2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
1H2LA 1MZEA 2ILMA 3P3NA 3OD4A 2YDEA 2WA3A 4Z1VA 4NR1A 2Y0IA 5JWPA 4QU2A 2WA4A 2CGNA 2CGOA 3P3PA 2XUMA 1IZ3A 1H2NA 3KCXA 1YCIA 2W0XA 4B7EA 4Z2WA 4AI8A 4B7KA 3D8CA 4JAAA 1MZFA 1H2KA 1H2MA 3KCYA 4BIOA 2YC0A
chains in the Genus database with same CATH superfamily
3AYDA 1LHUA 5FZ8A 1D0GA 2XLFA 4L92A 1JYCA 5LGUA 1UWWA 3D3AA 2B4KA 1MACA 5FZDA 2EIKB 4JYYA 5J36A 4B4RA 4B29A 4ET7A 4O2AB 4YVWB 3FYIB 4RFT0 4CP9B 1YJWV 2VZSA 3I54A 1H8TB 4ZU4A 4QU2A 4CCDA 1RUF3 3ACFA 3M3EA 2W87A 1FYUA 3AG4B 1SLBA 1P8JA 2DBIA 4WM7B 3ZXDA 2JDPA 2X5IB 4P14A 3ZHTA 1WD3A 3NJYA 1RXGA 5HBAA 2P4EA 1ULCA 3E22A 2UWCA 3H01A 2EJ7A 2RS31 3DYMA 2J42A 4Y20A 2Q9LA 3PUHA 3A21A 4OQ8A 1JOYA 2HBTA 1P7GA 3SXWA 4EZHA 3C7EA 3I3DA 3C3TA 5JVVA 2A1XA 1XNCA 4GH4C 1IS6A 3U78A 1O4TA 4W6WA 2Y38A 3GHMA 3K0GA 3PHMA 4LE3A 4F4LA 4ASUG 3K77A 1T5EA 5JJNB 4O9EA 1IG3A 1UXZA 2ADEA 1FAYA 1BK1A 4ZHNA 4X20A 1EV13 3UT5A 1Q82W 4LKDA 2ARHA 2VCAA 3ORJA 5EJ1B 1KFUL 4TSVA 4GIQA 4WVZA 1WW6A 5CIRA 1ZZ6A 3HEIA 4AHZA 2PYJA 3D36C 2HR3A 1QVFU 1COV2 3ABZA 2W5FA 1K42A 5LP6C 1RM1C 3GNEA 2Y6FA 3KT1A 1OD5A 2VCCA 3SJCC 3ZVXA 5JZGB 2XXZA 1O6UA 1UOFA 5IWFA 1G6NA 2UXDO 4CEWB 2IJHA 2AUYA 2CWMA 4DR1O 2Y6HA 2B1GA 4KBBA 5CFDB 2QJ1A 1AR63 1KITA 3B3QE 1QU7A 2ITCC 3JARA 4UI9L 4YZ5A 2O8OA 1O59A 4Y24A 1HB3A 5FBJA 2VC9A 2GNBA 3ZFGC 3AP6A 4LK6A 1OOPB 4K0KB 1JMKC 1DGLA 2BZDA 4MTXA 4YYOA 1JHNA 1Q43A 3BABA 4U7OA 3ZN6A 1RITA 5EZYB 2W95A 2DV9A 2VTFA 3QTCA 4FM2A 2ZGTA 1CGPA 1XUQA 2PI5A 1ENVA 4ICGA 4UV8A 3CP1A 3AKRA 1XNQO 5CA6A 3KD4A 3KZIZ 3WB0A 3HNYM 4O2BB 3KGLA 5FXZA 1WLEA 4Y1XA 3AYCA 3EFFK 1DCSA 1OCRC 4RGAA 1WLDA 1G1XB 2PI4A 1YI2V 4HKWA 1V0AA 3ML0A 3SLIA 3MGUA 1M57C 1VBD2 2WNVC 2AR6A 1DIWA 1PO11 1ULFA 4FP2A 4C90A 1XXNA 2RM21 2UXBO 1JYVA 3J80N 1G9BA 3RG0A 3HKEB 2PTMA 3S7IA 2RG4A 3EXUA 4Y33A 3NKGA 1O7FA 2JDMA 2VWKA 4IIJA 2ZHNA 4DNYA 2CAUA 2K2SA 2BGPA 2P1BA 3LDRA 1V9U2 2X53S 3CCJV 5A7QA 3OAAG 2NLRA 2VQ0A 3E5QA 3ZXLA 1VB4A 3NV2A 1NH2D 3CC4V 2OIIA 5EJ3A 1UIKA 2A75A 4LIUA 1W6MB 2ZX0A 2IXLA 1ZX5A 4TLGA 2VW2A 4FPKA 2HWF3 1ZWIC 3TGUH 5ANQA 3O1MA 4RWUA 3MFAA 2KR2A 3H8RA 1SFYA 1LULA 1RUG2 1GN3A 5BY5A 2P17A 4CCJA 3OPWA 2YEVB 4X1YA 3DPRC 1GP5A 3CRRA 3F5WC 3KQRA 4NRPA 4DV1O 2OTJV 3WU2Z 3LFMA 4UCSA 2ZGRA 2XJVA 3FE5A 3ST7A 4COWA 4FAGA 3BPSA 2YHJA 5ACA2 1YNAA 3ACHA 1AI7A 4NHMA 3SH5A 1AR4A 5FZ7A 4DXSA 1AJQA 2WLNA 2BYVE 4GMP1 2W94A 3I2DA 5IVCA 2NN8A 3ABKB 1Z0HA 5FO8B 1VF6C 1Q8PA 3U11A 2A6ZA 1RUC1 4XDPA 4QQPA 1WMXA 2H94A 3M99B 4PELA 4FPHA 5F1RA 2ZX2A 4IQPA 4I55A 3CCLV 4U2AA 2MNGA 2VBPA 2W92A 4N7IA 5IVEA 2VH9A 3T4DA 3C90A 4YW2A 2GH2A 5LZ6A 2DYRC 1ASJ3 3UJOA 1MZEA 2GN7A 4HXCA 3JD71 4XUTA 2XJTA 4LNUA 3V0BA 4BA6A 4GA9A 1W8ZA 2E32A 3LOBA 2JJ2G 3H7YA 4L0PA 5LHHA 4FFGA 2BV4A 3BOPA 4OHYA 3O7OA 3STZC 3ROUA 5JPNB 4QB6A 3ZFEA 1SG3A 2W52A 3LB9A 3R05A 4ZZ5A 1PZ9A 3BU0A 2VVEA 3GCWA 1BSMA 2QQPA 4F3JA 1QJY1 5FY1A 2PY5A 3ABMB 3AG3B 4LJHA 2BJSA 3JCUZ 4HKOA 1CAWA 1F9KA 4PIXA 3FB6C 4CDUC 2RMU1 4Q1RA 1OLME 2VE1A 3HKDA 1YTFD 1M4UA 1O8SA 4K35A 2P06A 1QJU2 1RUJ3 3KMHA 4HT1T 3OMAB 4Q27A 1YITV 4MTGA 2C24A 4DV5B 2ZJCA 4BZ4A 2OPKA 2F4VB 4LKFA 1YVWA 5KUMA 1RUD1 4GX0A 2F6BA 4E27A 4GX2A 1MEC2 4CU7A 4XYXA 1FFXB 1VRH1 2YSUB 4LO5B 3SKVA 4META 2VQEB 2O1QA 1IBKO 1DFQA 1R1A3 4AI2A 4LF6B 1UPGA 3SJAC 3G6JB 1FXVA 5FZOB 5F2VO 1T6BX 4RHV3 3SCHA 1OCZC 2CL2A 4KQ7A 2E33A 3JU9A 2ARCA 3FUOA 1CAUB 4YM1A 1I6XA 1K5MA 4GWJA 5JJJB 4U3JA 5F3CA 3SYPA 3TCUA 3J8F3 3B01A 3ABLC 3MAQA 2Y4TA 5DG2A 1LKNA 2LRPA 4URTA 1NA1C 5I8SA 4EWEA 5C5TA 4MUVA 3ZS8C 4NHYA 4JV4A 3T1HB 2WLQA 2D6KA 2BQPA 4W6YA 5FLIA 1TUEB 4QPGC 4XF1A 3ZLIA 4EWAA 4EROA 3DF0A 1S0BA 3ZN4A 2WS92 3QVNA 4ATEA 1DQ4A 4MGZE 4Q4V1 3FL7A 4LBQD 1US6A 1H2KA 2E53A 2ZR3A 2DOSA 1VBE3 4IV1C 4DR3B 4GALA 2Z3YA 2EXJA 3WD5A 3AG1C 2Y8KA 3PJYA 1H2NA 1O5UA 4QJFB 3VBHC 3H1KH 1AI4A 2QZ2A 2VNOA 5B1BC 1HRV3 4PLOA 1SQ4A 3VZKA 2ZZJA 1KU9A 4LWSB 4CVUA 4EFEA 3DGEA 3LKJA 4A41A 2YIBD 3WG2A 2BOCC 3WEZA 3N2GA 2VOXA 2QEXV 4XJ8A 2X0LA 3JD4A 2RS13 2XAGA 4R4ZA 2VU9A 4HVQA 1HNWO 4XABA 3ENRA 2D6NA 1L8DA 3I2KA 5EIBD 4JI2B 3H8UA 3C7OA 4W4KA 5K9YA 4JTNA 5E88A 1OXCA 2IW5A 3LNNA 1W9FA 3ZFFC 4YJ2A 2R043 3AFKA 3CMGA 3MW3A 1MVEA 4YJ3A 1M90W 2VZOA 2DN9A 3W7UA 5E1RA 1VR3A 1C4RA 4B08A 5A6ZA 1K34A 1VRH2 4M3CE 2VPVA 3B7MA 2XLAA 4H2AA 1L7RA 3PVOA 3FHQA 1PK6B 1F2NA 4YSFA 4BIUA 5CBHA 2LS6A 1UU5A 3A0NA 4LHKA 3CIHA 3ICXA 5J48A 1GM8A 2JS5A 3ETQA 2X10A 4DXWA 2WLMA 1UJWB 3GF6A 1ZREA 1B35A 3JZVA 4CCMA 4A44A 5KMGA 3MFCA 1W9WA 4A7KA 3NRUA 3N3HA 3K75B 4LO6B 1RXFA 1LB2A 1X50A 1CIYA 1HWYA 5ISLA 3L70H 2G1MA 3U10A 3GGLA 3UYJA 5IVFA 1I5ZA 1VARA 1GUIA 2XBO3 3T4ZA 4YW4A 2VMIA 1BEV1 3FLPA 3C7GA 2VOKA 2R1BA 3UCSC 1JYWA 4FOVA 2V73A 1VQKV 1Q8OA 3I8TA 4R9AA 2P3YA 4RQPA 3VBFC 2RR13 2OT5A 1PNGA 4X9QA 3ZBHA 1WLCA 3E2EA 1CAXA 1AROP 2JDYA 2IXCA 4FPEA 3QACA 3LSQA 5GKAC 5F3IA 1MS0A 2YBPA 1IXMA 5JVDA 5FPOA 4BHPA 4LFBB 1FATA 2DUOA 3UO3A 1QJX3 1GANA 1JTZX 4QWNA 4LR3A 1K12A 4LCUC 1NX9A 2QVSB 1IBLO 1QXJA 2FQPA 4WVMA 5L7OA 1OH4A 