2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
1H2LA 1IZ3A 4B7KA 1MZEA 4BIOA 5JWPA 2XUMA 4NR1A 4QU2A 2YDEA 2W0XA 3P3NA 1YCIA 4B7EA 3KCXA 2YC0A 3KCYA 2ILMA 4AI8A 1H2KA 2CGOA 4Z2WA 2WA3A 3OD4A 1H2NA 2WA4A 1MZFA 1H2MA 3D8CA 4JAAA 4Z1VA 3P3PA 2CGNA 2Y0IA
chains in the Genus database with same CATH superfamily
1F51A 3LOIA 4AVAA 2ZGPA 5LYJA 4IE5A 1E5SA 1JR9A 5FV3A 3EXAA 3M3CA 1R082 1Q3EA 3DPRA 4PF1A 3P5BA 4UW3A 2W5FA 5JVDA 5JOZA 4QPGB 3O1UA 4N53C 3HPLC 2IXLA 5EC1C 5ABJC 4U3JB 1AX1A 3GBWA 1UY0A 3HKDB 4META 3O1RA 3ZMNA 2XHNA 2GMPA 5LEKA 2BOIA 1CXZB 2F93B 4AW7A 4KP4A 2ZCEA 3A0RA 4G3YC 3N2KB 1F7YA 1GNHA 3LPGA 1UPIA 3EO6A 1TMF1 1AVMA 2WAOA 2DTYA 4QHOA 2ZE5A 4GD4A 5F5IA 1BMV2 1B06A 2VZRA 3L73H 4Y22A 5DN6G 3HR9A 1YC61 2V72A 3VBHB 1AR63 2QDNA 3SPCA 3ZN6A 2FMLA 4FM1A 5FMCA 4NHMA 1OQ1A 4GXLA 1BGYH 4YM3A 1ZL8A 4LF5O 4NXNO 4NTXA 5FL7G 1PK6A 3CC7V 3T0AA 1L0LH 4MZUA 4N43B 2Y4UA 3K5MA 3EXUA 3CJHB 4UV8A 1ALYA 2XL9A 4O4HA 5EBMC 1VPHA 2YC0A 1FFXA 5CEHA 3WUDA 4PLMA 2G19A 1YLLA 4JI8B 5B3SB 3I3DA 1NCQC 4OI1A 1PMJX 3CX5F 5KMGA 1S0FA 2KG7A 4IE6A 4QX3A 3S0MA 3B5LB 3RVYA 5HPOA 4N9HA 4NHYA 1NTZH 3RFRA 3WSOA 2FDFA 4CEWC 4YVWA 2A71A 3A21A 5L3BA 1W6QA 1QJX1 1RINA 1A8DA 4RUEA 5C3SA 4XZPA 2WZPP 3NL1A 3DC6A 3MUY1 3ZYRA 1IXMA 3V0BB 2YEVA 1UL9A 3MIBA 4BMEA 1XI1A 2WKKA 2XNDG 4EN9B 3R65A 2MW2B 3CCEV 1RUF3 4J80A 3IIAA 1FATA 2AGAA 4ET7A 1YJKA 2UXBB 4YZ4A 2OKXA 5C8CB 3SH4A 2W08A 3AG7A 1KKDA 3UESA 5EBWC 2VVDA 2EZPA 3H3ZA 3VBOA 4RQFA 1SLCA 3CL1A 1XNRB 2A6YA 1NG0A 3I59A 2XWJB 1O8SA 2DCYA 4A45A 1H2SB 5FFOC 2P7TC 4J10A 4H13B 2WT2A 1E1RG 3O12A 5FWEA 3FFQA 4A5UB 4L11A 1D5NA 2BE3A 4S2GA 2X0LA 5FZ6A 1VF6C 4AQSA 4JQRA 3ZYHA 2QFEA 3L70H 1DF0A 1JYWA 3NNGA 5K7PA 1SQQH 4NWWA 2OZJA 4FXGB 1B35B 3FX3A 1RFYA 1YTFB 3SH5A 3BI3A 3IKWA 1BJQA 2XAJA 2HBTA 5C4WA 1JYNA 5BR8O 2WABA 5K8SA 4EN8B 5J96B 4GLXA 1VBD1 1K3EA 3B4SA 5T50A 5L9VA 2DFCA 4GB33 4X62O 2D93A 5C5UA 3W20A 4BXFA 3B8NA 3VQWA 1G9FA 3ILNA 5F37A 2WFPA 1JBCA 3IT8A 1DGWA 2XLFA 1PGL2 5AC91 3HBZA 1VAVA 1FD9A 5I8TA 2ZGMA 2VCMA 3W5MA 3C3TA 1O4ZA 1ZZBA 5IUQA 3PDQA 1S0GA 4IV1C 1GR3A 2B1GA 4JI6B 4QAWA 4ZHQA 1PGSA 2JGDA 1EUUA 2DVAA 2NLRA 2D2CB 1GKBA 1OLQA 5LB6A 4HNAB 3THCA 1US6A 3ZFEB 4CCJA 4M4RA 5JH7A 2WO7A 1H8EG 4E4HA 1JJOA 2Q6AA 4F83A 2F95B 3WDUA 3THPA 4UBGA 1HRV2 5LL6Y 1O91A 1W03A 2P6JA 2Z5UA 4PDLA 5LCWL 1FJGB 5FYCA 1M5IA 2QTSA 5IVCA 4MLOA 1H8HG 4DUZB 4QU1A 4E9KA 2CU5A 4IUGA 2VPVA 2UU9O 4MGZE 2ARHA 1UY2A 3ZRSA 4YJ2B 1RPOA 2DYRB 5HXVA 3NJYA 1ZBA1 5HFMA 4EJRA 1PNMA 4B3MO 4GZRB 1XNDA 5BXZA 4CS3A 3IDEA 5CB4A 3CCQV 4XIOA 3EBRA 1AUYA 1CX1A 2DW4A 3MIHA 4CDUA 1NBMG 3P1IA 4AK3A 2OCCC 3PVBB 4JAAA 4IEWA 3E35A 1WLWA 3K3NA 1W04A 3MD0A 1JHJA 1JZ4A 5CBGA 4EQVA 3H9AA 1CAWB 3WQ1A 4JGZA 3FBMA 2PELA 2WLMA 2RJLA 2BSKB 5CMUA 2IM9A 2VCCA 2Y0IA 4I01A 3GVMA 3WFVA 5FZ7A 3PU3A 4CPBA 3JASB 4JX0A 3K0DA 1RUD2 3TEXA 3S5QA 2JDHA 5BMVB 2JDKA 1HB3A 1RTVA 3LB9A 4O4LB 2YXYA 3M4FA 2HEVF 4AGVA 3ZFGC 1S72V 4KMQA 1PO21 2EIKB 4EN0A 4HZ3A 4IERA 5CFCC 2WLNA 3PUAA 3ASNB 1UW8A 4Q4W1 4DZGA 4CP1A 1ND3A 2QM8A 1QOOA 3RYKA 2RNBA 1ZTEA 5FZHA 2Z69A 1T6GC 1W59A 2A6ZA 2IFWA 1Q8IA 1OC1A 1QBZA 3VDCA 5EYPA 4JI1B 1UOGA 4MVMA 4A3XA 4M0HA 1RUI3 2AXTZ 5IYDO 3WNMA 2W94A 3RWKX 2PAMA 5LP6C 1J58A 2ADDA 2VG9A 3FYIB 1F5JA 4JGSA 4ASLA 4FOQA 4QE7A 4OI0A 4BMBA 2CNAA 1QJZA 4BJ0A 2BTQA 3AKPA 3O1VA 1Z78A 2JK5C 3N36A 5FYYA 3NV1A 1W8NA 5LOVB 3KVAA 1JU3A 4EEQA 3T30A 4GA9A 2IWGB 1IBLB 1REDA 2BGCA 2VMCA 4QU2A 1MA1A 4QDQA 2EX3A 3EMRA 5LBFA 5C93A 4C1XA 3AK1A 4NIGA 3ZIWA 2Y6FA 1W8OA 4E27A 4MV2A 2J1EA 3MBWA 5EYXA 4JKMA 4L87A 1Y76A 2GNTA 4XJZA 3DN7A 4W4LA 1LECA 4XDJA 1QQCA 2E74B 3L9JT 1N4CA 3LCPA 4XQ4A 4HZFA 3ZR5A 2QQNA 2YIDA 3RRDA 1NY71 2IFRA 3V0AA 3LFMA 3LSEA 5FY0A 1TQ5A 4OHYA 4LF8O 3MFAA 3ZPOA 3E5QA 2CDYA 1YQCA 4NROA 1SQFA 2YBKA 5LXTB 4FFKA 3BUCA 3ZN1A 4Q4Y3 2BERA 3WV6A 2KKWA 3T09A 1SPPB 5J2UB 2VUCA 2DCZA 4JYAO 3OYWB 1EPWA 1H0BA 5FYTA 4FJCC 4GIQA 3WG7C 5JIUA 4XEZA 4XTMA 4PDWA 4DR7O 3CZJA 2QKAA 1WWYA 4U2AA 4XUNA 3FAVA 1UIKA 5IYZB 3ENRA 5JSOA 3STZC 4XETA 3NXSA 1XNCA 3ZRWA 2EXJA 1J59A 4K21A 1G4YB 1SDDB 1WA4A 1MQTA 2GNDA 4BQ5A 3QCWA 4JDNA 1XE7A 2A3QA 1R6KA 3OCPA 3PU8A 3AMPA 3LEIA 2Y6LA 3DECA 2HKOA 4S2FA 3BVOA 4TV8B 2AZ5A 2UY8A 4HKOA 2DF7A 1N34O 2E7TA 4QXBA 4X1IA 4KHPO 1EV13 2CAUA 5EPAA 4P9JA 1HWYA 2ADPA 3DF0A 2UYAA 1F5FA 3I49A 2W68A 4JGYB 4FLWA 1THZA 4LNUA 5EK0A 2EICA 2WS91 3EJKA 1LNQA 1H1MA 5A7WB 4LF4B 1HX6A 3VQVA 4WM7A 3K75B 3ETGA 3U1XA 3L75H 1GWLA 5CB7A 1C8NA 1IBKO 3CRMA 2XHBA 1BEV1 2J1AA 5BY5A 3U07A 4GKKO 1CZSA 2PHDA 1COV2 4WVVA 2R7EB 1S5HC 1HXS1 3VHRA 4D6RA 2B5HA 4Q0VA 4F6RB 2V4AA 3ABTA 1XU2A 3KF3A 5LMNO 4AVSA 1Y66A 4LTAA 3U4SA 1U5YA 4YJ3A 4HANA 4I0XA 3OBAA 1C8M3 4H14A 4JV4A 1GN2A 2EALA 3L2HA 4C8DA 1S0BA 2HWB3 4YSFA 4I4TB 2WC2A 1XBFA 5I0DA 4XBFA 3T1YO 4DUXA 4EFEA 4IXLA 3O1SA 3ZOIA 2EZOA 2VUAA 2BFUS 2YG0A 1RUG1 4DUVA 4YVSA 1VF7A 3FZ3A 2ARBA 4DR5O 1NVPD 4LO5B 4XMIA 4O7XA 2IXHA 3LA2A 3K77A 1H8TA 4IETA 2WAMA 1QHTA 1SLAA 4XCBA 4Z2WA 3VUOA 2RE9A 2YGLA 2MPFA 2VXJA 