2W0XA

Factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2w0xA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2w0xA01
1H2LA 4QU2A 4Z1VA 3P3NA 2W0XA 2Y0IA 2ILMA 3OD4A 4JAAA 4B7KA 2CGNA 2YC0A 1IZ3A 1MZFA 2WA3A 4BIOA 4NR1A 2XUMA 1H2NA 3D8CA 3P3PA 1MZEA 2WA4A 5JWPA 2YDEA 4B7EA 1YCIA 1H2KA 2CGOA 3KCYA 4Z2WA 3KCXA 4AI8A 1H2MA
chains in the Genus database with same CATH superfamily
1E5HA 1NY72 2J1SA 3ZIAG 4WFGA 5FK8A 1F7YA 1RUC3 5I0TA 2BP6A 4AI3A 4BIZA 4GT1A 4LF8B 4YM3A 2R0FA 1AR83 2OQ6A 1DCSA 5D1IA 2D98A 4ZU4A 4GIQA 3ACIA 2JB8A 5FRAA 5HCAA 4RFRB 1ULPA 5LB6A 3SEPA 1RUOA 3EBRA 3M8AA 3Q8AA 3E8HA 5J2TB 3THOA 5E89A 2BCCH 2WLNA 4CE8A 5F2SA 4YPJA 1R1A2 2ZXQA 3LDEA 4ZHQB 1J1LA 1XREA 1PVC1 3KHBA 2VWKA 4JVAA 3JARB 1FT9A 4NIAA 2EAAA 1VP7A 1V0AA 3SR2C 2ZGTA 2VW1A 3CWBH 4XQDA 2EICA 5C9AB 4NYKA 1WCQA 4BR6A 1S3JA 3OPWA 5FO9B 4QDRA 5HV0A 1VRH1 1GP4A 4DS0A 1FFXA 2BFUL 1C8M2 3PUSA 4K8XA 4AFMA 2JKBA 4LNVA 4DV0O 3ZRVA 4D8MA 2QKSA 1Q7YW 2IH3C 2XHKA 2W2IA 4IW3A 2O0OA 4CP2A 1K34A 4K0KO 3CJIA 4LH7A 4K1ZA 5EYXA 2VOWA 5F5CA 1UMZA 2Y4UA 3QO7A 2WS93 5CB7A 1FPN1 1JZ2A 2XVKA 2OYQA 3GCXA 1W2NA 1WW6A 4QGNA 2JX9A 1VIBA 3PMEA 2VECA 3S7EA 4AL9A 1YNAA 4X64O 4AW7A 3CF6E 4QU2A 1P49A 2JDUA 1RUI1 2Y0IA 3ZN0A 3OD4A 3ELNA 1AJQA 4X1KA 4Q4X2 1EV13 3CKHA 4WBNA 3I7DA 3ABMB 4LO5B 4EN8B 3T2OA 3SJAC 2JDZA 1E1RG 1UKGA 4FLZA 2R9IA 1SQGA 3JSNA 1ZRRA 4K8ZA 2WA4A 4NXMO 3NJXA 3KG2A 1POV3 2RM23 1AR93 1GQPA 4Z92B 4NIGA 3OB8A 3TXQA 5EZWA 3O1MA 3ZDSA 2UUCO 4JGYC 3O1OA 1VF6C 1WKYA 1VQ5V 4UYBA 4QGLA 3Q8BA 5LMNB 2R063 4BQYA 4QX2A 4LHKA 1K3EA 3D3QA 3JD0A 5JAXA 4DRXB 5DUXA 4K3UA 3H8RA 3K58A 3HKDB 2Q1ZB 4TYSA 1Q43A 3IAQA 5IVBA 3GJAA 3E22B 2R72A 1KDKA 3FUQA 3UESA 1GLHA 1YO8A 3T4ZA 4UFJA 4DV5B 3OOXA 3VD9A 1BBT1 1S55A 3VBOC 1E57A 3ZR6A 5AC92 2GNTA 1LESA 5JZGB 2CL2A 5IAVA 2GNDA 4IEXA 3K57A 2XAQA 3ZMVA 4L97A 1S2BA 3Q4HB 1KUQA 2RS12 4CS4A 4O4IB 4UW3A 2PMWB 3JU9A 3CYOA 3LSQA 1WGPA 5B1OA 1Q8VA 2ARAA 2QQMA 1BVP1 4LUMA 4M01A 1EN6A 5FO8B 4XHXA 1LEDA 2P3JA 3ILNA 4NXMB 3ABZA 4JI3O 4OI4A 4Y24A 1VRH3 2LW8A 3W7XA 3WW1A 2HWE2 3GCWA 5EPAA 2IJHA 3PURA 4MTOA 1Z7S2 3D3IA 4EN7B 1OPOA 5A3TA 1JHNA 4CRQA 4DO2A 1LCLA 1W2BU 2IU0A 4H7MA 3VZMA 3TEZA 4AVBA 4TWKA 4CCCA 4UVAA 3GHNA 5DAVA 4P9XA 2XJSA 5FPXA 2Y48A 3ZXDA 2PHLA 3LDCA 1RUH1 1AI7A 4H33A 1FPN3 1VMFA 3NMBA 2P6CA 5C3SA 2VWJA 1PIV3 4IYIA 4M00A 2OX0A 1G1XB 1HB3A 1IX9A 3B01A 5FFOC 2WAOA 1N36O 2YPJA 2LRPA 1CEZA 3POEA 3I2DA 5ITZA 1RUI3 4OCTA 3AG3B 3ASNC 3ZS8C 1OA4A 4AVVA 3LNNA 3I2KA 2PYJA 3P3PA 4KNCA 1W8WA 3VHRA 1Q8PA 4PJ0Z 1AL21 4DR3O 4MV2A 3KV6A 4KGQA 3K48A 3GBWA 1UOBA 4ZBMA 1K3IA 3WG1A 3SPIA 1F4MA 2VQFB 4CDUA 5JI7A 2AZ0A 1VEWA 4NTYA 2ZXWC 3VQXA 2VNOA 3L2HA 4XDQA 2V1DA 3AMQA 5L36A 2O8QA 1JQ0A 1Y6XA 4GWJA 4BQ1A 3WR0A 3AKTA 4X62B 5DQ0A 4QPGB 3WNLA 5J1XA 2C6SA 2XL9A 1W3XA 3E86A 3WB1A 1H30A 3KGLA 1C57A 4M3CB 4CH4A 3EHBB 1JVMA 1RUD2 1NVPD 4A44A 1U0AA 1QKQA 1WJZA 4YIOA 1AJNA 5EJ1B 2CDOA 4GH4C 3OBAA 3HWJA 2W0FC 4ZI7A 2XUMA 1GSLA 3Q8EA 1AZDA 1RVF2 1WP7A 4H0LB 3VN4A 3D36C 5KR7A 1LU2A 3C7HA 4EROA 1RJ8A 5FIXA 3DGEA 3N36A 2WT1A 2XAFA 4QHBA 1K4CC 4D69A 4L11A 2GMEA 4W6YA 3OBZA 3D6EA 2OZ6A 1AR62 1EZJA 1F23A 4BXSV 1Y3TA 3LQCA 2ZQMA 2QWNB 3Q8FA 5A3UA 2RG4A 2BUKA 3JARA 4Q4V2 3VDDB 4FFFA 2QWPB 2K0GA 4W65A 4LFBB 4XAEA 3K59A 3CXHF 3MYXA 1UOFA 4N9HA 5IJ9B 2DUPA 4GQ7A 3VBSB 1WD3A 5FL7G 4QE9A 1AR5A 3WP4A 2DVGA 4LBQB 3ZLIA 2DYSB 2XUEA 3BVOA 4YW2A 2YG0A 4NUBA 3W7UA 2DVBA 1GN3A 3APOA 3H0OA 4DR5O 4UAPA 5CG9A 2W92A 4ZONA 4Q4Y1 1W6NA 5FYVA 2JECA 1K5MA 1LOFA 1ZBA3 4TQFA 1YQCA 2XAJA 2ZGSA 1ZBE1 1SS3A 1ONAA 4RGGA 1M57C 1NH2D 2GDFA 2X10A 1QOOA 1W03A 3H9VA 3RWNA 4L99A 1RUG1 1H2GA 4YM0A 5K7PA 3ZPOA 5FZ3A 5FNVA 5CA0B 2DWRA 1I5PA 2W6JG 1JYVA 1ZX3A 1HNZB 4GAZA 4FZ1A 1RUH3 4O2AA 1LOCA 2HVJC 4R52A 4LC1A 1H9WA 1NX9A 4CU8A 4G2KA 2QKDA 3LFMA 1CAWB 1W8NA 3A0HZ 3RJRA 3OUHA 4TV8A 3TN91 4B08A 1YWKA 1LHWA 4J9ZB 2Y6LA 4CCKA 5ISLA 1NA1A 2VUJA 4MHUA 1GRJA 3ACGA 5CISA 2Q67A 2CWSA 5IFPA 4UCVA 1DLBA 3VHNA 3WHUA 2FQPA 1R6KA 2HLDG 3THPA 3D8CA 3H1LH 3TEWA 1VBE2 2EZOA 5JQGA 2BOJA 3H1IH 3HKCA 1RXFA 3MF6A 4CEWC 1PK6A 1PNGA 1NU1H 2GC3A 2W46A 2VO5A 4MYEA 4XXAA 4UW6A 4INDA 3HKDA 4MGQA 2YC4A 3WF0A 4W4KA 3BAAA 1AJKA 5A7QA 1XU2A 3BEHA 4K21A 3AG2B 4XDKA 4QAWA 1NCQC 1O8PA 1A32A 5LATA 2PHUA 2RR11 2CGNA 4J11A 4B3SB 1S0VA 2DUQA 1R3LC 1HRV2 3ROUA 1NKDA 4GALA 2LALA 5F3IA 5JZGA 2Z69A 2AHZA 1QU0A 3Q4HA 4META 4O4IA 2QTSA 3VBUA 4J7JA 3B2EE 3EFFK 2A79B 1GM7A 2D5FA 1CJDA 4XUTA 3A0NA 4CTEA 4OI1A 1G7YA 4X8AA 1A34A 4PD4F 5F3CA 3J9SA 3FYIB 2QQNA 4YG0A 4DV3B 3CX5F 3A23A 1NT2B 2RHPA 3RI9A 3JQWA 1Q81W 1SZTA 1H4HA 2WT2A 1HWYA 4W6WA 4QPJA 1DGLA 2RJKA 5J7MA 2GH2A 1TQ5A 2ZJCA 4PDVA 3BIWE 4JI7O 4TXWA 5FKCA 3THTA 5DG2A 2A6YA 2ID4A 1NZCA 2JWPA 3RN4A 1J5EB 1LGCA 4MADA 4RS5B 1W8HA 3LA3A 3NL1A 5FMBA 4YHHO 3ILFA 3BB6A 1THZA 1GM8A 5DPNA 2BVBA 2WYFA 3MIEA 3ZJZA 4XZUG 1MABG 4AQ2A 4FK5C 4F6RA 4X20A 1RUG3 4ARYA 5LGTA 3NV4A 4JV5O 4QKNA 4LE4A 2LQTA 1TVKB 1XL6A 1WUVA 5KXEA 2WBKA 3I2GA 4XBLA 3RWRD 1FXVA 4CU7A 2E7AA 4Z07A 