2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
2WA4A 3P3PA 2WA3A 2Y0IA 4JAAA 4B7EA 5JWPA 2W0XA 1MZEA 2CGNA 1H2KA 4QU2A 4B7KA 3KCXA 1IZ3A 4Z2WA 3D8CA 3P3NA 2CGOA 4AI8A 1H2NA 1H2MA 1MZFA 1YCIA 2YC0A 2ILMA 4Z1VA 3KCYA 3OD4A 4BIOA 2YDEA 4NR1A 1H2LA 2XUMA
chains in the Genus database with same CATH superfamily
1GZTA 3JALB 3UL2A 4CEWA 3THCA 4DEQA 1WW6A 1H30A 4AI9A 1V70A 5KX5B 1F7YA 2V5DA 4X65B 1AI7A 1PP9H 3ZXDA 1QOSA 1POQA 4D7YA 4CH4A 3OUFA 2DUQA 2JIJA 4Q0PA 1UIKA 1VE0A 4UW5A 1CAUA 5L36A 4C0BA 3T4VA 4M3CE 4COVA 3B94A 3HKBB 5CB4A 1SQPH 5FXWA 4CH6A 2AEZA 4M4PA 3ZXGA 1S5HC 2VMIA 3MBWA 5CBFA 1SRYA 4I9WA 2OIEA 1GFF2 5FLJA 1YVWA 3K9SA 5LP6C 2HLDG 4GT1A 4CC5A 3ZHVA 3THPA 3RZHA 4R8CA 1CJDA 1SFNA 2XL7A 2RM23 4E4SA 3W21A 1RUG2 1VP7A 1FFXA 2ZHMA 4YGBA 2H0BA 3BVOA 2YI8A 3RBZA 2FHRA 1IPSA 1UXZA 1W6NA 1ZWIC 2NN8A 2EIJC 4I3GA 4H7MA 3IFXA 2Q1FA 4OLLA 2IVIB 1LEDA 4AHCA 3IB3A 2ZX1A 5H9RA 2GP5A 3JD1A 1BQ0A 2D98A 4UBGA 2ZBJA 1RUE1 3EHKA 1RB8G 5B66Z 4GX0A 4B3TB 1Y7BA 3R6SA 1WBLA 2EILC 4KGQA 1HV0A 4KU7A 1KP2A 4BB3A 5J96B 1QQCA 2ZMLA 3B3QE 2W08A 3CCRV 4NXNO 4W4LA 3P30A 3ZHSA 4OHWA 2GNTA 4AK3A 3JBG3 1UYXA 4RGAA 3W59A 1HW5A 4PJ0Z 4PIYA 5JH7B 3IC9A 4NROA 3I3MA 1XNBA 1AL21 1XSRA 5EV7A 4BU2A 4EN6B 4MVZA 5FK8A 2NR5A 3CEWA 3NJZA 2LROA 4DRVA 2R49A 4MGZE 4CXXA 4UVAA 1S4CA 2RS13 1CPMA 1N3QA 5EIYB 1OD5A 1NXMA 2FCUA 4W6YA 1FPN2 3LUTB 3ABMC 3WP3A 2Q1ZB 2GNMA 4LBJA 3IJ4A 4PV1B 5DQ0A 3FMGA 1JOYA 4QKFA 5IW0A 5LGTA 2J22A 1NLQA 2CGNA 4FK5C 4JAVA 4GKYA 4AVVA 1O59A 3LEKA 5K8SA 4EEQA 3DPRA 3M70A 1PIV1 1CX4A 4CZZA 1B06A 4RQPB 2IXJA 4GX1A 2ZGMA 3M3CA 4P00B 1BBT1 4HSJA 5DZGA 3K08A 4ZU5A 1PV0A 4XBNA 1RJ7A 3OE7G 3V64A 1TA8A 3IAYA 1OMIA 1FXHA 1MQTB 1AR5A 5A32A 3E5XA 1TUBA 2ID4A 5DG1A 1GQPA 1QDCA 2P4VA 1KYOF 1WCKA 1QQP2 4F6RA 3K58A 2VC9A 1K8AW 4DV5O 3I59A 2K0GA 2DYRB 3LNNA 4EN0A 2Q7HA 1R1A1 3GJBA 4XFBA 2XAFA 1QCEA 2BJSA 1ONAA 2Q9LA 4W6XA 1RHI3 1NA1A 1ULFA 2YBSA 4IL6Z 1TME1 2VQUA 5DAXA 1VQ8V 4BQ2A 2FTKA 4CS4A 3N7MA 4FBFA 2E6VA 3H8UA 5L3CA 3K77A 4DV2B 2ZTNA 4O7XA 3FC0A 2XUEA 3RI8A 5FYBA 5LXTB 2YB7A 2DQ3A 2A5ZA 2BDRA 2FQPA 5KMGA 3VBOA 1ULPA 1W6MA 1RYYA 2XKPA 4XDKA 4D94A 1NLSA 2ADQB 5FYUA 3I97A 3ZIWA 4JKLA 4AFAA 2VCMA 4NRMA 5BNOC 3ZMUA 4U7NA 2LP7A 1QY4A 1JHJA 1DGRN 1WLWA 2LGQA 2FMYA 3FBYA 4AOCA 2ZDIA 4P2ZA 2AYHA 4EQVA 4LQRA 2JDYA 3RZGA 3VD7A 3MDSA 2HLEA 5B5EZ 1ZRRA 2ZEYA 4I50B 3KT7A 4NRPA 4XABA 4JV5B 1UKGA 2EIGA 4JGZB 2RVAA 3E35A 1RVF2 2GMEA 2WWSA 2EINC 4FT8A 3ZN6B 4YW1A 2QE3A 3AKPA 1QHDA 5FXVA 2Q6AA 1ZZBA 4K40A 4NXMB 2UXCO 5DUXA 2QDNA 4PBOA 1JZ2A 1WW7A 2VMEA 2NN4A 4J80A 2GP3A 1E1QG 4FXKB 1EZVH 2WZEA 3NSTA 4JX0A 3N2KB 2WSSG 1VBB3 1LOCA 5LBEA 1HNWB 4QAWA 3WW2A 2JIZG 3THDA 3FB6C 1F51A 5GONB 4JI4O 2QDOA 3U07A 2F1MA 3ZMNA 4AL9A 4DUYB 2GBOA 1KD7A 2MEV1 3PU3A 1M06G 4QKDA 5JZGB 5IE9A 1LCLA 1CJPA 4UCOA 4I30A 3ZXLA 4QQPA 3MGUA 5JI7A 4GH4A 2WL1A 5CA3A 2PLV2 2VO5A 3H1MA 4XCAA 1I5XA 1LU1A 4IGPA 1MZ5A 5EC1C 2KG7B 2A3YA 1EV13 5J2TA 4Q4Y3 2E7AA 3LAGA 4I0WB 4FFBB 3VBHA 2M7WA 5FZDA 1S72V 5ACA3 2A79B 1SACA 5FPRA 1C1FA 2DUPA 4NR1A 1W9FA 3R05A 4YGEA 3F5TA 1TNRA 3HKDB 1X59A 3ECQA 2MEV2 1EP0A 1NCRB 5J7MA 5BNNA 4AI2A 2RJZA 4XZPA 1CIWA 2GC0A 2XNDG 4FLZA 1NA1C 1RL3A 2W2IA 1MS4A 1NT0A 1HQLA 1Y76A 4CUAA 1BMV1 5E16A 4XMIA 3EXUA 4B1LA 5B2GB 3UM7A 1H6YA 2TUNA 3LDCA 1AR61 3E8GA 3D0JA 1NR7A 4BJ0A 1OCOC 2ZGSA 4LK7A 2VBPA 1LULA 3CZUA 3U4XA 1DF4A 3D8CA 4QX1A 4AEDA 4TTGA 3A0RA 2Y4UA 2P6HA 4IYIA 2Y64A 3FL7A 2ZCEA 2FDFA 3NWKA 1I1EA 4Y1ZA 1PO13 4K0KO 2V4AA 3I3BA 4FOQA 2ZXWB 3R4UA 1R091 4Q2FA 1TVGA 4U3JB 1DGSA 4FLXA 2WZR1 1POV3 3ABLB 4QPGB 4HVRA 4YJ3B 5DAPA 1Z2GA 1BMV2 5FYZA 3M3IA 3OCPA 5F2SA 2HBTA 2R6QA 1AR62 2A6XA 1REEA 2CH7A 1UU6A 2WO7A 3R4DB 3M99B 1ACCA 4C7UA 4WVVA 3IMMA 3KGZA 3B09A 4AHZA 4MGSA 1SQBH 4XQ4A 1VRBA 4DNYA 4MX3A 2HWF1 2PHTA 4PDWB 1AXYA 5FMCA 4EN7B 2VQFB 4Q8KA 1U97A 3J81N 4UFJA 1XNAA 5K7PA 4BAYA 2QTWB 1V00A 4FFKA 2DTYA 1KD1W 5L7OA 2ZKNA 3LSEA 4AW7A 2IFRA 2P3IA 4D6SA 3I5DA 5GLTA 5H9CA 2XAGA 2VMGA 3NV2A 4MTXA 4LF6O 1KP3A 3OGIB 4O4IB 4LBMA 4L2NA 1H2LA 1QNYA 3WZ1A 3IC7A 5A6QA 2PELA 3H1IH 2P06A 2FYUH 1PVC3 2VBBA 4QX2A 4AEKA 4LWSB 2IH3C 1DZTA 1AI4A 1UN1A 2JDMA 1LOGA 2NP0A 3I2HA 1DQ1A 2HVKC 3EFFK 5FYSA 3PUQA 4YG6A 5FREA 1MEC1 2WS91 4B3SO 4QKNA 3MIDA 5CFDB 4X1KB 5JXJA 1FMD1 2UUBB 5EYPB 3ZSKA 5FYHA 3I3QA 3OPWA 1PO21 1SC5B 2XB6C 1YCIA 3D0SA 3H1HH 1WW5A 4GH4C 2AR6A 2BEOA 4BDVB 1VBD3 2PZSA 1FT9A 3ZR5A 5I0RA 1GN6A 3ZSJA 1G9AA 4ARYA 5DDJ3 2JD9A 3V0AA 4AVCA 4CCNA 5C9AA 3VBHC 3K46A 4YRDA 3BVCA 3ZCCA 2JG8B 1FMD2 2Y6FA 3BU0A 4MSVA 3E6DA 4JI8B 1UAIA 2HWB1 3W7SA 2XAJA 3OBAA 3ZYFA 1H6XA 2W91A 5FZBA 2PHFA 2JE8A 1V0AA 1KRIA 1URXA 2IVJA 5JOZA 3PVEA 4WFFA 3H50A 3VDAA 3CDZB 4LOSA 1RUI2 1YHFA 4XDQA 1ENSA 4H14A 2WO1A 4CTEA 3LKJA 5IJ0A 1HXS2 1DLCA 5DEDA 3FHQA 4ZS2A 2A71A 5E89A 5LGUA 3ZRSA 2VWJA 1YRZA 1IS3A 2UYBA 4AAXA 2AENA 4HANA 3KV5A 4GB31 3N4MA 4CDQB 1QDOA 4HVOA 3O1UA 4XHBA 1I94O 4ZPIA 5C7GA 2J1RA 3CRAA 2G1MA 4DFSA 4I55A 4TUYA 3OSDA 4PIXA 3Q8BA 2QQJA 3QF7A 4DUWA 2JENA 1JXNA 