4OHZA 3FC0A 2ZGRA 5A6YA 3JD0A 3SHRA 4RR3B 4P9IA 2YI9A 3ZXEA 1DGRN 4OHWA 2YPDA 2ZKLA 5C6CA 3ELNA 3K08A 5LBBA 3AP9A 2HLEA 1F4HA 1F4NA 3NRUA 1MS3A 2IW5A 4HN1A 3AL6A 1G7YA 2FYUH 3CJXA 3IDCB 2DTWA 5LA2A 3WZ1A 1UMIA 4UFZA 4OVEA 2VXRA 3GB7C 4KI5M 4UCSA 2ZT9B 1YFXA 1MG1A 3LOBA 1AR73 2RQ6A 2RMU2 1XOYA 3BKZA 4YGBA 1ENVA 2C9AA 4R9DA 4LORA 4A41A 3AG2B 3NJZA 2YIBD 5CN0A 1CAVB 1VBB2 5B1AC 2DUQA 2GMEA 3KHCA 2BOJA 4BWOA 4XJ8A 5JJJB 3HJRA 4UBHA 4LHLA 4DEQA 1NCRA 1D4M1 3G71V 3RYIB 5FPAA 1FPN3 1R091 3FN9A 1MZ5A 4GX2A 3CZUA 3RT3C 1QDCA 4O2AA 1ASJ2 2WZEA 3OY8B 1AI4A 4JZGA 1FOD2 1XDCA 4IIJA 2XL7A 4X6QB 2RHPA 4DV6O 5EXOA 4Y22B 3W59A 1AHSA 4L2NA 5H9CA 1L1FA 1US2A 2VZSA 1VRH3 2EJRA 2IU0A 4PIZA 4PA6A 3OPWA 3SJBC 1KYOF 2Z2SB 1IBMB 2WLJA 1YQ8A 5DMYA 5CKMA 1W39A 1N3OA 4ATEA 5B1NA 1X8MA 3PTYA 4TN7A 1MSDA 3H1MA 1EAH3 3N3HA 3OGCC 5FKCA 3LKJA 4Y24A 4HPKA 1JH5A 3USUB 1MS8A 1N3PA 5EHDA 3WDVA 1RHI3 5A1FA 2CDPA 4BIFA 2JDUA 3FHQA 3BFRA 3IAQA 5GKAC 3SYAA 3TNPB 2L9LA 4YGCA 2RS11 1RUJ2 4SBVA 3E8HA 2ZZQA 3Q8EA 1RMU1 3T0BA 1H2NA 1PGW1 1M56C 4BQWA 4LA3A 5IVFA 3IB3A 1LESA 4PJ0Z 3N9MA 4B3SB 2IVJA 1XJAA 2QKDA 1WLTA 4H3WA 3AJZA 4CTEA 3N7KA 2WNVC 2XJQA 1JYTA 3C7HA 2J7MA 1K5SA 4YVWB 4Q1PA 3BABA 1WW5A 5FY5A 2YC2A 1SG3A 2HWE1 2QTOA 3ABLB 4FFBA 3GCWA 2AGSA 4F6EA 3X2QB 4WFBV 1I3HA 2ORZA 1RUJ1 3DXRA 2D3PA 2ITCC 1NA1B 2GTSA 1Q6IA 4YXWG 3B9IA 2ZMLA 4WFEA 3OSDA 4O4JA 2RS52 5DABA 3OGSA 3E22B 4XFGA 2UXCO 2JE9A 1OBNA 4EE2A 1GK9A 3KKYA 5GTHZ 5IT6A 3POIA 3SGIA 4DR2O 1AB3A 2PXJA 2UWAA 4LE3A 2YZ4A 2HWC3 3MGUA 3E86A 1XYOA 1E5RA 4GJYA 1JOYA 4GMP1 2G9GA 3B8MA 5IFPA 2DURA 2ADQB 1F8VA 3O5SA 2LFSA 4E4DX 1RUOA 1XHZA 4NRPA 3VKOA 4UXAA 1GFF2 3O9OA 4ZBMA 2KM2A 5IATA 4XUOA 1AYM2 2WQ4A 1VP6A 5D8AA 4AILC 4CBCA 1DP0A 3D36A 4XABA 5EIBC 5JI7A 1AL21 2VULA 2ERFA 2VWJA 1YF2A 1SQXH 2ZDIA 4Q0QA 3SDLA 4XFIA 1XYNA 3K4DA 1U0AA 1FX5A 1HRI3 3N4MA 4IYHA 5LBCA 1XL4A 4MVSA 5FZ8A 2UWBA 3FX7A 4HMZA 2BNMA 4DUWA 3OUFA 1QQP3 2FBEA 1J83A 3CCVV 4AFCA 2Z79A 3DCQA 3VGIA 5GW7A 2RM22 4DR4O 2B46X 3K06A 4I50A 2Q9LA 1ENQA 1JOPA 1MS1A 2A3YA 5JZGC 1RB8G 5SV8A 3WCSA 3JB4C 3GZTB 3CP1A 1W9SA 5I0TA 2EULA 4CC5A 4AFBA 2LUWA 1XNTA 1C57A 1SC5B 3SJAC 1J5EB 1UZWA 1QU7A 4JVAA 5IY5C 3A22A 3C2UA 3DV8A 1D5AA 5BNPC 1K5MB 3JD73 1FXKA 5FZFA 1OA2A 1AROP 1VJ2A 2C4XA 1OLRA 1SFYA 4FBFA 3G6EV 4RS5A 3HKEA 5A3WA 4WVMB 4AF9A 4FPHA 2JE7A 4YNIA 4DV2O 1JOJA 5HBAA 1HDKA 5E89A 5JJNB 3M8LA 4BU2A 3ZDSA 2TNFA 3M8AA 3NVCA 2JJ2G 3I8TA 2WR9A 5EBLC 3LEMA 1JFFB 4UCOA 5J9PC 3R66A 1ZZ7A 2XJVA 2OZ6A 1S5JA 1Q81W 1BK0A 1HNZB 5C9AC 4K6BA 4LEJA 4B3TB 2WLKA 1AR4A 1VALA 1IPJA 4HG6B 4WM8A 3GJAA 2V4DA 3POYA 3K46A 2VBBA 3K5NA 2JEXA 3WDTA 1IDSA 4DV3B 3ZFFC 2UWCA 1WNSA 4MVOA 3CEWA 3EB7A 1WCUA 5FLJA 5CB4B 2A6VA 2W39A 2MHFA 1RVF2 4P9LA 1JZ5A 4FPJA 1VBE3 1FV2A 2XBO1 2E9QA 1P4RA 1QNMA 3ROUA 1PNKA 2QGNA 1RM1B 4CEYC 4PIXA 5BPXA 3ETEA 2XAQA 4JAVA 4NKGB 4FFHA 1PD3A 1MPXA 1V54B 2BYVE 4X64B 4XBLA 1Z0HA 4TZDA 3U10A 3VBSC 4BM8A 3LDEA 5F8PA 2VBPA 1K34A 3LDBA 4UCTA 3E8BA 1VQ9V 2BVBA 4EWDA 1MVEA 3NNLA 1WP7A 4DV5O 5BNOC 1W0PA 4MG2A 2EIDA 3JAKB 2J22A 4F3JA 2FCTA 1UFIA 4EV0A 1A6CA 3SCGA 1POV0 1DZTA 3M99B 3IBMA 3H8UA 3HEIA 4EN6B 1QOTA 4CH6A 2WLIB 2D6NA 4YW1A 1RIRA 5LA1A 4COWA 2LW8A 4NVPA 2FDJA 4C0BA 3WLUA 3G4SV 4LO6B 3B2EE 4LH7A 3OGVA 3UGHA 3S6PA 5GLZA 4B4PA 3MAQA 3HB3B 2ZGNA 4QKNA 3PIJA 3GZAA 5JR7B 3ZSJA 3PUIA 4Z82A 2JWPA 2BZDA 3I2HA 4HVRA 2BTQB 3DTUB 2UXNA 1MMMA 2QEXV 3JARA 5JJEB 5FZ4A 1W6OA 5FMBA 1VAMA 4X88A 1E5HA 3O14A 2YC4A 1PX3A 3WW1A 2WJSA 4URAA 5C7GA 5T54A 1SQBH 4AEDC 3HNBM 3ABMC 3F5WC 1QHDA 4BW5A 4O9EA 2UXXA 5JXJA 1G9AA 1NE4A 2QQPA 2GN7A 1BVP1 4RQPC 3BTAA 3VDDC 1N47A 3VBUC 3OMNB 4HK8A 4KL1A 1JA8A 5FREA 1X36A 3VDAA 1AR62 2RV9A 5DUUA 1AILA 1YI9A 3POWA 1G9DA 5IYYA 4TWKA 1E5IA 4CDQA 1LHWA 1UPGA 1D2SA 5CVRA 4COVA 3HR0A 2YFUA 1O6UA 2Y38A 3G80A 3NJXA 3SYQA 5FZBA 3RG0A 3NV3A 1R3LC 2W1QA 4R9AA 3RZKA 2H3OA 3TEZA 4N53A 4QM8A 1B3QA 3WNPA 3PJQA 1ZZCA 4CDWB 5ABJA 3HVDA 2CK3G 5KXEA 4NOTA 2WSSG 2VOWA 1AZDA 1QNWA 3E6CC 1SLBA 1DLBA 2JENA 1KS4A 4CCMA 5BY1A 5JAXA 2ZX0A 3N9OA 4FMTA 2DWEC 4YY3O 2Z4FA 1QJX3 3FAVB 5FMDA 3KHBA 1IG3A 3B94A 4PLOA 1KDMA 3DXTA 3ZRWB 5A33B 1KBHA 1UKRA 4QPGC 3OTFA 3I2IA 5CFDB 2N7GA 4LHKA 5E79Z 3PUQA 4MVTA 3AYAA 2QTWB 3M7MX 1MZFA 2EINB 1EP0A 3HKCA 3AK2A 4JAUA 1RUF2 4D69A 2WDBA 3OBRA 3TXSA 5J2TA 1EBOA 1XSRA 4OHVA 4CP9A 4AZZA 4O2BA 4UVCA 2AZ0A 2VAUA 1W2NA 4IV1B 1JYXA 1RITA 3AFGA 4MGSA 4XF0A 1DTOA 2BP6A 4EB6A 1VQMV 1BHGA 2GP3A 1N33B 3ZHRA 1MS5A 3WF0A 3KB5A 3JXSA 1PO11 2WZR2 1YFYA 4XHBA 5KLVH 3HT2A 3VBHC 1LOAA 4HETA 4GZ9A 5FOJB 1QR8A 1NCQA 1VB4A 1UNBA 2YMZA 3W7UA 2XUMA 2VW0A 4PDMA 2WIIB 4ZY9A 4XE9A 4O61A 5JVVA 1S0EA 5CA0A 1ODMA 4LQRA 3S57A 2QWNB 3WNLA 4FLTA 4UFHA 5KAIZ 2VNOA 4NAMA 1W8HA 4CEWA 2WL1A 4Q20A 3OD4A 4N43C 5FDBA 4QPKA 3ZYFA 3FBYA 3U37A 3ZYPA 1VBD3 1KP3A 4I7ZB 4DXWA 3UT5B 4K9SA 1ZWIC 3IPVB 4FQZA 1KC8W 4PQ9A 1Z7S3 1K4CC 2VNGA 3VB9A 3ZIXA 5B3SC 2VY0A 2P3KA 3ZXFA 3BPZA 4GB32 4BB3A 3P30A 2ZHNA 1PM9A 4BOWA 1HB1A 3L74H 2QA4V 1EM1A 2BFUL 