5KBFA 4CH5A 2B42B 5L3CA 4K8ZA 2R071 5FZKA 3VOUA 4P9GA 1AYM3 3POEA 2RS51 1QWRA 4LULA 4XEZA 2HKOA 1HJFA 3S3XA 1AR82 2QQWA 2HFEC 3HWJA 4B7EA 5FP9A 4R50A 1H4GA 2VW0A 3IZOA 1J58A 1DP0A 1NCQA 1S0DA 3H50A 3GBWA 2DYSB 3K3WA 1L0LH 4NUBA 2IH1C 2JG9A 3W9AA 2MPFA 1X7NA 2EILB 1CAVB 3RGBA 2P3KA 4RAIA 5B1AC 1WP8A 4J80A 2W1SA 3STLC 1OF4A 2GMPA 2OVUA 2B1IA 1GU3A 4RO2A 2ATKC 2IU3A 2TBVA 1LAJA 3WG1A 3Q4HA 2NNUA 5HXMA 3WP6A 1GWLA 4N53C 1I1EA 4D8MA 3ZYRA 4LO7A 3AMNA 5GJ6A 3RQ0A 3I5DA 3K59A 2VBDA 1VMFA 1BMV2 5F32A 1N3PA 4MSWC 1R083 3SYQA 2WLPA 4DV3B 2D93A 5JQGB 3ZXJA 4JV5B 2D2CB 2WFF3 2ZHLA 3F7VC 4D94A 1QXRA 4BWOA 4XIOA 2UU9O 5DPNA 5ITZA 2K9PA 4WM8A 3RZKA 2FTKA 5C70A 2H6CA 2XDVA 3ZXAC 2ZGUA 3B9CA 5APAA 1XNAA 3PIGA 4PBOA 4XTPA 1KJRA 1QIQA 3P6BA 4K20A 4JCKA 1M1KW 2Y69C 2QQMA 3PTYA 3VBSC 4YG6A 4ATFA 1UU6A 5DUUA 1RUOA 5FXWA 4JYAB 3RPQA 4BOWA 1ULPA 3EB7A 4MHUA 2LGQA 4FJCC 3MW4A 1HQLA 4MYEA 5C4WC 2Q6AA 4CS3A 2JECA 5JCOA 1C8NA 1CX4A 1R092 4HL0A 3PUQA 3F7YC 4LA2A 1ND2A 1SPPA 3RNSA 3CCEV 3SPIA 3E22B 4ZKIA 4JGZA 2F93B 1BZWA 2Q8VA 1OCOB 3G67A 1Z7S1 1OCCC 4Y20B 1S5LZ 3QO7A 3VD9A 1JH5A 2ZS6B 2Q5ZA 1NE4A 1IGOA 5GZDA 4D6TH 3LF7A 3RSJA 4CTEA 3VBOA 3ZKUA 4DPNA 4YVWC 4R9DA 4DV4O 3IMNA 1QMJA 2C9KA 1UY3A 2P4VA 2MEV2 1H8TC 3AXDA 2Q68A 4B1MA 3ATGA 1BT8A 4DFSA 4DUZO 2GN3A 3I2FA 4UCVA 3AG4C 1JW6A 3UT5B 4XCAA 3WNXA 4BQ1A 1BBT2 4CEYC 2RQ6A 1OUXA 5EBWC 3BGAA 1N3QA 1AVMA 2LFRA 4UOJA 2VO5A 3UV9A 4GUNA 1PM7A 4F6RA 2ADDA 2JKBA 2J1RA 2JIGA 1XMOO 4U7NA 4QGMA 2A79B 1VALA 5GLTA 4PA9A 3H42B 1YQ5A 3KLSA 4TV8A 5JIAA 4UT5A 5DZFA 2OIGA 1UZYA 3I97A 1PGL1 4A2UA 4IYHA 1N34B 1ULGA 4AK3A 4DV0O 2GP5A 2JENA 5HCBA 4JI0B 5DZGA 1SQQH 3A2FA 2DQ0A 1NXD1 4COVA 3JARB 1QEXA 3SEPA 4IEOA 2PAKA 2WWJA 3O14A 2RDQA 4G9SB 1SESA 3S6PA 3MD0A 4PJ0Z 3GZUC 1WMFA 2CSGA 3VDDA 1S72V 1REDA 1JFFA 4ABMA 2VL4A 3LNMB 2IXHA 3SISA 3AX4A 3N9LA 4OYUA 3HKCB 1Q8QA 2AZ0A 3H1WA 1ZRDA 4XPVA 3I55V 3GYDA 3IT8A 1TUBB 2HJFC 2R9AA 3UGHA 1QHTA 1RUH1 2JS3A 5IVYA 4CEWC 5FOJB 3ZRSA 4XE9A 2WO1A 1TMF2 4COZA 4LE4A 3B02A 4Q0VA 4B4PA 1L3JA 5H9SA 2YI9A 1GK9A 2VS0A 1IURA 4CDQA 4X62B 2HWD3 1BVP1 2PHRA 4FLUA 2YS8A 3EQEA 2DFCA 4IIJB 2WZEA 5LMUB 3CNAA 1CJPA 2IM9A 4RL7A 4AILC 3ZCCA 3POGA 1XBLA 3VD7A 2RVAA 4XQ4A 3JSNA 1ZAUA 4XDKA 3UKVA 5EWSA 5BNOA 3KG2A 3C3SA 1K4CC 2UUAB 2HWE2 3ZMSA 4CSWA 3ACIA 1XDCA 1QJFA 4UUJC 4BR6A 4AG4A 4FZ0A 1LOFA 4QX3A 4MADA 1RUF1 4ZZ8A 4R8CA 3B69A 4XIKA 2EIDA 4ES9A 2IFRA 4X1YB 1MZ6A 3IWZA 4CDWC 1R6KA 4QAWA 1RPOA 2P37A 1EN4A 4YVSA 3JUUA 3T1HO 3S5QA 3F95A 4YW5A 4YNIA 3HQRA 2GU9A 2HH9A 1MR5A 5IY5B 1JPXA 1W2NA 1AP6A 2R49A 2Y6KA 3NNMA 1ZA4A 1W6QA 4AE2A 4XVHA 1SRYA 2FL4A 1DLCA 1HLCA 3ZN1A 1J5EB 4FQ4A 1RUE3 1UU4A 1HXS2 3Q8EA 3CBNA 3J7MA 2GSMB 1I94B 1VBB3 5FTTC 3PLQA 4I55B 4DV7O 3DEMA 4Q4X1 1W99A 5CN0A 1UNBA 4QHZA 4M4RA 3O1SA 1EV11 4FLWA 3CSXA 5CZKA 3AXEA 4BH9A 4NIGA 4EEQA 3M3QA 3K58A 2A3YA 3H7JA 4BJ0A 1EZVH 2RN9A 1PO23 4BW5A 4IV3C 2YXLA 4JTDB 4WVWA 4LNUB 3S5AA 5FYBA 2H6BA 5C8WA 3AKTA 3V0BB 3DV8A 1GAXA 2UWAA 2FMLA 3ZFEB 5CU1A 4AAXA 4AVAA 1Y67A 4P2ZA 5CISA 4GKKB 3ABKC 4CXWA 3AC0A 4WF9V 1PX4A 3B94A 5K1XA 1AR61 1UMHA 2XUEA 4N9IA 3UKNA 1CAWB 1MS5A 1UY4A 4IGOA 2X6BA 1HRI3 3K5MA 3HKDB 1O8PA 3LQCA 1XQNA 1VBA2 2QTWB 3PU8A 3KS7A 4DRVA 4GCZA 3RI8A 4I50A 3OM3B 3WDWA 1HN1A 2XAFA 3KCXA 3H1MA 3JQXA 3VL9A 2R063 4O4HA 2FDJA 3JAMN 3ZSJA 3TJTA 3SYCA 4J10A 2E5LO 1WJZA 2JG8C 4S2DA 1W9TA 1F7YA 1C5IA 1HQNA 4I02A 1HIXA 3R6SA 1QY4A 4H14A 1YFUA 1SETA 5A6QA 3HBZA 4CP1A 2W1UA 3AG3C 2V1DA 3DKWA 3ME2A 1H8VA 2JXAA 4FLVA 4U3JB 3E97A 3T2MA 3WF1A 4DEVA 2F1MA 4GKJB 2D5HA 2WLLB 1Y43B 3WB2A 3ZSKA 1K9MW 3QF7A 2C4XA 3NJXA 4E4HA 1G9FA 4RSUA 3AMPA 3JYCA 4KWJA 1DGRA 2W2IA 2VMEA 1UY1A 1XYPA 1GM9A 5BNPC 3J81N 4UFHA 1GOFA 1GM7A 2VZTA 3I2HA 4J1WA 1AR73 4FO9A 1NCRA 3B4SA 1Y66A 2CTWA 1M06G 1N0NA 2QBXA 4Q4Y3 1O9HA 5C8CA 5FWJA 1IS5A 1YFWA 1BHBA 2Q8EA 1DF0A 1GRJA 1LOAA 1US3A 1OT5A 4YG0A 3E86A 3GZTB 1Q6UA 1BKZA 3WLUA 4NJ4A 5KUKA 1FKAO 1AR62 4FP3A 1POV3 3I3QA 1N8RW 4M00A 1LOCA 4JASA 4DV6B 1NKGA 4XMAA 1YSCA 3UESA 3BI3A 2HKXA 5CG9A 2VM9A 2EXHA 1GMGA 2WNUB 1Y4MA 3HOBA 5EYYA 5GZEA 5BR8O 3DYPA 1W8UA 2DDUA 3RWKX 3LWCA 5TISZ 5E8AA 2PN5A 4UW4A 5ANNA 5FOBB 1CIWA 2WLIB 2YDEA 1EUTA 2ZGLA 5A7NA 3AG7A 5FUPA 5A3WA 5LA2A 2Y34A 5JR2A 5FRAA 4QDRA 1G8MA 3TEZA 5HXVA 2QWOB 1HB4A 1ASJ1 5FP7A 4B3MB 3HKBA 2NR5A 4M4PA 1OFSA 3N7MA 1AHSA 4MGIE 4Z8BA 1HX6A 3OOXA 2WSUA 1W04A 5IK8A 1B35B 1NQJA 3ZYHA 3CKHA 4UCTA 5I0UA 3ZDVA 4OUEA 1JJOA 5KMGB 4MTOA 4QKFA 5K7PA 4XURA 2BRTA 1YHFA 3LSSA 2WA3A 4UFJA 4M01A 2PAEA 4ARXA 4B3RB 4DEQA 3OGRA 4PJYA 1RHI2 4FFKA 1OHFA 3PMSA 2G9GA 4AVSA 3JALA 2UYAA 3APOA 4I0AA 1GNHA 1RUJ1 1W39A 3MHZA 2HWF2 3E8HA 3QG5A 5H2FZ 4CBCA 4KXRA 3C7FA 3E6CC 3HD8B 4ZONA 1XSRA 1C28A 5FYYA 1ZBE2 4DV2O 3N7LA 1GR3A 3UKTA 3EHBB 1RVF1 2QKCA 5AFEA 1CAXB 1LHVA 1AL22 2YGLA 2ZE6A 2DWDC 3W7SA 2I74A 2NP0A 3LGRA 1DF4A 1EP0A 3T0BA 3NV4A 3ZO0B 1MS1A 1MOFA 5A2QN 1FOD2 1R1A1 4PDWA 2BBVA 4RHV1 2UUBO 3C7HA 1QNMA 2DW4A 4WVMB 3ZYJB 5L7OB 4GYCB 4OFGA 3ZHVA 4J9YB 3ZX7A 2UUCO 