3B2EE 4PDMA 3F7VC 1OLME 3ACIA 3RT3C 5CN0A 2WZ8A 4ATEA 5FXXA 2XBO3 2ZGUA 2Q5ZA 1AR71 5KXDA 3S5QA 2P67A 3WDYA 2EJ7A 2UUCB 2YYOA 3HQUA 1VBE3 1HRV1 2VZTA 4GB32 2YFUA 4NIHA 2WLLB 5FQ0B 3I2DA 3S6PA 1W8NA 1FS0G 1VBA2 2W52A 1OLQA 4BIUA 5L7OC 1NI8A 4WM7B 1DZQA 2WDBA 2Q8DA 4HPKA 5CBLA 3IIIA 2ZKOA 1SLLA 4P5HA 4ZS3A 1UPSA 2R073 4PQQA 3AC0A 3WNPA 4YYOA 3OGGA 3STLC 4AHXA 1KC8W 2MNGA 1E5IA 1ST8A 1NJIW 1BK0A 1HRV2 2MHFA 2W1UA 3S3WA 5F2VO 4DXZA 5FZ8A 2DJVA 4HAMA 4FPEA 3VHNA 5IVYA 1OA2A 1P7GA 2B5UA 1ZUQA 4ZHQA 4X1IB 4FLUA 4UB6Z 3F2ZA 3U75A 3WNOA 3MDPA 4TV9B 2JWPA 2OXBA 3RMYA 3SJAC 4KGGA 5ANNA 5JJNB 5F5IA 4ABMA 2WNEA 3N3HA 3WNLA 5I91A 1XSQA 3TN93 1NR1A 3EHBB 2B42B 1YI2V 5CMUA 4FFHA 2IJKA 1K3EA 5EP9A 4QXHA 2VVEA 4N53B 4TT3G 3AG3B 5J37A 4DV6O 5GM0A 5KC6A 4R9BA 1SBDA 1F5FA 3JALA 5H6RA 2VTFA 4NO4A 1ZL8A 3MV01 4F6EA 2DWRA 3D36A 2UU8A 5KX5A 1PM9A 2UXDO 5B1AB 3MLJA 4JHZA 4ZZ8A 4LULA 1JFFA 3POYA 1J84A 2B46X 2GN3A 2KA3A 5FL7G 3HIFA 1QH7A 2LS6A 3SXWA 2DVGA 2W0FC 1VQ6V 2BCCH 4CPBA 1B35B 2BTQB 4DR4B 4O4LB 3J7LA 3OPTA 5KHJA 3GF6A 5IWAO 4FOYA 3UKTA 4LORA 3ZYGA 1X33A 5HXVA 4DUVA 2HWE1 2VW1A 3IDEA 1JYXA 2V1DA 3AJYA 3PMSA 4L97A 1SKVA 1PZ9A 3ORJA 5IY5B 2Z3YA 5IATA 4U2AA 4CCLA 4QU1A 3K0GA 3C7HA 2R043 4UXAA 2JDIG 1D4M3 1VRH2 5KUMA 2ET7A 1XYNA 2QQMA 5A1AA 3SKJE 1REDA 3N7LA 4PA9A 5J09A 3K03A 3C3SA 1F2NA 5KXCA 1EAH1 5DZFA 4PDLA 4B3RB 2YEVA 1Y9QA 2GMPA 2JJ6A 3T4HB 1UW8A 2HWE2 2OVUA 2OQ7A 5ABJB 3MW3A 1IS6A 2OS2A 4J25A 2VVFA 5LHHA 4EWEA 2XJSA 4OPHA 4J11A 2PUSA 3BIWE 3CSXA 4DV0B 4ZI7B 1AR4A 1N3PA 4A3XA 3ETGA 1ENRA 5FZAA 3OMNB 4MVOA 1J3PA 3PUAA 2WSUA 1WLTA 4IEZA 5JCOA 2D6LX 2GN7A 1MVQA 1QNWA 1W2AX 3RYHA 3ZXKA 5JJEB 4LOTA 3NKGA 1Y66A 3VDBA 4E2QA 4Q5OA 1EAH2 2D6MA 3ZN4A 1G6NA 5CKQA 5FUPA 4DZGA 5T3NA 5A7WB 1HQWA 5B1NA 2E63A 2QDRA 3M3EA 2VPVA 5JH7A 2H0VA 4N21A 1WP7A 2DCTA 2F4VB 2QM4A 4CXYA 1X9TA 5EBWC 1CN1A 1TNFA 1HRI1 4HETA 3AG2B 4QGNA 3W9AA 3K4DA 3CXHF 2MPFA 2XHBA 3UO2A 1XYOA 3I2KA 4NTYA 4MV2A 3VDCA 1WA6X 5BXXA 2D43A 2RMU3 3BUCA 3AP5A 3RW0A 1L7LA 4IEWA 1OUSA 4X9QA 1GQGA 2ZKLA 3VOUA 4JI3B 1HV1A 1UY0A 1J1LA 1XE0A 2WZPP 5H9QA 5EBLC 4CXWA 5AC91 3DKWA 3MIFA 2PF4E 1GMMA 4GQ7A 1V54B 1PGSA 2DVAA 2EXIA 3G4SV 2PHXA 5FDBA 3RI9A 5CFCA 3OOXA 2WT0A 4TV8B 1G86A 3LEIA 3M7AA 4AR2A 4RQPA 2VQ0A 2DOSA 4LF9O 1X82A 1ZA7A 2B1IA 4PF5A 1BSMA 4KFMA 4XJUA 1COV1 3OUJA 4QPIB 4URAA 4NJ4A 3G6BA 3D36C 4DV4O 3POIA 4NHMA 4DV3O 2WJSA 4G9SB 3ASNB 1RXGA 4OYUA 4WZCA 3CCMV 1PM7A 1MQTA 1Q6UA 2Q67A 5LATA 3H01A 1QJX1 1N32O 1D2DA 3A8TA 5T54A 3ZRXA 4TQFA 4XVHA 3N2GA 5FMOS 3HN3A 1XXNA 1ALYA 5FZ0A 4OI4A 4AQSA 3SC7X 2YU1A 5D1IA 3UGHA 2YIAA 3ZYIB 3DL3A 2QQUA 4UXNA 3RN4A 3SISA 3KG2A 3AKRA 2CYFA 1OD3A 5LA0A 1BZWA 4FMTA 3AZVA 3ETPA 3WUCA 1DBNA 1WKYA 3POSA 1XNTA 5LXTA 3IAQA 4X62O 1GUIA 2DYSB 1W6OB 2D5FA 3OTFA 3T4DA 1ZZ9A 4FP2A 2FDHA 3MIEA 2WBKA 2AC1A 3ZSMA 4YHHO 3QVNA 1VLNA 4UT5A 1GWKA 5HCBA 1LU2A 2AH2A 5CNAA 1GBGA 3AKTA 3O1MA 2R062 2Z4FA 1OC1A 4IEXA 3BIEA 3OF1A 4IV3A 2VOVA 1OH4A 4Q8LA 5JCOC 3WQ0A 2HEPA 5B4NA 2R70A 4C91A 3ZXEA 3VQWA 1UZYA 3VGIA 3VZLA 1TMF2 2Y33A 4FOVA 3VBUB 3R65A 4S2FA 4YIPA 1QWRA 2KSDA 1J59A 1KQRA 2PFWA 4HZFA 5FIXA 1KKCA 1RUH3 4S2GA 4JGZA 3BGAA 3IT8A 3JASA 4IDZA 5LBQA 1R64A 1X50A 4QB2A 2K9PA 5I8TA 4H7LA 1J5EB 4C90A 2OCHA 5A7PA 4D7SA 4Y1YA 5HFMA 3ENRA 1M4UA 4RUEA 2K9ZA 4JI7B 3CRMA 3OJBA 4MXWA 5KHHA 2P6JA 1ZZCA 3EYPA 1XE7A 3I3DA 3N2KA 3VKMA 4GWJA 3RYFA 3N9PA 4OFGA 5A3LA 1C8M3 2LTNA 1PNFA 1GNYA 4AGRA 4O65A 2YROA 3JD4A 1JI6A 3N9QA 5A2QN 3T2OA 4UI9L 3B00A 1WUVA 2W92A 4JHTA 4DR5B 4RQPC 1W0JG 4L8QA 2ZEXA 1GNHA 1EM1A 1TE1B 1SCSA 2QKSA 2JGDB 3ZN1A 1IBKB 2JVDA 2HWD2 4LMFA 5LEJA 2EBOA 1LNQA 1G6UA 4JGSA 3LOIA 3T0DA 1VAMA 3CPWU 2FCTA 3GZTB 2RM21 1MQTC 4K1ZA 4U7OA 2OIGA 2F93B 3UKVA 1ASJ2 2I2SA 3OY8A 1RUE3 4FFBA 2CNAA 2XOKG 5IYZB 4L9BA 1BCCH 5J2UB 1SEFA 4R9AA 1M56B 2I45A 2DYRC 1ROPA 4YM1A 3UCSC 2WA4A 4LFCO 2YU2A 4DUZO 2BOIA 1SFPA 2Z0AA 1WCDJ 4LA3A 4W6WA 5A3UA 2HHHO 2N04A 1NQTA 3I7DA 3K3NA 1FOD2 4BWOA 4IEVA 4GKKO 2VOXA 3AMMA 5AG2A 3CC2V 1W59A 4C1WA 1QIQA 3POFA 4FZ0A 4I01A 1DF0A 3HMYA 2Q8EA 1AL23 1WD4A 3WG7B 2UXBO 1S77D 3PURA 1KGYA 3JBG1 2Z79A 2VWKA 2ZE6A 4LO6B 4QB1A 1FJGB 4IEYA 4N7UA 4AQYB 1RTVA 2LUWA 4U3JA 4BZ4A 3WNNA 4MXVA 2PMWB 2R9AA 3NV4A 1SA0B 1OJHA 3F95A 4MTFA 3D5OA 1WPXA 4YJ2B 1ZBA3 5FLIA 3MEPA 1M5IA 2WKKA 2ZINA 1MMMA 2RS11 2PA7A 2C2AA 4K7JA 5HXMA 5IVCA 1B3QA 3WXPA 1BLZA 4X8NA 3FB7C 3SJQC 1WD3A 1ZBE3 1MPXA 2VNGA 2XONA 1B6QA 3CL1A 5L73A 5HBAA 1ZA4A 1BBT3 4GKXA 2IM9A 4PDWA 3DN7A 4COWA 1BCXA 2HJDA 3J9SA 5BR8B 4JGZC 1YQCA 4Y24A 1DF5A 2VNVA 4C0HA 3ZBHA 2F43G 4UCSA 3GBFA 4QJFB 3N9NA 2JJ1G 2ARCA 2F17A 3ACFA 4DXSA 1VQNV 2ZOEB 3USSA 1PGL1 1O9GA 1VQ9V 4M3CB 3T30A 3TXSA 1OFSA 5CU1A 3WG2A 3SJCC 3NNLA 1V6KA 2JEXA 2WN2A 1HQNA 3KF3A 1Y4MA 4KWKA 3UNPA 1FYJA 1V6OA 4LWSA 4LH7A 2H3OA 1HX6A 5IYCO 5CA0B 4YW2A 3OYWA 4A2UA 1JTZX 2J1TA 4MVTA 4L87A 1RUF1 1SLIA 3T1YB 3F5WC 4X1KA 3H3UA 4AYUA 2VCAA 1PGL2 5EYPA 3APOA 1SS3A 1RHI1 1SERA 1YTFD 1O4TA 3U14A 5JZGC 2WN3A 3LDBA 2VMFA 2FZ2A 3PN1A 