1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
3OF1A 1J59A 5KHKA 1ZRCA 3RYKA 1IPJA 4LEJA 2QJVA 5LEKA 1O3SA 3BPZA 3FZ3A 4XFAA 2Z69A 5J48A 4O9GA 4CYDA 4YSFA 3E5XA 4QX5A 3RDIA 5FLIA 4I3PA 4OLLA 3WW4A 1YUDA 4IEUA 4XFCA 4META 1FT9A 3H7JA 4KWKA 3OTFA 3SHRA 2GU9A 3SCGA 4P9GA 2FMYA 3LA2A 3C3VA 3ES1A 2C0ZA 1NXMA 4R8HA 2ZKLA 3B02A 5J3UA 2UYBA 3EJKA 2B8MA 4HMZA 1ZZ7A 2H6BA 4YNIA 3OD0A 2PFWA 3SXWA 4YARA 2PQQA 3L2HA 3EBRA 1EP0A 3OCPA 4MZUA 3LA7A 2QVSB 4LTAA 2F4PA 3NW4A 4L11A 5LRSA 5BV6A 5J7MA 2K0GA 4J1XA 1GQGA 3MYXA 1J58A 3HIFA 1YFWA 5CU1A 4QMAA 3LZZA 3E5UA 3HT1A 2MNGA 2ET7A 1PMIA 4WVZA 4MGYE 4A2UA 1LB2A 1OMIA 4QGLA 3NL1A 1DZTA 3BU7A 1CAXA 2B9UA 4Q0PA 4XFIA 4IEPA 2VQAA 3PVBB 2D5FA 1UIKA 2IXLA 3E6DA 4EWDA 1JUHA 1OD5A 4K8FA 1ZNPA 3MDPA 2D93A 4IERA 2IXCA 5I0TA 2HJIA 4XFBA 3ROUA 1SEFA 5FDBA 3NJZA 2CAUA 5CVRA 5KHIA 1IPKA 4KU7A 4HSJA 3O14A 2XKOA 3I7DA 4YRDA 4GULA 3EO6A 4I0BA 4MUVA 2EAAA 2Q0AA 1NE6A 1O5LA 1QWRA 3QACA 2UY9A 5FQ0A 2EA7A 1NE4A 1FI2A 3H1YA 1CAXB 2XLFA 1ZZ8A 4Q0QA 2CAVA 2GAUA 2UY8A 1VJ2A 2P17A 1X8MA 4ORFA 5BPXA 4IETA 2QNKA 5LEJA 3GBFA 5I91A 1YFYA 4WZCA 1UIJA 3H8UA 4MGKE 3SCHA 3MPBA 1CAUA 3KMHA 2GH2A 4JTOA 4HSLA 1X7NA 4Q0VA 2Q4SA 5E1RA 3RYPA 3D0SA 3QOPA 5EZWA 1HW5A 3H9AA 5JR7B 3ZDSA 1UW8A 3EQEA 3M3IA 3UKNA 3HT2A 4MH0E 1YLLA 1CGPA 1EPZA 2XLGA 4XFFA 3I59A 3H1WA 3D0JA 5HI0A 1DZRA 2VPVA 3ST7A 2Y0OA 1O3QA 1EY2A 3SCFA 1RL3A 5JCTA 3ELNA 4I02A 3ACLA 4XEZA 4F7ZA 2D40A 1O5UA 2O1QA 2CV6A 2KXLA 2XGXA 3KGLA 1J1LA 5CADA 4N9HA 3LWCA 4IEWA 2OPKA 2QCSB 3KSCA 3S7EA 5JSOA 2QDRA 4MX3A 2PAKA 1Q43A 5I8YA 1ZREA 2Z2SB 3CEWA 4KU8A 2GC1A 1ZVFA 4EV0A 5KHJA 1XE7A 3DV8A 3BCWA 4JV4A 1QXJA 1X82A 2MPFA 3RZZA 4AVCA 3N4MA 2E9QA 2PHLA 5FCCA 3E6CC 5FLJA 2IXKA 4QGMA 1ZZ9A 1Y9QA 2N7GA 4AQ6A 3E97A 4QXKA 3WW3A 3JZVA 4LUMA 3FWEA 4D7TA 3FJSA 4KWJA 2Q1ZB 3RYRA 4QGNA 4AQ2A 2WC2A 4PJYA 4E2SA 2PYTA 4IEOA 1ZZCA 4FAGA 1WGPA 3HQXA 5I0RA 1G6NA 3I59B 1GQHA 1RC6A 5I8SA 5I8TA 1YFXA 2Q30A 1O3RA 5LRRA 5KBFA 2BNNA 4XF1A 2ZCWA 3EHKA 4XFGA 2HKXA 3H50A 2K9ZA 5BUVA 1ZRFA 4NVPA 4IEQA 1UPIA 3DN7A 5K8SA 3MZHA 4I2OA 1OFNA 4L2NA 1SQ4A 2H6CA 1EYBA 4TLFA 3CLPA 2PA7A 2B5HA 1V70A 4OFGA 1H1IA 4D7SA 2XKPA 4HVQA 3WW2A 4MGIE 4HVRA 3E6BA 1PM7A 5AVPA 5D1IA 4AVAA 3BALA 2XL9A 4XF0A 3WW1A 4AXOA 4IEVA 1CAUB 2OZ6A 2VECA 3G7DA 4QM8A 4BHPA 3CJXA 3LAGA 4Q0UA 1XE8A 2GC3A 2I45A 5FPXA 4IEYA 1LKNA 1J3QA 1ZZBA 1Q3EA 4YYOA 1FXZA 1QY4A 2UYAA 3D82A 3KCCA 4F8AA 4N9IA 4UBGA 4EWEA 4BIFA 4E2QA 3UKVA 5E16A 5KHGA 1WA4A 4MV2A 4PIZA 3S7IA 4KWLA 2IXHA 3E5QA 1OI6A 3IIAA 4Z07A 