2B8MA 2IVJA 5T5JA 3R4UA 4X1KA 2UY8A 4CZSA 1XHXA 1U5YA 5FZLA 5DXDA 5DZEA 1R73A 3H1IH 1N0JA 4FXGB 2E75B 4AWDA 1CVNA 4UWDA 2EIJC 1ASJ2 2XWJB 5LBEA 1PD3A 1NCQB 4GX5A 3W7TA 3RYIA 1FXHA 1LUWA 4S2HA 3FJSA 1JA8A 4IYIA 2QQUA 1EZJA 4FPFA 4HETA 2JG9B 4KNCA 3FX3A 5FIXA 2ARAA 1VBE1 2RJKA 4CA9A 1FX5A 3ITQA 2D7FA 3HNMA 1PO13 1YXWA 3E8FA 5I91A 5F7UA 3MZHA 3BIEA 1FV3A 1L7LA 1HRV1 2E76B 2C2AA 3MYXA 1UO9A 1Q8SA 3K4AA 4QMAA 4DRRA 4WBNA 5T52A 1RYYA 3ZIAG 4K8XA 4LR4A 3Q4HB 1S2BA 1VMJA 2E63A 3SQOA 3MLJA 4HONA 3PUIA 4PF1A 1J95A 3LDCA 1A78A 5F2SA 2RS11 4JI5O 3URFA 4ASLA 4YW1A 2CYFA 1GZWA 2VCMA 3OFNG 4UCRA 1BE3H 4XJZA 3GDBA 1JYXA 4XTMA 5FR3A 2AYHA 4D3WA 4ZIBA 4X6RB 5H9CA 1U96A 5J2UA 2Q5TA 3AZVA 2DYSC 1KDMA 2R041 1YFYA 3IC7A 1IX9A 4P9LA 4CPBD 1T2XA 4MV2A 3GJAA 4FLTA 5CA0A 3IPVB 4C1WA 2X29A 1E1RG 2OW4A 4GLXA 4W4LA 2R6QA 5LMNB 4FPJA 3SCFA 3SJBC 3VV1A 3N35A 5ITZB 4WM8B 1C5HA 2F43G 2YROA 1QQP2 2V5DA 3HVDA 4K3AA 4M0HA 3AMHA 3WW1A 1VQ5V 4CXXA 1X36A 4CP2A 4RGKA 2YI8A 4X62O 1AYN2 3AKQA 2BVBA 3J8F2 4ZXKA 5IK4A 2XVGA 4BM8A 4GMP3 2XMLA 4JF3A 4NHXA 1HV0A 1LHOA 1Y74A 1Z78A 5LB6A 4BQXA 4JI3O 1I08A 4BLJA 3WCRA 3RYFA 1SPPB 2XBO1 2YY1A 2V4VA 1S55A 5FY5A 2DFBA 3NWKA 5JSOA 2VQFB 4AEMA 5LRSA 1FNZA 4JGZB 5FY0A 3L74H 4BW9A 4LXLA 1KP2A 2VUAA 3KV5A 1NAEA 3J7LA 3RZJA 2VNVA 3JD73 3WDXA 2ZCWA 4XXPA 2RR11 2YMZA 1YQ2A 2ZMLA 3K9SA 1SLAA 1HRV2 1YXBA 3VBOB 2ZACA 2YC0A 5L36A 4RS5C 2QDRA 4MLOA 5FBZA 2CGNA 4ZI7A 5C3OA 4AL9A 1QJX1 2QKSA 5L3BA 4D7SA 4QGPA 5BNNA 4Z2WA 4QXKA 5IT6A 1OLRA 5F5AA 2PHFA 3O9OA 2GALA 3A4UA 1NOVA 1HDJA 3TXQA 5DDJ1 5IVBA 1D2SA 4EN0A 2QTSA 2JJ6A 2RMU3 4UXNA 4AFDA 4GH4A 4GB32 1LGNA 2XUMA 3H1YA 4F6RB 4PLMA 2Q7EA 3NJZA 1O3SA 1S0FA 1BK0A 2V7QG 1OHHG 3LEMA 3AZYA 1XNDA 1EYBA 3KM5A 2NPIA 3A0RA 4PIYA 2JWPA 4K1ZA 4UFLA 5A3LA 2N04A 2JB4A 2XWBB 3JCIA 1R64A 1WN7A 2GNDA 3QLQA 1RUD3 1H6XA 5I8TA 1QH7A 2EXKA 3BEHA 3D36A 5FL7G 5HI0A 1CESA 4UCOA 5DAPA 5LP6A 3TAYA 5FZ1A 3CMEV 2FZ1A 3RYPA 1AI6A 2SLIA 1SDWA 4ZOLA 3WHUA 4QD2A 1IKPA 3SDLA 3VDDB 1H8EG 1F35A 3FHAA 1JFFB 4YPJA 1M56C 2R9IA 2EXIA 2Q30A 2HWC2 4L99A 5DABA 1Y3TA 4Q5OA 3GJBA 3WP5A 2HWB1 1WWYA 3ILFA 5JMOA 4TQFA 2RCVA 3WUDA 4BQ5A 5LYJA 3PUSA 2E6VA 2C6SA 3N9OA 4OI2A 3ZFGA 4JGYC 3CPWU 2ARXA 1WA4A 4XACA 1F4NA 4KWKA 3H1JH 5AC92 2LJ2A 2FZ2A 4PHZA 4XZPA 2UXXA 3B40A 3OMIB 4J7ZA 5LA9A 3JAKA 2FHRA 2F17A 4UB8Z 3KSCA 1FMD3 4CDQB 1LU2A 2O8QA 4QQLA 3AMMA 3JSLA 3CCRV 4ONUA 5L3GA 4LA3A 5J7MA 2D3OW 1R081 4EN7B 1XU1A 2LM3A 5CKMA 4R6ZA 3CLPA 2WFF1 2OWOA 2P90A 2WNVA 4AI3A 3LCPA 5F5IA 1VJ2A 1V6LA 2R72A 4OMDA 4AI9A 5BNOB 5L3DA 4N8MA 4L8QA 2WT2A 3U75A 3PMEA 2XKPA 4QB2A 5H6RA 4MO3M 2EZOA 1GTOA 2A71A 4Y5SA 2IH3C 4FOQA 2QWQB 3U14A 5L3EA 3LA2A 5CFCA 2VQUA 1AYM2 3CX5F 1H1MA 4CCCA 1S5JA 2VGDA 1XYNA 1XI1A 1FPN2 2ETNA 2PLV3 4X8NA 4YVSB 3APQA 3ZMZA 2MHFA 2WWSA 2ZGQA 1G4YB 2UURA 3J7HA 4IL7A 1F5FA 2QQNA 5DG1A 1MNGA 2UXDB 3POJA 1OLQA 4OULA 2VNRA 1TNRA 4DR1B 3VGIA 5KXDA 1W6QB 3CL1A 5F2WA 1WBFA 2QQVA 1W0JG 3E1F1 4XAAA 2IXJA 3CQOA 2OUHA 1SZBA 1OA4A 4UFIA 1NI8A 1UL9A 2XHKA 3RVHA 4Q4W3 2XKOA 1MZFA 2XHBA 1POV0 4XBFA 4FT8A 3BVOA 2FYUH 1FXKB 1XNQB 2XB6C 3OJBA 3QH6A 1VF6A 3FBYA 2WABA 4JAAA 3W7XA 4QGLA 3IAYA 2R0HA 1UYZA 1UW8A 5C8YA 1RC6A 4AQYO 3WNPA 4X6QB 2GTSA 2ZGKA 4LLOA 2P6CA 2UXBB 4HAMA 5GM0A 4FLXA 1M5IA 2VZRA 4NHKA 4BK5A 5FZIA 1UZVA 3O1OA 3K03A 1NZ6A 5HCAA 5GTHZ 4QPKA 1IPJA 3WG7C 2JDUA 5FYSA 3WXPA 1RUNA 1IBMB 1ENRA 1RPRA 3X2QB 4TUYA 3WVJA 5FPBA 1XRUA 1XOUA 3EHKA 4DK0A 3TEXA 3ZMVA 4FZ1A 2Y64A 4O4HB 3T1MA 5GLZA 1UY0A 3ZFEC 4FSJA 2RS53 2BSKA 2D44A 2QE7G 5BUVA 2ZTNA 5FZHA 1KGYA 1GQGA 4OZXA 4AW7A 3LZZA 5D1IA 1Q6IA 1OI6A 1VB2A 2BBAA 4J41A 3WQ7A 1P84F 1KQSU 1VQNV 3BB6A 4IGPA 5J3UA 3AVRA 3T4VA 2H3OA 1S3JA 3N9PA 2HWD1 4ZS3A 1JQ0A 5JIUA 4IEPA 4X65B 5FMOL 2EIMC 1HNZO 1DDLA 5I0TA 2UU8A 2ILMA 1PIV3 4O4LA 4LKEA 4G4FA 4JHTA 2DVDA 3VBBA 2VQTA 4GAZA 4K6BA 1JZ7A 3EMRA 1BMFG 2QKDA 4XFHA 5B4XA 1IS3A 1QF3A 2AZ2A 2Q7HA 4A5UB 5A3OA 3HT1A 3A22A 1RTVA 2EJRA 3JD1A 4AI0A 2P3IA 3B5LB 1NA1A 1BZKA 2ZT9B 1Q7YW 2D6PA 3K5LA 5C8CB 3JBG2 2KA3A 4ARYA 4QPGA 2VUDA 1OURA 5FPRA 1DYPA 1GOGA 4O61A 5FZFA 4MHRA 4BAYA 5FYZA 4LQRA 1ZRCA 1VP6A 3QH7A 4YY3O 4YGCA 4IV1A 1YQ6A 1SKVA 1VQOV 3O1RA 3VBHA 1W06A 1QGLA 3VLBB 4AGGA 1BGYH 5E16A 3CRQA 3LDEA 1KMIZ 3UT0A 2Q0OC 1BHAA 1VBB1 3KHBA 1MS9A 3C3VA 1YI7A 2VXJA 2B9UA 2BGOA 2KXLA 3HKBB 4AHWA 2C5DA 2J1VA 3SJQC 1PO21 3IN9A 3P3PA 1UFIA 1IBKB 3DN7A 3RMXA 5B5EZ 4LITA 1RP3B 5B1NA 3E83A 1D2DA 4BQ2A 4EB6A 4KU8A 3GBFA 4OVEA 2WNUC 2QSAA 1Z7S3 5CBLA 2ES3A 3K46A 1DGSA 1NUKA 4O65A 1R1ZA 4EJRA 4TV9A 1PV0A 3LPGA 1I5PA 2P2KA 1GFF2 2Q1MA 3PVEA 4O7XA 1BVVA 2YIDA 1NQTA 2ARBA 1A32A 1MABG 4XZUG 1HRI1 2VZQA 3JALB 3CCVV 1VQLV 2AEZA 1ZL8B 3L9JT 1CQ9A 4XBQA 3WCSA 1COV3 4JDNA 1LEDA 1NZIA 5I8YA 4N21A 1EUUA 1UZWA 4GMP0 1QLEC 5IDJA 2OPWA 3D4KA 5FZ3A 2ZNIA 4XAEA 2R061 4Q0UA 1Y9MA 2N74A 1EPWA 2Q4SA 2YUAA 1ZUQA 1U5IA 2BCCH 3OCPA 5C9AA 4X8AA 1DBNA 1ODMA 2RDCA 2JIZG 1AL0G 1AZDA 2XR4A 2M6YA 3RDIA 2PAMA 2XONA 3T3YA 3ZXFA 4A3XA 4X8PA 1XQ8A 2VD7A 1NLRA 3ZIWA 