1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
1I6XA 4EWDA 1WGPA 1NE6A 2EA7A 4LEJA 2Q30A 2XHKA 4PIZA 3WW3A 2D40A 1Q3EA 3H3UA 4IERA 3N4MA 5FQ0A 1RUNA 3R6SA 2PTMA 5LRRA 4MZUA 1CAXB 2Q4SA 1CAWB 1UIKA 2XLFA 5KHIA 4JV4A 4IESA 3ACLA 4Q29A 4YRDA 1OI6A 2Q0AA 2KXLA 2OZJA 1O4TA 2MNGA 2VECA 1J3QA 3H1WA 2GAUA 3H8UA 4KU7A 3IDCB 4IEXA 3DL3A 3CLPA 4I3PA 4Q0QA 3HIFA 4BHPA 4Q0PA 2MPFA 2N7GA 2PQQA 2QNKA 2OYZA 4E2QA 1CAVB 4YSFA 4XFGA 2IXCA 3I7DA 4AQ2A 4GULA 4R8HA 1Y9QA 3IWZA 4UBHA 3PNAA 4ONUA 1ZNPA 4Z07A 1TQ5A 1ZZ9A 3SCGA 1ZVFA 1QWRA 4ZU4A 5BUVA 5I93A 2IXHA 5C8WA 4NVPA 4Z82A 4L2NA 4FBFA 4Q0UA 2K0GA 5KHGA 4HVOA 3WW2A 2CAUA 4LTAA 1X82A 3L2HA 4KU8A 4HSLA 1RUOA 3H7JA 5KBFA 2ETEA 4N9HA 3NW4A 3KSCA 4E2SA 3JZVA 4JTNA 4UXAA 3DV8A 5CU1A 2BYVE 3FE5A 2IXIA 3KMHA 2BGCA 4AVAA 4X6RB 2D5HA 1SFNA 2ZCWA 1RGSA 2PA7A 3FZ3A 4HVRA 5JR7B 3UKTA 5FCCA 4XFIA 1CAXA 4D7SA 3QACA 4RD7A 3BPZA 4XFBA 4QGLA 5KHJA 2B8MA 4D7TA 4HZFA 5F1RA 1GQHA 2PAEA 4ZU5A 2WC2A 1PM7A 5I0UA 3E5QA 3GBFA 2C0ZA 2E9QA 1J1LA 1YFWA 4KL1A 1CAVA 4XF3A 5E1RA 2FQPA 3D0JA 4XF1A 1RTVA 1Q5OA 4Q0VA 3B02A 4IEUA 3LA3A 4IEOA 2Q1ZB 1O3SA 3EJKA 2GC3A 4XETA 2GC0A 1HW5A 3NVCA 1ZRRA 2PHLA 1O3QA 3LWCA 3D0SA 4UBGA 2V09A 3TNQA 2H6CA 1X7NA 1JUHA 2PHDA 5J7MA 5K8SA 4IEPA 3H3ZA 2I45A 3ST7A 3CEWA 1XE8A 3OCPA 4YYOA 3I59B 1V70A 5I0SA 1FT9A 5LEKA 2GC2A 2MHFA 3BALA 4IEWA 4MGZE 1CAUA 3WW4A 4HBNA 3FWEA 5JSRA 1WLTA 4I2OA 1LKNA 4JTOA 2EAAA 4WVZA 2F4PA 5I0RA 1O3RA 3UKNA 4YARA 3ZDSA 3EHKA 1J59A 4XF9A 3O14A 3M3IA 5LEJA 2Y0OA 3E97A 4MH0E 1OFNA 2GH2A 2O1QA 2XKPA 1H1IA 3ELNA 1YLLA 1UPIA 1CX4A 2WFPA 1O3TA 1GQGA 5BV6A 2K9ZA 3H1YA 3HQXA 5E16A 5KHKA 3H50A 1EP0A 4QMAA 1LB2A 2UYAA 3ES1A 2ET1A 4HLTA 3S7IA 1PMIA 1OMIA 3USSA 3FX3A 2IC1A 2UYBA 4BH9A 3H7YA 4HSJA 2H6BA 1UD1A 1UCXA 4J1XA 3SCHA 4X6QB 4F7ZA 3I59A 3HT2A 4LLOA 3RYRA 4EWEA 1YFUA 4QGNA 1LR5A 1DZTA 4IEQA 4TLFA 2OA2A 3CO2A 1QY4A 2ET7A 3OGJA 1J3PA 3S7EA 4DINB 5FLJA 3CF6E 1U12A 4MGIE 1CAWA 3E5XA 4J1WA 4QXKA 4LA2A 2PAKA 3DKWA 2PYTA 3OD0A 3WW1A 4KWJA 4IETA 5AVPA 4OLLA 4LUKA 5LRSA 3BCWA 2VQAA 3KGZA 4BIFA 3E6CC 3SMHA 1DGRA 5BY5A 1X8MA 1FXZA 4XF4A 2Z2SB 1OD5A 4HVQA 1UW8A 3ES4A 5I91A 2ATFA 4LA3A 4MX3A 4AVBA 1Y3TA 2XLGA 3IIAA 5FDBA 1ZRCA 4BYYA 3C3VA 3LA2A 2O8QA 1O7FA 1VJ2A 4EROA 3EBRA 3CJXA 3IDBB 2H0VA 3PVBB 3NSTA 4KWKA 1SQ4A 2GU9A 3GYDA 3H9AA 1XE7A 2B9UA 3BB6A 3U10A 4AXOA 5BPXA 4EWAA 3IBMA 4LULA 3FHIB 4MV2A 3UKVA 1H1MA 5FLIA 3RPQA 4I09A 2GZWA 3MYXA 4I0AA 2XL9A 4E2GA 5CVRA 3FJSA 1ZREA 1X8EA 4XFHA 3I54A 1XRUA 3SCFA 1ZZ7A 1ZX5A 4IEYA 1YFYA 1YHFA 3H1MA 3VHRA 3RDIA 1VR3A 3ROUA 3RYPA 4QX5A 1EY2A 4OFGA 1ZRDA 1NYWA 4QM9A 4MGYE 4YNIA 4I0BA 4I02A 5I8TA 4ZU7A 4Q0SA 4XEZA 4IEZA 3SHRA 2PAMA 4B29A 1DZRA 2BNNA 5I0TA 2CV6A 3G7DA 4IEVA 3BU7A 3D82A 4JVAA 2UY9A 1G6NA 3OTFA 1WA4A 2D93A 2ZKLA 1NE4A 3NJZA 5FLHA 4MUVA 5FPZA 3EO6A 2XL7A 2XKOA 4ORFA 4HN0A 2CGPA 1EPZA 3EQEA 1QXJA 4XFAA 5KHHA 2QJVA 3S0MA 1QXRA 2CAVA 1ZZCA 2BNOA 5JSOA 3U11A 4EV0A 4PIXA 2IXJA 5T3NA 4META 2QCSB 3RNSA 3KGLA 4O9GA 2XGXA 5CADA 3CL1A 2HJIA 1O5LA 3DN7A 3U0ZA 5BXXA 3NKTA 4I01A 1Q43A 1J58A 3LOIA 5I8SA 4QGMA 2Z69A 4H7LA 3M70A 3FFQA 4QM8A 1L3JA 4R52A 1J3RA 5EZWA 4AVCA 1NXMA 4K8FA 2OZ6A 1DGWA 4P9GA 1I5ZA 2EVXA 3LA7A 1UIJA 3E6BA 3LZZA 3RZZA 2B5HA 1CAUB 3KCCA 3HT1A 2QDRA 1EYBA 3LAGA 5D1IA 2XLAA 4HMZA 4WZCA 5FPXA 3ETQA 5FQ0B 1YUDA 4FT8A 3QOPA 1O5UA 1RL3A 4KWLA 2IXLA 3RYKA 4PJYA 4F8AA 1ZZ6A 2BEOA 3NL1A 4A2UA 4AQ6A 2DCTA 1VP6A 1FI2A 4L11A 2VPVA 4CYDA 3SXWA 2OPKA 2PFWA 5I8YA 2BNMA 5JCTA 4MGKE 1ZRFA 3TNPB 4XF0A 5EFUA 1YFXA 1RC6A 4LUMA 3MDPA 1LRHA 1NZCA 1ZZBA 3MZHA 2HKXA 3E5UA 4FAGA 3PLQA 4HN1A 1IPJA 1YWKA 4PIYA 4WBBA 1ZZ8A 3OF1A 5J48A 4O9EA 2IXKA 2D5FA 2UY8A 2FMYA 5JSPA 5HI0A 5J3UA 2QVSB 5JAXA 2P17A 1IPKA 4FAHA 4XFCA 3E6DA 4XFFA 3MPBA 2GC1A 1CGPA 1SEFA 4N9IA 5C6CA
chains in the Genus database with same CATH superfamily
5FO8B 1SBFA 3K5OA 1WGPA 1NOVA 1WW6A 4OI1A 3S3WA 3I3BA 5CFCB 2GTSA 4FPYA 4WCEV 3KZIZ 5B1NA 1C1LA 2XLFA 2ZGOA 4RQEA 1YJLA 2O14A 4DXRA 4O2BB 3LKJA 1VBC3 2OZJA 4Q1PA 4LKFA 3I2IA 2WDBA 1J3QA 1WLEA 4PBOA 2ZE8A 4AHYA 4LO6B 5JWPA 3F5WC 5E79Z 4FCAA 1AX2A 1V9U3 1TQ5A 4AVVA 1UU6A 1M1KW 2YU2A 5LHHA 1W9YA 1GZ9A 4L2NA 4XDPA 3WW2A 4LF8O 1E1RG 1VB4A 2ETEA 4P9LA 5KMGB 2W47A 2PN5A 1IS4A 2PLV3 5JXHA 3OW2U 3ILRA 1TGOA 3BODA 4PQQA 2Q73A 1C8M2 3AK2A 2XAGA 3FB5C 2RDCA 1F15A 1I5YA 3VBSB 5ERLA 1KDMA 3OBZA 1XNCA 1S1AA 2RMKB 5CB4B 5A7WA 5C3QA 1PM7A 2QWRB 2E53A 3K04A 3OY8B 5C4WC 1JPXA 4XF3A 3RYHB 1RTVA 3N27A 4AI2A 3FUOA 3RMXA 1O3SA 4XW3A 3VBUA 4LBQA 2K1EA 1YC61 1FMD2 1P8JA 4FSJA 1RMU2 3N7MA 2PHDA 5FZFA 2KB1A 5LHGA 1YTFD 1K9MW 2BJSA 5FY9A 1XE8A 3K9SA 2NMOA 2JD4A 3QVNA 4FFIA 4JAAA 1CZTA 3MLJA 3O9OA 1AX0A 4ZI7B 1UY1A 4AK3A 1UX6A 4WVZA 3K4ZA 3CSXA 1Y4WA 2LO1A 2IUWA 3J4UH 3M3IA 3X2QB 3U07A 2Y4UA 4YG0A 2HEPA 4XBFA 1H1IA 3CRAA 4JI3O 1O3TA 5BV6A 1S4CA 2PHXA 2ZE5A 1ULEA 4WVMA 3THPA 4MSVA 2PYLA 2UUBO 1NTZH 2K2SA 4HK8A 3I3MA 2HWF2 3KT1A 3MO4A 3IMNA 3ILNA 1OCZC 4ISRA 3OUHA 1YFUA 4CZSA 2FBEA 3WF2A 2AEZA 3CJIA 1TVKB 2GN3A 2F6BA 1Y76B 