2BTQA 1RC6A 4O4LB 3LIHA 5C4WB 3JUUA 5KHJA 1UY2A 2ZR2A 1B35C 4QHOA 4JAUA 4ONUA 3W9AA 1O7FA 4E4EA 1DLLA 1KMIZ 4ES8A 4MT8A 3K9AA 1QH6A 4XF3A 2W1QA 3ZIXA 4QPGA 1OXCA 1SFPA 2JGUA 4O2BB 3V0AB 2W95A 1SCSA 4CEYB 4M3CA 3WZ1A 2PI4A 3L9DA 5DDJ2 4X1YA 1BKZA 1LAJA 1M1KW 2MK3A 1FXKC 3R4UA 2YGMA 5KXDA 1M5IA 2QVSB 3MPPG 1MSWD 1WA6X 1R091 2WDBA 2FKXA 1CQ9A 3S30A 5F2VO 5GTIZ 3AZYA 4XJAA 1XDCA 3ZYJB 2NP0A 1OT5A 2QR4A 1AJOA 1L0NH 1RXGA 4FQZA 3B5LB 3N4MA 4E2QA 2DQ3A 2C5DA 4XVHA 3ETEA 3BN6A 2YSUB 5FAXA 3VDDA 1COWG 1L1FA 4JV5B 2HWD2 4KI5M 2JVDA 4LO8A 5EBWC 3ST7A 4COWA 1PGL2 1JYWA 3WX5A 5BV6A 3BOWA 5FJHA 5ACA1 3HNYM 3BU0A 3T1HB 3VKNA 1KECA 3WY6A 4TTGA 1GM9A 3SYCA 3FFQA 4N90A 3FX7A 2BGPA 4NAMA 5DG1A 4LBQA 4A7ZA 2YZ4A 3VD3A 5L3CA 4JDOA 1JYTA 3VBHA 2K2SA 2PHFA 2R072 1Y67A 3RDIA 1PVC2 4R6ZA 2XH6A 3VL8A 2XBO1 1HDKA 2Q6AA 4XUOA 3I3DA 5A7WB 1X33A 3CZJA 3ZFGC 4P9LA 3APQA 3D0JA 1VB4A 1PHMA 4N8MA 4FOWA 4GB32 1PD3A 3CS5A 4DV1O 2BTOA 3GXUA 4QJFB 1LODA 1ND2C 3ICXA 5ERLA 2OTLV 3WNPA 4BLJA 1WLDA 2L35A 4Y5Z0 3TRSB 4K20A 4B3MO 2VCBA 2IC1A 1FNZA 5HXVA 1CAWA 3IBMA 5ANQA 2W91A 4GZRB 2BV4A 1OF3A 1QMJA 2JG9B 4QDSA 4DINB 1EBOA 3AVSA 1YHQV 1JA8A 4YVWB 2KQXA 5FZOA 1GMGA 3JSLA 5DECA 5CEHA 1REEA 3P3NA 1EM1A 4FTEA 2ZZQA 1NXD1 5JPMB 2QA4V 1BYHA 1US3A 2Q8CA 3WINE 2FB5A 4CYDA 2VMEA 1DQ6A 2VMDA 4QT6A 5CBHA 3ZFEA 3KKYA 3CCEV 2PYTA 4LBNA 1VE0A 5JIAA 5T55A 4KP4A 4X66B 2K46A 4AHXA 1IURA 1EAH2 1FS0G 5EIBD 3I59A 2W39A 3OSDA 2UXDO 1PZ9A 4LF5B 2HHHO 3AYEA 1VQKV 3K9SA 4MS2A 4DV7O 3IPVB 3K0GA 1RJ7A 5I0DA 1HRI2 4AVCA 2Y6JA 4OUMA 5A9GA 2G1MA 3PMSA 1FD9A 5IJ0B 1L7QA 2E53A 3SNMA 1C4RA 1TG7A 5FUIA 2WWJA 1IOAA 3T4DA 3E1F1 4BU2A 4XDPA 1R093 2VXRA 1LUVA 2UYAA 4FVVA 2VBDA 4X1IA 3LDKA 4NIDA 4UCSA 3CCJV 3BA9A 4NE9A 2DVAA 5E1AC 4PCRA 4JCKA 1M56C 3CCRV 5B3SC 1LGBA 3USUA 3ZN6B 2E7TA 2YC0A 2HFEC 3IC9A 4AGGA 4LUKA 3E8GA 5FMOL 1HXS1 2Q5TA 5DXDA 2PAMA 3DXRB 3WDXA 3JD1A 3R66A 2WPDG 1DZTA 3LEKA 1BBT2 3ZHUA 3H3UA 4IT5A 3TXSA 4X89A 4JGZB 3QO8A 5BNOB 1CX1A 4ASLA 1H2KA 4N7IA 5FXVA 1BEV1 4E4HA 1AXZA 2Y6KA 2VE1A 2NPIA 2XHBA 4RS5A 1XNBA 3ENRA 2YU1A 3JD71 4ARXA 3JCZA 3TCUA 2EULA 2VQEB 4UFZA 4DV7B 2X6CA 2W68A 2VCAA 3E8FA 1PGW1 1JCHA 5FMOS 3K4AA 2JENA 2EIKC 1K5JA 3IWZA 3AYAA 1XNAA 2CE4A 3CCQV 1Q6UA 4AEDA 5EK0A 3K3NA 1HV1A 4LF6O 1DP0A 1C8NA 3ZYRA 2E7QA 5FZ0A 4DV2B 1G9CA 4I3GA 3HVDA 4NXNB 4YG3A 1PZ8A 1TVKA 3J80N 1FKAO 1XSQA 4GKKB 2HR3A 1DYPA 5KAIZ 4BPZA 5IVYA 1NE6A 4FLYA 2NNUA 4O4LA 2VZVA 5C4WA 3AC0A 4Y5SA 5H9SA 2D97A 3T2TA 5C8CB 4IEPA 3TB0A 1H2LA 1YC61 2WNVB 1D4VB 1NE4A 1RINA 3VBRB 3SCFA 4YJ3B 2BWAA 2WABA 2E32A 1X9TA 4XFBA 3LEMA 3O1PA 1BE3H 1VQPV 4OX9O 2WINB 1IXBA 5BNNB 3OTOO 5DUUA 4URAA 4YGDA 1KB9F 4LE3A 3VKOA 1R73A 4GULA 1XBFA 1QR9A 1N34B 4FFBB 1JU3A 3NNMA 1AL22 1OSGA 4WV8A 3ZSEA 1H1AA 2XMLA 2NR5A 1ALYA 2ZKOA 4LCUC 2ZGLA 2VOXA 1LENA 3WHTA 3ZDVA 5FMDA 2YEVB 2D6OX 4KWLA 1DQ0A 5BNPB 3RZHA 2LW1A 1W2UA 3GBGA 5L3GA 1LKNA 4JAVA 3N7KA 1NVPB 3JAMN 2GMPA 5JJEB 4B3RB 1WB7A 3KLSA 2B45X 3EVKA 3T1CA 4S2GA 1U5XA 1JYNA 1NCRC 4NJ4A 5FZEA 3WNKA 4IGGA 1FFTB 3RRDA 4AI2A 1BHBA 4NMIA 3VZKA 4MXWA 1X59A 4YY3O 2IJIA 4OMCA 3E6CC 1WCUA 5IYYA 2ZX2A 1F9KA 2XDVA 1LNQA 3PVBB 1BCCH 1VBB3 3SH5A 3NXSA 1GZ9A 4HVQA 1OI6A 3B77A 3ZMOA 4QB1A 2ADEA 1Y9QA 4FPEA 2WQ8A 1QXRA 4M3CF 4OHXA 2QDRA 4OQ8A 1D2SA 2GP5A 5FY8A 1PNMA 2VY0A 3VZOA 2FCVA 3NSTA 2LROA 3OTOB 4EFEA 1G9AA 5FZBA 2HH9A 4MH0E 1MS0A 1ST8A 4UFKA 1AX2A 1SLLA 5BR8B 3M99B 4C91A 3WD5A 3LOIA 1NLRA 1FX5A 3JD73 1AYM1 1VBC2 2DUOA 2DW4A 1GKFA 3RS6A 2DV9A 1ASJ2 3ORJA 3NWKA 3OPTA 3X2QC 5DAWA 4PF5A 3FD9A 5CBLA 2JG8C 5FK7A 1OV9A 1ZRIA 2WZR2 3TEYA 2JE7A 4R7CA 4RR3B 3SEEA 4Q4Y2 1MNGA 4YW7A 2JG9A 4RD7A 3ZN1A 1CESA 3L72H 3MIFA 1ZBE2 1X82A 2WFF3 2QM4A 1S0BA 5I93A 2QWOB 4EFBA 4TQDA 5H9QA 4GKJO 4YY3B 3MHZA 2PLV1 1QLEC 1OOPB 5I8SA 3RZZA 1TA8A 2BGOA 4Q4W1 2GC2A 1JX9A 4OZXA 1DZQA 4COVA 5C3QA 4FPHA 5T3NA 3A22A 3SLIA 1GP5A 5B4XA 5GKAC 1EUTA 2JKXA 4KU8A 3KZ4C 3S3XA 2DE0X 1N3OA 2J22A 4K35A 5L3DA 4LKEA 2HVKC 1WLCA 2EILC 3HBZA 5GM0A 1ROPA 3AG1B 1W28A 4AAPA 4AXOA 1SPPB 2DTYA 3TN92 1RHI1 2YIBD 1NTZH 4OQ9A 2WFPA 1VQLV 5FYCA 4JRLA 3RJ2X 3KMHA 2K9PA 2AEYA 5IJ0A 1UL9A 1OJHA 2JDYA 4YVSA 2CAZC 4Q0PA 3RYIA 3J7MA 3KSCA 2XAHA 4CP0A 1H1IA 5EJ3A 1BGYH 1QJU3 4OFGA 4MZUA 4O4JA 1HQNA 4BDVB 1OD3A 5DZGA 3UK9A 1N32B 2X29A 3UV9A 3CP1A 2UUBB 1F2NA 3DGTA 1ZX5A 3ZN6A 4QB6A 4IL7A 1V6IA 2DOSA 4DPNA 3DXRA 3ZN4A 3NNGA 3V0BA 3SC7X 2RR12 2G9GA 4GKJB 1N33O 3CSXA 2UU8A 1LOEA 4JI4O 2HWB2 5LP6B 2IFRA 3HNMA 2JDPA 3T09A 4O9EA 2X8KA 2WWWA 5BNOA 5H9CA 5DEDA 3OGCC 4KGGA 4XCAA 4CDQB 2FDIA 2KM2A 3ABKC 1ORQC 1VBA1 3FE5A 4LA2A 1YXWA 3N35A 2ZM6B 4KHPO 1EPWA 4S2FA 1QWRA 3RYHA 4U7OA 3B93A 5C6CA 1UXXX 1Q86W 1JUIA 4E27A 2R1DA 4DR7B 4FTSA 1SACA 1U5YA 1AR71 4PBOA 4QX8A 3HPLC 5J36A 4FI9A 1VLNA 3BYWA 3CCLV 5LXTB 1AYM3 5FZGA 2E3CA 3LIGA 3TWIA 3K51A 4N43C 1LUWA 1ZRDA 5IY5B 4QU1A 3RFRA 4Y22A 3JATB 4E4ZA 4NHLA 1IGOA 2RJZA 3R4DB 2EXIA 3ZYFA 2WRAA 2AW9A 3OYWB 1QXPA 2EAKA 2Z0AA 1DF4A 2AGAA 4MGKE 4ZU5A 1PM7A 2EIEA 5C8CA 2E26A 2XONA 2Y38A 2WNVA 