2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
1IZ3A 4JAAA 1H2LA 2WA4A 4Z2WA 2XUMA 4Z1VA 1H2KA 3KCXA 2WA3A 4B7EA 4NR1A 4QU2A 1YCIA 3P3PA 4AI8A 2ILMA 3P3NA 4BIOA 2YC0A 3KCYA 2Y0IA 2W0XA 2CGOA 3OD4A 1MZEA 1MZFA 1H2NA 5JWPA 1H2MA 2YDEA 3D8CA 4B7KA 2CGNA
chains in the Genus database with same CATH superfamily
4AILC 1ZRDA 3GB7C 2GNMA 2A0LA 1K92A 1M4WA 1YRZA 4G2KA 2VWKA 4X20A 4DXSA 3DC5A 1V6KA 3ZHUA 1W8TA 4XW3A 1UXXX 4HVOA 4DFSA 5CA1B 3T4HB 1ROPA 3NR7A 4FAHA 3B9CA 4M3CA 3KV9A 4OUEA 1NLRA 2EJRA 3BCWA 2QKAA 1FOD3 3DGTA 1BEV1 1ZBE1 2VNRA 5FCCA 2PF4E 3ZN0A 3H3ZA 3GJAA 1GFF2 1QOTA 3O1RA 3INAA 1JYCA 1I3HA 4AOCA 5CFCA 1MQTC 2A7WA 4XPVA 3HN1A 1O7FA 4Y4RA 5B3SC 3AZWA 1J58A 2PQQA 4LORA 4I09A 4N53A 5DN2A 4CP1A 2XXZA 2JKBA 3T2TA 1PVC3 2XJVA 3WNMA 5L3FA 4CUBA 2E7TA 4GH4B 2BSKA 1LODA 1WA8B 3RZKA 1COV1 2DQ0A 2JVDA 4Q8LA 4LO4B 2R32A 1B35A 3PNAA 5FAXA 1U5ZA 5J36A 1K45A 5D8AB 3C7GA 2EINB 4F83A 3CE2A 3ZHVA 3LPGA 4NHMA 4H0LB 2ZOEB 2GP3A 1RUF1 4AVCA 2RMKB 4Y5Z0 4KFMA 4DV3O 3K3NA 3N2GA 2XWJB 3KT1A 5F8PA 4JRLA 3N9OA 4WFHA 1WBLA 4P30A 1J3QA 2Q8OA 5IHRA 1SA0A 2BTQB 2DYRC 1RC6A 3SPJA 1QDOA 2ZGNA 4M3CF 4QJFB 3CLPA 4DPNA 3B00A 4LF6O 1NU1H 2Q8DA 2EAKA 4LBMA 4QGPA 1VALA 1W6MA 4CDWB 5BNNC 3V65A 2DVFA 4LE3A 1L3JA 3EO6A 2ZXWB 3WSOA 4GX0A 1LOFA 3WP6A 4OUMA 4BM8A 2A7AA 1LHNA 2RJLA 1HRV3 5DDJ1 5EBWC 2Z79A 2QKSA 5EV7A 5T54A 3RYHB 1APNA 4R8HA 4JI0O 2GC1A 1H8HG 3WF3A 5T5JA 2WWWA 3K59A 4OX9O 3WXPA 1SQXH 4LKEA 1BSMA 3I97A 4WFEA 3PJQA 1CIYA 1PL0A 5JPNB 2EIJB 4E4EA 5E1RA 5FYUA 3K3WA 1NCRA 3I3BA 4K9SA 4AEDA 4LCUC 4B7KA 4NIHA 2BNNA 1KJLA 1KQSU 4IE4A 3SYAA 3QD6A 2AC1A 4JI7B 1IGOA 2GNBA 1RPOA 2ZE7A 4BW9A 2WLIB 1UWWA 4BMBA 3C90A 2QGNA 5J2TA 2ZDIC 1WCQA 2KA3A 3G6JB 5BY1A 5C8YB 1HRV1 1P4RA 5HBAA 3RYFA 2VOVA 3AYAA 3FLTA 5LA1A 1K3IA 3WLUA 2VZ1A 3MGUA 3ZN1A 4AI2A 5I0DA 3HAGA 5FXZA 1NKDA 2JWPA 1HJFA 1YQ8A 1S0GA 4GKJB 3VZOA 4G3YC 2WR9A 3OYWA 5LMUO 3K58A 1HJGA 3CXHF 4GQ7A 3FKSG 4CCLA 4DEVA 1V6MA 2PELA 2EIMC 4XABA 5F32A 4IEYA 4FP2A 3B3QE 1HX6A 2A6ZA 5JSRA 2FCVA 4I0AA 4XACA 1B6QA 1YSCA 4UW4A 4XMAA 1H38A 1JPXA 2JIJA 3STZC 2JKXA 1RITA 4QM8A 1UY0A 2FDHA 5B4XA 4EFEA 4L8JA 3JASB 1GN6A 4RQPA 4DY5A 4IEVA 4BW5A 1K5MB 3WUCA 4UCSA 3MBWA 3B09A 2WN2A 2QCSB 3FX7A 1MABG 4I30A 4MGTA 3L71H 3LD8A 1CAVB 3N3HA 4PV1B 1G9BA 1JBCA 4QXCA 2HWF3 4CH4A 2JG9A 1O3TA 5ABJA 1J5EO 1CZSA 3FYIB 1RUE3 2YHJA 4EN8B 2A71A 4QKDA 2XVLA 5LK5A 5B5EZ 1HRI3 4EWEA 1LB2A 3OMAB 2DVAA 1CZVA 2MHFA 1BHAA 2WDBA 1AYM1 1X9TA 1PVXA 2ZQMA 4LHKA 5AFBA 5DEDA 1OCZC 5CN0A 1Z2GA 2WLLB 4JYYA 4CDWA 3GZTB 1RUG1 2VQEO 2OQ7A 3NKGA 5EYPB 4GZ9A 2UXDB 4P9PA 2C4XA 2JDAA 3QO5A 4GX2A 1O3QA 1R091 2ARHA 1BEV3 4RGGA 1C4RA 1VQPV 5GLVA 3ZYPA 4YZ2A 2C5DA 4LC1A 2F93B 3M7AA 4I3PA 1WMFA 1I5ZA 2VCBA 4ZOLB 4IE6A 2Z42A 5IT6A 1OOPB 2RJ2A 4JASA 2ZX2A 1F35A 4DXRA 4JI0B 4MOAA 3N35A 3WG7B 2VQAA 4YSFA 4RHV2 5IWFA 5EC2C 1LR1A 1VPHA 5IATA 2W94A 2YDEA 2NN4A 3AP7A 2A9HA 1JJ2U 4YLZA 2YSUB 1KGYA 3WG3A 5EBLC 5L19A 4ARYA 4H3WA 4QDSA 5FYTA 2IBZH 1XE7A 2G1MA 1NCRB 1VBC3 2DF7A 3JB8A 4XZPA 4XHBA 3C3TA 3C3SA 4Y1XA 4Q4X3 4Y33A 3WCRA 3V0BA 4IIJB 4MTGA 3W58A 1RUF3 2ZDIA 1ULFA 1AYN1 1PK6A 1W9SA 1G7YA 3ZYBA 3BALA 1GZ9A 4TQFA 4XFGA 2IXLA 3ILFA 5KHIA 1DQ4A 1YITV 4AG4A 4UOJA 3NV2A 5E79Z 5HXMA 4YW3A 1GOGA 2Q7EA 2A3YA 3R4SA 4XAAA 3MPPG 3K4ZA 3AG2C 3DL3A 4LP8A 2FB5A 2LO1A 5FQ0A 1WGPA 1OBNA 2B5HA 3FB7C 2XVGA 2ZM6O 1N1TA 4FPCA 1SPPB 5DECA 1MG1A 1S0JA 1GZCA 2VNOA 1Z7S2 4QQPA 1W8ZA 2VNGA 5C3QA 2HBUA 4M01A 1N3PA 2RM22 2B1GA 1SDWA 4X1YB 3QVNA 4C8DA 4JV4A 1UIKA 4QKBA 1PKXA 4JGYA 4MTFA 3ZBHA 1WCUA 4IE7A 2L6LA 1AJQA 4JQRA 4RFT0 2F17A 3M3CA 2I45A 4ORFA 1QJX2 5C8CC 2Q1MA 3AP5A 4GA9A 2HEWF 4JCKA 3S3WA 3ETQA 3POFA 1HXS1 4BE3A 3RFRA 4Z07A 2ATKC 2IXCA 1W39A 2HWB1 2E74B 5LMNB 4GB32 5F2VO 2JICA 1VR3A 1O6UA 3TRSB 5FZKA 1FFTB 1QJFA 4O65A 2M7WA 2D93A 1HB1A 3FLRA 3SCFA 2DWRA 4MVOA 1OCOC 1XXNA 5IK5A 4I0XA 1YI7A 1ZZ7A 5KC5A 3K2OA 5KXDA 4QPYA 1OCCC 5FLIA 4CPBD 2WS92 1VQLV 3V0AA 4FLUA 4IV1C 4KHPB 3WV6A 2QQNA 3OBZA 4UW5A 1NR7A 4A2UA 3CHXA 4IQPA 1XMQO 2J1UA 1RVF3 5LL6Y 3O65A 2NLJC 3DKQA 3HKEA 2VCMA 4J42A 1JS9A 2FL4A 3RWNA 1NJIW 1QF3A 3E5QA 3D36A 2ILMA 4GKKB 3SNMA 4MW3A 2D6NA 2EILC 4LHSA 3CCSV 1WW7A 5CFCB 2ZGLA 4CH6A 2R16A 1NQTA 4DV0B 2NYYA 2VQ0A 4NB5A 3DGEA 1FT9A 5LBFA 1IKQA 3G67A 2ARBA 1PGSA 3F5WC 3TYJA 3EBRA 1BGYH 3TXSA 2E75B 1GQGA 3AK0A 2P4VA 1TEIA 1RUJ3 3BEHA 3CCQV 3E89A 2NN8A 1UU5A 3OEEG 4GH4C 4UW6A 3VZKA 5IYZA 5HV0A 5CMUA 4TSFG 4EFBA 5H6RA 1SZBA 3ZM8A 1JR9A 2Q0OC 3NV4A 3BUCA 4CH3A 2ZX0A 5FZ4A 3V0BB 1TVGA 2QZ2A 1SFPA 4Y5TA 2JE8A 3CMEV 2DBNA 3Q4HB 4QQ2A 2YS8A 1OOPC 2CWSA 1V55C 2HWF1 2WLHA 2RDRA 3V56A 3GWKC 4W65A 1ZBA1 1P8JA 2H8PC 5F3EA 4XDJA 1WW4A 5IDJA 1DGWA 2UXBO 4G27B 3L72H 4RS5A 2BTQA 3VOUA 1QOSA 3SLIA 1GOHA 3USUB 1TZOA 4B1LA 1XNAA 3LWCA 2ZCEA 2WO3A 3LFIA 1SLTA 4LA2A 1IURA 4QE9A 3ZFEB 4CUCA 4TOIA 3HOBA 5BV6A 3SPGA 1LHWA 1HQLA 3M3OA 3OBAA 2ZPXA 4JYAO 1AR92 2WL1A 3UESA 2QQWA 2EF6A 1SRYA 2HG5C 3IBMA 3JCIA 3NMBA 1PVC1 1U96A 5LHIA 4AFDA 1IX9A 1W0PA 2UXBB 2Q69A 