2XJRA 3AP4A 4AEDC 4DUWA 2RS11 4D6QA 3VBBA 1I1EA 5LP6B 1XMQB 5D2AA 2E33A 4FOWA 5T5JA 4IE4A 2VQAA 3OMIB 2JECA 4TUYA 4NIDA 5BY5A 2WPDG 3ZHTA 1U97A 1FXZA 4H55A 4AAXA 4DUXA 3SQOA 4XTMA 1DGSA 1GZWB 2YHJA 3WF3A 4K3UA 4JI8O 3I49A 3JU9A 4DV2B 3J7LA 3HKBB 4GZRB 3EBRA 3N2GB 3T1HO 3SPIA 3ZFEA 4LHSA 1BVVA 2JB8A 3GYDA 2B9UA 4UXNA 2ZM6O 1SC5B 3O1SA 5BPXA 3ZN6A 3FHIB 3AKTA 1H2NA 1VBA2 4BB3A 2P90A 1E5RA 4Z2WA 5KX5B 5G04L 1VF6C 4AQTA 1S0FA 3VHOA 1BBT2 4AOCA 2GN7A 2Q8OA 3CCUV 1ULFA 3GBWA 3ZFGB 1K34A 1J1TA 5FXZA 1NT0A 3OUSA 1UMZA 5IAVA 4MGYE 2G4IA 2CYFA 5CKQA 3SHRA 1QH7A 4DMIA 2WNVB 4XDJA 5J2TA 1NE4A 4XDOA 2VUAA 5FLHA 4AE2A 4X8AA 5FP7A 3SJQC 4JDNA 3UETA 4CXYA 4Q2FA 4XE9A 3DCQA 4GKYA 1JJOA 3S0MA 3BGAA 3WR0A 2RDSA 2Q0OC 2ZGRA 5EC1C 2JG8C 4PCRA 5K0UC 4O9GA 1NCRB 4BU2A 1JOJA 1BHAA 3IPVB 2Q69A 3WNLA 1YJNV 1H1AA 2YIBA 2HYXA 3F5TA 1K12A 4NO4A 4ZS2A 5CAZA 2KA3A 4JAVA 3UQ8A 4TV8A 3HQRA 1IQDC 5FPVA 2LJ2A 4LMFA 1IBKB 1PVXA 3FHAA 3U78A 5A7QA 1ZBE1 1SHWB 2A79B 4BCUA 1NX9A 4LF8B 2YB7A 3KWVA 1RL3A 4EJRA 1VQ8V 2XTAA 2F17A 1H9WA 2ZGQA 5FKCA 5H6QA 3THDA 4CYDA 5APAA 5GLUA 2D3OW 2AW9A 3RSJA 4LIVA 1FXKC 4C1WA 4EZ4A 2O8OA 3MDPA 2ZX4A 4GLXA 1RUC1 2JK5C 2Q6AA 4COVA 3K5MA 4M3CE 4NTXA 4LF9O 5J48A 2FMYA 4QPGA 1V6KA 5M0TA 1WZXA 2A6ZA 2XBO2 4XFCA 2ZHNA 2RS13 1RM1B 3JD72 2WNUC 1QOTA 2RDRA 5LL6Y 3KV5A 2PZSA 1QVFU 1B04A 1RUNA 3AZXA 3OB8A 3BVOA 1SQGA 4JASA 1K7DA 3T0BA 2D6PA 2VOWA 4CU7A 5CBFA 1F4MA 5A7WB 1L7RA 1VMFA 4I3PA 3GF6A 1OFSA 1SERA 4Y24A 2BV4A 4QGPA 3OTOB 1H8EG 2IXCA 3CRRA 1ZZ9A 3UL2A 4NPLA 3B01A 3H1HH 3VBUB 4BQ5A 1QH6A 4LBQB 4N43A 5C8WA 4NVPA 4FBFA 3N2KA 4OYUA 4LTAA 3BPSA 1RUOA 4JI3B 2YBSA 3ZFFA 3D36A 4TN7A 2ADEA 4R9AA 2BGCA 3WDWA 5J36A 3ZMVA 1W6MA 3TRSB 2ZCWA 2UUBB 4MHRA 3OEEG 3KB5A 5EBLC 4BLJA 3CQOA 4LLFA 1IX9A 1DP0A 3AL5A 5H9QA 1PKXA 4KG8A 4AF9A 2XWJB 1R082 3GALA 1RPOA 5E1RA 4S2GA 1W8UA 1YQ8A 4L8QA 1VRH1 3S5AA 1A32A 2A7WA 3IFXA 4WVMB 2PHLA 3ZYGA 3VKNA 3B9CA 1X7NA 2AEYA 3APBA 3AKSA 4JI8B 3ZBHA 5GW7A 5LBEA 5C3OA 5FMDA 5JR2A 3T1HB 3JD2A 1W6NA 3WW4A 4MVOA 1DYPA 2X6BA 5FLXN 1VALA 4FP3A 3HKDB 2ZM6B 3QNEA 2D7FA 4MW8A 3A7QA 2AREA 3BU0A 2OPWA 5LBFA 4Y20A 3A2FA 1KD1W 3APQA 5FYBA 2A1XA 3OGCC 1OH4A 3N7KA 4WM7C 4AILC 2W0FC 1S2KA 1R3KC 3T4VA 2EZPA 5KHKA 3V64A 4D6TH 3ZFEB 3PU8A 2YPDA 3T2QA 3BRCA 1STMA 1RUC3 1PHMA 1JS9A 5JOWA 2ARHA 4XQDA 2VVFA 2H6BA 3E8FA 1V55B 1E79G 3H01A 3ZN6B 5HV4A 1AJOA 4LLOA 4QHOA 4P00B 3RYRA 3WNMA 5A6YA 4E4EA 1OPOA 3DC6A 4I3GA 4TLFA 4YW7A 1ENQA 3S7EA 2VW1A 4PHZA 4OI2A 4BQ3A 4DV4B 4ASUG 1XBFA 1PD3A 1JZ6A 5F3IA 4KWJA 5KR7A 4ES9A 5C9AC 3PU3A 3BVCA 1QJX1 5FO7B 5LASA 1VQMV 5C3SA 4IV3B 2ATFA 5KUKA 4AFCA 4AVBA 3T1CA 5FZ3A 3P5BA 5CN0A 5J2TB 4YZ1A 1OSGA 4DZGA 2R0HA 2RM21 4U36A 1R6KA 1O8SA 5FZ6A 2YYOA 1SKVA 2R061 1IDSA 2R042 1K3EA 3RYCA 1T2XA 2EIJB 3CP1A 1EZJA 2P3YA 1AR1B 3BYWA 1X8EA 4O4HB 3GZAA 1CIYA 1WW7A 4GH4A 5KUMA 1EY2A 4JTDB 3W7TA 4EKWA 1BEV2 1V6LA 2RDQA 2A0LA 2D6NA 4DR3B 4LF9B 1XI1A 3IAYA 4COUA 3MBWA 4CXXA 3SH3A 2IBZH 4PA6A 5BYNA 3IZOA 3RFRA 3OBRA 4IDZA 3ABMC 2VNVA 4ARYA 4U7NA 1VRH3 3FFZA 2DUPA 4CPBA 4MG2A 3QO5A 3L74H 1NA1A 2XAHA 4IE5A 1LHOA 3BAAA 1QVGU 2L35A 2AR6A 3VGIA 3RYIA 4META 1AJQA 2AH2A 3MLKA 3IAQA 1QNMA 1KQRA 1QLEB 5F3EA 2ZHMA 3U0ZA 3OEBA 4AEKA 1GKBA 3AKQA 4P9PA 1BHBA 4QM8A 2FDFA 1L3JA 5EZWA 3PVOA 2ARXA 1YCIA 1PVC1 3FD9A 5GZDA 3WG4A 3QBQA 3JCUZ 1D5AA 1VQ6V 4A5UB 5LBBA 3D8CA 3NRUA 3KCCA 1OF4A 1FXHA 5LBQA 4JCKA 1FFTB 1DBNA 5DDJ2 1A34A 2YGLA 1TA8A 2A70A 3ZRWA 3T2TA 2LRPA 1Q7YW 4O7XA 4RR3C 3SGIA 5SV5A 2VOXA 2VMEA 5BNNA 5IJ0A 5FUNA 3R65A 2TNFA 1PO22 3W58A 1CWPA 2HKXA 2QKCA 1KP3A 1IPJA 3OGVA 3IC9A 4DR2O 1Z78A 4XAAA 4NHMA 4YLZA 5FZ4A 2D5FA 3LF7A 2ZMLA 3RBZA 4JYAB 3EYPA 2BQPA 2QDNA 2X5IC 3ZFFB 3V65A 3CYOA 4RQPB 4LBKA 1TMF2 4K6BA 3ZXEA 2FDGA 2C24A 1S0GA 3K06A 1DQ0A 4UFHA 2D40A 4X64O 1W6MB 3LDKA 4DOUA 2B5UA 1Y74B 1W8FA 1QJX3 1UIKA 1W2BU 5FOBB 4X9QA 5IUQA 2FHRA 3B3QE 4RHV2 5LA2A 3JSLA 4H3WA 4J80A 3H8UA 1OLQA 4IEXA 1JYTA 1GBGA 4J9YB 3DPRC 4E2LA 4GKKO 2RM23 4FFFA 3OEHG 4PI2A 3K03A 2R063 1PGL1 3AP5A 4Y33A 3E89A 2C9KA 1HQWA 4GCZA 3NAPA 1LEDA 3EVKA 4CBCA 3CCRV 1TUEB 4IHJB 3NW4A 3JZVA 2BYVE 1I9RA 2ZABA 4UW6A 4FPOB 1LHNA 4X6RB 5JR7B 2L6LA 1NVPD 1LOCA 3VD7A 1LOGA 4FLWA 3UESA 1AR61 1NLSA 2PHWA 2P4VA 3WG7B 3TAYA 3W7SA 4LF5O 2C0ZA 2ZZJA 4Y20B 1PNGA 4P2ZA 4XF1A 3Q8FA 4GJYA 4E27A 1AXKA 2JS5A 1HW5A 1K92A 4LT5A 2X09A 1XSQA 5BR8O 2J7MA 5A80A 1JYIA 3POYA 1ZM1A 4XMIA 4XJZA 3OCPA 3KT7A 4XDLA 3ABLB 5LEKA 3BALA 4K1ZA 4HBNA 1WP8A 1PVC3 4P14A 1JQ0A 2DVDA 1GM8A 1JOBA 1R1A3 4OVEA 2A3YA 5ABJA 4XJUA 3EHKA 3VDDA 1F2NA 3E97A 1YJWV 3SH4A 2ERFA 2QFEA 3TWIA 2R072 4FPFA 4B1LA 5F2VO 1GNHA 4OHYA 3VBRA 5DUVA 5FK7A 1GNZA 1LB2A 1CVNA 3JBG1 3MI8A 1R3JC 4J41A 1Z5WA 2E26A 4BIUA 2I74A 1NR1A 1Q6HA 5CA6A 4N21A 1BE3H 3ABTA 4BM8A 3ETEA 2A75A 1ENSA 1V54B 4LOSA 1OA3A 1IGOA 5GZFA 2XT9A 3VLBB 2WBKA 3PVNA 1TME1 3KGZA 3SMHA 4P9YA 1AR4A 1XNRO 4WBNB 4QIWF 4DR4B 2Z2SB 3SJBC 4MOAA 5FDBA 5L7OC 3RVYA 1RUE2 1DF0A 2C26A 2CHHA 1FPN1 1GMGA 1MABG 3U10A 1S0JA 3VD3A 1OHHG 4TYSA 