3D6EA 4XF0A 4YIPA 3VZLA 3VBFA 3G80A 2Y6GA 2AGSA 3MEPA 1KD7A 5DECA 2YBKA 3BIWE 3WT3A 4Y4YA 3C2UA 3MO4A 1S2KA 5K8SA 5EJZB 1JX9A 1N33O 1NY71 1RUE2 4QXCA 5CNAA 3RYCA 1QDOA 1YQCA 3EXAA 1Z5WA 1OLMA 4LBKA 3NV3A 1GP6A 1S76D 2Z5WA 3T0AA 3FAVA 2PQSA 3CJIC 1AR71 4CE8A 1MSWD 1ZBA2 4WV8A 4DUVA 4UW6A 1OQEA 4PCRA 3OUHA 2CDYA 3M3OA 1RUH3 3OBRA 4HANA 1NG0A 3VD3A 4PIZA 4Q4Y1 1K8AW 3KKYA 2IJJA 3IB3A 4DIQA 1V55C 2PUSA 1CD3G 4OX9O 4I9QA 4H44B 3TN91 1KKDA 4LK7A 2BTQB 4YRDA 2KM2A 1NTKH 4WBNB 2IWGB 1CX1A 3P1IA 3USUA 1V9U3 3AZXA 3GBGA 2WYSA 5D8AC 4XMIA 3WNMA 1POV1 3HAGA 4IE5A 5CB4A 1FI2A 1HRI2 1C57A 4HLTA 1W28A 2GNMA 2ZHKA 1GZWB 1LOBA 4E4ZA 1DGRN 1JU3A 3OGGA 3ZYFA 1NCQC 2E7QA 1W6NA 3CHXA 4UW5A 5LBCA 1JZ5A 4W65A 3WG4A 1ZX3A 2JK5C 3DGTA 1U5ZA 2ZPXA 5J2UB 1AI5A 2R7EB 3SH3A 5DAWA 4DUYO 1EAH2 5DAXA 3MIGA 2B45X 3OT7A 2JG9C 3MIHA 1XL4A 4R7CA 1SFPA 3X29B 4N53A 4ASMB 2ZKNA 1PP9H 3AEIA 5CA0B 1FJGO 1E57A 1W8FA 4Y1VA 5J1XA 2Q1ZB 4CU8A 1TVKA 3ASNC 3OPTA 2ZGSA 3VBUA 3IMMA 5ACA3 4OZOA 3ZXEA 5JSRA 2TEPA 1KBHA 1RINA 5IVJA 4BYYA 1J83A 1PL0A 1MVQA 4Y1ZA 3WDUA 1UOJA 3AB0A 3AL6A 2DCZA 1IBLB 1SQVH 5CA1A 2HEWF 3Q8BA 3T2TA 4X1IA 2HJDA 1UMIA 3VKFC 1Y74B 3LDDA 4TSFG 1GZCA 1LEMA 5LRRA 1XE7A 1ZA7A 3H1HH 5LHGA 4DUXA 2XJPA 3RYFB 2A9HA 1ZZ7A 2WAAA 5J96B 2FDGA 2LTNA 3H8XA 4IE0A 4Q4X3 5AG2A 4D7YA 2KG7A 5BZBA 3VBSA 1GKBA 4X89A 3I2GA 2Y0IA 4XHBA 3AP5A 4LH6A 4IERA 1JZ4A 2E7TA 2B9ZA 3KV4A 3E35A 1Y4WA 4P9OA 1AJKA 4IESA 5C4WA 4M3CA 4AI1A 4KU7A 3T1LA 4QPIC 1S77D 4GJYA 4AVBA 4QPYA 5DUVA 5LWBA 2L35A 2LO1A 1BCXA 2MW2B 5I93A 4FFBA 5KHIA 1FS0G 3ILRA 3O0WA 2WZR1 5IWAO 4ZI7B 1IPKA 2R70A 4F83A 5BNNB 1FPOA 2OX0A 4ZS2A 5LA0A 3AKSA 3IM0A 1YF2A 1K73W 4PBPA 2WAMA 4NXMO 1DU3D 4GH4B 3ASOC 4O2AA 2D98A 1W8NA 4YVWA 5LATA 1ZZ8A 1KYOF 2AGAA 4CP9A 4DR2O 1XMQO 4JGZC 1I5XA 4NAMA 4RGGA 3BYWA 1B6QA 1SZXA 2BOIA 3BCCH 2VJXA 1W3VA 3OEAA 2CH7A 4PLNA 4FPLA 3LOIA 1TEIA 4LFCO 1U12A 4CEYA 2R1DA 2DCYA 3ZR6A 4JAVA 2QUOA 1XBFA 3ETEA 2YU1A 2UXCO 4JI6B 1IKQA 3BN6A 4GJZA 5FZMA 4I7ZB 3VZMA 1RM1B 5KAFZ 5A3PA 5SV5A 3VD5A 4ZOLB 3FD9A 4AEDC 3DXUA 4QDSA 5FO7B 2UU9B 5GTIZ 4F6EA 4QQOA 4LBMA 4XUNA 1DZRA 2HLEA 2RS32 1PGW1 5I0RA 4PV1B 4CZZA 2ORZA 2D40A 2CDOA 3TB0A 1RUI1 4CU9A 3H8OA 4JTCB 2LALA 1SFNA 2VAUA 2J22A 2B5HA 3SEEA 4QX7A 4B3TO 5LBBA 4CUGA 4V2VA 5K0UC 3CJXA 5C5UA 2IXIA 4LHSA 1WCUA 4BIZA 1IBMO 4R9BA 1R3JC 2ZDIC 3ZXKA 1CJDA 2WS93 4XJAA 4GKXA 4TQDA 5A1FA 5KWRA 5IT9N 5FZ0A 2GNTA 3JAKB 1OSGA 1OA2A 4BIFA 1QHDA 2PYLA 4QT6A 3R66A 4NXNO 1VQ4V 5FZBA 4LF7O 1NLSA 1JJ2U 5EHDA 2H8PC 3B8NA 4CEWA 4M0NA 1M57B 2WNVB 1AX0A 2JEXA 2BNOA 4LFAO 1AF9A 5FNVA 4DY5A 4DV4B 1U97A 4JGSA 2V4DA 2JEMA 5FYHA 4DUZB 3F5TA 5LXTA 3BHPA 3N9NA 1FD9A 4E2SA 4C91A 4R9CA 1NJIW 1QR9A 1K3IA 5CFCB 4X65O 4MSVA 5A3NA 3PIJA 2ZXWC 1KDKA 2VZPA 1KXGA 1O3RA 1VBC1 4EFBA 1XMOB 5J09A 4QGNA 1GQPA 1WW5A 2D43A 1EN6A 1L0NH 4FLYA 3CDZB 3MIBA 2OZ6A 4CCNA 2W46A 1UX6A 5JI9A 1DGWX 2E7AA 2B39A 2JDNA 4DV0B 5JOWA 1N36B 4JKLA 4FOYA 3H3UA 4FPGA 1MQTB 1HQWA 3WY6A 4CDWA 3LEGA 1PGW2 1PO12 2RM22 3L71H 4MVZA 4HFSA 1HKDA 4XOGA 1G9DA 1LGBA 2BE3A 2CTPA 3D8CA 5E6HA 4D6RA 3IBMA 5T5LA 3M3IA 5LY1A 2XTAA 1OH3A 1JHJA 4IGQA 4N7UA 4D6SA 1WGPA 5FP4A 3AK3A 1JOJA 2VRZA 2VR4A 2O57A 1AR91 4EN9B 3OGIB 1WMEA 4FPPA 4QKBA 1J84A 4RFRB 2CU5A 4RQEA 4YGBA 1NXMA 2V5YA 2E26A 3W5NA 1S5HC 4E2GA 2QWNB 2A6YA 2GMMA 3AP7A 4B4QA 5C8YB 1KQRA 1BQPA 3A0KA 3K08A 4AFMA 3VQXA 2YEVA 3GM8A 2CTRA 5ABJC 1VMHA 2DVBA 1UCXA 2DYRB 2A3XA 1TME1 2WA4A 1D7PM 4IV3A 2CV6A 3ZDSA 1RVF3 2ZOEB 4TYSA 1NZCA 4FTEA 2LP7A 1V6KA 2JD9A 3VKNA 2EINB 4YGDA 4LH7A 4JI4O 1W6OA 3MLLA 4TUYB 1FXKC 3B77A 3ACLA 1LUVA 2YXSA 3T30A 4I01A 3HQXA 4DY3A 1SBFA 4CUBA 5DN6G 3AG2B 1YC61 2UWBA 3L73H 2A70A 1I7FA 4UXAA 1SQXH 4AFCA 1XOYA 2X6CA 1K3EA 1SZTA 4CUCA 1FT9A 4K7JA 3NR7A 3AK0A 1AR83 1RUC2 3DKQA 4IEYA 4JI1O 3OE7G 2JGUA 3K51A 4DR7O 2BSKB 1F4MA 1JOPA 5C3PA 4Y1YA 5DMYA 4IT5A 4FPCA 3NNGA 1D4M3 3TNPB 4C0HA 4Q8LA 5A32A 3WV6A 3HPNA 3JD72 1FMD1 4KG8A 1ND3C 3X2QC 5T5OA 3CB2A 2JG8A 3K3NA 4TT3G 4FPOB 4MVQA 1W9YA 2DVFA 4PI0A 1LOGA 1VLNA 2RHPA 2W6IG 3THCA 4O4LB 1LR5A 1SLCA 2Q73A 1OD3A 1AR1B 4ZY9A 3POFA 2LROA 4BK4A 4IE4A 2WKKA 3IDBB 3OG2A 3ZM8A 1QJY2 4UFZA 2ZBJA 2DWEC 3E5UA 4QXBA 4EKWA 2F4LA 1BLZA 4DV7B 4IEXA 2ZM6O 4XF3A 2RMU2 3ABLB 1ULOA 5FCCA 2LW7A 4UCUA 1M9NA 1NA1B 1PNKA 4EN6B 5TSWA 2WUHA 2AC1A 3GZAA 5A7PA 5BNPA 3UL2A 1XE8A 3E5XA 4QPGB 3ZEDA 4JPRA 4JKMA 2PLV1 3A23A 3SCGA 1RUD2 4LKSA 3I3EA 2P5OA 5EPAA 5FUIA 4HOOA 2XOKG 1Z5VA 3S57A 4DRXA 1YJKA 4GX1A 2KB1A 5BMVA 4C8DA 1GQHA 2IBZH 2WZ8A 3OYWA 4IV1B 5FK8A 1Q86W 2Y60A 3AG1B 3VBRA 2W0XA 1KEXA 3IDCB 3VBHB 1JN2P 4D0QA 3JASA 3MIDA 1CN1A 5B1BB 3UM7A 2GC3A 2QQOA 2C1FA 4LBJA 1YO8A 2ZGPA 3W20A 5JXHA 1I5YA 4LBNA 1NKDA 2WC2A 3ZMTA 2RDSA 4LF5O 2ZMKA 1GSLA 4HZ3A 1ODNA 4NVPA 1EY2A 4Q4W1 3WF2A 4UF0A 2FDFA 2XJRA 1R093 4WFHA 3JD0A 3SHRA 5AFBA 2AZ5A 3JCZA 1QJEA 2E5LB 4Y22A 1SDDB 3W21A 2R32A 1YWKA 4QX1A 1H2GA 4YM0A 1BQZA 3LDBA 1URXA 4B7KA 2LUWA 4FAHA 1WB8A 5KR7A 1EN5A 4Q4V2 2JEUA 2YUEA 4W6XA 4G2KA 4EB6B 4RUEA 3MF6A 1EM1A 