4WZCA 1JOYA 2LS6A 1XNDA 4XXPA 2F4VB 2X5IB 1N33B 3SH3A 3CRRA 1QVFU 3I55V 5FP3A 4KWUA 3IMMA 1RFYA 4Q4W3 2KB1A 3PUQA 2UXCB 2TUNA 4YM1A 5BNNA 4X6QB 1ULEA 4AFBA 4DR2B 2FZ2A 2NLJC 5C93A 2DBIA 3DPRC 1O3QA 5L7OA 2P6JA 3OGGA 1XEQA 3I2IA 5H6QA 4H3WA 2YGLA 3JQXA 2RCVA 3MPBA 4MVTA 3C3TA 1GTOA 2B9ZA 1RHI3 2YI9A 2YEVA 3AX4A 1VAVA 5BNPA 5JI9A 2P3IA 3BODA 2P67A 1QIQA 1RUE3 2P4EA 2WKKA 1N1SA 1S0JA 3B3QE 4UFHA 4V2WA 4QX7A 2Q9LA 1KFUL 2PHWA 4I30A 2OPKA 5GJ6A 4MG2A 3VUOA 4NB5A 3POWA 4IEZA 4URTA 3ETGA 3N9OA 4LJHA 2GHYA 1SFYA 3ACHA 3AP9A 2OIGA 5JJNB 4FVMA 2VL4A 4LBKA 1SA0A 1R1A1 4XE9A 3KV9A 1Z2GA 5FKBA 4KG0A 3IFXA 1A6CA 2XAGA 5JWPA 5LMUO 4NN0A 3RYCB 2D6KA 2R70A 4GJYA 2ZHMA 5JOZA 2Q1FA 3VLBB 3W5NA 2BBAA 1CAXB 2WA3A 1FAFA 2AENA 4JTOA 3OD0A 4FP2A 2F1MA 2UWCA 4YSFA 5HPOA 2N05A 1SLAA 3WQ1A 5I0UA 1MQTA 4I4TB 5ACA2 3JD4A 2DYRC 1T6GC 2ZBJA 1KS5A 3TNQA 3N7LA 3ZMNA 4UCOA 5H9PA 2Y64A 1VBA3 4Y33A 1RMU2 3RYRA 1PVXA 2E51A 4QXKA 4FPGA 2ZD9A 4PELA 3PDQA 4HK9A 3VBBA 1W8TA 3QLQA 3VQWA 4XF0A 2EIMC 2C9AA 3A4UA 1QEXA 1Y74A 4AHCA 1AR73 4RR3A 4RAIA 4AYUA 2WO1A 2XBO2 1YJLA 3FBYA 4Y20B 3RZLA 4IETA 4PIYA 3AP4A 4BHPA 4X9QA 4WVMB 2CTQA 3BPSA 4RWUA 4JX0A 5B1AC 5JJJB 3Q8CA 1C1FA 2XG3A 4XUNA 5CKNA 2P22C 4LHLA 4O65A 4R9BA 4FXKB 2Y33A 4UW4A 1W3VA 3N2GB 5CVRA 3FJSA 3O1RA 3B02A 3I3BA 4Q4X1 5JIUA 3TJTA 2KR2A 3VKMA 4Q0QA 4I2OA 2W1SA 1P4RA 3AFKA 1N47A 1OKOA 1PM4A 3CO2A 2BNOA 4XFGA 1U5ZA 4JZRA 3HKEA 2QQUA 4H37A 2PY5A 3OGJA 4DUXA 1X4TA 3CJHB 5D5PA 1SPPA 3T0DA 4CDUC 2GN3A 2WLLA 4JGYB 1P7BA 3KWVA 1LU1A 4P00B 2GAUA 4N9IA 3NJZA 1QNMA 3AMPA 1Z0HA 5JCOA 4WVVA 4MSWC 4FLXA 1WNSA 3BTAA 2VM9A 5FREA 3ZN5A 3NNJA 4LBMA 3FHQA 4JI8O 2QDNA 3H50A 2XWJB 2CH7B 4Q1PA 2XLAA 4E9KA 4U36A 4FPFA 3UL2A 4P9WA 1JJOA 4LBOA 1VMHA 1ULGA 5BXXA 3LSEA 1SQ4A 1QXJA 3EO6A 4YGCA 4BXFA 3WUDA 2OCHA 4UBGA 2XVLA 2JJ1G 5IYBO 3VBOB 2H8PC 5L3FA 4I55A 3IIAA 5T50A 2F66C 3SPJA 2B46X 3N9NA 5E6HA 1V9U2 1D4M2 1LGNA 1Y76B 5A1FA 4QKFA 4WM7A 2PFWA 1YIPA 4CXXA 3AZWA 1R1A3 3ZXFA 2A7AA 5JVVA 2EJRA 3AP5A 1UAIA 4QQOA 5FZAA 1Q82W 1BK0A 3K5MA 3I8TA 4XAAA 2DJVA 2MHFA 2VGDA 4TUYB 2UXBB 1E79G 4TSFG 4P08A 1YIJV 2I07B 5LA6B 3CMAV 4B4RA 1GQGA 3MV01 1EP0A 3UT5B 4AHZA 1D7PM 2WZEA 4CDQA 1R081 1CZSA 3AK3A 3VD7A 3PU8A 5CMUA 4GZ9A 4LBLA 2I2SA 2MNGA 2GH8A 2NQYA 4CUGA 2HWE1 1DGSA 1C8M3 1GN2A 1HXS2 4IV1B 4FAHA 4HAMA 4LKFA 3M70A 1OCZC 2EA7A 3ZYBA 4MGTA 5FZ8A 3AG7A 1M4UA 3CMGA 1OQDA 1K5MC 1LOFC 4DFSA 1UW8A 4XOGA 4JI8B 1X8EA 3M1HA 4ZU7A 4IV3C 2W0XA 2BW8A 3JATA 5FPRA 1YJ9V 1GYKA 4J1WA 4K6BA 3B9CA 1BEV2 2ORZA 5LRRA 3OYWA 3CRQA 2GTAA 2TNFA 4LO7A 3J8F2 4AF9A 5GZFA 1T5EA 2F23A 1OUXA 1XUQA 1FMD1 2WN3A 3O1TA 1A8MA 1PGW2 1H8EG 1VAMA 4MUVA 4B3NA 3ASNB 3ETQA 1PNKA 2GDSA 2A6ZA 2X5IA 5FPAA 4BM8A 4N21A 4RN5A 5IWAB 2DCTA 4Q4X3 1JN2P 2D44A 3N9LA 2VTXJ 3PUIA 1DLCA 4V1PA 3CU7A 2DURA 1NA1C 2C24A 5LGNA 1HV0A 4O7XA 3NAPB 3SDLA 4FLVA 2ZXWB 1OCRC 4P14A 1UY4A 1IBKO 3BALA 2D3OW 4JI5O 1BHGA 3UGFA 3PHMA 2W9XA 2N7GA 4JI0O 1CPMA 3POFA 2Y6FA 3SXWA 1F31A 3J7HA 2B39A 2NYYA 1IQDC 2ZE7A 4PDMA 1SBFA 1PK6C 3JALB 1PNFA 1WCDJ 2XGXA 3G71V 1HNXO 5A3WA 1JXNA 4GH4B 2ZHKA 3NVCA 2Q8OA 4IDZA 2QTWB 1RVF1 2ZX1A 4CS3A 5H2FZ 4JI6O 1PGSA 2XJQA 5DUVA 2JS5A 1S0EA 3PVNA 3FUOA 2LO1A 2V4AA 3AL5A 5BMVB 4EKWA 1W0NA 2ADQB 5CA3A 5C3PA 3E35A 1TUBA 2IFWA 2Q1MA 2XOKG 2VJXA 2ETNA 3RYCA 5AC93 4QX3A 1GWLA 3HPNA 4Q4V1 4XW3A 2EINC 3VBUC 1W6PA 3OE7G 3AYDA 3F2ZA 1TGOA 1QU7A 1CAXA 2PA7A 1LHNA 2RS13 4XJ9A 4L92A 4E4SA 5T5JA 1RB8G 4YG6A 4HNAB 2G19A 4LH6A 1G9FA 2PZSA 4IEYA 3J7NA 2G4IA 3SITA 1V00A 1HW7A 3WW4A 4Z2AA 2DCKA 1VQ7V 3RZMA 3HQUA 1QJY1 3IB3A 4H13B 1IBKB 5KXBA 2TBVA 2RS51 3O1UA 4GKYA 5T52A 2UY9A 3CZUA 3LB9A 2HWE3 2WWUA 3BI3A 1Z7S3 3IKWA 3T1LA 5JSPA 4HK8A 2LJ2A 1M57B 4YGEA 2QQPA 4Y4RA 1YIFA 4Y20A 4BWAA 5D5QA 1FV3A 3B4SA 2FMDA 4FPJA 1PO12 4AR2A 4HKOA 1TME1 1CXZB 2R041 5JOWA 4A42A 1KS4A 1GN6A 1QF3A 4ZS2A 3N2GA 1DGWX 4PA9A 3CIHA 3VKLA 4A7YA 3C7GA 3I2FA 4MLOA 1GNYA 2QBXA 4I02A 4V2VA 3ATGA 1GWMA 4RFT0 5EBLC 3ZHVA 1IPKA 4XIOA 1JYCA 2ZCEA 1XNRO 3AXEA 3ZXJA 1J95A 4FLWA 1Q3EA 3QVNA 1QOSA 1UPSA 3QH7A 5KXCA 3A2FA 4X8NA 1D0GA 2CYFA 4JGYA 1G9BA 4D7SA 5ABJC 2G9ZA 1CAVB 2IXLA 4LEJA 3GNEA 4JKLA 2BZDA 1DU3D 5L19A 1TEIA 5IFTA 2PLV2 5CKMA 5T5LA 3N9QA 4XF9A 3ZSLA 4UCRA 2A06H 3I2HA 4CEWB 2BVVA 2QEXV 1W6OA 1UPIA 4YLZA 1W9WA 2LTNA 4RGKA 1H38A 3VQVA 1ZTEA 4NKGB 4BJ0A 1I94O 4LWSB 3KCXA 4ET7A 2ZGMA 1I3HA 1NCQB 2XHNA 2VXJA 2P4KA 2ZS6B 1RUD3 3CB2A 4W4ZA 5LK7B 4GX0A 3VBOA 1H2SB 3K5NA 1HRV1 1RVF3 1XMOO 2B9UA 1XMQB 3WOGA 1Y76A 4FM0A 4LULA 1GZWB 3ABLC 2RV9A 1AL0G 5JSRA 2NLRA 2VOTA 4QKBA 2EIDA 3GWOA 1D5AA 5HFLA 4IE7A 1AI6A 1BK1A 2EVXA 1BSMA 4QGMA 4DMIA 4XDJA 1AR63 1W0PA 3UNPA 1ENSA 3UGGA 5LA6A 1QQP1 3ZFFC 3CXCU 4OGQB 2QZ2A 1XNRB 4Q4V3 3ZHQA 5FY0A 2HEYF 3U1XA 3AK0A 2YXYA 3VD5A 4YWAA 1TAEA 2NZ9A 3SGIA 3TAYA 4CZSA 3H01A 2ZT9B 4MTGA 5AG2A 1I7FA 1SRYA 2GUZB 4N23A 1ENXA 4GX1A 5FY7A 4LK7A 3VBHC 1PNLA 5EV7A 1EUUA 3OCPA 4IV1A 1HDJA 1IBMB 2J1TA 4LT5A 1QDCA 1DYKA 2ES3A 3ZSJA 1HN1A 4CC6A 3K75B 2Z5UA 2ZPXA 2A0LA 2UU9B 2WQZC 