4JGZA 5JVVA 1YQ6A 3M8AA 3A8TA 1QU7A 5F39A 2XAFA 2G9ZA 2MK3A 4RUEA 1OVPA 1S3JA 4MTFA 1M56C 1WMXA 1IXBA 1ZZ7A 1D7PM 1BZWA 4PQ9A 3JARA 2BDRA 2VW0A 3OEAA 2RR11 1AR63 4YNIA 5GZCA 3OT7A 1AJPA 1Q8QA 2BOJA 5JXJA 3TEWA 3G7DA 4JTAB 4L92A 1US3A 5AFBA 3HKEA 5T55A 4CUCA 2EINB 1RJ8A 2Q8VA 3ZRWB 4Q27A 4KP4A 1EPZA 2DE0X 1DDLA 2QBXA 1NG0A 1W9SA 1MVQA 4QPGC 1ZZCA 2BNOA 3RW0A 3T1YB 4GB33 5IVBA 1HKDA 3RNSA 3ZYPA 2Y6LA 2B1GA 3J9SA 2XJVA 2WAMA 1UYPA 4N7UA 5H9RA 4QPIC 3LOIA 1BMV2 4GKKB 5KWRA 1QNYA 4R52A 5D5PA 3ABKC 5FZ0A 3ZXDA 4XAEA 3GZEA 1WD4A 5FO9B 4HMZA 1SPPA 3GJBA 3ETQA 2F23A 2RS51 4KBZA 1O5UA 3LDEA 4A6SA 3WCSA 4F8AA 3WG2A 1PGW1 2YXYA 4L11A 1VE0A 4QQLA 2Z5WA 1ZRFA 1VB2A 2ZNJA 4MLOA 3T4HB 1KD7A 2F4LA 3P6BA 5AG2A 4W4ZA 1KYOF 4FAGA 3O65A 1OA4A 5A3OA 2R6QA 1YRZA 2J1VA 5JAXA 2P17A 1IPKA 5AVAA 2WWJA 3E6DA 4XFFA 1SEFA 1Z2GA 5LY1A 2XUMA 2HYKA 2C9AA 1R091 1TME3 3OGGA 1JMKC 3I56V 2DYCA 4JKLA 1WLCA 4CDXC 5ACA1 4CP2A 3ZXJA 4X1IA 1OZ0A 3ZOIA 1FPN3 2Q7HA 4PA9A 5CKNA 4EN8B 1ZL8A 1ZYBA 3N9QA 4AWDA 3SCGA 4D7YA 2TUNA 2HVJC 4EEQA 1GWKA 1OOPB 1FPOA 4TOIA 4YJ2A 3U1XA 4GQ7A 1R64A 2CGOA 3O1VA 5KBFA 4N9HA 1T6BX 5CU1A 1RUF1 1GH6A 4UCVA 3FYIB 4LIUA 5JOYA 2BPA2 4DV3O 2RR13 5LGUA 1IKQA 3QACA 4RD7A 1JH5A 1EV12 2UXXA 1QJEA 1OV9A 4JGYA 4I30A 3MIFA 4K8RB 3LIGA 2LALA 1YFWA 5KXDA 2WS93 1I0HA 1SFPA 4QXHA 4ZZ5A 3VBRB 4XETA 4H33A 1JXNA 1FJGB 1SACA 1RHI2 5GTHZ 1QQP1 4Z2AA 1XNRB 4CE8A 4MXWB 5J7MA 1VQNV 1Y6XA 4CCDA 3E83A 4UCTA 5GALA 1SQBH 4RWUA 4FPKA 4NAMA 3N3HA 5LATA 4J7KA 2WZR1 3CCVV 3MGUA 3AVSA 4KH9A 4MGSA 4PELA 4YW2A 4I2OA 3RQ0A 2DTWA 4JYCA 4CEYC 3PVEA 3ZMSA 5IW0A 4ATFA 4YARA 2YC0A 1AUYA 2RS53 3VKLA 3MW4A 3VDBA 2D3PA 3W59A 1PMHX 3ELNA 2ZX1A 1WWYA 2P6JA 1NXD1 2DCYA 1YXBA 1W2UA 4DFSA 3W7UA 2FKXA 2QQNA 1REFA 1EP0A 5IFTA 2JG9A 2Q9LA 1I08A 3JD1A 1LHUA 1VQ7V 1VBE2 3IN9A 3CCEV 3VZLA 4RS5A 4XYXA 2Q5TA 3GHMA 3CNAA 2UXCO 3CEIA 2Z79A 5GKAC 4LFBO 3CJHA 1FOD1 4IEQA 4DO2A 4XZPA 3VDAA 5FLJA 3PJSK 1ZLZA 4WM8C 4AGGA 1Z7S1 1M57B 1K5MB 5EP9A 1CESA 4LXLA 1QMJA 3DKWA 2BW8A 1R093 4MXVA 4WFAV 1XBLA 1SQVH 4BIFA 2WLNA 1XU2A 1DGRA 5ACA3 3GB7C 2V5YA 3ES4A 5I91A 5FZBA 2ZS6B 4I4TA 2JEXA 2QQUA 5F5IA 4RFRB 5C5UA 2GSMB 4K8ZA 4HONA 1YSCA 2EIMC 4MTXA 3HKEB 1X4TA 3LD8A 2EICA 3AMNA 5FYTA 1QEXA 1WCKA 2WN2A 3CXHF 3WQ7A 2WLHA 4NXNO 1ULOA 3WZ1A 1H1MA 2AZ5A 4O4JA 1VQPV 1MG1A 2Y34A 4E2GA 1AP5A 2WFF1 3OE7G 5L9VA 3URFA 3TCUA 1RUH2 3OJBA 4AHWA 5JQGB 4HETA 4IT5A 4DV6B 4HANA 3RDIA 3ROUA 1XPWA 2BOIA 4ZZ8A 3AP7A 2VE1A 1QHDA 1DCSA 1XNKA 1F4NA 1LESA 5JZGB 1XILA 5B1BB 1ODNA 3ICXA 2PYJA 2KKWA 5KXBA 2ZPXA 5T5LA 2RCVA 3DYOA 1XHXA 5BNNC 1G6NA 1GMMA 1SPPB 4LQRA 3NJZA 4BA6A 3KQ4B 3CZUA 1Q8OA 1ZA4A 3T2PA 1QJY1 3E1F1 4YHHB 3VBSC 1QQP3 2V5DA 4YXWG 1ASJ2 2BGPA 2P2KA 5BNPB 1BK0A 4UB8Z 3GCWA 2VZPA 4A7ZA 2WZR3 3CL1A 4I01A 2RMU2 4PV1B 5J37A 3EHBB 3RZMA 4BR6A 1MS3A 2QE3A 1MSWD 4YJ3A 4LKDA 3ZR5A 3WF4A 4AYUA 1LENA 1PM9A 1QJU1 4UFLA 1JZ3A 3NKGA 4DIQA 4OHVA 1N0NA 4QJFB 1N3QA 3RYKA 2ARBA 5HFLA 4PA4A 5FMOL 5EXOA 1EZVH 4X1IB 2OPKA 3KS7A 3NAPC 4DV3B 4OZXA 1RUD2 3VBHB 4V2VA 2RNBA 5FZGA 2PHRA 1ZL8B 2WNOA 3POIA 1NZCA 4GALA 4FXKB 3X2QC 5IK8A 4AEJA 5D21A 2EXKA 1JUIA 1FOD3 1F35A 4GYCB 4LK7A 3FB8C 2UY8A 5FYHA 1Z7S3 2QVSB 4HAMA 2Y33A 2E3CA 1CGPA 3BHPA 3MUZ1 4EWDA 2EA7A 3STZC 1L0NH 3VKOA 3H3UA 5HCHA 2AHYA 5LRRA 2XUEA 2QWNB 5C33A 2FCUA 1SETA 1US6A 2F4VB 2AGSA 2VD7A 4JGYB 1E1QG 2ZR2A 3HIFA 2XJPA 4AAPA 1OQ1A 4E2QA 1ENRA 2SBAA 5C7GA 4O2AA 2X05A 2ORZA 1I5PA 3BEHA 1KS4A 4YG6A 1YQCA 1ALYA 4QB6A 1COV1 1HB2A 5I93A 3GBGA 4BWAA 1LUVA 3FYEB 2ZGNA 3DC5A 4L8JA 2QQWA 2Y69C 5H2FZ 1AR82 2WFF3 4WZFA 4GUNA 5KAIZ 2A3QA 5ABJC 1RUI2 3VDDC 3APOA 1C8M1 1Q81W 5CA1A 4AG4A 1SDDB 4ZOLB 1SLTA 3SKVA 4V1PA 3ZMOA 4QGLA 4RAIA 2B8MA 3LIHA 1IG3A 1R1ZA 2PAEA 4A42A 5A1LA 2UXCB 2OX0A 1O8PA 3QO8A 3GBFA 2E9QA 5AC92 5FNVA 1X50A 5EIBC 1FYJA 3P3PA 4NMIA 4R8CA 1B35A 4Q4X1 5EYPA 4LBEC 1NH2B 1QJY3 1NY72 5B1OA 1O91A 2P34A 2GC0A 1NU1H 2CSGA 1JBCA 4NHYA 1PPJH 1RMU1 1NUKA 2BWAA 5DG2A 2GNTA 2GUZA 2JG9B 4UFMA 5FZOA 3VZNA 2E75B 4JAUA 1JN2P 2WKKA 1KKCA 4B3MO 2A6XA 1V6OA 3W9AA 3SISA 3D4KA 2DVFA 2QTSA 1V6IA 2AYHA 3CJHB 2LQTA 5HXMA 1T6GC 5KA6A 2AHZA 3FBYA 3POBA 2KD7A 4FXGB 1QJU3 3ZDSA 1F4HA 1LR1A 5IT9N 5FAXA 4MH0E 5LEJA 5C8YA 1SCRA 4FZ0A 3N7LA 2WFPA 2Y38A 4XMAA 4I4TB 2VCBA 5F5AA 3H50A 3L73H 2ZJCA 1PMIA 2BTQB 3ACFA 3M3EA 3TEXA 1SLIA 4GX2A 4J1XA 4Q4Y2 1PZ8A 2D98A 5A3LA 2RS32 4COZA 2ET7A 2TEPA 3NJXA 3TXSA 4FQ4A 3C7EA 4DXWA 5EHDA 5ANNA 1GM9A 1W6OA 2ZMNA 4E8DA 1OT5A 4GWNA 2CH7A 4TSVA 4YW5A 5B1AC 5AVPA 1AZDA 3DXTA 3JALB 2DYRC 2A3XA 4C1XA 2VNOA 4XF4A 2QWOB 4IGQA 2YS8A 1GSLA 1S0CA 4LA3A 4MX3A 1UX7A 2LUWA 3IIAA 5A3WA 1AHSA 3CDZB 1OLRA 4BLIA 4MW3A 4DXTA 5LWBA 3CJXA 3CD6V 3PVBB 3CB2A 5DN2A 1SMVA 2JE9A 1COV3 2WINB 1GZTA 3LSDA 4I50A 4KHPB 4W6WA 3IBMA 5FZCA 1ZTEA 3AG1C 3SEPA 2ZKNA 4BK5A 3SPJA 3RPQA 1GV9A 5IVVA 5FJHA 4Y5SA 2XL9A 4ICGA 1XEQA 3ECQA 3ML0A 3W7WA 2R16A 2OQ7A 1WW4A 4Y5Z0 1JW6A 2HBUA 1C8M3 4UW5A 4IEYA 3DTUB 3KG2A 4C90A 3RVZA 4FTBA 3KF5A 5C8CB 1ZBA1 1KQSU 3T4ZA 3CHXA 4IL6Z 