3VZJA 3U4XA 4D69A 1WCKA 4HKLA 4CDXA 1KC8W 4HZFA 4TV9B 2I45A 3T08A 2VZUA 3B2EE 4DS0A 4J25A 2MEV3 3NVCA 2ADQB 2JB8A 1QH6A 1QNYA 2VWJA 1OFNA 2IUWA 4E4DX 1RMU1 3NW4A 3N2KA 4ZU5A 3RYRA 1BBT3 3UQ8A 4AHXA 2Q0AA 1V6OA 2GP3A 1CR7A 3O12A 5IATA 1ALYA 5IYDO 1WPBA 1K5SA 1S0VA 1FFTB 5E89A 5FZ4A 3D3QA 3RRDA 4JTOA 3SGIA 1OZ0A 1V9PA 2ZEWA 5EIBC 2ERFA 5DDJ3 2DMXA 4N9HA 3G4SV 3ABUA 4DR4B 4QE7A 2G9ZA 1W3XA 1L7QA 3SITA 3OF1A 5C9AB 4CC5A 1I9RA 3MHHC 4I3PA 3LDKA 3RFRA 3IKWA 4DO0A 4QXHA 4WVVA 2DU0A 2XAJA 2ZX3A 3WNKA 3OY8B 3BFRA 1C8M3 3VBFB 2J1EA 3GWOA 1LRHA 2QQKA 1G9CA 1WZXA 3CMAV 5IHRA 1KD1W 3FB5C 4B3NA 2VQAA 4I30A 4FQZA 3VUOA 4AEKA 1FYJA 1GBGA 1TQ5A 5AVAA 3RYCB 5BR8B 2JDAA 4IE6A 4WBBA 5KC5A 2WAOA 1PIV1 1X9TA 4QQHA 1Q8IA 4JI8O 3NSTA 5B4NA 2IJKA 2YC4A 3AYEA 1K5JA 2HWB3 4FOWA 2EF6A 3FAVB 2LFSA 4N43C 1YHQV 2WBKA 1VQMV 2OCCC 4P08A 3WDTA 2B9VA 1KB9F 1U5XA 1G8WA 2JKXA 1N3OA 2WQ8A 5J9PC 1TMF3 2BOJA 4P9YA 2Y6JA 3TEWA 4YZ1A 2WNEA 2YXHA 4J42A 3SYOA 1ENXA 1BEV2 2JJ1G 2Y33A 1NT2B 1XC6A 1GWMA 2GDFA 1JR9A 3ZJZA 3I59A 5FO9B 5GZFA 2VTXA 3RWRD 2YYOA 1XNBA 4CRQA 1WMDA 5CMUA 1YEWA 1E5HA 3USUB 3HN3A 2OXBA 4BPZA 4JDOA 3WR0A 2ATFA 2BGCA 4JKKA 4JI6O 3RT3C 3OEBA 3G6BA 4NWWA 4YZ4A 1PNMA 5CB4B 1W2UA 5DUXA 4PA6A 4LTAA 1YI9A 2V72A 3B00A 1JODA 4LF8O 2I2SA 3CYOA 1D4VB 1V6NA 2VMHA 2YXYA 2ZEZA 1W6NB 4HNAA 2QJVA 2W08A 1N1VA 2OS2A 3QOPA 4BWAA 2WWWA 3T1CA 1BXHA 3ZSEA 5FFOC 4HPKA 4MVOA 1O5LA 2R072 1CZTA 2CTQA 1WKYA 1VQ6V 4DV2B 5C71A 5D21A 2RS52 2WPDG 4QX2A 3V65A 2X7RB 2FMDA 5GALA 1V54B 1SA0A 2WWUA 4P9WA 2ZEYA 2NN4A 1AUYA 3VBUB 3DSQA 4NIHA 3IGAC 5LW9A 4MZUA 2XHNA 2UUBB 4EE2A 4Q29A 1CAVA 5JXIA 1CWPA 3OR7C 3CF6E 1W2TA 2P6JA 4CH4A 1R3IC 1N1TA 3TK1A 2UUCB 4DQAA 4X1IB 5A6YA 2EIKC 1WP7A 1W2BU 2BFUL 2XAHA 1W59A 2CK3G 3TWIA 2DTWA 2Y69B 2OA2A 1OV9A 5JI7A 2KG7B 3VBSB 2HHHO 3PUAA 4X20B 4WM7C 3KF3A 3AM2A 5KA5A 2GMEA 1WAZA 1COV1 5KHHA 3KVAA 3TBDA 3ZHRA 2X5IC 4JQTA 1WLTA 3L9DA 5C4WB 4WFEA 3RS6A 4M3CB 4AGVA 2ZX4A 3FFQA 2OCHA 1VF5B 3AZZA 3FX7A 1D0HA 1W6PA 3ABTA 1ROPA 3WB1A 4FFBB 4DW0A 2OUJA 3BRCA 2PXJA 3MICA 1PHMA 3NNJA 2YV8A 1JZ6A 3RWNA 5FPLA 4MT8A 1OCCB 1N36O 4G27B 2W1QA 4QM8A 3ZRXA 2JDHA 1VBA3 2OYZA 2D3RA 2AXTZ 4P00B 4UVBA 3FBMA 5A7WA 3UGGA 4JI5B 1JUHA 4RS5A 3CEIA 2NM1A 3FLTA 1J3RA 3ZN6B 2WO2A 5J37A 3POYA 1BCCH 2CH7B 4AEJA 5IJ0A 1HJGA 4DO2A 4M3CF 4WFAV 3DC5A 4CEYB 3H9VA 2XPJA 4E2LA 4A7YA 3VZOA 1WCSA 2JDIG 3T2PA 1FAFA 2BNMA 1GICA 5DAVA 5JZGC 1VBD1 4MGYE 1O91A 4CPBA 4UB6Z 5BNNC 3JD2A 3BU7A 2Z5UA 1PNFA 5CFDC 3CCMV 1Z7S2 1THZA 3OTFA 3FN9A 1X59A 3NL1A 2QDOA 3CE2A 1VAKA 4A45A 1IOAA 1PGSA 3D5OA 4XUOA 1E5RA 3AK1A 1HB1A 1OOPC 1KJLA 4J7KA 1V9U1 3AJYA 4XDQA 3MDPA 1GNZA 4QX8A 2JD4A 1O9GA 2P67A 3VHOA 2WLJA 2X6AA 4GQ7A 3J7NA 2EVXA 4OXSA 4YFZA 2Y48A 4JI3B 4QNHB 5JH7A 4B3SO 1LR1A 3CC2V 3WP4A 1UOBA 4XDOA 3OD4A 1LECA 4AHYA 2ZGOA 3L72H 2X05A 5LBQA 4YM3A 2AHYA 5A9GA 2QZ3A 3UETA 1NS1A 1RUG1 3IJ4A 4PDMA 3OGJA 2XOMA 4KWUA 5FMOS 4JGYA 4LC1A 4MTFA 4I5SA 5A70A 5T3NA 2BU9A 1F8VA 4XBNA 2GH8A 2WQ4A 4QPWA 4BB3A 3AYAA 5FNVB 1PGL2 5K1PA 4UBGA 1UZ0A 1DQ6A 1SCSA 4BQWA 5ACA1 2XVLA 1B09A 2BEOA 2GAUA 2BOBC 5LXTB 4O9GA 3ZPOA 1KP3A 4NRQA 1EFRG 3NAPA 2ZE5A 1UMZA 4KGGA 1PPJH 4UV9A 2BPA2 2QKAA 3HKCA 4I3GA 2XJQA 3VDCA 1FV2A 3ZYBA 3P3NA 4PA7A 4ZXEA 4QX5A 4LORA 1TUBA 2ZKOA 4ZPIA 2NZ9A 3KWVA 3C8XA 1S0GA 2RJZA 1CPYA 1G86A 2VMGA 4IGGA 1P49A 1K4DC 1MS3A 3CZJA 4DXZA 3ZHUA 3MV01 1F31A 3KT4A 2NMOA 1RUH2 3RN4A 3CRCA 1RGSA 5KX5A 4QE9A 4CDWB 1OVPA 2ZE8A 2TNFA 2LW8A 5A3UA 4LHLA 5FZ6A 3A0BZ 1VQ7V 3LEKA 2YGMA 5L9RA 1ZRFA 5EK0A 1H9WA 3W5MA 2DWRA 3ZR5A 5CFCC 5EBLC 3RW0A 4AR2A 3UK9A 4YFWA 4D7TA 2DF7A 3A0HZ 3SNMA 1LODA 1LNQA 4YW7A 1RHI3 1SQPH 2GC1A 1H2MA 4JYBA 3OR6C 4FVMA 1QJU1 5DEDA 1TAEA 2VZVA 2ZGNA 2UY9A 5CKNA 1HR0O 3CRAA 1H2SB 1WCDJ 1HNXB 5HPOA 2XNDG 2EIBA 1ZBE3 1F51A 1MQTC 3BA9A 5IYZA 2WFPA 4CS2A 2YB7A 1MEC1 1AL23 1WD4A 3CRMA 5FZAA 1RUF2 5FKCA 4I0WB 1PVC3 4IV3B 5JSPA 5JR7B 2VW1A 4L9BA 4HMZA 1FOD3 1OA3A 2JVDA 1LENA 2FDKA 4ISQA 2W39A 1X4TA 4LT5A 2Y6LA 1W6OB 3RMYA 2LGWA 5KHJA 4AVTA 4YW3A 3N36A 2JRIA 4I09A 1QLNA 2V09A 4LBOA 3ABMC 3O1TA 2FDIA 4MVUA 3RYHA 2HBUA 2X8KA 5KXEA 1NT0A 5LK7B 3TNQA 1K5MB 3NXSA 4DOUA 2XJSA 2WSVA 1W2AX 4LUMA 2ENRA 4KHPO 3ES1A 5GLUA 3T2OA 3TRSB 3L75H 4QDQA 3WDVA 5M0TA 4XQDA 4OQ9A 2E3CA 4Q4X2 3V0AA 3THDA 2WS91 1B04A 1EV12 2AACA 4AXOA 4Y4RA 2R30A 4PD4F 3B93A 5EP9A 5A32B 2EINC 4NTXA 3TOJA 2WDBA 1OQDA 2RE9A 1XPWA 2JG8B 1UOGA 4DR4O 1YUDA 2PHLA 2OTLV 2PHUA 4LF4O 4GZ9A 5FK7A 4X66O 3AG2C 3NQHA 1EBOA 1DQ5A 2VZ1A 3LAGA 3Q8FA 5B2GB 2QQJA 1NLQA 3TN93 2VBBA 4OI4A 1JI6A 2E31A 2M7WA 1A8DA 3M8AA 5DUWA 4GWIA 2D6OX 1Q8VA 2CAVA 2W47A 4ORFA 1NTZH 1GZ9A 4QPJA 3N2GB 2RNBA 4HVRA 3IDEA 2NLJC 3DECA 1RB8G 4JI7O 5IJ9A 2WO7A 3HNBM 5BNPB 2QM7A 5FYTA 3B09A 1JS9A 4L2NA 3K0DA 4YJ2B 4LMFA 1K33A 3UGFA 4AQYB 3HB3B 4RR3A 4YJ3B 3RYKA 1Q5OA 4DRXB 1XE0A 2FDHA 5BMVB 3BPZA 3M7AA 4DK1A 3PVBB 1HW5A 3D82A 3N4MA 3OYWB 5FZGA 1QQP3 3WF0A 4A6SA 1NBMG 3VBRB 3SMHA 2Z79A 4JRLA 3JASB 2G9FA 4NAOA 2VCBA 1S4CA 2W68A 4E4SA 2GTAA 1AYN3 