4INDA 5LW9A 3CMGA 4XFFA 1VEWA 4NAOA 3FE5A 2Q30A 1P7BA 2ODMA 1F8VA 3PVBB 2JG8A 2W9XA 2E32A 3E5QA 4HMZA 1PNMA 1NCRC 3HPLC 5T55A 3WF0A 5IYBO 3HT1A 5EZYB 3FAVB 2WLIB 4K3UA 3AX4A 1BHBA 3T08A 3E6BA 3WG1A 4H55A 1GN4A 5G05L 1BEV3 2HBUA 1XMQO 1ND2B 1W8WA 2VD7A 4MVUA 4UFLA 3LFMA 3SEEA 1OKQA 3DUIA 5E8AA 4CUGA 2WIIB 2R0HA 3APQA 3O0WA 2BQPA 3L9JT 1BGYH 2X29A 2C26A 2GC1A 1NQDA 4I9QA 2OX0A 5EIBC 5I0TA 3JD72 2YBPA 3W58A 2ZXWC 5A33A 3C3TA 2E5LB 3DYPA 4CDQA 3G80A 3NL1A 1QJU3 1MG1A 3ABLC 5SV8A 4ZOLB 4QPGC 1GOFA 1WCSA 4N9IA 5G04L 1IBLO 4EFEA 1PNKA 3N9LA 3L72H 4MVRA 2P4KA 1F31A 5APAA 1NY71 4CDXB 4MHRA 5I8YA 4UVCA 1CIYA 2BSKB 2IJHA 1VBB1 5IWFA 1V6IA 4PDWC 4FPFA 5FO8B 1HKDA 3OR7C 5J3UA 2A6YA 5FQ0A 3LQCA 1LGBA 3FX3A 5JIUA 2XUMA 1K4CC 3ZDSA 4I5SA 2ERFA 2LFRA 4WM7A 3IDBB 3VBRA 5FO9B 3BU7A 1UJWB 3OTOB 2PQQA 3ELNA 1NY72 2B4KA 1U0AA 3O1SA 1T6BX 3IKWA 3KVAA 2OZJA 2QWNB 3ES1A 2JDKA 2AHZA 4JTAB 4LITA 2CWSA 3UESA 4W8JA 5IK8A 3BABA 4XFCA 2JDPA 5LMNB 4X1YB 4Q4Y1 2BVVA 4NHKA 3BALA 3D6EA 5ACA1 4YSFA 4QQOA 3GGLA 5B3SB 3JATB 5CFDC 3OEBA 1VQ5V 1L0LH 1DP0A 4ZKIA 1UWWA 4X1IA 1DK1A 4G27B 4I09A 2QQLA 2ZT9B 1XMOB 1FNYA 4IEPA 1K4DC 4TV9A 2ZR3A 2RQ6A 1UPIA 1D2QA 4A7KA 1UOBA 4NUBA 4B4QA 4M0NA 3VDDA 3SLIA 5FZ6A 3AG1B 5J9PC 4QGLA 2ORXA 1RC6A 1Q7YW 3HPNA 4ASLA 2W1SA 3NJYA 3VZNA 4YG0A 1EV12 3S5AA 3ZPOA 3V0BB 4WM8B 4PF1A 4COUA 1UO9A 5ACA2 4Y1XA 1RPOA 3PJSK 2JG8C 2RMKB 1PO11 2IFWA 3JD3A 4CBCA 4TQDA 3EBRA 1JA8A 4OHYA 2KB1A 2GC2A 1QOOA 2QSAA 4X64O 2QQKA 3B7MA 2JJ2G 3OD4A 4I02A 1N34B 4FPLA 4FO9A 2WT1A 2FL4A 2BTQA 1GWMA 4HONA 3KT1A 4O4LA 3RJRA 2P7TC 1OUXA 4CP9B 2AREA 3T4ZA 4FOWA 1S0GA 4LF7B 4CH5A 3IDCB 2YHJA 3EMRA 3ZSLA 4XURA 1S0BA 3SNMA 1O3RA 1Z7S1 4LIUA 4IV1B 4I7ZB 1HR0O 3CZJA 2BNOA 5KHIA 4FAGA 1T2XA 4JDNA 4CDQC 2ZZJA 3GYDA 4M4RA 5DM6V 4WBBA 2QA4V 3WT3A 4X88A 2DCKA 1U5ZA 1KFXL 4JYBA 4IGOA 5KXBA 5FOBB 1PZ7A 3T1CA 1BZKA 2RDQA 3RWRD 2RG4A 4DV7O 4LKFA 4N43B 5LWBA 1MEC3 4A44A 3ZRWA 2W1WA 5ABJA 2D6KA 4JTNA 2B8MA 4O9GA 1PVC1 4FIPC 1KFUL 4A7YA 4JKMA 4JZRA 4AF9A 1XU2A 3SDLA 4CDWB 1KDKA 3CE2A 2W94A 3BAAA 1S0IA 1PD3A 2BWCA 2V4DA 4WM7C 4F4LA 2EAAA 3BN6A 1UYZA 2PHLA 4DYLA 5A7WA 4EJRA 1GOHA 3AYDA 4V2VA 4QQHA 1GH6A 1VBD1 3DC5A 1S0JA 1PVC2 3KLSA 1V6MA 3TOJA 3KV4A 2D6PA 2ZR2A 4R50A 3PJYA 4Q4V1 4LTAA 1FFTB 3VBFB 2UY8A 4JKKA 1XEQA 2ADEA 3H8XA 3CMAV 4YVSB 1W8UA 1OPMA 2F4LA 4B08A 4QXKA 1PHMA 4QHOA 1OQ1A 1UU5A 1AP5A 3TRSB 1O5UA 3ACGA 1N1TA 2A73B 3NRUA 1QU7A 4FLTA 1W99A 1UPGA 2KQXA 2XJQA 5FPLA 1CZVA 4LE3A 2NM1A 1AHSA 5LMUO 1H9PA 1XQNA 4LFBB 3WHUA 3W7UA 4IGQA 2RS52 1WB7A 5HV4A 3SCHA 5DDJ2 4N53C 2P34A 3AG3C 3AJZA 2NYYA 3FUOA 4B3NA 3HT2A 1UZ0A 1QLEB 1FI2A 4E2SA 4BW5A 1JZ4A 2Q7EA 3T0BA 1W2BU 1XNRB 2YGMA 5B1AC 5A7QA 3RWKX 4JDOA 2YIBD 3WUDA 1JBCA 4NIAA 3BODA 3ZMOA 2VZSA 1UYPA 2YC2A 1M4WA 4XEZA 4DS0A 3LSDA 2P37A 1RUJ2 4AFBA 5JVDB 1B35C 1X4TA 3AYEA 3B5LB 2VZQA 3ZFEB 1YQ8A 4EZHA 4LF5O 4X8AA 3GHMA 2Q73A 3DXRB 4E9KA 5ITZA 4GWIA 3WW4A 5IY5C 4CS2A 3GXUA 3JARB 3RYKA 1VBE1 3W7WA 3HQRA 4DPNA 3K75B 1GSLA 3PLQA 2G19A 3ACHA 5FYYA 2CY6A 4LA2A 3GZEA 2GTAA 3Q4HB 4PI2A 4RN5A 4MTGA 3GCWA 3KB5A 2PYTA 3B01A 2DCZA 4OQ9A 4CU9A 1W6OA 1AR1B 5A3NA 2YC0A 3JCZA 2PYJA 4I3PA 4XXAA 3T0AA 2R071 4JQRA 1I5YA 1QOTA 2VH9A 2VVDA 2XBO2 5ABJC 1I08A 4KP4A 2JKBA 3HKEA 5IFPA 3K3WA 4Y20A 1DYOA 1UZVA 4FLVA 4DO0A 2C4XA 4D6QA 5CG9A 3VBSA 2ZAAA 4DK1A 5LA2A 1QR9A 2QBXA 1R1ZA 1GM7A 4PHZA 2H6CA 4EZ4A 3KHBA 1K9MW 3GJAA 2TNFA 4AGGA 3ABKB 3J7MA 5EFUA 2XOMA 4GJYA 1H4GA 2X5IA 4CCDA 4PLMA 1RUD2 5FY8A 2ZAHA 3VBUA 2R072 3UT0A 1HIXA 1VQOV 4YLZA 3TN91 1QJY3 4QT6A 3AG2C 4M01A 1W6PA 2WWJA 2F6BA 1BL8A 2JEMA 5C4WB 4ONUA 2HJFC 4TWTA 3ZYPA 4BQ3A 2IH1C 1LESA 1YI9A 4DB5A 2QWPB 4E2GA 2NNUA 3WP4A 2XLFA 4XMAA 2LRPA 4QE7A 4MVSA 2WUHA 4E8CA 1DTOA 4FVMA 1V54C 3VHPA 2JEUA 4NXNB 4Q4X1 1LENA 4BISA 3WB0A 2IW5A 3H1KH 3H3ZA 4TSVA 4P5YA 1Q81W 1HNZO 1VF5B 1W3VA 5JCTA 3SPHA 3J4UH 1K7DA 2IUWA 1HN1A 3JXSA 5CKNA 2IXKA 2YZ4A 3TCUA 4Y3OA 3FB8C 1JN2P 4BLJA 4D8MA 4QPIC 1UD1A 4BMEA 1XDCA 3LF7A 1F4HA 5FMBA 2R041 3ASNC 1UMHA 1D4M1 2WNUA 3B8MA 1SQVH 2Q8VA 1NOVA 4RWUA 4AQ6A 2C9KA 4B8EA 2L35A 4R7CA 5HI0A 2GDSA 2A75A 2F66C 2D93A 4OHXA 2XJTA 4XJWA 4RYDA 4QNHB 1YJ9V 4LBEC 1L0NH 1ULGA 2VCBA 2GC3A 2VZOA 2Y60A 4RHV2 2O8OA 1S5LZ 2CAUA 4KNCA 2P2KA 1XYPA 2ZACA 4FFIA 1GTOA 4QGPA 1RUG3 1GR3A 4GA9A 1F4AA 1M57B 5LGNA 2VS0A 4EYUA 4ATFA 4WF9V 1H1IA 2HEYF 3ZPYA 3KM5A 4NYKA 4MG2A 1TVKA 4ZY9A 3ILRA 5FO7B 3T1HB 5CBGA 5T52A 1MA1A 3NQHA 4M0HA 5HCAA 2DYSC 5L9VA 2LW7A 4LUKA 4W4KA 1IGOA 1JYCA 1VMHA 3FUQA 4BIOA 4NHYA 3I56V 2CTRA 4QPKA 5A6YA 4FVVA 2Q1MA 4BHPA 3CKHA 2RS33 4DV5B 1YTFB 2QQWA 1Q6IA 4MW8A 4V1PA 1QLNA 3APBA 1QU0A 1OFNA 5LBCA 1VAVA 1RP3B 2VUJA 3A0HZ 1W03A 3NO8A 1SA0A 5AC93 2XHKA 4KMQA 2RMU1 3SH4A 1F23A 2X10A 1N33B 3EB7A 3B4SA 1ULDA 3VL8A 1XNDA 1AJPA 2CU5A 4JASA 3VBUC 1B04A 1QVFU 3UJQA 3BI3A 3CJHA 2QM8A 1H2KA 4KWLA 4OVEA 2BTVC 1FPN3 3J8F2 4OHVA 1K42A 4PDVA 4YW4A 2DUOA 4RFRB 2YGLA 4D6TH 5EQUA 4O4JB 3SGIA 2RMU2 4XE9A 1YIFA 1IQAA 1QJX3 4DR4O 5JLVA 2FMLA 4M3CA 2E76B 