3VHRA 4FT8A 1CX4A 2O8QA 4PIXA 4LA2A 3CL1A 1ZX5A 4BYYA 5F1RA 4HLTA 1U12A 3IDCB 3S0MA 3U0ZA 3U10A 3FHIB 4O9EA 4HBNA 2WFPA 3H1MA 1YFUA 4X6RB 1SFNA 4LUKA 1L3JA 4Q29A 1VP6A 2D5HA 5KHHA 4I0AA 4FAHA 3NSTA 1UD1A 4AVBA 4HN1A 4ZU5A 3DKWA 2PAEA 3U11A 1CAWA 1UCXA 1ZRRA 3H3ZA 4I01A 1ZZ6A 3USSA 1RUOA 5C6CA 4Q0SA 5T3NA 3R6SA 4FBFA 5JAXA 1DGRA 2ETEA 3NVCA 1RUNA 2MHFA 4PIYA 1I5ZA 1VR3A 5BXXA 4ZU7A 3M70A 4JVAA 4LA3A 4QM9A 1NZCA 2GC2A 5EFUA 4KL1A 4IESA 5FQ0B 2DCTA 5FLHA 4RD7A 3TNQA 3PNAA 4E2GA 1J3RA 5I0SA 2PHDA 3SMHA 3FX3A 4XFHA 2XHKA 4DINB 3I54A 4I09A 5I0UA 2ATFA 3CO2A 1H1MA 3H7YA 4JTNA 3KGZA 1J3PA 4HN0A 4BH9A 4IEXA 3GYDA 2V09A 5I93A 3TNPB 3H3UA 4XF9A 3OGJA 2IXIA 3IWZA 4R52A 3ES4A 1CAVA 2OYZA 1O7FA 4ONUA 2ET1A 1CAVB 4XF4A 1ZRDA 1O3TA 2BYVE 1I6XA 1LR5A 4HVOA 4UBHA 3CF6E 4Z82A 1RTVA 5BY5A 4XF3A 3UKTA 4EROA 3IBMA 4MGZE 3DL3A 3RPQA 1XRUA 2GZWA 1O4TA 3NKTA 2IXJA 1X8EA 1CAWB 2BNOA 4J1WA 4B29A 2H0VA 1YWKA 4H7LA 5JSRA 2IC1A 2OZJA 2EVXA 1NYWA 4X6QB 2XL7A 4EWAA 5C8WA 2XLAA 2GC0A 2BNMA 4WBBA 5JSPA 3FE5A 1DGWA 1Y3TA 4HZFA 1Q5OA 1RGSA 3LA3A 3LOIA 3IDBB 5FPZA 2BEOA 2OA2A 3FFQA 1TQ5A 3PLQA 1LRHA 1YHFA 4LLOA 2PTMA 4XETA 2PAMA 2CGPA 3ETQA 1QXRA 1WLTA 4ZU4A 2BGCA 3RNSA 4LULA 4IEZA 3BB6A 4UXAA 2FQPA
chains in the Genus database with same CATH superfamily
1KFXL 2HWF3 1OLMA 3O12A 1BBT1 4N90A 4DR5B 4FLUA 4BA6A 1CONA 5IVCA 5FZMA 1W8FA 1JYWA 1ZBA2 2LFSA 1U0AA 4BQXA 3W7XA 2WZR3 1K4CC 4CZZA 1KITA 2B8MA 4HMZA 4RL7A 4FTSA 4CS4A 1EP0A 2VE1A 1W9YA 3WU2Z 5FPUA 5J7MA 3R0RA 3P3PA 1RMU1 3WSOA 1J83A 1RP3B 1HV0A 2EZOA 1W06A 1H2MA 1QKQA 1NLQA 2YSUB 1WAZA 5C8CB 3JALB 1ZTEA 4BJ0A 2RDCA 4CC5A 1PMHX 1GH6A 3WUCA 3T2TA 1CEZA 2ZT9B 3W7SA 3G4SV 1Y74A 2VNVA 4QPGA 1K45A 1OJHA 1J84A 4EE2A 1BMFG 1FFXB 4IV1A 3VQVA 4GWIA 1W8TA 1ND2A 1FNYA 3EO6A 5EBMC 1OCOB 4I0BA 1WMEA 2ZMKA 4LBQA 4XDLA 5T5JA 4C7UA 1D7PM 4W4ZA 3R66A 2Q8DA 5D8AA 3SKVA 3H9AA 1VQLV 5EBLC 1J5EB 3PUSA 5CG8A 4YZ4A 2WDBA 3HR0A 1AXZA 3MF6A 1G4YB 2WLIA 4SLIA 2ZE5A 2VZ3A 1RUF2 1WBLA 2PI5A 1WMDA 5T54A 2PLV2 1GMMA 3FBMA 4XFFA 2XDVA 3VD5A 4BMEA 1SC5B 3WF0A 2CH7B 4CEWC 3VBRC 2G9FA 4LBEC 2RS31 5C33A 3ABLC 2Q8EA 1XHZA 4IEWA 5FZDA 2N04A 4D69A 2DUOA 4CDXC 4WM7B 2WLNA 2RVAA 1D4VB 3Q9OA 2ETNA 3MHZA 3POWA 2XPJA 5IHRA 4RQPA 3BCWA 2WSUA 3VBUB 2EALA 5FY1A 1QJX2 3MD0A 1IZ3A 3T2QA 4QGNA 2YIBA 2QBXA 3PUHA 4I0WB 1W0OA 4LF6B 3IAPA 3OTOB 3BPSA 5GLUA 4S2GA 4PBOA 5A3TA 2WLIB 5AFBA 4BQ4A 1SQ4A 2A6YA 3GVMA 4JAUA 1XREA 4KH9A 4FZ1A 5K0UB 2EIJB 1LHOA 4IHJA 4TYSA 3TBDA 1AVBA 1HRV3 1PNFA 1IDSA 2J22A 4NIGA 1LKNA 1J3QA 