1IQAA 2MK3A 1VIBA 2WLLA 3RZMA 1JCHA 4UVAA 1QCEA 4UF0B 4C1XA 3VD4A 2EAKA 1XJAA 3E8GA 2AH2A 4NO4A 1QNWA 2KSDA 4JDMA 5D2AA 3OUFA 1FNYA 5A3TA 3CJHA 1LJ7A 3Q8AA 5FP3A 4Y22B 2DVGA 2CTVA 3K79A 1REFA 2F66C 4NMIA 4HN1A 4AI8A 5GZGA 1CZSA 1A3KA 5B3SB 3JB4C 4E8CA 2DTYA 5T5PA 1N32O 3SYAA 1PK6C 1ST8A 1NTMH 1N1SA 2WR9A 5IYYA 5C33A 1W8OA 2HVKC 4TOIA 4CDXB 4XFIA 4RQPB 4WZCA 4X64B 4NIDA 2EULA 1ULEA 3ZMOA 1VPHA 3MW2A 3POSA 1HNZB 5FZ9A 3N2KB 1W05A 2JX9A 3N9MA 5JVDB 5FJHA 2WZR3 1SEFA 1REEA 4FVVA 2WNUA 3O1UA 3T1YB 4OUMA 5J98B 4Q2FA 1XILA 1AJPA 2JDKA 4GB33 1DZQA 2QWRB 5ERLA 3P5BA 3D0JA 3CXCU 4YM2A 3RZLA 1N47A 3VKMA 3FMGA 2WLIA 1H8HG 1SLTA 3MI8A 4IEZA 1AP5A 1XU2A 1VQ8V 2DBNA 1AR81 1TG7A 2OZJA 4BDVB 1QQCA 4NYKA 3W59A 1IPSA 4FPYA 1AILA 1Q90D 1X8MA 3ZSLA 2XVKA 1NVPB 2D6LX 3J9SA 4LPLA 1D4M1 2J1AA 1CPNA 1KS5A 4CUAA 2BERA 5JAXA 4AGRA 4YY3B 5EYXA 4BU2A 1PM4A 2HWC3 4DZGA 4XW3A 3NNFA 5BY1A 3WINE 4XJ9A 5FPAA 5FY7A 4NRMA 1RUI3 4AFBA 3MLKA 4NWVA 2E51A 2CGPA 1JYIA 2HEVF 1QU0A 3HR0A 5DQ0A 1WW7A 4KMQA 4EZ4A 1AX1A 5C9AC 2QA4V 2ZX1A 4E8DA 4L11A 2RJLA 5AC93 1YZBA 2GZWA 1RUJ2 1NE6A 1BJQA 2VMDA 3U1XA 2XH6A 3V64A 3CCQV 5H5NA 3FB7C 3I56V 5CEHA 2KQXA 5F6LB 1DTOA 1BMV1 1OKQA 1SBDA 3MF9A 1TNFA 3I59B 4LBEC 1YRZA 3OEEG 2EIJB 3ZOIA 3CJIA 4AVCA 4Q20A 3PN1A 5JOZA 1YLLA 4KFMA 1RVF2 4QKDA 4XILA 1C3HA 2EILC 2P34A 1GN4A 2GV9A 3H3ZA 1J1LA 5F8PA 1UYXA 3GALA 2PHWA 5F39A 5CYYA 3EJKA 3SPCA 1KECA 1R1A2 3GXUA 4RHV2 2Q8CA 4H7MA 3THPA 5I0SA 5G04L 3AL5A 4HNAB 2P7TC 2H0BA 5KA6A 2FBEA 4HPKB 5LL6Y 5D8AA 4XDJA 3L2YA 1G9AA 3OEHG 1UQXA 3D3IA 1FPN3 1XL6A 1T6GC 1SF9A 1R091 3VL8A 3HBKA 3CD6V 3ZYGA 3T09A 1SA0B 4AQ2A 1VBC3 1YFXA 1W2OA 2YICA 3APBA 3ELNA 2CWSA 2DURA 2J1TA 4LOTA 1D4M2 3RVZA 3KGZA 1ND2B 1SS3A 4YHHB 1DF5A 1Z2GA 1J1TA 1UZZA 5JDBA 4DXRA 4MG2A 4WFGA 4Y1UA 4OHXA 2Q1FA 1IG0A 4PI2A 4TN7A 1Q3EA 4I2OA 1VBE2 1K45A 3POWA 1OPMA 4CH3A 1W0OA 1SBEA 3WUCA 1N33B 5L9VA 3QCWA 3S7EA 2MEV1 1ZSPA 2VULA 3FKSG 5A7OA 4BQYA 4KUMA 1WCQA 2ET1A 1AXYA 1ENSA 1BBT1 2VOVA 4K40A 4IETA 3VDBA 2A6XA 1RL3A 4K0KO 1V54C 4JYCA 1AR93 2RS12 4MXVA 3VBUC 3ZYIB 1FXZA 2P5BA 3M8LA 5LA6A 4EQVA 5FLHA 4H33A 1SLLA 4H13B 1W6PB 2A0LA 3FLRA 4NN0A 2R042 2GBOA 1LTEA 1ZM1A 5A1LA 4RYDA 1OCOC 4RD7A 3IPVA 1H1IA 4EV0A 4W8JA 4OX9B 2DUPA 2ZIMA 4TV8B 4AVVA 3VHRA 3NO8A 5T55A 1TME3 3EO6A 3WDYA 1J3PA 4E2QA 3U07A 4OI1A 1V70A 3SR2C 3LE0A 1C8M1 4QPIA 3BAAA 3VN4A 3KCYA 4O4IA 5A7WB 4QKNA 4XDLA 1GH6A 2L9LA 2ZR2A 4RS5B 3GCXA 4MOAA 4K3UA 2GHYA 1WA8A 5IVVA 4DW1A 3J4UH 5IJ0B 3G7DA 3HT2A 4YLZA 2WNOA 1VP7A 4K1YA 4A4AA 4DUYB 3KZ4C 5L73A 1O4ZA 2DYCA 2Q67A 2WIIB 4U36A 4F7ZA 2DU1A 2YBSA 3SPHA 1FJGB 1OBNA 1TMF1 2PMWB 3I4IA 2XBO2 3N7JA 1JBCA 4AFAA 4MXWA 3E6DA 1HNXO 4BQ4A 4R52A 3ETPA 1I3HA 4Y3OA 3WW4A 2FCVA 1PL4A 4GD4A 4Q0SA 2Z2SB 1MPXA 4PQQA 1PMHX 5CA3A 4DR5B 5G05L 1ACCA 3LSUA 3RJ2X 1IVSA 2RR12 1VMGA 1Q56A 5BV6A 5FLJA 1HW7A 3VHNA 5GONA 4AEDA 1M4WA 2VECA 2W9XA 3L2HA 1OPOA 3ZYPA 3ZMNA 2ZA9A 4INDA 4HK9A 2HWE1 3DXTA 5LASA 5HFLA 1M56B 1QJX2 3A7QA 5JH7B 5J2TA 2ZXQA 1ZYBA 1XHZA 1LESA 3MUZ1 5DDJ2 1VAVA 2QFEA 5C3SA 3USSA 3QO8A 5K0UA 3JBG3 4JGYB 3DUIA 4Q6GA 1H9PA 3G6EV 3K9AA 3NNLA 2PFWA 1W9SA 2PGGA 3ZRWA 2ZDIA 1QR8A 2RV9A 4MX3A 1UF2C 1R3LC 4OHVA 2W6JG 1AXKA 3M3CA 4CCLA 2Y0PA 3OD0A 4BIOA 5IWAB 1C8M2 5JXJA 5FPUA 1JYTA 3ZRVA 4IE7A 2A73B 1Y9GA 3NAPB 2OIEA 3U4SA 4AF9A 4N90A 1G7YA 3B9IA 4XHXA 2VVDA 4XETA 4NXMB 4E9KA 4EYUA 5FYIA 3DPRA 1ZZCA 1HXS1 1J59A 2VUCA 3MPPG 4DR2B 1XMQB 2DCTA 5HCHA 4J6GA 5IFTA 4MGSA 3JAWA 2HWB2 2GSYA 4JZ2A 2K46A 3WF3A 5FXVA 3F2ZA 5JJEB 4LFCB 4COYA 5FV3A 3UO2A 4CH6A 4DV5O 3OUSA 2CY6A 3VQVA 2XASA 2UXCB 1RIRA 3J26N 2L6LA 2O14A 4P9JA 1YYNA 5KX5B 4OUSA 4MH0E 2F4VO 1JU4A 4P30A 1YIPA 5A1AA 5IY5C 5HCFA 3E6BA 4Z07A 2YPDA 2XAQA 3JB8A 2IVIB 4X88A 4XF4A 3GZEA 1R082 1ULDA 1NR7A 4TZDA 2VQEO 1H38A 4PF5A 3IIIA 4LF6O 4YGEA 1GZTA 2WFF2 5KAIZ 4KBZA 2BWCA 5IK5A 3WF4A 4QHBA 3KQ4B 3AKPA 1CONA 3THTA 4B3TB 2OT7A 5LEJA 1XNKA 1VBA1 5JMCA 2WRAA 1GN2A 1RMU3 3OUIA 3BUCA 4BLIA 3WQBA 5KHGA 2HG5C 5JCTA 4MW3A 5FMBA 1F15A 5B66Z 3CCSV 4I50B 5IYZB 4NROA 5L19A 4IEQA 2WZPP 1GP4A 3MV11 4P9IA 3DTUB 4GWNA 2PELA 4NXNB 5LGNA 1PMJX 4TWTA 4CDUA 4LF7B 4FLZA 4FIPC 4AYUA 4BQ3A 1WNSA 5IFPA 3EBRA 2ZKLA 2E74B 2K1EA 1Q81W 3M4FA 1H4HA 4LFAB 3MBWA 1ZZ9A 5ABJA 4DR3O 5CBGA 1OJHA 5F3EA 4Z2AA 1UAIA 3RYHB 4QU1A 1SHWB 5IAXA 5FAXA 5FUNA 2VY0A 1RJ7A 5IAVA 3WNNA 5CB7A 4X64O 1ZTEA 4F8AA 3WG7B 4KWLA 2Y0OA 4YWAA 5A7SA 1AB3A 1MG1A 1TVGA 5H6QA 1PZ7A 3RBZA 4XJUA 4BCUA 3ZN5A 1K7DA 2W0FC 3I2IA 1FXKA 3OBTA 1U0AA 4YXWG 3IIAA 3V0AB 4N23A 1O4YA 1ZBA3 1WPXA 4RUFA 4J11A 3T1YO 2O0OA 4GULA 4JI2O 4HG6B 4IUGA 3SC7X 4GXLA 2ZZQA 2A5ZA 3CZUA 1NCRB 4J1XA 5LCWL 3JXSA 2EIGA 4JVAA 5LOVA 3WHTA 5C6CA 3MUY1 5KLVH 4BE3A 4BMEA 1K5MC 4JHZA 1N4CA 4TXWA 2F95B 2EAAA 2ODMA 2OQ6A 1VRBA 4Q1PA 2WQZC 3T2QA 3CC7V 1ND3A 5A33A 4JZRA 2CDPA 3OB8A 4XJWA 1UPSA 1E79G 1XEQA 2WL1A 1GKFA 1GYKA 2Q8OA 3MPBA 2EIMB 2YPJA 1E5IA 2PHTA 2TUNA 3WFVA 5FPVA 5IJ9B 4Y5Z0 4LLFA 2W91A 1K5QA 1BYHA 1X33A 5FZEA 1O3TA 4UFMA 4MGKE 1EAH3 4COUA 