4X62B 4NIHA 4JDOA 3THTA 5DECA 3EVKA 1KEXA 4GKJO 1S1AA 3POSA 3J7LA 3I2OA 4IE4A 5FYZA 2XPJA 3WG3A 1NQTA 2LO1A 2VTFA 4YWAA 2IUWA 2KD7A 5C5TA 2JDMA 4FVVA 1EY2A 5IK8A 3LGRA 5IAVA 2CV6A 3IN9A 2QWOB 3B02A 4W50A 3P32A 1ND2B 3UO2A 3RGBA 2F4LA 4A42A 3NKTA 1XMOO 3VBFB 1J1TA 1RJ7A 1UX6A 1N32O 4LFBO 4AI3A 3HIFA 4HSJA 1JMUB 1GOGA 1POV1 1VF6A 4GX1A 4IEVA 3SXWA 2E7QA 2BW8A 2TBVA 5A1AA 1FYJA 4YG6A 5C8CC 5A3LA 1YRZA 2G1MA 2JX9A 1G6UA 3ZFGB 4TLFA 4V1PA 2CH7A 1SCSA 4LF6B 2IJKA 4BQXA 3AYCA 1ZREA 4BE3A 1LUWA 2YXSA 1M90W 3AJYA 4FAHA 2IH1C 1ZBA3 1TUEB 3E83A 4PIYA 4Y4RA 3WP4A 2HVJC 3W7WA 4GUNA 1H2GA 2VC9A 1US3A 1I1EA 1TAEA 1B35C 4Q4V1 1KRIA 5LP6B 5B4XA 1SETA 4AGGA 3SQOA 4ZU4A 3CC2V 3KCXA 5J36A 2ZE6A 1PP9H 3OF1A 5BV6A 1XNQB 1Y9MA 2ZD9A 4IV3B 3MLLA 3JBG2 1XOUA 3MLJA 2F4VO 4P9GA 3TWIA 2X7RB 4BK4A 4V2VA 1ULOA 4UFKA 5F2SA 2PF4E 3OMIB 1YVWA 4CU9A 2JG9C 4LR3A 1OPMA 3Q8BA 1APNA 4QB2A 3PIGA 1T2XA 4XURA 2XJTA 5EJ3A 5GJ6A 4PT6A 2DWRA 4GWMA 2XAGA 5GONB 2VZOA 2YGMA 4A2UA 1YQ2A 4I0BA 2OVUA 1PO23 1AJQA 2XB6C 5JXGA 1DCSA 3RZJA 4Q4W3 2XUEA 4LBEC 2P3IA 2XJRA 4X66O 5C3QA 5FMOL 1CAUB 4KH9A 3ZFEC 3CBNA 2DBNA 2ARAA 4XUTA 1N3QA 1JX9A 5F1RA 4ZKIA 4LUKA 1W06A 3RYCA 3TOJA 2H0VA 2BEOA 3CQOA 3L2YA 3RYRA 2QSAA 1DU3D 2B45X 5C33A 2GNBA 1RUI2 2D3SA 2NNUA 2VQEB 4DRXB 4LF9O 2Y48A 2W2IA 3ABKB 2D3RA 4R52A 2DN9A 4DR6O 1TVKB 1M1KW 4RN5A 3MLKA 4MTOA 2Y69B 2QVSB 3N35A 1OA3A 4ZOLA 1I7FA 1UZYA 2A73B 3GYDA 2DYRC 1FV3A 4GJZA 1COWG 4IESA 2ZEWA 4X20A 2RVAA 4Q4X3 5FAXA 1PV0A 2LTNA 1OVSA 1K12A 2O57A 5FPOA 2ZEZA 3MW2A 2LRPA 2XTAA 3Q4HB 2PHLA 4MS2A 4E2SA 2RDRA 3ZJZA 1XSQA 1EN4A 5IVJA 3WY6A 2XDVA 4FPLA 4BA6A 1C3HA 1JZ7A 4QB1A 4I9QA 3M2MA 4DW0A 4S2DA 4MXWA 5HXMA 3MHZA 4HL0A 4LF8B 2VM9A 4TT3G 4KBBA 3RYHB 1BQZA 3CD6V 1SCRA 4Q4Y2 5LASA 4LT5A 5BNNB 2WFF1 1EFRG 1XMQB 5CZKA 3APOA 1UZVA 4AQ2A 3UCSC 5CKNA 3QG5A 4UB6Z 4YHHO 4AI0A 5DAPA 5KUKA 2ZIMA 2EIKC 2ZQMA 3HPNA 4JYAB 2O8OA 3ZMOA 4Q0PA 3ASNC 3MUZ1 2ZGTA 5DDJ1 3CIHA 1HQWA 1W6PB 1NJIW 5T52A 3QF7A 1M9NA 3K3WA 3POFA 1NVPB 4X1KB 3GNEA 3WG1A 5L3GA 4Q4Y1 1H2LA 4ES8A 3FLPA 2BU9A 3T4HB 5H2FZ 5DZGA 3OUJA 1MOFA 5L9RA 4PCRA 1CD3G 1SLIA 4OZOA 2X09A 1K7DA 1UMHA 5FBJA 2X53S 4K1YA 4MH0E 5HCBA 4JI4O 4YLZA 3ES4A 5AVPA 1EV12 5H9RA 1CPNA 2WS93 1N1YA 1WCKA 1YXWA 4RS5B 3MIGA 2D7FA 1PZ7A 3ON7A 1O3TA 4LFCB 1LJ7A 2B42B 3MHSC 4B1LA 1SS3A 1IBKB 1NI8A 1JYVA 1HXS3 2RJKA 4CDXA 4QKDA 4K8RB 5JQGA 1V0AA 2VZQA 2HHHO 1GZCA 4OLLA 1BL8A 3RZMA 4X8NA 5KR7A 3BCCH 3ABZA 4UFLA 5LY1A 2WNUB 4CXWA 1SFPA 4QM9A 2F1MA 4DQAA 2WWWA 1LEDA 4FPGA 2Y34A 1D4VB 4AOCA 2ITDC 1YI7A 2EXIA 4URTA 2JVDA 3LZZA 5B4NA 1C8M2 1E57A 4XQWA 2D6KA 2R30A 4LKFA 2HEPA 5CYYA 2RR13 4CUGA 1K33A 2HWB2 1D0GA 5LGNA 5AVAA 1W9TA 1RUG3 1YHFA 1L0NH 3H1YA 2A70A 4Q8KA 2CGPA 3E2EA 4RYDA 3HN1A 2Q5ZA 1UYYA 5F6LB 1D0HA 3W9AA 2C1FA 2AHYA 4N9IA 1YHQV 3JCIA 2Q8OA 4DV7O 1NR7A 4NPRA 4XF3A 1RUH1 2D6MA 4Q0SA 3ZR6A 1UY1A 5A1LA 1M4WA 2JKBA 1N0JA 4GH4B 4DXTA 1A8MA 1SLLA 4ORFA 2QWQB 2XOMA 1ZX3A 4K0KO 3ZBHA 4KNCA 4ZPIA 4EYUA 3AZWA 4XUQA 5FZOB 1NX9A 3UETA 4O4IA 4JGYC 2ODMA 2ZA9A 4K8FA 1C1FA 1OXCA 1CEZA 2YXHA 3D3IA 1X7NA 3ML0A 1NU1H 3PVNA 1EPZA 2YV8A 1ZUQA 2OCHA 2WSVA 3E6BA 1UMZA 3UJQA 1VQOV 4BIZA 2K0GA 4QD2A 3QO5A 2AENA 2ZZJA 4JHTA 2ZGOA 4LWSB 2AH2A 4QGNA 1CPYA 1QF3A 5FY4A 4BH9A 1AR72 4AEJA 1W8TA 2VZ3A 2OPKA 3IDAA 2W87A 1K5JA 3H42B 5E1AC 1VIWB 4K20A 3DSQA 3MEPA 3EHBB 1X82A 4MO3M 3JARB 5J37A 2AC1A 2WNVB 4J1WA 1OCRB 1R093 4FTBA 4KGQA 4TOIA 3AP6A 4DNYA 3ZHVA 4TXWA 3HN3A 3NAPB 1VMHA 4FFFA 2ZR3A 1FPN2 5KXBA 3SKVA 4AFDA 1AX2A 3EQEA 3AEIA 2FQPA 2R0FA 4ASMB 2H94A 4X8AA 1VMFA 2UYBA 5FYBA 3L72H 2QQUA 4DV6B 3ETPA 2W46A 1VRH2 1GWKA 1XYPA 3CEIA 4YIOA 2P06A 1JZ6A 4WBBA 3ECQA 4M3CB 1HNWB 1LEMA 3AP5A 4CDQB 4NWVA 5IJ0A 4Y5TA 2ZHKA 5CA1B 2IJJA 4CCLA 1W99A 1DYPA 1EAH2 5HCAA 5C3RA 4BLIA 3CMEV 1HW5A 4Q29A 3KF5A 4DPNA 2RS13 5DN2A 4X89A 1BBT3 4RR3C 1RMU3 1RHI2 3N7LA 2P4VA 2JG8B 3K2OA 1R64A 2ZHLA 5LW9A 5C70A 4UW4A 3MYXA 5T5PA 1PVXA 4PQQA 1XUQA 4CU7A 1DZRA 1VRH1 2VW2A 3ZN5A 3OEHG 2ZM6O 3ZCCA 5F2VO 4CC6A 3M70A 1AR93 3H8XA 4N90A 4LULA 3D3AA 3KZ4C 2VOTA 1NTMH 2R32A 4ZKTB 5JLVA 2HWE3 1PNLA 3U11A 4XDPA 1W0JG 4PA3A 4I09A 5C3OA 4QHBA 2WAAA 3JALA 4ZHNA 1VQLV 1N0NA 3CCRV 2ZKNA 2HWF1 3H1WA 5T3NA 4ZI7A 5GZEA 1ROPA 3OB8A 1XNAA 1SBFA 3R4SA 3AG2C 2P5BA 1LHOA 4FPCA 5IVBA 4NRQA 4RAIA 2GP5A 3T4ZA 3K04A 1VARA 3SNMA 2NMOA 4BIUA 4OX9O 5CU1A 4Y1XA 3CJIB 2P5OA 3J81N 2DMXA 2EXHA 4QE9A 5EQUA 4DV0O 2EIEA 1ZRDA 2VO5A 4KQ7A 1PVC1 2QBXA 5DPNA 4GMP3 1W3XA 1N1SA 2DQ3A 4AHZA 2VE1A 4CP2A 1C28A 2HWC2 2QQJA 3HKBB 5M0TA 2YB7A 4Z1VA 4DUYB 3UYJA 1W8FA 4ES9A 1HNXB 2P90A 4YW4A 1NT2B 2EXKA 1QXPA 1IX9A 1RUE1 2OUHA 1Y4MA 2VMEA 2O0OA 3KGZA 1PIV1 1WA8B 1AL23 4B7EA 2JIJA 2ATFA 1P49A 1XHXA 2JB8A 4X1YA 1Q8PA 2JDZA 1XL6A 1XQNA 4XDKA 4RHV3 3GXUA 3AMMA 4IEPA 1HRI2 5FNVB 5E16A 2DVBA 3D8CA 1CJPA 5A6XA 1QQP2 2OPWA 1GN4A 3RNSA 1GNYA 2P37A 4OQ8A 1IVSA 2KQXA 3TBDA 2VOVA 4UW6A 2IXCA 4XACA 4OHXA 3WNKA 2VS0A 5ANQA 4BK5A 1XXNA 4QQLA 3I55V 5I0RA 1G86A 5JXIA 2GHYA 5FQ0A 3J8F1 2HJDA 2MEV1 