1PZ7A 4GD4A 4IE0A 1MS3A 3BTXA 3CCEV 1H8TC 2HH9A 3SC7X 1LOCA 5IVJA 1XDCA 4K0KB 4YW2A 2O8QA 4MG2A 2AZ0A 1IBKO 1AB3A 1C57A 1PZ8A 4CUAA 3ZX6A 1GTOA 4HLTA 2G38A 3DEMA 5B1BC 5F5QA 1P84F 5C8CA 2FDJA 4P5HA 4UCUA 4XJZA 4X1YA 1PO23 1SFNA 5JIAA 1QDOA 2E33A 1WCQA 3ZMOA 1SERA 2IFRA 5FFOC 4DV6O 3RGBA 3OBTA 3KM5A 1Z78A 1MNGA 3U11A 3KF3A 3H3ZA 3N7MA 3ETDA 4AEDA 1LR1A 3P3NA 3HKDB 1OOPB 4PIYA 3SITA 3CEIA 1XNDA 2LROA 1G9AA 1AJQA 3AG1B 4B3MB 1B3QA 1W3VA 4DW1A 4KQ7A 1MQTC 5F9TA 4B3MO 3T0DA 4YGBA 1FOD3 3APQA 1OH4A 4QD2A 4MW3A 2RMKB 2KR2A 4IE5A 1V6JA 1Y9GA 5F37A 5IFPA 1SA0B 3SPHA 4DV6B 2RS52 4CU6A 1GN6A 5JH7A 2DJVA 3ASIA 4B1MA 4UXNA 1R082 4EROA 2PY5A 3VOUA 4AEDC 4F3JA 5CZKA 5JCOA 5IE9A 5IK8A 4J1WA 5KMGB 3UJOA 2NMOA 5JSRA 4E9KA 1W6QA 2PELA 4FXGB 2UUCB 3CRQA 5HCBA 4I55A 4YY3B 4K0KO 4BIOA 1MZ6A 3VB9A 2YZ4A 2ZE6A 4FI9A 3U75A 5JMOA 3JQXA 4RR3B 1CPMA 1DP0A 2VULA 2WYSA 2FCUA 3GZAA 3NXSA 5FY7A 3JD71 3RWKX 4P9WA 3OF1A 4LJHA 3JCZA 5A3LA 5F3CA 5DZGA 5LEKA 3OEAA 5HCFA 3OPWA 3K58A 3TB0A 4GWNA 3SQOA 1BZWA 5BNOA 3HQUA 4KWKA 1UXXX 3BTYA 1ULOA 1CXZB 2ZHNA 3PURA 4FFIA 3ASNB 1K5MC 4R8HA 1PV0A 4ES9A 4FPJA 3WG3A 1H4HA 1S76D 1H2SB 4QPGC 2AEZA 3NNJA 4CPBD 1PIV2 1LEMA 2FHRA 3MI8A 4XAEA 1VBC1 1XSQA 3E2EA 2HEVF 2Q8CA 3V56A 4CDWA 5IK4A 2ZM6B 5K1XA 1AX2A 4CS3A 3ZYHA 3ZPOA 1TEIA 1K5MA 4JI1O 2RDRA 5CKQA 3V0AB 1SQVH 3K77A 2VQFB 1YHQV 3N7JA 4GX5A 4DV7B 2VQAA 2H0BA 3RYHB 3PN1A 1UY4A 2EF6A 1MS5A 5HXMA 1NLSA 4J7KA 3ROUA 4BIZA 1TMF1 5JR2A 5KHIA 1IPKA 1SCRA 1PGW1 5J2UA 1S0IA 1QU7A 4QQ2A 2RCVA 3ZR6A 2JG9B 1SFYA 5BR8O 3D36C 2AZ5A 2UY9A 5FRAA 2EA7A 2HLEA 2WLMA 1NA1B 1TA8A 3I2GA 3WD5A 5CBGA 5FIXA 1PHMA 3C3TA 2P7TC 1N3OA 2P06A 2VUAA 3VBOA 2RR11 3T30A 2GH2A 1LOBA 4YVSA 1LGCA 5A3NA 1H8VA 3SDLA 1GWMA 1G9DA 4LNVA 3M3IA 5HPOA 1RM1B 3JD1A 5LA6B 1AR81 1BZKA 4CEYB 5LMUO 3I59A 4UF0A 3AJZA 3JASA 3UT0A 4JZ2A 4X8AA 4IL6Z 1RITA 1O3QA 3F7YC 4MW8A 3ZYIB 5IVFA 1R092 2XOMA 2KXLA 1JFFA 5CADA 3IKWA 2A6XA 1MEC1 2BRTA 1GNYA 2WABA 3U14A 5FWJA 1UXZA 5L3DA 2VMFA 2VS0A 1DDLA 1ENXA 5A7NA 5FO8B 1Q6IA 3DV8A 2VCAA 3ZXLA 1EUUA 5FLJA 1DF4A 3K9AA 1O4YA 3E97A 4PT6A 1M57B 3H3LA 3MAQA 5FYUA 4MTOA 2WQ8A 2OYQA 2YC4A 2ADQB 2YDEA 1NH2D 3CDZB 1NKGA 4KBBA 4GWJA 3ASNC 2DCJA 4GKJB 3U07A 5KBFA 3WNKA 5K8SA 4YVSB 2PLV1 2XH6A 2RN9A 3OW2U 1XNQO 3PVEA 2BU9A 5B1AB 1NY71 2JIZG 2B5HA 2OPWA 4G4FA 5GONB 1GM9A 1Q8SA 1VMGA 4AVAA 3WQ0A 4FIPC 4XABA 4NXMB 4M4RA 3JBG2 1AR4A 3DXUA 2YXHA 2Q8OA 4AK3A 2I45A 5FPXA 4K8XA 3MW3A 1JJOA 4BQ5A 1W2AX 4ICGA 2VH9A 2ZE7A 4JDNA 4QQPA 1OI6A 2F4LA 1QOTA 3ACHA 1PX4A 