5EXOA 2JGDA 2EX3A 2D6MA 1PX3A 5IYBO 3R0RA 4L87A 1SQGA 4PT6A 3V56A 4RR3B 1PVXA 3BTYA 3JQWA 1QOSA 1OKOA 4H7LA 5L9BA 1YCIA 2VTXJ 3WP3A 3CWBH 5GLVA 5IW0A 3I2OA 2QQIA 1GWKA 3VDAA 1UX7A 4B8EA 4JI4B 3ZFFA 1TGOA 2VG9A 3CS5A 4G28B 1BS3A 1DHKB 3PJQA 1Y9QA 2HWD2 4Z92B 1JYNA 5FQ0A 3O0VA 2QTOA 4LFBO 2N7GA 2CGOA 3K4DA 2YFUA 5EQUA 1RHI1 3CJHB 3KVBA 3WNLA 3DXRA 2JIJA 3QD6A 2XJUA 5FMDA 3I3MA 3KHCA 3KV9A 3OGVA 3ALQA 2ZINA 4OCTA 4JI1B 1QXPA 2YFZA 1GN6A 4DR7B 2VOWA 2NQYA 1JVMA 2ZGMA 2RMKB 2HWF1 4IHJA 2SBAA 2CE4A 2F23A 1R6NA 2ZCEA 1ZBE1 4LEJA 3VBRC 1CP9A 1NVPD 4YIOA 5FP8A 1PM9A 1LCLA 5T50A 2FB5A 3LD8A 4QB1A 1AL21 4C0BA 3HQUA 1VIWB 5CVRA 3RZGA 3OGCC 4Z1MG 1D2QA 1PVC1 3BTZA 1W90A 1B35C 3OUJA 2HYXA 5KXBA 3FYEB 1FOD1 3OSDA 4FI9A 4S2GA 2BFUS 4XFGA 2BTOA 4LBQA 4QM9A 1A8MA 2VMFA 3O65A 2GDSA 4PDWB 3QO5A 3BCWA 4YHHO 3ZPYA 5EYPA 3PU3A 4IL6Z 1X82A 3ZIXA 1LOEA 1GMMA 4G3YC 3BODA 2ZM6B 4DB5A 5B3SC 4HN0A 2G19A 3AVSA 2YIBA 2OQ7A 5KXCA 5LGTA 4X1KB 4IW3A 1VQPV 2G38A 2J7MA 4OLLA 1VBB2 4DINB 3FB8C 5IJRA 5H9QA 1QOTA 4KL1A 4ZHQA 3LFIA 4CDXC 1JMUB 1XNTA 3POBA 5D5QA 4ZU7A 4RQPC 4JX0A 2C26A 1Y76A 1QLEB 2CHHA 4ZBMA 3BVCA 2ZHMA 3LA7A 4MVRA 3I7DA 4LBLA 1PO22 3RYIB 2GUZA 1VBD3 2RS33 1JXNA 1AJNA 1OUSA 1ONAA 1M93A 1J3QA 1NR1A 4DV3O 2ZD9A 3J7AU 3K5NA 4JV5O 3AP9A 2ETEA 3T0DA 4WFBV 3PDQA 5L7OC 4NPRA 2OYQA 3OBZA 2ZE7A 4NTWA 2QM4A 4LF5B 1NYWA 2C9AA 3BTXA 4JAUA 4B1LA 5CG8A 5F3GA 1P7BA 4A6OA 3GVMA 1ZL8A 2A6VA 4FM1A 3FC0A 2ZABA 4O4JA 2I07B 1AR5A 5KHKA 2RDRA 3ASIA 4IEWA 4YARA 1IDSA 1SQFA 4LOSA 5C93A 4I0BA 5FDBA 1YQ8A 4JYAO 1UN1A 1S0CA 1O3QA 3ETDA 2DQ3A 1RSOA 1NU1H 3CCUV 4KGQA 3VQYA 4N43A 3CJIB 1YJNV 1PVC2 1RUG3 2R062 2ZAAA 3K04A 3TYJA 4H55A 2A3QA 3WNOA 4YW6A 4CCKA 1HB2A 1QQP1 1XSQA 1PKXA 1V55B 2EIEA 3AZWA 2XL9A 1OMIA 2A6WA 1ZVFA 1AYN1 5L3FA 1R1BA 3J8F1 4XBLA 4DR5O 3ES4A 3P30A 5D8AB 1IZ3A 3N9QA 1C1FA 1NY72 3JATA 3HR9A 1YJLA 4P5YA 2ZIOA 1GOHA 3M70A 5JWPA 5IUQA 4S2FA 2GC0A 1E5SA 4W4ZA 5LY2A 4OHZA 1BHGA 4UAPA 1Y6XA 2ZAHA 4H0LB 1GV9A 5EFUA 1IXBA 3E8BA 4I0XA 1EPZA 2DCKA 3NV1A 1AR72 2BNNA 4YZ3A 2PQQA 1F4HA 4K21A 2CNAA 3N27A 1CPMA 5EIYB 2V4AA 2RM23 4BXFA 5BPXA 4WM8C 4YG3A 3KCCA 2PF4E 4Q4Y2 2A7WA 3ACGA 2BTQA 2QNKA 4NKGB 1N34O 3ASNB 4FMTA 4AAPA 4HYOA 2QDNA 3R4SA 4JI0O 3TN92 1N1YA 4K8RB 3BOWA 2ZNJA 3HPLC 3S3WA 1DQ2A 5A80A 4FTBA 4JI8B 4CXYA 4I4TA 4UFKA 1ZLZA 3DCQA 5EV7A 1QOOA 5JCOC 4FBFA 4GB31 3WW3A 4LHNA 2XG3A 4QHOA 1QJU3 1HDKA 2VMCA 4LIVA 2B5UA 5LA6B 2PHDA 3SH4A 1ND2C 4HK8A 2AEYA 4BXSV 2EA7A 2BWAA 3DYOA 4RQFA 3O1VA 4GT1A 3K2OA 3G71V 4OHWA 1H8TA 5SV8A 2B46X 3EYPA 4XCBA 2E9QA 3BALA 4NPMA 4UW3A 1YJ9V 3LSEA 2EZPA 2W1WA 1MEC3 4WM7A 4DR6B 4H3WA 1GNYA 2IZWA 1XYOA 2X5IA 3VBOC 4MS2A 3THOA 4AQTA 2D97A 4LP8A 5FKBA 1KRIA 4QPIB 4NIIA 4QQ2A 3IDAA 1QJZA 5LP6B 3GHNA 5JPMB 4O4IB 5H9PA 1W8HA 1DLLA 1SERA 2FMYA 2WT1A 4LF8B 1VE0A 2HWC1 4EWDA 1WA8B 2Q8DA 2DVAA 1L1FA 1F23A 5LMUO 1XNRB 4FFFA 2C0ZA 5CADA 1JOBA 5LA1A 4KI5M 3HIFA 1WBLA 1RUC3 3H9AA 4LO8A 3ECQA 3CEWA 1W0KG 4IEUA 3FWEA 3INAA 3WX5A 5JXGA 4TLFA 2UUAO 3ASOB 3LUTB 5LYJB 4HVOA 3ZFGB 1QDCA 3OMNB 2JE8A 5AC91 2UXNA 5EC2C 4KP4A 3K06A 4MXWB 2PA7A 3CU7A 2XQRA 5B1OA 4DMIA 4ES8A 4V2WA 5K4LA 3KF5A 1DYKA 5JOXA 1B06A 4DXTA 3QNEA 4NPLA 3OTOB 3NJVA 1WUVA 4RA0A 5JZGA 1OCRB 3VDDC 4BMBA 5GONB 1MMMA 4MVMA 4AEDB 1CEZA 1OF3A 4LF9B 3HMYA 4A42A 3K4ZA 3FZ3A 1QJY3 1UKRA 3NMBA 4OGQB 1R3KC 4MW8A 3A8TA 1X8EA 2WZR2 2BW8A 2GC2A 5CFDA 2HP8A 4XFAA 1VAMA 5AVPA 5J2TB 5BYNA 1UXXX 2AREA 1G6UA 1JZ8A 4IXLA 1US2A 1UY2A 1WW4A 2HHHB 5FWEA 1J5EO 3TXSA 1DLBA 3WQ1A 1OOPA 1MSDA 5CAZA 4U3FH 1AYM1 5D5PA 2BVVA 5EZYA 3LPFA 5K0UB 4XFFA 3OW2U 1I94O 2LW1A 1SLIA 4R4XA 3GWKC 2HVJC 4NB5A 2W3JA 1FPN1 1UYYA 1AVBA 2NMNA 3WQ0A 3W7WA 1RFYA 3ZRWB 3K57A 3UNPA 3UKMA 1ZRRA 3IAQA 4O2BA 4CDQC 1C1LA 3IFXA 4J7JA 2RJ2A 2IU0A 2JE9A 1VRH3 1RJ8A 2JDZA 4JQRA 2K0GA 4WFFA 1V00A 1F5JA 2WN3A 3MIFA 2WO3A 5A6XA 4FFHA 2QWPB 1QVGU 2DE0X 1H0BA 2Z4FA 4HSLA 5BNOC 3K5OA 3DPRB 4A7ZA 3HKEA 4GKKO 1RUI2 1UPIA 2VUJA 4NHLA 3JAWB 3I2JA 5FMCA 1DZTA 2Y4UA 3PNAA 1LOFC 1PNLA 5E1AC 3ETGA 5JLVA 5CBFA 2LQTA 2BDRA 2IFWA 1W6MA 4C7UA 2ZXWB 4YVSC 2ADPA 2WINB 1A34A 2WN2A 3ZKYA 4Q4V3 3WSOA 1SMVA 1AJOA 4SBVA 5GLWA 5FY8A 3NAPC 4BISA 3VZNA 2Z69A 2KKWA 4V1PA 4FCAA 2X09A 3FFZA 1VF7A 4DUWA 4LUKA 3OPZA 3ZX6A 3R65A 4K8FA 1UYPA 3AMQA 2XT9A 5E79Z 5FLXN 2K9ZA 1MA1A 2IJIA 5IE9A 2PHXA 2WT0A 3LIGA 1LHWA 1S2EA 1ZNPA 4GKJO 4Y26A 3B8MA 2QM8A 4DYLA 2PZSA 5I0DA 2HLDG 4B3SB 1H6YA 1SQBH 2ID4A 5F37A 2J1SA 2AW9A 2VXRA 2ZMNA 1NH2B 5EBMC 3LIHA 4Z82A 3Q8CA 3MIEA 3S0MA 2ITDC 4CCOA 2HYKA 4CDUB 1P4RA 1VBC2 2IC1A 4E4EA 3QBQA 1B3QA 5LK5A 4PDRA 2DUQA 3H1LH 1S1AA 4JZGA 3P32A 1A6CA 1MQTA 3HN1A 2XQXA 5ABJB 4I9WA 4MVSA 4AQSA 4UVCA 1HV1A 5F5CA 5FY4A 3ZHSA 4P5HA 2Q4PA 1Q6HA 3RZHA 1V6MA 2H0VA 3U37A 1ORQC 5DAQA 1S0JA 4NOTA 4UBHA 1DK1A 1SACA 4FM0A 3W58A 3RI9A 3RJRA 4PA3A 4DV6O 5FXXA 1W8WA 1OCZB 3AFGA 4W50A 1W03A 4HSJA 1AR92 3WW2A 2AENA 1X9PA 4XFBA 3POIA 4URAA 1V6JA 4XQWA 2R0FA 2Z0AA 1BEV3 4JTAB 2BUKA 4YZ2A 3BY6A 5KC6A 2WJSA 3ILNA 1QKQA 1POQA 3JBG1 