4DK1A 4X6RB 1SLTA 4YVWC 4GULA 4ARYA 3NW4A 3MICA 1CPMA 2XKOA 2F43G 5H9PA 4A3ZA 3ABLC 3WF1A 1JHNA 2XAHA 3JD72 1DF4A 2AEYA 3JATB 1CAXB 3VD4A 1WMXA 3X2QC 2Z42A 4LR4A 3VBSB 3I3QA 3RN4A 1JODA 3WF2A 1NA1C 5BZBA 3WCRA 3RWRD 2R1DA 3BPSA 5CA6A 1KITA 5FO8B 2VWKA 4AQYB 5ITZB 1LB2A 2CWSA 5JPMB 3T3YA 2QJ1A 4D0QA 1L7RA 4DV2B 5GZDA 1HB2A 1IKPA 3JQXA 1JUIA 1EN6A 3T2MA 1JI6A 4Y20A 4JYYA 3J7AU 1O4YA 4UCVA 2ILMA 2A75A 4B4QA 3INAA 2WA4A 1SHWB 3M1HA 1S4CA 3HD8B 3CPWU 4JI8O 4IGOA 1UU5A 4LBNA 4OXSA 1V9PA 2E26A 4W6XA 3SH3A 4G27B 2AUYA 5JZGA 3VHNA 4AAPA 1M57B 4YYOA 2JS5A 5F3GA 2XT9A 4RGKA 3AXEA 2XBO3 4P9XA 1UY3A 1AP5A 3FMGA 4DMIA 5BNPA 1VBE2 2AACA 2A0LA 4P02B 1FXZA 3RZLA 2BNOA 1GTOA 1IZ3A 1GM7A 2PA7A 1RSOB 3OEEG 4E4SA 2GTAA 3ZMUA 5GLTA 5D5PA 1V55B 1CN1A 1VMJA 2H6CA 2UXBO 1PZ8A 3CMAV 4C7UA 4I9WA 3NNFA 1W6NB 1WPXA 1D7PM 1VQ5V 4QQ2A 1VQNV 5FLHA 4WBNB 1TG7A 1S0CA 1GBGA 1K5MC 5DUXA 4OFGA 5A32A 2BVVA 3N9NA 4BCUA 3VBRA 2ORXA 4QIWF 5C9AA 1ZYBA 4HONA 2A7AA 1O9GA 3CSXA 1J3PA 5T5JA 2OW4A 5HV4A 3GHMA 3I2GA 2A79B 3WHTA 5A3UA 4NO4A 2JE8A 2Q1FA 2QQWA 4PBPA 5EP9A 2AREA 2XAFA 1ZBE1 1BSMA 4IGGA 3VD7A 5A3PA 5C71A 5B1OA 4Z07A 3ZFFA 3ZMVA 1KU9A 5IJ9A 2V5YA 1TUBA 2ETEA 1GZWA 4A44A 3BYWA 3PUHA 4QX5A 4XJAA 2R70A 3U4XA 5F9TA 2XXZA 3SMHA 4A6SA 3AZVA 5EC2C 3MI8A 1R1A1 4LIUA 3AG3B 1E1QG 1TMF2 2W1WA 1UOFA 3GBGA 1Q8QA 3JAWB 5EZYB 5H6RA 5DQ0A 4K8ZA 5BNOA 5FO7B 1SDWA 2E33A 2ET7A 1UJWB 2ENRA 3RMYA 1WAZA 2QQIA 2TUNA 4NN0A 3UV9A 4JI6O 1QEXA 1RM1C 2QDRA 1UXZA 3K3OA 2JJ1G 1PHMA 4D6TH 1GWMA 2EILB 1PKXA 1ULCA 1V54C 5C8YA 1Y74B 2Q7GA 1QIQA 1NQDA 3P3NA 2WWJA 4MXWB 4BYYA 4YIPA 2PYTA 3AZXA 4HYOA 1NZCA 5A7QA 1OF3A 4UCRA 1L7LA 2P1BA 3BY6A 3C7EA 3WNXA 3PL0A 5FUIA 1F4MA 2D40A 4OYUA 3HAGA 1MABG 4RL7A 3C3SA 4M01A 2NYYA 1I5YA 4Y4YA 3IWZA 4QX8A 3NQHA 3IJ4A 1F15A 3GM8A 4HFSA 2NPIA 2DCJA 4NR1A 1QJU1 4CPBD 5K4LA 1QJX2 4NRMA 2YUEA 4WZFA 5K0UB 5LZ6A 2BBAA 4AEDA 2Y6HA 2A5ZA 3WU2Z 4FZ1A 2WQZC 1LOEA 2KR2A 1W2UA 5A9GA 2XVKA 4LBKA 2W6JG 1W8WA 1IPSA 4RQPA 4A6OA 2VQUA 3VDDA 2PY5A 3OMAB 3VBUA 3QD6A 1W0KG 3LDKA 1JUHA 3FHAA 1O4TA 4I0WB 4K7JA 5JWPA 3WB0A 3SEEA 2ZXWB 1IS5A 1TEIA 4LBQA 5LA6B 1O9HA 1WMDA 1XU1A 3ALQA 3L71H 1W6MB 4COZA 4HK9A 2RS33 1PO13 4H37A 3FJSA 3VZMA 2GUZB 2YXLA 3ZXKA 1NYWA 3DXUA 3NWKA 5D21A 3SPIA 2ZE8A 4IE0A 5B1BB 2BNNA 1YYNA 4EZHA 5BNQA 2N05A 5DUWA 4JI0B 3KMHA 3Q8CA 1J84A 2QQLA 1ZRRA 3UGGA 3PHMA 3VL9A 1Y4WA 4JI1O 3OW2U 1OUXA 3LEGA 1VBD2 4XXAA 1N8RW 4QPGA 2FDHA 4A4AA 1UYZA 1Z7S2 1JPXA 4CDWC 4U3JA 1V00A 1S2KA 2WLQA 3HKDA 4I55B 1OVPA 4UF0B 2WT1A 3RZGA 3ZIAG 2F23A 1H9PA 1POQA 5AC92 4P2ZA 3S3XA 1IBLO 2JEMA 3A0KA 4FO9A 3V56A 3N2KA 2PZSA 2BUKA 5IW0A 4BAYA 4JV5O 1HV0A 4CH3A 3WB1A 4E8CA 4XFFA 3ZSEA 3RYFB 3TYJA 3C7GA 5CFDC 4WVZA 1AJOA 5F7UA 4BWAA 2JG9B 4AFMA 1Z7S1 3N9PA 3UKNA 2UUBO 1POV3 2W0FC 1WZXA 1XMOB 2EINC 4CXYA 3VBHA 4AEMA 1N32B 2ZABA 1W2TA 3SC7X 2VMFA 5B66Z 2R043 2B4KA 1GAXA 1UOBA 4TV9B 3TB0A 3ZX7A 2SLIA 3LWCA 2WN3A 4J9YB 4N43A 3AZYA 4MVZA 1PMIA 3CJHA 2QZ2A 1FI2A 3KV9A 2WWSA 2JXAA 1Q6HA 5LK7B 3ZN0A 1LOFC 1ZBA2 1WCQA 5G05L 3O0WA 4Q4V3 2R49A 1NS1A 3JSLA 4WFFA 2UUAB 1SA0B 1YIFA 2F17A 3BU0A 3M3IA 4LO4B 3RJRA 2OWOA 1URXA 5FP9A 5F5QA 4NE9A 4AI9A 4CU6A 4NIDA 2M6YA 4L0PA 2BGPA 5A7PA 1RPRA 1VQ7V 5L9BA 3C7OA 4OI4A 1YEWA 1QJEA 4I5SA 1OKQA 3V0BA 2VVEA 5TSWA 1TE1B 1TVGA 5K1XA 4FCAA 4YG0A 1MS4A 2UURA 4LITA 4EFBA 1U5XA 4CCOA 4RQEA 3CDZB 3AMHA 1QVGU 2V73A 2CGNA 3VKFC 1UOJA 2E53A 2E32A 4WZCA 5C8CA 3ASIA 1RGSA 1WCDJ 4YM2A 1OCZB 2X5IA 3KD4A 3ASOB 2Q5TA 5L7OB 1NUKA 1PO22 3GBFA 2WLLB 1VQ8V 1ND2C 1B09A 5FXVA 5L3CA 1QGLA 1REFA 3VBFC 4Q4W2 5A3OA 4JI7B 1O59A 4DEVA 4P5HA 3AXDA 5A3TA 4F4LA 1EZJA 1OSGA 1WKYA 4X66B 4Y33A 2OT7A 3D0JA 4AYUA 1PNFA 2G38A 2ET1A 1N36B 1YQ6A 1B35A 1NT0A 3ZXGA 1I5ZA 2AW9A 2CHHA 3MFCA 1S77D 4LLOA 3JAMN 5JMCA 1DQ0A 2Q8CA 4ARXA 2LQTA 4JKKA 1KJRA 3KCYA 3B00A 3MW3A 1ZX5A 4XILA 1F23A 5TISZ 1HR0O 4AEKA 3LSDA 1OURA 2GDSA 4CP0A 2A7WA 4JDMA 1GZ9A 2DQ0A 2A6WA 2H6BA 2Z0AA 1GQGA 1RL3A 5LGUA 1AJNA 1URFA 5EJ1B 5JCOA 2QNKA 4X9QA 2P6HA 4MGYE 4H33A 5A3NA 4LCUC 3I3EA 1JXNA 1W90A 4IV3C 3RSJA 3OUIA 1IHMA 3LPFA 3CS5A 1Q8OA 1YI2V 4TWTA 1NY72 2I45A 3OPZA 2VQFB 3VKMA 4KFMA 2LROA 4ZXKA 1BYHA 5EV7A 2RN9A 4OCTA 5A70A 3K03A 4CRQA 1OMIA 5A6QA 3OGIB 4AVBA 3ZFEA 4FXKB 4AG4A 2WFF3 3AYDA 2VU9A 4Z2AA 4Q4X1 3WW2A 1OOPB 4CCKA 4QPIB 2JD9A 2GMMA 4XQDA 4ASKA 1C5IA 4B8EA 2ADEA 1JCHA 1FMD1 4NPLA 3THDA 3J80N 3TRSB 3IC7A 2HFEC 1H1IA 3SKJE 4E2LA 5DDJ3 4YHHB 2HP8A 1UWWA 5FPVA 1BKZA 1SEFA 4K35A 1UPSA 3MO4A 3GWOA 4J11A 2PLV1 1GMMA 5F5CA 4CA9A 4YJ2A 2IXIA 2DU1A 4ZZ5A 3LA3A 4TUYB 4PDRA 3JD3A 5KXCA 3F7YC 3DL3A 2E5LB 1JYCA 4MTFA 3O1OA 1KFUL 5FPUA 4PA7A 1PMHX 1ZLZA 3POBA 2YU2A 2IJIA 1AP6A 2VBDA 1I5PA 1V6MA 5ISLA 5FPLA 5KUMA 3ABKC 4FPPA 1OCCB 2X6CA 4N23A 1A3KA 3ZXDA 4DO2A 2VCBA 2Y69C 5JOXA 5IK7A 4LOSA 4X8PA 2BSKA 3A4UA 1IOAA 1CWPA 1KMIZ 2R6QA 3JASA 4JI4B 2XONA 3G67A 2OIEA 4W4ZA 5A7OA 3PVOA 2WS92 4C91A 3K51A 3FUOA 2Y6GA 1F4AA 4LFAO 5BMVA 2JD4A 1GYKA 4MHRA 4O4LA 1BEV2 1SACA 1AXYA 2WLHA 1IBMO 4MGIE 3N2GB 3BA9A 