4CU9A 2V7QG 1O6UA 3FN9A 1UU5A 3K0DA 1FAFA 1XUQA 3RYCA 1LNSA 1CD3G 1JYTA 3ZYGA 1XNBA 4XC9A 4NXNB 5KHHA 5CA0A 3AJYA 4OHWA 4TQFA 2ZKNA 2D6MA 3GCWA 3RVYA 4X66B 3L2YA 2EINC 1ZZ6A 3USSA 4K40A 4CP9A 3QTCA 5T3NA 3NVCA 5AG2A 4PV1B 2BFUL 2BTVC 1H2NA 1I5ZA 1Q6HA 1GOHA 4LO7A 2A3WA 1W05A 4RD7A 3TNQA 1X50A 2FTKA 2RJZA 2W94A 1YI2V 1ENVA 2ATFA 4YGEA 4HL0A 5IYDO 4IEXA 3GYDA 2UXDO 3TNPB 3IWZA 3SJQC 2FDFA 1YJ9V 2EULA 4UFIA 2YI9A 1Q8IA 2W1UA 1CAVB 2VW2A 5GZDA 2DCZA 5DG2A 1NCRB 3TWIA 4DK0A 4EN8B 3I49A 3H42B 3PU3A 1VQ8V 4GZ9A 1SFPA 2ZMLA 5J09A 5C8WA 4P02B 1SS3A 1G1XB 5IFTA 1PVC3 2Q68A 3WINE 5FLXN 2X5IC 1VE0A 5FPZA 3MIEA 1FS0G 5EC1C 4RN5A 1R6KA 2VTFA 2ZIMA 1JOBA 2GNMA 3FB8C 1QXRA 5JVVA 2R061 4IV1C 3WLUA 3TEZA 1J59A 3UV9A 1ZRCA 4MVUA 4ZZ8A 4HKLA 4CYDA 1OD3A 5T50A 4QX5A 4FFGA 3LFIA 3W5MA 1NR7A 3JD2A 3OY8B 1W6PB 2YXSA 4BLIA 3LA2A 5H2FZ 1QJY2 1V6LA 2E53A 5FOBB 2PQQA 3MF9A 1N1TA 1R093 3HKBB 1UNBA 1KB9F 3HVDA 3L72H 3HIFA 3GZEA 3HD8B 4DMIA 4MVZA 1V00A 4HNAB 1OLQA 1AXYA 4BW9A 1D4M3 1G6UA 5IJRA 2XASA 3HPLC 3LFMA 2WO1A 3BU7A 1RSOA 2P4VA 1NCQB 4N53B 4LBOA 2HVJC 5FZOA 4A44A 4C90A 2R1BA 2X0LA 1ZNPA 4M3CA 3MDPA 3NJZA 3CCUV 4BZ4A 3RWRD 4Y1UA 4NMIA 1MOFA 2DTYA 4COZA 2JD9A 4XBNA 2XAGA 1K3IA 3CKHA 1NS1A 1R3LC 4FLXA 2LO1A 3VD4A 4PA4A 4MVOA 4Q4V3 2B42B 3UL2A 1LEDA 2XLFA 2GAUA 3ZHQA 3JSNA 1AJNA 1NTMH 4WZCA 4DV5B 4P9PA 3KMHA 3POJA 5A1LA 1KC8W 2KG7A 1RUG1 1H8HG 2C6SA 1UW8A 3HT2A 1S2KA 1PO21 4FCAA 4X8NA 1OPOA 5IT6A 4A3XA 3NRUA 3ETEA 2HKOA 4YIPA 5JCTA 3ELNA 1SQPH 5J2TA 4XEZA 4F7ZA 2DYRB 4YVWC 1UZVA 3KGLA 5FKCA 2B46X 3O1PA 4XCAA 3IFXA 2XAHA 4RYDA 1MG1A 3N9NA 1CZVA 4TSFG 1Q43A 4IGQA 2YUAA 1ZREA 2RMU2 1CIYA 4Y4RA 4ZKIA 4YM2A 3UETA 3PL0A 4LUMA 2AACA 4CDQA 4WCEV 1VQNV 3RI9A 3H1HH 3JD4A 3ZS8C 4JZGA 4OUSA 5CBFA 1ENSA 3JD0A 1ZA7A 5I0RA 1G6NA 1PNMA 2E5LB 3AG2B 4ISQA 2VMIA 2YG0A 2B1IA 1UYPA 5EXOA 3CCVV 4GB32 1DLBA 5FPLA 1AR92 3BKZA 4GJZA 1ZRFA 4RGAA 4GT1A 3BY6A 1H1IA 4B3RO 1YI9A 4WFBV 4FM2A 2D44A 4QPKA 1TVKA 1OVPA 3BALA 2XL9A 4PBPA 2A73B 2QDNA 1OKQA 2F66C 3G7DA 4P9XA 3LAGA 4AFDA 2HHHB 2WA3A 1UX7A 2RS33 2Q7EA 2Q1FA 1R3IC 2XBO1 1WZXA 2W6JG 3QD6A 4EWEA 3AP5A 1NKDA 2ITCC 1AR91 2DV9A 2VD7A 1PO12 2KM2A 2E7TA 1FPOA 4R6ZA 2XAJA 1PMJX 1JU3A 4E4DX 3JAWA 4OPAA 4UYBA 4HKWA 5GZFA 3UT5A 1XSRA 2A5ZA 2EILB 1JU4A 2OT7A 1XI1A 2RM21 5FZOB 2WS93 4ZIBA 2AENA 4RQPC 1HXS1 5LA2A 4UFMA 5KUKA 1QJX3 2A70A 1MPXA 3ETPA 4JI0B 4AHCA 2XJQA 5JAXA 3LSUA 2MHFA 4W8JA 1PM9A 1F5JA 2OQ6A 1YEWA 1KQSU 2GC2A 2GN3A 5BNNB 4LE4A 4LNUB 1V55C 5LA1A 3ZHRA 5A6QA 2YROA 2PHDA 3SISA 