2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
1H2LA 1H2NA 1H2KA 1MZEA 1IZ3A 2ILMA 4Z2WA 1YCIA 3KCXA 3P3NA 3KCYA 4AI8A 5JWPA 3P3PA 2YDEA 4Z1VA 4QU2A 2WA3A 2YC0A 4BIOA 4NR1A 4B7KA 2WA4A 3OD4A 4B7EA 2W0XA 2XUMA 2CGNA 3D8CA 4JAAA 2CGOA 2Y0IA 1MZFA 1H2MA
chains in the Genus database with same CATH superfamily
4EWEA 2XNDG 4QGNA 3CHXA 2CNAA 2CAZC 3MV11 5JZGB 4D6TH 1Q8PA 1A34A 2J1VA 4IEWA 1FATA 3K79A 3ZYGA 4PF1A 4JI4O 1S0FA 4Y1ZA 2A9HA 4IYHA 1QJFA 2PAMA 1REDA 4WFFA 1L0NH 4AHCA 4SLIA 3UKVA 1NCRA 3K4AA 2RCVA 4OUMA 4K6BA 4MVMA 4BCUA 1IDSA 1R1A3 4J41A 4LBLA 5KC6A 3UGFA 5ACA2 3NV2A 3LB9A 4I3PA 2YBPA 2JDNA 1K4DC 5JOXA 1MG1A 1MQTB 3STLC 1IPJA 1PZ8A 5B5EZ 4NIDA 4J9YB 5HCHA 5FZ0A 5KXEA 1FFXB 2H8PC 4AHZA 3I2KA 3SH5A 2OIGA 3MIDA 2IW5A 2CYFA 4LBMA 4Y1UA 5KAIZ 4B3TO 2DTWA 1UAIA 3CCMV 5IVBA 4AFDA 2RS53 2R6QA 3RYRA 4AVTA 3N35A 2V5DA 4BR6A 3GYDA 4XMAA 2WS91 2XL7A 2BJSA 4EFBA 3Q4HA 4YW1A 1FNYA 2VZ1A 4UOJA 4GKYA 2ADEA 2ZGQA 4DV7O 4YW3A 2D7FA 4YNIA 4FM2A 4NPMA 4JI4B 1VP7A 1VQ4V 3FE5A 3JQWA 4ZU7A 1Y43B 2E76B 1UY3A 2CU5A 3VD4A 4X65B 4N43A 4JRLA 4C1XA 4PLNA 3LDCA 2ORZA 5GLVA 1TA8A 1DF4A 4YVWB 3KLSA 2PXJA 4PF5A 5FZHA 3VBFC 1I5PA 2BOBC 1PK6B 1FJGO 2B39A 3B2EE 5A7OA 1GOHA 2A6VA 1URFA 3U75A 4W4KA 3ZFGA 1PM7A 1N1VA 1F35A 4CDXC 1NKDA 1QBZA 1FMD3 3A0NA 4PD4F 3O9OA 4PBOA 2DN9A 1H1IA 3ASNC 2R1BA 4CP1A 4YVSA 3IAQA 4XF4A 2CTVA 5CADA 2W94A 4AQYB 1I94B 3RZKA 4QGMA 2ZEYA 2XPJA 3O1TA 3CS5A 1ND2B 3E6BA 5LZ6A 2DCZA 2ETNA 1SMVA 3B69A 2ADPA 5EIYB 3AZZA 4YJ3A 2Y69B 3ZDVA 5KUKA 1LR5A 3OUHA 2B5HA 2D3OW 2VZRA 3SHRA 5JAXA 1ASJ1 4YGEA 3N36A 1YJWV 3ZJZA 1SCSA 2V5YA 3LNMB 2ENRA 4QXCA 5DMYA 2ITCC 2YIBA 3UKNA 4L8JA 4DUYB 2RR11 2JDIG 1AR81 3UV9A 1MEC3 2DF7A 2FCVA 3H50A 5CKMA 1D4M1 1QH6A 4KHPO 3OD0A 3B09A 4U2AA 1S3JA 1BS3A 2RM21 4LUMA 2W0FC 3GBFA 4XFGA 1PNGA 2IVIB 4CCLA 3BY6A 4F4LA 3FX7A 4N43B 1DF0A 1FXKB 3TCUA 1QQP1 1XRUA 5DN2A 5J36A 1WB8A 1XOYA 4RQPC 1H8TC 3IT8A 3IFXA 2PI4A 5LA6A 1VQNV 3WUCA 1OKOA 3G6JB 1UY2A 4FLXA 2XT9A 3VZKA 5IAXA 2IUWA 1OCZC 3CWBH 1ND2A 4Q0QA 3T2MA 3A2FA 1QJY1 4ZU4A 5GLUA 1L8DA 1GN4A 3ZSLA 1NE4A 3LIHA 4DQAA 3IIAA 3ZMSA 1RMU3 3M8LA 1NCRC 1XB9A 3AK1A 2E75B 1M93A 2VBDA 3BIWE 3ACIA 1PM9A 4LWSB 1OD3A 3KGZA 3D36A 4LO5B 2WDBA 3HBKA 4URTA 4E2LA 3ST7A 2ZE6A 2BSKA 3CRCA 3Q8CA 3KT7A 4LEJA 3VZMA 4G4FA 4IEXA 3OY8B 1NOVA 1BVVA 5GALA 4MT8A 5FZ9A 3CJHB 2QR4A 3ETDA 3L71H 5M0TA 4QKBA 3HNMA 2WLMA 4EN6B 4AGVA 4NHMA 3PIGA 5I91A 1V54C 1G6UA 1W0NA 1IOAA 1GWKA 4RHV2 5F3IA 4MYEA 3BABA 3MDSA 4HANA 3W5NA 2W6IG 3ON7A 3B40A 3FFZA 3RPQA 4OHWA 2F6BA 4ICGA 5FWJA 4WFBV 1Q86W 3VDDC 3ZFEA 5EBLC 1RMU2 4IEZA 4CPBD 5HXMA 4FIPC 4UCTA 2G9FA 4AEJA 2WT1A 2BTQA 1LOGA 4CEYA 1G4YB 1BZKA 2OYQA 2DV9A 1NS1A 4GKKO 3THOA 1JJ2U 1JCHA 1Q8VA 4FAGA 1FFTB 1ZZ6A 3VBHA 2N04A 1ULFA 5JIUA 2EX3A 2EIBA 3J8F1 1AXYA 1KQSU 1O59A 5FWEA 3VHPA 4I50B 5EIBD 1VMHA 5ANQA 4JI2O 4PDRA 4I0XB 1E57A 2RDNA 1OH4A 2QA4V 2E7QA 5BPXA 4C7UA 3UESA 5IW0A 1KYOF 4CXXA 5FZ7A 3J81N 1I0HA 1N34B 1N1TA 1R6KA 3G67A 4QQOA 1V9PA 4ORFA 3E5UA 2H6CA 1NXD1 5KMGB 1IPSA 4DK1A 2XUEA 1UY0A 1RUG3 3KM5A 4CDWA 4UT5A 4UW3A 2XGXA 2EIEA 4PQQA 4QM9A 1X82A 2Q8DA 5FPAA 3CMAV 1KUQA 2NMOA 2ILMA 5A1LA 4CBCA 4IUGA 1AI6A 3U78A 2VMIA 1PMHX 5IDJA 3OJBA 2JKXA 4X64B 2JJ2G 1FMD1 3JATA 3FHAA 4R52A 1KD1W 4IEYA 1C8M1 3ACGA 2WNOA 3M3IA 2FD8A 3ZHUA 3K06A 5IVJA 5CA0B 4TQFA 5FYIA 2G9GA 1AYN1 2WLIA 4DR7O 4FOVA 2D2CB 1CR7A 1UU6A 3PTYA 1GV9A 1ZZ9A 4BISA 5FYVA 4JKLA 3CO2A 5IAVA 2Q4SA 3PIJA 3M7AA 3MUY1 4FI9A 3LDRA 4QDQA 3ZEDA 1QU0A 3ZYIB 4PIZA 1JYVA 3ZRWA 2YXLA 1PX4A 2Q7HA 2WAOA 2FDKA 4K1ZA 1R1A2 4QQHA 3ZMNA 3H1KH 4UB8Z 1UPGA 3ZXGA 1V6JA 4BK4A 5A9GA 1N3QA 1UYYA 2FMDA 4R7CA 2YUEA 5L7OA 3JAWA 2AHZA 1ZRIA 4LF7B 4IV1C 3POBA 4DS0A 3ZMOA 5CU1A 1N8RW 1ODMA 1HRI1 3MPBA 5K1XA 1RUJ2 2CUGA 1GSLA 4OHYA 1R3LC 4LNVA 1AR71 5IWFA 4TLGA 5FMCA 3BALA 4XYXA 3JCIA 5A6XA 3JZVA 1VBC2 4NO4A 1K4CC 2LS6A 4YFWA 4CDWB 3WW3A 5CEHA 3TGUH 3F7YC 1KDKA 2WZR1 4NIGA 3W21A 2AREA 2QQKA 4W6XA 4DYLA 3DUIA 3A22A 3MGUA 3MUZ1 2K0GA 4WBBA 2YB7A 3VBUB 3RYPA 2WS92 5L3BA 3N9OA 1FXVA 5F39A 4GH4C 3JAMN 2ZIMA 2PLV3 4RSUA 2C1FA 2BGPA 4TLFA 4UAPA 5B4NA 2P90A 1JODA 4DR2O 2AHYA 1T6GC 5KHKA 3AKRA 1PVC1 1RM1B 1R3KC 4FPPA 4D8MA 2CE4A 1OHHG 2KG7A 3QCWA 1AI4A 1VBE2 4Q1RA 4QM8A 2EXJA 1R73A 1OC1A 2UYBA 4EN7B 2Z5UA 3NNMA 4JI0B 3RRDA 3DGEA 4FJCC 1XNQB 2R9IA 4ES9A 4JAAA 1O4ZA 1GKFA 4YLZA 1T2XA 1UOJA 1YFXA 4YY3O 4OVEA 1B3QA 4GMP0 2VU9A 1E5SA 2R061 2XJVA 4FSJA 2WT2A 2F4VO 2HYXA 4RHV1 4AYUA 4K40A 4CC5A 2MEV3 4Z07A 3KQRA 1EUUA 3K4ZA 4Y1XA 3KV5A 1BCXA 3DC6A 2DU1A 4LP8A 4RFT0 3H1MA 3D82A 5T55A 4FLUA 4OI0A 3LGRA 4GB33 3ACFA 1POV3 2W2IA 4R9AA 3SCHA 2IZWA 3OY8A 2OUJA 3MYXA 4EFEA 3WG1A 3MI8A 5J2TB 3NL1A 2ZHMA 1LENA 1GNYA 3JALB 4OX9B 1NLSA 3BEHA 4SBVA 3QO8A 2WN3A 1PO22 1POQA 4NIAA 2VMDA 3N9MA 1RUC2 3AC0A 3CRAA 1BZWA 4PT6A 4UB6Z 4XJ9A 2AZ2A 4TQDA 1NX9A 4X8NA 4PDWC 5A32A 1BMFG 1H8HG 3AK0A 4FAHA 4AEKA 4FPEA 2PYJA 1E5HA 2JS3A 3CXHF 2VMFA 4MG2A 1QJY2 1SLTA 4GULA 2J1TA 5JJNB 3P1IA 2ZABA 5JPMB 5LGTA 1DZQA 3SNMA 