1QEXA 4W50A 2GC0A 4OI2A 5IYBO 4MZUA 2UXXA 1RXGA 4HONA 4R52A 5FXVA 2HWE2 1JZ2A 3ZFGB 2D6OX 1R1BA 4BWAA 4JV5O 3I2JA 3POBA 4DV4O 1F5FA 3A22A 2BVBA 1M9NA 2OPWA 2J22A 1FFXB 3HNMA 2W1SA 4TQDA 2R7EB 2YIAA 2X05A 4AEDB 4WBNA 4FFIA 5FZIA 1OCCB 3A2FA 4P9XA 2WYSA 1ZVFA 4QX2A 4CDUC 1QJZA 1PNMA 3O12A 5IWAO 2UY8A 1W8UA 1UMHA 4IEPA 4ASLA 3HPNA 1KXGA 1RL3A 4IL7A 4FLYA 4V2WA 1SQGA 2PHUA 3MUY1 3AG1B 3NJYA 4CS3A 1KS4A 1ULDA 3SKJE 2Q4SA 4WFGA 3CCVV 4DXTA 4CEWA 4NPRA 2R9RB 5JCOA 5FZ8A 4EV0A 4PDWA 4KBZA 1XJAA 2RNBA 5E1AC 2JG8A 1KKCA 3FBMA 1BHBA 3WD5A 3KM5A 1J3PA 3JU9A 3JCZA 4CDUB 4C7UA 5LA6B 3S5AA 2CAVA 3WQ0A 2VRZA 3R05A 5L73A 4GX5A 1WLWA 5C7GA 3W7XA 1L0LH 3B5LB 4CCDA 1R6TA 1SLCA 2J7MA 1DLBA 3T1YB 1LNSA 1IZ3A 2QQLA 3MW2A 2VZOA 4YW7A 4CXYA 1H6XA 5EPAA 2KG7B 1POV3 3K75B 4X1IB 2HHHO 4W8JA 3HIFA 4IE5A 4L11A 1OURA 4PCRA 4GYCB 2WYFA 3PVBB 1US6A 3IAQA 4XEZA 3AG7A 3FZ3A 3H8UA 4QQLA 3VBFC 3OYWB 2JEMA 2Y6FA 3JXSA 4QMAA 3KVAA 2X7RB 4A7ZA 2CK3G 2OCHA 3N4MA 4P9WA 5GLWA 1KEXA 2Q68A 1XHZA 4RA0A 4LOTA 2AHYA 1UIJA 3ZEDA 2AEYA 3LGRA 4AXOA 3I2HA 4DV7B 4LULA 1N34O 3THCA 1FNYA 4RUFA 5LWBA 3R65A 4X66B 3OTOO 2LW1A 3OPTA 3RWRD 4PA6A 5HFMA 1RUI1 4DOUA 5EQUA 1WB8A 4E27A 3S57A 5L36A 5KAIZ 1DGWX 1WLDA 3FJSA 5IAVA 3SH3A 4IV3B 2AR6A 3M70A 1K5MA 4O4IA 1OQDA 1JXNA 3K9SA 2B9VA 2DE0X 2WNUA 2RS51 4EN0A 3ZFFA 2WABA 3CD6V 1RINA 2QDNA 1N36O 2JG9B 1QJX1 4B3RO 4QB6A 1AP6A 1MS4A 1ZZ6A 3UL2A 1SBEA 3BA8A 4O9EA 5A7QA 4DEQA 2N74A 1I9RA 1T6BX 3RYPA 1AROP 2VZUA 1EN6A 1GUIA 3K06A 1UYPA 3STLC 2YB7A 4FI9A 4AVBA 4FT8A 3QO7A 2RS31 2Q0AA 3CJIB 3KSCA 4YWAA 2P6CA 1LUWA 3R0RA 4YFWA 1TVKB 4W4ZA 4CDXB 1VAKA 4JHTA 2UXCB 2BEOA 3VBHA 4O4LA 3POSA 5IY5B 4DZGA 1JYWA 4BCUA 4E4SA 1KMIZ 1YVWA 3VUOA 2AH2A 2XAHA 2WWJA 1U5IA 3D3QA 1IG3A 3ZSMA 1Y9MA 3JALB 4Z8BA 2LP7A 1OQ1A 4EKWA 4OQ8A 5F6LB 1PZ9A 1PM4A 1COV2 5JI7A 3RYKA 5LA9A 2GP5A 4NJ4A 1QQP1 4NVPA 3WX5A 3OGCC 4LHLA 1ND2B 4NIDA 3UV9A 2TNFA 2H3OA 2HWC3 4QU2A 2HYKA 5L3CA 5HPOA 4DR2O 2DUQA 3IIIA 2CTVA 3KT7A 4CRQA 5F5AA 1H8TC 3VBUA 1EN4A 4ZHQA 1OT5A 3APBA 2YY1A 3J9SA 4Q4V2 1K3EA 5LY1A 2HLDG 4JTOA 1YJKA 2K46A 5EWSA 3VDBA 3ZIAG 3PMEA 3FLPA 4DW1A 4XF0A 3ZVXA 4QHBA 1XREA 5DAWA 4YYOA 1ULEA 2DYSC 4AEKA 3VKLA 2LGWA 4FLZA 1WA4A 4LXLA 4UV9A 3CJHA 1J5EB 2VXJA 1QR9A 1AR83 4UCTA 1BVVA 1N3OA 4Y4YA 1EV12 2JGDA 3IDBB 5KXCA 1XRUA 1S0EA 2HWF2 2PAMA 4PQQA 3WNPA 4IV1B 4QKFA 2MW2B 3QCWA 1H0BA 4NROA 3JCUZ 3WW2A 2R0FA 1K7DA 4DR3O 4RS5C 3TBDA 4XAEA 4X66O 4OZOA 4DUZB 2ZAHA 3K0DA 2D5HA 1SG3A 3BY6A 2O0OA 3LA7A 4YW1A 2OQ6A 1O4ZA 4I0XB 5IYYA 1JU4A 1OCOB 4FVMA 5IE9A 3VD4A 4N21A 4MGQA 3OD4A 2CDYA 1HN1A 1L1FA 5HCAA 5A33A 3D8CA 3OTFA 1GTOA 1COV3 2PGGA 3LB9A 5KMGB 1VQOV 4FOVA 4CCEA 5IYCO 1W2OA 4RGKA 1CXZB 2R0HA 3JAKA 4C0BA 2BE3A 5A6QA 4HYOA 4C90A 3I3DA 4B3SB 1QBZA 2NP0A 4AWDA 1S77D 3S5QA 4P9JA 4L97A 2QTOA 4I50B 2PYLA 1C8NA 2QDRA 2JEXA 3OTOB 5D8AC 1E5HA 2IXKA 3ICXA 2X5IB 1PMHX 1WNSA 2DTWA 1I08A 3KT4A 3O1PA 1J3RA 3AG4C 1W28A 3AG3B 1UCXA 1US2A 3GJBA 4U3JB 3GBWA 3CDZB 1RUOA 4FTSA 1RMU2 2E26A 1AF9A 4CEYB 2ZHKA 4WV8A 3RMXA 1TQ5A 4BQ1A 1NZ6A 1K42A 4X6RB 3UT5A 4Y26A 3E8BA 3WQ7A 1POQA 1LOEA 2B9ZA 2IXIA 4R9BA 1BCXA 1X33A 4OI1A 3ABKC 4QPIB 3GXUA 3AL6A 4E8CA 1G9CA 2XGXA 1UAIA 3L2YA 1VE0A 5HCFA 4HN0A 5FDBA 5K8SA 3ALQA 4CP9B 2QR4A 2IM9A 4OXSA 3WNOA 1LR5A 4XIOA 1GBGA 1POV1 3NNGA 4LITA 1VBE2 2Q30A 1SZTA 4OQ9A 2VD7A 4Q0SA 1S0BA 2VVDA 4K35A 4D6SA 4FLXA 3HD8B 4GT1A 1ND3C 3I2KA 2YXYA 2A70A 2JDNA 1K12A 2FBEA 1R083 2YC0A 2DYCA 1DLLA 5BNOB 1WW6A 3MW3A 1RUG2 3M3IA 2W46A 3ZFEA 1LUVA 1IDSA 3DXUA 1OLRA 2F4VB 1BQPA 3PU8A 1VF7A 2XHBA 2DYSB 3RW0A 1U97A 3KCXA 3DYOA 3SYPA 5IK8A 1ENRA 4A42A 3MAQA 5FUPA 2ZNIA 1IBMB 1NCQB 3BOPA 3U37A 3WVJA 3IMNA 3AZVA 1YIPA 3DC6A 5FJHA 4GX1A 4LFBB 5D21A 3UK9A 1G6UA 5JCOC 3DPRA 4GWIA 1Z5VA 5FZ7A 1AJPA 3OGIB 2X0LA 5C4WA 2ZINA 4BLJA 2JJ6A 3H1YA 4ASUG 1BT8A 4UVBA 5DUXA 4ZZ5A 3LE0A 1WLCA 2A73B 2ZR2A 3NV3A 1OF4A 5FXXA 4TV8B 3A7QA 4JI8O 1JYTA 3FE5A 4JAVA 3U4XA 3NAPA 1QXPA 2R6QA 3ON7A 4COWA 2UWAA 1W90A 1JYIA 4YM3A 4YJ3A 2A06H 2EBOA 3W5MA 2LROA 4FBFA 2ZMKA 5FY0A 4Q4X2 1MZ5A 4U7OA 3WF4A 5AVAA 1RUF2 3IPVB 2DCTA 1J59A 1LEMA 1LGNA 4BHPA 3I2GA 1S2EA 4PHZA 3WW1A 1DQ1A 2CY6A 1E5RA 2WNUC 2Q8CA 1YF2A 4PDVA 3VL9A 4CEWB 1W8WA 5CB7A 1K9MW 2R9AA 3AKRA 5FMOS 3NNLA 4PLMA 4PF5A 2XHKA 3VBHB 2IH3C 1WMEA 1YWKA 1GZWB 2EVXA 4JGYC 1V9U2 5EJZB 1QGLA 5GJ6A 4IGQA 4JF3A 1YXWA 1YUDA 1VAMA 5H9SA 5FZHA 3RNSA 2ADPA 2IU3A 4MS2A 3SYQA 1XMOB 4C1XA 3POYA 3FWEA 5L3GA 2GN7A 5CFDC 4GCZA 3VBBA 3AXDA 4NHLA 2RM23 3T3YA 1MQTB 2CL2A 1W59A 3IAYA 1S0CA 1KDMA 4P9YA 3R66A 2BJSA 2WLLA 4X1IA 5CFDB 1N0JA 4OUSA 3CEIA 2HHHB 1SBFA 1LHVA 2CGOA 3VD9A 1NS1A 4JGZA 1H2MA 2QVSB 3K46A 4NRPA 4QE7A 3Q8CA 4M0HA 4BMEA 4Y5SA 4I0WB 1LKNA 4PBOA 5IVJA 4BR6A 2P6JA 2H0BA 4YM0A 1C3HA 3WB0A 4ZIBA 4EROA 3PVEA 1EV11 4BPZA 3AX4A 2PLV3 1FI2A 3QO8A 1ULOA 4FAGA 5BXZA 4DV0O 3ZXKA 5JAXA 4C0HA 2JDIG 3Q8FA 2QQMA 2X53S 3AG3C 1Q43A 3N9PA 5C3SA 5FPXA 2ZGQA 1OXCA 4XUNA 4IT5A 4YJ2A 4QXBA 3T1MA 2DUOA 2JB4A 2E7QA 5FZ9A 4LH7A 2KG7A 1S5JA 1D2SA 