1VQOV 3LEKA 1UOJA 3AX4A 2NR5A 1R081 5I0UA 3H7YA 4JTNA 1KMIZ 1US2A 4JI0O 2WIIB 2ZX0A 1U96A 4FSJA 1AVMA 5IWAB 2UURA 1RUH1 3INAA 4NAOA 4X65B 2QZ2A 5C8YB 1HRI2 4WM8C 4RR3A 1O4TA 4TWTA 2P5BA 1SBFA 4MVQA 3AC0A 5D5QA 2Y48A 1POQA 2SBAA 5H6QA 4IW3A 3AG1C 3MLKA 1UOBA 4GH4B 3UK9A 4LOTA 4N7UA 4QJFB 2OT5A 3CCLV 5FMOS 1QR8A 2BEOA 1UY3A 4QX2A 1NZIA 4UW4A 3W58A 1T6BX 1DF5A 2CGNA 5B4NA 5LGUA 5JOZA 5CB7A 2JICA 4G2KA 4B3RB 2PN5A 1D5AA 1ACCA 4OLLA 2DVGA 3ZYJB 3H7JA 1VB4A 4CDQC 2EIKC 1BKZA 2WINB 1XBLA 1H8EG 3C3VA 4TXWA 3J7NA 1JODA 4IE6A 4YARA 1QLNA 2N05A 4LTAA 1VF6A 1ASJ3 1HLCA 2E5LO 4FPGA 1R6TA 4YJ3A 4QHZA 4QMAA 4QPWA 1WN7A 3JCUZ 2QQLA 4LO6B 5F5IA 3K46A 4XBLA 3BIEA 2YPJA 3POSA 3ZN1A 2RS53 4PLOA 5JOWA 3PUIA 4YZ5A 2FDKA 4MXWA 4PDLA 1VF6C 2R16A 5FZGA 4ATFA 5FMCA 5CVRA 5AC93 1DGLA 1WMFA 4XJ8A 4QHOA 1K33A 2WNVB 2EIBA 2XKOA 2Y6GA 2ZEYA 3VZJA 2B1GA 2ZGKA 3ZXJA 2W08A 1HR0O 2A7AA 1QWRA 1P49A 2A71A 1LGBA 1B35C 1ZZ8A 1YO8A 4P9YA 2ZHKA 2PHUA 1RJ7A 5I91A 1HB3A 5JOYA 3B9IA 4O2BA 3SJCC 4JTOA 5F3EA 3RYPA 2WKKA 4JTDB 1AR62 4DV5O 3J9SA 3OEHG 5ANQA 1S5HC 1IQAA 4J10A 2O0OA 3VBRB 5L3FA 1VRH3 4LF9B 1Z5WA 1BEV2 1AX1A 4LCUC 3ABZA 3T4ZA 2EIGA 3K5MA 2VTXA 1PIV3 2Y6JA 5FYCA 2W1QA 2ZGTA 4IE4A 1VQKV 5APAA 3AP6A 4KGGA 3OBRA 1X4TA 4KU8A 1OHFA 4NJ4A 2PHXA 4O4IB 2QQUA 1XE7A 4LKDA 1QBZA 3N3HA 3VKNA 5CBLA 3CX5F 4XVHA 1VIBA 3CCQV 3HR9A 2WO7A 4ZOLA 3FWEA 2W52A 5E8AA 2ZGPA 4X1IB 5FKBA 2P34A 1YQ8A 4IEOA 1C8M3 3ASOC 4IDZA 1UMHA 3H01A 1UF2C 4UB8Z 2YFZA 2M7WA 1DBNA 3U1XA 2ZCWA 1KS4A 4DXTA 4PLNA 1C3HA 1LNQA 4CH6A 1BXHA 4LXLA 3CSXA 4COVA 1RUJ3 4DFSA 2ZBJA 4EJRA 2JK5C 4LFBB 4IQPA 1IS6A 3BOWA 3T1CA 3DUIA 4Q5OA 4YFWA 4AQSA 2LM3A 4LF8B 4WFEA 2XVGA 3JB8A 4IL7A 1XE8A 3M3CA 4JYBA 3THOA 1N33B 1UFIA 1YQ2A 4BMBA 1DYOA 2C4XA 4IV3C 5BNOC 2X6BA 2QQWA 5GZGA 1QVFU 1V6MA 3B01A 4OX9B 2PXJA 4KBZA 1I9RA 3ZN5A 1WW5A 2WT2A 4M3CB 3JAMN 4MV2A 2LTNA 1WNSA 3UQ8A 2DCKA 4FT8A 3ABMB 3M99B 1MSDA 3WG1A 4LP8A 4H0LB 2WA4A 4DR1O 2PMWB 2OIEA 1I5YA 3DC6A 3IDCB 3S0MA 1S0GA 2XWJB 4CSWA 3HMYA 3M8AA 3T1LA 4EYUA 5GLWA 4Q29A 3AYAA 5EYPB 2YBKA 5D2AA 4AGVA 2RM23 5CN0A 4FAHA 1E1RG 2R0HA 5KXEA 3PIJA 3ZFFB 4JC1A 1FYUA 1ZYBA 2UXDB 4YZ3A 2ZS6B 1RUI3 1COWG 1JTZX 2ID4A 1BT8A 4AI9A 3MIDA 1YYNA 3HNBM 2D6PA 5DAQA 2R72A 4L8JA 2BV4A 3WVJA 3TN93 3K08A 4U36A 2HG5C 4MHUA 4XJAA 5H9QA 3WF1A 5C3OA 5K4LA 2YU2A 5IUQA 4PI0A 2F23A 4QDRA 4C1XA 3DYMA 3N9PA 1WLDA 3JQWA 3IZOA 4X66O 3T08A 5FY9A 5A9GA 1VAVA 3FYIB 4YLZA 1L7RA 2OYZA 4A4AA 2DMXA 4A6OA 2V72A 1O3TA 4PELA 1LR5A 2VOTA 3JBG3 3RN4A 3UKTA 4F4LA 3EYPA 