1QDOA 4XXPA 4XF1A 1HXS2 1QU0A 2D3OW 5FPZA 1RUC1 5JIAA 5A7NA 5DAXA 1Q8VA 4XDQA 3SR2C 1OFSA 3RPQA 2HHHB 2FB5A 5FXXA 4RA0A 2JKXA 5JSPA 1CONA 5BNNC 2JS3A 1JW6A 2CSGA 4GWNA 4RGAA 4DW1A 1GH6A 1V9U1 4GMP0 4NIIA 2PAKA 1STMA 1LHUA 3O65A 4B3SO 3OE7G 4K3AA 4NXMO 3RI9A 2RR12 5KX5B 3RS6A 3BB6A 4D6SA 5AFEA 1N1VA 3DYPA 5LOVA 1RUG2 3VV1A 2ZHMA 3BOPA 2ETNA 3UQ8A 1JYIA 1VBA1 2X8KA 4LMFA 5SV5A 4QGLA 5FP8A 1QVFU 1WMFA 1RUH3 3PN1A 3IM0A 1WN7A 4FP2A 3FD9A 4BQ1A 4CCNA 3HQRA 1U5ZA 4JZRA 1SZXA 1DGSA 4MADA 4QX1A 4JTAB 2R063 2RR11 4BHPA 2PAEA 1AYN3 2YPJA 1S2BA 2DJVA 5IWFA 3CKHA 1AF9A 1ZM1A 1LGCA 3VZNA 2QWPB 5IVEA 1FXKC 4HAMA 1V70A 5A32B 4Y3OA 2VNVA 1YUDA 3VBRB 4YGEA 4H7LA 5JR2A 1WD3A 2WWUA 2ZR2A 5LRSA 1Q90D 4RS5C 1KS5A 4M3CF 1UKGA 1YJWV 5ACA1 4IHJB 4RFT0 3G6JB 2JIZG 1SPPA 5LBEA 3BTZA 1QCEA 1QY4A 5J2UA 3CRAA 5FZGA 5KHGA 5EFUA 1IGOA 3DC5A 1H9WA 3UNPA 3H3UA 2F4PA 3H1HH 3UL2A 3C8XA 1I94B 3A8TA 2Q69A 3MIFA 2IXKA 1QOSA 1KKCA 5IYZA 1D2DA 3B3QE 2WNUC 2ZX2A 5IVVA 2RCVA 3K58A 3L9DA 2FMYA 4O65A 2R9IA 4HKWA 5LYJB 1UF2C 3JCUZ 1D4M2 4COYA 5DAQA 3KM5A 1SQVH 3OR6C 1RYYA 3H7JA 1R092 1WGPA 3DPRB 5JVDB 3OUSA 4XBQA 5LHIA 2A3WA 1J5EO 2DBIA 5A3MA 4TV8A 2CTVA 1R1ZA 3VKLA 1K92A 4JTOA 2HVKC 2JEUA 5FY1A 2ZE7A 2J1SA 3CRCA 1ST8A 3AZZA 3DEMA 3QVNA 1MR5A 5FYMA 1CESA 2W91A 5LBQA 2NM1A 5LWBA 2VECA 4JGYA 4H55A 4LKSA 3KQRA 4COUA 1YCIA 4QB6A 1DF5A 4GWJA 3A23A 4PD4F 2VGDA 5JXHA 5A7WA 2GC0A 1LCLA 2SBAA 1IKQA 3OGRA 4GH4C 2YHJA 2QQKA 2A06H 3S5AA 4DRVA 2AR6A 4DR3O 2A6XA 3KSCA 2ZTNA 2RS12 4MGKE 1BBT2 1RMU2 1PGW2 1HNZO 4KBZA 3ZN6B 4F6RA 1U12A 2LW7A 4B3TO 3B01A 1F2NA 4IE7A 2W0XA 3BU7A 4U36A 4DS0A 3LNNA 1PNGA 1ZL8B 5L3DA 1WB8A 4CXXA 1Y6XA 1FKAO 5H5NA 1AR92 1Z5VA 3M3OA 1PK6B 1KFXL 2GNMA 3WVJA 1CQ9A 4OUSA 1MZEA 5G04L 3FB7C 1OHHG 2HWE2 2DVGA 2VUJA 4O4HB 2HWF3 1FFXB 3CWBH 4BXSV 4TYSA 4I4TA 3LD8A 3CHXA 1BBT1 5FXZA 1SRYA 1RVF3 3KV6A 4KU7A 5KMGB 5FK7A 2KG7B 4MXVA 4IEOA 3CRQA 2HEWF 3KT7A 1PZ9A 2ZGQA 1UQXA 1Y67A 1AR91 1PVC3 3LA7A 3TJTA 2QKSA 1AR81 3LE0A 1OCRC 1W6QB 4Y5Z0 3D3QA 4OI2A 1K42A 3BHPA 1OZ0A 3NAPC 2NP0A 3RMXA 1VE0A 3OR7C 1UAIA 1AXKA 3CCJV 2YEVB 2EJ7A 4C0HA 2Q0OC 1RUE3 4CZZA 4YPJA 1G9CA 3KS7A 1PIV3 2BBVA 1OD5A 3KG2A 3BODA 1YFWA 4Q27A 1KQSU 1KP2A 1QJY3 2L35A 4LOTA 3ZYBA 1TME3 5FZ1A 1AL22 4WF9V 4JI5B 3H0OA 3KV5A 4UT5A 3MHHC 1C4RA 1XRUA 1V6JA 5CISA 5F6KA 3WINE 1AX0A 5A7SA 4CDQC 4HVOA 3VBOB 3APBA 2DYSB 3BA8A 4AE2A 4RHV2 4QKBA 2Z5WA 2R72A 3JCZA 3I59B 4JYCA 4GKXA 1WLEA 4XAAA 3WF4A 3AMNA 2JG8C 2PTMA 4MVRA 5FZLA 4I3GA 4JI3B 3HNYM 3C90A 1OQEA 2Y0OA 5IAXA 3J8F3 4LXLA 4P08A 3G6BA 2MEV3 1CAVA 4FLYA 2JDIG 2ZGLA 3ES1A 2VMGA 2NQYA 4TQFA 3U0ZA 5C4WB 2M7WA 4RHV1 4FPFA 3B9CA 3RYIA 3URFA 5K9YA 2D97A 3ACFA 3FWEA 5LEJA 1R081 1H8VA 2PUSA 4UAPA 3BALA 1GOHA 2X10A 2N04A 3OY8A 1R6NA 5KHIA 5IJRA 2Y0PA 2ZNJA 3ZSMA 1QH7A 2VTXA 5LHHA 1WLDA 4IEYA 4DV1O 1UN1A 4BW9A 2IVIB 1NXD1 2NN8A 3M7AA 4QDSA 5FO9B 3CJIC 2JGUA 1OT5A 4ZU5A 5DXDA 3HQXA 5LA0A 4J41A 5J3UA 1AVBA 4ZHQB 5F32A 3POGA 4L99A 3TN93 1JTZX 2JGDB 2TEPA 3USUA 1HJGA 1BMV1 3SPHA 4W6WA 1H38A 1SF9A 1KECA 3FLRA 3SCHA 2UXDB 3IMMA 1HW7A 3UKTA 5FZ0A 1Y7BA 5JH7B 3UKVA 2PHXA 3B7MA 1FT9A 2V7QG 4DOUA 1J3RA 5FY9A 2YBSA 1SFNA 1HN1A 3ITQA 4XF9A 3CU7A 1R3KC 3I3MA 1H4HA 3ZSLA 1HQLA 2XBO2 1ONAA 1BK1A 3MPBA 3RQ0A 4AHCA 1JOBA 1UD1A 5FPRA 4QT6A 3CMGA 4XJ9A 2CDOA 1L8DA 3KT1A 4PLNA 3NNJA 5FRAA 4GX5A 1NA1A 4UFIA 5CAZA 4IQPA 4Q8LA 3TEWA 3F95A 2VZPA 4TSFG 5CG8A 2IXJA 1GM9A 3E22A 3OTOB 4CDUB 1UZZA 4B3RB 4NIAA 4LBLA 4U7OA 4D3WA 3NJVA 4UB8Z 1HQNA 1NKGA 1EN5A 5LK5A 2XASA 1ULDA 3W7TA 1ZZ6A 3ZDVA 2X5IB 3TXQA 1WBFA 4JGZB 2YFZA 2UUCB 1N33O 4U7NA 1CZVA 5JSRA 2D6OX 3LSSA 2ZACA 2WZR3 2C26A 3ZM8A 3WF3A 1ZBE3 3STLC 2FZ2A 2J1RA 3N9QA 5L3EA 3E97A 2Y60A 4DO0A 2J42A 3K57A 3WQBA 2PQQA 3K9AA 3LEKA 1GLHA 4W8JA 1H2MA 2AZ2A 2NZ9A 5LATA 1I08A 3TAYA 1K4DC 1N1TA 2BWCA 2DWDC 4NYKA 4FPEA 5B5EZ 4IGQA 1YXBA 1SQGA 4NJ4A 2O8QA 3M3QA 3AKQA 3ZX6A 4E4EA 1OH3A 1R1A3 3H1JH 4DXZA 1ND3B 1AJKA 5IHRA 3TETA 1O7FA 1GANA 1M57C 1GZTA 1XEQA 5EYPB 5I0UA 5JUVA 4CCCA 1Q5OA 1C1LA 3C7FA 4P9WA 4K40A 4DR1O 3UT0A 3IAYA 5IK4A 1K5MA 1EZVH 3CB2A 2P67A 2Q7HA 1RC6A 4J7KA 1JMKC 3K4AA 2HH9A 2WNEA 4HN0A 2F6BA 1WP8A 3TK1A 5J7MA 4OPAA 4WVMA 1J3QA 1V55C 4PA9A 3I2DA 2BPA2 4J25A 2ZINA 2CTQA 2CAZC 2NR5A 1YWKA 1Y9GA 2Y8KA 3Q8AA 2WO1A 1PGL1 4UCUA 1Y76B 2D5HA 1JFFA 2ZMKA 4LA2A 4LF6O 4KWUA 3ICXA 4Q0UA 1CP9A 3EFFK 3QO8A 5IYBO 3T2QA 1W9FA 3T2TA 3AG1B 2ZGSA 3V0AB 3FB8C 1QJU3 4KG8A 2VJXA 3H1LH 2RMKB 4LF5B 1KUQA 2QWRB 4NXNB 1O5UA 1LHNA 4YGDA 1VQPV 3ZXLA 4MT8A 3JSNA 5L3FA 2XMLA 2H8PC 4GX0A 1AI7A 1PPJH 2C2AA 3AKTA 4JI2O 1HRV1 4LNVA 1XNQO 4LF7O 4FLVA 1IPKA 2GH2A 1PL0A 3TEYA 1BZWA 4BQ2A 1ZAUA 3K48A 4AWDA 1WA6X 1AI5A 3JBG3 4PDWB 4NB5A 1NKDA 4MTGA 3AG3C 3UGFA 4OUEA 1FXHA 1BS3A 4GWIA 1SMVA 1MQTB 4I02A 1W0NA 4LK7A 1RJ8A 4LO8A 5J98B 5LMUO 4LHSA 1ENRA 4DINB 3S3WA 2RS32 1PO12 4W65A 4PDVA 4AI8A 1HN0A 3JAKA 3NV4A 2R0HA 1OJHA 2Z3YA 1DQ5A 5GZCA 3ZYIB 1FAYA 1HB4A 4TLGA 5E6HA 3PUSA 2EILC 1YITV 4X1IB 4P9YA 2WLIA 1YDXA 2EIBA 4ZS3A 5L73A 