3NV3A 1YQ6A 4NRQA 5DZFA 4MO3M 3ZN1A 5I0TA 3KCCA 3KF3A 1GNZA 3ASNB 2XMLA 1C8NA 1OUSA 2FDFA 4L2NA 2YBSA 4MS2A 3H0OA 4ARYA 4FLTA 2GSMB 4DNYA 1PVC3 4HAMA 3ABTA 4COYA 4LF5B 2WPDG 4JHTA 3VDBA 3LKJA 2RDCA 2B7YA 3JUUA 5CB4A 4BIFA 2WAMA 2WUHA 4WM7B 3VBSB 4IE6A 3AMPA 3HNYM 1NA1A 3MHSC 1HDKA 4LKEA 1ST8A 2VOKA 5D2AA 3BTAA 4S2DA 1X4TA 3JARA 1YI7A 2HWF3 1V70A 4FZ1A 1IBLB 1VJ2A 1XHXA 2BP6A 5FYCA 3S30A 1HNWB 1M57B 3HKDB 1BK1A 4CP9B 5LP6C 3ZFFA 1S5HC 1XNQO 3ASOB 1BEV2 4X1YB 3WDTA 1O91A 3K3NA 2G19A 3WCRA 4CUAA 1EBOA 1OJHA 1N3PA 4HVOA 1N47A 3CC4V 4NTYA 3OEAA 3QF7A 1L7QA 4U7OA 1QNWA 1NH2B 4CDUC 3H1LH 5CFDC 4FP3A 3I54A 2ZT9B 4RQPB 3TXSA 2DWDC 1KRIA 1CQ9A 3HKCA 2JENA 3HQRA 1W6OA 1YUDA 5HI0A 2YS8A 4Q0PA 3H8RA 3ZKUA 3AJYA 2WSSG 3NV4A 3POGA 1V6NA 1KMIZ 1LJ7A 5KUMA 4X6QB 1GBGA 5GM0A 5DDJ3 4LC1A 1NCRB 4QPGB 3F5WC 1ZA7A 4AQSA 3RZGA 1BEV3 2CTPA 1RHI1 3CX5F 4LT5A 5FMDA 4GXLA 4YHHB 1ZX5A 3CRRA 1SQVH 4HVRA 5FBZA 1WB7A 3OAAG 3ZIXA 3SPCA 1X8EA 2EZOA 4G3YC 4XBNA 4HMZA 1QR8A 3WLUA 1K5MA 4DOUA 3RJRA 4FVMA 3WNMA 3J8F3 5F5IA 1Q81W 2H6BA 4NWVA 5CKQA 4OFGA 4R4ZA 5CFCB 1N36O 3OR7C 3AMHA 4Z2AA 5I0SA 4U7NA 4Z1VA 2WZEA 5LYJA 2RM23 1G8MA 2Y64A 1SBEA 3POEA 4FQZA 2WZPP 3ABLC 2DYSB 3N9PA 2F93B 1HLCA 1JZ7A 3K59A 2JG9B 5LBFA 1K5QA 3T1LA 1RXFA 1J5EO 2GUZB 1HP8A 1AR83 1W8WA 1F4NA 1G6NA 1N33O 4NRPA 3FAVA 1I5ZA 3ZX6A 2A06H 1L1FA 3WB2A 2N74A 2BPA2 4E4DX 3UCSC 1VRH3 4GCZA 2WLPA 5GLZA 3OGSA 3SMHA 4XURA 2MEV2 3QO5A 1NT0A 4R6ZA 2YC2A 4XCBA 4KL1A 4DR7B 4UCSA 3RN4A 1KDMA 3THTA 1G7YA 2NYYA 1F4HA 2VC9A 3JAKB 5GZGA 5BR8B 3S5QA 1XE7A 2ZGTA 4JYAB 3SPIA 1GAXA 3VQXA 3HKEB 2O8OA 1OUXA 4JI3O 1LRHA 3Q8FA 5CKNA 5FP3A 4M0HA 3QACA 1N34O 2BBAA 2YMZA 4CP2A 4TUYB 3L70H 5C5TA 3E86A 2O0OA 4MVZA 3DXTA 3P30A 2ZX4A 4DINB 4GIQA 1JTZX 2WFF1 4Q1PA 4NWWA 2AEYA 2ZMKA 4DR3B 1X9TA 1KEXA 4B4QA 4NXMO 5A7QA 4MVOA 3OGVA 2GTAA 4EB6B 2F43G 4N7IA 2Z5WA 3FLRA 2VZVA 2Y26A 5FREA 4DR3O 4NAMA 2HJDA 5JMCA 1SZXA 1LULA 2QCSB 3I8TA 1V55C 5FP9A 1AJKA 3WVJA 2LP7A 4KBZA 5T5JA 5LBQA 1T6BX 3OGJA 4DRXA 2GNDA 1UFIA 1F51A 1LHWA 4H2AA 2PTMA 1SDWA 4L87A 3POIA 4P00B 5A32B 3S5AA 4XFAA 5DECA 2H3OA 4Q4X3 1SETA 1ZZ8A 1G9FA 5H6RA 3H1WA 2XKPA 2XHNA 4I2OA 1QLEC 1BK0A 1WCQA 1W06A 1JOYA 2D43A 4QD2A 1GH6A 1RP3B 3LA2A 3WHUA 2J1EA 3CCVV 2BTQB 2WLKA 2OIEA 4ZI7B 3OUJA 3Q8BA 1RMU1 1K12A 2TEPA 3F2ZA 2BU9A 4TUYA 2D3RA 1NI8A 2IJKA 1YXWA 3ZLIA 4UFHA 5H2FZ 4L8QA 3U1XA 4MXWB 3BTXA 2QSAA 5FJHA 1V6IA 1OHFA 4A7KA 3VDDA 2B9VA 3RYIA 3BI3A 3SGIA 3ZVXA 5JJJB 2FKXA 3RWNA 1W6QA 1VRBA 1OLMA 4BQ4A 4TWTA 4E4HA 2P6JA 4V2VA 1YO8A 3WOGA 3IZOA 3E89A 3BHPA 4I01A 4KWKA 2WSUA 2B1IA 2RMU1 4ARXA 2R041 3AG4B 1IHMA 2E5LO 5EC1C 2OKXA 1YZBA 5EWSA 3AYDA 2CH7A 2BRTA 2NZ9A 4FBFA 4JI6O 1Q43A 2FQPA 1PZ9A 1GN3A 2VL4A 4DEVA 1X36A 3ML0A 3LQCA 3FB8C 3CKHA 1B6QA 3OE7G 4UF0A 5JH7B 2BTVC 1VF7A 4EWAA 1ZA4A 2E7AA 3VBBA 3CCQV 4GD4A 4LR4A 2RMU2 1FD9A 3ZOIA 2VM9A 3X29B 3VKLA 2E26A 5J7MA 5JSRA 4LHKA 5H9CA 4Q0UA 1LCLA 3EHKA 1I1EA 2B5UA 3KQ4B 3IDCB 2GV9A 2DYSC 4ZZ8A 5ACA3 3IDBB 4JI7O 1QLNA 1F7YA 1BBT3 1F4MA 3ACHA 2RMU3 2UXNA 5JZGA 3W7XA 4Z92B 2LJ2A 4ATFA 4KXRA 3ENRA 2B9UA 1BBT1 4UWDA 5A7PA 1D7PM 3JBG3 5BYNA 4B1MA 3ES1A 1NG0A 2PMWB 1R3JC 4XAAA 1VF6C 4LK6A 2SBAA 2QM8A 2C5DA 3RZMA 1NVPB 4QQ2A 2JGDB 3EO6A 2W68A 4OHVA 3BIEA 4UF0B 2DBNA 2E7TA 2V1DA 3U37A 4HKLA 5FJKA 1VF5B 3OR6C 1VQ9V 1FYUA 2IXKA 1DBNA 4HETA 3CMGA 4NVPA 1UYZA 1GICA 1OCOB 4BQ1A 4JGSA 3CE2A 4O61A 1OCCB 2D6PA 3D36C 1IZ3A 4CUGA 1WLEA 1CAUA 4X20B 4GLXA 1HB4A 3T2OA 2YDEA 2R72A 1EFRG 3UT5B 4ZIBA 4EYUA 1VALA 1X9PA 1FOD2 5CBGA 1HW7A 5LHIA 4RHV3 4X8PA 3GALA 1XXNA 4FFBA 1UPIA 4KU8A 3SJAC 4S2HA 1H4GA 4AXOA 3KKYA 1A32A 2ZX0A 1UNBA 1WP7A 1OOPA 4BXFA 4WM8C 3SDLA 4CS2A 2R9AA 2PGGA 3VUOA 4WFGA 2VWJA 4EQVA 1OURA 4CTEA 4YARA 3T3YA 1MS8A 2A3QA 2ZINA 4JV4A 3GHNA 2CY6A 5T3NA 3K04A 4DXZA 1PPJH 3PVBB 1OQ1A 2ZEWA 2A70A 5F3EA 5L7OB 4B3RB 1M90W 3QNEA 2G1MA 1ZX3A 2OX0A 1FPN2 1Y76A 2ZCWA 4AVSA 3LSUA 1WMDA 1RUJ3 4LNUA 1HW5A 1B04A 4V1PA 1W90A 3K77A 3C8XA 3HBZA 1WW4A 3CCSV 1ZBA1 4P9PA 2JDPA 4X65O 5LK7B 2MEV1 1UKGA 3E22A 2Y60A 1R091 1L0LH 2CK3G 1WW7A 1JYCA 3AFKA 3FAVB 4Z2WA 1CGPA 4NTXA 4I0XA 1BHBA 1CN1A 1ENSA 1CP9A 4D94A 1PGL1 4Q0VA 4YG0A 2WA4A 3VBOA 1JUIA 2HVKC 2PHUA 2OCHA 4WBNB 3PTRB 3MFCA 3DSQA 1HRI3 5T50A 2EA7A 1WGPA 3K0DA 3GJBA 4UCRA 2ZX1A 1XMQO 1G9DA 2GSYA 3VD9A 5IJ0B 2R0FA 4XDQA 1F8VA 2W91A 1AJQA 1UWWA 4BIUA 2ZMNA 2TBVA 1JXNA 1RVF3 1BQZA 3W7UA 1SA0B 3V56A 2BOCC 1UX7A 1UZ0A 1W3VA 2VMEA 5HCBA 1ZRCA 1JH5A 4QB2A 4TSVA 3FLPA 4LTAA 1RUI1 1K8AW 2J1RA 4YW7A 3JB8A 3U11A 4OLLA 3DTUB 1MS4A 4AI0A 3LF7A 2RHPA 2W08A 2UUCB 4LH7A 4JGYA 3B9CA 1TMF3 1H0BA 3NQHA 1STMA 2XL9A 3NAPA 1MABG 1LHVA 3PUAA 3D6EA 4DV5O 3RYHA 3LSDA 2Y6LA 3UNPA 4GH4B 2QWNB 1Q82W 4YG6A 4A6SA 1ZM1A 1HWYA 4RA0A 1R64A 2KD7A 1C8M3 3LWCA 3FD9A 4UBGA 2PELA 1QJEA 3AG3B 3CXCU 1S55A 3R65A 3BA9A 3CQOA 3J8F2 1CJDA 2LTNA 4MSVA 1ZBE2 3U07A 1KBHA 1TNFA 2VTFA 3E5XA 2KKWA 4XABA 3EFFK 1COWG 2LW1A 3AKPA 3SYPA 2FYUH 1UZYA 2ZKNA 5FLIA 1PNLA 1VR3A 5BV6A 5FZAA 1XL6A 2EIKB 2XJPA 4IEUA 