2V72A 1EAH3 4GB31 4N43A 2VMCA 3T2PA 2V5YA 1F15A 1JMKC 1N33O 3SPIA 3LDCA 3LEIA 5FPLA 1JOYA 2EXJA 1Y9QA 3U14A 3FHIB 4Q4X1 3FYEB 4LKFA 3HBZA 4WM7A 1OCZB 2W9XA 1OH4A 2YXSA 3PLQA 3I3MA 4LKSA 4LIVA 3LUTB 4Q29A 1GN4A 1UKRA 3OSDA 3OY8A 2WLMA 4DR7O 4LKDA 4JI7O 3LFMA 3ZYHA 5ACA2 2GUZA 3GCWA 3P30A 3LIGA 2WLQA 4HVQA 1BJQA 1V6LA 5EC1C 3E86A 2QTWB 1C5IA 1MMMA 3OPWA 4D94A 3CJIA 2JGDB 4N9IA 4NHXA 4DS0A 4FPKA 3BYWA 1Q8QA 2HYXA 2YUEA 3ELNA 1XQ8A 1Y76B 1YYNA 1RSOB 5EIBC 1GNHA 2LQTA 3CRMA 1IXMA 4DRVA 1QJY1 2WZPP 3K5OA 1JZ3A 1FXVA 4H14A 3P3PA 1GN2A 3H9VA 3U4SA 1H2SB 5JCTA 1NE4A 2VTXA 2BBVA 3M1HA 5C3PA 2PYJA 2PLV2 4DR4B 1JHJA 4YIPA 5JMOA 5BZBA 2VH9A 2JS3A 5JR2A 1PMJX 5FTTC 2GALA 1YFWA 4GWJA 3IDEA 4LBKA 4B1MA 3RVHA 2AGAA 1HXS3 3T08A 4OHYA 4UXAA 4AI1A 3POIA 4LR3A 2J1VA 3OOXA 3FFZA 4Q6GA 4QGNA 4B3MB 2HR3A 2VY0A 3A0NA 3W7UA 4DV6B 3HEIA 5F2WA 2R073 4XJAA 5KUKA 1JI6A 3ZR6A 2D44A 1QJY3 3MIHA 1REEA 4NE9A 3I56V 4AVAA 1Q81W 2N04A 3POWA 5IFPA 2D3RA 3Q9OA 2FDJA 2Y69C 4TN7A 3FB5C 1HNWO 3JBG1 1AI6A 1UO9A 2ETEA 1PP9H 2XTAA 1MVEA 3ECQA 5FMCA 5FO7B 2BRTA 4XUPA 4N53C 4I9QA 1QVFU 5FZBA 2QQUA 3WT3A 1FJGO 5LP6A 2N7GA 1AZDA 4MH0E 3C3VA 2Q8VA 2HWE3 3ACLA 5C8CB 4IXLA 5D5PA 4NYKA 3HKDA 2MPFA 1XNCA 2YI9A 3B8MA 3I59A 1A78A 1NA1A 3RGBA 3O1TA 3SEEA 3T1HO 5ITZA 2B39A 1CD3G 1NI8A 3EYPA 3H42B 4HSJA 4AI3A 3RYIA 4UB6Z 2RJZA 4B3SO 2C0ZA 1G4YB 1FV2A 5DG1A 5HCHA 2HH9A 1UZYA 2V5DA 2DURA 5H9QA 4HSLA 3UKTA 1B3QA 4XJ9A 1ZLZA 2ZHLA 3FUQA 3AMNA 4L8QA 1TUBA 4LE4A 1ODMA 3SH4A 4YPJA 4W4LA 4BQWA 1ZSPA 1RUI3 2QWRB 1YIJV 2RMU2 3T2QA 1XOYA 3JASA 1L0NH 1VLNA 2VW1A 4R9AA 3LDKA 1PIV3 4KQ7A 4HG6B 1SDDB 1Y74B 1Q8VA 2HWE1 3PL0A 3LDEA 1KU9A 5JVDA 1W99A 2EULA 3ZO0B 1ZBE2 3K4AA 2H6CA 1HW5A 3J4UH 2FDIA 2DYRB 3GZUC 2R1DA 4CC6A 1VARA 3ABMB 1OHFA 3ZRWB 4MXVA 3CCRV 1BBT2 4O4JB 2RM21 2ZGRA 5B66Z 2BNOA 1YEWA 2ZKNA 3CJIC 5C4WB 1N3QA 4OVEA 2XQXA 2HWD2 1HNZO 3CRAA 2BOJA 2PN5A 4JTNA 2NNUA 1QU0A 1QIQA 5A3OA 5DZFA 5I8TA 1X7NA 1RUJ2 1TMF2 4QGLA 5DAQA 2UUAO 2X6AA 5GZDA 5FYMA 1AXKA 3LAGA 4XTMA 3N7JA 4NIIA 1NCRC 1G8MA 2VU9A 2ZGTA 4NHYA 5IWAB 4AQ2A 3OE7G 2YFZA 1ZRFA 3NO8A 1DF4A 2E5LB 1SCSA 3RQ0A 4CE8A 4Y1UA 3E22B 2VAUA 1HV0A 1QKQA 2OYZA 5A6YA 5IY5C 1QQP3 3ZFGA 3GNEA 1RJ8A 3AK1A 4KXRA 3SC7X 1P49A 1PGW1 2WZR2 5I8YA 4IETA 1XBFA 1Y4WA 3FMGA 4O2BA 2BWCA 1I1EA 1V0AA 1HNWB 3WW4A 3SPHA 2JK5C 1HWYA 2HEYF 1CAXA 2F1MA 3AG1C 1HR0B 1F23A 4OCTA 1B35C 2AHZA 4R50A 4LO8A 3OM3B 4J11A 3MIEA 4JI6O 4JYCA 4CS4A 4IL6Z 3PURA 3R4UA 3WDYA 4O2AA 4LUMA 1QHTA 4JDNA 2OIIA 1FPOA 2WWSA 1PX4A 2JB8A 5KA6A 4O9GA 4DMIA 4UBHA 2UY9A 4JV5B 2VZVA 3KKYA 4GB33 3HBKA 2OCCB 4M3CE 5B1BB 1FYJA 3T0DA 4JQTA 1YHQV 1RHI3 3ZHQA 2HWD3 1N36B 3VBSA 2ZCWA 2WRAA 2B8MA 3P32A 4JKKA 3CXCU 4J9YB 2GAUA 1MSWD 4OFGA 2CTPA 1W6NA 2VQUA 2BOBC 1DG6A 3ZN4A 5CKNA 5B1BC 4AEMA 1Y3TA 4J9ZB 4R4XA 3PUIA 3D0SA 3W21A 3URFA 3JARB 1K8AW 4LF5B 3AZYA 4KGQA 4FK5C 5CA1A 4HVRA 3OD0A 1W8FA 4DRXA 3UKNA 1QOOA 1YQ6A 4EZHA 3CBNA 4I5SA 4LFAB 3ETEA 2QM4A 3HT1A 3GZEA 5E16A 3E5XA 2Q4PA 2ZKLA 3HMYA 1WW5A 1H1MA 4YNIA 3ME2A 1FMD1 4YHHB 1WD3A 4RUEA 2LFSA 3GVMA 2ZGKA 2CSGA 1F9KA 2YV8A 3BPZA 3DTUB 4BIUA 1QQCA 3NJVA 1GZWA 4AVTA 3UO2A 1GU3A 3D0JA 2IJJA 3CCUV 1A6CA 1ZRIA 5FR3A 1YO8A 2Z69A 3ORJA 2XJUA 3J81N 2N05A 2ARCA 4XF9A 3M99B 4WZFA 1PO21 4JDMA 2ZEWA 5KAFZ 3EHBB 4ICGA 4WFAV 4CEYC 5JJNB 4YVWA 4OZXA 5IJ9A 2XT9A 3ASOC 1BVP1 5T3NA 2G19A 4Z2AA 2W3JA 4G4FA 1O5UA 1K5SA 3GHNA 5B1AC 2XB6C 1KJRA 5FOBB 2WNUB 4P9GA 2R043 2JIGA 4AQYB 3ZHTA 1IHMA 4CCKA 1H1IA 3VGIA 4YVSC 3FFQA 1P7BA 1FV3A 4UUJC 1IBLB 4PLNA 2GHYA 4UFLA 1QHDA 3B8NA 3VDDC 2VE1A 2VUAA 3AFKA 4YJ2B 4NXNB 4NUBA 4YVSB 4M0NA 1K34A 3WHTA 1O4YA 4QPJA 4E2LA 3SPCA 2M6YA 2QQKA 4XUTA 1W6MB 3VQYA 4UCVA 4L87A 4N7IA 5B1AB 3H9AA 1FXKA 1OD3A 2X29A 3ILRA 3KF5A 5LA6A 1PPJH 1C8M3 1FOD2 1LOCA 2K9PA 5C9AA 1Q82W 1S5HC 3D3AA 4LF5O 3J7LA 1WBFA 3H1IH 3THPA 4AAXA 3VHPA 1UZZA 1TNRA 4FLWA 2DJVA 3WOGA 4MXWB 1OVPA 2RE9A 1OUXA 3RYIB 4O4HA 4PI0A 2WZEA 1YQ2A 2ADEA 4XF3A 4JTDB 2Y0IA 3FC0A 5FUIA 2RG4A 5B1NA 1GYKA 3NKTA 2VCAA 1GLHA 5FZ3A 2DCZA 1JZ5A 1A32A 1E57A 4PDWB 1ND2C 4MHUA 2XUMA 4GJZA 1ZNPA 5FK8A 2LS6A 3SJAC 1AR1B 2TEPA 5ISLA 1YJ9V 3BB6A 4HNAA 2B4KA 3VZNA 4Z1MG 1AVMA 1I5YA 4DIQA 4W4KA 3ETGA 1KC8W 1QR8A 2F4VO 3D6EA 1JYXA 2L35A 3HPLC 1QXJA 3EHKA 1M06G 1YJNV 1UY3A 1XPWA 1CAUB 5DM6V 4NTWA 2WS93 1Z5WA 5JI9A 3KF3A 2DCJA 4K7JA 3WF0A 3GBFA 5J2UA 3IIAA 1HLCA 4JI5B 2O14A 3L73H 2O8QA 1TUBB 1W3VA 3O0XA 1GQPA 2Y26A 4JKMA 2P22C 2EIKC 1UYZA 2YICA 2WT2A 4EQVA 3BI3A 3SHRA 4KH9A 2QBXA 4WVMB 4YW6A 1TNFA 4KU8A 4IV1A 1Y74A 2ZGUA 3LA3A 1SEFA 3OR6C 1VQ7V 2DQ3A 3IKWA 1XNDA 4EB6B 4IEWA 2B46X 3DV8A 2PHWA 5KC6A 5BNQA 2QQJA 4CCJA 3BTYA 1GOFA 5CB4A 3ZMSA 2FDKA 4BDVB 2VUJA 3O7OA 4MVUA 5K0UB 2BUKA 3GF6A 2ID4A 4YGCA 5LATA 4J41A 2FDFA 4MW8A 4UI9L 1HRI1 4RQEA 1VBD2 4FPOB 5A6ZA 1DGSA 4NXNO 2YC4A 5LXTB 2RS12 2CH7B 4QDRA 3FBYA 4LPLA 1AR91 3CPWU 3FAVA 2W92A 2VUCA 3J8F1 3QBQA 4BQ5A 1M56B 1U5YA 3GHMA 1CX1A 3B2EE 2QDOA 3VV1A 3B94A 1JHNA 5IK7A 3VHRA 1GNZA 2P3KA 3AZXA 5FZ6A 1IBKO 3N2GB 4XYXA 