1C1LA 1XL4A 1WW4A 5B4XA 3RVHA 3TEWA 1CWPA 1XOUA 3ZHQA 2OTJV 3SKVA 3JAWA 2A3QA 4GJZA 1GM9A 5K1XA 2I74A 5IK4A 1SLBA 1VQMV 5C8CB 1H8VA 2WYSA 2WNVB 4QDSA 3PNAA 3B93A 3WW1A 4AVAA 1DU3D 4UUJC 3OFNG 2Q4SA 3KCXA 2JDUA 2DF7A 4BQYA 3HNMA 3AFKA 3RYIA 3QLQA 4C8DA 3CMEV 2OA2A 4YWAA 1R73A 2YUEA 2WO3A 1E5RA 1O4ZA 2B45X 1O6UA 1C5IA 4B3RO 2CGPA 4XZUG 2VQEO 4Q20A 2GV9A 1UNBA 4IUGA 1YXWA 3T09A 4JI0O 3BOPA 1S2EA 4FPJA 5CA1B 5M0TA 3JU9A 2UXCB 4KQ7A 5JQGB 1JPXA 5SV5A 2EXKA 4QE9A 3LNMB 2HEWF 4DV0O 4Z92B 1O3QA 5DG2A 3AFGA 3WF2A 4LHKA 2ZE5A 4GCZA 3F7YC 5LBFA 4LNUB 1YFWA 1M56C 4JI4B 3K4ZA 2DFCA 3RSJA 2E26A 1YJLA 1Y9MA 2WLIA 3K5OA 1YQ2A 1W2OA 3OGVA 2WLNA 3I4IA 4J9YB 3G67A 4TLGA 5LYJB 2WT2A 4BYYA 1S76D 4YVWB 4MVQA 3FLPA 3MI8A 2V5YA 1TGOA 1Q90D 1EPZA 1C3HA 3TNQA 3WG7C 1PL0A 4Q4W2 1CP9A 1G9BA 3UETA 1WCUA 3WDUA 1MSDA 1RUH1 2V73A 2E3CA 1RMU2 4OCTA 4XC9A 3H8RA 3UKNA 2XVGA 4ASKA 3AYCA 1VR3A 2DDUA 4UW4A 1WA8B 5FUNA 2X53S 3OGJA 3FHAA 2BNNA 4NOTA 2Q0AA 1RVF3 1VMJA 4EN9B 5CA6A 1SMVA 2QJ1A 3ZKUA 4CEYB 1BJQA 1K97A 5H9SA 4QX5A 2VZVA 3DSQA 1GKFA 2C6SA 3MIHA 1YYNA 3U4SA 1C8M1 4Z07A 1W6QB 3CJIB 4PA3A 3ZM8A 1VPHA 4K0KB 3Q9OA 2PHUA 3IPVA 4XJAA 2Y48A 2Z42A 1WMDA 2R32A 5FYIA 3N9MA 3HKCB 2DCJA 4N23A 4OUEA 3AKQA 1IDSA 5FWEA 2BGPA 3UT5B 5JPNB 1NZIA 2QGNA 1OSGA 4TSFG 3SCFA 4QPYA 5F6LB 1ULOA 3T2QA 1S2BA 5BUVA 1US2A 4X1YA 5K1PA 4CEWB 3WDTA 2GMMA 5FFOC 5GTHZ 5FWJA 5BNOA 4UV9A 3K59A 3FX7A 2PLV3 2E75B 4XBFA 5IT9N 4HG6B 4NHXA 4KG0A 1LAJA 1ULEA 2E9QA 2JD4A 2VTXJ 1LB2A 5CB4B 2XKOA 4LF6B 1DIWA 1UZWA 5D21A 4GWNA 3E6CC 4AE2A 2YPDA 4BQXA 1RUE2 1G8MA 1YJNV 4ZHNA 1V9U3 2WABA 5A7SA 4LO8A 3T2PA 2C9AA 3KQ4B 5KWRA 3BTXA 3ABZA 1KDMA 2EXHA 5EJZB 4DK0A 4JI6O 3QH6A 3IN9A 2ZGLA 1XBFA 1ZTEA 5JXGA 4B3SB 1S1AA 1FFXB 5IHRA 4DR6O 5FZLA 5HV0A 2EA7A 2VCCA 5JSPA 4E2LA 3KS7A 1ZBA1 4I2OA 2B1GA 4AXOA 4AHWA 1D7PM 1ND2C 2DWEC 3QOPA 4KG8A 1LRHA 1V55B 3TEXA 2ARHA 1YSCA 3GZAA 4CP9A 5DECA 1UKRA 2XJPA 1AL22 3ILFA 4FTEA 1H2NA 2EALA 3E22B 3DYMA 1ZBE1 2XASA 3LDRA 4FQ4A 4YZ5A 1NTKH 1FPOA 3H1LH 1CESA 4IV1A 3CCUV 1AJOA 5FJHA 2RDNA 5A3OA 2AGSA 2C5DA 1JYIA 1LUWA 1CAWB 4FM1A 1P4RA 4LH6A 4QWNA 2GUZB 2WR9A 3HNYM 3ZN5A 1GWLA 2J42A 1OBNA 5KAFZ 3JCIA 4CDXC 3A23A 4CPBD 4N43A 1PIV2 1ZBE2 1RUF3 3ILNA 4Q6GA 3POEA 1BBT2 5DXDA 3RPQA 4HT1T 1OXCA 4WZFA 4DY3A 2D2CB 5FZOA 3D3IA 1Y4WA 5JOWA 5FY9A 2EIMB 3OEHG 4A5UB 4P14A 2G9ZA 1BHGA 5C8WA 4BIZA 1S0EA 5L3DA 2Y69B 1OCCB 1I94B 4MHUA 1ZM1A 2WLHA 5IT6A 2DBIA 4Z8BA 4Q0QA 1NH2D 5IVEA 2Y0PA 5ISLA 1DDLA 3ZYBA 4WFBV 3DPRB 3FHIB 1L7RA 4RD7A 1R1A2 4DR1B 3DV8A 4YGCA 3CCLV 1LUVA 5KA5A 4Y26A 1TME2 3VBFA 1W0NA 4IT5A 2UU9O 3ACLA 3E89A 2CAZC 5B3SC 4YVSA 5FP3A 3S7IA 3RDIA 4D7TA 4SBVA 2AXTZ 3MV11 4HN1A 4IE5A 4Y4RA 5A32B 1DLBA 4RS5B 1TUBB 5KAIZ 1F4NA 4IYHA 4DR2B 2X09A 5IJ9B 4GWMA 1JU4A 3C7FA 4LBQB 2YIDA 4LF4O 1BEV1 2P4EA 1VF6C 4F6RB 4R4ZA 2IJIA 4LR3A 3AG1C 2XDVA 3I59B 2CDYA 2VQAA 5KUKA 4E4HA 5FLXN 5FY1A 3OEEG 1NG0A 4WM8C 5C6CA 3LIGA 5IAVA 2Q5TA 4V2WA 3I8TA 1DQ2A 3HEIA 1RIRA 2WA3A 2X6CA 2RDRA 4AEMA 4OHZA 2BVBA 4PA4A 1DQ4A 1E5HA 5A80A 1RUI3 1X7NA 1AX1A 1AVBA 1QJU1 5L3GA 2MW2B 3USUB 1HNXO 4XAAA 2VUCA 1W90A 5JVDA 2HEVF 1RXFA 2QQOA 2W5FA 2FDKA 3LB9A 4MGQA 3WEZA 3ZFEA 4QHBA 3H0OA 1AL0G 1O5LA 5L9BA 3TWIA 4LLFA 5I0DA 3SITA 3JCUZ 3CXCU 4E4EA 3DXRA 2QNKA 1VP6A 1URFA 4DV6B 4G2KA 4MGIE 4OZXA 2VJXA 1SBEA 4ZU7A 4IV1C 5JVVA 5LK7B 4JZGA 4PLNA 1DQ0A 1QJU2 4UW3A 1XQ8A 2YSUB 1TG7A 2PHRA 5F5AA 2ARAA 3RGBA 2YI9A 4LEJA 3K3OA 1J95A 3PVOA 1W8TA 4ORFA 1AYN1 2EF6A 3FN9A 1NUKA 1SQFA 2CAVA 1BQZA 3Q8CA 2D6NA 5F5QA 3PIJA 4TLFA 4CVUA 5FZGA 3BTAA 1LEMA 3E8FA 4N43C 4TZDA 2ZA9A 2RR11 2XHNA 1VB4A 5IWAB 3D82A 1VBA3 4JI2O 1CAVB 2V72A 2VG9A 1YFYA 2BW8A 2YBKA 3ZYJB 2WFPA 4N9HA 2JB4A 1AF9A 1YZBA 3WP5A 1BHAA 4CDWC 2JICA 2YC4A 3L75H 1G4YB 1S0DA 4MW3A 3AK2A 5FY4A 1AYM1 3WOGA 4YGDA 4Y5TA 2DU0A 4OI0A 2DYCA 1OPOA 1AX2A 4YW6A 5BY5A 5FPBA 4KXRA 1V9PA 1EUTA 4IEQA 2GSMB 2KM2A 1KJRA 1OQEA 1EZJA 1OLRA 4HOOA 2VZRA 3MICA 5GLWA 1HDJA 3HVDA 4IHJB 2YFZA 1SCRA 4U3FH 3VBFC 1ZRCA 5C4WA 1UMIA 3LWCA 5GKAC 4YVSC 5T50A 2K46A 3QNEA 3LSUA 2ARXA 4FI9A 1OA3A 4HL0A 1K12A 2A6VA 3FLRA 3BKZA 3ETDA 1I7FA 2CSGA 1H2GA 4ISQA 1AJKA 1LR5A 1Q8PA 1VIWB 3T3YA 1F9KA 3ZIXA 3OAAG 3TXQA 3TEYA 4XUPA 4JI5O 2NZ9A 1R3IC 1Z7S3 4NHLA 2PHDA 1R092 5BNNB 1JMKC 1W8OA 2WZR2 3O1PA 2PI4A 1M9NA 3MPBA 2R9IA 1QLEC 5EYXA 4FPYA 1L1FA 2YXHA 3NV1A 1U5YA 1LOAA 1OLMA 2CTVA 5LA9A 4S2HA 4AEDB 1YXBA 1Z78A 4UW6A 2AGAA 4FFGA 1K3IA 3CQOA 4E27A 4GD4A 2GU9A 2HWF2 4F8AA 3R66A 1MS0A 2Q7GA 1C8NA 3NMBA 3H8OA 1KKDA 1WWYA 1AB3A 3BHPA 1RITA 2UXNA 1GZ9A 4CU7A 2XMLA 1WMFA 4J7JA 3ZFEC 1AVMA 4LF8B 1MABG 2QKDA 3HR0A 2FBEA 3LPGA 4GMP0 1VRH3 5E6HA 2XAHA 3LDEA 4GLXA 1TAEA 4B4RA 2Y0IA 1UZZA 2GH8A 2XVLA 1J58A 2X05A 1EN5A 5F6KA 2V09A 5DN6G 4HN0A 1STMA 4DV4B 3B9CA 4UCVA 4DV3B 4CA9A 3OG2A 4SLIA 4LKEA 2OUJA 4JAAA 3WSOA 2OT7A 2LALA 3OMIB 5FYVA 2GDFA 4XJ9A 2Y34A 4AVSA 3L71H 1N32B 2BOBC 2VZ1A 4Q4V3 2G9FA 3WY6A 1KITA 2BWAA 2KR2A 1MEC2 2WS92 4BM8A 4JYCA 4OQ8A 3KMHA 1AILA 4QB6A 1XMOO 4YPJA 4CRQA 4RR3B 