4OHXA 2G38A 4FPFA 2YV8A 3SJBC 3THCA 4QNHB 1X50A 4QDRA 4MXWA 1XNTA 4OULA 1FPOA 2AUYA 2DFBA 1W9SA 1U5IA 3HN3A 2W47A 4CUBA 3RVYA 3BODA 3I2OA 4XZPA 3K9AA 3VQVA 2ZGUA 1VBA3 3H1YA 1QJX2 4ET7A 3K51A 5CN0A 4DEQA 4WM8A 4XDLA 4Y1VA 3NNLA 4EN8B 2GP3A 4PHZA 2P3JA 4WZCA 1TVKB 4MGZE 3OTFA 2I45A 5IE9A 1RUNA 1JOPA 3WW4A 2A7AA 4IHJB 1GWLA 1RUF1 4I7ZB 1OLQA 1HXS3 2A75A 4ZKIA 1XC6A 4KGGA 2JKBA 3JD3A 2XASA 5C8YB 4R50A 1COV1 3ZRWB 4DV6O 3UT5A 4EROA 3PUHA 1W05A 4X1YA 4EZHA 1JMKC 5C3QA 1NT2B 3NVCA 4XFIA 1RUF2 4YZ5A 4XJAA 3WDXA 5L73A 3OT7A 1T5EA 2GC0A 3H8UA 1F15A 4J9ZB 3E8GA 3JB4C 1AXKA 2PLV2 4GA9A 1ULOA 1XSQA 1XDCA 2EICA 5FPBA 2OQ7A 2X6AA 1V0AA 2ZE8A 2OCCC 2OW4A 4X62B 2Y0IA 3LPGA 1PGW1 3HQXA 5FZGA 4JTDB 5LY1A 1H2KA 4XVHA 1QWRA 1CPNA 5FTTC 3NR7A 4JI2B 3JD72 3I2IA 5FRAA 4UW5A 2HJIA 1Y9QA 1YQCA 5GLTA 1OCRC 3GJAA 1K33A 1C57A 4LK7A 4JGZA 3TEYA 2A3XA 3CIHA 3ZMZA 5LMNB 4X62O 1H1AA 5DUVA 3SPJA 1J59A 3ITQA 1QY4A 4ATEA 1RFYA 3AKSA 4GKJB 2A0LA 4DK0A 3S7EA 1P8JA 4MGSA 2XWBB 1K34A 3JD1A 5LGUA 3IAPA 1RUH3 4CP0A 3HPNA 1VAMA 5K0UA 4Q20A 1WA4A 2R49A 1R1BA 5F2SA 3TYJA 1N32O 1I3HA 4O4HB 2A71A 4JKKA 1VQPV 4RD7A 4C91A 4UI9L 2RG4A 4U36A 4O4JA 2GN3A 1FXKC 2JGDA 5J48A 3SCGA 3UKMA 4E4ZA 2Q1MA 2GNMA 5J2TA 4MX3A 3RNSA 4A3XA 4AQ2A 2R32A 2HJFC 1XILA 1KKDA 2JIGA 1Q8QA 2F4PA 2XJTA 3MIEA 1D5NA 4CCCA 3A0BZ 1WCSA 2DYCA 4M00A 4FLYA 5FXXA 3H8OA 1Y9MA 5JR7B 1AR63 2QDOA 1W6QB 2GP5A 4XMIA 3E5QA 2EJRA 2HBTA 5EXOA 4W6WA 1JHJA 4YSFA 4IE7A 4N9HA 4FQ4A 3H1IH 3N7KA 4AFMA 4O2BA 5EIBC 5L3GA 2DVAA 2WT0A 5BNOA 4XIKA 3TB0A 4ZZ5A 4RUFA 2IU3A 4AW7A 3LCPA 2DJVA 4F6RA 1ULCA 5EC2C 4LKFA 3WSOA 3VHRA 1PD3A 4XF0A 1TEIA 5A1AA 1EN4A 1FYJA 5J09A 3PLQA 3ZHSA 3K57A 4H3WA 3ABLB 4CU8A 4OMCA 3T1CA 1FFXA 1V54B 1F5FA 2W9XA 5F3GA 5B2GB 4YM0A 2GNTA 4L92A 1YQ8A 1NQDA 5F7UA 3ZMVA 3QVNA 3H7JA 5C8CA 5FLHA 1AYN3 3H8XA 2X6CA 4LFAO 1Y67A 5DZGA 4XJWA 1CX4A 4H0LB 4P9OA 3K75B 3K3OA 1ENXA 3MIFA 4KU7A 3ZIAG 4QHBA 3AK2A 5C6CA 1SHWB 4RGKA 5EBWC 4DW0A 3WG2A 5I8SA 1P7BA 1DQ1A 1Q6IA 2DURA 2K9PA 2Y6FA 4Y5TA 1WN7A 2VS0A 2X05A 5DAVA 3MW4A 3IGAC 3LOBA 2BZDA 4QU1A 2YICA 5LMUB 4MVQA 2XJUA 1ZRFA 4OYUA 1W2OA 5HXVA 2VVDA 4FT8A 3RYFB 4IESA 2JK5C 3TNQA 4WVZA 3MHZA 3CCLV 2UXXA 2IM9A 3O5SA 1J95A 4S2GA 2X0LA 2QQWA 1XL4A 4IGGA 2QQLA 4FLWA 3AP6A 4JTCB 2QGNA 3CEIA 3X2QC 2WRAA 4NXNB 4MUVA 4IE0A 1LR1A 1B35B 4HN1A 2QQNA 1KFUL 5F5QA 5LASA 3N7MA 2W92A 4DRXB 5IYCO 3VLBB 2ZXWC 1DQ2A 2PA7A 5T5LA 5IYYA 1ULDA 3T2TA 4UBHA 3ZYPA 1YRZA 4FVVA 4WFEA 3NNJA 1EAH2 4YW4A 2EIGA 1JOBA 2WIIB 4RS5B 5H9QA 2YXSA 2LROA 3BTZA 1QJX3 2AR6A 1VQ8V 2ZGKA 3K4DA 4MVRA 3DGTA 1OCRB 2QUOA 2PHTA 1MZ6A 5KHIA 5FZDA 3WP3A 4I3GA 3A23A 1OF3A 5FZ4A 1RUD3 2IWGB 2P34A 1WLWA 1ND3A 3NRUA 1UIJA 3KWVA 5J1XA 4B3RO 2VUJA 2WO3A 4UVBA 3USSA 4JZ2A 3DPRC 4RO2A 3HD8B 1NKGA 3POFA 1AX2A 1B09A 3FYEB 4CCEA 3V0AA 2RV9A 4META 1HRV2 1I7FA 2VVEA 2UURA 4A3ZA 4RR3B 4Y1YA 3KGLA 2DVFA 4Y20A 4YW5A 2N7GA 2VD7A 3CJIC 5JMOA 3NXSA 1NLQA 4QMAA 2B1GA 5KBFA 3PURA 4BWOA 4UFZA 2WZR3 1AR92 3KV4A 3O1PA 2CDPA 2ZE5A 3K48A 3FLTA 3E35A 4B08A 2EIDA 1R083 3CMEV 2ZX3A 5FYUA 3BVOA 4GX1A 3VB9A 1FKAO 1HQLA 2V09A 4LWSA 3ILFA 1LOCA 5F2VO 1HB3A 2YXYA 1OD5A 4LO6B 3AXEA 3AG1B 5A3LA 4LLOA 3ZM8A 3CC2V 2GZWA 4LO7A 1GLHA 4MSWC 2K46A 2KR2A 1J1LA 1I6XA 4QIWF 4Q4Y1 4TV8B 1HRV3 1K5JA 5FZEA 2VOXA 2RN9A 4AEMA 2PHLA 1O8PA 4V2WA 4E2SA 1K5MB 4RN5A 3F95A 4YW6A 2D6NA 2PHXA 4KQ7A 2IXJA 1H9WA 4O2BB 5ABJC 4JI1B 5EYXA 4LLFA 1W0KG 3MLKA 4QGPA 4OCTA 1QLEB 2O14A 4UW6A 4CDUA 2EF6A 4XQWA 5LXTB 5FK8A 4KFMA 3WDYA 1RXGA 1Z7S1 1LGCA 1W28A 4RUEA 1XMOB 2JE9A 3JD71 1XOUA 5IWAO 1DQ5A 4W8JA 1HNWO 2RS32 3TEZA 1EV12 2LQTA 3VBSA 2H0VA 3E6DA 1G9CA 2DFCA 2JWPA 4KWUA 1QHDA 1C5IA 1CAVA 2YI8A 5JZGC 1NJIW 2CWSA 1ACCA 1WBLA 1HJFA 4IEQA 3GB7C 4AZZA 2BVVA 5CA1B 4FLVA 1U96A 3WNPA 4A45A 1G9AA 1LECA 2DDUA 4FTEA 3ZR5A 4H13B 1Y6XA 3ZRXA 1S0BA 3VBOB 4AVBA 1IBLO 1DFQA 3WG3A 1PO12 3JD0A 3HKBA 3AB0A 4DR6O 4XXAA 1IGOA 2VOWA 1W99A 5LB6A 1TME2 1V55B 1KKCA 3ETGA 2D6KA 3M2MA 2A3YA 2A5ZA 5KX5A 1RUF3 4Y5SA 5HFLA 3W5MA 2VCCA 1SFNA 5LA1A 4AL9A 2PZSA 4YYOA 3E22B 2R30A 1YXBA 1Q7YW 1X8MA 3VHNA 2UXDB 4DRVA 3AG4C 1D2SA 2GMEA 2VNOA 1QU7A 5DG1A 3UGGA 2AW9A 1ODNA 4BLJA 3BN6A 1QXRA 1RSOA 1CIWA 3ZXFA 1WMFA 1S0EA 3AZWA 3ZYHA 1HXS2 5BNNC 3HR9A 3JYCA 3KT1A 3JXSA 3C7EA 2Y0PA 2YU2A 2Q73A 4C90A 3WX5A 5LP6A 3ZFFC 5C3PA 5BUVA 2QKAA 1W8ZA 3JSNA 5FZOA 1AROP 3IMNA 4FPCA 1S0GA 1J3RA 3I56V 4JDNA 1M4WA 2X10A 2NNUA 2RJKA 3I59B 1QNMA 1DGLA 1X59A 2JDYA 4LMFA 2VQAA 4RFRB 1AF9A 4WV8A 3O1MA 5D5QA 4BK5A 2RR12 2LO1A 4Q4V2 1C28A 3LDEA 2ZX2A 1WCDJ 2ZE7A 4JGYC 3B3QE 5IYZB 4B7EA 4TN7A 4LH6A 4O4LA 1R093 5B1AC 1ZBA3 4UFIA 1LKNA 1ASJ2 4X6RB 4HNAA 5E8AA 2UU9B 1AI5A 4UV9A 5EQUA 3STZC 1YHFA 1N0JA 2IXCA 4P9YA 5EZYA 1KB9F 2MK3A 5DQ0A 3CJIA 2DWRA 3DF0A 2EIMB 2VTXA 3UO3A 3IAYA 2OYZA 3LAGA 1XQNA 3AYEA 1SZBA 3OBTA 4JASA 5IYDO 4MADA 1W59A 3MV01 2ZGSA 1IURA 4ISRA 2WAAA 3NMBA 3EHBB 3RS6A 4GMP3 3VBHC 3WUDA 1QOSA 2R16A 1V6LA 1OCZB 3ZSKA 5CFCA 1ENVA 4DR5B 3SPHA 4INDA 5DAPA 2I2SA 2D5FA 3VZJA 3THPA 4CH6A 3HMYA 