4UFKA 5HXVA 5EZYA 4KWJA 2EIDA 3AFGA 1WP7A 4A45A 3H7YA 5FPAA 1GWMA 4FLTA 3P1IA 2WLJA 2MEV1 2WO1A 4G9SB 1SLIA 4RL7A 4QIWF 4NTXA 2Q73A 2ZGMA 3E6BA 1R6KA 1VJ2A 2WA4A 3OUFA 1EM1A 2CTRA 1V00A 5FMBA 4LF9B 2DUPA 1LU1A 5BXXA 1N8RW 2A79B 1ZYBA 3HVDA 1D0HA 3ZYFA 3GBGA 4LNVA 4GZRB 1M56C 4CDXA 3CU7A 5LP6B 2AENA 3BABA 3K9AA 1XMOO 1MVQA 5I0UA 4BQ3A 2Q5ZA 3ABLB 1O9HA 2JDKA 3UJOA 3T1CA 3JSNA 4FFHA 4DINB 2YYOA 3TEXA 2WC2A 3VDCA 1GH6A 3UETA 1AILA 2WLIA 3ABKB 3H3LA 4ZU5A 3W5NA 3CP1A 2AXTZ 3F2ZA 2YEVA 1H4HA 2Z4FA 2EIBA 2CAUA 3ZSEA 3KWVA 2J1SA 3BRCA 4DV5B 1CP9A 4PBPA 2WSSG 3RVZA 5LP6C 2K2SA 4LF7O 4RHV3 5FMDA 2IVIB 3NJZA 1Y43B 5FZ1A 4K40A 1VB4A 1IPKA 5LGNA 5F6KA 3L74H 2WNVA 2R72A 4L2NA 3CKHA 3EXUA 4JAAA 1AR73 3U1XA 1BCCH 4NHKA 3K51A 1Q8SA 1SETA 1KKDA 3WF2A 2QUOA 1AJOA 4YG6A 4GAZA 5C3OA 4YGBA 3EXAA 1AL23 1W9YA 3CJHB 5FPUA 4LF6B 3VZJA 4E2SA 4J80A 1CJPA 3DECA 2Y0OA 4I01A 3KZ4C 2OZ6A 3RPQA 5CADA 3FX3A 1OVSA 3ZRXA 2LTNA 4ITCA 3S0MA 1W8HA 4URAA 1VQ9V 4H55A 3AYCA 2IXHA 5FY9A 1ZL8B 1AXZA 3TCUA 2ITDC 2UWCA 4QB1A 2K0GA 5LXTA 4A44A 2KSDA 2Y64A 5F5QA 3ATGA 1WWYA 3FD9A 2JE9A 2ET7A 1SQBH 4AR2A 1O91A 2LJ2A 4OLLA 3DCQA 4ZONA 4AYUA 1PO11 3ZYRA 4DR1B 4NRMA 4QPGB 5FYYA 4JHZA 1FPN3 3SCHA 4O2BB 1R1ZA 1UN1A 5GZCA 1UOBA 5CBGA 1C8M1 1L7LA 2CNAA 1H6YA 5LGTA 3IDAA 1EYBA 4QKNA 4RWUA 3BKZA 3FL7A 1F8VA 1VRBA 1SFNA 2PMWB 1JZ8A 4MADA 1W2AX 2D97A 2KKWA 1OUSA 1CEZA 5GTHZ 3ZIWA 1O3RA 1L7RA 1FXHA 2RDNA 3H1MA 5FPZA 3ZFGC 3SJQC 1PK6C 1TMF1 1AR81 5FZDA 3JAWA 4FTEA 1ONAA 1R092 1GANA 1A3KA 1AI7A 3VHNA 2K9ZA 3OGVA 2VTFA 2XVKA 1ASJ2 4Y1VA 2RS32 5C8WA 1I5PA 4OPAA 3THDA 2A6YA 4QPIA 2VOXA 4DO0A 2YGLA 3MF6A 4UF0A 2BCCH 4XC9A 3NQHA 3O1VA 3ZXJA 1V54B 4YY3B 5JIUA 2RHPA 3GGLA 2YXHA 5FLHA 3AEIA 3IC9A 5J37A 1S0DA 5FP7A 1QNWA 1AX1A 1N32B 1X4TA 5BUVA 4CA9A 2XKPA 2YBKA 1KD1W 5J2UB 3KHCA 3QG5A 4AQYO 3MZHA 4QM9A 3MDSA 2VM9A 2OZJA 3WP4A 1DTOA 4RQPB 3KB5A 4WVMA 2QWPB 2VVEA 1N34B 1SPPA 4MGIE 1XYNA 2WNVB 3IM0A 3N9QA 4IEZA 1DHKB 2E51A 4JI3O 3ZXDA 2XBO2 1VMHA 5KHJA 1G9DA 1CAUA 1XNQO 2B45X 4QX1A 4LNUA 5CEHA 2YBPA 4Y22A 5CNAA 1YLLA 5LOVB 1UOJA 2BDRA 2VR4A 5EFUA 2OPKA 2ZX1A 1TUEB 1S2KA 3UKMA 1FD9A 2D43A 5FP9A 2BBAA 5LBCA 4J7ZA 4UXNA 4FOWA 4PLOA 2IU0A 5KHGA 4TUYB 5GM0A 3CCEV 1Y76A 4FFBB 1NT0A 1LENA 5DDJ2 1MOFA 3OBRA 3SEPA 2EZOA 5T5LA 1WAZA 4LBQD 4JI2B 4FO9A 3E8GA 3WNNA 5KXBA 1LULA 1ZRRA 3CX5F 5C5UA 1OOPA 1Q56A 4PA7A 3O1MA 4KWUA 4JYBA 2CH7A 5F7UA 2BFUL 5IVEA 2EIJC 1PVC2 5F9TA 1SACA 2BQPA 4ZXEA 4FIPC 4I4TA 2NLRA 3WU2Z 2Q7HA 3JYCA 2PHFA 4AW7A 4YIOA 1WMXA 2UUCB 2EJ7A 2ZX3A 5LYJB 1HDJA 4D7TA 2Y6GA 5JH7A 3RS6A 1SLAA 3A0RA 5H5NA 2OS2A 1SFYA 5T5OA 3T2MA 3MPBA 3OUSA 1VQKV 2P3YA 1AR71 3JBG2 1FAYA 2VXRA 5F5CA 2F4PA 2FCUA 3IN9A 4NTYA 2GMMA 3UNPA 4CDQA 3DXRA 2CTWA 3AMMA 1NX9A 1NCQC 3T1LA 2CTQA 1ZZ8A 2R70A 3AYDA 2K1EA 3MICA 1YNAA 1WB7A 4DV2B 3OW2U 2W68A 2KB1A 2HJIA 1T5EA 3K04A 5FPVA 2BTOA 4NWWA 4Q26A 3HKBB 1W6PA 2TBVA 3OEBA 3E6DA 4QB2A 1F31A 4TXWA 4XBNA 5LA2A 3ZHSA 1DF5A 1YFUA 2WJSA 2DVBA 2B9UA 2LGQA 2D40A 3MIFA 2CUGA 1VF5B 3VBOA 1U0AA 4HZ3A 1YDXA 5DUUA 5DDJ3 1W2NA 1PM9A 1SS3A 3RZLA 3R6SA 4PDMA 4JGYB 4Q5OA 4XFAA 2QWQB 4FPGA 3ABZA 5L3EA 1OA3A 4B4PA 3VL8A 4U7NA 4DR7B 2BW8A 4N43B 1YI2V 1CPMA 2R042 1KBHA 3BPSA 3QNEA 2YIDA 1BZWA 2Z5UA 2RQ6A 4B7EA 4ES8A 1WZXA 5A7WB 3H8RA 2LFRA 4XE9A 2GTSA 4AGRA 4QX8A 3NXSA 1O9GA 1BQZA 4E9KA 2ZNJA 4BZ4A 2W1QA 1EAH2 3RJ2X 5CVRA 3E8FA 1VQ6V 1UJWB 3FHAA 3WR0A 2Z3YA 2XJRA 3LZZA 1GRJA 5BNNA 4X8NA 3CC7V 2R063 5JXJA 2DCYA 5IK4A 1XL6A 2WQ4A 4XJUA 2DVGA 2JG8B 4X6QB 5FP8A 1FPN1 4CYDA 3POEA 1HNXB 1W6OA 3N7LA 5BR8O 2PUSA 5DMYA 4CEWC 2UYAA 3GZAA 1UX6A 4FXKB 5EZYB 4FPHA 1R3LC 4P02B 1MZ6A 1US3A 3S7IA 1WCKA 5B2GB 4TT3G 3E22A 3RT3C 3JD73 3TGUH 3AP9A 1QNYA 2EZPA 5C33A 4BLIA 3VB9A 2IFWA 1T6GC 4EEQA 4A5UB 1K97A 2PFWA 5FY4A 1S0IA 2YC2A 1QXRA 2BYVE 2WO2A 3CCJV 1W0OA 4KL1A 3J8F3 2OKXA 2ATFA 1VBB2 3DPRC 3JD3A 1AUYA 1VBD1 5DZGA 2ZAAA 1L7QA 3CIHA 5C4WC 3CCMV 1LRHA 3NVCA 1PO12 3RDIA 2ZABA 2IJHA 3ZYIB 3AYEA 2V4DA 3N7KA 2MNGA 2E53A 4X8AA 1AHSA 5L9VA 3M8LA 1Q5OA 3A8TA 1OC1A 2Y34A 3ZYGA 4DR5O 1LHUA 1LOFC 4RGAA 2VMIA 3SMHA 4Y1YA 3KCCA 3JB4C 3FB8C 4P5HA 1EUUA 5DAXA 4Y20A 3KGZA 4XQWA 2XAFA 2D7FA 2PAEA 2VBDA 4GMP3 1BMV1 3B9IA 1FAFA 1G6NA 1WKYA 2ZJCA 2JDUA 5D5QA 1QWRA 4YZ1A 3TB0A 2A3QA 3HKBA 4XJZA 1GKFA 1SKVA 4J7KA 5J7MA 1MACA 4MGYE 2IH1C 4BYYA 4ZHQB 1KYOF 4S2DA 3CO2A 4BU2A 4W6YA 4IV3A 4B29A 3KGLA 1SQQH 5DXDA 1XYPA 1ORQC 2DOSA 2ZA9A 4ZU7A 3D3IA 1IQDC 1OH3A 2KR2A 1UYYA 1PM7A 2PLV1 5KA5A 3ZKUA 1V70A 4INDA 4Y22B 3UO3A 2FYUH 5GZEA 4X8PA 3PTRB 1UY4A 3HQUA 3KLSA 4M00A 5FLJA 4Q27A 3IAPA 4FM0A 5BYNA 2P6HA 3GDBA 3J80N 1ULPA 5JDBA 1FX5A 3CB2A 4XFBA 1KB9F 5KXEA 1G9FA 1H1AA 1HKDA 4XCAA 3BU0A 2J1AA 1RMU3 1CQ9A 3FUOA 4HKLA 3WZ1A 4JVAA 3ROUA 5CKMA 1XU1A 1VBB3 3QLQA 4KMQA 2RV9A 3ZFFB 3E83A 3IGAC 3N27A 2PI4A 1R3IC 5FZLA 4TSVA 2WLPA 1DQ5A 3NL1A 2VZPA 3VZLA 4R9DA 4ZI7B 2YIBD 1RVF2 5JQGB 3KHBA 3CC4V 3USSA 3LOIA 3HKCA 1ZTEA 1COWG 2J1TA 2QFEA 2EXHA 5LB6A 4COVA 4MSWC 5GALA 1TVKA 1XI1A 2YGMA 1H9PA 4WVVA 