4YIOA 4E4DX 1JUIA 3D3AA 1Q82W 3GALA 1PO22 1VAKA 4XOGA 4D6RA 4XFGA 2DMXA 5LB6A 1W8FA 4NPLA 4LBOA 1GYKA 5DUWA 1RFYA 4YM3A 1LHWA 1XC6A 2BRTA 4CE8A 1BMFG 4UWDA 1LOFC 4CP0A 1WP8A 3FBMA 3MYXA 5JUVA 3ZXAC 1Q8OA 3ABKC 1JU3A 3PIGA 1IBMB 4X62B 1JODA 4ASUG 1SZTA 3CX5F 2NLRA 4G28B 3FKSG 4WFHA 1UIJA 3S30A 4YW5A 1EN4A 3HAGA 2Z2SB 2JS5A 2HWB2 3AVRA 4UYBA 4YHHB 5LCWL 2H94A 2WNOA 4O4JA 3B40A 4Z82A 1SBFA 2CHHA 5C4WC 1LOBA 3AL6A 3ASOB 1FAYA 1XI1A 1WCQA 2C0ZA 1W9WA 2W6IG 4J1XA 2JRIA 1W06A 3LEGA 4LKDA 4JF3A 4FPPA 3RZMA 2LW8A 2E51A 5C9AB 1A8MA 5C8CA 3KKYA 1C5HA 2QE7G 4RUFA 3LIHA 3AP7A 2CDPA 1PPJH 4ZU4A 1AJQA 1QHTA 2ZHLA 4WBNB 4CUBA 1FATA 2BERA 2NPIA 1YITV 2RDSA 2XPJA 3ZR6A 2HYXA 2CTWA 3AZXA 3MHHC 2ET1A 4UFMA 3FFZA 4UAPA 5FZIA 3ALQA 1SESA 5E1RA 5JQGA 2Y8KA 1R3JC 3BA8A 3FZ3A 4BE3A 3S7EA 1AR72 3CEIA 1FYUA 4A7ZA 2W39A 5K4LA 2IU0A 2ZEZA 3MW4A 3V56A 4LNUA 3WB2A 1AR83 5FPXA 4P9YA 3KV9A 1W9TA 1SLCA 3VD3A 1QJEA 2JECA 3MAQA 4XACA 4I55B 4DW1A 2GTSA 2QFEA 5C3RA 1M57C 1H8HG 3HB3B 1O3TA 3G7DA 1VMGA 1RM1B 2XR4A 4GKJO 1K73W 5LYJA 2XLAA 4XETA 2VM9A 4WFEA 3VHOA 2VNRA 4YVWA 3U11A 5J1XA 1W05A 3BTZA 2X6AA 4BW9A 3MUY1 2HP8A 1WLDA 5C5UA 3AL5A 3UK9A 1RPRA 2QJVA 3GM8A 5IVBA 4XQWA 1A3KA 5F37A 1Y74A 4K8XA 2P1BA 3BOWA 3T2TA 3VQYA 1PX3A 3ZMVA 1QJY1 3WNMA 4BQ1A 4HPKB 1JZ5A 5BY1A 5D5QA 4LFCB 4DUZB 2ADPA 5GLVA 3JB4C 1YO8A 1BT8A 3SH5A 2D3OW 3ZFFB 5DMYA 3VKOA 2AEYA 3WG3A 1TMF3 4MOAA 4AILC 2QKCA 2JS3A 1WA8A 4R6ZA 3M8AA 4Q4X3 3QCWA 2ZMNA 1I0HA 3IBMA 4JDMA 1Y43B 3HKBA 4MLOA 4FM2A 4GKKB 4YXWG 1H8EG 1AROP 3CHXA 3DF0A 2QWQB 4AI8A 4O2BB 1VIBA 1JMUB 3KSCA 3BRCA 1EUUA 1RJ8A 2GNBA 4Y5SA 2WLPA 3ES4A 2AZ0A 4YY3O 4EN8B 1XNRO 1W6QA 2EULA 2W0XA 5C3QA 3POJA 2OPWA 1NCQB 5IAXA 3NNGA 4CCKA 2ZGTA 1N47A 1IXBA 1WJZA 3GHNA 3DXTA 3HKCA 2ATKC 4S2DA 2DVFA 4XW3A 2XWJB 1QMJA 4FCAA 3PTYA 2DBNA 1SFYA 4KHPO 3UT5A 2OCCB 2F4PA 3RYCB 1DYKA 3ITQA 1KXGA 1YDXA 4P9XA 5C8CC 4MSWC 3PUSA 3BEHA 4NPRA 2HKXA 3L2HA 5J36A 1I6XA 2WNVC 5FPAA 4IE4A 3K79A 4LHNA 1ZL8B 3TB0A 3I2FA 1R6KA 4JZ2A 3X2QB 2HWD3 3WVJA 4AWDA 4XBQA 5FYMA 3I2IA 1A34A 4E4ZA 3FYIB 4Y1UA 1KECA 1JFFB 2ES3A 2XQXA 3ZHUA 1K5SA 1Y67A 1BQPA 1RUG1 2EZPA 4OGQB 1ASJ3 4IEUA 2A9HA 3D3QA 2Y38A 1JQ0A 3KZIZ 1TQ5A 3ZYHA 4UCTA 3AP4A 3S57A 5IK5A 4PLOA 3SYAA 4F3JA 1GLHA 3PL0A 2ZX4A 1UY3A 4FLYA 5IYYA 4YNIA 1X36A 4Z2AA 1CVNA 4UB8Z 2ZHNA 2ENRA 4IW3A 4DO2A 3CC4V 5AVPA 4UFIA 3WW3A 3MIBA 1FOD3 3ZHRA 4K8FA 5FCCA 2XL9A 2RS31 4QD2A 5LZ6A 1RSOB 1VALA 4FP3A 1NH2B 3VZJA 5BMVB 3ZDVA 3POWA 2ETEA 4K20A 5J48A 3LZZA 2YEVB 5E88A 1YFXA 1F5JA 3O0XA 5A9GA 1PMHX 3HBZA 1JOPA 1LODA 3E5UA 5FZ9A 1SETA 4B1MA 1QVGU 5BZBA 2ZIMA 4YVWC 1HRI2 3SYOA 1S5JA 3RZJA 3E22A 5EWSA 4J7ZA 2L6LA 3OBTA 1GZWB 1PX4A 2HR3A 2RS32 1SLAA 2A0LA 3RYHB 2WAAA 2WFF3 1FPN1 4XIKA 2DWDC 3NW4A 2QUOA 2W46A 4JGYB 5AC92 4ZONA 2IBZH 2ZJCA 4K35A 4JAUA 4BIFA 1CAWA 3RVZA 4X8PA 5H2FZ 2GUZA 1IS4A 1I5ZA 4YARA 2RV9A 2ZHKA 1XMQB 3SEPA 3H9VA 2LFSA 2D3PA 4LNVA 4CEYC 3I49A 4ICGA 5FZMA 1ND3B 1COV2 2JGUA 2I07B 4NIIA 1YWKA 1JYTA 2YIBA 2D6OX 4WCEV 4WV8A 2WLQA 1W8HA 3CJIC 1NTZH 4Q0SA 1W9SA 5EHDA 2BFUS 4Y22B 2A6WA 1KU9A 4LHSA 2L9LA 2YDEA 3WDXA 4MT8A 1QJX2 2JB8A 3JYCA 2SLIA 4RO2A 1YHQV 4QX8A 1IBLB 5CFCB 1LHOA 4AFCA 3RYRA 4I0XB 2WC2A 4D0QA 4P9OA 2RN9A 2ZE8A 1HJFA 1QQP1 4NMIA 3MF9A 2B7YA 3LPFA 1WLEA 4CH3A 2JX9A 5F9TA 1CR7A 3BCCH 3W20A 4TXWA 3OGSA 1HB2A 1QNMA 4I4TB 4RGGA 4CEWC 3DECA 1RUC3 1J3QA 1FNZA 3VZMA 3T1HO 3HWJA 4RS5A 4LFAO 1IURA 3DCQA 2Y6GA 5IJ9A 1QJFA 4P9GA 3GWOA 1CD3G 1XNQO 3N2GB 4LBQA 3CLPA 3AB0A 2C24A 2HH9A 2HJIA 1O3SA 4HVQA 5F3GA 2XTAA 3K9AA 3URFA 2HWC3 4YG3A 1L3JA 4I50A 4K8RB 1KBHA 4Q0VA 3CCJV 2Y6HA 3TNPB 1ENVA 3AK3A 3A22A 3V65A 1GICA 1OCZB 3ZN6A 2PXJA 3DYOA 1N33O 1DGWA 1IVSA 1Q6HA 3K57A 1C28A 2P5BA 2BBAA 4PA6A 5F8PA 2Q8CA 3MW2A 1N3OA 1HWYA 1JCHA 3U10A 3AZZA 3AK1A 3USUA 4XUQA 4JYAB 4PIZA 1CX1A 3AVSA 4Q26A 1S2KA 1WGPA 1X8EA 3AMQA 3JD73 4U36A 1V55C 3M7MX 5B1OA 4XBLA 4P9LA 5D2AA 4X66B 1RVF1 2P3YA 5GONA 3TBDA 3WNXA 3WDVA 1I5PA 1N1SA 5DN2A 3B8NA 2CTQA 2LM3A 3U1XA 3BPZA 3O5SA 4BQ5A 4EB6B 4TYSA 2A3WA 4IV3B 3RS6A 2VECA 1GV9A 4QXCA 5JZGA 4DR7O 4B29A 4MTOA 4XDJA 1XNKA 3SMHA 2KXLA 1RUOA 3K04A 2ZM6B 4O4HB 2FDIA 2BTOA 4BCUA 1HW7A 4FZ1A 1JX9A 4J42A 4X64B 3WNKA 1RINA 2KG7A 3ZX6A 3CU7A 4OX9O 5CBHA 1VMFA 1D4VB 1JZ3A 2HVJC 5T5LA 1KS5A 1W8ZA 3N9OA 3JASB 3HKDA 4H2AA 1O4YA 1W3XA 1CAVA 1NCRA 2ZX3A 1AUYA 2W1QA 1DGLA 3OGRA 2EIMC 4MXWB 1HR0B 2RM22 5FZKA 3GBGA 2Y69C 2VMCA 5JOXA 2PLV1 3CP1A 1K92A 3QG5A 1UX6A 2RJKA 1OCCC 2JDAA 1EPWA 4DXWA 4IEOA 1PKXA 1HJGA 3RYFB 1ENXA 2A7AA 1EY2A 3ZIAG 3VQXA 4QKBA 2IXCA 1JYVA 3I2GA 2ILMA 2DURA 3KHCA 3DPRC 5JPMB 2VOTA 3POBA 4DV7B 3A0BZ 1YIJV 1G8WA 1N8RW 1N4CA 4RAIA 4AGVA 2BGOA 4IHJA 3C7EA 4B7KA 1V9U1 4JI1O 2UURA 3H9AA 5LY2A 1H1MA 2BBVA 4QPGA 4I0AA 4YJ3A 2MK3A 3S3XA 5JAXA 3RJ2X 1Q8IA 1OV9A 1GKBA 1KEXA 2YPJA 2E7QA 2Q8OA 2B5HA 4PJYA 3A0NA 1R083 4GALA 4RS5C 2X0LA 1IXMA 4N7IA 2YXLA 3OY8B 3PMEA 5B1BB 1W9YA 2BUKA 1DLLA 4BH9A 2ARBA 2OUHA 3JBG2 1T6GC 2G4IA 1DG6A 4X65O 3PVNA 1V9U2 5K0UB 3BFRA 4YZ4A 