4XURA 2V09A 4XUQA 1OPMA 2ERFA 4WVWA 1KDMA 2C1FA 3I4IA 4GYCB 3DCQA 4JDNA 4NIHA 1LNSA 1UMHA 3RZJA 4UBHA 1RUF1 3JBG2 1Z5WA 1NTKH 4BQWA 1GKBA 3T0BA 4HMZA 3S6PA 1JZ5A 3DKQA 5FZFA 3ML0A 2VVDA 5CKQA 2D6MA 4LLOA 4CDXB 4QXBA 1K7DA 1XYOA 3GHMA 1OA2A 2X05A 3SJCC 2VR4A 1QJX1 3DKWA 4DEQA 1O6UA 3LDDA 2QJ1A 5CA6A 1I5YA 4YM2A 5CB4B 2XB6C 2QQJA 1ODNA 3NAPA 4Y1XA 4XQ4A 2BPA2 5LYJA 5JOXA 1SG3A 5LHIA 2XJVA 1XI1A 4NROA 3BIEA 3ACFA 4SLIA 3ZFEC 4KBBA 4XBQA 4U3JA 2ZX0A 1M06G 3SJBC 4LF7O 5KHHA 1XQ8A 4HPKB 3BVCA 3HN1A 1H2MA 3JAKB 3GZUC 5AFEA 1MG1A 1DIWA 5J2UB 2ILMA 5IVEA 2QKCA 4LF4B 3K0DA 1SLIA 1I0HA 1VBE3 1VB2A 4X65O 4C1WA 2RDNA 2GNMA 1FXKB 5BY1A 4JF3A 1NQTA 5LRSA 1HR0B 5HCBA 5HCHA 1LTEA 1I1EA 2WLMA 3RI8A 5H9RA 2ZKNA 2K9ZA 1XJAA 3IDEA 1AROP 4KBZA 5BMVA 1XNQO 1QVGU 1ZNPA 4CZZA 1JUHA 1ZUQA 3T1YO 2WAAA 1HRV3 4ZXKA 4F8AA 2WT0A 1YF2A 1ND3A 3AVRA 3ZR5A 5LOVA 1V6OA 1FJGO 2YV8A 2HWD1 4KXRA 1PGL1 1I5XA 2D6NA 4FPKA 1W0JG 4YRDA 3CE2A 2CWMA 1QHTA 3TYJA 4YFWA 3WF2A 4EZ4A 3C3VA 3EMRA 2R071 3JCIA 2IBZH 3T3YA 1EPZA 3JAWA 3RMYA 4LF9O 5FXZA 2QUOA 1H6YA 2EX3A 4FLUA 4LF7B 4UWDA 3IZOA 4F6EA 3OMAB 1VBD2 3ZFGB 5FPLA 3N2KB 4FM2A 1YZBA 2XQXA 1ENQA 2AACA 1H1MA 4BK5A 5C71A 1U12A 1YLLA 4XJUA 2UY8A 2GSMB 1W6QA 4GB31 4H14A 2E5LO 1JZ7A 1UY1A 3S5QA 4H2AA 4YZ3A 4IE5A 3UJQA 1L7RA 4XIKA 3WW3A 4IE4A 3ZM8A 5KBFA 1NQDA 2H0VA 4DXRA 3PTRB 2VVFA 3TGUH 4QQLA 2JICA 4XFCA 4AEDC 5IYZB 1X36A 4AEKA 1URXA 2WC2A 2W6IG 5FPZA 5IE9A 1DTOA 2VQTA 2AUYA 4TV9B 3OJBA 3T1YB 1E5RA 4NHYA 3SYQA 4YYOA 4G3YC 1GFF2 4IESA 1OC1A 1YVWA 4WM8A 1AVBA 1AYN2 4QDQA 5A7SA 1DF0A 2Y6GA 2FZ1A 3ZMTA 3QOPA 2BOIA 4QE7A 4JI1O 4JGSA 5IAXA 5F2WA 1PL0A 1WP8A 3AKPA 2BFUS 5HI0A 1POV0 2CGOA 1CAVA 1OLQA 2R16A 4PQ9A 1REDA 1IKQA 4PDLA 5J3UA 2X7RB 5H5NA 1R6TA 1T2XA 4CXYA 4DXZA 1K33A 4CEWA 2B1GA 1MOFA 1EAH1 4CCDA 4LF9B 5FP7A 1JOPA 1X9PA 5CFCB 2HWF1 3ITQA 4LWSA 3DXUA 2ZOEB 2FL4A 4QWNA 4XHBA 3K4DA 1NCQA 2EXKA 1URFA 2CV6A 2RS31 2YIBA 4WFFA 3PJYA 1W9TA 5FTTC 3ZO0B 4UCTA 5DDJ3 4XJZA 3AK2A 3I97A 2LW7A 1H8TA 1HRI1 4K7JA 3R6SA 1KBHA 2B5HA 1S5HC 2HWC1 5M0TA 1O91A 2HJDA 4WZFA 3PVEA 1HP8A 4DV0B 1TVGA 4PBPA 5FPVA 4I5SA 2B7YA 1O4YA 3NRUA 2GALA 1WD4A 4AAXA 1SHWB 5A3MA 1QJFA 3UKNA 3H7JA 2VMFA 3RNSA 4K0KB 3Q9OA 2JS3A 4LFCO 4ZKTB 2B42B 3OUJA 1M56B 5B3SB 5A1AA 4GMP1 3FZ3A 4JASA 3WDTA 3LSUA 2HWD3 2E74B 3BHPA 4K3AA 4AHYA 3QG5A 2FD8A 4CP9A 2GUZA 3UO3A 4DZGA 5KWRA 3BTXA 3IAPA 3JB4C 5JR2A 1W90A 4N53C 2WZ8A 2ZX3A 4RL7A 4EEQA 3FC0A 4X64B 4KH9A 1NR1A 2PAKA 1G6NA 3H7YA 4BK4A 3ASOC 3OR6C 2Y26A 1AR1B 1STMA 2R073 1GH6A 4YIPA 1PVC3 5IVVA 3MZHA 3UGHA 1Q6IA 3M8LA 4BE3A 1SLCA 3DC5A 4OHYA 2VZRA 4GJZA 5CADA 4YGBA 3W59A 5C8YA 1R082 2ZHNA 2H6BA 5I91A 2EIKB 4GB33 2WLIA 3PL0A 4D0QA 5I0RA 4P9OA 1P7GA 1PV0A 4AEJA 3ZHSA 4JI2O 1GANA 2UUCB 2VS0A 1NZ6A 2O57A 5EXOA 4CDXA 2HKXA 2HYKA 3H1YA 4W8JA 4GX2A 4IYHA 3SQOA 1KKDA 1GO3F 3K46A 3POJA 5LBQA 4DUYO 4CVUA 4RQPC 2ZABA 3IIIA 4QPIA 3IC7A 1XE0A 3OEAA 1WMDA 2BNMA 4P5YA 2A73B 2EALA 4AE2A 1KKCA 2WR9A 2Y8KA 5B66Z 2W3JA 2JD4A 2Z42A 3O5SA 3RQ0A 3C7EA 4KL1A 1WLTA 2FCTA 1YHFA 3PNAA 1NOVA 3N9MA 4ZOLA 2ZEXA 3LSDA 4IE0A 3E5UA 4QM8A 3LPFA 1FMD2 4XJWA 2ODMA 1ENRA 4DUZO 3OEHG 4J7ZA 3WNMA 4GKXA 4KWKA 3JAKA 3POSA 1RSOA 3AYCA 2QZ3A 1JTZX 3L70H 5J2UA 4L9BA 5BYNA 1W59A 5LGUA 3NJVA 4B1MA 3U4XA 5G05L 3LDRA 5FZDA 2WSSG 1EAH3 1FXKA 3VDBA 4BIOA 3RT3C 1SMVA 3ES1A 4JZGA 3ETDA 5CBGA 3D82A 2J1EA 4CH3A 2QQKA 2XJPA 5TSWA 1V6NA 3C90A 4K8FA 4PQQA 5EWSA 4HVRA 1OQ1A 3BGAA 3CBNA 3WNNA 4JQRA 4N7UA 4YVSC 4JI3B 3ETPA 1VIWB 1HRI3 4AVTA 1RIRA 4JI2B 1NCRB 3H42B 4LBJA 3NNLA 2Q0OC 4EYUA 2VG9A 2Q7GA 1NS1A 2IXCA 1K4DC 1K73W 4GXLA 4DUYB 1PP9H 3FFZA 2Y6HA 1YI2V 3WB0A 3OUIA 1HIXA 2YFZA 2GV9A 5EFUA 3MFCA 4GMP3 5J2TA 1HNWO 3JB8A 2RE9A 5K0UB 1SC5B 1HJGA 1BZKA 4DW1A 1K92A 3WT3A 2FYUH 5FLIA 2A75A 3MW3A 4QHZA 2WNOA 3SPHA 4ZHQA 3QF7A 1KRIA 3R0RA 2OW4A 2P3YA 2W1WA 2PHRA 2D6LX 1SQBH 1Z78A 1COV1 3W58A 1BBT3 3IGAC 1N36B 5A32B 1B09A 4ZY9A 3ZFGA 4HETA 4NRQA 1ZAUA 1IS3A 3THDA 4I09A 3OUFA 2IVIB 5C9AA 4UFMA 2JXAA 3ON7A 3EXUA 1GU3A 3BPZA 3B09A 2TEPA 1ZVFA 1UO9A 1XNCA 4GWMA 4DR3B 2DVDA 2VQUA 1VBC1 2MEV1 5SV8A 3O0VA 2VQ0A 5IYZA 4RUEA 3H3LA 1ASJ1 1J3RA 1QJY2 1UU6A 1KP2A 2JG8B 2RS52 3OGSA 2A6VA 1N8RW 2WZR1 2Z79A 4TV9A 2F43G 4O9GA 5K1PA 1XHXA 1R64A 3CD6V 4D3WA 3K4ZA 2GBOA 3GZAA 4K8RB 3ZBHA 5LHHA 3A7QA 4X6RB 1NXMA 5F8PA 4IGPA 5F5QA 2XXZA 1QLEB 2PHDA 2WLPA 2G9FA 4A6OA 1P8JA 1TME2 2WNVC 5GZCA 3PLQA 3WG2A 3WP5A 4Z1VA 1NQJA 1WW5A 4JTAB 2R042 5FY9A 5G04L 3C7OA 4ISQA 4C1XA 3POBA 4LQRA 1VQ8V 4LORA 3WDYA 2ZAHA 2VBBA 1MS5A 3EB7A 2EILB 2V5DA 5CFCA 4IHJB 5EYYA 4ZHNA 5FDBA 5FPOA 2GTSA 4HZFA 2AZ2A 5L7OC 2P3KA 3AMNA 4LA3A 1TMF2 4OXSA 4FIPC 5A3LA 1E5SA 2WN2A 3LOBA 1CN1A 4UXNA 1NR7A 3ZRSA 2ZA9A 4QKDA 1AL23 3H1JH 5BNPC 3IDAA 2D6PA 2YI8A 2V4VA 3RG0A 3PN1A 3VZNA 3DL3A 3HBKA 4PDWC 1N3QA 3RW0A 4QX0A 4ICGA 1XQNA 1K12A 2WWSA 3HOBA 2YMZA 1OZ0A 1UYPA 5LEJA 2FDFA 4DR5B 4EN9B 4M3CE 3AEIA 4DRXA 5E88A 1OLMA 2RVAA 4OUSA 1VQMV 3PVOA 4YARA 3E22A 4Q0UA 1DQ5A 1QCEA 1GBGA 5CA1B 3E97A 3MI8A 4BIUA 2FBEA 