5FNVA 5JH7B 3H01A 2CWMA 3BHPA 5FZGA 2DW4A 3UJQA 1RFYA 1SMVA 4IYHA 4CPBA 2GNDA 4ZZ8A 1Z7S3 3CCLV 1XNTA 3C2UA 3ASNB 4HN1A 5DAPA 1D4VB 1YFXA 2QQIA 1ENVA 3OGSA 1DCSA 5AVPA 3EB7A 1GICA 2RN9A 4GUNA 2J1RA 2JD4A 3THTA 3LSDA 4IEXA 3D82A 1YQ5A 1D4M1 3VQXA 1IS4A 4LLFA 5L3DA 4XJWA 1JQ0A 3W9AA 2ADDA 3LKJA 3OCPA 3RRDA 4IGOA 4LK7A 4LBLA 3WDTA 2ENRA 4PT6A 2PI5A 3VBUB 4ARXA 5L7OC 1CAXB 3HJRA 1X59A 1NT2B 5B3SB 2VUDA 4OHWA 4PJYA 4H44B 1L8DA 4JI4B 3T1YO 3UGGA 5CYYA 4LNUB 3UT0A 1XSRA 5CBLA 1Z7S1 5CZKA 4LF4B 4MGSA 4GULA 2WAAA 2WZR3 2B1IA 1S76D 4CDXC 1MR5A 5A80A 2WBKA 1MZEA 4BQXA 2WNOA 3CRRA 4UFIA 4DRRA 4DRXB 1XNKA 4WF9V 1H9WA 1UD1A 4TUYA 1XE8A 1UXZA 3LSSA 1Q86W 1M1KW 1EUTA 4I02A 1URXA 3OUJA 4NAMA 5CFCC 1AR62 1LNQA 3ZKYA 4BIZA 5GLTA 1JOPA 1RTVA 2XMLA 2X5IA 1JZ7A 1OHHG 2CDPA 3OFNG 1EBOA 2WS91 4JPRA 2R9IA 4FJCC 1M57C 1GV9A 4NR1A 1CN1A 4RYDA 1JTZX 2IXJA 4L9BA 1CIWA 4K8RB 3POGA 3OB8A 3DPRB 2NR5A 4J1WA 5JJJB 1UY1A 3EQEA 3IDCB 4AFMA 1PNKA 2AW9A 4LBJA 4CDWC 5BNNB 4DR3B 3BTZA 4F6RB 3RG0A 4A3XA 3BOWA 1XNBA 4RR3C 1LOAA 5J09A 2RR12 1BLZA 1PIV1 4L99A 2ZEXA 4EYUA 5LYJA 3G80A 3PIGA 3ZX6A 5A7WA 5BMVB 4FZ0A 4QPKA 1IXBA 2Y0PA 1M57B 1QVGU 1OLQA 4X88A 5K0UA 2P5OA 3RJRA 1NXD1 2W5FA 4KGGA 2VOKA 3CZJA 4QNHB 1H2LA 2HWC2 2CDOA 4UBGA 3MHSC 3RSJA 1UOGA 3KV5A 1RUI2 2RMU3 3K03A 1ULGA 5K1XA 3TOJA 1WCDJ 3W7WA 1R1A2 3VBRB 4LO5B 4ZY9A 5A3LA 1RHI1 5E8AA 4NO4A 1ACCA 4MVRA 4QHZA 1FOD1 4LIUA 4O61A 3ZSJA 5FBJA 3O14A 3PN1A 2VQTA 2UXCO 1UU6A 4MGZE 4YGDA 2DTYA 4B3TB 4Q4Y1 3VBRC 3QH7A 1AX0A 3T1HB 3MYXA 4K1ZA 4MVTA 2OX0A 1NLSA 2H0VA 4CDQC 3NAPC 4FPJA 1P84F 1AVBA 4XFCA 1J84A 1E5SA 1M4UA 2FDGA 1I94B 4N9HA 5AC92 2BVVA 3ETDA 5G04L 5LASA 3MUZ1 5HV4A 3B40A 4DUYO 4CDQB 3AM2A 2WFPA 1VQ8V 4EN6B 4GMP1 5JPMB 3O1UA 1Q8PA 2RCVA 4P08A 2ZE6A 5FKCA 3RN4A 2XJTA 1V9U1 3E5UA 2X8KA 1V54C 4K1YA 1W6PB 5C9AB 5FZEA 1AP5A 3JAMN 2QNKA 2C9KA 1NY72 2C26A 4SBVA 5FY8A 3ZN5A 4BA6A 4XOGA 5FYBA 2ZMNA 1OCRB 4BQYA 2BTVC 3RZJA 2GH8A 1SQPH 1LEDA 4TZDA 4DQAA 1REFA 2QJVA 1PO22 5JXIA 1NCQA 3TK1A 1JFFB 2YXLA 2PHTA 2IW5A 3BTXA 3JD1A 1Z0HA 4OULA 2VMDA 5KHHA 4UCOA 1R1A1 4YG3A 2ZZQA 2R49A 4P5YA 4OYUA 2VTXJ 1RGSA 1E1QG 2IJKA 3T4VA 1DQ0A 2A6WA 1NE6A 2WLKA 1HRV2 1BE3H 3U11A 3Q8BA 4YJ3B 1HNZB 4MHRA 4K3AA 3ZXEA 1J1TA 3MLKA 4PDRA 4UT5A 5IAXA 4CH5A 4J7JA 1ZA7A 3TNQA 4DUYB 3A4UA 3AC0A 4LBQA 1HB4A 1WJZA 1TME2 3IZOA 2GZWA 3WDWA 2BOCC 5AC93 1MNGA 2Y48A 4EN7B 5FZ0A 1C1FA 3E1F1 5IVVA 1YC61 3ZPYA 4AQTA 1XNRB 5J1XA 5D1IA 3W20A 1OLMA 2D6LX 5SV8A 4XDPA 2J1EA 1C1LA 3U75A 3AZZA 1MEC3 3E6CC 1MS1A 1DBNA 4IV3C 4Z2WA 5A3PA 1OD5A 1OZ0A 2WT0A 4DO2A 5H2FZ 1FYUA 1STMA 1HN0A 2Y4UA 2CU5A 1S72V 4JGZC 2E63A 2UU8A 4I2OA 2VQFO 3WW3A 4YXWG 3JZVA 4F4LA 1D7PM 1OV9A 3IT8A 3T30A 5A1AA 3MHHC 4ZXKA 4AHXA 1P7GA 3P6BA 4ZS3A 1UMZA 2Y60A 1PO23 2VBBA 5F2SA 5EJ1B 4UW3A 3PTYA 4D7YA 4GMP0 3O0VA 1VBA3 2HEVF 1OFNA 5JOZA 1AL22 4LF8B 1FFXA 3WB2A 2E32A 3APOA 4PD4F 3AK2A 4Q4Y2 3AMQA 5HI0A 4A4AA 1HNXO 2P5BA 1GNYA 1LTEA 1UYXA 1UQXA 1ZA4A 3THOA 1PZ8A 3AVRA 2IVJA 1ENQA 4K20A 4FFGA 3WG1A 1PK6B 3PJYA 4KNCA 4UFMA 1XSQA 4DUVA 2GDSA 1DZRA 2ZXQA 1KP3A 3DKWA 1QJX3 4JZ2A 2R072 4BWOA 2GUZB 1Y67A 1AL0G 3RZHA 1O4TA 3WEZA 3V0AB 2F43G 1URFA 2QE7G 3BAAA 4N8MA 3IFXA 4HOOA 2AZ2A 3KG2A 2LUWA 1XNRO 1LU2A 1LHOA 3OPZA 4TV8A 4EN9B 3NAPB 1RUNA 4KG0A 1XYOA 2AEZA 4WM7B 1IBKB 4ATFA 2RDQA 1W3XA 2PAKA 3RVYA 3D36C 1QMJA 4PF1A 3H7JA 5FZAA 1OI6A 5J9PC 2VMEA 3HN3A 1DP0A 3OY8B 4NOTA 2UWBA 4DXWA 1R3JC 3H8XA 1S3JA 2QWNB 5LRRA 1I0HA 1VQ5V 3AP4A 3N9NA 4SLIA 3H1JH 4LF9O 2JE7A 2LRPA 5KBFA 1JU3A 1YQCA 1X50A 2GBOA 4X65B 1KRIA 2UUAB 3KV4A 2R061 1AR61 2VMHA 3WHUA 2RS11 1ZX3A 2WN3A 4S2HA 4ISQA 3IJ4A 4CZZA 4XXPA 3V64A 3I5DA 2NMOA 1RB8G 4XDQA 4GKKO 4K3UA 1X9PA 3VKNA 5GZFA 3CEWA 1JUIA 5LBEA 1XQNA 3OJBA 2WPDG 5F37A 1ASJ1 3S30A 1QLEC 3LDDA 1GSLA 4LUKA 1RUE1 3BGAA 1S5LZ 2DDUA 2WZ8A 1OA2A 2BSKB 5CG9A 1NR1A 1AR4A 1F4NA 4RR3A 1NTMH 5LMNO 5A7SA 2VBPA 2FMLA 2P90A 3O9OA 3AKPA 5C9AC 4HETA 3K77A 3N9LA 5F3IA 2JJ2G 2I74A 2W0FC 5G05L 1QJU1 3TEZA 2Q6AA 2QKDA 3M8AA 4YZ5A 5LEKA 3POJA 3OGJA 5DQ0A 4AI9A 5LMUB 3LA2A 1SHWB 5K1PA 1HQWA 4C1WA 5FYIA 1MS0A 1ZL8A 4RQFA 3J26N 1NA1B 2X5IC 4MVMA 5FP3A 2TUNA 4FPEA 2BGOA 4OPHA 1JZ4A 2IZWA 4XXAA 4YW5A 4QDQA 3K48A 1ENSA 3EJKA 3M4FA 3ACHA 1JMUB 2X6CA 3MI8A 5LRSA 4I3GA 2UUBB 3Q8EA 2XQRA 1GK9A 3CSXA 3BFRA 1PHMA 4LTAA 1FJGB 1LCLA 1FMD3 2QE3A 1GWKA 5EXOA 4XFFA 4N7UA 4WFFA 5APAA 5BNPB 3WINE 2E6VA 2Y38A 3DXTA 1W0NA 4JI6B 2YZ4A 1A8MA 5C71A 2DU1A 1B09A 4D6TH 1NAEA 2CGNA 3QACA 1DZQA 3WQBA 1YFYA 4HT1T 1LECA 4U36A 2A3WA 4LO7A 4XFHA 5E89A 2DWEC 2WSVA 3K08A 1OKOA 4CXWA 4GH4A 3B7MA 4DV6O 2D5FA 1D4M3 4M3CB 2XPJA 2XDVA 2DBIA 2P3JA 2YUAA 2FD8A 3TXQA 1CVNA 4YGEA 3DUIA 4UFZA 1FNZA 4CTEA 2ZMLA 1F4AA 4J1XA 2AZ0A 1HR0O 3VHOA 2XJQA 5LZ6A 4XFIA 1MS3A 2GC2A 5C8YA 5IVFA 4FOQA 4X1KB 5FPOA 2AGSA 1IQAA 3W7SA 4BXSV 5FXWA 4IW3A 5I0RA 1OMIA 2ZGOA 1Q8OA 1W8OA 2GSMB 2XAJA 2JRIA 1O5LA 3QOPA 4IESA 3U07A 1DU3D 2I07B 1HB2A 2UUBO 2W47A 2P1BA 4X9QA 2JD9A 1W6QB 3TJTA 5E6HA 1CZTA 4QX5A 1NVPD 5D8AA 3SJCC 