4K21A 4BPZA 2V7QG 2NMNA 5FPOA 3JB8A 4EFBA 5L3FA 3MPPG 1W04A 3OUHA 4CDUB 2RS12 4NN0A 4MGTA 1YJWV 1H8TB 1FAFA 1GK9A 2A06H 4O4IA 3ZSEA 2FZ1A 4HSLA 1LHNA 4IESA 4JQTA 1S3JA 3GNEA 4LR4A 5LMUB 4R8HA 3VBOC 3WB1A 2B9VA 4UFHA 3KD4A 2W68A 2R0FA 4RSUA 3K4AA 3QO8A 5CFDA 4FM0A 3M8LA 1W39A 4NPMA 3QO5A 1NTMH 1JOJA 1D5AA 1DQ5A 4UFZA 4IE7A 4DY5A 5C8YB 4P02B 4IIJB 4AQTA 1WAZA 2ZDIC 3ZEDA 1U12A 3CC7V 1LECA 3THTA 2D44A 4J9ZB 4R4XA 1MS9A 1DFQA 1UOJA 1IG3A 4H44B 1JOBA 1YI7A 2IXHA 4B3TO 4G4FA 1SHWB 2QQIA 4CU8A 1RUF2 1AR93 2FDJA 3IGAC 1YNAA 2PQSA 3IDAA 4RR3A 1N36B 1D0HA 3CCSV 4LF5B 4R9CA 1NU1H 1RHI2 4OI2A 4DV1B 5BXZA 1MS5A 3LA7A 4LCUC 3WFVA 2VOKA 4OMDA 2ZGPA 1EBOA 2ZGRA 1GZCA 2Q4PA 2JG9B 3L73H 5JR7B 1LR1A 2YG0A 2W6JG 1PZ8A 3OYWB 4HFSA 3ZFGB 5JIAA 5LY1A 3B69A 4OZOA 5FNVB 1W2UA 4K8ZA 4GZRB 2XG3A 3OGCC 1OA4A 4KWJA 1H38A 4LT5A 2A3XA 1D5NA 1UU4A 3HD8B 1UX7A 3VZKA 1SF9A 1WN7A 2VXRA 4F83A 2H6BA 3H7JA 5BNPB 4GAZA 5LRRA 2RS53 3VLBB 1EYBA 1K45A 1RUI1 1WPBA 3ZLIA 4B3MB 5HPOA 5T5OA 1O8PA 2XJUA 2X6BA 2DV9A 2IU3A 5CYYA 1HXS1 2CUGA 4CC6A 3RG0A 2VMDA 4ISRA 1NE6A 4ZXKA 5BNNC 1CGPA 4WBNA 2WLLA 1FXVA 3FLTA 5HCFA 4AG4A 1PVXA 5LA1A 2W95A 1RGSA 1AX0A 2EAKA 4QPWA 4RGKA 3EXAA 4CSWA 3HBKA 3LA3A 4UOJA 1AYN3 2J1SA 5FMDA 1RUJ3 1NE4A 4A3ZA 1DYPA 3BCWA 3IM0A 3OW2U 4FJCC 2P22C 3SH3A 2QQPA 4AEDC 2ITCC 3OR6C 2WINB 4PI0A 2RR13 3B02A 1VBB2 4JV4A 2C1FA 2ZGOA 2V4VA 4X20B 3CJXA 1WLCA 2FD8A 2UY9A 2ZS6B 5FPUA 3VD4A 2W3JA 5IVJA 2EXJA 3RNSA 5A33B 4A6SA 3LDDA 1LJ7A 3TAYA 1HNZB 4DV2O 1ODMA 1OHHG 4XQDA 1NQJA 3DGEA 1VBA1 2LQTA 3BA9A 4ASMB 2G9GA 1R3KC 1AYM3 4N8MA 3WQ7A 4LLOA 4NIDA 2Y6LA 2DVBA 4BMBA 2R7EB 4PBPA 2GSYA 5F39A 5KHKA 1CQ9A 4K6BA 4QM8A 3GWKC 1J83A 4PQ9A 1XHZA 3CRCA 5L19A 2GH2A 4L8JA 4DR1O 4NKGB 1IPKA 3LFIA 4NTWA 3AG4B 4N53A 2QQVA 4Q4Y2 1NZCA 2QKAA 2QTSA 4HZ3A 3CO2A 5BNQA 5JDBA 4CCMA 3E97A 4PT6A 5FYCA 3U78A 4RR3C 4DR2O 4TN7A 1A8DA 3WDWA 2WQ4A 3VBRB 2B9UA 1UY4A 5A7OA 1PMJX 1KQSU 3E2EA 2O57A 3AKSA 4XDOA 3ZFFA 5H6QA 4AFDA 1RUD3 2GAUA 4JV5O 5JSOA 1B35A 1IG0A 4LJHA 4BOWA 4BLIA 4MVMA 3BB6A 4LO7A 2R1BA 1JZ7A 2QQNA 4O2BA 3C2UA 5A3PA 3ASIA 3POGA 3NXSA 5FRAA 3PUHA 3JAMN 5DPNA 3SYQA 2ZGKA 2Y26A 4NXMO 1PO12 3GDBA 3JUUA 1Z5VA 2XAQA 5T5JA 4X6RB 3LSSA 2BZDA 2J1EA 1CXZB 2W87A 4K3AA 4A6OA 2WLKA 3UJOA 5CISA 1NCQA 1W0PA 4WVMB 3CS5A 1XBLA 5IFTA 2Y6KA 1K34A 5JMCA 5JJJB 3K51A 4EKWA 1MZFA 3KZ4C 1HNWO 1S0FA 3ASOC 2AZ5A 2VRZA 1I3HA 3INAA 3VDDB 1X9PA 3M2MA 3I2JA 2IJJA 4YZ2A 5EYYA 3RYCA 5F2WA 2DTWA 1X8MA 5C93A 4DRXB 3OEAA 3NAPB 4DUYO 4CU6A 3LGRA 3WD5A 2VULA 3STZC 1LKNA 5C9AC 5TISZ 3QO7A 3E8BA 5CADA 2JDHA 2EIBA 2OTLV 2DN9A 1VQLV 3LE0A 1JZ6A 3NNFA 1PNLA 3AXEA 4X6QB 4HNAB 1JW6A 1Z7S2 2PYLA 3MO4A 4ZI7A 5IK7A 2P6CA 1GMGA 1VRH1 3IWZA 5JMOA 1KB9F 3WF3A 5F3EA 4URTA 2HG5C 2P5OA 1R1BA 1O91A 1OI6A 4JTDB 3N27A 4NB5A 3H3LA 4WVZA 1U5IA 3J80N 1CPYA 2PI5A 1UOGA 4MGYE 4RHV3 4DR3B 2WRAA 3G6EV 2P3JA 3VD5A 5I8SA 2D97A 2XQRA 2Z5UA 1CZSA 3THOA 3ROUA 4JRLA 5A1LA 1OF4A 4COZA 1WB8A 1WA4A 1M90W 1US3A 5A70A 3TEZA 1R6TA 2R16A 2VMHA 1RSOA 3RRDA 2BOJA 3JSNA 3SPGA 3LEMA 5BMVA 3AZYA 1HN0A 3VKNA 5FPZA 1CZTA 2VQEB 4PA7A 3TK1A 4JI0B 2ZMKA 5LBBA 1AXZA 5EPAA 1RM1C 2LGWA 1VBD2 2R72A 3ZRWB 3P6BA 1P8JA 1O7FA 1B09A 2R30A 4QX3A 1K5QA 4TV8A 4E8DA 2RJLA 4XTPA 2VBDA 4Q4V2 2QVSB 5A3WA 2RDCA 4QX0A 1ZAUA 4LP8A 1Q8SA 4BXSV 4YFWA 1GZWA 1H9WA 1DGRA 3K48A 2RNBA 4LE4A 4QPIA 1QXJA 5K9YA 3N7KA 1ZX3A 2ETNA 2ZX0A 3OBZA 1BVP1 1LTEA 4JGYA 4ES9A 3VQVA 1CAXB 4O2AB 2RE9A 3ZFFC 4FPKA 5FTTC 1XU1A 1ZVFA 4XUOA 1UOFA 5HCHA 5LA6B 4Y4YA 3Q8EA 2TEPA 4QIWF 5E79Z 5FYTA 4AQ2A 4UCUA 3OPZA 2VQFO 5LL6Y 2VUDA 4HKWA 1GOGA 1GRJA 3J7AU 2ZEWA 1N0JA 3J8F3 1N0NA 3S0MA 4LIVA 3ZO0B 2UUAB 1PGW1 4UF0B 1IKQA 1ND3A 4MS2A 2PAEA 4XF0A 2F23A 3ZX7A 3I55V 4UBHA 3H1WA 3O1VA 5AFEA 3DEMA 4LO5B 3MHZA 3ZOIA 1Q8QA 4ZBMA 3C7GA 3PU8A 1XILA 1NCQC 4Y22A 4GMP3 4Z1VA 1C57A 1K5MB 3ZMTA 5KR7A 5GJ6A 3AMNA 3AG7A 3T1MA 4BK4A 1DHKB 3SCGA 1GP5A 1V6NA 1W28A 2OCCC 4LF8O 1IZ3A 1OF3A 2DCYA 4I0XA 3KGLA 2UUBO 4XF3A 2PAMA 1PGW2 1VF7A 2X7RB 3RFRA 2IXIA 2YXYA 4UVBA 1EN6A 4PELA 5FZ1A 1MS8A 3D4KA 3RZZA 3PTRB 3VB9A 4W65A 4I4TA 1TZOA 1VBE2 3X2QC 4JTCB 3C90A 5JSRA 3A7QA 1SQXH 2FKXA 1AR81 1GO3F 2WYFA 2QEXV 5DAQA 2XVKA 2A1XA 4XXPA 1D0GA 2EIKB 5FZFA 4MH0E 4QDRA 2CK3G 4NRQA 1H2MA 2ZD9A 1PK6B 4EWDA 4JI8O 3L9DA 1K33A 1NT2B 3E86A 5DUUA 5ITZB 5FY0A 4JC1A 2R061 4LXLA 1ORQC 1AR82 4OULA 5FP9A 4W50A 2J7MA 1ZZ7A 3OBRA 3WCSA 1BXHA 3NKTA 1IQDC 1IBMO 5KBFA 1JUHA 4IE0A 4P9JA 3ZHTA 4Q4W3 1VBC3 1VQ4V 2Y0OA 1TMF1 1SLTA 3WF4A 1ZLZA 1IKPA 4LUMA 1UXXX 3BY6A 3TN92 3P3PA 4CP2A 3RZKA 3CB2A 3HKEB 1CONA 4NE9A 4MO3M 1RMU3 4J1WA 3RVYA 3KV6A 1V6LA 3WP6A 4Y20B 5EC2C 5FBZA 1FXKB 3VBSB 2JGDA 4EB6A 5LK5A 4HLTA 2N7GA 3TJTA 3W7XA 4DRRA 3CWBH 1FXZA 2ZABA 4JI6B 1V6JA 2KKWA 1UY2A 3VN4A 5F3IA 3ATGA 4JGYC 4CCCA 4O4HA 2X5IB 2O1QA 4DR6B 2YV8A 5H5NA 2UUCO 4Q4X2 4PDRA 2CE4A 4OMCA 2ZE7A 1YIPA 1NLRA 3IAPA 2VL4A 2FB5A 2WQ8A 2HKOA 5IYZA 5LOVB 4QQLA 5J2UA 1XE8A 2GZWA 1W6PB 4XUTA 3MIGA 3JD0A 2VE1A 4DEVA 4QMAA 5AFBA 3H42B 2DVDA 1YQ5A 