3VBUC 4MGIE 4CVUA 4X1IB 1S4CA 5FY4A 5LW9A 4QPIA 1NZ6A 1E5IA 4BIZA 4L0PA 2E51A 2UUCO 4LBQB 2WWUA 3I3QA 4OZOA 3AP9A 2CL2A 2RDRA 4PLOA 2ZA9A 3FX3A 4FCAA 1SLBA 4R9BA 3ABUA 1MS9A 2JG8A 4ASLA 4D0QA 4X1IA 2Q1ZB 1Z5VA 1KP3A 3CCRV 4IV3C 2SLIA 4MVSA 5B1OA 3KD4A 4M3CE 2LALA 1U97A 1WLDA 2ZXQA 1WW5A 3M99B 4OQ8A 1ND3B 5IK8A 1WBFA 2GAUA 2PFWA 4TZDA 5FL7G 4P14A 3M3QA 3RT3C 2IFRA 5EJZB 4XPVA 5FYBA 2HEVF 5FR3A 4A42A 1D2DA 5KWRA 2D44A 5J98B 2V73A 4CDQB 3LEIA 4JI7B 3ZN5A 2X8KA 4DW1A 3R66A 4GZRB 1H8VA 1CZSA 3WR0A 4IIJB 3J7MA 2JB4A 1MNGA 3VZNA 3OSDA 2Z69A 2YC4A 5FZLA 2OT5A 3A0HZ 3PJYA 5ACA1 1JX9A 3OEEG 3VL9A 4E8CA 2CAVA 4XIOA 4QU2A 2HG5C 2YIAA 1AILA 5LA6B 1VLNA 3OBZA 4AHXA 1WD4A 3TJTA 4KWLA 4I09A 5DXDA 3K58A 2OS2A 4A7YA 1IKPA 2ZXWB 1SACA 4R8HA 3C90A 3SISA 5JCOA 3PUIA 4LQRA 4JI8B 4P9XA 3N7LA 4DV2O 4Q4V1 1JYIA 1TUEB 3T0AA 2NMNA 4ASUG 5JVVA 2WLJA 1CXZB 3ZHVA 3SH3A 4CDQC 4ZS3A 4CPBA 5KA5A 3RW0A 4QPJA 4NMIA 5FZOB 4Y22A 1O3TA 5LP6B 1PL4A 2AGSA 2D5HA 2ZD9A 5IT6A 5KMGA 1LESA 2P67A 4A4AA 2PY5A 2VZUA 3ZFGC 4RAIA 5JSOA 5DN6G 3P5BA 1YFYA 2D40A 5HV4A 3K46A 1MS1A 5FZCA 4AWDA 4IEPA 3CJIB 3SR2C 5GONB 4M4PA 5C3OA 4I9QA 4DV0B 1COV2 3ZHRA 5LWBA 5FLJA 4JI1O 3UQ8A 2RDSA 3ROUA 1IQAA 3GZTB 3WDVA 3MICA 3E2EA 4ZHNA 1RUC1 1W6NA 3J7AU 1V9U3 3H42B 3RZJA 5IFTA 2XJSA 4XUNA 4AGRA 2XG3A 4O4LB 1QR9A 2XLFA 5IWAB 2ZZQA 3RZZA 5A6YA 3U4XA 2VVFA 4LE4A 1DG6A 3O0XA 3OTOO 1GQGA 3ZYFA 3ZFGB 4D69A 4Y22B 3BCWA 1NA1B 2JECA 1SQPH 3C7GA 5FV3A 1XREA 1W3XA 5JUVA 1YIJV 2FDJA 2WA3A 4DV5B 5LA9A 2Q30A 3IC7A 1S0JA 1UKRA 2NN4A 1NCQB 2Y6GA 4GWIA 4P30A 5J3UA 1PP9H 3WQ1A 4GALA 2R062 1D0HA 2QM7A 5AVPA 3D3AA 1QXPA 4MVUA 5A1FA 1AR1B 3ZSJA 3EB7A 1F2NA 3ZN4A 2VH9A 4DV0O 5A3WA 5JOZA 3GZUC 4KUMA 1VBB2 3QO7A 4NXMB 1DGRA 3U4SA 1ZSPA 5C9AC 2JXAA 2ET7A 4LR3A 2R072 2ZGRA 3FHIB 1CAUB 2PAKA 5FP7A 3MF6A 5C8CC 2HYKA 3FZ3A 1JA8A 3MZHA 3OCPA 2KG7B 3LD8A 1GMMA 5DDJ1 3BPSA 5AG2A 1QIQA 3NKGA 4K20A 1W6MA 1UOBA 3N9LA 1K97A 2FDHA 4MGQA 3ZXKA 5A2QN 4O4IA 4LBOA 1GTOA 1W6PB 1G9BA 2HWB3 3RSJA 5K0UC 3DN7A 1MQTA 5C71A 1US2A 1U5ZA 2VQEO 3NAPB 2HKXA 1RTVA 1CAVB 2WNVA 1GYKA 4CUCA 2PYTA 1M56C 3K5NA 1AR91 1UU4A 1VF6A 4QQLA 5BNOB 5GKAC 2ZAAA 2P17A 5C4WC 3TN91 1CAXA 1UYPA 4DUZO 4UFLA 4DXWA 2HP8A 1ENQA 1K3IA 5FXZA 2GNBA 4QPYA 4CEWB 4G28B 2VULA 2HWB1 4XBQA 1GZTA 1VBC1 4DR4O 4HKWA 3ZMUA 4JX0A 2LRPA 2ZR2A 1NUKA 1TAEA 3JD2A 3AG2B 5EJ3A 2ZHNA 2ZOEB 1SQGA 1VBC3 1WCUA 2WWWA 3S3WA 4OUEA 5LGNA 1CJPA 3ALQA 3KV6A 4NN0A 4E2GA 4IEOA 4KG8A 3ETPA 4O9GA 1QJY3 5LY2A 4AAPA 3A0RA 1JYXA 3D0SA 2E3CA 4O7XA 2YGMA 4R9CA 2HWF1 3H3ZA 4TT3G 4ZXKA 4O4JB 1M56B 3GCWA 1BVP1 1WPXA 1FJGB 3HVDA 3LSEA 3WEZA 3D3QA 2VNVA 1PGL2 5LK5A 2QQVA 2QJ1A 4XF3A 1OF4A 3WDWA 1UIKA 3CSXA 3BOPA 5F5CA 2VUAA 4I0WB 2LW7A 2BGOA 5K1PA 4LHNA 2WO2A 2BYVE 3BU7A 4NTWA 1S72V 4I55A 3VL8A 1ZVFA 5E6HA 5FUNA 4QPKA 2C9KA 1LHUA 3KHCA 2A3WA 2QQUA 5F6LB 4X89A 2QNKA 4ITCA 4XQ4A 4DUXA 2Y8KA 1MEC1 1WAZA 4LA2A 4Z8BA 4CP9A 4GQ7A 2WLLA 4NKGB 2ES3A 2ZZJA 5IYZA 3MEPA 3O65A 3BUCA 2AZ5A 2GU9A 2DTYA 3D8CA 1HDJA 1Q56A 1N33B 3FBMA 3I3BA 3ZBHA 2J1UA 2Q8VA 1OQDA 2VCBA 1MR5A 3AKQA 4DV1O 1K9MW 2ID4A 1OCOC 3I59A 1W2UA 2AGAA 2WBKA 3SPGA 2ZACA 1EM1A 1HX6A 2ARAA 4PJYA 4PI2A 4PIXA 4ZI7A 1OLME 1HQNA 2BOJA 5CBFA 4A44A 4YJ2A 2WLQA 1HN0A 5IYBO 1KECA 5IY5C 5A7WA 3GCXA 1JI6A 2QWQB 1PVXA 2JJ1G 1ZYBA 1D4VB 3LDBA 1LU2A 5B3SC 4QHZA 5KAFZ 2XOMA 1GM7A 2HWC2 2DUQA 3UL2A 1SQQH 1NLRA 1L3JA 3VKFC 2DQ0A 3O1RA 3ZN0A 4YGCA 5C93A 4D3WA 4LFAB 2CGPA 3CP1A 2UUAO 2WYFA 1QXJA 1W8OA 1M57C 1DZTA 5B1BB 1AYN2 2JDMA 4FOWA 2H0BA 4RS5C 1Y4MA 2HEWF 4NIHA 3J4UH 4XE9A 5CG8A 4FTSA 3T4VA 2XBO3 4X8AA 1VRH1 3OOXA 2P22C 1DGSA 4K8ZA 2GBOA 3ZR6A 5C3RA 4RGGA 4C1WA 3VD3A 5JXJA 4OHZA 1GKBA 5J96B 3I4IA 1ZTEA 2JDKA 3LA7A 4X1KB 2VY0A 1Z5WA 3SYQA 2XOKG 3O7OA 5JCTA 4GUNA 2HWB2 1RUD2 3TBDA 3K2OA 1GR3A 3M3OA 4PDMA 4AI3A 3K9SA 4DV3B 4EE2A 3ZXLA 2IBZH 5K9YA 4XDJA 4WF9V 3KHBA 3I5DA 3KZ4C 3QLQA 4TTGA 4K8RB 4AFBA 3GVMA 3IIIA 3MDPA 1C1LA 1WNSA 1OI6A 1EYBA 3Q4HB 4B7KA 1KFXL 4K3AA 4AE2A 4AOCA 1EPZA 3MIGA 3OM3B 1IS5A 5ABJB 1KS4A 3DXUA 1O3SA 4Q4Y2 4JF3A 1PGSA 1H2LA 4AHYA 2LGQA 5T5PA 1VPHA 2ZGOA 3RZHA 2QTSA 1GZ9A 2XJQA 5DEDA 2B4KA 1N32B 4NROA 1P7GA 1HB2A 3I7DA 3W20A 4NYKA 3ZHTA 4MHUA 1D2QA 4BYYA 1ZRDA 4IETA 3B02A 5FAXA 1L7RA 1JZ8A 1ENRA 2Y48A 5E1RA 3URFA 1B35C 4MTOA 1D5AA 2V4AA 1XYNA 1YQ2A 1OZ0A 5FO7B 1GM9A 1VBB1 1DGWX 5FUIA 1DTOA 2V4DA 1W8TA 3JASA 2P5BA 1UY1A 3FN9A 2JEUA 1HN1A 4QX2A 4DFSA 1NCQC 2ORXA 1S0CA 4BPZA 5IVFA 2JG9C 3C3SA 4DPNA 4I4TA 4U3FH 3K5OA 1NH2D 1W39A 1SESA 1O6UA 2DUOA 4ZKTB 5BXZA 4X1KA 5TISZ 1GMGA 5FPOA 4K7JA 4QPIB 3CRMA 4GJYA 2NLRA 2RQ6A 1W2BU 2ERFA 3ZN6B 3POJA 2RS11 5IJ0A 1CZTA 4LE3A 3LA3A 2XLAA 4EEQA 1ZAUA 5JWPA 1DLLA 1PM4A 4I0BA 1AVBA 4HL0A 2HLEA 5A70A 3GHMA 2Y6KA 1UU5A 2PLV1 1R081 2PHDA 2QQJA 5D1IA 4A2UA 2N05A 3GBGA 3UT0A 1CPMA 3FB7C 1W6NB 1XNCA 4MVTA 4AG4A 3A4UA 1C5HA 3AJZA 1ZRRA 3WQBA 4LF6B 3KS7A 1K42A 2VMCA 3WU2Z 4XTPA 1GWMA 5FMOL 3N2GB 4FLZA 3KG2A 3I3DA 5GONA 4Q5OA 4QX3A 1YFWA 2XVKA 5EFUA 2Q0AA 4NXNO 4DXTA 4UFJA 