1VQ4V 2OS2A 2HWB1 2CNAA 3B7MA 3WQ7A 2CDPA 4IEWA 4IEQA 3G7DA 3ZX6A 1H9PA 2FHRA 2D2CB 3OT7A 2ZNIA 3ZYHA 5A3PA 2ATFA 2BWCA 2Q8VA 4RQEA 3WF1A 2HYXA 1W0OA 3ABKB 2J7MA 3T1MA 1MQTC 1Q6HA 1QQP2 1AP5A 3OMIB 3UYJA 2XLFA 3KV5A 2J1RA 3M7MX 3PJSK 2JK5C 1UKRA 3K2OA 4Q8KA 3JD2A 4QQPA 4K9SA 4XPVA 1R3IC 1OHHG 1O5UA 3WU2Z 2F95B 3BFRA 4FPPA 1VBC3 4N43B 4CBCA 2XASA 1C3HA 3S0MA 4BQ3A 4QX5A 1ASJ3 4RR3C 5E8AA 4LBEC 1KD1W 5A1LA 2P6HA 5H6RA 2WZR3 1QY4A 3R65A 2OZJA 2NMNA 4DYLA 1UU5A 1W2OA 2FDHA 1W0KG 4QQHA 5K1XA 3LWCA 3MV11 5LL6Y 4Q4Y3 1WN7A 1P84F 1ZBE3 1RM1C 3B40A 1YQ2A 4DIQA 3OBRA 3WG4A 1FOD2 1RUF2 2WNUC 4MW8A 2PN5A 3FMGA 2GZWA 3NKTA 2FMLA 4MTFA 2ZKLA 4WBBA 2R0HA 2VNRA 4A5UB 3WF4A 4ASKA 1MVQA 2UWAA 4Y3OA 1QJX2 5KA5A 5D8AC 4FZ0A 3DPRB 2P7TC 3T4HB 4NHXA 4AQYO 1RUC1 2KKWA 1Q8SA 2VZTA 1IQAA 2Y34A 1GZTA 1OCOC 2Y4TA 3VDCA 5C3OA 3NW4A 1XYPA 3TN93 4IIJB 4CDWC 5JR7B 1GUIA 5C8WA 4DR6O 1UIJA 1G8MA 3J26N 1KYOF 5FPBA 5IVJA 4XQWA 3U4SA 5FLXN 3IAYA 3I2OA 2UUAO 4Y5TA 4J9YB 2MPFA 3KT7A 5HCFA 4E2GA 2DN9A 3ZVXA 2ARHA 2GMMA 5LWBA 3CJXA 2P1BA 4DRRA 4DY3A 4RGAA 5FYTA 4B3TO 4ZZ5A 1KFXL 3AP6A 2JDKA 1O59A 4Q27A 2CSGA 1DYOA 1QNYA 5F3EA 2AH2A 1PO22 3I3QA 4JI7B 2Y69C 4CH6A 1NG0A 2DCJA 2JJ6A 1OFSA 3ZXKA 4AQ6A 3AZVA 4I01A 2ADDA 4WM7C 5AVAA 5K0UA 2XWBB 2ZHLA 4UB6Z 4A41A 4PA6A 4YHHB 1XOYA 2R6QA 5KUKA 1XSRA 2V4DA 2RR13 1R6NA 5DMYA 1RYYA 1OHFA 5FJKA 4E8CA 5A32A 2QQOA 1ZWIC 2OCCC 4HOOA 2N04A 1LULA 2HWB3 3AM2A 3IN9A 4CDQC 1JMKC 1DGRN 4TWTA 2F4LA 4ISRA 5L73A 2VQAA 4ZZ8A 3D4KA 4YW5A 3UO2A 5FBZA 2VNVA 1JHJA 4Z1MG 4Q26A 4R50A 1IG0A 4LF8O 1NI8A 5IJ9A 3VBSA 1RMU1 1CGPA 1W06A 1XRUA 3KF3A 4KUMA 2YU2A 1JR9A 2EIMB 2JG8A 2JEMA 4WFEA 2JE8A 4FOQA 2XNDG 4J42A 1SLTA 3APBA 4Y1UA 1L0LH 1VRBA 5B1AB 1TNFA 4CH5A 1VF5B 4BMBA 3MHSC 1HX6A 1RL3A 3WUCA 1DQ2A 4EN0A 4Q29A 5ITZB 4XMIA 2VMHA 4LHNA 1PZ7A 4FPOB 5CA0A 4UW5A 1ZA4A 4AI1A 2P34A 5JLVA 1RP3B 4XTMA 1E1QG 4XUPA 1BS3A 1POV1 3PJQA 4QQ2A 2RM21 4Q2FA 3GGLA 3HAGA 3QO5A 1W8FA 2WZPP 3QNEA 2VCCA 4IHJA 1XXNA 2BGCA 1Z5VA 4EB6B 1CWPA 1IZ3A 1FYJA 4BISA 5JCTA 2R061 1AILA 3V64A 5K4LA 2Q7HA 3RVYA 3S3WA 4LOTA 3M2MA 3MAQA 1OKQA 3DV8A 3ZOIA 4ASMB 4EV0A 3BUCA 1OQEA 5I8YA 4GCZA 3HR0A 3F7VC 1DQ1A 1H0BA 5A6YA 2D3RA 3CL1A 2EZPA 1W9YA 3PUAA 3TOJA 4XZPA 3IMNA 5JOYA 3SKVA 1BQZA 3P5BA 4I3PA 4AOCA 3F5TA 4ZI7B 1S5LZ 2RDRA 2HWF2 3G6EV 2WLQA 4FCAA 1FPOA 1I9RA 1M9NA 5I8TA 2WUHA 1UFIA 4AHWA 2RS32 1V9U1 1WBFA 1D4M1 5CA1A 4LFAO 2VNGA 1UZWA 3ZRXA 2Q5ZA 1UOJA 4DV1B 1DDLA 2EIJC 4AILC 3FYEB 4FFKA 4DY5A 2DU0A 2KXLA 2HWC2 1CAUB 1JYXA 3ZHRA 3OR7C 3FKSG 1SZBA 4ORFA 1CPNA 1V9PA 2BYVE 2ZGNA 3ZPYA 2YROA 3V56A 1KITA 1FAYA 4P9JA 4B3MB 1F8VA 5LMNO 5J96B 4RHV2 2OTJV 2Y60A 3K3OA 5ACA3 5E79Z 1OCZB 2LFRA 5FZ7A 3RYPA 2RJ2A 4LR4A 1NT0A 1US6A 1W6NB 3HQXA 1K5MB 1VALA 4N43A 4XFIA 4WFAV 1RMU3 4IV3B 1JW6A 2E33A 2F17A 2VBPA 4DEVA 5DABA 3PIGA 5FZHA 1Q56A 1PIV1 2BBVA 4DV5O 3LSSA 4G9SB 2V73A 5FWEA 2FDGA 2QCSB 4XJ8A 4RSUA 2Q68A 2BE3A 2WNEA 5A3OA 2XBO3 5FNVB 2UXDB 3J8F1 3JXSA 2B5UA 2HHHB 3MF9A 3BRCA 3RSJA 4RYDA 2M7WA 2AGSA 4O2AB 3ASIA 3JCUZ 4LO4B 5BUVA 5IT6A 3ZX7A 3HEIA 4LFAB 1C1LA 5KHIA 5CFDC 1QR8A 3IJ4A 3WF3A 3AZXA 3T2QA 4TV8B 2PXJA 4O4HB 2YIDA 3ZEDA 2QM8A 4Z8BA 2GU9A 4WVZA 4TLFA 1NA1B 2AEZA 1PMHX 1DBNA 4TOIA 3J81N 3ZHTA 3BTYA 3UT0A 2WLKA 4MGZE 1OCRB 3ZRWB 3DPRA 4L87A 3FB8C 3A8TA 1OMIA 1S0DA 4H7LA 4OHWA 1IPSA 2M6YA 4BA6A 2GC1A 5JQGB 1NBMG 2DCYA 4IIJA 1PPJH 3HKCB 4LNUB 2CU5A 2W1UA 3OEEG 1PK6B 3P1IA 5EIBC 3CC4V 4A2UA 3GM8A 4Y26A 2D3SA 2CGPA 3DC6A 1MZ6A 4DK1A 1V6KA 2EXHA 2HEVF 1MZEA 1ZA7A 4CA9A 2AXTZ 2PQQA 1O9GA 4O2BA 3V0AA 4QPYA 4CEYA 1XBLA 3SYOA 4AGRA 1UY0A 5HBAA 4HN0A 2NMOA 2OT7A 3KV4A 4CS2A 1CIWA 2JIGA 3N9PA 3R4SA 3MIHA 4XBNA 4AG4A 1SZXA 5IT9N 3RPQA 2ZEZA 2ZACA 2DMXA 3K5OA 2JDAA 2RMU2 4YW3A 2FDKA 1V9U3 1YJNV 1D4M3 4JAAA 4JYBA 4QM9A 3RMXA 4DRVA 5B1BC 2EINB 3VBUB 2F4PA 5GLUA 2W52A 4WFHA 1GAXA 2QE3A 4NWVA 4JC1A 2B1IA 2VQFO 4LF6B 1YSCA 4PI0A 3W21A 1WWYA 2X6BA 1SQVH 1C5HA 5LBCA 2ZMLA 3C7FA 3PTYA 3TK1A 4A3ZA 2JJ2G 1DGRA 1RUJ2 5F32A 1CVNA 4COZA 1BQ0A 4C0BA 4X62O 3OM3B 1LECA 1UY3A 4OZOA 2ZE5A 2EXJA 1EZVH 4IV1C 1CX4A 4J10A 1ZBA1 2YXSA 1FV2A 2JIZG 4LO6B 4OULA 4FPYA 2SBAA 3O14A 4CPBD 1HXS3 4P9IA 3M3CA 4CCNA 5FOBB 4XFHA 3CCSV 1COV2 2JB4A 2CTPA 1J84A 2PHXA 5A7WA 3EJKA 3VL9A 1PO11 2VMCA 4OX9B 2YPDA 2JDHA 1AB3A 2RDSA 1K5QA 4B4QA 5L9VA 1BEV3 1HJFA 5HXMA 4F6RB 4X20B 2CAUA 5A7NA 4XF1A 3D0SA 3J8F3 2V72A 2MEV2 1H4GA 1MEC2 1MR5A 5DAXA 4LFBO 1WPBA 5C5UA 5A70A 1OCCC 1ZZ9A 4Y1ZA 3WV6A 2BTQB 2ENRA 4UFLA 1UYZA 4BQ2A 2IZWA 3M7AA 4CCJA 4EB6A 3E6DA 4NTXA 1V55C 5GZGA 3NAPC 4LXLA 3GZEA 1WW4A 3OAAG 5ABJB 5LA0A 2PELA 4KG8A 4YVWA 3VHPA 5DM6V 1RUNA 1Q5OA 2WO2A 3CNAA 3SMHA 4DB5A 3THCA 4HVOA 2BEOA 2C9KA 3AKSA 2E63A 1O9HA 4DUWA 1YEWA 3LA7A 5JMCA 2D93A 5DN2A 3MEPA 2WLHA 1IHMA 1S4CA 2ET1A 4X1YB 1OVPA 4A4AA 3G4SV 5C33A 2A70A 4IQPA 1XL4A 4XETA 5FYIA 5KAFZ 4ITCA 2HEPA 1PM9A 2WSUA 4BYYA 4DW0A 1U5IA 2RQ6A 1D5NA 1N1YA 2BDRA 3WP3A 1HNZO 1SKVA 3WP6A 3IPVA 3N7MA 2GC0A 3MLLA 5T5PA 5A33B 3RZGA 3GZTB 3VBFB 4LPLA 3X29B 1I08A 