2UY9A 3LNMB 3OR6C 1OA2A 4Q4X3 2HHHO 5CEHA 2D93A 1AI4A 3OUIA 1HP8A 1UZYA 1FKAO 1FMD3 2HWE2 3ASOB 3NNLA 1DGRN 1DQ4A 1ULDA 1RMU3 4OX9O 4DV0B 1GWMA 1OC1A 4AQSA 4AQYO 3TN92 3AG4B 1SLAA 1W8HA 2VQFB 3LUTB 4YW4A 3KGLA 5EBWC 4Q8KA 3BTXA 1AR92 3FN9A 5BXXA 1VF7A 4C0HA 2A71A 3A21A 2DJVA 1NLQA 1IQAA 3HAGA 2OZ6A 4QQPA 1WPXA 1CAUB 1ND2C 4JHTA 3BABA 5JI7A 3IKWA 1VBC2 3JB4C 3R4UA 4X8PA 1UQXA 2QM4A 1QIQA 3AFKA 3VZOA 4WFEA 5IYZA 4CDQB 1JMUB 1GKFA 4K40A 4JI2O 4Q4V2 4GMP0 2C2AA 1HNZO 4F83A 5A6ZA 3FLRA 2DCJA 5JVDB 4CZZA 2X53S 4M01A 1UOJA 3E5UA 4M4RA 4PIYA 3WG3A 4IIJA 3MHZA 2XBO1 1TE1B 4COYA 1VBB1 2PLV2 3WVJA 1I6XA 1XE0A 3I55V 5A3UA 1AI7A 1R73A 3EB7A 4FPCA 4Q20A 1W06A 1ST8A 4FOVA 4I7ZB 2LW7A 4KFMA 4YG3A 4K0KO 1H9PA 2A3WA 5HCAA 3A0KA 5A33B 2VECA 2D3SA 5FZAA 2N7GA 1NS1A 1U96A 2BFUL 2QNKA 4QX3A 2NZ9A 1W0OA 1GR3A 3MICA 4A3XA 2CTWA 1VBA3 5C4WA 3GZTB 2TBVA 4UFIA 2J42A 4AVTA 4IV3C 5FZOB 2GUZB 4A7YA 4FLYA 2JDUA 3NNMA 3RRDA 1JYNA 2Q8DA 1HB1A 2W95A 2DURA 2O0OA 4AFBA 2GTAA 5DECA 2E5LB 4A44A 1RUG2 3QH7A 1TUBA 2PA7A 5EC2C 3ZHQA 4DR6O 5FTTC 3UKTA 2YSUB 4CUBA 4EFBA 2AUYA 4YM2A 2WL1A 2OIIA 1ZBA3 1S77D 1GQHA 1C5HA 1WCQA 5FWEA 1UFIA 4U3JA 5JIUA 5T5OA 3USUA 5C8YB 2FQPA 1UXZA 2IVJA 4Q0VA 4NHLA 1SF9A 2OCHA 2Y6KA 4RS5C 5LY2A 4D6SA 5B5EZ 2B45X 3N9LA 3IDAA 3LWCA 1UZ0A 4UBGA 2MEV2 5F3CA 2ZGTA 3E22A 2H6CA 1EN5A 3L70H 2WSSG 4YYOA 3DKQA 1HNWO 2MHFA 2JIGA 3KV6A 4IUGA 3TXQA 1QR9A 1LKNA 3KM5A 3NV1A 2EAAA 5DZFA 1W6OB 3C7FA 4LWSA 4LFAO 4DV1O 2CH7B 4OQ8A 4I0XA 2ODMA 3VBOC 4LH7A 4AEDA 5CISA 5FMOS 2PQSA 5KAFZ 1VQLV 1SZTA 1RFYA 1GQGA 1EFRG 3AZVA 4LBLA 4AGVA 1HNXO 3H1JH 4GZ9A 1MEC1 2JKXA 1CPNA 4LJHA 3UT5B 3ES1A 4YZ4A 1SFYA 1QR8A 3ZN5A 3D3AA 2ZGLA 4DV7O 2V4AA 2XBO3 4Z8BA 2A06H 3JD73 1IVSA 5LB6A 1D2SA 4DK1A 1VBB3 4DNYA 1NCQC 4UV8A 4NXMB 3B94A 4GMP1 1CAWA 2XJUA 4Y22A 2ATKC 3B77A 4UFJA 5A32A 4AEMA 1W0KG 2ZX3A 4AQYB 3BCWA 3MFCA 2ZGMA 1J5EO 1W9WA 2A7AA 2YC2A 4P02B 5TSWA 1VF6A 3SJAC 4PDWB 2X6AA 3AG7A 3HBKA 5FP9A 4HVQA 3F2ZA 3FX7A 1ZA7A 2DFBA 5FY8A 4BYYA 5KC6A 4EFEA 1RITA 1YQ2A 2WT0A 2PUSA 1UOBA 2ZZQA 1MR5A 1JYWA 2BSKB 3THTA 3AG3B 1N36O 4NHXA 1UY2A 3U75A 5FLIA 2N05A 2WZPP 4YWAA 5B66Z 3SYAA 1OCRB 1ULCA 4QB1A 3SCFA 1BEV1 1FFXB 1KC8W 2JG8A 5K0UA 3MF6A 4B3RB 4JI6B 3GWOA 2EIGA 4E8CA 1R083 2BNNA 5IAXA 4LE3A 4Y5TA 1PX3A 1BJQA 4JVAA 4IXLA 3WD5A 4JI7B 2VVEA 3BN6A 1GQPA 2UU8A 2G9FA 2UWBA 4PF1A 5IWFA 5L19A 3E35A 3JYCA 2W6IG 5IYZB 1Q6IA 1Q6UA 4SBVA 4FPLA 2W39A 1KGYA 1V6MA 4N8MA 1OUXA 5BNOB 2CAVA 3ZXKA 4F6RB 3WU2Z 5CBGA 4K0KB 3I3DA 5E6HA 1EAH1 3HPLC 5LW9A 4UCUA 5LXTA 1BS3A 1FXKA 1AI6A 3O1MA 4PDRA 4IV1A 2NQYA 3ZIWA 2W46A 3OPZA 1SESA 1UNBA 1Y7BA 1C5IA 3E6BA 2H94A 3N9PA 2HH9A 3MW3A 5LMUO 3AG2C 4HKLA 5DDJ1 2D3RA 2UWCA 1EYBA 3Q4HB 1PNLA 4LBQD 1IBLB 1WCDJ 2WNUA 5FYVA 4Q4W1 3ZMZA 4XHXA 2BEOA 3JSNA 4P9WA 2L9LA 4CCOA 1MEC3 2FDIA 5FWJA 3UO3A 4DR6B 4GWIA 4BQWA 4JDMA 2YROA 1YFXA 1SS3A 1PO21 5IJRA 5DAVA 2DOSA 3FLPA 4R7CA 4XACA 2DW4A 1KUQA 1HV0A 1YWKA 5C4WB 4U2AA 3WB2A 3VD4A 5JSPA 4LH6A 1TMF1 5CKMA 4GMP3 3M3OA 1QOSA 2GC1A 4YGDA 1G8MA 2XHKA 4HPKA 1SCSA 3WX5A 4OPHA 4DUYB 5IT6A 1TUBB 2RVAA 1UN1A 5J96B 4RHV1 4O4LB 4YZ3A 4C7UA 3VQYA 1MQTC 5DAPA 1HV1A 3JAKA 1V54C 3ZMNA 4YVSC 1N47A 3IDCB 1HNWB 3KHCA 4XFGA 3USUB 2DVBA 4R8HA 3N35A 1WB8A 4YVWC 2R043 1YI7A 5H6RA 4DW1A 3E8HA 4H0LB 4LFAB 2VZ1A 4H13B 5J09A 4DV1B 2IXHA 3K51A 3MEPA 4Q1RA 5FPLA 4Z82A 4YIOA 3BA9A 3O0XA 1F7YA 3OUJA 1QGLA 3WNPA 2YZ4A 4E2SA 2JWPA 2O57A 4TQFA 2IXIA 3OYWA 1LHWA 4MVQA 1BEV3 3AMMA 3C7GA 4QPJA 2Y60A 3AJYA 1BT8A 1OCZB 1ZBE2 2YMZA 4HZFA 4UCOA 4Z1MG 3OSDA 4NRMA 2W1SA 5I0UA 3E5QA 3AKPA 2BBVA 4AFAA 1CAVA 2E74B 4NR1A 3B02A 4NTYA 2WLPA 2FB5A 2Q1ZB 1PIV2 1UY0A 1PX4A 2AZ2A 3J7NA 4CCCA 1KXGA 5CB7A 5FOJB 5FPUA 3D0SA 2Z3YA 2AXTZ 1V9U1 3VN4A 4WM7A 3TGUH 4IEPA 1EAH3 1OXCA 2DQ0A 5A1FA 4DRXA 1S5JA 2YV8A 2JKBA 2N04A 3BKZA 3RWNA 1DQ2A 2KSDA 2XG3A 5DUXA 4Y26A 3ZXAC 3VL9A 5GLZA 1N1VA 3ZXLA 1N36B 4CCKA 4Y22B 1O3RA 5A32B 5DDJ3 2ZEYA 1NKGA 4NHKA 2ZINA 3I97A 4Q4W3 2LM3A 2QGNA 4CH3A 1B09A 1SG3A 4HNAA 2UXDO 5C9AA 1H4HA 4JZ2A 4JZGA 3H1IH 3NJYA 1PO23 2ET1A 1KFUL 2VNGA 1HR0B 3WF0A 4QPWA 1W28A 4UYBA 1XMQO 3I8TA 3AX4A 3LEIA 5B4XA 4X6QB 2HFEC 4XQWA 3U4SA 2PY5A 3A0HZ 2ZE7A 1LR5A 1TMF3 3CC2V 2V4DA 1KJRA 4XHBA 2F43G 3SYQA 1VIWB 4S2FA 1YJKA 4DV2O 3ZLIA 2VNRA 4RHV3 2JG8B 1SA0B 4Y1UA 2AACA 5K0UB 4NIAA 5GLWA 1SQXH 1JZ5A 4UCSA 2BFUS 4MTGA 2P6HA 4AI3A 2YXHA 2P37A 4OUSA 2EXJA 3H9AA 3W20A 2C6SA 1J84A 1AP6A 5LMUB 1K3IA 2VGDA 1C1FA 2EULA 1AR71 3ZYRA 3J81N 3CMAV 5K1XA 4GWJA 1GO3F 1TZOA 2GZWA 4I0AA 2WN3A 3LQCA 4XILA 1BL8A 5CVRA 4MS2A 1TNRA 1P4RA 3I54A 3K48A 1XXNA 2P5BA 2WAOA 3H1MA 5EQUA 4XABA 1FXKB 1VR3A 4FLZA 1JOYA 2GMEA 2W91A 1OOPC 2VUJA 5D8AC 1RJ7A 5EYXA 1IURA 3UJOA 4IEZA 2PAMA 1XNQB 2XONA 2XJTA 2P5OA 3HKCA 1VBD2 3R66A 2JDKA 2WNUB 1YIJV 3MF9A 3L2YA 1YDXA 3EO6A 2VZQA 5L3BA 4YM0A 4NKGB 3P3NA 4QX2A 4JZRA 3C3SA 5DZEA 2XHBA 5F2SA 3RN4A 1QU0A 1IBKO 4RR3A 2F66C 4FFKA 3DN7A 1BMV1 2PHUA 2HWB2 1H38A 5CFDC 1G9DA 1N8RW 1TVGA 2GMMA 3OG2A 4AVCA 3GZUC 4K8FA 5E1AC 5EZYA 