5A33A 4B3SB 3ILRA 2IVJA 1RB8G 2GH8A 1CVNA 2EINC 1URXA 2AXTZ 3HKDA 4WVVA 4G9SB 5JQGB 1VBE3 5A7WB 4UUJC 4JV5O 3G4SV 2DYRC 3WINE 1M4UA 3MIBA 1CESA 5FKCA 5FOJB 2Y0OA 1CD3G 1OKQA 2GDSA 3RWRD 1Y9GA 2QFEA 1KITA 3JCUZ 2O1QA 1ROPA 3ZDSA 4L97A 3KVAA 4UCUA 3AYAA 5FYTA 4DV1B 1N36B 4OXSA 1LOFC 2HWD2 5GTIZ 2PQSA 1FT9A 4LF4O 1WKYA 2YYOA 4BMEA 1NTKH 3R4SA 1JYNA 4K0KB 1H6XA 4Y4RA 3ZPOA 1AR73 4DMIA 1QH7A 4OQ9A 5LMUO 4K3UA 1QDOA 5CMUA 1XNKA 1RINA 3A7QA 3ABZA 4M4RA 4YZ2A 4NB5A 2OZJA 2UUBB 3OF1A 5A3UA 2FMYA 2DOSA 3POSA 5I8YA 2VXRA 4YVWC 1G86A 3JBG1 4AI2A 4JI5O 4AEDC 4ZOLB 1QQP3 5FXVA 1EPWA 4E4EA 4JYCA 3DV8A 1ZZ7A 1JMUB 5FYZA 2DU0A 5EYPB 4BA6A 2M6YA 3WF3A 1BL8A 4JAVA 1H4HA 1UOFA 2E31A 4LF7O 3IBMA 3RMXA 4GB32 5BY1A 5CA1A 4IW3A 3ILNA 1CAWB 3KZIZ 2VNRA 5CZKA 4C0HA 1HNXO 1Z78A 3CBNA 4JRAA 1DHKB 1J83A 1X33A 1Q8IA 3EXUA 4MW8A 2YSUB 3ZFEB 3AMQA 4BM8A 1KXGA 1PIV3 4U3JB 2WFPA 4BW5A 2PUSA 1HV1A 2VNGA 4IV1B 5CNAA 1KP2A 4GKXA 2WZR2 5AFEA 3VV1A 1HNZO 1W9YA 4UFKA 3LNNA 5AC93 5DUXA 3ZCCA 3AVRA 4LJHA 4DR5O 1ZL8B 1K7DA 1DP0A 3LE0A 2MPFA 3KB5A 4DXSA 5D8AC 3AG7A 3WG4A 3UETA 2VZ3A 4RQEA 2Z4FA 3RFRA 3DPRB 5CYYA 4JYAO 5K4LA 1NTZH 3O0WA 2JIJA 3VBFA 5IK4A 2CSGA 1IBKO 3LSSA 2JDUA 5ITZB 2BTOA 1PV0A 2QWPB 1VBD2 1W6OB 5C5UA 2FCTA 2UYAA 1QJU2 1O5UA 2Q1FA 3BPZA 2A1XA 2ZTNA 4KH9A 3TAYA 2VQUA 4O4HA 1YYNA 2XAFA 4URAA 4GWJA 1SC5B 2ZJCA 1RITA 1RC6A 2P6CA 2NPIA 2YFUA 2W1QA 5EJ1B 2RS13 4LFCB 2P3YA 1YF2A 5BMVA 4GKJO 3JBG2 3HB3B 5F8PA 2UWAA 1RPRA 5EZYB 4B3TB 2FHRA 1I9RA 3C2UA 4EV0A 2KB1A 3HT1A 2ARHA 3L2YA 4AHWA 1F31A 4ZPIA 4I5SA 4KP4A 2JVDA 4HNAB 1VQ5V 1MZEA 2DE0X 4M01A 3LOIA 1K3EA 1OH3A 1H2GA 4PA6A 2BOIA 2YU1A 1GQPA 3H9AA 4YGBA 5IT9N 2VCAA 4CU9A 1GANA 1MS3A 4GT1A 2K2SA 5FY7A 1BLZA 5FCCA 2EVXA 2RS52 4PA7A 3LDKA 2GMMA 3OTOB 1SCRA 1SG3A 2GALA 2PAEA 4FXKB 1IKQA 3OW2U 4FXGB 5FP8A 2E32A 2LUWA 3GWOA 3AZVA 2BNOA 3EXAA 1X7NA 3WP5A 5JR2A 2VWKA 3ZYJB 1V6KA 1HB1A 2FDIA 2FTKA 4Q4W1 3G7DA 3KVBA 2VJXA 3H3UA 5APAA 3IWZA 2UUBO 1VMGA 1SKVA 4FFIA 4A41A 4CCMA 1UN1A 3E8FA 4R4XA 3OD4A 4HLTA 1SQ4A 1JPXA 1QHTA 1SQXH 3VKNA 2W39A 3N9NA 1OLRA 3NV1A 3NSTA 3AZYA 2Y38A 2IXHA 5C8WA 1LAJA 3WF4A 4BH9A 1I5YA 1PO11 3I97A 4LBEC 1R6NA 2EXKA 1DU3D 1YLLA 2VQFB 3EYPA 4NJ4A 1VP6A 3VBHB 5IJ9B 5I0RA 2XQRA 3FB5C 4GX0A 2ATFA 2XKOA 4BU2A 2UXCB 3OBRA 1WZXA 1RUH2 4AF9A 1YSCA 1K5SA 4TYSA 2IJJA 2P06A 1LUWA 1PK6A 2NQYA 2AYHA 3BB6A 1K73W 2QQIA 4GX2A 5DZEA 4HSJA 2JG8B 1DK1A 3NJVA 2D97A 3G6BA 4EKWA 2WNUB 1MZ5A 2XBO2 3CPWU 4LCUC 1Z7S2 4UVAA 4DO2A 4N43C 5CA6A 1EAH3 1VQOV 1YVWA 1VEWA 1J1TA 4CU7A 1Z2GA 4IV1A 3UGHA 1YIFA 2QJVA 1AR62 2HWE1 1GU3A 1FS0G 2GN7A 5A3TA 3T1MA 4WVMA 5LBEA 2FZ1A 2BNMA 3OMNB 3B7MA 5DAXA 5FBJA 1AR4A 4J7JA 2HKOA 2BSKB 3RYKA 4DR1O 4TOIA 3QBQA 1VBE1 4AGGA 1WWYA 1RM1C 4WFHA 1JU4A 4Q0SA 3P3NA 1SLAA 5FZ8A 1W2NA 3H1JH 1DYOA 2X5IC 3AP5A 4MLOA 5FK7A 4JYYA 2P3IA 2YUAA 4FPJA 2Z79A 2RNBA 3S7IA 3MFAA 4CE8A 5B4XA 1O8SA 3PU3A 4JDOA 4N53B 4M0NA 1QF3A 3O14A 4O2AB 4OPAA 1AX1A 4JZGA 3AKTA 5L19A 4CZSA 3RZLA 2ADDA 5F37A 4AILC 2FZ2A 5FO9B 1WMEA 4XDOA 4F6EA 3WF1A 4K35A 4CEWA 1F23A 5FDBA 2CTRA 3I2HA 4Q4W3 2WS93 1JS9A 3TNPB 2A6ZA 1SA0A 3ZRSA 2AACA 3R05A 1AR72 3WB1A 4WM7A 4CYDA 2F95B 3KV9A 2XDVA 1XE0A 1JHNA 2YIDA 4XHXA 3CJHA 2QVSB 2RJ2A 2WNVB 4LHSA 5FPZA 2ZIOA 3BAAA 1XI1A 2C4XA 2UU8A 5CVRA 3AX4A 4R8CA 1AR82 5FPRA 5D8AB 2ATKC 1YI2V 2RS33 4QPWA 3TK1A 1LGNA 2YG0A 4YVSC 1BYHA 4PQ9A 1IX9A 4YXWG 3G6EV 2YY1A 5JQGA 2F4LA 4RQPA 3ATGA 2Q8CA 1VAVA 2OVUA 5KC5A 5IHRA 3LSQA 1NQJA 3NO8A 3IKWA 4IV3B 5IVVA 2DCTA 5GZDA 1DYPA 1UMHA 5FKBA 3TWIA 3ZIWA 2OPKA 4JGZC 2MW2B 3N2GA 1ZBA2 4TXWA 2QBXA 4D7SA 2J42A 1GN6A 2OT7A 2W46A 4RGAA 1J84A 3POYA 2C0ZA 5A3MA 5D5PA 5JJEB 3TN93 3CD6V 1Y76B 2F66C 1ZZCA 2NM1A 3M7MX 5EPAA 2A79B 4KGQA 3GZAA 3ABMB 3O1UA 4HXCA 3CCUV 4YJ2B 1EZJA 2BDRA 4PI0A 1DYKA 1SPPA 1OOPC 4P9GA 2K9ZA 2TUNA 3OUIA 3OEHG 2YROA 4I02A 3K03A 2PHRA 1RPOA 4LULA 1QOOA 4Q8KA 2W1WA 5KHJA 1GP5A 1GFF2 1YITV 2CTWA 3VBRC 3O1SA 4QGLA 4X64O 4DUZB 2FCUA 2B8MA 2WQ8A 4PJ0Z 1GO3F 3T2QA 4UCVA 1K45A 5L9BA 3DL3A 5LHGA 4YZ4A 3E1F1 1W9TA 3HT2A 1PK6C 5C70A 3HAGA 2VPVA 1D0GA 2I07B 4H14A 4F3JA 2LM3A 2EIMC 2O57A 1KQRA 1S5JA 4M3CF 5KR7A 4TV8A 5C8YA 5H5NA 5A7SA 2G9ZA 4W4LA 5K7PA 5C8CB 1OFNA 1S2BA 4QKDA 1W8HA 4WZFA 4J80A 5L9RA 1O3RA 3LEKA 1JVMA 2GUZA 4HSLA 3VN4A 1ZZBA 2OWOA 2EIKC 3TXQA 2AEZA 1COV3 2VZPA 2YGLA 3CL1A 1UOGA 1DZRA 2YEVB 3RDIA 1S5LZ 1Q6UA 3IDEA 4F6RB 2HH9A 4W50A 2ZQMA 1H8TB 2HVJC 2DW4A 1H2MA 1BQPA 4AVAA 1QJU3 1BGYH 2HEPA 3WF2A 1WW6A 5JVDB 3M3CA 2ZAHA 4Q4Y3 5A7NA 3ACLA 1REFA 2W87A 4PA4A 3ZO0B 4CDWC 1RHI2 2V72A 5BNPB 3FMGA 4LBQA 4AI9A 5FP4A 1W0PA 3I3MA 1LOFA 4Q4X2 3K5MA 3V0AB 5LCWL 3E83A 3T4ZA 4HBNA 4XW3A 1A8DA 3LEMA 3WP4A 3T1YO 1OVSA 3W9AA 2DVBA 1FXZA 2DCKA 4BQ5A 2QWRB 1HR0B 1P49A 1LU1A 2WJSA 5F2WA 2Z3YA 3ZSEA 2PI5A 3V0BA 1JZ2A 1PIV2 1UMZA 3I2JA 4HK9A 1Y4WA 1NQTA 1RGSA 4RQFA 4MV2A 5AFBA 5IJRA 1PMIA 2R7EB 3QH7A 4DV6B 2MNGA 4DUVA 2IJHA 4JVAA 1YTFB 4LF9B 3QH6A 2ZDIC 1W8NA 1JR9A 2R071 1QEXA 4XFBA 3L72H 5DAQA 4XJUA 1TG7A 1UZVA 2RE9A 