1YFUA 1OF4A 1H6YA 3LAGA 1QR9A 1YJ9V 5JOYA 2XR4A 2Q68A 4LNUB 5IVYA 3JD1A 1RUD1 1V6KA 5DAVA 3AKRA 1NLSA 4WM7B 2RS31 3CXCU 3U78A 2D6PA 2VQEO 3ZMTA 3NV2A 3KWVA 2ZEYA 3AG4B 1DQ2A 5FIXA 2IJHA 1OLMA 1LUVA 1FAFA 5BYNA 2BOCC 4LBOA 1GP5A 4RGGA 4XVHA 3O0VA 5E1RA 2Q8DA 2GALA 3CXHF 2YU1A 4YJ3B 4JKLA 2EIMB 1UYXA 4I0XB 4QX0A 4JCKA 5K0UC 5BR8B 2ZJCA 4DK0A 1GUIA 4JV5B 1P7BA 1Q8SA 2WYFA 1W2OA 4BLJA 1UIJA 2P34A 2YI8A 3WB2A 3TNQA 4WVWA 3D5OA 3OG2A 1A32A 3TGUH 2R9RB 3PJSK 4YFWA 5IYCO 3SYOA 5JMOA 1DFQA 2NN4A 1BQ0A 2I07B 2UUBB 4Q26A 3D82A 2WPDG 3MV11 2XJUA 5H9QA 1HP8A 4DB5A 2JDNA 2HWD3 2R042 2ZXWC 1HV1A 4YVSB 4BQ3A 4Z8BA 4M00A 1ENSA 4LBJA 1LU2A 4XJWA 2HJIA 1PL4A 1H8TB 5IDJA 2JECA 1XMQO 2B39A 3UM7A 2KSDA 4PA4A 2XLAA 1IQAA 2IU3A 4CDWA 1KD7A 2HLDG 4UOJA 4JTDB 4B29A 4CDXC 2ZPXA 4Q4V2 5B1BC 1OA4A 1X9PA 4MSWC 1XC6A 3EHKA 5J1XA 3R05A 2R041 1ZVFA 4SLIA 3ZYGA 2WN2A 3SJCC 3BRCA 4AI1A 1NE6A 4LH6A 5A33A 4OULA 1Q7YW 2GH8A 1M06G 3I4IA 1P8JA 3JU9A 5CFDA 2UU9B 4QMAA 3ZVXA 1ULFA 3RZZA 1EUTA 4P00B 2NLJC 4B3MB 2WNOA 1G9BA 1IURA 3W7XA 5HCFA 3GALA 3SPGA 1DGLA 1O8PA 1VBC3 3RDIA 2P4KA 1Z5WA 4IV1A 2Q73A 1X4TA 3NO8A 1NCRB 4D7TA 3FHIB 3AM2A 2QM7A 4QQOA 3BGAA 4LFCO 2VOKA 3WHUA 4I2OA 4L8JA 3ME2A 5C3PA 3WQ0A 5FZMA 4FQ4A 2YS8A 4DFSA 2VQAA 2YBPA 1LR5A 4O2AB 2OTLV 1IG0A 4IIJB 5FZ3A 1LOFA 4QGPA 3IAPA 2JICA 5FLXN 5CBHA 3ACIA 3GJBA 2OS2A 3FB5C 3T4DA 3AL5A 2EF6A 2VZTA 2FHRA 4FT8A 4GQ7A 3WG4A 4FLUA 2DV9A 4XW3A 2QQMA 3UT5A 5D2AA 3IPVA 1NZ6A 2G9FA 2E6VA 4HPKB 2Y6KA 2GC1A 4MTXA 5KHKA 1HR0B 2QJVA 3K5OA 5CKQA 1XQ8A 1COV1 1OQDA 3SJQC 2BJSA 1VP7A 4DXRA 1OKOA 2DU0A 4S2HA 4GCZA 1NQJA 3C3VA 3BEHA 1VLNA 3BN6A 4WV8A 2UU8A 5FK8A 3IGAC 3E1F1 1DK1A 1ND2A 1VR3A 1S5LZ 2I74A 3KQ4B 3HQUA 3VBFA 4F8AA 4FFBB 4QNHB 3J7HA 3GHNA 3DXRB 4XOGA 3WG2A 4ICGA 2P22C 2ZIOA 2WFF2 3VZOA 4O4JB 2JDAA 3ZHSA 2JDYA 2Q4SA 1FMD3 3CRRA 1ODNA 4QX7A 2QM4A 1X33A 2G4IA 4WCEV 3OPTA 1OCZC 3ASOC 5L7OC 3PVEA 3ZFGA 4GKYA 4FPKA 3ETQA 2PLV3 3AVRA 3J9SA 5CFCA 5DDJ2 1S0JA 3A0NA 4OMCA 2C9KA 2ARCA 1VB2A 4XFAA 1B04A 3N9LA 5KHHA 3QNEA 3OGGA 3ETDA 4K1ZA 1OD3A 1UZ0A 3H01A 5LP6A 5FZCA 5FTTC 3VLBB 5D8AB 5ERLA 2AYHA 4N7UA 3W5NA 3OUHA 4J1XA 1WD4A 1LR1A 4ISRA 2VQTA 4J6GA 4Y26A 1IXBA 3ST7A 2FDKA 5GALA 4IV3A 2VD7A 4R8HA 5LRRA 5FZAA 3OGJA 2X29A 4DR7B 3FKSG 4BISA 1KD1W 5CBLA 4UFMA 2IZWA 3ILFA 1GRJA 4I50B 5GLUA 1S0VA 2RMU1 4NHKA 3LSQA 3K0GA 1X50A 1QKQA 1LTEA 1TZOA 4XBNA 3F7VC 2GSYA 5I0SA 2DCTA 5GONA 2BV4A 4LFAB 4RUFA 1VBB1 4PBOA 3BIWE 3SLIA 1DGRA 4R50A 1RUC3 3OEBA 3DYMA 1HNWO 1N34B 4NTWA 1FXKB 4KHPB 3W7SA 3VD3A 2VZVA 3APQA 5KAFZ 1CAUA 5H6QA 2K9ZA 1VF5B 3ZSKA 1G8WA 3NMBA 4PV1B 1ASJ1 3HKEB 1FOD1 3WQ7A 2BWAA 5FMOS 1ULGA 1NAEA 3DKWA 1LOCA 1V9U3 3QACA 3DUIA 1OOPC 2EIJB 4H2AA 4QPIC 1BQPA 2E51A 5FCCA 4QDRA 3NNMA 1XNKA 3GDBA 4E2QA 4MGTA 3P3PA 4B3NA 5FYIA 1XILA 4QQHA 2BTVC 4DRXA 4GKKB 1XE0A 4QPYA 4L97A 1FS0G 4NXMB 1TVKA 1LOBA 3MIEA 1ZNPA 4K8XA 2QKCA 5H9SA 1VBA3 3SYPA 5LMNB 2V1DA 2DVFA 4WM8B 1WW6A 3I54A 4QGMA 4HOOA 3WP6A 3CCLV 2ZKOA 2IC1A 5FOBB 4FOWA 3H50A 4QHZA 1RUH2 1ORQC 4DV4O 4R9CA 5DZFA 3Q4HA 1OCCC 1JU4A 3OFNG 3VZLA 2R062 5C8WA 1YZBA 1GNZA 3T1YB 1R73A 1AYN2 1W8UA 4B1MA 3DGTA 2XOKG 4BPZA 3VDBA 3HWJA 1MZ6A 4XF4A 2HG5C 2PI5A 3AP7A 1W2AX 4I0AA 4BR6A 4DUYO 3WP5A 1J95A 1QXJA 1HNXO 3ZYJB 4DR5B 1LOGA 1PM7A 5ACA3 4P9OA 3RYHA 3DKQA 2LW1A 3H1KH 3T1HO 2OYQA 5BNNA 4YARA 3WEZA 2RS51 1ULEA 1ZA7A 3AX4A 3GZUC 4QWNA 3T2PA 2YSUB 5F3CA 1OHFA 2R061 2PYLA 1AYN1 3SYCA 2X6BA 2OXBA 1QH6A 1H1AA 4DY3A 3ZO0B 4U3FH 5FP3A 3QBQA 3AK3A 2XKPA 1LULA 2Y64A 1W6PA 2VNRA 1AXZA 4X1KA 3JD2A 1OH4A 4JZ2A 2E75B 4LC1A 2FKXA 4LKDA 3HMYA 1AYM1 2X6AA 3GF6A 3VZJA 3POJA 1WW7A 3MF9A 1CJDA 4KGGA 4IL7A 4HSLA 1YJNV 4I3PA 4RD7A 5EIBD 1LENA 3GWKC 3CLPA 2YDEA 4WFGA 4AL9A 2R073 1GM8A 1GV9A 4XIKA 1GP6A 3LNMB 1DZQA 2DYCA 1CX4A 2O14A 3ACLA 1MEC3 4GYCB 2P17A 3J7MA 1W6OB 4AXOA 2ZXQA 3H1IH 2RM21 1AR1B 2Y4TA 3DYOA 3H8RA 2XJSA 5CBFA 2C0ZA 4AQYO 1TA8A 2YIAA 2JRIA 3O7OA 5FPBA 1H2KA 4PELA 5IWAO 4CYDA 4F7ZA 2A9HA 4AHWA 4QQPA 2ZCWA 4FOYA 2HEYF 2RDSA 3AK0A 3POEA 1HDJA 1UO9A 1QLEB 4XZUG 4XHXA 2FTKA 2CWMA 2ZAAA 4DR3B 2UY9A 4KWLA 1O3SA 2PHRA 4JTNA 3FL7A 2YIBA 5A2QN 4FFIA 2BCCH 4XDOA 2ZMNA 4OMDA 3VBRC 1ZRCA 3G7DA 2XQXA 2B1IA 4P30A 2WNUA 2V4VA 2Q8VA 2QQOA 2VMIA 2B8MA 2EBOA 3ZHUA 4H7MA 4XDLA 2Q0AA 3I3BA 1WUVA 5FYVA 3WDXA 1NR1A 3AB0A 3ZHQA 3S7IA 2PN5A 1RUNA 4L8QA 4P9PA 4H44B 1JZ3A 2OQ7A 5DUVA 2HWF2 4TTGA 1Q86W 5JI9A 4N53B 5FR3A 5ABJB 3MPPG 1XNBA 4NAOA 2FCVA 4EWEA 1CVNA 3RVZA 1KXGA 4J42A 1W3VA 4AR2A 3N27A 1AR83 2BTOA 4KWJA 5FUNA 3RI8A 1PVC2 1QXRA 4J7ZA 5ANNA 2JDPA 3DPRC 3W58A 3S30A 1KDKA 2WO3A 1XREA 2RG4A 2QZ3A 1U5IA 4GH4A 3E5UA 2VW1A 4LE4A 4ISQA 1RUE2 2Q4PA 3BTYA 4D8MA 1RVF1 5JCTA 1PIV2 2ATKC 3HKCB 1Y3TA 1TNFA 4W6YA 5FZOA 2VH9A 4QKFA 1ENXA 5J2TB 2KA3A 4KU8A 1QJY2 1BZKA 2GAUA 1TME2 2UXCB 4CP9B 4O2BB 4PJYA 1G8MA 2CY6A 4X65O 1DQ4A 2C6SA 2XLGA 4H0LB 4DR2B 3WOGA 5F2WA 1SKVA 5B2GB 3ZKUA 4EB6B 2Y6JA 3T4VA 4LWSA 2EIGA 1X9TA 3HOBA 5CG9A 4Z92B 4YRDA 5GM0A 5FZDA 1NCQB 3D0SA 4MGQA 3KV4A 1QJY1 