4XTPA 3ABLB 4FO9A 2PAEA 4JHTA 2Q69A 1V6LA 5J37A 1XNKA 2ZDIA 2HBTA 1ND3C 4P02B 1JZ6A 1CAUA 4UXAA 1ZZCA 2VZPA 2A9HA 2E76B 2XKPA 1CP9A 3ZFFB 1HW5A 3M3OA 2R32A 1R3KC 3D3AA 3RZKA 3ZXGA 5C5TA 2QNKA 2O1QA 4XACA 3WQBA 4L8JA 2E75B 3H9AA 2ZMNA 4W6XA 5LA2A 2XJUA 4F7ZA 1CPYA 3VBHB 1UF2C 1AI4A 2WAMA 2JDMA 4CCMA 1CJPA 3HR9A 3MD0A 2KA3A 2UYBA 1YFXA 2Y0PA 1YFYA 4EWAA 4L8QA 2DCZA 4IV3A 3HT1A 4JGZA 1N1VA 2X6AA 4B3SO 2R9RB 5LY1A 1QJZA 5FMCA 1IXMA 2YXHA 2H0BA 2ITDC 1JMUB 1F4HA 2H3OA 5EZYB 3WDWA 4J1XA 4WF9V 2W47A 5B4NA 2WO7A 3UKMA 2AR6A 1PO13 3JBG1 5BNQA 3VD4A 4AI9A 2RN9A 4IL6Z 1LEMA 3CDZB 4CUBA 4Q1RA 4DUVA 4RUFA 4FXGB 3CJIC 4ZIBA 1APNA 3ABTA 1W2AX 2ATKC 4LIVA 5FYHA 4O4HA 4Z82A 4WM8C 5FZOB 2EIGA 1OH3A 3O1VA 1PKXA 5KC6A 2CK3G 3HQRA 2GN7A 4DV3O 4K1YA 3OY8B 3K06A 3ZRWA 2ZGRA 1YYNA 3DYMA 1V54C 4F4LA 3A0BZ 2B4KA 1SCRA 5F1RA 3GDBA 3ZFEB 1VMJA 1AHSA 1PL4A 5B2GB 1TUEB 4JZ2A 1YITV 1WZXA 2P5BA 3ABUA 4OYUA 4LNUA 1ODMA 1IDSA 4OUEA 3VBRA 3I59B 3TBDA 4YJ3A 4JRAA 1J5EO 3ES4A 2BJSA 4UF0B 2PLV3 1AP6A 4JKMA 4CUCA 1OFNA 3OTFA 2Q4SA 2ARBA 3MO4A 1MS1A 4DXWA 4KU7A 4JI4B 2CDYA 5IUQA 5JXIA 2J42A 4AFAA 4J80A 2XVGA 4AK3A 1AUYA 4PIZA 3O0XA 2B8MA 1IS6A 2PI5A 3BOPA 3LD8A 4FFBA 1OVSA 1H8TC 3LZZA 3OPZA 3WXPA 2IJJA 1RUC2 4DK0A 4FJCC 2XOMA 1M93A 1HQWA 2R30A 5FLHA 3DECA 2VC9A 2BRTA 3DN7A 1AR82 4KHPB 3E89A 4OMDA 5APAA 4X1IB 1ZLZA 1W9SA 4TT3G 2QJVA 3RVHA 3LGRA 3UKVA 3WVJA 4Z2WA 1WLWA 5KHKA 3EXAA 3USUB 4R9AA 3MBWA 5IW0A 1KJRA 1RGSA 4YXWG 3O1SA 4XCBA 5KUMA 2FDJA 1CR7A 3J7LA 5GONB 1BVVA 1ZREA 2OIEA 1Q8QA 2RNBA 4BOWA 3A0RA 3W7WA 2AYHA 1ACCA 2DWEC 2IVJA 1EYBA 3INAA 5LCWL 4BH9A 1MS3A 1U96A 1GR3A 5DZEA 1GWKA 1VBD1 4JDMA 2ZINA 4LLFA 4COYA 2KSDA 1G8WA 3SH4A 4HL0A 3WNXA 2OXBA 1JS9A 2ZGUA 5F5AA 4ZS3A 4JTDB 4L2NA 5D2AA 4PV1B 4GWIA 3BY6A 1YFWA 1MZ5A 1J58A 4AEDB 1SDDB 4HT1T 3SYPA 2ZNJA 3NNFA 1Q90D 1FNYA 4UUJC 1MPXA 4NWWA 1FATA 4CDXC 3JBG3 2EJ7A 1E5IA 2WS92 2W87A 4QIWF 3UM7A 1IKPA 3T1HO 4FT8A 4QPIC 1FYUA 3ZMSA 5DZFA 3FLTA 1AYN1 1XU1A 3AG4C 3VDAA 5JUVA 2QGNA 4YW6A 3KCYA 4MW3A 3U07A 5KHGA 4BW5A 2IXHA 5ABJA 3IDCB 4ATEA 5CN0A 1X7NA 1O4TA 3J7AU 4R4XA 2VUCA 4S2HA 1EFRG 3WG7C 1EV12 3KM5A 1N3PA 2IWGB 3FN9A 1CZVA 1OOPA 3CEWA 4BW9A 2OYZA 2DVFA 1UZVA 3SYAA 5JVDB 1Y9MA 3CLPA 5KX5B 2PTMA 2V5YA 1VQ6V 3E83A 3DUIA 1ULCA 2ZEWA 5LMUB 2ZX4A 5FY1A 1WPXA 2RM22 1AR92 4IEUA 3VB9A 3L75H 4NOTA 5K8SA 1K5SA 2DFCA 2XLGA 5KA6A 1YQ5A 2ZTNA 2R062 1GK9A 5A33A 3VBFA 4ZPIA 3VKFC 5FYUA 1ZRFA 3E8BA 4QX1A 1IG3A 5BZBA 3EYPA 4X88A 5AFBA 1S77D 4MXWB 3ZFFA 3FWEA 3HNBM 3TETA 4NO4A 5F9TA 3KHCA 2GNBA 5J09A 4M4PA 3CEIA 4XBFA 4R9CA 5GLZA 5FZKA 3MIBA 3B8NA 1NLQA 1C28A 4HXCA 3MHHC 5FYSA 4N53B 1SF9A 3MFAA 4X66O 1H8VA 2Q4PA 1VARA 3K03A 2EIBA 2Z5WA 3ASOB 1WMXA 4DR4O 4LF5O 5F39A 3LUTB 1MMMA 5J9PC 3CC2V 5FBJA 5LP6A 4B29A 4XABA 1OF4A 5EIYB 2VW0A 1GOFA 5CNAA 4NVPA 5C9AC 3O12A 2K1EA 3UKTA 3FBMA 1VBD3 3H1WA 2DQ0A 3PUHA 1VRH2 3AMHA 3H8XA 3CC7V 2A6WA 3RWKX 1S1AA 5EZYA 5FQ0B 4UVCA 4H55A 1W8ZA 1FXHA 5F6KA 3BA8A 4J7KA 2WSVA 4M0NA 1BLZA 4GX5A 4MVMA 4ABMA 4D6QA 1XOUA 4RA0A 2FMYA 2AHYA 3MDSA 4UFIA 3NV2A 1DF5A 2G38A 2VUAA 5LXTA 4RQPB 3ALQA 4IERA 4EJRA 4O61A 1HB4A 1FPN2 3OEBA 1J1TA 1Y4WA 2CTWA 5L3EA 1PIV2 3F7YC 3ZYGA 5FZ1A 4R4ZA 3OY8A 5GLWA 3BU7A 1PMIA 4JPRA 5FXWA 5JDBA 1S2EA 4OHZA 3WCRA 1AYN3 1NTMH 2VUDA 1REFA 1LR1A 1N4CA 1RUI2 3CCUV 4QMAA 1BT8A 1PMJX 5IVFA 4Y1VA 3L74H 1I5ZA 5A7OA 1MA1A 1UIKA 4UF0A 3ZSMA 5CFCC 2A3QA 4DR4B 3KQ4B 2VQEO 3T08A 3ABMC 3KQRA 3AJZA 4NHKA 2XT9A 3I49A 1BMV1 1LRHA 4C7UA 4HN1A 5DAQA 1O3SA 1DFQA 1AF9A 4DXSA 5B1NA 4P9YA 3CMEV 4FPCA 1AX1A 2ZGKA 3GALA 4XC9A 3FB6C 4FAGA 2P5OA 3MW4A 3SISA 5FZMA 3OFNG 1W99A 4YVSB 4CCLA 1T6BX 4DV2O 4IXLA 4NXNO 4DO0A 3RYIB 2R49A 3USSA 4GKKO 4I9WA 5F37A 5EJZB 4O4JB 1W9FA 1UWWA 5B5EZ 3MUZ1 3BKZA 1XNTA 2ZAAA 4Y4YA 3QBQA 4AQSA 1UNBA 1R1BA 1VBB1 3LFIA 1XE7A 1KC8W 1OA3A 4MO3M 5IJRA 2QM7A 4LP8A 2DFBA 3V0BB 3HIFA 5GONA 2ET7A 5IDJA 5F3GA 5CIRA 3NKGA 3K08A 2UURA 3KD4A 3ZKYA 2VW2A 5JZGC 4CXWA 4LIUA 2HLEA 4I0BA 3HB3B 1S76D 1N34O 1AXYA 2QSAA 5FZIA 2IJKA 3ZKUA 1ULOA 3AFGA 5A3NA 3U10A 4J25A 3FLRA 4C90A 1SERA 1BZWA 3KVBA 3WDUA 1HB1A 2JIJA 4K40A 4DXTA 3RYHB 1KQSU 1KQRA 3PU3A 3B9IA 4I4TA 5JSOA 5CBFA 1TNRA 1SDWA 4W4LA 4DV4O 1R083 1XILA 4B3RO 5CAZA 1HN0A 4JI5B 2BSKB 1ZBA2 4LOSA 5FZLA 2WFF1 4JI0B 4MGYE 4Y22B 4EWEA 4D6TH 3OBTA 5HV4A 4G28B 2OWOA 1BJQA 2QE7G 4R9DA 1H8HG 2BQPA 1HNXB 5BY5A 5A6XA 4ZKIA 4WCEV 4WVMA 1RUH2 3SCGA 3OUSA 5CG8A 4P9PA 2VZ1A 4KQ7A 1HQLA 3WFVA 4JI6B 3MIGA 2Q8EA 1SBEA 4ZXEA 4EN6B 3WCSA 5JVDA 1F4NA 1QOTA 3AG3C 4J41A 4PHZA 5KX5A 4E4DX 1FMD3 3J4UH 4Q6GA 2LUWA 2OVUA 5A80A 1Q8IA 1LR5A 1GOHA 3QD6A 2OPWA 5E1RA 1PX4A 5BR8O 3LAGA 3O9OA 2YICA 5L7OB 3GWKC 3E6BA 2ITCC 3O65A 4UVBA 1X8MA 1TMF1 2HEWF 2YBPA 5FLJA 3CJHA 1J3QA 3G6JB 1VF6A 2ZMKA 3U14A 1QJU1 4Q5OA 1R1ZA 1YQ6A 4MX3A 1JZ4A 4DV4B 3T0AA 5EC2C 4MGSA 4PDWB 2ARXA 3WEZA 4QPGC 4A6SA 4LMFA 3BABA 2HKOA 2CH7A 2P2KA 4E2LA 1IBLO 2ZGQA 4D6RA 2VMIA 1JYIA 3EHKA 4MVOA 4JKKA 2VVEA 1SA0B 3CRAA 4A7KA 4PJYA 4XFAA 3MLKA 2RDQA 2CUGA 2ZE8A 3MICA 5K0UC 