4QX0A 5LOVB 3K48A 4WZFA 1IQDC 4FTSA 3ZHQA 2QGNA 1COWG 3ZN0A 2G4IA 5A3MA 4QIWF 2CUGA 1DGWA 2VNGA 1TME2 4B3MO 1FFXA 3IAPA 3S30A 2FCTA 2EALA 3BKZA 1ND3B 1KFXL 5A33B 2A06H 4CP0A 5FZOA 1CZVA 2FKXA 4ZKTB 4OMCA 4NR1A 3BA8A 2QR4A 3I49A 5IYCO 5FZCA 5GW7A 4D6QA 2EICA 1CAUA 1GLHA 1OVSA 2JICA 1HR0B 2AHZA 5FJKA 2JGDB 4CU6A 5FYMA 4PDLA 1NCRC 4LO4B 2R073 2KD7A 4B3RO 4AQ6A 1TA8A 1YTFB 2ZQMA 2JE7A 3MHSC 3TEYA 5C8CC 1LHNA 4DV1B 4H37A 1VQ9V 1MS4A 1SCRA 1H30A 2QQLA 2B7YA 5DN2A 2WLKA 3ZFFB 2DJVA 4ITCA 1UKGA 3VHPA 1JZ2A 4GWMA 1FMD2 2D5FA 5FQ0B 4JRAA 2A7AA 4TTGA 1R6TA 5GZCA 4WCEV 4AOCA 5FYVA 1Y7BA 4OPHA 4LWSA 4JC1A 4KHPB 3M2MA 3DXRB 3DC6A 4RR3C 3PL0A 1URFA 2QE3A 1CXZB 1W8TA 4A3ZA 3WZ1A 3JD3A 3K3OA 2D3PA 3N7KA 4IHJB 1S0IA 4GKYA 3OBAA 1XREA 5JOYA 4ASKA 1D5AA 5BXXA 2A3WA 4XFCA 4R8HA 1KKCA 2RDNA 2ET7A 4IDZA 3KV6A 4Q0QA 2WLHA 1PZ8A 1K97A 1W0PA 3NKTA 3OGSA 5DM6V 3RVYA 1WA6X 3U0ZA 2QCSB 4LF4B 2PLV2 4IEVA 1E1QG 3D0SA 1NQDA 4X66B 2BP6A 1F4AA 4LBQB 1BQ0A 3IC9A 2FCUA 1PK6A 1OC1A 4PQ9A 5BXZA 5FYUA 5EYPB 2DCJA 4P9PA 3TETA 1H1AA 2XLGA 3ZSMA 3WOGA 2VVFA 5IK7A 3VB9A 2XGXA 4Q0PA 1RUE1 1H2LA 3DL3A 2YC2A 2HEPA 3SKJE 1LNSA 2J1UA 4JI7B 3RZZA 3H3LA 5FYCA 4Q4W2 1IS4A 4Q8KA 1AX2A 1D5NA 4ZHQB 2WYFA 1WB7A 1DYOA 4MGTA 1ZBA1 4GZRB 1Y76B 3PJSK 4L97A 2Q7GA 2NYYA 3LEIA 4AHCA 4XXAA 4P02B 3HJRA 2CAZC 2GUZB 4PDWC 5CKQA 2FD8A 3LSDA 4XC9A 4XUQA 3T4HB 5F5QA 4CCEA 2ORXA 4AZZA 3SPGA 1ZRIA 1DQ0A 2VZ3A 1MZ5A 4DR6O 2YIAA 5LMNO 1YIJV 1YDXA 5C3QA 4XUPA 5HV0A 4MVTA 2IXKA 4L8JA 3I3BA 3KB5A 1DQ1A 1W0NA 1UD1A 1RMU2 4O4JB 1STMA 4NTYA 3H0OA 1MS8A 2HWE3 3EVKA 1JUIA 3CXHF 3VKOA 1SC5B 5B1AB 4KH9A 2Y26A 2OKXA 1TZOA 3FUQA 1RSOB 2D3SA 1GO3F 1EAH1 1XNRO 5C3RA 5F6KA 2N05A 1OQ1A 4N43B 4J9ZB 1HN0A 1ZZBA 1N32B 2VOTA 4MGQA 3KT7A 2OCCB 3AK2A 3PVNA 5LBFA 1PMIA 1S0EA 3MDSA 1I0HA 4LNVA 2YU2A 4EN8B 1IHMA 3O0XA 5BNQA 4N53B 4Z1VA 1APNA 1XB9A 4TWKA 2P3JA 5FPXA 4FK5C 5H9RA 3ON7A 2VQFO 2XL7A 5JUVA 3PURA 4NIAA 2F4PA 5T54A 2UYBA 3OY8A 1ENQA 4CYDA 1TVKB 3VQWA 5HFMA 3BTAA 5LHIA 2R16A 5HV4A 2P6HA 2HJIA 1HNWB 1LGCA 3Q9OA 4KG0A 2ZEXA 1YIFA 4NE9A 1WLWA 3OTOO 4XF9A 4HBNA 3PTRB 1VEWA 4P9XA 4PDVA 5CA1B 3VKLA 1UIJA 1JZ3A 5EZWA 5C7GA 4CS4A 3JATB 2EBOA 5FREA 1HXS3 3WG3A 4LF9O 1PIV2 2P22C 3UJQA 4CC6A 1KS4A 1AXZA 3CO2A 3FHIB 3ZXGA 5FPZA 3M7MX 3LA3A 3AJZA 4I0XB 1LU1A 1K92A 3M1HA 1QBZA 2HEYF 3O1PA 5FY9A 4ISRA 2WSSG 2BTVC 5F9TA 4Y5TA 4SLIA 3O5SA 2Z42A 4K9SA 4FFIA 5EC1C 4OPAA 4Q26A 4UYBA 2P4KA 1KUQA 1HP8A 4PA4A 2PYTA 4FXKB 3SPJA 3R4DB 5JQGA 3AP4A 1DG6A 5LEKA 4OI0A 3GB7C 3E89A 1TE1B 2R9RB 2YZ4A 2YG0A 4I4TB 1V6IA 2Q69A 4RN5A 3ZMUA 1BL8A
chains in the Genus database with same CATH topology
3AYDA 4Y1YA 4AVSA 1C8M2 2UYAA 4I0AA 1LHUA 1GNHA 1D0GA 1RUJ1 4FPCA 2XLFA 4L92A 1D4M3 1JYCA 1W39A 2A73B 3NAPB 3TNPB 2HWF2 3V15A 4C0HA 4Q8LA 4AF9A 5A32A 3WV6A 3JD72 1MACA 1FMD1 4KG8A 4N90A 1G7YA 1ND3C 3HD8B 3E6CC 3B9IA 5J36A 4B4RA 4B29A 4XHXA 2VVDA 1C28A 4XETA 4YVWB 5T5OA 2JG8A 4E9KA 3DPRA 1ZBE2 1ZZCA 4RFT0 1DS1A 1HXS1 3N7LA 3I54A 1GR3A 1H8TB 4FPOB 4ZU4A 3UKTA 1J59A 4QU2A 3MPPG 2DVFA 1RUF3 1LOGA 1RVF1 1VLNA 5AFEA 1CAXB 1LHVA 2RHPA 2DCTA 1AL22 2YGLA 1LR5A 3M3EA 4J6GA 1SLCA 1FYUA 1SLBA 4WM7B 2NP0A 2I74A 2HWB2 3ZXDA 2GSYA 3LGRA 1EP0A 3NV4A 2WKKA 3IDBB 3ZO0B 1MS1A 2X5IB 4P14A 1FOD2 1R1A1 4PDWA 1QJY2 2BBVA 2ZBJA 4COYA 1WD3A 4RHV1 3E5UA 2WBOA 5HBAA 2CY6A 4IEXA 1ULCA 4XF3A 1RIRA 3J26N 2RMU2 5HSXA 2UWCA 4WVMB 3ZYJB 4P9JA 1YYNA 5FCCA 5L7OB 2RS31 4MH0E 4OUSA 4OFGA 3ZX7A 1NA1B 4Y20A 1YIPA 4EN6B 2B8MA 5HCFA 5TSWA 3GZAA 3E6BA 5BNPA 5T5JA 3UL2A 4Z07A 1XE8A 3SXWA 3R4UA 2UY8A 3JB8A 3E5XA 4CZSA 1NX4A 4QPGB 5JVVA 4XF4A 1XNCA 2PLV1 1U5YA 4GH4C 1R082 1IS6A 1ULDA 4TZDA 1O4TA 4W6WA 5DXDA 2Y38A 3GHMA 3SCGA 1RUD2 4PF5A 5DZEA 3PHMA 4LE3A 4YGEA 4O9EA 2WFF2 2BWCA 4FXGB 4AWDA 5IK5A 1YJKA 4QHBA 1FAYA 1CVNA 3AKPA 1CONA 3THTA 1GQHA 1ASJ2 1BK1A 2XWJB 5LEJA 1EV13 1XNKA 1NCQB 1VBA1 3OYWA 4IV1B 5JMCA 1KFUL 4TSVA 1RMU3 3VBRA 2W0XA 4GIQA 3IDCB 4S2HA 4BLIA 3FJSA 5KHGA 3VBHB 5JCTA 1JN2P 4WVZA 1WW6A 1OTJA 1ZZ6A 5CIRA 4AHZA 3MIDA 1CN1A 2GC3A 4FPFA 4HETA 2JG9B 4KNCA 2C1FA 4LBJA 1COV2 1YO8A 3FX3A 4M2CA 1VBE1 2RJKA 2ZGPA 1FX5A 2D7FA 1PO13 1YXWA 4LBNA 3GNEA 2WC2A 3KT1A 5I91A 5L19A 4IEQA 2WZPP 2ZMKA 3MZHA 1OD5A 1GSLA 1FV3A 1EY2A 1HRV1 4NVPA 4Q4W1 3ZVXA 3MYXA 2XJRA 4P9IA 5JZGB 1Q8SA 4GWNA 2PELA 4QMAA 4DRRA 5T52A 1G6NA 1R093 4TWTA 4CDUA 4CEWB 3SHRA 2AUYA 4LR4A 5AFBA 2AZ5A 4AYUA 1S2BA 2CWMA 2E63A 3MLJA 4KBBA 3EBRA 5CFDB 2ZKLA 1AR63 4Y22A 3M4FA 1KITA 3B3QE 4M25A 1A78A 1YWKA 1H4HA 2R32A 2RS11 4M23A 4YM0A 3URFA 4YZ5A 4ASLA 4YW1A 2O8OA 4Y24A 2CYFA 1GZWA 1ZZ9A 1URXA 5ABJA 4B7KA 2GNBA 2LUWA 4XJZA 4FAHA 3ZFGC 3AP6A 4XTMA 4Q4V2 1OOPB 2AYHA 4D3WA 1UAIA 1DGLA 2YUEA 4W6XA 4YYOA 1JHNA 1Q43A 4X6RB 3ZN6A 3MF6A 5FAXA 1RITA 3VZJA 2DV9A 3U4XA 2VY0A 2Q5TA 3AZVA 1RJ7A 1KDMA 2R041 1YFYA 4D69A 5CB7A 2ZGTA 1CGPA 4M2FA 1WCKA 4F8AA 4HKLA 4P9LA 4KWLA 2Y0OA 4CDXA 4HZFA 2I45A 3AKRA 5CA6A 3KD4A 4MV2A 4DS0A 2MEV3 1PZ7A 4XJUA 4BCUA 3NVCA 3ZN5A 3KGLA 3IPVB 1QH6A 1QNYA 4C1WA 4Y1XA 3OBTA