1GOFA 1S0IA 2WO7A 4AHZA 4UF0B 5IE9A 4UW3A 4H7MA 2XAQA 1C4RA 4HPKB 3WG1A 3LSUA 3QLQA 2X5IA 2HKOA 4FVVA 3UYJA 2HWD1 1DZQA 2WT1A 4AQ6A 5K7PA 4IYHA 4K1YA 2VPVA 1H8TB 5I8YA 4MGKE 4DR7B 2RM22 2UUAB 1QCEA 1UYYA 3T08A 4JQRA 2R062 2CE4A 1O9HA 1JODA 3E86A 1ZZBA 2LS6A 3MZHA 2DU1A 3LB9A 5EJZB 4HK9A 2IFWA 3DPRA 4HYOA 4XDKA 2YIAA 1OCOB 1MS0A 3DF0A 5FY0A 3TJTA 3PUHA 1Q90D 4ZXEA 5IY5C 1YI9A 3OTOO 2JB4A 3ZHRA 4EE2A 2CNAA 2EJRA 4ZKIA 2IU3A 4BQ4A 2DFCA 1K4DC 1RUE3 3SYOA 2JEMA 3I2HA 2X6CA 4Q0QA 2DQ3A 3A22A 3WINE 3POFA 3K5NA 2YGMA 4BHPA 5CMUA 1K5MC 2RJKA 4QX0A 1OURA 1CAVB 4YSFA 4IE7A 3LOBA 1IG0A 1GANA 1P7GA 1AR73 4ZHQB 2EIBA 2QSAA 2A73B 5JPNB 1WB7A 5BMVA 5A9GA 2WABA 1JHJA 1VP7A 3B00A 1EBOA 2PMWB 1KJLA 4WM7B 1S2EA 3IIIA 5CBLA 3O1OA 3VUOA 4YM3A 2H0BA 4SLIA 2UXDB 4DRXB 3THOA 2VMIA 5H5NA 5F6LB 3E8BA 4HVRA 1W6QB 1EV11 4FLTA 4BW5A 1S0EA 2BRTA 3JUUA 5IWAB 4NN0A 5HFMA 4YGBA 2R49A 1W9FA 2DTYA 3N7JA 1F51A 4BXFA 2QM8A 4PA7A 1WA8A 2JGDA 1I94B 4EN7B 2FZ2A 1ZRRA 1O3QA 4FM0A 5JZGC 1JUHA 4BQ2A 2W52A 1MPXA 3ASNB 3CEWA 4N53C 3J8F1 1M90W 5FP3A 2LW8A 3EFFK 1GU3A 1V0AA 2Z5UA 5FYCA 3JCIA 4XVHA 4LBNA 3ZR6A 4D6RA 4NIHA 2XH6A 4GIQA 2OW4A 4QX8A 2RV9A 5BNPC 4K9SA 1O9GA 4J25A 2PI5A 1NI8A 2GDFA 5FZ1A 1HRI2 4CPBD 3THCA 2HWD3 4AI1A 3UCSC 1MZ5A 2EILC 4YZ5A 2EZOA 5IVYA 2WLLB 4B3SB 2YEVA 1F4AA 2ZHLA 1GN6A 3H1LH 1JU4A 4GAZA 5E16A 1VBE1 2CK3G 3UK9A 2QEXV 3BI3A 4B4PA 4CDWB 3S7IA 1PGL2 5F9TA 1UPSA 3AZWA 4DV4O 1POV0 5L7OA 1UCXA 2VTXJ 3HT2A 4CP1A 5A7OA 5K4LA 3VBFC 3ITQA 2ZD9A 2EIDA 1VMJA 2QTWB 2VJXA 3E5XA 3WLUA 3T3YA 5J2UB 5L3FA 3Q8AA 4P9IA 3OD0A 2VWJA 1SBEA 5FIXA 4YGEA 2ZGUA 3E6CC 3WEZA 1Q8PA 3BCCH 3WQ1A 5FY1A 1M4UA 4CS3A 1RSOA 2XLGA 1OCCC 4F4LA 2XQXA 4CS4A 4QDSA 5CZKA 1ND3A 1D4VB 1W0NA 1SLLA 1MVEA 3PHMA 4WVVA 1P49A 4YM1A 1VPHA 4XOGA 1APNA 3CRQA 2VBDA 2YXLA 4QD2A 1WCUA 4JRLA 4CUAA 4TSFG 4DV5B 4IV1C 2XVGA 1P7BA 4S2DA 3K2OA 4MHUA 4DR3O 2JIJA 1XHZA 1POQA 4NAOA 5L3EA 5F37A 3OMAB 4RR3B 3RZKA 1UY4A 1FX5A 5KLVH 1EV13 1H8VA 2W9XA 1H2LA 3OBTA 2HEWF 4QAWA 1YQ5A 5EZYB 4GKXA 4QQOA 2WLKA 2E32A 2C1FA 4LPLA 4X65O 4QPIA 4P9XA 3BU7A 1F9KA 1LGBA 3BTZA 4LP8A 3ZEDA 2G1MA 4QDRA 2FYUH 3LSQA 5A70A 4QXBA 2WR9A 4JPRA 1EUTA 3HWJA 1W8ZA 5FZMA 2XL7A 3H8RA 1Y43B 2CGPA 1CEZA 1HXS1 3JBG2 4HG6B 4TV9A 1ZRIA 2KG7A 1ZX3A 2C5DA 3ZDVA 5GZGA 1LNQA 3U11A 1LU1A 2HEYF 4LF6O 2RMU1 1IOAA 5CIRA 3J8F3 3ZIXA 2ZX0A 4FFGA 3DPRB 5I8SA 4LITA 2Z69A 2R30A 2XMLA 2DCKA 1F8VA 3ZHSA 1NXMA 2JDHA 5DPNA 4MSWC 4P9GA 5FZLA 2Y6HA 3S3XA 4XQ4A 1TME2 1V6NA 3AMPA 1YJ9V 2CY6A 4NIIA 2VG9A 3D6EA 3HR9A 4R6ZA 2E63A 5JOXA 3ZYIB 2HG5C 1ENXA 4FT8A 2IXLA 4MGQA 5CNAA 3PURA 1VP6A 5IYYA 1VBE3 1FPN2 1RUD1 2JRIA 1AL0G 4JYAO 4XF0A 1FNZA 1RC6A 4CDXA 2WSVA 3FB7C 2XNDG 5HPOA 3LSEA 2QWPB 3ZMUA 3OF1A 1DF5A 1XMOO 5BMVB 2VCMA 3VQXA 2F95B 5J3UA 3L9JT 4FAHA 2EBOA 4J7ZA 3NWKA 1G6UA 1D5NA 1L1FA 4PIZA 4GX1A 3CJIB 2RR12 1POV1 1Q3EA 4XUNA 3K3WA 1VAKA 4X89A 1MZFA 1IS6A 1JFFA 1LOEA 2MNGA 1PNFA 2WQ4A 3H1WA 1K4CC 4JYYA 4DR5B 4Q0PA 4TUYB 4I5SA 2GALA 1MS9A 1YO8A 3NV3A 4AQ2A 1EM1A 4RUFA 3CU7A 3PNAA 4ONUA 2ZBJA 4DXZA 1HN0A 4A41A 1IBMB 5TISZ 1QWRA 4ZU4A 1M9NA 1CN1A 3DEMA 2JGDB 4OZOA 1XU1A 2RQ6A 1GOHA 3KSCA 5FY7A 4LF7B 4AHXA 3MPPG 3M3CA 1G7YA 3E8GA 5LA6A 1PP9H 2D5HA 3GDBA 3WNKA 4HFSA 2VZOA 3BPZA 4XFBA 2YBKA 5JJJB 4KXRA 1URXA 3K0DA 4OUEA 2ZAAA 4XDQA 3B4SA 3WP4A 3S57A 1PGW2 2J1TA 3M1HA 4CEYA 4ZKTB 1HXS3 2ZIMA 2YEVB 3NVCA 2JDYA 2DYSC 3MFAA 2QQMA 4YGCA 5C8CC 2VR4A 3TETA 2RMU3 2JICA 3B5LB 1JYVA 5L7OB 4BIZA 5FYIA 3ACGA 3JD4A 1SZXA 4ZONA 3ASOC 2OCCC 2VULA 3LDRA 2IWGB 4WFHA 4J7JA 1W6PA 4RQFA 1R092 2F4PA 2CDPA 3B7MA 3KCXA 3CXCU 3M8LA 2HWC1 2W5FA 1FXVA 4TTGA 1YXWA 4P9JA 4WM8A 4TV8B 3HN1A 1RYYA 1M56B 3I2GA 4DQAA 3LDCA 3JCZA 1HDKA 1RUD3 3K59A 1RSOB 1BSMA 1O4YA 4QMAA 1G1XB 4BZ4A 2G38A 1K97A 2RS31 4X65B 4M3CA 1UD1A 3A4UA 3P32A 1H6XA 4QGNA 1QBZA 1KFXL 4BPZA 5CFCA 1RUF2 4D0QA 4DR4O 3VQVA 5A3NA 3KV4A 3ZN4A 5B3SB 4CU8A 1VQOV 4CEWC 5ISLA 1IPSA 1KP2A 1POV3 4O2BA 4QPGB 2I2SA 2X8KA 4AI0A 5DUWA 1R1A1 4LF6B 2Q8CA 2WLMA 4QPIB 2B39A 1PK6C 4UV9A 2VS0A 3ZSMA 4A45A 3ABKB 1QF3A 2QQJA 3ORJA 1ULGA 1N3OA 3LE0A 5KMGA 3PUIA 1AR83 5BXZA 3EMRA 1QDCA 4TV9B 5C93A 2CU5A 2YY1A 2KG7B 2YFZA 4XTPA 4S2HA 3MYXA 4R4ZA 1GP6A 1ZREA 1O6UA 4N43B 1JVMA 3AXEA 5C3PA 2VH9A 3VBSA 2HR3A 3N2KB 4JI4B 1YHFA 3VHRA 5CB4A 3N36A 1N0JA 3UT0A 3K4AA 3UO2A 4KBBA 2JJ6A 4DY3A 4LR3A 1WN7A 4FO9A 2ZQMA 1XMOB 1RINA 3M3QA 3T1YO 2DWRA 2HWE1 5FPZA 1S5LZ 2HVKC 3H9VA 2XAJA 4TWKA 1V9PA 2PXJA 4Y1XA 2VBPA 3QF7A 4MVUA 4W50A 4BIOA 3AM2A 4TXWA 3TN91 2LW1A 4D69A 2EXIA 4CDXB 2OT5A 1OJHA 4MVRA 3S30A 2IXJA 1L0LH 2W0XA 1L7LA 3GXUA 4ZIBA 1EUUA 2VAUA 1Q43A 3SLIA 1Z7S2 4GT1A 4UVCA 4L97A 4NPRA 2EVXA 1W6NB 4ITCA 2HWC3 2B5HA 1GN4A 3T2OA 3LEGA 4Y1YA 3MD0A 5JOZA 5K1PA 3B09A 3WHTA 3QOPA 1G8WA 1GWLA 4PJYA 1JFFB 1ZZ6A 3VD5A 4LO7A 2ITDC 4Q4V1 1D4M2 1H30A 1AXZA 4FLXA 2RHPA 1W04A 3TNPB 3R4DB 4DY5A 3PN1A 2YICA 4Q4Y3 1JJ2U 1TVKA 1VQKV 3FB6C 2RS33 1YF2A 5DAWA 3PLQA 2R9AA 1Y76A 2UURA 2JGUA 2OYQA 2UU9O 3NR7A 1OKOA 5CA3A 2EAKA 2IXKA 5HV0A 2PI4A 