2VRZA 4M4RA 1GV9A 4N53A 1JZ8A 1RITA 4F3JA 3K3WA 1SETA 3GB7C 4JHZA 3L2YA 3U78A 5KMGB 2YBKA 3WG3A 1LHVA 2LFSA 1CIYA 1DZRA 5FXXA 4PA4A 3VOUA 3B69A 4PDRA 3VDDC 2Z3YA 2OUHA 1MQTB 4TUYA 3AJYA 1N0NA 3MUY1 3IM0A 1JU4A 3UT5A 3T4VA 5DAPA 5BPXA 3ZIWA 1F5JA 5FQ0A 3VBSC 4TLGA 1AI5A 2A6XA 3ZXEA 3QCWA 2DYSC 1KP3A 1K9MW 4B7KA 1Y74B 4QXHA 2ZE6A 1B06A 1NH2B 5HFMA 4XYXA 1Y7BA 4OPHA 4I9QA 1N32O 3KS7A 2OIIA 3RYFB 2UUBO 1QJY3 3OG2A 1NZIA 2I45A 3A0KA 2DDUA 2RS53 4RQPA 5FP8A 1YUDA 3NQHA 4HSJA 3FAVB 3S7IA 3JASB 5GALA 1KU9A 3L9JT 1IBLB 1I94B 4I0XB 2WQ4A 4OI0A 1MS4A 4A3XA 1RUG2 3DF0A 4XFFA 5CZKA 1RM1B 4IEOA 1QH7A 2ORXA 3A21A 3P6BA 4ES9A 4FM1A 1YQ8A 4B8EA 1W2TA 2WNUB 1FOD1 3AB0A 2YC2A 3I2JA 1L3JA 1O8SA 2H94A 1TME3 3ZSKA 5IK5A 1W6MB 3STZC 1XMOB 2YIAA 2H6CA 2R043 2LM3A 3HKEB 2PUSA 1OBNA 4JYYA 5D8AB 5FP9A 3T2PA 4F83A 2XTAA 2ZM6O 1RTVA 2WLLB 2ADPA 5I0SA 4NPLA 3RGBA 1OCOB 1M4WA 4DR7O 1RUE1 3M3EA 3SHRA 1SQQH 3WB2A 3DEMA 4DR1O 3H8UA 1B35B 4CDWB 2VTXA 1VQ9V 5L3BA 5JXHA 3HKBB 1SESA 1TMF3 4I50B 5FOJB 5GLTA 5EC1C 1K45A 2JE9A 1ZRCA 2QQIA 2OT5A 2XR4A 2R9AA 3VQYA 4DNYA 4BMEA 3M3QA 4L0PA 3POYA 1GOGA 1MS8A 3LDBA 4MGIE 2ZIOA 1GNZA 3JALA 4ATFA 3C2UA 4MXVA 4AQTA 2QFEA 4YW4A 2UXXA 3LCPA 3I5DA 2Y69B 1PO21 2IXJA 3RYKA 4I55B 4G4FA 4GH4A 1VPHA 3AG2C 2LGQA 1QJEA 5C7GA 2D5HA 4QPKA 3LPGA 4WM7B 3MLJA 2F4VO 3D36A 1GMMA 4YZ1A 2C2AA 1UZYA 3SPGA 3H1MA 4AVAA 2JEUA 3CQOA 4Q8LA 1ZSPA 5D21A 1UCXA 2UXCO 3E5QA 4UT5A 5FR3A 2IU3A 1J3PA 1XC6A 3VZJA 2WO3A 2Z2SB 4DR2O 5FV3A 2AC1A 2QTOA 2OCCB 4FOYA 2RDCA 4RO2A 2J1UA 5FYZA 3UQ8A 4PIXA 1QNWA 3KT4A 1F51A 2VTFA 1MZFA 4IGOA 3VGIA 4C0HA 2NN4A 2XQRA 2P06A 1DHKB 1H6XA 4MVQA 3KGZA 4HNAA 2F93B 1BMFG 1VF7A 1QQP3 4CUAA 1HKDA 2J1AA 1B6QA 4DR1B 1KXGA 1G9DA 3G80A 3BTZA 4CPBA 1WMFA 3K5LA 5EP9A 1POQA 3K79A 2BSKA 1V6JA 2P17A 5FO7B 4QGPA 4I0WB 5KC5A 5GLVA 1GNHA 5FZCA 1JJ2U 3JD3A 1L8DA 3NR7A 2J1VA 4RS5C 1D0HA 4JTNA 1C5IA 3ZYIB 1YTFD 3DSQA 4X65B 2PHTA 1BXHA 5EYPB 1F15A 1GN4A 3O7OA 1AX0A 2IXKA 4UOJA 4BLIA 2WJSA 1ND2B 1F35A 5LA9A 4XDLA 4FMTA 5CYYA 4D7TA 4AI8A 1GICA 1SQXH 2A71A 2VZOA 1XNQB 3I3MA 1WW7A 4CP1A 1FOD3 5J98B 1RUF3 2VOVA 1JBCA 1W04A 2D7FA 1Y43B 1VR3A 4HKLA 3WNOA 2VU9A 4BIFA 3WLUA 2CTVA 5L9BA 4YFZA 1FJGB 2HJIA 4Q0SA 3FHAA 1KGYA 3CRCA 3C3SA 1VQNV 5C4WC 1QJX3 3L73H 1NY71 4U7NA 4HYOA 1HLCA 1NKGA 2UXNA 3W20A 3KT1A 3UCSC 5A6ZA 3HN3A 4NTWA 2XJTA 1A78A 4KMQA 1VQOV 1S0FA 4H44B 2GSYA 4PDWA 4MTXA 1LHOA 2IM9A 1ULFA 1JFFB 1AVMA 2ZZJA 4CEYC 1UJWB 2VPVA 3CRMA 3H1KH 3F5WC 4MHRA 5LBEA 3S57A 1UZ0A 2DU1A 4LTAA 2E5LB 1PO23 1R092 1TUBB 2VD7A 2EIJB 3ZXLA 4I0AA 1UQXA 2CY6A 2VCMA 1JOJA 3MGUA 1GZWA 1W6PB 3IT8A 5KMGA 4EE2A 1TZOA 1JODA 4JQTA 3GBFA 2XJRA 2VAUA 5FPUA 4LR3A 5IK7A 1C8M1 1OD5A 4XF4A 3ZMUA 4HG6B 1WCKA 2C26A 2HP8A 3HD8B 3U75A 1DK1A 2VULA 2VZ3A 1MVEA 1A8DA 4RHV1 5AVPA 1HB2A 1LHUA 4UI9L 1JH5A 1IPJA 3FL7A 2WL1A 1ZZBA 4BB3A 4JI1B 3W5MA 4NPMA 3SKJE 1QQCA 5KLVH 1ULDA 2AREA 3NJYA 2O14A 2YB7A 1ZM1A 2JDNA 2YS8A 1CZTA 2X0LA 1LOAA 1F5FA 4FBFA 3RYFA 5LHGA 3G6BA 3STLC 4QNHB 4FLTA 4NRPA 4S2DA 2C0ZA 5DUWA 3FAVA 1L7LA 3JASA 4QXCA 3H1HH 1JZ3A 5T54A 5FYBA 2ZGOA 3AXDA 3K77A 3QACA 1OH4A 4NRMA 3AP7A 4I0XA 2YUEA 1MS9A 3U37A 1QBZA 2KG7B 1R3JC 2C4XA 3E5XA 5FCCA 1AR4A 2Q73A 3M4FA 2WNUA 3LA2A 2UXBO 5CFDB 1IVSA 1S2KA 2Q7EA 1O3RA 4U2AA 1W6MA 4BQ4A 3KF5A 4B1LA 4LHSA 5FUPA 3JZVA 1YDXA 5D8AA 1UYXA 4EQVA 5A6QA 2VZSA 2JG9C 4AFCA 4YZ4A 2CHHA 4AWDA 1JOBA 4QPWA 4LFCB 4YVWC 5CB4A 3ZXAC 1RPOA 4GA9A 1QHDA 4HZ3A 3W7TA 1GP6A 3UETA 1Y4MA 2QQLA 2FCUA 1B3QA 4GLXA 2LP7A 1B35A 4CDWA 2OQ7A 2JD9A 3B94A 4HANA 2A3WA 3HKBA 4PF1A 5LA1A 4UV8A 1W6OB 4FOVA 2V7QG 4I50A 1OUSA 5JH7B 2QQWA 2DWDC 3FLPA 2XPJA 4AFDA 4Q20A 3R05A 4HPKA 2P37A 2A7WA 1WLEA 2Y0OA 3W7SA 5C70A 5FYMA 1H2NA 1K97A 4SBVA 5GTHZ 1BMV2 3LF7A 1ZYBA 5AC91 2B9VA 2A5ZA 1WA8B 2HWF3 1KD7A 4OLLA 3SJQC 4JV4A 4CCOA 3POGA 3FHIB 4W50A 1TE1B 4TN7A 2PYLA 1NLSA 2ZDIC 2RS33 4GMP0 5IWAO 2RMU1 3I56V 2RS11 3QTCA 2ARCA 5FP4A 5LASA 5B1BB 3OW2U 5LBFA 1YI9A 1S5JA 1B04A 3SCHA 3LNMB 2HWC3 4TZDA 2D3PA 5K9YA 1UD1A 5FZ9A 3UJOA 4AEMA 4E2SA 1RUJ1 2BOCC 4BQ5A 1ZL8B 4UCUA 1OLME 1VBB2 4G27B 5F6LB 1A3KA 3U11A 5IVCA 1Z7S1 4PI2A 1UZZA 2JGDB 2A3YA 4D6SA 4DOUA 2YUAA 2BERA 4A45A 5FZ6A 5IWFA 4RHV3 3B00A 2JEXA 1YI7A 3I54A 4BZ4A 4IE6A 3LEIA 2AZ5A 2UWBA 2HJFC 5IK4A 4JGZC 5FUNA 4XDOA 3T30A 5BNOC 2IW5A 4PLMA 4DUZB 3AKQA 3ECQA 4FP3A 5C3RA 3N2KA 1UOGA 3N3HA 2QDOA 1EN4A 3AKRA 4FFHA 1SQPH 2BNNA 4D7YA 3RVZA 3JD72 2CTRA 2R7EB 2VOKA 5IHRA 1GZCA 3N27A 3M3IA 3HT2A 2DBNA 2E6VA 2NM1A 4PT6A 3PIJA 4NPRA 1UU4A 2OUJA 1YRZA 3FB5C 5A7PA 5ANNA 1KJLA 3VV1A 5GZEA 5EYPA 5LY2A 1XB9A 3L71H 1UX7A 1UYYA 3ACLA 1ND2A 4HONA 4M0HA 1N1TA 5DN6G 1J83A 1UMIA 4MSVA 4LKSA 1MEC1 1ZZ6A 1YXBA 1LB2A 1S0IA 3X2QB 3LEGA 3WW2A 1FXZA 1OCCB 3SPCA 1EY2A 2ETEA 3KVAA 1BCXA 4IEVA 4XEZA 4LKDA 2WFF2 4J6GA 4PA3A 2I74A 1V55B 2WYSA 4CC5A 4FTBA 3AMMA 2SLIA 4HKWA 5LYJB 3ZCCA 3ME2A 3F95A 1CD3G 4CU6A 5L9RA 3KZIZ 4YJ2B 2PGGA 1SQFA 4U3JB 3MIDA 3OGIB 5IK8A 2CAVA 2FTKA 5C8CC 5GZDA 1LJ7A 4FSJA 4DV6O 4NIIA 1VJ2A 2Q8DA 2BOBC 3ILRA 