4W50A 4EN9B 2HBTA 4HZ3A 2ZR2A 5GKAC 2OZJA 4FOVA 4EWAA 2D98A 4YXWG 2WLJA 2HR3A 4ISRA 3H0OA 4UV9A 3ZMTA 1O4ZA 3ZFGB 1GM7A 4O4JA 2GALA 4AOCA 2Y0PA 4ZS2A 2QJ1A 4GZRB 1NCRA 1SQBH 4FZ0A 4HK8A 2Z5WA 1ZA4A 2UUAO 3QO7A 2QJVA 4XBQA 2DURA 4CA9A 1U5ZA 2VJXA 3MLJA 4IEUA 2WQ4A 4OI1A 4DIQA 5DG1A 1D5NA 1FFTB 5TSWA 2QTOA 2ZKLA 3DPRB 3CXCU 1GZCA 2Z42A 5DZEA 3MBWA 2LW8A 3I2JA 4M0HA 2CHHA 1VMHA 2QVSB 4XHBA 3KHBA 5T5PA 2F4PA 4CCLA 3CRCA 4CP0A 4LKEA 4MGYE 2DDUA 1LB2A 1LOFA 3IB3A 2WZR1 4XTMA 1OMIA 5FO7B 4QGLA 3PMSA 4NROA 2HWE1 2E76B 2QQIA 4OX9O 1MZFA 3AM2A 4Y5Z0 3GHNA 4YGDA 2C9AA 1N33O 4YGCA 2D5FA 3MO4A 3UYJA 2IXLA 1OD5A 4K8FA 5ANNA 1DLCA 1POV1 1VBE3 1HDJA 1DQ0A 3H1KH 4HSJA 1THZA 5JPNB 4GULA 1K8AW 4Q4Y3 4UW3A 1VAMA 1AI5A 3AKTA 2J7MA 4LHKA 4A45A 1O5LA 2R041 2XBO3 4BK4A 2XMLA 1JYNA 3CMGA 1VQ7V 1JN2P 1NE4A 5H6RA 4TV8A 1YRZA 3B93A 3A8TA 5GONA 3Q4HB 3C8XA 4E2LA 4BB3A 5LP6B 3GBFA 2NLRA 3J7HA 5FBZA 1GK9A 5JXHA 2WSVA 1YQ5A 5IJ0A 1OCZC 2QKCA 3NO8A 5EZYA 1VBB1 1QJY1 1NUKA 1Z0HA 3UKNA 4XPVA 2HWC3 2VZTA 2VZOA 4PDWC 3ORJA 1CJPA 1RM1C 4QE7A 2CTVA 5LB6A 3H1WA 5JQGA 4DV2B 1A32A 2D6KA 5DDJ1 5BR8B 2Y0OA 5IYZA 4JGZC 4M01A 4AWDA 2W6IG 2ZGQA 1A6CA 2LALA 3KQRA 2DVFA 4BISA 1JZ3A 3NKGA 3UGHA 4EFBA 1QQP2 3WDVA 2JIJA 2FMLA 4DPNA 4AI8A 3K03A 3BRCA 4AILC 4AF9A 4Y3OA 2HWB2 2QWRB 1H9WA 2Y4TA 4JDOA 1DYKA 2XWBB 2XJVA 4LF9O 4CXYA 4XXPA 1KBHA 5FXWA 3BN6A 3CWBH 5FCCA 2N7GA 4CCDA 5CFCB 3ASOB 4X64O 4LBQD 3HBKA 4B4QA 1S0JA 1YJKA 2HJDA 4FAGA 5CFDA 2WZEA 3T1YO 1OH3A 3I59B 4UF0B 4LFCO 4BAYA 5I8SA 1D2SA 3FB7C 3BTAA 5FYHA 1KJLA 3WNNA 4GLXA 2X6AA 1N1YA 3K04A 4TT3G 4R9CA 2VC9A 1RJ8A 2CU5A 2P4KA 3A0RA 1DQ1A 5IY5B 4NIIA 2JE8A 1FXKA 3B69A 1QXPA 2VECA 2FBEA 4BHPA 1CP9A 1DK1A 1TUBA 1T2XA 2NMNA 4NOTA 4JCKA 1VBD3 3WF4A 1Q3EA 1WCUA 4Y1ZA 1K5SA 1H30A 2WT1A 4XTPA 1QY4A 4PQQA 3D82A 1QDCA 3UKVA 1OOPC 3WP3A 1UOFA 1JA8A 1AYN3 3RZKA 4PIZA 4YY3O 1AL22 2UUCO 4PIXA 2EIKB 4LA2A 3WOGA 4D8MA 3H9VA 2ZGRA 5KR7A 1HKDA 4I4TA 3DYOA 1AL21 1DGWX 1CESA 3I2DA 2DCYA 4DY3A 4XDOA 1K9MW 4G27B 3AKSA 1RIRA 2WLPA 5BY1A 3IAYA 1FV2A 4F6RB 1CAWA 3SEEA 3E1F1 4EZ4A 3R6SA 1REFA 3DXRB 1OF4A 3UESA 1W2UA 1T6GC 2PZSA 3A23A 4TZDA 1QJEA 5EFUA 3AKQA 3ZYPA 3CCJV 1NI8A 3LSQA 3UT5B 1UQXA 3ML0A 3CZUA 1WCSA 2CWMA 4YW6A 4E4ZA 2QQNA 5K0UC 4DXZA 2W3JA 3W20A 2Y69C 4MTFA 2ARBA 2HYKA 3KGZA 1J3PA 5KX5A 5L9BA 3KV4A 4GYCB 4FK5C 2QE7G 1W0NA 3VBFA 2ET1A 4DZGA 2BYVE 3K51A 2XJPA 4TV9B 3OB8A 5JXGA 3VL8A 4FPFA 4ZHQB 2WBKA 1ZWIC 5FPAA 2GNTA 1IBKB 4X65O 4PLMA 5IWAO 2OTLV 1OURA 4HZFA 4D94A 4WVMA 1XNKA 4QQLA 2RG4A 