1U5YA 3N9OA 4GB31 2A6VA 5FJKA 3QD6A 4CRQA 4N9IA 2WIIB 1FAYA 5DABA 2XASA 4RL7A 1NH2D 4CC6A 5ANQA 4XJWA 3G71V 1W8OA 5LA6B 1AYM2 1DTOA 1KDKA 4KNCA 3HJRA 4MVTA 5KHIA 3N2GA 3WUDA 1YZBA 2ZEWA 1PMJX 2BCCH 2ZXWC 2BOCC 2BP6A 4DEVA 1MS1A 2NMNA 4IW3A 1QJY2 2PHFA 2R72A 4CEYB 1N34B 4W6YA 1Q56A 1BMFG 5KX5A 1DYKA 2A6YA 3ACIA 4IE0A 1N4CA 4AI9A 3IB3A 4PDWC 5F3GA 4OHXA 2CAUA 1X82A 4HSLA 4BQXA 5F8PA 3NQHA 4UW4A 5JH7A 1XYNA 1RUG1 5AFEA 3RYCB 3LCPA 2EXHA 2QKAA 4XFIA 4KMQA 2JENA 3ZSJA 3PJQA 4PDMA 4AHCA 1Y9GA 1S5HC 3I5DA 1QJU2 1W6PB 4BAYA 4GH4B 1FJGO 2VTXA 3MIDA 2CWSA 2OTLV 1W0PA 2HWE3 3CCSV 4WM8B 2BTOA 4CTEA 1J95A 1Q5OA 2P06A 1MZ6A 4IEOA 1W9TA 2FL4A 3PMEA 3TN93 2MEV1 1WMFA 2XJSA 3AK3A 4B3NA 1YIFA 4KUMA 2YUAA 1AR93 2DWEC 3IGAC 1I5XA 3AL6A 2VOKA 1UPGA 4M3CB 1LJ7A 3GGLA 1NA1B 2BERA 5IFPA 1BZKA 1FT9A 2YPJA 2EIMB 5FZDA 3RYIB 2XXZA 4O61A 3FWEA 1SZBA 4JTOA 4XXAA 5BNOC 4D94A 3ZN1A 3UKNA 4CDUC 5FZHA 4XF9A 1ND3C 1VQ4V 1GN3A 2IU0A 3LFMA 3WQBA 4F6EA 2P3JA 1BKZA 1M93A 3AMHA 4Q4V3 5FUIA 5FPBA 2K9ZA 3OPTA 4CP9A 4X62B 2WS91 2UYAA 2PGGA 1COV2 3USSA 1C28A 1Q8IA 4OPAA 2A5ZA 3HNYM 2F93B 5BNNB 5IJ0B 3SEEA 5FYYA 5I0DA 1DZTA 5HCBA 1OHFA 1HDJA 4CCMA 3KVAA 1UMHA 4QXKA 1H4GA 4IETA 2QKDA 1REDA 2Y8KA 4AVSA 5LA1A 1WLWA 5E88A 2VMHA 5GONA 2ZDIC 5EWSA 1OPMA 1Y3TA 4E9KA 1ZRCA 4Q4X2 3C3VA 3LA2A 1O7FA 3AYEA 1VJ2A 3MIEA 3I4IA 2G9GA 3TOJA 1R1BA 2H0VA 4XUPA 3STLC 1NLRA 2WLIA 4PI0A 3BB6A 3UNPA 4DV6O 1B3QA 3T2MA 3UKVA 3AP9A 3WQ0A 3WV6A 3IJ4A 5DM6V 4P30A 1OH3A 2CGNA 1F23A 3ZYJB 5FY4A 1IZ3A 3M99B 4HKOA 1RUG3 3HBZA 3E2EA 3PTYA 3AK1A 3NAPB 1NYWA 2VL4A 4QHZA 2JX9A 4XEZA 1DLCA 1NBMG 4YHHO 4XBLA 2CV6A 4FLUA 2UU9B 3D82A 5JCOA 4QT6A 4CU6A 1GN2A 4JI5B 2WJSA 1H2KA 3OAAG 1KMIZ 2KR2A 4LCUC 3CMEV 1ND2A 2AENA 5GJ6A 2MEV3 1FV3A 4GA9A 1DYOA 5L9BA 2AC1A 4LBJA 5FPAA 1KS5A 5DG1A 1K45A 4EV0A 1AYN1 1A6CA 4E4DX 5GM0A 2LROA 2EJ7A 5JJEB 3HKDA 2XGXA 1YEWA 3RZJA 4JF3A 1CPYA 2D43A 2B9ZA 5LGNA 1J3RA 4PD4F 3ZPYA 2QQPA 4WFGA 1NZ6A 4C8DA 2NPIA 3SNMA 2Y69B 3LAGA 4JI0B 1QDOA 4QDQA 3FBMA 2WAAA 4FPGA 2OTJV 4OHZA 4JI1O 5ABJB 4AW7A 2EIKC 2DCTA 3VDDB 4URAA 2VRZA 3NMBA 4LHKA 1AJNA 3ZN0A 3ZYFA 1D2DA 1E5IA 4ARXA 2VTFA 1R3IC 5IJ9A 2YXSA 5GLVA 1C3HA 3VZJA 4MVZA 3FAVA 1WW5A 1M06G 2F4VO 3ZS8C 1W2TA 5J1XA 5JH7B 1S76D 2Q30A 4IV3A 1UU4A 5GTIZ 2FDHA 4B3TO 2FDJA 2Q4SA 1RP3B 2JJ1G 3I2FA 5LMNB 1ZBA2 3JAWA 3AZYA 1UL9A 3RI9A 1K33A 3K08A 2P1BA 5J98B 2UXBO 3IWZA 5DXDA 3HOBA 1W90A 1X36A 3O1RA 4O4HA 2GNDA 1RB8G 2K0GA 2BVBA 3L2HA 3M7MX 4UXAA 4LF4O 3A0NA 3OD4A 1PNKA 5BZBA 4JGZB 4BQ1A 2FD8A 3V0BA 1XOYA 3D3QA 2VWKA 1R6NA 4D7TA 2WQZC 4UWDA 4ZU5A 3JARB 1J1LA 4KL1A 2V73A 2YU1A 1GTOA 5JIAA 1UYXA 1PIV1 3Q8CA 1L7QA 4FOQA 1GLHA 4GKJO 3KCYA 5IVJA 4CP9B 3POSA 5B1AB 3O5SA 5IYBO 3VBOA 1OF3A 2CAZC 2DYRB 2KQXA 5CFCC 2VUCA 5FBZA 5GZEA 2VXJA 3O12A 1AYN3 5IHRA 2Q7GA 4Q8LA 2BGOA 5C3RA 5K8SA 5H9PA 1WCSA 2ZACA 4LKEA 1HRV2 3H3ZA 3ST7A 1AILA 2J22A 1QQCA 1VBB2 1BLZA 5I0SA 2XQRA 1VIBA 4TLGA 3SC7X 3AYAA 1CZSA 1WLTA 2BU9A 1PL4A 1QHTA 3VD9A 4DRVA 1VEWA 3AG1B 3SR2C 1YYNA 4YW6A 2HJDA 5DN6G 3B2EE 1NCQA 4CCJA 1RIRA 4L87A 2GMPA 1EN6A 5GONB 1AF9A 2GSYA 3CCLV 3J7HA 1NT2B 5L73A 2BOBC 3CC7V 2BE3A 4HLTA 2XJQA 3I2KA 1G9FA 3MIGA 2UYBA 2JD9A 2FMDA 2WLIB 4RQPA 2QQIA 1GICA 3I59A 4K35A 3EXAA 2OA2A 1QY4A 1J3PA 1RVF2 1W3VA 1H8TC 1DF4A 1Y74A 4MGIE 1C57A 4GWMA 4G9SB 3MV01 1X33A 2PYTA 4Y3OA 4ZS3A 3J80N 3ALQA 3GM8A 1AL22 2VW2A 3LPGA 3RZGA 1LODA 5LA9A 4QKFA 1Y9MA 2GP5A 4KHPO 4H44B 1U5ZA 1OCOC 4XXPA 4DUZO 4OMCA 4EROA 3HPNA 2W3JA 3H3LA 3HD8B 1SQ4A 2VY0A 3HR0A 1E57A 3L71H 4EB6A 4IHJA 1ND2B 1RUJ2 2YDEA 3ATGA 2ZTNA 4ES8A 1MMMA 4LHNA 3KT4A 4QX1A 1LCLA 2VCAA 2Y4TA 2CTPA 4MGTA 4JI1B 1IS5A 3FJSA 2YI8A 1BK1A 4YJ2B 3B8MA 2NLJC 1S0BA 3K46A 4EN6B 2IH3C 5A3TA 1ZBE3 4OFGA 4LO5B 5KXCA 4UUJC 3PJYA 3BUCA 2RJLA 4GXLA 5EIYB 4RYDA 3FMGA 3WCRA 4I02A 4FMTA 1DZRA 1VBD1 1G9CA 4DV0O 1KBHA 3T09A 1BCXA 3POJA 1JR9A 1PIV3 3ZO0B 2VQFO 3NJVA 5A6QA 3QCWA 4ET7A 1E5HA 1UXXX 1MEC2 4BE3A 2BBAA 4QWNA 4B3TB 4K20A 5LP6C 1BYHA 5FZ8A 4KI5M 1IXMA 5T3NA 3R4SA 3L75H 5IJ9B 1OKQA 4FPHA 2HWB1 4IQPA 4M0HA 1CZVA 2UXBB 3FAVB 4OHWA 1Q8VA 2DU0A 1LEMA 5EJ1B 2CTRA 2ZT9B 2ZE6A 5LHIA 4Q5OA 5EPAA 5FPOA 5D1IA 2XLAA 2XVKA 4AI8A 2EALA 5HBAA 1W99A 4L9BA 2VCCA 3OOXA 3ASNC 3F7VC 4OGQB 4LF4B 4KWLA 5EK0A 1FYUA 3WP3A 3JAWB 4A2UA 1XNAA 1JYCA 4JKKA 3VZKA 1JX9A 2ARAA 5H9SA 5IDJA 3PUAA 1YIPA 5BNQA 3WNXA 4UVAA 3ZFGC 3ETGA 1MQTA 1FMD1 4OQ9A 4YVSA 3FLTA 4H37A 2BWCA 4PF5A 3OMNB 3T4DA 2IW5A 2WNVC 4YVWA 4RS5B 5C5TA 4GKJB 3J7AU 2BTVC 1WAZA 1DQ5A 2W92A 4CDWC 4WBNA 1NE6A 4JGSA 3WW3A 1WD3A 3VV1A 3V0BB 5FQ0A 2Z4FA 2AZ0A 2Y6JA 3K5LA 4Q29A 1H2MA 1OI6A 3IAPA 3B9IA 3PIGA 1NCRC 4XCAA 5HCFA 2MPFA 1ROPA 1G86A 1CJPA 3I7DA 4COWA 4V2WA 1N32O 4UBHA 1GZCA 2B42B 3DGEA 3G67A 4XC9A 5BUVA 2E5LO 2HWF1 5JPMB 3VBOB 2D6OX 4J10A 4M4PA 4LK6A 1S72V 2WT2A 2VM9A 1I3HA 1FS0G 1EAH2 1J83A 1NJIW 3DV8A 4JHZA 2JDMA 3FE5A 3ACHA 3KMHA 1SBDA 1JCHA 2WA4A 4O4JB 4AVAA 5F32A 4XPVA 4EQVA 2GBOA 3FZ3A 5A7SA 4RGKA 3RYFA 3LNNA 3OR7C 4PLOA 2LTNA 3TB0A 1GYKA 5IVCA 3WB1A 