5DEDA 1TME1 1VQ6V 5CA0B 5D1IA 3J8F2 2Y26A 2MEV2 2Q30A 1W05A 2WNVA 1PK6C 3RWNA 4CEWB 1OCOC 1CGPA 2XVGA 1R083 2LJ2A 4OZXA 1TMF3 3HNMA 2VVFA 2OX0A 2PYJA 2ZEXA 3NAPA 3D6EA 2YUAA 2GC2A 1OLME 1A78A 4LO7A 1W28A 3JB8A 2G9ZA 5JDBA 4J9ZB 3FE5A 4DR4B 3K59A 4D6QA 1LGNA 5KA6A 1NLRA 3OEAA 4DV1B 4QJFB 2OT5A 3MF6A 1H4GA 1B6QA 4QPWA 3ZXJA 4M3CA 2A3XA 1SZBA 3H7YA 4AQTA 3WNNA 4MOAA 2XJPA 5CA1A 5BXXA 3KVBA 3M3EA 1XE8A 2NMNA 3KLSA 3ZS8C 3HT1A 4IGPA 3LDRA 3OOXA 3CC4V 3TN92 4A7KA 3ZMSA 5EJZB 2RJ2A 2EA7A 2JG8A 2QE3A 5FUPA 3D4KA 1HKDA 2VL4A 3LIGA 3Q8FA 1OI6A 2XWBB 1AR61 3I2FA 1GKFA 2PGGA 2W6IG 1TNRA 3VD9A 4XMAA 1DHKB 2CH7B 2D43A 5KC6A 3VBOC 2DYSC 4Z1MG 1A34A 4MW3A 3ZKYA 4HBNA 4LBQD 1NH2D 4JRLA 2C24A 3TN91 4NHXA 3AYEA 1REEA 3Q9OA 3WP3A 1R6TA 2FMDA 4OUMA 1KB9F 1W2BU 4ZU7A 4JF3A 4CH4A 4Y1UA 4JPRA 5FP7A 3UJOA 5FYHA 2Q7EA 3FUQA 3X29B 2W1UA 4ITCA 4IW3A 4KWKA 4UVBA 3CCSV 2CTRA 3UK9A 3UKMA 4XFHA 3CJIA 4YW6A 5C4WC 1SZTA 1W8ZA 3WDWA 4CZSA 4EROA 4LIVA 5AG2A 3J7NA 3QH7A 1CIWA 4AHXA 3HKBA 2W52A 1UCXA 3LUTB 3VBBA 5EWSA 3ZRVA 2HKXA 1EYBA 1SERA 5FY8A 5BUVA 1WA8A 1ZBE2 1BHBA 4LKEA 1RUF1 4XJUA 4JI0O 1I9RA 4DV5B 5FXWA 2IH3C 2QUOA 2HYXA 5L36A 4MW8A 3RW0A 1WMEA 3A0HZ 1XNRO 1SBEA 4C90A 5J48A 3J4UH 5FNVA 2PHTA 2OQ6A 3MDSA 2HJFC 1KGYA 2VUDA 1GN6A 3I97A 1R1A2 3F5TA 1VRBA 2WZR1 3RYCB 2B9ZA 1RXGA 3LDCA 5DZEA 2ES3A 2GDFA 3JYCA 3ZEDA 4N7IA 1WLCA 3LFIA 2Q67A 5AC93 2D5FA 2OCCB 5I8YA 1HLCA 3I56V 2R16A 2EVXA 4IEXA 4DR1B 4CEYA 2P6CA 1E79G 3AFKA 2ZS6B 1DYOA 2AEZA 3JATA 2P2KA 1CAXA 4ZOLB 2OTJV 4AAXA 4LJHA 4K3UA 3VBSA 2D44A 1S0IA 4JQTA 4QXCA 5FY7A 1LU1A 3PLQA 2OUJA 4X20B 4GB31 4YG3A 5ITZA 2X05A 4CDUC 5F5AA 2RDQA 1OPOA 3PNAA 4BQYA 3V64A 3ZRXA 2Q8EA 1S55A 1YO8A 2X5IC 4YW2A 3OD0A 3THOA 5JOWA 3RBZA 4JGZC 4TSVA 3K5LA 3PJYA 2HYKA 4INDA 4IEQA 2PMWB 5CFCB 1R3IC 1V6NA 4UXNA 1QJU2 3IMNA 1NXMA 4E4ZA 4LLFA 3GCXA 2BGOA 3WW4A 2UUAO 4P5YA 1WCSA 1AR5A 2XQRA 1ZSPA 4ABMA 1S76D 4XFBA 1FJGO 1HRV3 1BVVA 4D7YA 5FZKA 2O1QA 3LSUA 3WT3A 4DUZO 4FVMA 1K5QA 4CE8A 3I5DA 3N7JA 2VZ1A 3RZHA 4Y5SA 4JI2B 5CIRA 4YM0A 1BLZA 3QOPA 4LF7B 4D7SA 4Q1RA 4L9BA 4CUBA 4G28B 2ZAHA 2WLPA 1ND3C 3ZXAC 4E2GA 2ZGKA 2WBKA 4NHLA 3SITA 1RSOA 4YY3B 4PHZA 4FP3A 2Y33A 1QWRA 4WFAV 3ACGA 1GMGA 5DG1A 4R6ZA 4G9SB 5JCOC 4Y1YA 2YYOA 1CIYA 1LODA 1W6NA 1YTFD 3ZMZA 5EZWA 5LMUB 2F66C 4WBNA 3JQWA 2PQSA 3IZOA 3PTRB 2N74A 1DIWA 3BIEA 4PI2A 3T1CA 4UI9L 3OAAG 3JBG1 3DGEA 5DM6V 4B7KA 2H0BA 4JI7O 4HXCA 3H8OA 3HBKA 4LPLA 3LDDA 1DYKA 3AKSA 1RUD3 3MDPA 1M93A 3E8GA 3JUUA 3VHOA 3P6BA 1I0HA 3ZPYA 1U97A 2QQVA 4R7CA 1N36O 4FAGA 4IL6Z 1D2QA 5GLVA 4OPHA 5HCHA 1MNGA 1VIBA 5HV0A 1QNYA 1NLQA 1K97A 1CR7A 2DUOA 4CDXB 1LNSA 4XPVA 3SCFA 5F3IA 1GU3A 3H3LA 5JQGB 4OGQB 3R4DB 4LP8A 3AG1C 3WG7B 1AL0G 2ZGUA 4EN7B 1R1BA 4YZ1A 4AFAA 5FWJA 4RO2A 4EZ4A 4FM0A 3NR7A 3ACHA 1QJFA 1FYUA 3WUCA 1OUSA 3W21A 3CF6E 4XYXA 4FSJA 3CYOA 1YJLA 4R9BA 3JAWA 5EZYA 2J1TA 3BOWA 3OBTA 1TGOA 4UYBA 3O1MA 1ZRIA 2Q1MA 1RUI1 3MV01 4O9GA 1F9KA 5D5QA 4EWAA 1UU6A 3GZEA 2HR3A 2GC3A 4PDWC 1W9WA 1U96A 2ZOEB 2VQFO 3T0DA 4GKJB 4ZS2A 1VAKA 3B93A 4FLXA 2CTPA 4NUBA 2HWD2 2RDCA 1GN3A 1Y74A 2WO2A 4IEUA 4AVTA 2BOBC 1NOVA 4GALA 1MQTC 2E76B 4N21A 2AHZA 1DBNA 2DCKA 4CCEA 2YROA 4UW5A 1FNZA 4Y1VA 1BHAA 1DLCA 1NZIA 3O0XA 4UUJC 2VRZA 1V6LA 2C5DA 1SBDA 4CUCA 5HFLA 2FDGA 5T55A 4N8MA 4JHZA 4Y1ZA 3PURA 4LFBB 3VL8A 2B9VA 2ID4A 5I93A 4FTEA 3ZLIA 2OIGA 1YQ5A 3SISA 1BCXA 2OIIA 2HWD1 1H6XA 3NKGA 4O4IB 4IT5A 3FYEB 5KHJA 2W3JA 4W4KA 4CUAA 4QX2A 3VN4A 1PM4A 3AC0A 3BVCA 3KT4A 4DIQA 4WM7C 3CCMV 5KA5A 2E5LO 5K0UA 1J1LA 2ZX3A 3WDYA 5JPNB 3T1MA 4AQ6A 4HVQA 2QCSB 2P3YA 2E3CA 3AG4C 4G2KA 1S3JA 5E8AA 1HIXA 4WFHA 4P14A 3IFXA 4ZZ8A 4XAEA 1XBLA 2LP7A 3OBZA 4MX3A 5FJKA 2FL4A 3PMSA 4XTPA 1ZZ9A 1W9YA 1ZZ8A 2QE7G 2EIMC 3WX5A 4D94A 3QH6A 3E8FA 4EKWA 1VBC2 5LA6A 2WT0A 2WYSA 3ABUA 1W6MA 1OV9A 4CH5A 2F4VB 5IE9A 4JTCB 4YZ5A 1MS9A 3R6SA 2GUZA 3BTXA 4ZXEA 1BEV3 2V09A 4IYIA 3NSTA 4G4FA 4A7ZA 1MS0A 2J1VA 1CZTA 5K1PA 4V2WA 5EYYA 2CL2A 2GSMB 2FD8A 2ZX1A 4AVCA 1Q82W 4YVSC 1X8EA 3KZIZ 1K3IA 1EV11 3LIHA 4LF4O 4CS2A 3VD5A 1VBC1 2P4EA 1H8TC 2PHWA 4PF5A 3FLTA 4DXSA 3U75A 4QXHA 1WPBA 2K9PA 5IJ0B 5FJHA 3CCUV 1KQRA 1COV3 4B08A 3KGLA 3K79A 4I55A 3J26N 3GGLA 1GO3F 1YIPA 1VEWA 4UF0A 5T5OA 4MSVA 2B7YA 3VQYA 3A2FA 3B09A 3ZHTA 1JS9A 2K2SA 4LUMA 2FCUA 5B1AB 3VQXA 1F35A 4LF9B 1UX7A 1JZ8A 1YNAA 5IK5A 4KXRA 1SQ4A 2K1EA 4FI9A 3RYFA 1ULPA 1FXVA 4DR6B 4MHUA 2VMDA 1C8M1 2JG9A 3JALB 1IS4A 2RDNA 5HI0A 3QTCA 2JB4A 5LY2A 4E8DA 4OQ9A 2HWB1 4ZI7B 4FIPC 4LK6A 4Q4X2 3B77A 4MVUA 4BIOA 3S7EA 4MVQA 1FMD2 2PI4A 4HT1T 2VMHA 4MUVA 1K8AW 4TV9A 2E63A 3CE2A 1ZA4A 1XPWA 3E89A 1NCRC 3TCUA 4IEZA 2B9UA 1Z2GA 2PLV2 4CU8A 2QDOA 4HNAA 1Q56A 2LGWA 2I2SA 2WUHA 3LQCA 4LBMA 1LGBA 1S0DA 3N7MA 4CS4A 3R0RA 4Q2FA 3VOUA 2E7AA 4FK5C 1BT8A 1QMJA 4KG0A 3OM3B 4QXKA 1SA0A 1I94O 3SEPA 2RJZA 2LALA 2LM3A 1BXHA 3AVSA 1BCCH 1M56B 1QLNA 2QR4A 2XHKA 2FZ1A 4X1YB 5GLWA 3B40A 4FM2A 5FP4A 5FYUA 1D4M3 1O5LA 3ILRA 4M0NA 4RFRB 3AMQA 4R4XA 1WBLA 4LHNA 2CUGA 5LGTA 5GZGA 2VCAA 2RMU3 1O3QA 