4LWSB 4Q2FA 3V65A 3QBQA 1GP5A 2ZE8A 5LZ6A 1JS9A 5LBCA 1PVXA 4NWVA 1JMKC 3ZO0B 5IT9N 4LULA 4WM7C 2CTRA 1W6QB 1OA2A 2BBVA 4LEJA 2JDHA 5AVAA 4YSFA 1UZ0A 1S77D 2XONA 4X1KA 1A78A 3T1MA 2JGDA 2J1AA 3GCXA 2G9ZA 1XMQB 1W99A 3ES1A 3WHTA 3SJAC 4DUZO 2LJ2A 2AGSA 3ZN6A 3WF3A 4DY5A 3SPJA 1AYM2 3ZXKA 2Y0IA 4MADA 1HRI1 1NZ6A 2DU1A 3M7AA 1PMIA 4GJYA 5A7WB 4WVZA 1UZWA 2YMZA 4QB2A 3VBRA 1SPPA 4W6YA 2R073 1S5JA 1WW7A 2LW1A 3ZFGC 4QX3A 2HFEC 1H9PA 4DS0A 2JXAA 3JATA 2W0XA 5FK8A 4FM0A 2JDUA 5FY4A 4ASLA 4IGOA 1KU9A 3J26N 4QNHB 3K3NA 1K73W 1MS1A 3B40A 2OCCB 1AXKA 3CJHA 3UNPA 2VM9A 2HWF1 1IOAA 4LBQB 4TV8B 1XXNA 4HK9A 3RVZA 3AZVA 3WEZA 3KV9A 2W1SA 2KKWA 1NT2B 4AFCA 4E4SA 4JGYA 1GNZA 1CVNA 4NN0A 4Z92B 2DFBA 4Q0VA 2Q4SA 2WJSA 1BCXA 3RMXA 4CCEA 1RPRA 4DUYB 4GWMA 2KG7B 1Z7S2 2XAQA 4YZ2A 2GDFA 4YW5A 1PPJH 4PHZA 1IPSA 2GNDA 5EQUA 3IJ4A 5JI9A 1LUWA 3CRAA 3C3SA 1SKVA 4QX1A 3OUIA 3T2MA 3ZRSA 3AZZA 3SCFA 5DUVA 3IC7A 3ACLA 2YU1A 2XB6C 5IYYA 2GMPA 4LQRA 4HANA 2CV6A 1VRBA 4NIHA 2WR9A 1LJ7A 3LWCA 2ORZA 5CA3A 2Z5UA 1BCCH 1JZ4A 3FLTA 2IJHA 5I8YA 3R65A 4Z2AA 3LUTB 5A3OA 4COUA 4CBCA 3ENRA 4OZOA 4ES8A 2E9QA 1VBA1 3I3DA 1GOFA 3ABMC 5JXJA 2XHNA 2AH2A 4F83A 3VDDC 1NQTA 1HWYA 1PNGA 3OYWB 1JW6A 3ZDVA 3HQXA 2XUMA 5LGTA 5JJEB 1HNWO 2YIDA 1GQHA 4OHVA 5BNPB 3RBZA 3CE2A 4XILA 4YW4A 3ILFA 4L9BA 5BUVA 1S0CA 2VCCA 4IGGA 2MK3A 2JG8C 3PHMA 1OFNA 1QNYA 2ODMA 2BVBA 2GH8A 2WFF1 2NP0A 3H8RA 4NTYA 1V70A 4Y4YA 4K7JA 5ITZA 1IG0A 4DV0B 5LGNA 1DCSA 4TV9A 1J1TA 5AVPA 3HEIA 2VY0A 1BHGA 4AXOA 2WNUC 1EAH3 3CJXA 4Q0UA 1AR63 3C7OA 3ZMNA 4OULA 3UGFA 3FC0A 5FYIA 4IUGA 1N8RW 3APBA 1AI4A 1R091 4D6RA 2GN7A 5A70A 1ORQC 1VRH2 1N3PA 4H13B 4FLZA 1GM8A 1FX5A 3QF7A 4LWSA 4CZSA 3WNOA 1KD1W 1PP9H 3GJBA 1UN1A 3K5LA 1UY0A 4J80A 1RUC1 1ZX5A 3D3QA 2CTQA 2AR6A 3FHIB 4QKNA 4FVMA 5JPMB 1XB9A 1SQGA 4CH3A 4XJWA 2A9HA 2DN9A 5D8AB 1AX0A 5H9CA 4LORA 2DE0X 2X10A 1QR9A 5DUXA 4ZU5A 3MW4A 1HN0A 4G3YC 2F93B 1RUH2 2H94A 5C6CA 2FCTA 1DF0A 4Y1VA 3DXRA 2P3IA 3ZXEA 2CAZC 1C8M2 2Z3YA 2RV9A 1SLCA 4JHZA 2OUHA 4QHBA 5C3QA 3IDAA 2C9KA 4W4LA 1L7LA 3I2IA 4LKSA 2VO5A 5DXDA 2PI4A 1RUJ2 1JYVA 1ST8A 5FAXA 5KX5B 1EV11 1D4M2 3B8MA 5LCWL 3R05A 1WLCA 1NQJA 3JD3A 1O7FA 1I94O 5CA1B 4Z82A 4HXCA 2JG8B 3CJIA 4FQZA 1VAKA 2QM4A 1PGL1 3J7LA 1A8MA 4F6RA 1CAWB 3E22A 2ZEWA 3OUJA 1ZSPA 4TUYA 1CZSA 4X6QB 2OCHA 4QX8A 2BNMA 5FR3A 4JYYA 1H8TB 1DGWA 1ODNA 3J7AU 3J8F1 5ERLA 1UX6A 2Q0OC 3P5BA 4B8EA 4DB5A 2Y33A 4P30A 1EV12 5FYVA 3ZMZA 2PTMA 3MIBA 4XJ9A 3T2PA 3AG4B 4QE9A 5LBQA 1RUD3 3OM3B 4UFJA 1K42A 4KUMA 2Z69A 3JD72 4LLFA 