1ULCA 4RHV1 4XZUG 5EBMC 4FFBA 5K0UC 1MEC1 2OVUA 5HCBA 4NIGA 2XLFA 4AVSA 2JGUA 2ZD9A 4HXCA 3DEMA 2GDFA 1NH2B 2Z2SB 5F3CA 4NXMO 2KQXA 3AJYA 4AHYA 5EZWA 2UURA 4CUAA 3KQ4B 3K57A 2ZBJA 4GKXA 2XG3A 4FQ4A 3JD2A 2XL7A 2WA3A 3BVCA 3LSQA 2JG8C 4H2AA 1S0VA 4AI8A 1BYHA 4DV5O 4XCBA 4HL0A 4KG8A 4XIKA 1VEWA 2P2KA 1PGL1 4H37A 2VJXA 4XBLA 3VBRA 5FL7G 4DYLA 3L2HA 4LMFA 1W04A 2HJDA 4I4TB 4META 1H8TA 5I0TA 4KU7A 3JUUA 2CYFA 1GP5A 3LNNA 2F66C 3LQCA 3VBSB 3CRQA 1CAVA 3FN9A 2OT7A 2Y8KA 4XDOA 4JI1B 5GLZA 2F23A 3BCCH 4DUWA 1QY4A 1UPGA 4K8XA 1JA8A 1N0NA 3AMPA 5FK7A 5CA0B 2RMU1 1LJ7A 4O2AB 5GONA 4JI1O 3CQOA 2XJPA 3RMYA 1ZZ9A 3VDDB 2NQYA 1FXZA 2EIEA 1JCHA 2GC3A 1TAEA 1IPJA 3C7HA 2FHRA 2ZX4A 4CCMA 4J25A 1AR63 4XTPA 5EK0A 4Q1PA 1PNFA 2CHHA 3F7YC 5BPXA 4AHCA 5IVCA 1AYM2 3SKVA 3ENRA 4FP3A 3MIBA 2VVFA 4ZOLA 5C6CA 1RUD1 4HKWA 3ASNC 4DXZA 4I55A 1F2NA 2RR11 2RJKA 2A1XA 5J2TB 1REDA 4BB3A 2WO7A 4Z92B 3ZMZA 2CGPA 3AP6A 3G6BA 2ZHMA 5KX5A 2HVJC 4RN5A 3KD4A 4B3MO 2XWBB 1JN2P 4W6XA 2JIZG 3TETA 5CA3A 4AQ6A 4NPLA 1IS5A 2WNEA 1Q8IA 3JQXA 1UFIA 2XOKG 3VKFC 3LSUA 5IJ9B 2B42B 2PHXA 2NMNA 3RWKX 3HT2A 3T2OA 4MYEA 1GAXA 3I2OA 5D2AA 2RS13 2ZM6B 3NV1A 4LLOA 4CP2A 1RUH3 1VF6A 4A7KA 4Q4W1 3I54A 3NWKA 4UYBA 3RYCA 2Q8EA 4BQ4A 3AKTA 1AYN3 4YVWC 3CJXA 3P3NA 4FZ1A 4WFBV 1C28A 3EMRA 4LO6B 1UOFA 3VBFA 4J6GA 3ZDSA 2VCCA 3ZDVA 2W87A 2GNTA 4F3JA 1DYPA 5LW9A 4CSWA 1RUD3 4YW4A 2UU9O 2XR4A 3S6PA 1JVMA 3OUHA 2SLIA 3WP3A 1LOGA 5FZCA 4MVZA 4KUMA 3KVBA 3VDAA 4L0PA 1VBA2 3PUQA 1SA0B 2F4LA 3RBZA 5AG2A 1SLLA 1K5QA 3PUSA 1KD7A 4GALA 4YVSA 2YPJA 4YG0A 2YI8A 4AHWA 3G4SV 2EXKA 3NNFA 2PHDA 1UKGA 1VAVA 4MTOA 2NPIA 2E76B 3T4ZA 2AACA 1UZWA 2A6VA 1W9FA 4ET7A 1NUKA 1D5NA 2NZ9A 1N1SA 1ZBE3 4KP4A 4Q4W3 4WM8B 4EB6A 4BH9A 3HR9A 2FZ1A 2ITCC 5FLXN 1CJDA 1UPSA 1VMFA 5I0SA 5CB4B 4O7XA 5JR7B 3JALA 1VBE1 5FY7A 4BQ2A 4E4HA 3SH5A 4YM2A 3RZGA 2VW0A 3CF6E 1GP4A 1JW6A 1WLTA 1C57A 4Z1VA 1XB9A 2ORXA 4AAPA 2G4IA 2GH2A 2ARXA 2Y6LA 1QNMA 3K5NA 4P14A 4OHZA 4XQ4A 3OAAG 3M7MX 2E7AA 1Q6UA 4E2GA 5FZFA 5T52A 2VZQA 2Z0AA 3LNMB 1C5HA 4LF7B 1JOBA 4ONUA 5T55A 4FVVA 3Q8AA 5FNVB 3SYOA 2HWD1 3K3OA 5A3MA 2QZ3A 2VULA 1O8SA 1W6NB 5ABJB 2A6XA 5L9BA 4ZKIA 1W2TA 1UU4A 5LCWL 4MXWA 2RS52 2PZSA 5GONB 2VZRA 4K21A 4ZKTB 3UM7A 1ZZCA 2OTJV 4IGPA 1FKAO 2HKOA 1PNLA 3ZYJB 1VBA1 5CFDA 3G71V 1UPIA 5L9RA 5DG2A 4TYSA 4WVZA 4LOSA 4EWAA 2ES3A 2UXDO 5JZGC 2DV9A 1KP2A 1RUC2 3ES4A 1GM9A 1ODNA 2A3XA 1S0FA 1QH6A 4LBOA 4HBNA 1R1A3 5K4LA 4BOWA 4DUXA 4N23A 4BK5A 2PTMA 5ABJC 5BR8B 4NN0A 2JDYA 1RUC1 5K9YA 4E8DA 3VBUC 2HP8A 4S2GA 3LCPA 4WBBA 4AEJA 4Q4W2 4CP9A 2C6SA 1F5JA 2W1UA 3SDLA 3JATA 2A75A 3IPVA 1SF9A 2BERA 4LWSB 4TWTA 2VGDA 3C7FA 4Y20B 4HPKB 2O57A 1S2BA 4CC5A 3LPFA 2R1BA 3OF1A 1F7YA 2VZ3A 5A33B 5IYZB 1Q3EA 2XLAA 1NVPB 5JZGB 4PA3A 2BGCA 2JENA 2ZGPA 2WAOA 1PO13 2YFUA 4PELA 4IERA 3O1SA 1ND3A 1JOJA 4WZCA 4K8ZA 4N43C 5JSPA 4B3NA 5GLUA 1BKZA 2AUYA 3MFAA 3K79A 5KHKA 3OEAA 1RUE2 4QGMA 3VBFB 2ZXWC 4FM2A 3A0HZ 5FOJB 2XHNA 4Z82A 2VZSA 2E9QA 4UVAA 4WVWA 1UY2A 4XUQA 2WLNA 4XF1A 3KZIZ 2OUJA 4CBCA 3ZXGA 1NH2D 4RFRB 4NRQA 1N4CA 2ZEZA 4LEJA 4RR3B 1BEV2 4U3JA 3OMNB 4QXHA 5DAVA 4X64O 2KD7A 3ITQA 1UL9A 3ZHRA 2JDZA 5EYPA 4JGZB 4IYIA 3CNAA 2IC1A 2JS5A 3PUAA 3HKEB 5BMVA 3HR0A 3NSTA 1ASJ3 5LY2A 3N9MA 1YIFA 4K0KB 4DW0A 1BL8A 4PDLA 3E35A 5M0TA 3N2KA 4ZHNA 4QXKA 1R3KC 3ZMNA 5CA6A 1DGLA 4DR4O 2IWGB 1OPOA 4JC1A 1V6NA 5EP9A 3DN7A 3KV6A 2C1FA 5JOXA 4QU1A 1EN5A 1NQDA 3U0ZA 2HWC1 4R9CA 2PA7A 1H8TB 2NM1A 2QJ1A 3FAVB 4Y24A 4LF8O 1Y4MA 2OUHA 3PUHA 5EYYA 5FJKA 4WM7C 2OYQA 4W6WA 5BNOA 3VQWA 4K6BA 2VECA 5IW0A 1AXYA 3BU7A 1GMGA 1J95A 1M90W 3DYPA 5BNPC 2DCKA 2P17A 1J83A 3LSEA 5FUNA 1YJWV 3MEPA 3ZJZA 3J7NA 2P4KA 3FB6C 1OFSA 2ADQB 5A1LA 1V9PA 5A9GA 3WB1A 2WINB 1WUVA 3T0AA 2VQEB 2PHLA 5FQ0B 4WCEV 1SBDA 1RMU1 1IPSA 1OCRC 2EXIA 4FPYA 1V9U3 4HAMA 1OPMA 1DF0A 4IGGA 3O1OA 3CMAV 1EPWA 5FYSA 1O59A 3AL5A 5EYXA 2P3IA 3WG2A 1ZUQA 2D6PA 4QD2A 4UAPA 3WNLA 1NKGA 3Q4HA 4XBFA 1R64A 1SLBA 5EJ3A 3LDBA 5A7OA 5TSWA 5TISZ 5DN6G 5ERLA 1CGPA 4B8EA 4LR4A 4RS5B 4IEUA 2MK3A 4PA4A 3OT7A 5A7NA 3J8F2 2Q9LA 5CIRA 1XOUA 1QJU2 1EZVH 2C24A 3ZR5A 1W9WA 2XL9A 1O3SA 4DY3A 4MGKE 4MX3A 4XILA 1F51A 1WPXA 1MA1A 2ZEYA 4JGSA 2ZS6B 4TLGA 1E5IA 3ILNA 5GZGA 4FMTA 1GWLA 5J96B 1AB3A 3OEHG 4COYA 4Q8KA 3WDVA 3RZMA 2D3SA 1LGCA 3UCSC 4ZPIA 1VRH1 3PMSA 1JYNA 4YY3O 3SGIA 4LBQB 4CU8A 3CS5A 5CAZA 3LF7A 4D7SA 2KXLA 1H8EG 3G7DA 4X65O 1OQEA 3AG4B 4DV2O 1NTKH 1E79G 4M4RA 1PL4A 1G86A 2HWB3 5FO9B 1RSOA 2OT5A 1SQ4A 2HLEA 2LW7A 4UVCA 1F4HA 4AFBA 3ZPOA 4JTAB 2ARAA 3OGRA 3W59A 5GW7A 2JDMA 3F95A 1G9AA 3WF1A 1Q6IA 4Q4V1 3VD7A 1NG0A 2QKCA 5EIBD 1IVSA 3I8TA 1PD3A 3VN4A 3GALA 3VD3A 5CA0A 2WZR1 4AI0A 4FFFA 1ZZBA 1KS5A 3U78A 2ORZA 5FPBA 1PMIA 1VQMV 4P9LA 4LFAO 4FOYA 3WP5A 2WAMA 3ABMC 2Y6HA 5BNOC 3SR2C 2W52A 4UWDA 1LGBA 1QJEA 4Q2FA 4U2AA 1GZTA 5GTIZ 4DV1O 4F7ZA 4CS2A 2FTKA 2ZACA 4QPWA 1BMFG 3UKVA 1DFQA 3C7EA 3LOBA 2HKXA 1ST8A 3ZMOA 2XJSA 4BXFA 4XURA 2GN3A 4PIXA 4GWNA 5DPNA 1A34A 2XAQA 3ZSKA 2QQVA 4XETA 2WFF3 3TN91 3OBTA 4PA9A 2FMYA 