3ZMTA 4Q4W2 1L7LA 2ZGNA 3NNGA 4DV3O 1B35A 3DC5A 3L75H 4HK8A 3W7WA 2JE8A 3R4UA 1Z0HA 1Y66A 2DVGA 4D6SA 2QE7G 3CB2A 2Q5TA 4N53C 4HYOA 3NW4A 5J2UB 2XAGA 1IPKA 3TEXA 3RVZA 3RYIB 1RIRA 1GK9A 3EMRA 1NCQA 3CZUA 3ECQA 4I9WA 1OBNA 4GKKB 2C2AA 5DPNA 1QVFU 4FFFA 2YPDA 2EAKA 5FPVA 3WY6A 3OB8A 1MS0A 3OUFA 3C3TA 1D4M2 1UO9A 1OA4A 1ZUQA 1AYM2 2LFRA 1RUH1 1REEA 5EBMC 4CXYA 3RBZA 3BCCH 1QVGU 4XJZA 4OX9O 1JUHA 2A6XA 4KG0A 4YZ3A 1JJOA 5JI7A 1S76D 2EJ7A 1MVQA 1YJ9V 1XNDA 3RGBA 2F1MA 2QTOA 2JD9A 2NN8A 1K92A 2C24A 3NWKA 3ELNA 1XU2A 3ICXA 4ZU5A 4Q27A 4ABMA 1JZ4A 3QD6A 4NHKA 5KHGA 3HEIA 1LOAA 3AM2A 4FFBB 3UJQA 3APOA 2NLJC 4QX5A 3WXPA 3INAA 3VBRA 2JICA 3AZXA 3IJ4A 4LORA 2YFZA 3E8BA 3VZOA 5CB7A 4J42A 3RYCA 4CRQA 4IT5A 3U14A 1ZWIC 1DGWA 4DB5A 3SITA 4BB3A 1R3IC 4LNUB 1LEMA 1ONAA 3J7LA 4MXVA 2B42B 2IC1A 1JU3A 5A3PA 2TNFA 2XHKA 3GF6A 3AG1C 5B1AB 3L2HA 5KA6A 2B9ZA 4MW3A 4E4SA 1PL0A 1E5RA 3IB3A 1H38A 2XHBA 3T08A 3JD4A 3WNLA 3JATB 5ITZA 2ET1A 4QX7A 2IFWA 4QT6A 2ZNJA 1VQLV 4O9EA 4PLMA 4XF9A 3VBFB 2W3JA 4FMTA 3UO2A 2YC0A 1NR7A 5F32A 4UCOA 1HIXA 4PDLA 2BERA 1BMV2 2UUAB 3C7HA 3AVSA 3T4HB 1LNSA 3OG2A 1OOPB 1TMF1 2ZS6B 4B1LA 4IXLA 1AVMA 4Q8LA 3MW3A 1KU9A 5FPLA 3GM8A 3UKTA 2ZGLA 3ZSMA 1YC61 3WNNA 5H9SA 4XJ8A 3U0ZA 3MIHA 4JAUA 1BSMA 5IVEA 3CJXA 3WNKA 3B9IA 2E74B 2W95A 1RUI3 2XVGA 1JFFB 4J7ZA 4KMQA 3M3EA 1XSRA 5T52A 4JI5B 2GHYA 4P9IA 5DABA 1MACA 2WR9A 4UYBA 5BMVB 4LHLA 3QOPA 4O4IB 4FZ0A 4DV7B 4ISQA 2CAUA 5LRSA 1Q8SA 2DCJA 2AC1A 2RJLA 1FNZA 1BXHA 2FB5A 3T1HO 3PMSA 2X7RB 4HOOA 1OPOA 3C7OA 4EJRA 3K5LA 3OGGA 4FK5C 5DG2A 3WFVA 5FZIA 4AVCA 4Q4V3 3J7NA 4E8DA 1RUE2 4K1YA 3MLJA 4COUA 4FPYA 1AXZA 1H30A 1MA1A 3CCEV 3BGAA 4DR4B 1MPXA 4PBPA 1IG3A 1GZCA 1YFUA 4YM1A 2JGUA 3EJKA 1DGRN 2BEOA 4FPLA 1XJAA 4OGQB 1YIPA 1LNQA 4J10A 1W8UA 5BZBA 5EV7A 1RUI2 2W52A 1ZL8A 4I30A 1N1YA 4L9BA 5IFPA 2QQPA 3FBYA 1RUE3 3AL5A 1M5IA 1MZFA 1VE0A 4LXLA 3O0VA 2Q8OA 4F8AA 4IYIA 3JU9A 5FQ0A 4WCEV 2XLGA 1N1SA 4LBKA 1QQCA 5FUPA 2HWE3 2DUPA 5LA2A 2UWCA 4EWDA 4N53A 4JPRA 2J7MA 3FUOA 1CAWA 4DY3A 5JI9A 4QJFB 4LF4B 2AENA 1JBCA 4X66B 2PN5A 1RUOA 4QKNA 2L6LA 2PYLA 2ARCA 5C4WB 4Q6GA 3BFRA 5FY0A 2WABA 1GZWB 5C33A 4XF1A 4QE7A 3BOWA 1AX0A 1IXMA 3IN9A 1AL23 4NE9A 3SCFA 2E63A 5JLVA 1FAYA 1OCCC 2HR3A 1BEV1 1VAKA 4IL6Z 2P5OA 4CDXB 3CCJV 3A21A 3T1HB 3RMYA 1NVPD 4H37A 1NR1A 1LTEA 2VECA 2IXIA 2Q68A 2R9RB 2VQEB 2CV6A 2QM4A 1PZ7A 3NKTA 3OFNG 2WLNA 3SXWA 2FBEA 1BMV1 4FM1A 3ABKB 4D6QA 3MLLA 3DXRB 3ZKYA 3K08A 4FPGA 1SPPB 1UMIA 1NY72 1V00A 2ZM6B 5BNNB 4JCKA 5K8SA 1RHI3 1Y7BA 1FV2A 1DDLA 5E88A 4HFSA 1JOJA 1AL0G 1QNYA 5J37A 2VOVA 4COZA 5JSPA 5SV5A 4FFKA 2R073 4QPIC 4YRDA 5CAZA 2B46X 3ZXAC 2J22A 2KXLA 1RVF2 1FI2A 4TWKA 2OXBA 2KA3A 1CEZA 2VZOA 1XQ8A 4YM2A 4YGDA 4IGQA 1P84F 3GBWA 1WMXA 4FO9A 2HHHB 3PVOA 3ZXJA 2QDRA 4OI4A 1OA2A 5H9PA 1UXZA 2Q7GA 3PL0A 4IV3A 4JDMA 1AR93 1SFYA 1AB3A 5DAWA 2YBKA 4XTMA 5SV8A 1BHGA 4PELA 2B45X 1DLBA 5F5AA 4PDWB 1AYM3 3I2DA 1RL3A 4B4PA 1QJZA 3E97A 3ME2A 4AI8A 1MSWD 3DECA 4KWJA 5B3SB 2Q67A 4X9QA 3L9JT 2RS12 1HKDA 2PHFA 4IDZA 3ZXEA 3IC9A 2A6YA 5FQ0B 4IE4A 1YDXA 4QPGC 1EV11 2IH3C 4XUPA 1LHOA 5JPNB 3W58A 1V9U2 3G80A 5JXGA 2Q6AA 3SEPA 1UL9A 4P2ZA 4COVA 1VBD3 4JKMA 2VUCA 4AFCA 4AEDA 1C4RA 5A3OA 4ZHQB 1A8MA 3B8NA 4QAWA 2ITDC 5FZFA 3H1HH 4BHPA 3FYIB 3I55V 5IUQA 2J1SA 3TEWA 3FKSG 1ZBE3 4MZUA 4CA9A 3O1OA 2F4VB 3JCZA 2OUHA 2LFSA 3DKQA 1M06G 3ETQA 3DKWA 4XILA 1SERA 4IL7A 1F5JA 1ZBE1 2QWOB 3D0JA 4CDQA 2QKCA 1UZZA 2P4EA 4YIOA 1SLLA 4JQRA 3CYOA 5A6QA 2JG9A 3GWKC 3NJZA 4EN9B 5EYPA 3HWJA 5JOWA 3ASOC 1PIV1 1ULPA 3BTYA 1GP6A 1LEDA 2WQZC 4XFFA 2GTSA 4JQTA 2X5IA 5GJ6A 4BQ2A 2AH2A 4JI8O 2XVLA 1MVEA 4XZUG 1J3PA 1JFFA 3APBA 2D6MA 1RYYA 2Q5ZA 2PF4E 3LPFA 2HWC1 3DPRA 3GXUA 2MHFA 2V7QG 3ZS8C 4X88A 4LBNA 2JJ6A 3EQEA 4PA3A 3AK3A 2WWJA 1GOFA 2X29A 1ULGA 1WPBA 4JZRA 4QHOA 3VKOA 3VQYA 1QQP2 5FZ1A 2VRZA 1UY4A 2XJRA 3B00A 1MSDA 3UM7A 1HR0O 1BKZA 1W2AX 1SEFA 2VG9A 2E33A 1J58A 3AFGA 4XBLA 2E9QA 3ZFEC 4NPLA 5HPOA 1YI9A 4FPHA 5ISLA 3TETA 5FZ6A 1HRI2 3ZX7A 5GZCA 4BE3A 3B77A 4X66O 2ZMLA 2VOTA 3P3PA 2C26A 3FFQA 5LOVA 4XXPA 2XH6A 4UVCA 4WBNA 5GTHZ 1VB4A 4QXKA 5L3FA 3AXDA 3J9SA 2VCMA 3USUA 4DR2B 5FZ3A 5L3DA 2CDYA 2GC2A 4K8XA 1A6CA 2Y33A 2Z42A 1NAEA 4NOTA 1LUVA 5CBLA 1NTMH 2X09A 3ZXDA 1FXHA 3D5OA 5BNQA 1XYPA 2D3PA 4BQWA 3WQ0A 4DUWA 5FO8B 4J1XA 2KQXA 1OPMA 4NHLA 2KSDA 4AR2A 1IS6A 5CISA 4TSFG 1RJ7A 3CRQA 1UPSA 2ZDIA 1NZIA 2W1SA 3I2GA 2EIJC 1O9HA 4MGTA 3WHTA 2BBVA 3SLIA 3PJSK 3H3LA 4OI1A 2JDAA 4E2QA 5HCAA 3B94A 1C8M2 5BNNA 1SQBH 1XEQA 3IPVB 4JI3B 1H9PA 4DV4B 3NAPC 5FMBA 3RYFA 1Q3EA 2HWD1 4DIQA 1WA8A 2ZEXA 1AP6A 1UZWA 5FIXA 4LFCO 4YVWA 2WKKA 5B1NA 4MTXA 1FOD3 4YHHO 4N90A 1CZVA 4B3SO 3HJRA 4CDUB 3RG0A 4XQDA 1HJGA 3LFIA 1CAXB 2WLLB 2UWBA 1P4RA 4WFAV 4L99A 2ZR3A 2WZ8A 1WA6X 1H1MA 2OTJV 2PQQA 2EXIA 3VDCA 3WF0A 4I55B 2Q0OC 3CNAA 3M70A 4EN0A 1YJNV 2ZKOA 1SLIA 5LHHA 4X20A 2L9LA 3H7YA 3UJOA 1EUTA 2EXHA 4XAEA 1PO13 4YVSB 5LL6Y 4LFBO 1SZTA 3NJXA 5FOBB 5JIAA 1W9FA 3I49A 3MHHC 1XPWA 4RWUA 1WCKA 3PUSA 3ZYBA 2W6JG 4C8DA 