3VBRC 4AGVA 5F5IA 2D40A 1DGWA 2DYCA 1HNWB 1RUD1 4ASUG 4WFBV 4MVZA 1O5LA 2E9QA 4RQFA 4EZHA 4UB8Z 1JFFA 4NHMA 1S72V 2PF4E 2VMGA 5BNNC 4BAYA 3GVMA 2IH1C 1AJPA 1NAEA 2N74A 5LZ6A 2D43A 4MVUA 5FZ4A 2W5FA 3KB5A 5IYDO 1AR61 1X50A 4GUNA 1W39A 2YDEA 3OGVA 5BXZA 1VP6A 2R1BA 4TSVA 5J48A 3B8MA 4GWNA 1ND3B 1US2A 5LOVB 2QWRB 3V65A 1QJU2 5EBMC 3TNPB 1ENVA 4X8PA 3S5AA 1VMGA 1EN5A 2E31A 3AZZA 2RMU3 1UXZA 1YCIA 2BU9A 1IS4A 2A3XA 5IYCO 5IATA 5CU1A 2ZEYA 4COUA 4LITA 1O4ZA 1W05A 1SFNA 3N7JA 5GW7A 1RUJ3 5JXGA 3JAWB 5FY5A 4U3FH 1W8OA 1UX6A 4LBQD 2X09A 4DV6B 1N0JA 4PA7A 2YFUA 2ZCWA 1WCSA 1LOGA 2YY1A 3CCVV 4XILA 5E16A 1W6QB 2L9LA 4YZ5A 4BQXA 3LE0A 1I6XA 1O3TA 2ZGPA 2XKOA 3GJBA 1FFXB 1D2QA 2W94A 4C8DA 2QQVA 4YW1A 1XMQO 1OLRA 1COV3 3O0WA 4NAOA 1XE8A 4HSLA 2KG7A 2A1XA 2WLJA 1LOBA 1K8AW 1AYM2 2Z4FA 2IXIA 1GQHA 3DYOA 5FWJA 3CJIB 5CFDA 4BWOA 3GF6A 3NV1A 1KEXA 4B7EA 5LBBA 3JYCA 4YNIA 4UV9A 3DXTA 4AI0A 2MEV3 2EF6A 2YHJA 4JYCA 4WM8B 1MEC3 3E2EA 1MSDA 2QKAA 1JI6A 2VZQA 3VZLA 1XHZA 3HMYA 1V54B 2P4VA 5FYYA 3H3ZA 1WB8A 3TEXA 3BCCH 1IBMO 1XYNA 1RPRA 1CONA 3D5OA 5SV5A 3AK1A 3P30A 1VBE1 1IS5A 1OOPC 3MW2A 1ZZ8A 4QB2A 4Q4W2 4X1KB 1ZZ7A 2UU9O 5JH7A 5LW9A 4LK6A 1S0GA 2VH9A 3OMNB 2X53S 4WBNB 3WSOA 4P2ZA 5T5OA 2YBSA 3AL6A 1SBDA 2P90A 3VHOA 3LKJA 1QDOA 3MDPA 4OPAA 3AG1C 1H8TB 5LEKA 4JYAO 1FI2A 4P30A 1F4AA 2DTWA 3GYDA 2QWQB 1RHI2 3VBFC 1WA8A 4I7ZB 2W08A 1RUE2 1PX3A 2YYOA 2JRIA 2WIIB 1YJKA 1JPXA 5JCOC 1AR81 2YXLA 3DTUB 2RMKB 5EQUA 1NJIW 2BTVC 2HBUA 4Q0VA 2F6BA 4OHVA 1WAZA 4MVSA 1NCRA 5F7UA 1WA4A 1NYWA 3OF1A 4R8CA 4CP9B 3T2MA 3WDVA 2KD7A 1ZL8A 5JXJA 4P5HA 3G67A 3WQ0A 1DG6A 4JTCB 2JGDA 1QGLA 4HFSA 1G6UA 4CSWA 4LF4O 1UPGA 2LGWA 1QLNA 2OKXA 4EWDA 4GD4A 1DQ4A 3I3EA 4OI2A 4FFGA 2IUWA 5LP6C 2VZUA 2L6LA 1XPWA 1BL8A 1S0CA 1J59A 1HR0O 4YZ2A 2OA2A 1WMEA 1YFUA 4XMAA 2EBOA 5C8YB 2NN8A 1W8UA 4IGQA 4QD2A 4FFIA 4Y1YA 2WLIB 3CHXA 2ZIMA 1Y66A 4R8HA 1VBA2 3ZMZA 3ZYPA 5JPNB 1AXKA 2DYRB 4KFMA 4JYAB 3RBZA 1SEFA 4AQYB 3POIA 5A2QN 2JDIG 3QH6A 1MACA 4MVRA 1AR72 3FB7C 2MW2B 4HLTA 1Q8OA 2WS91 1V6MA 4B4PA 2XL7A 4IUGA 1WBLA 4DR6B 4P9GA 3BCWA 4QPIB 2UUAB 1OURA 4AVSA 3AG4B 5IY5C 2PQSA 1YTFB 5JMOA 4OVEA 3U0ZA 1NUKA 4B3TB 3CPWU 1VAKA 1G4YB 4BCUA 1V70A 1Y9GA 5FY4A 4FQ4A 4CCEA 2ZR3A 4YJ2A 4E8DA 2O8OA 4FPLA 4ZOLB 4D94A 3HJRA 3WG7B 1D2DA 4AZZA 3FX3A 3IDBB 1EV11 1BQPA 1G86A 3P32A 3DYPA 2HG5C 1RSOB 1YJWV 3K04A 4PLNA 3NO8A 1K42A 2X5IC 2Q0AA 3URFA 5DDJ1 3OGRA 4HBNA 4MOAA 4PLOA 1AR91 4CU9A 4KWJA 3KCCA 2DF7A 1BHAA 2GP3A 5LK5A 1UN1A 2RJLA 3NV3A 2Q30A 5EHDA 3H8OA 4CDUB 1U97A 4NR1A 3CCMV 5TISZ 1M90W 3EQEA 4DQAA 1SLBA 3C8XA
chains in the Genus database with same CATH topology
2G9GA 1NY72 2UU8A 4Y1VA 1ASJ1 1J3RA 1LOEA 1I5ZA 3N6WA 1QJY2 1RUC3 5I0TA 1UU6A 2HWB2 2IFRA 2JG8B 2RS52 2A6VA 4AI3A 1UIKA 2WZR1 2Z79A 4YM3A 4O9EA 3ZSMA 2X8KA 5CFCC 2R0FA 5BNOA 4O9GA 1AR83 5D1IA 3KQRA 2D98A 3AJZA 4KGGA 4NHKA 4ZU4A 4GIQA 4D3WA 5FRAA 5HCAA 1BMV1 1LRHA 4CDQB 4HN1A 1O3SA 1DFQA 1AF9A 3GZAA 4P9YA 1RUOA 2KM2A 3EBRA 4FPCA 1AX1A 2ZGKA 3GALA 4X6RB 1NXMA 1VBA1 1GQWA 5F5QA 5E89A 3FE5A 4LA2A 2PHDA 1YXWA 1R1A2 4FAGA 2WLPA 2G9FA 3MW4A 3N35A 1EPWA 1TME2 2WNVC 4S2FA 1QWRA 3SISA 5GZCA 3PLQA 3WG2A 3WP5A 1J1LA 4Z1VA 1PVC1 3B93A 1NQJA 5C6CA 1WW5A 4YVSB 1JUIA 4E27A 2R042 4IXLA 2R1DA 4FTSA 1SACA 1U5YA 1AR71 2R49A 4ISQA 4JVAA 4PBOA 4C1XA 3USSA 5J36A 1VLNA 1FT9A 2EAAA 1AYM3 2ZGTA 2VW1A 3TWIA 4XQDA 3WDYA 3K51A 4N43C 2ZAHA 1MS5A 1ZRDA 5C9AB 5CFCA 5EYYA 2ZAAA 4Y22A 4Y4YA 4E4ZA 3QBQA 4NHLA 4AQSA 1IGOA 3R4DB 2EXIA 5FDBA 1VBB1 5FO9B 1XE7A 4HZFA 1VRH1 4DS0A 1OA3A 3OYWB 1QXPA 5L7OC 2P3KA 2BFUL 3AMNA 1C8M2 2EAKA 4LA3A 1TMF2 2DFBA 5A3LA 3V0BB 4AFMA 2JKBA 3HIFA 4LNVA 4MGKE 4ZU5A 2ET7A 1PM7A 3LOBA 1CN1A 5CIRA 3NKGA 5C8CA 2ZA9A 2Y38A 2UURA 3KD4A 1AL23 2WNVA 4WZCA 2XHKA 2O0OA 4CP2A 1XNDA 5BNPC 2D6PA 3RG0A 2VW2A 4XXPA 5JZGC 3VZNA 3DL3A 3CJIA 2X5IB 4K1ZA 5EYXA 3SH3A 4I0BA 4PDWC 1N3QA 2VOWA 4J5IA 1AXYA 1XQNA 4Q4W3 1UMZA 3AFGA 2TUNA 2WWSA 3U10A 1VZ5A 4YM1A 2YMZA 5BNNA 4X6QB 5LEJA 2WS93 3FLRA 1ULEA 5CB7A 4C90A 4EN9B 4M3CE 1FPN1 1BZWA 4AFBA 2XVKA 5E88A 3WDUA 1WW6A 4OUSA 2FZ2A 4QGNA 2JX9A 3PVOA 4YARA 3DPRC 2VECA 3PMEA 3S7EA 4K40A 1YNAA 1O3QA 4Q0UA 5L7OA 1DQ5A 1KQRA 4AW7A 3CF6E 3B9IA 4QU2A 3OGGA 1RUI1 1GBGA 3E97A 5JSOA 2Y0IA 4H3WA 2YGLA 1TNRA 1SDWA 3JQXA 3OD4A 3MI8A 3MPBA 3ELNA 4MVTA 1R083 5CAZA 1RHI3 2FBEA 3AX4A 1VAVA 5BNPA 5JI9A 2P3IA 3BODA 2HWB1 2CNAA 4Q4X2 3B7MA 1ZBA2 3WQ7A 1RUE3 2WKKA 4M25A 4IEWA 1N1SA 1S0JA 2WFF1 4IEQA 3B3QE 1EV13 3G7DA 4MGYE 4Y22B 4EWEA 3OBTA 3I7DA 4LO5B 4EN8B 1KFUL 1H9PA 2PHWA 4I30A 2OPKA 2FHRA 2JDZA 5GJ6A 3VUOA 3POWA 2OG6A 2ATFA 1BJQA 3R1JA 4IEZA 2BWCA 1UKGA 4URTA 1W0OA 1ZRRA 4R9DA 3T1MA 1MQTC 2BQPA 2WA4A 1QQP2 1SFYA 5BY5A 3AP9A 1POV3 2RM23 1AR93 4LBKA 4WVMA 4Z92B 1R1A1 2XLFA 1RUH2 5EZWA 3SCGA 4XE9A 3ZDSA 5CG8A 4C8RA 4JGYC 4QGLA 4KQ7A 3V17A 1HQLA 4KG0A 1UKRA 4Q8KA 1A6CA 3MIGA 2R063 4QQPA 4K9SA 4XPVA 5JWPA 4NN0A 1SBEA 1O5UA 4EN6B 3WCSA 2D6KA 1VBC3 2ZHMA 4N43B 5JOZA 4LHKA 1QOTA 1C3HA 3S0MA 4QX5A 1ASJ3 4RR3C 1FMD3