3RYHA 4HMZA 3DXRB 3ML0A 5KX5B 1W2BU 4MLOA 2Y6KA 3BODA 1JFFA 1U5XA 3ACFA 2HFEC 3I55V 3JBG3 3WQ1A 4HPKA 3ZXLA 1E1RG 1GO3F 1I7FA 4TWKA 2WQ8A 2IUWA 1K73W 1WA6X 3JD4A 4COZA 4QQOA 4CDUA 1SQVH 5ACA1 2O1QA 1QJY2 1KUQA 4AQSA 1YI9A 4QX7A 5EHDA 1CPNA 1XEQA 1HDKA 3MO4A 3QH6A 4AVVA 5IVBA 4Q1RA 5C5TA 1K5JA 4FTBA 3QTCA 1N33B 4JAUA 1UF2C 2A5ZA 3MHZA 1LOBA 4R8CA 3ZN6B 4CUGA 3MIGA 1JYVA 2V7QG 3O0WA 1DLCA 2W95A 3JD71 2B5UA 3OMIB 4FXGB 2C9AA 1RUJ1 1ZBA2 5IJ0A 3A23A 5JZGA 3SYCA 4ES9A 1BXHA 5LA0A 3WUDA 2OTLV 4TTGA 4JTCB 2JJ1G 4AZZA 1N47A 2XASA 4TV9A 1GKBA 1DYOA 1W9TA 4C91A 2ZE8A 4DV1B 4COUA 3VZMA 1A8DA 4XVHA 4KWLA 2E5LO 2QM8A 3TAYA 4WM8A 3CL1A 4LFCO 1WPBA 3X29B 4OHXA 1GQHA 1EV13 3D5OA 3LEKA 4LQRA 4AGVA 2ZGSA 5C93A 2P4EA 3HB3B 1K4CC 4RD7A 1WMDA 2SBAA 2D3PA 4XDLA 5F39A 1JJOA 4DR6B 2VS0A 5LEJA 2BPA2 1VQ4V 1IBLO 3ZMTA 5KMGA 1CAWB 4MV2A 3ETPA 2HVKC 1BK0A 5A3WA 2P06A 2VMGA 1AR93 3J7MA 3MLJA 2XAGA 5L7OB 1VP6A 3K4DA 1V6OA 1EP0A 1ZAUA 4I50A 4M4PA 4AHZA 3I3QA 3I7DA 4DV7O 5C8CA 4D3WA 1W0KG 3H1KH 4LH6A 2YROA 3WCSA 5FYHA 3EVKA 2HEPA 2ZZJA 5DABA 4RO2A 4CU6A 1VIBA 4YZ3A 4CP0A 2GSYA 1Y6XA 4NKGB 2F95B 4DR6O 1NBMG 1HIXA 1JH5A 3AKSA 2EIGA 1V6JA 1RJ7A 5IVYA 1JODA 1ND2A 3H1LH 4F8AA 1HP8A 4ZS2A 2QQOA 1KFXL 4LT5A 2ZIOA 1ENXA 1EAH1 2G9FA 2V09A 1HW7A 1GMMA 4OMDA 1AJKA 1IG0A 1QJU3 4DK0A 4PIZA 2AZ5A 2PHRA 5FBZA 4AK3A 4XUOA 3PVOA 1RUH1 2V1DA 3JQWA 2O8OA 4KHPO 5KR7A 3MW4A 1NA1C 3C7OA 1SESA 1W06A 3SITA 2DMXA 2F6BA 1MS8A 2FMDA 2DU0A 5I91A 2YG0A 4EE2A 4JI8B 2BZDA 3ZCCA 4JZGA 3RYFB 4Q0QA 3ZS8C 4IE0A 5J48A 1AI5A 4R6ZA 5AC91 2P7TC 4ZU4A 3MFCA 1OKQA 3KS7A 1JX9A 3CC2V 1WA8A 1YCIA 2UU9B 4V1PA 1W8NA 1PV0A 1B35B 5EIYB 2OWOA 5A7PA 1KFUL 4DR5B 4XBQA 2RVAA 1RIRA 4QT6A 1MS5A 3H1HH 5FYCA 2R071 2G9GA 2Q1ZB 1RM1C 1VBB1 2C2AA 2G38A 4ATEA 5T5PA 1B06A 2DWDC 4JZRA 2PY5A 2GMPA 2VG9A 2FQPA 1ZWIC 1VRH3 4NXMB 4HK9A 3TEYA 4UFJA 3DYMA 2BU9A 1AX2A 4NAOA 2DN9A 5IUQA 1AL21 1ALYA 4JI5O 3NW4A 1Z78A 4RAIA 4A6OA 4PIYA 1WP8A 2Y6JA 4QX0A 1W6QA 3C8XA 5A3TA 4ABMA 2QTSA 3K5LA 4P2ZA 4XHXA 1JUHA 4S2FA 1BMV2 4P9OA 4D69A 4YFZA 1QLNA 2WT1A 3VKMA 1KQRA 2X09A 4MG2A 2E33A 4CCOA 5E88A 3B77A 2OA2A 2W1WA 2GMEA 2XLGA 2YPDA 2IFRA 4A3ZA 3PJSK 3I4IA 1PGW2 4TLFA 3K0GA 2JX9A 3J7HA 3ABUA 1X36A 1D5AA 3S7EA 1W2UA 4GD4A 1RUD2 3HQXA 3ZOIA 1H2KA 2IJIA 3HKCB 1ZREA 1TGOA 2EA7A 4X89A 1SQFA 3M3QA 3RYRA 1GN3A 3UYJA 4LBNA 2MEV2 1W6OB 3A21A 4GXLA 5FY5A 4FPPA 5BNPA 1R081 4QPGC 3ZSLA 4AFCA 1VQNV 3J7AU 4OX9B 1UMIA 2R041 4JX0A 5A70A 3L9DA 1F4MA 4GIQA 4FLVA 5FP4A 1TME3 3I2IA 1SZXA 1RPRA 1MQTA 1HV1A 1DGRA 3H1WA 3AXEA 1LAJA 4UCRA 3AMHA 1K5MC 3CMGA 2WSUA 2VOTA 3JARA 1TMF3 4BK4A 2W2IA 3L70H 4HKOA 2QSAA 1YXBA 3ZXFA 2RDSA 4JDOA 4MVQA 1VBD3 2JDPA 4H13B 3VBSC 3ES1A 1HQNA 1H8VA 1CX4A 1S55A 1NY71 3I2DA 4URTA 2EICA 4HFSA 2W0XA 1AJNA 1N32O 2CE4A 4PI2A 2WKKA 5FYZA 3B93A 1M93A 3K5MA 2RR13 1CONA 4GJYA 4NMIA 4L92A 3ST7A 3KQRA 4YRDA 1NXMA 2R062 5K7PA 4X1KA 4R4ZA 5JVVA 3ZN6A 3RI9A 2W6IG 1IS3A 3ASOB 3ZFEC 2V4AA 1WCSA 5CKQA 1HB3A 4OHVA 4CVUA 4OI0A 4YVWB 4H33A 4B08A 5JQGA 2JDHA 2OIGA 5FIXA 1RUG3 1BQ0A 1D2QA 4XF4A 2VC9A 3JAKB 4HNAB 3AJZA 4FCAA 5B4NA 4MVSA 1AI4A 4EZ4A 1R093 3IC7A 2BGPA 1O8PA 2WUHA 1BS3A 5A3UA 1YHFA 5CG8A 2AYHA 2JEUA 4FQZA 3WY6A 2MEV3 4X1YA 4YARA 3JD72 4J10A 4BISA 4ZBMA 1TA8A 1R73A 4LBEC 1ZRCA 5LHHA 3OGGA 1W0JG 5KWRA 4AFAA 1IOAA 1YTFD 3CZUA 3JSLA 4QWNA 2ODMA 3WNKA 3APQA 1AR82 3ABTA 3A0KA 5IJ0B 1BHGA 5FRAA 3TN92 1RHI2 2D6MA 3HQRA 4WM8C 4YM1A 5T50A 4F6RA 1NOVA 2D6KA 3I2FA 4CEYA 1BBT3 4HANA 2D98A 5LBBA 2VQFB 4GKJO 1DK1A 4XQDA 4BIOA 1S4CA 4UB8Z 1PNGA 3TWIA 3UGHA 3T4DA 1EY2A 4B4RA 1U12A 2VZTA 4LFBO 3MDPA 1Y66A 2ZHNA 2PYTA 4NWVA 3NRUA 1AYN2 1WN7A 1VBE3 2VOWA 4QAWA 5LK7B 4IEOA 3IB3A 2YBSA 4ZI7A 4CU7A 1GM7A 3SJBC 1H2NA 1AR72 5JXGA 2WWUA 4NIAA 5H6QA 3RI8A 1KITA 1R082 2EAAA 3VDDA 1S1AA 3AG2B 2Z5WA 2Q5TA 3SXWA 4FPFA 4QPGA 1FXKC 3ZFFC 2BNMA 2XOMA 2OIEA 5JOWA 5LBQA 3S3XA 1N1VA 3GM8A 3GWOA 3LEGA 4HLTA 3OR7C 3X2QB 2GV9A 4ASMB 3WFVA 1PIV2 3AKQA 1G8WA 4MO3M 2LW8A 5A3NA 4CCCA 5I8SA 3X2QC 1DZTA 1R6NA 3F5TA 1WLEA 2WIIB 5SV5A 1MSDA 5JXHA 3TNPB 1VRH2 1CPYA 4H7LA 4ISRA 3VBHC 1THZA 3GCXA 3UGFA 5FFOC 2GTAA 2XH6A 4OI4A 5BY5A 4QX3A 4DB5A 4P9IA 2ZTNA 2DVDA 1KECA 4CU9A 1BK1A 1J1LA 2EX3A 1PZ7A 5FZOB 1GR3A 5A32A 1XE0A 4I0BA 5FWEA 2ZT9B 1RP3B 1DIWA 1HRI2 2OXBA 4A41A 3VD5A 4EWDA 4N53B 1T2XA 1I6XA 2WQZC 3HWJA 4QQHA 2ZKOA 4X20B 2QA4V 1DQ2A 5JWPA 4DNYA 5ANQA 1PGL2 3U10A 2HWB2 3USUA 2PQSA 1CAWA 2V4VA 4BJ0A 4ASKA 5IFTA 2G9ZA 5GKAC 1V6IA 4B4QA 4TV9B 4E4ZA 5CBFA 4FSJA 5FMOL 2CAZC 1PX3A 2BV4A 1WD4A 1RUC3 5IT9N 2WNVC 3SQOA 4X62B 3ASIA 2XBO1 1Y7BA 4Y1ZA 4D0QA 3F7VC 1XNQB 1OF3A 4Q4V3 4O4JA 2QWOB 1OLME 5B1OA 4JI3B 3SISA 1VMJA 3MIDA 2VWJA 5A2QN 3LIHA 1RUH2 2H6BA 2XKOA 3NNMA 3EFFK 5J3UA 1V55B 3ABLC 4IEQA 4JKLA 3ACIA 1RVF1 2FZ2A 3SCGA 4HZFA 2BOIA 2D2CB 3PIJA 3TEWA 4LA3A 2XNDG 3WDUA 4BIFA 1VIWB 2Y4TA 2W08A 3B02A 2QEXV 2Y33A 4H7MA 1DGRN 4LFCB 3DF0A 5JLVA 4OMCA 2XUEA 4CCNA 5FO8B 1OJHA 1OSGA 4Q0UA 3WNXA 5F5IA 5L3BA 4I55B 1YZBA 3D4KA 3T09A 1XU2A 3H50A 