3WDUA 1VBD3 3UKMA 4BMBA 1QNWA 1HB4A 4EYUA 4Q4W2 4J9ZB 3G80A 2ADDA 2IJIA 1NCQB 1URFA 1B6QA 3UJQA 2X7RB 5FKBA 4EN0A 2XWBB 1RM1C 2GC3A 4LOTA 4LE4A 4X8NA 3MIHA 4BOWA 1TEIA 3B93A 1AX1A 4HL0A 3LFIA 2E76B 2B4KA 4K21A 3TBDA 3TNQA 1LOAA 4BMEA 4ZXKA 1VBA1 2HWB3 3SKJE 3SPHA 3T1LA 4DUZB 3I59B 2QDOA 1UZVA 2ZGSA 1BBT1 1G4YB 3BTYA 2B1IA 4FPEA 1K5JA 2ENRA 1GFF2 1OQEA 3RVHA 1HRI1 1MZEA 1DLBA 4P9OA 3VBUC 2X10A 1JZ2A 1V00A 4DO0A 5FXXA 1PM4A 4YJ3B 1CX4A 1CD3G 5JMCA 4E4SA 1PO12 3WUCA 1XUQA 3H1YA 1HX6A 4IYIA 2VMCA 5FXWA 1AR5A 3J26N 3DUIA 2RN9A 2VU9A 4ZPIA 2D6LX 4CSWA 4A4AA 2HLEA 4NXMO 2FTKA 2J1AA 3ZCCA 2VXRA 4EB6B 1K42A 1UOGA 3SCHA 3S5QA 1R6TA 2DCZA 3MHSC 4N90A 3CO2A 3OGJA 2VQ0A 4NYKA 4B7EA 4Z92B 2QKSA 2XR4A 3VB9A 3J7MA 1KEXA 5JCOC 1S55A 2E51A 1YTFB 4TWTA 4AL9A 3JD3A 3K77A 2R1DA 1HB3A 1WMEA 1UW8A 2YI9A 2V7QG 5SV8A 1BHGA 3CCJV 2O8QA 1SRYA 4MT8A 1MA1A 2NNUA 1OOPA 5D8AA 3OGIB 1LHVA 3OFNG 3CJIC 3FUQA 1DQ1A 2HWF3 1N33O 1LU2A 5A7NA 3WP5A 3AG2B 4LULA 2CDOA 1V9U2 2ZEZA 4O2AB 1JHNA 3VHPA 5FPRA 2ZCEA 4B3RO 3WDVA 4JI6O 2W1WA 2H3OA 3LPFA 4D3WA 2JEUA 4MTOA 4JI7O 3JD71 2OIEA 2VUDA 4DR1O 1DHKB 2QJ1A 5A3MA 3K75B 5JXIA 3ZFEC 5F5QA 3RJRA 5CA1B 5CFDA 1Y4MA 3K0GA 4IEVA 3FL7A 3GWKC 1HWYA 1V55C 3VKFC 3AZZA 3OTFA 1WA4A 4URTA 5LK5A 3CMGA 5LOVA 4ORFA 4H14A 4HN0A 5FNVB 1MOFA 4W4KA 4MXWA 2JS3A 2R1BA 3EQEA 1QXJA 4XFAA 1B35B 5EYPB 1UWWA 4R50A 1F5FA 2WYFA 1MQTB 3C7HA 2X0LA 1UKGA 4YVSB 1V6JA 5FMBA 2NLRA 4W8JA 4NPMA 3G6JB 1BBT3 1IBLO 1N32B 3HMYA 1HIXA 4YVWB 3S6PA 1CPMA 1HRI3 2V1DA 1UIJA 3LZZA 1QXPA 3WHUA 2VOTA 3MV11 3H8OA 1JYXA 2CDYA 5FQ0B 3H8XA 2EIJC 1R081 2ILMA 2UUCO 4FPJA 3SXWA 1Y67A 2BNMA 1XL6A 4EN9B 2CWMA 2YC4A 2Q5ZA 1W8NA 1FAFA 3DECA 2V4VA 2ID4A 4GX5A 4IE6A 1AR72 2R32A 3VKMA 4DUYO 1K5MA 4O9EA 3DXUA 3WT3A 1OUSA 4A7KA 3M4FA 3TEZA 3O1PA 1PV0A 3QTCA 4LEJA 1VLNA 1CX1A 5DQ0A 5IK4A 4DR2B 3RYFB 3WP6A 2PTMA 4MZUA 3R05A 4OCTA 3ACLA 4YRDA 2KXLA 3L9DA 3AVRA 3CLPA 1QLEC 5B3SC 2PQQA 4HZ3A 4J11A 1BQZA 4X64B 3A23A 1Y9QA 1H8HG 2VQEO 4KG0A 2P22C 2ZEXA 1D0GA 4LBOA 5JQGA 3C7OA 4KU8A 5LA0A 1QOOA 2WNEA 4I50B 1QJFA 3C3TA 2R70A 2QWQB 2V72A 4Q26A 4PDVA 5FZEA 5JZGA 1SFNA 4E4ZA 3IDEA 2M7WA 2YIDA 5KC5A 1CAXA 1JOPA 5FR3A 1W3XA 4J42A 3ASIA 4N53A 4LNUA 1DGLA 1LNSA 2OKXA 3JASA 2WC2A 2B46X 3NNJA 2HWD2 3ZRVA 4N43C 2GP3A 4FM2A 1XDCA 3D0JA 4QE9A 1N3PA 3JBG3 5IVEA 3BOWA 1FATA 2Y48A 4IEUA 5BNPA 3ZFFC 1IHMA 3D36C 4RQPC 2OS2A 2WA3A 4LF5B 5FYUA 2QE7G 2QUOA 2R041 1W59A 2ZGPA 4RA0A 3SJCC 4MO3M 4W65A 4PDLA 2I45A 2RDNA 4A3ZA 2W68A 2FDKA 4XIOA 4DEQA 2E7QA 5BR8B 3A0BZ 1N33B 2MW2B 5I0RA 1XYOA 3A0RA 1CIWA 4PBPA 3VBFA 3T0DA 4ASMB 2Y0OA 1HR0O 1XNDA 1GP5A 2XKPA 2VZUA 1CP9A 3VBHA 4K8XA 3CWBH 2VQTA 4O65A 5T50A 2WWWA 3GVMA 1CJDA 4DR1B 5T5PA 2DUQA 5D8AB 2JIZG 1OMIA 1COWG 2IC1A 4FM1A 1KECA 3FHQA 2YG0A 3WG7C 3ZM8A 4F7ZA 3PL0A 2R7EB 1BGYH 1TG7A 2VO5A 4IIJB 2DVAA 1AROP 2RS12 3MHHC 1AJKA 2NR5A 4LUKA 5LRSA 2IJHA 3AMQA 5JLVA 1JI6A 1M4WA 2P3IA 4BXSV 3INAA 3CX5F 3CCQV 3C2UA 3W21A 2JDIG 4NB5A 1MS8A 1OLME 2J1UA 4YFZA 5CFDB 2IZWA 2BZDA 1S2BA 4CU9A 5A1AA 3ABLC 3HN3A 4CCNA 4KWKA 5LOVB 2GU9A 1XE7A 3D5OA 4MYEA 1W2AX 2WUHA 3ZHVA 4DPNA 3MW2A 5A7PA 3DYPA 2AGAA 2EIEA 4NROA 1UU5A 5A2QN 1AVBA 4TZDA 1YVWA 1QJZA 3M7AA 1UOFA 3MLLA 4ZOLA 2DBNA 3J8F2 3ETDA 2UUCB 1XNQO 4RGAA 1CQ9A 1ZX5A 1SQFA 4I9QA 3RYPA 1XOUA 4QX5A 5EBMC 1VMHA 2WO2A 3WDXA 1C8NA 1THZA 1A3KA 1NTMH 4QU1A 2ZA9A 5LBCA 2Y26A 1O59A 2IH1C 1NR7A 3VDCA 4CC5A 2VVDA 3K3OA 4A6OA 5CG8A 2QA4V 1UYZA 4MUVA 2ZXQA 4HXCA 1VF5B 4OI4A 5IY5B 4U3JB 1VRBA 1H2GA 1G9AA 3K57A 5KHHA 3ZXGA 2VZ3A 3ZYHA 2IJKA 3K4DA 1WKYA 4L0PA 4GH4C 1W8TA 1U5IA 4ASLA 1ZWIC 3I3QA 5CADA 2ES3A 4NRPA 3OPWA 5J9PC 4FLVA 5JDBA 2HJFC 2QR4A 3E22B 2WO3A 4QGMA 4Y4RA 4DXSA 2ZX2A 1X9PA 5F7UA 4LORA 2VQEB 3ZSKA 4BQYA 3VL8A 4JTCB 4DR7O 3HT1A 2UUAO 2QDRA 3LDDA 3TK1A 4E4HA 3BFRA 2Q67A 4YY3O 4QE7A 4X1KA 1NA1C 4NTWA 1FNYA 4DK0A 1D4M1 4LWSB 2DVGA 3NL1A 4UOJA 2BTQA 1UKRA 4I0XB 3MAQA 1XJAA 1DIWA 5DAXA 4AEDB 2XB6C 3HVDA 4XJ8A 2CTVA 4BWOA 4JRAA 2A6WA 1LRHA 3O1UA 2VZVA 4HN1A 2VC9A 3T0AA 1RUF3 1RUC2 4W6XA 1K73W 3PIJA 3I2DA 1Y66A 1ZSPA 3JALA 3MPBA 2EINC 1AYM1 3ZKYA 5LYJA 3AC0A 5JJNB 5IK5A 4XURA 4B7KA 1TNFA 1CAXB 1CAWB 2Q8EA 2D44A 1D2QA 4JV4A 4N53B 4LKSA 4UCRA 4LNUB 4FOYA 3ZYBA 1QLNA 1ZAUA 1O4TA 4I55A 3JASB 3NNGA 2GAUA 1LUWA 2R071 1KKDA 2HP8A 1PZ9A 1XQ8A 2N74A 3JQXA 2OYZA 5FL7G 1HXS2 5FRAA 2P4EA 3ILFA 2E7AA 5EJ3A 5CBHA 1XL4A 3C8XA 4MVSA 1KU9A 1HQNA 1FD9A 4YZ2A 1ORQC 3T1MA 1US2A 3RGBA 2HLDG 4FFHA 1WMDA 2IVIB 3WNOA 1NQJA 2YIBD 4AFMA 2EILB 5IWAO 2XPJA 4X20A 3AEIA 5L3CA 4FP2A 2QQLA 3B69A 1GP4A 5C8CA 1NAEA 3K3NA 3ZX7A 2CL2A 3JD0A 5KHJA 1VQ5V 5F1RA 3JB8A 1I94O 1W0JG 4WV8A 3VBFB 3TEYA 1Q82W 5FV3A 5BY1A 1RUE1 2WWSA 2FCTA 2P4KA 4WFBV 2JDZA 1H2SB 1UY3A 3U37A 4C0BA 1WP7A 5IK7A 4CA9A 3UM7A 1KRIA 3SYCA 5EV7A 1VRH2 3VHNA 4NOTA 3K9AA 3NXSA 1E5SA 1MACA 2W87A 3AK0A 1N1YA 3GCXA 1OCCB 2DV9A 1XYPA 1M5IA 1HN1A 3WB0A 2OT7A 4JV5O 2NYYA 5T54A 5FZKA 1CAUA 5EYYA 1PNMA 2GH8A 1UJWB 5LXTB 4B3SO 3I3EA 4JDOA 1W39A 1LULA 3RMYA 4IV1B 4F3JA 1S0DA 