4XACA 1W9WA 5LYJB 2HBUA 2RVAA 1TVGA 5D8AA 4ONUA 4F7ZA 4CEYB 1UJWB 4DZGA 3OGRA 1OMIA 4Y5Z0 5L36A 3RI9A 4QXHA 4CCJA 4YZ1A 4ASKA 4WVMB 3DEMA 2HHHO 1BBT2 3N3HA 4AI1A 5E79Z 4JTOA 2RS31 4MTGA 2M7WA 1NZCA 2BWCA 3ZHQA 4AEDB 4LF8O 2JB8A 4P9LA 1NE6A 3EVKA 5E89A 3OEBA 2WC2A 4RR3A 3TN92 3W7TA 4KBBA 1ZNPA 3AMNA 1S0VA 2FDGA 2K1EA 2P6HA 1Y74B 1IBMB 4U3JA 5FFOC 1M1KW 1U12A 1Z7S3 4O2AA 2UU9O 2F17A 2YIBD 2JG8C 3N27A 3BU0A 4QKFA 2VZQA 1I5XA 4MH0E 3T4DA 1CIYA 2VTXJ 3V64A 5JH7A 1SS3A 3PJQA 5LRRA 5ERLA 3OYWB 4JTAB 4XUQA 5T5OA 4B29A 3WP6A 2D6OX 3DYOA 3OPWA 3PUQA 3L74H 4FOQA 4JI6B 1VBA1 4Z82A 5IVCA 4W6YA 4GWNA 3VOUA 2UY8A 4BW9A 3MAQA 1S77D 5F6KA 3T2PA 4H55A 4B3NA 3R6SA 3S6PA 3CC7V 3Q8EA 2EULA 4LPLA 5AC91 2QEXV 4QQPA 4MTFA 5FY5A 1AR61 2WO7A 1AR5A 3SKVA 2ZBJA 2I74A 3FB6C 1POV0 1H6YA 3WG7B 3GZEA 5LEKA 2HLDG 1K5MC 1NU1H 2XAHA 2CTQA 3HPLC 1RUD1 3PMEA 4G2KA 4LF5O 5CIRA 1KJRA 3VDDB 4DY5A 5FPUA 5HCFA 1V9U1 4XUTA 2JD4A 4LO8A 4S2FA 4IE5A 5IVYA 2RM22 1DLCA 2RS51 3CF6E 3RJ2X 1JZ6A 5CB4B 1BJQA 1KJLA 2QQOA 1AJPA 2YZ4A 2UXBB 1F4AA 1ULEA 3T09A 1U5XA 4HPKB 3IPVA 4Y3OA 5L3EA 1IQDC 4Z1MG 2VR4A 4FTBA 4Q2FA 4P9WA 3O12A 1VQ7V 3LEGA 4NHXA 3WNXA 2P4KA 3E8HA 1POV1 1DIWA 2DQ3A 4JI0O 1Q8OA 5GW7A 1RSOB 2DYRB 3NJYA 4UXAA 4BZ4A 1AUYA 4Q26A 4CH5A 4QXBA 4H33A 4QWNA 4WM7C 5IATA 1THZA 3DYPA 4BQXA 3IMMA 2R063 1SRYA 2GH2A 4HKOA 2BCCH 1ORQC 4IGPA 1GZWA 2EALA 4B3MO 5LATA 4LBQD 1PKXA 2ZGPA 1KS5A 5CBHA 3OPZA 5EHDA 4O65A 5DUUA 1KC8W 2OQ6A 2R70A 2VBBA 2EIJB 4G27B 2WNUC 4DRRA 4YW2A 2L35A 3D4KA 1XNBA 3IDAA 2Q69A 4HZ3A 1BCCH 1W03A 4QX0A 4YG3A 4UV8A 1XYOA 2LGWA 3WCSA 1WJZA 4N7UA 3SKJE 2WYSA 3F5TA 1YJLA 3JQXA 1UF2C 4GAZA 1SFPA 3FWEA 4JHZA 3SC7X 2HWD3 1AJOA 2IXLA 1Q5OA 3WNOA 5BNOC 1W8FA 3FJSA 3VDAA 3BA8A 3SYAA 1O4YA 1RUE1 1MOFA 2GMPA 2XUMA 1YNAA 5BXXA 3KMHA 3P32A 3HKCB 5CG9A 1YTFD 3WDUA 1ZREA 1SLCA 3AP7A 4W65A 2GC3A 3M8AA 2WO1A 5KHHA 5CA3A 1OSGA 1JZ5A 1WUVA 4CSWA 2BW8A 1US6A 5DM6V 3C7FA 1AJNA 5HBAA 2AZ0A 4GZ9A 2OIIA 3FL7A 2CH7B 4BWAA 2R0HA 4DV4O 4ZOLA 1UW8A 4A6OA 3RYHB 1RJ8A 3RQ0A 3VBSC 2IH1C 1S0DA 4CH4A 3VBUA 1XNAA 3DYMA 4BAYA 3C3VA 3N2KA 1ALYA 1HQWA 1J5EB 2QQMA 1XNRO 4CXWA 3J7HA 4MGYE 3VQWA 4N8MA 4XHBA 4JGZB 3TRSB 1VIBA 4ZHQA 2ADQB 2ODMA 3SJCC 4BDVB 1YEWA 4HT1T 4CC6A 2D3SA 1GN2A 3K0GA 5BR8O 2EBOA 1AZDA 1JN2P 4CZZA 2XB6C 4ZXEA 3B01A 4IEVA 1V6MA 2ZEZA 4QPGA 1WD3A 4H7MA 4BJ0A 2VBPA 5G04L 1VARA 5D21A 2EZPA 2BFUL 1RUJ1 3ES4A 3UK9A 2PHWA 2Q4PA 2XWJB 3U10A 5JOYA 4DR1B 2VQ0A 1YWKA 1VB2A 1UQXA 2O8QA 3MF9A 1GUIA 3F7VC 1TZOA 2WQ4A 2YEVA 1W6PA 4GB31 2XAQA 4KNCA 1UXXX 4IGOA 3MW2A 4AVVA 3WW2A 1FX5A 3WG7C 1ND3C 4N23A 1R1A1 1S2KA 4B8EA 1QGLA 3WV6A 2UY9A 3B5LB 4P5YA 1O4TA 5ANNA 1HNXB 1ND2C 4MOAA 1RUG1 1R092 3FUQA 5E1AC 1CPYA 5FYYA 2Y6HA 2CGOA 1FV3A 2J1AA 2VW2A 2BV4A 1JYTA 1AP5A 2WNVC 1TUBB 4UXNA 2UXCO 5LMNO 2X53S 1LHNA 3WT3A 2Z0AA 1BE3H 4IHJA 3D3IA 5FY8A 1Y3TA 3PVEA 2RR13 5KXBA 3I3EA 1FXKA 3JALA 4ZY9A 4Y24A 3KF5A 3FHQA 4FPKA 3ZPYA 2DCYA 2JEMA 1FMD2 3OPTA 1OXCA 2E6VA 3T0BA 4YPJA 1AYM1 3RI8A 2BE3A 4K21A 2XXZA 1W0OA 1KD7A 4MHRA 3J80N 1PGW2 3UYJA 1WA8B 4R9DA 1TQ5A 2C9AA 4CS3A 1GRJA 2WNEA 5J9PC 4KI5M 4P9JA 5H6QA 3HKEA 4BOWA 2HFEC 1D4M3 2XR4A 5E16A 1QOTA 3WW1A 3A0KA 2EILB 3GGLA 3RVHA 1VMJA 5A33B 5FNVB 2ZHKA 3JASB 3BVCA 4LBJA 2VUDA 4CDXA 2FMLA 1MS5A 4BQYA 4A5UB 1EN5A 4CU6A 4ZS2A 2R1DA 4IQPA 4F83A 3RYCB 2RJZA 3N4MA 4XDPA 2X5IB 4XC9A 2OCCB 4K8FA 2GDFA 1EP0A 4HVQA 1YCIA 4AK3A 2HEYF 3KCYA 2QZ3A 4FP2A 1LOEA 1TME1 2OZ6A 4YIPA 3USUB 2ARXA 3RWKX 1S0IA 4I50A 3ABKC 3JD73 1PO21 4BQ3A 4B3MB 2VE1A 4WM8B 5CFDB 4GH4A 2VQFO 3CZJA 4COWA 1QJX1 2CGNA 2QE3A 4J1WA 3B93A 4JGYB 1QCEA 4DV2B 1A3KA 3S57A 2YPJA 5I8TA 2JDZA 3APQA 3MBWA 1M9NA 2HWC3 2BQPA 2KM2A 1FPN3 1IXBA 1XHZA 3L9DA 5LA0A 3DCQA 4W4ZA 2X6BA 1N3OA 1BQ0A 2QKDA 3MO4A 4LITA 5I0DA 3K3WA 3WZ1A 1KGYA 3SEEA 1OV9A 5JDBA 4QDSA 4XFHA 2UXDO 5EP9A 2Q8EA 4LF9O 5FXWA 3G71V 2P4VA 3IM0A 3PNAA 2Y6JA 2VZSA 4XEZA 1OT5A 5EZWA 4KHPB 2OTLV 3BRCA 4M3CB 4GX5A 2WLHA 3NNFA 1YJKA 4CH3A 3JAWB 1O7FA 3QTCA 2XAJA 3N7JA 3AEIA 1PVC2 1W6MB 3ASIA 4NUBA 4PA9A 3WD5A 1DF5A 1MMMA 4RS5A 4J11A 5JCOC 1EAH1 2YHJA 4CCOA 3H01A 2DMXA 2VMGA 3KSCA 2P7TC 3S3XA 1BT8A 5G05L 4AQ6A 1LGBA 4P08A 2YI9A 1SF9A 1HNZB 4LOTA 2R042 1PHMA 5FMOS 3B4SA 3HOBA 1WLTA 4YY3B 5C3SA 5JXIA 1JW6A 1IS3A 1XMOO 4HG6B 1S1AA 4QX8A 2WN2A 4TV9B 3OGIB 5C9AA 3ABMC 4AQYO 1I94O 2WLIB 4Q4X1 3ZFFB 1SBFA 4E9KA 3L73H 4FFHA 3R4DB 3Q9OA 4FFGA 3J26N 5BNPA 2WINB 3AMMA 1TME3 2XQXA 2WSVA 1NYWA 5GLWA 2VMHA 3V65A 2P1BA 4LKSA 2JEXA 1H8EG 3M1HA 4LF8B 5FY1A 2G4IA 2VXJA 5FLXN 1BHAA 3H9VA 2DWEC 5FYHA 5JVDA 5KLVH 1JQ0A 4LKDA 5TSWA 4FM0A 4N9IA 1TNRA 2ZM6O 1H8TA 4GWMA 1S2EA 4J7KA 2VAUA 1IBMO 3THDA 2BUKA 2A73B 3Q8AA 4K9SA 1VRH2 5A80A 4RR3C 4DUYO 3WB0A 4C0BA 2ARBA 5CFDA 1EV13 1YHQV 4IERA 2ZHLA 2ZKLA 2Y69C 5HFMA 4J25A 5AVAA 4NAOA 2IU0A 2P2KA 4OZXA 3X2QB 1R1ZA 1IG0A 3AL6A 3E6CC 4QB1A 1MEC2 2E53A 1ZLZA 4N21A 3OGCC 2WL1A 5FYMA 3LFMA 3VGIA 4AFAA 1EN6A 3VHOA 5KXDA 1UX6A 3CU7A 4PDVA 3VKMA 2ETEA 4XOGA 5DUWA 2GC1A 1HV0A 2XONA 4JTNA 1QKQA 