3CYOA 2E31A 1G1XB 2XBO3 4U3FH 4XMIA 3ZIXA 3WDXA 2ZIMA 2YEVB 1M5IA 3GYDA 2XONA 1IKPA 3VKOA 4MT8A 3PHMA 5A1FA 3PU3A 4LK6A 4B3RB 2UYBA 5CISA 5JUVA 1UNBA 3I3EA 4DV3B 1UZ0A 1DDLA 3BN6A 3CRCA 2CV6A 1QQP2 3LEMA 5JOYA 1DYKA 3L75H 5ACA3 5FWJA 1H30A 3UQ8A 3RYCB 4K8FA 4IUGA 5FKBA 5ITZB 4JYAB 3W7TA 2ZE5A 2R30A 5CBHA 4FFKA 4GKYA 1XBLA 5FPRA 1I94O 1ZBA3 4LHNA 1C8M2 3KMHA 4UV8A 1X82A 3AVSA 4F6EA 2PXJA 5LOVA 1QH7A 3JAWB 1NYWA 4AE2A 4E4DX 4I7ZB 3HNBM 1CWPA 2JECA 4A6SA 2AREA 2DFBA 1XHXA 3H8OA 1BBT1 1VBC1 3T0BA 3ACGA 3M2MA 4AF9A 5JJEB 4JI4O 3ZLIA 2X6BA 1ND3B 1NZCA 3E8HA 3VQVA 5FZOA 5IYDO 4X62O 1NZIA 3ZX7A 4UF0B 3MV01 1QCEA 1YTFB 4NPMA 5A6XA 2ETNA 2VNVA 2VMFA 4GWMA 4LWSA 1JZ6A 1H2GA 1IBMO 1D0GA 1MPXA 2LM3A 5LHGA 2WFF2 3MV11 4XJ8A 4Q0PA 2FKXA 4R7CA 3N36A 2YU2A 2DFCA 3MF9A 1AYM3 4KWKA 2P67A 4A7YA 2I2SA 3FHQA 4AEDC 4D6QA 5J98B 4O4IB 1LESA 4JRAA 1CESA 4O4LB 3E2EA 4WBNB 3B01A 3B4SA 5KUMA 1NQJA 1UW8A 4Q4Y3 2OCCC 2B7YA 5F3GA 3P5BA 3NNJA 1RXFA 2OW4A 1GP6A 3M3EA 2GU9A 4UCUA 1X8MA 5JMCA 2H94A 5DUVA 3N2KB 5IJRA 4Q20A 1YJLA 1W03A 1TG7A 4CZSA 4HK8A 4YZ4A 2EALA 2EIMB 4YW2A 4IHJA 2QQPA 1BZKA 1ZX5A 3WG4A 1POV0 5H9PA 4D8MA 2KM2A 2D3OW 4I9WA 2VO5A 4B3TO 1VMGA 4CXXA 3WG7C 3BIWE 3HKDB 2Q7GA 3I59B 1VF6C 4PJ0Z 4MUVA 1QU7A 3MD0A 4FM1A 2LALA 1Q6HA 3VBOB 1KDKA 1EZJA 1N1YA 2P34A 1DQ6A 2L9LA 1HXS2 2E3CA 3JATB 4Y3OA 4QHOA 4IDZA 1MZFA 2QM7A 3DSQA 2VW2A 3IMMA 4LJHA 5DUWA 4RQPC 4DUZO 3N7MA 1GM8A 3ZRVA 2ERFA 2Q1FA 1RM1B 4AL9A 2W91A 2Q67A 2BP6A 1RYYA 1Q7YW 4QPIC 2ZR3A 4OGQB 2EINC 3O5SA 5C70A 5A32B 3H0OA 5JIAA 1FS0G 5JVDB 5CU1A 1FMD2 2EILB 4XDKA 4O4HB 1QDCA 1XILA 5FZMA 2WFF1 3TN93 4DR2B 1IS6A 2J42A 1SC5B 1XUQA 2W39A 3ZRWA 1OA4A 3HNYM 3MLLA 3VLBB 4KI5M 2X10A 1MEC2 4D6RA 3CWBH 1XDCA 2JXAA 1VP7A 4AGGA 4DV4B 3IWZA 3OG2A 5ANNA 3ZRSA 4YHHO 5LGUA 2BWAA 5I93A 3E97A 4V2VA 3PDQA 1XL4A 1W05A 2BFUS 3LDRA 2RS53 1EPZA 3RZZA 3BIEA 3ZMVA 5JSOA 1VBC2 1UZVA 2V73A 1CR7A 1H4GA 4DK1A 1TE1B 1Y9GA 3R4DB 2YMZA 1NLQA 3QF7A 1XC6A 3BTAA 2HBTA 3ZMUA 1D2DA 2FCTA 4G28B 4EJRA 4KBBA 2Y69B 2ET1A 5H9RA 5FYVA 1NTZH 1K4DC 3ZXAC 2JG9C 1FATA 2RS33 4DR1O 3OUIA 1UX7A 2VL4A 4MTXA 3UT5B 4N90A 1SERA 1ZM1A 4GLXA 1FXKB 4Q0VA 4PDWC 5H9CA 2YIBA 5FREA 3BA9A 3PVNA 4JI2O 1XMQB 1MS9A 1B04A 4BAYA 4MSVA 4P00B 1EFRG 5FV3A 1VB2A 5C3RA 3G6EV 4UFHA 2P37A 3BVOA 1I5XA 1Q90D 1SCRA 4RSUA 2EIKB 1K33A 5HFLA 3AK3A 1TME1 3NJXA 2UUCO 2RDCA 3L9JT 3H3UA 5FY1A 4K0KO 3A0BZ 1AR5A 3AB0A 5DZEA 4IHJB 3KCYA 4E2QA 2UXNA 3B69A 5L7OA 4PQ9A 1D4M2 2HJFC 1QLEB 4LF4O 1X8EA 3VBOC 2YU1A 5F1RA 4IIJA 4FPLA 5KLVH 4X64B 3I49A 3JD0A 2VPVA 1FPN2 2W6JG 5AFEA
chains in the Genus database with same CATH topology
4FAGA 3ZXKA 5BNPC 2DCKA 2P17A 5JAXA 3LSEA 3ZYGA 4C0HA 1ZRDA 2GNMA 1LHUA 1LOFC 2X53S 3MEPA 1Q43A 4RGAA 1M4WA 5FPXA 1YRZA 2VMIA 2ZGQA 3KCCA 4Y1YA 3SMHA 1OFSA 3JB4C 4P5HA 3T1MA 1V6KA 2DUOA 4Y20A 3KGZA 4XW3A 2E7QA 4HVOA 2WINB 4DFSA 1WUVA 1D2SA 4XQWA 2PAEA 2D7FA 2PHLA 1EAH3 4GB31 4GMP3 1BMV1 5FQ0B 3B9IA 4N43A 4FAHA 1G6NA 3B9CA 1SBDA 2V5YA 4M3CA 3V17A 1RMU1 2ZJCA 1NLRA 1QWRA 4YZ1A 2EXIA 4FPYA 1V9U3 3BCWA 1FOD3 3TB0A 1OPMA 4XJZA 1DF0A 2EXJA 1EPWA 5J7MA 1MACA 1Y9QA 3DGTA 4MGYE 5EYXA 4BYYA 2P3IA 3FHIB 3WG2A 1BEV1 4Q4X1 1ZBE1 2D6PA 2VNRA 4S2DA 5FCCA 3CO2A 4QD2A 5JSPA 4W6YA 4IV3A 3H3ZA 4B29A 3KGLA 1GFF2 3HBZA 4WM7A 1QOTA 5DXDA 1XYPA 2ZA9A 4ZU7A 3INAA 1JYCA 1I3HA 2YXSA 3PLQA 5CFCA 1MQTC 4XPVA 4Q29A 3HN1A 1O7FA 1UKRA 3OY8A 1PM7A 3AZWA 1J58A 1SLBA 4M25A 2PLV1 2PQQA 5EJ3A 4I09A 5ACA2 4N53A 5TSWA 4CP1A 1V70A 2JKBA 4INDA 4Y22B 3T2TA 1PVC3 1CGPA 5GZEA 4B8EA 4LR4A 4X8PA 2Q4AA 2WLQA 2XJVA 4HVQA 4RS5B 4IEUA 1BJQA 2E7TA 3KLSA 1V6LA 4M00A 4GH4B 1LODA 3J8F2 5FLJA 4Q27A 5CIRA 1COV1 5BYNA 1QJU2 4Q8LA 1C5IA 4LO4B 5JDBA 1FX5A 2R32A 4D94A 1B35A 4XFBA 2XL9A 3PNAA 5KXEA 3CJIA 1G9FA 4N9IA 5FAXA 1U5ZA 1H1AA 1HKDA 4DS0A 4FPKA 1O3SA 4DY3A 1RMU3 1Q8QA 1CQ9A 4MGKE 5J36A 4MX3A 2YUEA 4XILA 5D8AB 3ELNA 3FUOA 4HKLA 4F83A 1YYNA 3WZ1A 4JVAA 1GNHA 3ROUA 4DRVA 1QJY1 4NHMA 1XU1A 2ZS6B 2WZPP 2ZOEB 3ILNA 5GZGA 1VBB3 1RUF1 3QLQA 4H14A 3P3PA 4AVCA 5J96B 4Y5Z0 2XWJB 3KT1A 1VZ4A 3ZFFB 4COYA 4JRLA 4Q8KA 5JCTA 1NE4A 2BBVA 3M1HA 4TSVA 2WLPA 3WDVA 1WBLA 2D3SA 1LGCA 1VRH1 1DQ5A 3PMSA 3NL1A 2PLV2 1J3QA 3V15A 3VZLA 2Q8OA 4R9DA 1RC6A 4LBQB 1QDOA 2VH9A 2ZGNA 4M3CF 5CAZA 3CLPA 1RVF2 4DPNA 5FTTC 3B00A 4D7SA 2GALA 1YFWA 3IDEA 4LBKA 3USSA 1HXS3 2EAKA 2KXLA 3G7DA 4OHYA 4UXAA 3LOIA 1OQEA 4LBMA 1VALA 1W6MA 4AI1A 4CDWB 5BNNC 3V65A 2DVFA 3MS5A 1G86A 2HWB3 2QFEA 5FO9B 4LE3A 2EXHA 1L3JA 3EO6A 4COVA 3FFZA 5GALA 1SQ4A 3PVJA 2YGMA 4QGNA 1H9PA 4WVVA 2VY0A 3A0NA 2R073 4AFBA 4XJAA 2CWMA 1LOFA 3W59A 2D44A 3WP6A 1QJY3 4OUMA 3UJQA 4BM8A 2A7AA 1SMVA 1G9AA 3MIHA 2GNDA 1LHNA 1REEA 2RJLA 2OG7A 4AVAA 4Q4V1 1NG0A 1HRV3 1Z7S3 3I8TA 3POWA 3C2UA 4HN1A 2D3RA 3Q9OA 5DDJ1 2Z79A 3VN4A 1D4VB 5EV7A 3GALA 5T54A 3JBG1 1YFXA 2WZR1 1APNA 4AI0A 1ZZBA 2ETEA 1KS5A 1MVEA 5AVPA 4R8HA 2GC1A 1GICA 3THTA 2JD4A 3ECQA 1PMIA 5FO7B 4P9LA 5T5JA 4N53C 3LSDA 4FOYA 4IEXA 3WP5A 3WXPA 3PJQA 3WT3A 5JPNB 5BNOC 3D82A 1D4M1 4M23