4CDQA 1J59A 1DQ6A 5HXVA 1OLMA 4CP0A 3PMSA 2GH2A 3K58A 1D4M3 4AGRA 2QZ2A 1YLLA 1UPIA 4CEWA 3U14A 5FMCA 4CS2A 5JVDA 2ARCA 3PUSA 1P84F 4B4QA 1NVPB 2RE9A 2Q68A 5CYYA 2NN4A 3SITA 4XCBA 2ZOEB 5LGTA 1UO9A 3HQUA 4QB2A 3HB3B 3AP6A 1PK6A 5DUUA 4EWEA 3ZRXA 5DEDA 2PHTA 3AXDA 4DINB 2GNBA 4RO2A 3CF6E 1OD3A 4GX0A 1AYM3 4P5YA 4J1WA 5JI9A 5F2WA 1WBLA 1W03A 4LA2A 3VBRC 2EX3A 3H1KH 3ZXFA 5A33A 4LFBB 3KF3A 1X8MA 1DK1A 1HLCA 1WBFA 2GV9A 1OD5A 4UFZA 4JYBA 1QJX2 3OUFA 2LFRA 2R073 4QPKA 4DV5O 2QQVA 1REEA 1YITV 3HEIA 1VARA 4H2AA 3RWKX 3JAKB 4XBNA 4QKNA 4YFWA 5L3DA 1BCCH 1YNAA 4MV2A 3CBNA 4YY3B 4P5HA 3UGHA 2J1EA 4N7IA 3ZPOA 1LOFA 3RI8A 4UB6Z 1UZZA 2ZMKA 2LGQA 3P1IA 4M0NA 4WVWA 3WDTA 2ZHKA 1YFYA 5FREA 3VOUA 2QQKA 1ZUQA 1XNTA 3ZVXA 1ZRDA 4EZHA 3I2JA 2QM7A 4NXNB 2WO1A 4HT1T 3R0RA 3GJAA 4HKWA 3OYWB 2PF4E 2HWC2 4I0BA 1CXZB 4Q0SA 4OUMA 4G27B 2IFRA 3SDLA 3KD4A 3RWRD 1GRJA 2H8PC 3NNFA 2ZKLA 2GNMA 4JGZC 2VQUA 4X1KB 3ZKUA 2F1MA 3NO8A 1M57C 2JE8A 1RXGA 4QKDA 1MSDA 5CA0A 2FCVA 2ADQB 4CCLA 3WNNA 3X29B 4IGPA 3IT8A 4N23A 3CC4V 4P08A 3ZIAG 1WNSA 2D2CB 5FK8A 2E31A 2HJIA 1O5LA 1WLDA 2VBBA 3OM3B 5A3PA 5IVFA 4FFBA 2LFSA 4H7LA 2NP0A 2I07B 3GHNA 3K79A 3LA7A 1PVC2 4LBMA 3RZZA 2ZKOA 1JZ4A 1R1A2 5LYJB 3ON7A 1YUDA 4LO8A 4LFCO 4PLNA 3UT5A 2J1RA 4PJ0Z 2WYSA 2OVUA 5GLTA 4I55B 4I0WB 1RPRA 2SLIA 1SDWA 2Y6FA 4FIPC 5JCTA 4CVUA 4M00A 3O1TA 4LUMA 2W08A 1RHI1 4HNAB 5FXVA 5C9AB 4B8EA 1VAMA 5B1BC 4WBBA 1ZZ8A 1R3LC 2VMFA 4INDA 2DWDC 1FV2A 1SLCA 3H0OA 5LCWL 3NV4A 4X20B 4UT5A 3BA8A 3ZX6A 2P6CA 4WFFA 4PDWA 3B40A 1A8MA 4DR5O 4ZY9A 2DYSB 3D3IA 1LECA 4QQHA 3N4MA 4LC1A 4KWUA 4IESA 1IBMO 3C90A 3CZJA 5FY5A 2KM2A 2Q0AA 3LGRA 4JV5B 5F6KA 2BSKA 4B4RA 3MIBA 2OCCB 4FQZA 4NIGA 4OXSA 5CG9A 4GULA 4LF7O 2Y0IA 4ISQA 2QQOA 1Z0HA 1ZNPA 1VMGA 4Z07A 4X66O 1DFQA 1DLLA 2VZTA 2R9IA 3DXRA 2E7TA 4Q0UA 4W4LA 3KKYA 3AB0A 4YW3A 4HVOA 1NKDA 1IS3A 3H7JA 3WSOA 1LGCA 3Q8EA 1FFXA 3LDBA 4QPYA 4BDVB 4NJ4A 2B7YA 3ABMB 4HOOA 1RGSA 3KVBA 2K9PA 3RT3C 3VBHC 2DN9A 4D7SA 4QNHB 2IM9A 1JU3A 3QG5A 4TQDA 1DG6A 1Q8SA 1AR62 1GUIA 1BQPA 3BIEA 2WZEA 4QX7A 3G4SV 3MUY1 4Y1VA 2OUHA 5BNOA 4F6RA 4CEWB 3HKCB 4XUTA 3EJKA 4CDUA 3PDQA 2Z0AA 2WZ8A 5DZGA 1HQLA 2Q7EA 2ZIOA 1UZWA 4QQ2A 3AYCA 5IYCO 1HRV1 1LTEA 1HJFA 4XUOA 3OBAA 3CS5A 4JC1A 1VAVA 4GB32 3WF1A 2UXNA 1PK6B 4JGYC 1V70A 4X88A 2R9RB 2GC2A 2OUJA 1RUH1 3KLSA 4QHBA 2D6MA 3Q4HA 4UAPA 2NM1A 1UAIA 1T5EA 2WQ8A 2YBPA 4B3MB 3VZMA 3CIHA 1ONAA 5JMOA 2JDNA 3O14A 4X1YA 3SPCA 1ULPA 1W2OA 1SQPH 4ABMA 2O1QA 4ZHNA 3LEMA 1OBNA 4R9CA 5FUPA 3JAMN 4FPPA 1B06A 1W2NA 2X5IB 4PLMA 5C71A 4FTEA 1U5XA 4DRRA 2ADPA 2DF7A 2C4XA 5B2GB 1RHI3 2W2IA 2ZDIA 2P7TC 3CCMV 1ASJ1 1MS4A 4BH9A 3W5MA 4QXCA 4G3YC 3CPWU 3H7YA 1AXYA 4C91A 5B4NA 3POGA 3JATA 4G4FA 5FP4A 5L9RA 1RVF1 3ZJZA 4O4IA 3V0AA 1U12A 3KZ4C 3EXUA 4O4LA 4U3FH 1AL21 3WW1A 3OGSA 4DB5A 2JG9C 4JQTA 4OI0A 3SPGA 1LOBA 4DUVA 1DGWX 1UF2C 1ACCA 4LO4B 3OGRA 2RJZA 2QZ3A 3IDBB 3NSTA 3POWA 1RUJ1 2Y6GA 1LAJA 1U0AA 4LR4A 4JI4O 4AXOA 4YIPA 2XOMA 5CA0B 5ITZA 2ZNIA 4LFCB 1PGSA 4I09A 3N9MA 3WY6A 4YW1A 1YI2V 2ZR3A 4XFHA 1XRUA 3W5NA 1K5SA 1SQQH 1JZ8A 2VMGA 3AKRA 3LSSA 4FFBB 4QM9A 3N9NA 4LHLA 1QKQA 1UMIA 5FZIA 5T52A 1N1TA 3I2OA 1D0HA 5H9CA 4K7JA 2G19A 5EIBD 2OWOA 1Q86W 3LEKA 3ZSLA 4TT3G 1BXHA 3T30A 3IC7A 2JDPA 2XKOA 2WS92 2K46A 1WJZA 3W7XA 2QJVA 1EN4A 4XZUG 2JVDA 1GM7A 1HRV3 5JSOA 1HJGA 4L99A 5C70A 2W1UA 2HHHB 1BVP1 3L72H 2ZXWB 2EF6A 2QCSB 3IM0A 1WA8B 1AR81 2ZGKA 1W8WA 4BISA 5LK7B 3NKTA 5DAQA 1I7FA 1RUH3 4MVMA 4GD4A 4OX9B 1CONA 1RUI1 4X66B 1EPWA 1DGWA 1I5ZA 5LZ6A 1XB9A 2Q4PA 2IJJA 4WZCA 5FPXA 4NWWA 4XUQA 5KXEA 4CXWA 5AC91 2RS52 4FVMA 4JKMA 1AB3A 1FI2A 4KQ7A 3RZHA 2W1QA 5FYZA 3QH6A 1NY71 4NRQA 1Z5VA 1ASJ3 4AFDA 1MS5A 3VQWA 3PTRB 3U4XA 3F7YC 3DXRB 1RVF3 4JI2B 2J1SA 4QKBA 2JXAA 1WA6X 3AFGA 5K9YA 4CH6A 2WWUA 1HNZB 3H42B 1KITA 1F5JA 1PZ7A 3Q9OA 4NWVA 4DS0A 5C6CA 1SA0A 4BW9A 1MNGA 3KQRA 1AL23 4I9WA 1BQ0A 1A78A 4Q6GA 3QO7A 4IERA 3R6SA 2VZSA 1G9BA 1N34O 2LGWA 4AZZA 4RN5A 1N1SA 3AG4C 1GAXA 3RJ2X 1NTKH 5ACA2 2YFUA 1X59A 4KU7A 2OXBA 3DL3A 4YPJA 4FJCC 4BJ0A 3O0VA 2XOKG 1RUJ3 1LGNA 2JDAA 5D5QA 1K8AW 5DMYA 1AVMA 3PUQA 1ZVFA 4CDUB 4FK5C 1JTZX 1H6YA 4U7OA 4CUGA 1ND3B 1AYN2 3ZSEA 1O4ZA 5KHGA 4Y4YA 4ASKA 4Q4Y1 1XREA 4JTNA 1GNYA 3O7OA 2CUGA 3M2MA 2E6VA 4CDQC 3B8NA 1XSRA 3HNMA 2Z42A 5FCCA 4FZ1A 4G28B 4B1MA 2GHYA 1TAEA 5L36A 2GDSA 3O0WA 4AR2A 5IATA 4PA3A 2WSUA 3WOGA 3GNEA 2OQ6A 4XBQA 3JQWA 4X1YB 4UI9L 1NZIA 2Y0PA 2VZRA 3BY6A 3V56A 4R9BA 4NUBA 1XNBA 3LA3A 4ATEA 3CRMA 2ITCC 2FZ1A 2XHNA 3UGFA 1WUVA 3UV9A 2V09A 3Q8BA 4B08A 2JE7A 1VQ9V 1QQP2 2RJ2A 2P3KA 3AJZA 3BTAA 5F5CA 3RZLA 2X29A 3CRCA 4UF0A 3JATB 1RUI3 4MGZE 4IEWA 2WZR2 4O4IB 4XJ9A 4D8MA 1F31A 2D6KA 3V0AB 5JSRA 4FI9A 1B35C 5E89A 1ENVA 4GJZA 4XIKA 3ZRSA 3NV2A 4X62O 3OY8A 1KB9F 3JXSA 4IGOA 2Q1FA 1GOGA 2BUKA 4CH5A 3RYHA 4CCEA 1OFNA 1H8TA 5AC93 5G05L 1GK9A 3WXPA 1PO11 5JUVA 5FYSA 3HQXA 4K3AA 3WDYA 4OMDA 2XVLA 1XC6A 1L8DA 3ME2A 1LOFC 3ABUA 3FX3A 2D97A 1RXFA 4PT6A 5FZ9A 1AI5A 4HSJA 4KGQA 2Y64A 1WPBA 4R4XA 4IGGA 1HNXB 1SLBA