5KX5B 2RMKB 2VGDA 4HONA 5FY9A 1DQ4A 2YXHA 2OPWA 1JZ3A 2A7WA 1SBDA 2ZGMA 5CA0A 1FPN1 1XMQB 1QJU1 4XCAA 3HIFA 3JARB 2EILC 5EYYA 1VBD1 3R0RA 4NHYA 1E79G 1DQ6A 5GZEA 2VW0A 1DCSA 2VO5A 1XU1A 2BNNA 4XDKA 1O5LA 3VD7A 4BXSV 2Z2SB 5IK5A 1ASJ3 3DXRA 2ZPXA 2DBIA 1YQ5A 2CWMA 2Q9LA 2H94A 2OA2A 4AQTA 1RUC3 1Y74A 2W1UA 5F3CA 1QDCA 1PO23 1WLCA 1UD1A 1N0NA 3HNBM 1U0AA 2BGCA 3B8MA 2C6SA 5GZFA 4H7LA 1XUQA 4Y33A 4HN0A 5C7GA 4DR6B 3ETEA 4CEYC 1EZVH 2D6LX 3PDQA 4YFZA 1HXS1 2VW1A 1CONA 3ORJA 1XNRB 4LIUA 1R6TA 4ZONA 2Q7EA 4JC1A 4TV9A 5C9AB 1I08A 2ZNIA 3N9QA 1IBKB 4LOSA 5KXCA 4CEWC 1U5YA 4RYDA 3WQ7A 5A3NA 1FOD1 3N2KB 4LA3A 4YM3A 5IK7A 2ZCEA 3AG2C 2Y4TA 3KT4A 2FL4A 5FPXA 3OMIB 3EBRA 5I0UA 5L3CA 3AYCA 4UW4A 4ASMB 3AP4A 3VBOC 3QG5A 5C4WA 3SH4A 5K0UB 2Y34A 4BIOA 3ZYRA 2NP0A 4XETA 3S0MA 4D7YA 3V0BB 1O3QA 4BLIA 4PCRA 2VQTA 2EAAA 2HWF2 2WWSA 1PMJX 1JYWA 4JV5B 4OMDA 1VIWB 5ABJA 2QDNA 2BWAA 1J3QA 1CWPA 1LB2A 1GQHA 5HV0A 1LOBA 3FC0A 2V4VA 1N4CA 3VZLA 1B06A 3SYCA 5F9TA 5FYSA 1VBB3 2BVBA 3KCXA 3JSLA 3VD5A 4OUSA 5LXTA 1TMF2 4Y20B 1QMJA 2QTWB 2WNUA 2JE7A 4QB6A 4LF6O 1SDDB 3W59A 1PNFA 5I93A 1US3A 4NRMA 5F1RA 4QX1A 1WP8A 2D98A 2JRIA 1XE8A 3A8TA 4H44B 1OQEA 1NXMA 1VQMV 1NA1C 1V6OA 2P37A 4QE9A 1PX3A 2QZ2A 5BNPC 4D7TA 4E27A 4P5HA 1E1QG 5FZBA 1GNHA 5B1BC 4I0AA 1AL21 5IJ9A 1H2NA 4LIVA 1GP4A 4OI2A 3PHMA 1VQKV 4PDWA 1Q90D 4K0KO 1SQFA 1XBLA 4NR1A 5L9VA 3PN1A 1VQ6V 1PNMA 5DDJ2 4L11A 3MD0A 1G8WA 3HN1A 5B66Z 1XBFA 1AHSA 1APNA 1AI7A 1A78A 2JDHA 3BKZA 1OA3A 1GOGA 2CHHA 3M4FA 4P02B 1CX1A 5L7OC 3HQUA 3GDBA 1RVF1 2HWE2 5FNVA 2LW8A 4A7ZA 1W04A 4NIIA 2CDOA 2RDQA 2EINB 2JIZG 2NR5A 2P3KA 2A6WA 4RL7A 5FZMA 3TOJA 4FPOB 5EK0A 1LODA 2VZTA 1F9KA 1R082 5LBBA 4LO4B 4EB6A 2W5FA 1H2SB 2IJIA 2XBO1 3BYWA 2DVDA 4DXRA 2BFUS 5T54A 4LUKA 4GMP1 1HRV1 4HPKA 1C1FA 4OPHA 1W0JG 4B4RA 1Q6HA 3OUSA 1NY71 3OMAB 3T0DA 2UXBO 3ZN6A 1TE1B 3MPPG 5FZKA 5LBCA 4XBFA 4BMBA 3P6BA 1OVPA 5IY5B 1PNKA 4AAXA 2JX9A 4XUOA 3AG3C 4NPRA 4WVWA 4GJZA 1IS4A 2E5LB 5J2UA 3PVNA 3CDZB 4I4TB 1TGOA 1G1XB 3SJQC 2XTAA 3JAKA 2F23A 5BY5A 3LUTB 4GYCB 3T1YB 3O1VA 4Y4YA 3OBAA 4YJ3B 1UCXA 1TUBA 4D6RA 1OFSA 3LDDA 1C3HA 3PU8A 4PIYA 5LEJA 4J6GA 1NBMG 5AC92 3GNEA 2QKSA 1GM8A 3SYOA 4CS4A 2D93A 1RUG2 3I2FA 1VMFA 3VBRB 4IIJA 5H9RA 5A6ZA 2WFF3 2R043 1UYXA 4CCKA 4CCDA 4UFMA 5JXHA 1EY2A 1FAFA 1VBA2 3ZRVA 3HKBB 3HR0A 4MGKE 4ES8A 3CEWA 5CFCC 1TVKA 3OYWA 4YWAA 4PV1B 1O9GA 4LFBB 4CCNA 3LZZA 1IVSA 4EZ4A 5LOVB 1DQ0A 3SQOA 3LIGA 4XFCA 1AL22 3T30A 4JYBA 2JS5A 3W7SA 4FOYA 3CLPA 4ZBMA 4Y26A 4DO0A 2WFF2 1E1RG 4M3CA 1MQTC 2Y4UA 2W0XA 1W2TA 4Q29A 4HZFA 3POWA
chains in the Genus database with same CATH topology
4EWEA 1EV11 2TBVA 4QGNA 1JXNA 1RVF3 3I4IA 1LHOA 2CNAA 5JPNB 5JZGB 3LA7A 2VY0A 3W58A 1V9U2 1Q8PA 3V56A 3O7OA 5JCTA 4IEWA 2HWB2 1RUD2 5HCBA 1UL9A 3TBDA 1ZRCA 1GR3A 1FATA 3ZYGA 4COVA 1JH5A 1VBD3 3M3OA 4TSVA 3FLPA 4LTAA 4AFCA 1RUI1 1S0FA 4AEDA 4AI3A 4Y1ZA 1C4RA 3ZXLA 1A8MA 3JB8A 3U11A 4OLLA 5K9YA 2PAMA 1REDA 4SLIA 3UKVA 4BHPA 1NCRA 3KZ4C 3QLQA 4OUMA 4AFBA 4K6BA 5IUQA 4BCUA 1R1A3 1MS4A 3MDPA 4AI0A 4LBLA 1C1LA 2RHPA 5KC6A 1OI6A 1EYBA 2W08A 4B7KA 1KFXL 4AE2A 1ZBE3 4JGYA 3B9CA 1TMF3 4MZUA 5ACA2 1EPZA 1H0BA 3MIGA 3NV2A 1IS5A 5ABJB 3LB9A 4I3PA 2XL9A 3NAPA 2OUHA 1LHVA 1KS4A 1O3SA 3D6EA 4Q4Y2 1M06G 3ETQA 5JOXA 3DKWA 4XILA 1PGSA 1H2LA 1MQTB 3LSDA 4IL7A 4AHYA 1F5JA 5T5PA 4GH4B 4C5WA 1ZBE1 1IPJA 2ZGOA 1PZ8A 1GZ9A 2XJQA 4YG6A 1ZM1A 3D0JA 4CDQA 4BG1A 1UZZA 4RA0A 1C8M3 1SLLA 3LWCA 4JQRA 5KXEA 4UBGA 2PELA 3I7DA 2JG9A 4AHZA 1S55A 3NJZA 4EN9B 3SH5A 3HWJA 1D2QA 5JOWA 4BYYA 1ZRDA 4IETA 3B02A 3J8F2 5FAXA 3MIDA 1PIV1 1VZ4A 1CJDA 2LTNA 2CYFA 4MSVA 4LBMA 1ENRA 1LEDA 2WQZC 5E1RA 1ZBE2 4Y1UA 3U07A 1TNFA 3URFA 4XFFA 1B35C 2DTWA 1UAIA 4AFDA 2RS53 2X5IA 5GJ6A 3E5XA 2R6QA 3RYRA 4AVTA 3N35A 3GYDA 4XMAA 2AH2A 1XYNA 2WS91 2XVLA 2XL7A 5FO7B 1MVEA 1VBB1 1DGWX 1J3PA 3AKPA 4OJ8A 3APBA 4CWDA 2D6MA 4YW1A 2HWC1 3DPRA 1FNYA 1UZYA 2MHFA 2ZKNA 5FLIA 1VR3A 5BV6A 4GKYA 4LBNA 2ZGQA 2JJ6A 3EQEA 4YW3A 4DFSA 1NCQC 2D7FA 2XJPA 1S0CA 2X29A 4BPZA 4YNIA 1ULGA 4IEUA 2JG9C 4OHXA 1OIKA 4DPNA 3FE5A 3JQWA 3VKOA 4ZU7A 1Y43B 1QQP2 1W39A 2XJRA 4FPFA 2YV8A 4N43A 3B00A 4JRLA 2DUOA 4C1XA 4ZKTB 4PLNA 1BKZA 1X50A 4MXWA 5GLVA 1SEFA 4OULA 2VG9A 2AUYA 4K7JA 2DFBA 4QPIB 1J58A 1U5IA 3AFGA 4XBLA 2E9QA 2NLRA 4YVWB 3KLSA 3ZFEC 4PF5A 3VBFC 1YI9A 1PK6B 4FPHA 3BODA 2B39A 1HRI2 2ERFA 3ZN6B 2RS11 3ZX7A 5GZCA 4XZPA 4BE3A 2ZGUA 2A6VA 1VBA3 4LE3A 3LA3A 2XLAA 3H1YA 1QJX2 3K51A 5JWPA 2ZMLA 3ZFGA 1PM7A 1N1VA 1DLLA 3P3PA 4I0BA 4CDXC 3FFQA 1AVBA 4HL0A 3GHMA 4WM8A 1OIJB 4Y1VA 4XXPA 1FMD3 1UU5A 2XH6A 2PLV1 3A0NA 1R081 2PHDA 4EN8B 4M2CA 1VB4A 4A2UA 1Y0ZA 5D1IA 3GBGA 4PBOA 1CPMA 4QXKA 2P3JA 4WZCA 4MGZE 2I45A 3OTFA 1RUNA 1W6NB 1XNCA 4MVTA 4AG4A 3AXDA 3WW4A 2A7AA 3A4UA 3J9SA 1H1IA 3USUA 1C5HA 3AJZA 2R1BA 1ZRRA 1RUF1 4CP1A 1OLQA 4YVSA 4XF4A 2CTVA 3KS7A 2GC2A 5CADA 1HXS3 4XTPA 1A6CA 2A75A 5FMOL 2Z42A 4NOTA 4QGMA 5CBLA 4KGGA 2JKBA 3ZXDA 1COV1 2XPJA 1GQWA 1ND2B 3D5OA 4EROA 5BNQA 1XYPA 2D3PA 3E6BA 3WQ0A 1YFW