1ND3C 2R1DA 2YXSA 1GN3A 1LGCA 2HWD1 1APNA 1FV2A 4JPRA 2R042 3L70H 4TWKA 1D4M2 3R0RA 5FUIA 5GW7A 2VQTA 3FWEA 3A4UA 1DZRA 3WLUA 4LKSA 2WO2A 2XH6A 2O14A 3CRQA 1QGLA 1REFA 3SYCA 1ASJ1 4AI1A 4CS3A 3GVMA 3I54A 4OXSA 5CFCC 2XT9A 2ATFA 1SZXA 2GHYA 1LHUA 1EFRG 5GZEA 1S0VA 1OCRB 1AXKA 1OOPB 1FX5A 1Z0HA 4MADA 1G1XB 5FBJA 5I0UA 4YJ2A 2WNUB 1FOD1 1XL6A 3EJKA 5FZ4A 1AJNA 4COYA 1Q5OA 1JVMA 3JZVA 3AXDA 5C33A 4WFGA 1PL4A 3ZYRA 2ZZQA 1UFIA 4ARXA 5A6ZA 1R6NA 1BK1A 3GZUC 1JHNA 1NBMG 3FB5C 1MOFA 5K0UA 2P17A 1M93A 1SQQH 5C70A 4BXFA 2OW4A 2F95B 1OCZC 4CUCA 3ICXA 4BQWA 2AUYA 4DUXA 1LHVA 5D8AB 4CCEA 4CDUA 2UU9B 1HB1A 1MVEA 1CEZA 2BU9A 4AZZA 3G71V 1H8TA 5EXOA 2WFF1 4FFFA 1TVKB 5FOJB 4UV8A 5FZCA 3ZXJA 5BV6A 4META 3N36A 2AW9A 4HBNA 2N74A 4D3WA 1ODNA 1ZNPA 2ZXQA 5F7UA 1ZRFA 1QJZA 4LF4B 1SG3A 1QXRA 4J41A 2IC1A 3BYWA 5CA0A 5LRSA 2VZPA 2O0OA 1MSWD 3A2FA 2Y4TA 4L92A 4QM9A 4B4PA 1KUQA 5FMOL 1T5EA 2XWBB 1IOAA 4IV3C 3WF1A 4YM0A 2WFF2 2DQ0A 5C8YA 4IIJA 3SPJA 3A0KA 4AFMA 2EZOA 1PIV3 4LBNA 1QQP3 2SBAA 2BFUL 4XDLA 1JS9A 4Y33A 1HNXB 3FFQA 4KI5M 5LP6B 3CJHB 5LEKA 1NX9A 1VJ2A 2QR4A 3LSQA 1NKDA 3JAKB 5CG8A 5KHGA 4XUNA 1XREA 2ZX2A 3OUSA 3DKQA 1YUDA 4CP1A 1IHMA 3HJRA 3VV1A 2PY5A 2VUAA 1KMIZ 5EZYA 3FAVA 1BKZA 5DAVA 3BTYA 1SPPB 4BQ4A 4CCOA 1F15A 1RUC1 2EIJB 4GULA 2W47A 1HLCA 3WHTA 4MYEA 2UWBA 1QKQA 2ZIOA 2F4VO 1ND2A 3JAWB 2J1AA 4FLWA 3C7OA 1ZZ8A 3VD9A 2WQZC 1R1A3 1W0OA 2JG9A 2VU9A 5LHGA 1SQGA 3ETEA 3VL9A 3P3NA 1G9CA 1TME3 3ZFGA 3JSLA 3RYIB 3WQ1A 1XNCA 2D3RA 2HWC1 1NS1A 1OVSA 5FNVA 4JI3O 2EILB 4A4AA 5JWPA 4FQZA 4GUNA 3QBQA 1MS3A 5IYDO 1BE3H 3P1IA 4Z2WA 4JI2B 4O9EA 1AI6A 4ZOLA 1RUC2 2E33A 1YF2A 1U5XA 5JR2A 5BNPA 3PDQA 4AAPA 5KC5A 4KBBA 4CDXA 2OT5A 3W5MA 1OZ0A 5B1BC 4QHZA 3OMAB 5FKCA 1P49A 2BSKA 2FCVA 2VW2A 4FPCA 2CWMA 2HWC2 1XUQA 3LD8A 3KQRA 1I9RA 3JD71 1RUH2 2XLGA 5JI9A 5JOYA 5BYNA 4ZKTB 2GALA 4L11A 5K0UC 5GZCA 4BA6A 2N05A 4P9WA 3M4FA 3ABMB 2BPA2 4CCJA 1C4RA 1UYYA 2E31A 4YFZA 5FZ3A 1Y6XA 4DMIA 4HXCA 1UCXA 1R3LC 3Q8AA 4CDUC 1G7YA 1AP6A 1MR5A 2VTXA 2WAMA 1NKGA 2VZ3A 1IX9A 4C1XA 1H8TC 1W2NA 2P3KA 3T2MA 2OYZA 2LO1A 1XPWA 5FV3A 3ABTA 2IXLA 3ZVXA 2BOCC 1POV0 2UWCA 3CD6V 3LA2A 4X20A 1LOEA 1W0KG 1S0CA 1NVPD 4QDQA 1C8M2 3RZLA 4F7ZA 1WBFA 2ZGNA 4M00A 3O14A 3I3EA 4JI5B 2KD7A 3JATA 3X29B 4HK9A 1VQPV 5DAWA 1VQ7V 2P90A 4KUMA 1F4MA 1CAUB 1O9HA 1BYHA 2VNOA 4GX2A 4IQPA 4H3WA 2DU1A 5CB7A 4GYCB 3H1JH 4H0LB 2E74B 2VW0A 2DW4A 1U96A 1VF6A 4J7KA 2OZ6A 4A42A 2XJRA 4Y5Z0 3NR7A 4TOIA 1OT5A 4I0BA 3UGGA 4BR6A 2MEV3 3V0BA 4WM8A 1LGNA 3VUOA 3FD9A 3B77A 4H37A 4LO4B 3J7NA 3ZMZA 2WAOA 3B9IA 3IPVB 5GZDA 3CNAA 5FP8A 5FZ7A 3ZN0A 4UFKA 5DUVA 1ZREA 2QWOB 4Q0UA 4XFHA 4YW7A 1BVVA 1W6NB 3IMNA 1GM8A 5GZFA 3SR2C 1JJ2U 1Q3EA 1SZBA 1E57A 4RFT0 3MLLA 1R081 3AZWA 1QH6A 1J1TA 5C3OA 5EJ1B 1JZ8A 2JG9C 1EV11 1G9FA 1J5EO 2CGOA 4R9DA 4QPJA 3ZFGC 5J98B 2IZWA 2Q69A 2DFBA 2RHPA 4JI7O 5BNOB 5L3EA 3GB7C 2D40A 1US6A 1AR63 3LDKA 1NYWA 3WX5A 3C3VA 3HNBM 2ORZA 4WVMA 3AMPA 3NNJA 3CCEV 3AYAA 4ZZ5A 3AP6A 1J3RA 2A7WA 4JYAO 1L7QA 4OUMA 4EWAA 5FY5A 2NMOA 1ZBA2 3SHRA 3NV3A 5IUQA 1GU3A 4Q27A 3ME2A 1JYNA 4QGMA 1QF3A 4X66O 1R082 3MFCA 5BNPC 2ZGQA 4A45A 4DR5O 4DRXA 3NAPA 1R093 2EINB 3C8XA 1FD9A 4Y1VA 1IBKO 2WZR3 4DQAA 3ML0A 3N7JA 4YM2A 2VZUA 3WV6A 3DXUA 4OI1A 1ULCA 3WINE 2Z5WA 4HNAA 3P32A 5D5PA 3OD0A 4CDWA 2ZM6O 2BGCA 4J10A 4LBKA 4H13B 5C71A 1HP8A 1POV1 5F3CA 3M1HA 2EX3A 1GP4A 4FTBA 1H2SB 1E1RG 2O8QA 2WPDG 3CF6E 4W4ZA 3QACA 4FSJA 5TSWA 3RMXA 2HWF3 1ZRIA 2JKXA 3KCCA 3W7TA 3T1LA 2EICA 4XDPA 5GLZA 1DGWX 1F35A 4GXLA 1RUNA 4PCRA 1MZ6A 2ZQMA 1HB4A 4FXGB 2OYQA 1AR91 3KT4A 3UKMA 4DIQA 2VR4A 5FR3A 1Y3TA 3U0ZA 1UL9A 1Y9GA 4M3CF 4P9IA 4JVAA 3K5LA 4JRAA 1D2SA 2OPKA 5C5TA 1FJGO 2WS93 4AQYO 4YW3A 1THZA 2D3SA 1FMD3 3ZJZA 2VAUA 3TETA 3O1OA 3WU2Z 3CIHA 3AG4C 2YY1A 4XAEA 1O8SA 4Q1PA 2OKXA 1PO23 1NA1B 4IERA 2PHWA 1AR92 5FZOB 5AVAA 3DTUB 1GP6A 4BK5A 2AZ2A 2Z69A 4AVTA 3K2OA 3EO6A 3WCRA 3Q8FA 3OUIA 4NWWA 3UO3A 1GANA 2K2SA 1QXPA 4WFAV 4YZ3A 1OCOB 3VBRC 3NVCA 1OHFA 1H4HA 1CAXA 5BPXA 4O2AA 4O61A 3CYOA 1BEV2 2ZNIA 2VXJA 5LA6A 1PNGA 1HXS3 5BR8O 3UYJA 5KMGB 4Q1RA 2IWGB 3VBOB 3KVBA 4RL7A 4GKJB 4JCKA 5GZGA 2RS51 1W6MB 4DW0A 2D5HA 4JTOA 5DDJ1 2HWB3 4H33A 4UF0A 5FAXA 4WVWA 4IETA 1DCSA 1Q86W 1A6CA 4ZXEA 4DXRA 2UXXA 1XB9A 4YZ1A 5EJ3A 1LNSA 3WR0A 3JARA 5GLUA 5F1RA 5FPVA 2QTOA 4KBZA 3JQWA 3VBBA 1XRUA 4AI3A 4NAMA 4XPVA 3IZOA 3I2OA 2UXDB 1K5MA 5JXIA 3FYEB 3R4SA 2VGDA 4LBLA 3M3QA 3QD6A 3Q4HA 3VDDC 1MNGA 1UF2C 5FXZA 1RUJ1 5LASA 4XF4A 4XTMA 3T1YO 2Q68A 2GNDA 3H1YA 3NAPC 5FKBA 4GB33 3HQXA 4NIGA 4ET7A 2EIEA 4PD4F 4MGKE 4KH9A 4NWVA 1ENQA 1IPJA 3QTCA 1MACA 4YY3B 1A78A 4EV0A 3RQ0A 2J1VA 3GBWA 1PM4A 2WLJA 1LOFA 1ZYBA 1AYN2 2UWAA 1M1KW 4OUSA 1AR73 5A6XA 1JR9A 3MFAA 1HRV3 1PK6A 1WNSA 5ERLA 5E1AC 4KHPB 3OT7A 1N36O 5HFLA 2RR12 3O7OA 1E5SA 2XBO1 4DV1O 3K0DA 4HYOA 1BS3A 5CKMA 1AI5A 5KA6A 2PN5A 2B39A 4UCRA 4JYYA 4AHYA 3ETQA 4CYDA 4IXLA 2NQYA 4GH4B 2WSVA 2YICA 3PUIA 5A3MA 3MUZ1 4A41A 2LJ2A 1AYM2 1WMXA 3IIAA 3W5NA 3HN1A 1SDWA 4L0PA 4XFAA 1NXD1 