1JN2P 4ATFA 3K4ZA 3A0BZ 5I91A 4RSUA 3V65A 1AR71 1L3JA 4CVUA 2E31A 1ACCA 4ONUA 1ZRFA 1VBB3 1GOFA 2BQPA 2LFRA 3BAAA 5FQ0B 1CAWA 5L7OA 2P3JA 2BRTA 4YZ2A 4CCDA 2WLLA 4JASA 1RUC2 3T2OA 5CADA 1AI6A 3BCWA 5FLIA 1K73W 4TQDA 2JJ6A 1ASJ3 3FFZA 1Y9QA 1FOD3 1H30A 4BDVB 5DAWA 1FPN1 2CTWA 3A7QA 2DUPA 2JIGA 3U14A 2GN3A 5LA9A 4YM1A 4M3CE 1V9U2 4AHYA 1LKNA 2WINB 4NMIA 4I30A 3R4UA 1V6OA 2GBOA 5CA3A 1UY4A 4UVAA 3VZKA 2BDRA 4JYBA 2PHUA 2HBUA 3MZHA 2WRAA 4Y20B 1JVMA 4AVVA 5IFTA 3RJ2X 2WQ8A 3QO7A 1EAH1 5L19A 4AGRA 3JZVA 5E88A 2D6LX 1VBA2 1K9MW 1GSLA 2CYFA 5FZ9A 1RUJ3 5FPXA 4YFZA 1RHI1 3MIDA 3JD4A 2W9XA 5D8AC 5JZGB 1O3RA 3D36C 2GV9A 5KBFA 4QPJA 4YW3A 2ZDIC 2KB1A 1MVQA 3MW4A 4DRRA 1UU4A 1GQHA 4DV4B 2DOSA 4GAZA 5IY5B 1UYPA 1W0OA 2FDIA 3VHPA 4DYLA 2DFBA 5BNPB 2XVLA 1MACA 4YZ3A 4NTYA 4ZONA 4ASUG 2W95A 4JRAA 4Q6GA 4NPMA 5KXDA 1X59A 1VQ4V 3WNOA 1WB7A 3CNAA 5CNAA 5A80A 5A6ZA 2MK3A 5ACA2 1JJ2U 2RS53 3WR0A 5DG2A 1OOPA 4QPIA 4DV7B 1S2EA 1DDLA 5KWRA 4JI5O 3T1HB 2VQ0A 2CAVA 2A1XA 2PFWA 1VQKV 1WW4A 3EYPA 1I6XA 2DVDA 4XFCA 4RWUA 1DG6A 1L7QA 4K0KB 1M4UA 1AJPA 2EAKA 3AP4A 2VZUA 1Y43B 5EIYB 4UWDA 1K45A 3KCCA 2ZX4A 2W1SA 2WSUA 5C9AB 1WJZA 1Q43A 5LXTA 1DQ6A 2HWC1 2R9AA 1LHVA 4FFGA 4HKLA 3OT7A 2VR4A 4B4RA 1PX4A 5IT9N 1UXXX 3ATGA 4TUYA 1T5EA 1AYM3 2EIJC 4JI3O 5F39A 4C1WA 1FNYA 4FZ0A 5LHGA 4FTSA 1G6NA 3OYWA 3ZFFB 3UO3A 4FLZA 2L6LA 5IJ9B 2OYZA 3K9SA 4XC9A 1F31A 5FZIA 1TUBB 3WW3A 1Q6UA 4HLTA 1LRHA 1GZWB 3LF7A 4BZ4A 2R072 1MSWD 1HRI1 4MYEA 4CEYB 4WM8C 2RM23 4J7JA 2CGOA 2WA3A 1MEC2 1QQP1 1DLLA 4IDZA 2VOXA 5I8SA 2WZ8A 5KC5A 5F3EA 1XB9A 2V5DA 2LS6A 4M4PA 5BNOB 5IWAB 2YICA 3N2GA 4KUMA 3F2ZA 3QLQA 3CO2A 5FYSA 2R071 2XGXA 3B69A 5GTIZ 4ZIBA 3H9VA 1RXFA 3JD71 1MEC1 3FB6C 4CSWA 1FPOA 5C8YB 2UXDO 4L92A 3I7DA 2PHFA 4XCAA 1BE3H 1LAJA 1HJFA 3T08A 3USSA 2LGQA 4XUPA 2R1BA 3ORJA 1KJLA 1R3JC 5KX5A 4PI0A 2DDUA 2KXLA 1YIJV 1OFNA 4FOVA 2EAAA 4A7YA 2Q1ZB 2YY1A 2ZM6B 4UFJA 4FPYA 2MNGA 2GU9A 5FBZA 1VMGA 4AI2A 1AR82 1OCOB 3VKNA 1IS6A 3WD5A 2OA2A 4DV3O 1V6IA 4FPOB 1JZ2A 3I2KA 1SQPH 2D98A 3OTOO 4B3RO 3IIIA 4AEDB 4Q5OA 1C5HA 3ABMB 2ARXA 1G1XB 5FZEA 1BMFG 3OJBA 4UV9A 4RQPB 1YSCA 2J1UA 3VDDB 3O1TA 3RVHA 5APAA 2UUCO 1NTKH 3VBUB 4BQ4A 1JQ0A 4YW7A 3RYPA 5J09A 2B5UA 4X64O 1I5XA 1DQ1A 1VBE1 1GICA 1FFTB 4OX9B 1IS3A 2W47A 2XG3A 1IQDC 5GZFA 4DV0B 1DGWX 4LBQB 5AFBA 1NH2B 3I2JA 3ZN4A 2IBZH 3T1LA 4JC1A 3PMEA 4X65B 4IHJA 1T6BX 3SPJA 2W92A 5FKBA 4YW5A 3E6DA 3O1PA 1GP4A 4GT1A 1P84F 2K46A 1QLEC 4RR3A 4R8CA 2ZNIA 2GZWA 3IC9A 1GQPA 4DY5A 3IDBB 3WXPA 4R4ZA 2ZBJA 5T5LA 2DE0X 2XH6A 3E5XA 1RP3B 2VTXJ 1SESA 1P7GA 2CE4A
chains in the Genus database with same CATH topology
3VKMA 3LOIA 2BFUL 4ZXKA 1OHFA 2R061 4AVAA 1BYHA 2ZGPA 5EV7A 4JDOA 3THTA 1OMIA 4CRQA 1AYN1 4AVBA 1S1AA 3POSA 3M3CA 1QH6A 1H1AA 1R082 1Q3EA 4DY3A 3DPRA 4UW3A 4FXKB 3WG3A 3ZFEA 2XPJA 4AG4A 3ZO0B 2WFF3 4BGKA 3QBQA 2XKPA 3AYDA 5JOZA 4QPGB 2VU9A 1LULA 4N53C 4FVVA 1EY2A 2IXLA 1W6PA 2VNRA 4Q4X1 3WW2A 5IK8A 3LGRA 5ABJC 1AX1A 3GBWA 2CV6A 1OOPB 1AXZA 3IN9A 4QPIB 3B02A 2GMMA 4META 4XQDA 1ND2B 1C5IA 4B8EA 3NKTA 1FMD1 3ZMNA 4BG1A 3VBFB 1J1TA 3TRSB 2GMPA 5LEKA 4AW7A 1H1IA 3HMYA 1RJ7A 1UX6A 5DDJ3 1AYM1 4AI3A 1BKZA 3HIFA 4HSJA 1SEFA 3GF6A 1POV1 1UPSA 4G3YC 3VZJA 1WW7A 2PLV1 4IEVA 1GNHA 3MF9A 1CJDA 1UPIA 4KGGA 1OIJC 3SXWA 4IL7A 2E7QA 2BW8A 4HSLA 2TBVA 3EO6A 4I3PA 4RD7A 1LENA 4YG6A 3CLPA 1TMF1 5C8CC 2YDEA 1OIIA 5A3LA 2IXIA 2DTYA 1YRZA 2DU1A 2JX9A 2R073 3ZFGB 1BMV2 3LA3A 1GV9A 4TLFA 4V1PA 5KXCA 3DL3A 4XIKA 1SCSA 1JYCA 1DZQA 2DYCA 4Y22A 1CX4A 1KFUL 3ACLA 1MEC3 2P17A 3AYCA 1ZREA 1W6OB 4BE3A 4AXOA 2YXSA 3HR9A 3VBHB 1AR63 2QDNA 2RM21 1V6MA 5J92A 3AJYA 3ZN6A 4FAHA 2XJSA 2C0ZA 1ZBA3 4PIYA 3O7OA 4NHMA 1A3KA 1OQ1A 3WP4A 1H2KA 4CYDA 3ZXDA 4F7ZA 4GXLA 5JOXA 4YM3A 1I1EA 4AHWA 5IK7A 4QQPA 2ZCWA 4FOYA 4X8PA 2HEYF 3A4UA 1IOAA 1B35C 1PK6A 3AK0A 4Q4V1 1KRIA 4MZUA 4N43B 4XHXA 1DRTA 2R6QA 4AGGA 3EXUA 4ZU4A 1JR7A 2CWMA 2ZAAA 2UY9A 2WBOA 1ALYA 2WS92 2XL9A 3PVOA 4KWLA 3K51A 4C91A 1O3SA 3KCXA 5J36A 2YC0A 2PHRA 4JTNA 3FUOA 3OF1A 3WUDA 5BV6A 4PLMA 2ZMNA 1ZRCA 3VBRC 1YLLA 3G7DA 2JD4A 1GYKA 2WNUA 4IV3B 3MLLA 3JBG2 1NCQC 3MLJA 4P9GA 4OI1A 3TWIA 1S0FA 1BEV2 2VMIA 1SACA 1AXYA 2B8MA 3S0MA 3B5LB 4H7MA 2Q0AA 3WDXA 1WUVA 2JG9C 4MGIE 1OPMA 3AB0A 1QDOA 4N9HA 4XF1A 1HXS2 1QU0A 2PN5A 4XXPA 3S7IA 1APNA 1RUNA 4L8QA 5FPZA 1RUC1 5JIAA 4CEWC 4YVWA 2A71A 2XJTA 5DUVA 2HWF2 5EJ3A 5GJ6A 5JI9A 1Q8VA 4XDQA 1W6QA 4N53B 1QJX1 1OFSA 1RINA 2DWRA 3RPQA 4GWMA 5ABJB 3MPPG 1A8DA 1XNBA 2YGMA 4XZPA 4A2UA 2WZPP 3NL1A 3ZYRA 4I0BA 4RA0A 5JSPA 4EWEA 2OVUA 1PO23 3V0BB 1UL9A 1CONA 3MIBA 1CVNA 5BNNC 4BMEA 1JW6A 1KXGA 2XB6C 4GWNA 4RGAA 2WKKA 1AR83 1V9U1 4GMP0 4KWJA 4EN9B 3RI8A 2PAKA 1RUF3 4Q4W3 3IIAA 1FATA 2P3IA 1LHUA 2XJRA 1PVC2 1QXRA 3RI9A 5FMOL 1YJKA 2RR12 1OIJB 1CAUB 4KH9A 3DPRC 3ZFEC 1N3QA 4YZ4A 3S30A 3W58A 5F1RA 1KDKA 5C8CB 4LUKA 3TOJA 2H0VA 3SH4A 2W08A 3RS6A 2QZ3A 3BB6A 1U5IA 2BEOA 5AFEA 4GH4A 1N1VA 3E5UA 3L2YA 3RYRA 1DU3D 1RUG2 3VV1A 2VW1A 2VVDA 2R6SA 4LE4A 3H3ZA 4ISQA 3VBOA 2ZHMA