2BNMA 5J2TB 4XYXA 3VBHB 1Q8VA 4RA0A 3J26N 1RUD1 1JH5A 5FZHA 1CPNA 1G9DA 3L2YA 1YLLA 4LBQD 3UGFA 4FPOB 2RJ2A 2E5LO 2JDNA 2XJVA 4G3YC 5A3TA 2PGGA 1VB2A 2QZ2A 1FXKA 1OH3A 3VHRA 2ZCWA 1Y76B 3PHMA 2WWWA 1SQ4A 2QCSB 4XF1A 1VQKV 1GNZA 3AEIA 5IVVA 4B3MO 2JXAA 2EIDA 1FKAO 2H8PC 4IL7A 2JK5C 1QBZA 4AEJA 5FP7A 5L3BA 5KXEA 3O0VA 5FK7A 3SQOA 4EROA 2A70A 1COWG 5LOVA 2WWUA 3TGUH 2LW1A 1AZDA 5F5CA 3WQBA 3KCYA 2PAKA 1Q56A 3P5BA 1TEIA 2DE0X 3OTOO 5DABA 3SJBC 4LF9B 3QH7A 4P08A 3UQ8A 1W2TA 4XILA 2E7TA 3AP9A 2CH7B 5C3PA 5DZEA 5F32A 1PMIA 5IJRA 1K5MC 2HWE3 4OPAA 3K06A 4XHXA 5LMNO 1XJAA 2K1EA 1YFUA 3UV9A 1FV3A 1XHXA 5A7NA 3ZKYA 4RHV1 3ZXFA 3DGTA 4LHLA 3DC6A 3MLKA 3FJSA 4NVPA 1OOPA 5L7OB 2NLJC 4R52A 2CL2A 2B9ZA 3CBNA 4XJZA 4IGGA 5A1FA 5L9RA 3EQEA 1EAH3 3NJXA 4X89A 5FY7A 4ITCA 1H1AA 1H0BA 4D69A 4BWAA 2HYKA 2CDOA 3CCQV 3N35A 2EIKC 1YQ6A 1OKOA 2JE7A 4N90A 1PK6C 4XJ8A 2Q0OC 2EJRA 4LC1A 3SPIA 3CCVV 5ANQA 3M3OA 2YUAA 5EIBD 3LOBA 1KS4A 3ZMSA 1OVPA 4IE6A 3A21A 2XXZA 1NZ6A 1E79G 1N34O 5I93A 5CVRA 4FTSA 1OURA 1JJOA 5D8AA 2JIGA 5EBMC 1DQ6A 4AVBA 1UMZA 3SYPA 2CV6A 4CZSA 5FJKA 4P9PA 1HRI3 4Q29A 4QX7A 4LF7O 4L99A 3ZS8C 4LFAB 2QWRB 3V0AB 4XFIA 1N1VA 1GN2A 3CRRA 2WNVA 5H9PA 1XNQB 1TUEB 2BV4A 4Z1MG 3ABUA 3SPCA 4FAHA 2QZ3A 4HK8A 3ST7A 4GX5A 1SDDB 4J6GA 4QXBA 2HFEC 1IS5A 3J8F1 2G38A 4FPHA 4QQ2A 5JXHA 1NAEA 1FXKC 3VBSC 3J7HA 1ZRDA 3O12A 3ON7A 3PJQA 4XCBA 1VARA 2JDZA 5C3SA 4DINB 3VKFC 4KWUA 1MS1A 2WLMA 2CTPA 2EVXA 2VY0A 4KL1A 1UQXA 4QU2A 5CA1A 3E8HA 4XF9A 1XOYA 1KJLA 4GMP1 2A6ZA 1P84F 3MD0A 2X5IC 4GZ9A 1ZX5A 2D7FA 3O65A 5IJ0B 2VOWA 1COV3 5LP6A 2ZPXA 4GIQA 2Y6JA 4HKOA 4HKLA 2E53A 4LK6A 2YMZA 3E1F1 3JAKA 1GQHA 4MZUA 3K5NA 2OQ6A 4B7EA 1QR8A 2J1UA 1YJKA 4TUYB 1SPPA 2PTMA 1ZSPA 4DR3O 1OQDA 4KU8A 4DR7B 3VZOA 2BE3A 1NVPB 3GCXA 1A32A 4K9SA 3ZRVA 5GTIZ 1HDKA 1MZEA 3KWVA 3MZHA 2TBVA 5T5PA 3OB8A 3E83A 2JE9A 5FP4A 2OWOA 4OX9B 5GALA 5FLHA 2R063 1QEXA 4RQFA 5I0SA 3JQXA 1OCRC 2BP6A 3LCPA 1OOPC 2UYAA 3MHSC 3HOBA 2XGXA 4K1YA 5IDJA 5EK0A 1YC61 4LFBO 2BYVE 2ADDA 4AI0A 5KLVH 2AHYA 2HHHB 2WNUC 3TYJA 2QM7A 3VKLA 2OIIA 1N1YA 4ES8A 5CZKA 5FZEA 1K5JA 5CAZA 2AACA 1UY1A 3NNMA 3WG4A 5CEHA 4CEYA 3L74H 4MUVA 1GAXA 4Q4W1 2M6YA 2R9RB 1VBC1 4LPLA 3RYPA 2FDGA 1WZXA 2ZNJA 3BPSA 2UXBB 1Z5WA 2FMDA 3O1RA 2X8KA 3MF6A 3K5MA 4P30A 1QJY2 3CJIA 2RCVA 3AK0A 4ZHQB 1RMU1 3G6JB 3RWNA 2ITDC 1JYWA 4JI1B 3EVKA 4XIOA 5D8AC 1S55A 3KF5A 3NJVA 1YEWA 1WMEA 3U37A 3HR9A 5LHIA 2UUAO 4DXTA 4NTXA 1HB3A 3AM2A 5EZWA 3OM3B 4EE2A 4RQEA 4DOUA 5IVFA 3JD2A 1VBC2 3AMHA 3H7YA 1Q43A 3O1TA 5CIRA 4ZIBA 1L8DA 3O9OA 4FPGA 1Y74B 1ZZ6A 2YS8A
chains in the Genus database with same CATH topology
4QPIA 1QXJA 1AYM1 1V6OA 3WOGA 4YGDA 3UL2A 4CEWA 5K9YA 3N7KA 1HX6A 2DU0A 1WW6A 1H30A 4OI0A 2DYCA 1V70A 2ZX0A 1BVP1 4YW2A 1LTEA 3OYWA 4JGYA 3ZXDA 1OPOA 1QOSA 4A2UA 4D7YA 1AX2A 4ES9A 1JTZX 5BY5A 1CAXB 4MVTA 2DUQA 1RUF1 1SLIA 4Q0PA 2RE9A 3ZFFC 1UIKA 4FPKA 5FTTC 4IEQA 1XU1A 1ZVFA 3H3UA 4UW5A 2KM2A 1KJRA 1CAUA 1OQEA 4AYUA 4Y4YA 2TEPA 1PGL2 4AQ2A 5L36A 1OLRA 3OPZA 3MICA 5GLWA 4C0BA 4HKWA 1RHI1 1O4TA 4M3CE 1SCRA 5JZGC 4COVA 3B94A 3J8F3 3VBFC 3S0MA 3ZO0B 1ZRCA 5C4WA 2FZ2A 1PGW1 3LWCA 1IKQA 5GKAC 4INDA 4YVSC 5T50A 1ND3A 3ZXGA 2PAEA 1JR7A 2VMIA 4XF0A 3ZX7A 4UBHA 3H1WA 1GFF2 5AFEA 2ARXA 5FLJA 4LO5B 1OA3A 1Q8QA 4HL0A 4XFFA 2A6VA 3FLRA 4Y22A 1NCQC 3FE5A 2Q30A 4ISQA 3THPA 4GMP3 1AJKA 1LR5A 1Q8PA 1F8VA 1CJDA 3PVBB 4Z1VA 1VIWB 1C57A 1K5MB 1SFNA 2JG8A 1F9KA 2XL7A 2RM23 3ZIXA 4E4SA 3E5QA 4HMZA 5GJ6A 3AMNA 1RUG2 2ZHMA 3T1MA 4YGBA 1DHKB 1NCRC 2H0BA 1Y0ZA 3SCGA 5T55A 1V6NA 2NZ9A 1Z7S3 4NHLA 2FHRA 2PHDA 1R092 3HT1A 5BNNB 1IZ3A 2DCYA 1W6NA 4K3UA 3AX4A 2NN8A 2WZR2 3KGLA 4I3GA 3E6BA 4H7MA 2PAMA 4H55A 4XF3A 3WG1A 1PGW2 2IXIA 4OLLA 1BEV3 3MPBA 1LEDA 2ZX1A 5H9RA 5EYXA 4FPYA 1ND2B 1MS8A 3D4KA 3RZZA 2D98A 4W65A 4UBGA 3N6WA 2ZBJA 1OKQA 1VBE2 1RUE1 3DUIA 3NV1A 3EHKA 5E8AA 2WIIB 1U5YA 2R0HA 1LOAA 5JSRA 3O0WA 2CTVA 1RB8G 4S2HA 2BQPA 3L9JT 4AEDB 2X29A 2GC1A 1AR81 1Z78A 1NQDA 1Y7BA 4UW6A 3R6SA 1WBLA 4KGQA 5I0TA 3JD72 2XVKA 1HV0A 4KU7A 4XXPA 4E27A 1D0GA 3W58A 2GU9A 2HWF2 4MH0E 5A33A 4F8AA 2R6SA 1MS0A 1C8NA 5J96B 4CDQA 1RITA 2ZMLA 1GZ9A 3B3QE 2W08A 1H2MA 3NL1A 1WMFA 1QJU3 3ZFEC 1PK6B 5SV8A 4QPGC 2QKDA 2FBEA 4OHWA 4GMP0 1VRH3 2GNTA 4EWDA 4AK3A 3JBG3 1WCSA 4N9IA 4RGAA 3W59A 1HW5A 4B4RA 2Y0IA 1UZZA 4PIYA 5DUUA 2GH8A 2XVLA 1J58A 1XNBA 1F31A 1NY71 1AL21 4CDXB 5F6KA 5EV7A 2V09A 4HN0A 4JC1A 4EN6B 1OIKA 2R061 5I8YA 3B9CA 3CEWA 3NJZA 1AR82 4DRVA 4OULA 2R49A 1VZ5A 1VBB1 4MGZE 4SLIA 2OUJA 4JAAA 1ZZ7A 2RS13 3OBRA 3WCSA 1CPMA 1N3QA 1V6IA 2LALA 1BXHA 1OD5A 1NXMA 3NKTA 4W6YA 4PDWC 1FPN2 2GDFA 4XJ9A 4AVSA 5KBFA 4FPFA 4Q4V3 5FO8B 2G9FA 3WY6A 1HKDA 1JUHA 1KITA 4P9JA 3WP3A 2Q1ZB 2GNMA 2BWAA 5J3UA 2A6YA 4LBJA 4Q4W3 1MEC2 2WBOA 1VBC3 2WS92 4BM8A 2Y0OA 3FMGA 1LGBA 1TMF1 1SLTA 5FQ0A 3FX3A 3KMHA 5JIUA 2XUMA 1IKPA 4LUMA 3ZDSA 2ERFA 3TN92 4WM7A 3P3PA 4CRQA 3IDBB 4RR3B 3VBRA 5FO9B 3BU7A 1JUIA 4E4DX 2CGNA 4CP2A 3GALA 4GKYA 4AVVA 1PO22 2PQQA 3ELNA 1NY72 1CONA 1RMU3 4J1WA