1XMOO 5FZCA 4DW0A 2BPA2 1XOYA 4OI0A 4XXAA 3I3QA 4AFBA 2L9LA 4ATEA 2C0ZA 5C71A 4JGYC 3SXWA 3NJXA 3VBBA 3RW0A 1AR73 3HJRA 1G8MA 3F2ZA 4M3CE 4L11A 4GH4A 3KCXA 3NV4A 1W6MA 2Q5TA 1BYHA 4R9BA 4J1XA 1GQGA 3MYXA 5KAFZ 5C5TA 3HT1A 2MNGA 5BMVB 2QQKA 1KDKA 4IYIA 4A2UA 4YFZA 3VD9A 3AYEA 1QH7A 1TNFA 5J2TB 4Q0PA 3D3IA 3ZCCA 2WWUA 3RWNA 3PVBB 4Z1MG 1WA8A 1JUHA 4U7OA 2EIDA 2XJRA 1XE0A 4XUQA 4AEKA 4E8CA 4MHRA 2G1MA 2BGPA 3RFRA 5B3SC 1SQFA 1AJKA 5BNQA 5F32A 3VBSA 3FAVB 1X9PA 2KQXA 3UJQA 1XNQB 4DEQA 3AZYA 1VQPV 2B45X 1YNAA 3QACA 4JI3B 1DTOA 3LNMB 2XJSA 3S5AA 5I0DA 1E5RA 4JRAA 3IMMA 2WS91 1VJ2A 1WD3A 4GKJO 4O2AA 4IETA 2QNKA 1SLIA 2JX9A 3H8UA 1XYNA 1SBDA 3VQYA 3QOPA 1OV9A 1JX9A 1K7DA 4J25A 1VMFA 4A41A 2RS32 4OHZA 2B5UA 1UJWB 3FLRA 2ZJCA 4AGGA 1N0NA 3DYPA 1YIFA 1REDA 1O59A 1OQ1A 2PYLA 1V6OA 4H37A 1BSMA 3T0AA 1IQDC 3RRDA 3GDBA 1FXKC 1O5UA 1G9CA 2EJRA 5E88A 5LXTA 3K48A 2IBZH 3CB2A 5D21A 5FK7A 4I55B 3MDSA 5FZ6A 3OEEG 2B4KA 3AZXA 3KV5A 4I30A 2WO2A 2Z2SB 4YIOA 1MZEA 1QXJA 1W2NA 4X62O 4AVCA 5LMUB 4NHLA 3E6CC 3J4UH 1XBFA 5J1XA 2X7RB 2ZDIA 1WD4A 2JDKA 4Q26A 3TOJA 2JDAA 4KWJA 1AL0G 2JEUA 4DUYO 3QVNA 5EYYA 2CTWA 1OLRA 2EXKA 5A3UA 2EBOA 2A06H 4X1KB 3WQ1A 5LHHA 1ULCA 1K34A 4GA9A 3D36A 4WBNA 3ZVXA 4GUNA 2Q30A 2WNUA 2XHBA 3G6BA 3VBUA 3UO2A 2RS13 3OPTA 3M2MA 1MR5A 2H6CA 1HIXA 5DAVA 3VKLA 4MXVA 2HP8A 3HKDA 2XR4A 1RVF3 2ZXWB 4Q6GA 4J9ZB 4K35A 2UUBO 4BQ2A 1Q6UA 1GR3A 3ZSJA 2W95A 3L9JT 3C2UA 1SA0A 4XDKA 5K9YA 2QEXV 5FYMA 2VQFO 4F8AA 5A1AA 4UBGA 3ZX7A 4RWUA 5LWBA 2E7AA 1FV3A 4DR6O 4U3JB 3ZOIA 2JG9A 3M7MX 3U78A 1N32B 3AYDA 3AMHA 1O9HA 3BYWA 2ADDA 2NLJC 4XURA 2FB5A 1U12A 2VNRA 3Q8FA 1PGSA 3U4XA 1NA1A 2VWKA 1NCQA 4N53A 1E57A 1EBOA 3EHBB 2FYUH 1XMQO 4FLTA 1JHNA 5EBWC 4YVWB 1N3QA 2JG9C 3Q8AA 3ZXDA 4Z8BA 5K7PA 4Q0SA 4Q4W2 1DGRA 1F23A 4JI8B 4P9IA 1FNZA 4X1YB 2ZX2A 2DWEC 4D6QA 2F4VB 1NOVA 3FX3A 4XFHA 4B3NA 2XJTA 5DPNA 2GHYA 1RUC3 1X36A 3LB9A 1M9NA 1ZBA1 4Q1RA 2D7FA 1YJLA 5L36A 3H3UA 4XF9A 3CHXA 3S6PA 4E4EA 2FMDA 4LO4B 4FFBA 2O57A 2BSKA 4A7ZA 4A42A 1ZM1A 3CF6E 4AI0A 3CRRA 2VQEB 3AMPA 2F1MA 1K5MB 1W6PA 2BNOA 4JX0A 5JLVA 2NQYA 5HXVA 4H7LA 4ZOLB 4Q4X1 3VBHA 1W04A 1NYWA 2QGNA 2TUNA 1AYN2 2CNAA 3KWVA 1PVC1 2AGAA 3M8LA 4QB6A 1AL23 1RGSA 4I50A 1WJZA 1HB2A 5EHDA 3FL7A 2JJ2G 5JCOC 3N9QA 1YHFA 1JCHA 3CJHB 2J1TA 4ZU4A 2CDPA 3LIHA 1RHI3 3ME2A 4YW7A 4UXAA 3MV01 2VOXA 4BM8A 5ISLA 1TME3 1EN4A 3BPZA 5KXDA 5FREA 4AEMA 3CMEV 3UM7A 2JJ6A 4UCVA 4META 1FT9A 3VZKA 5FZKA 1YIJV 5HFMA 2Z4FA 4FPOB 3LDKA 2KSDA 5JOXA 2DU0A 1QJFA 4HYOA 3LA7A 3OSDA 1SBEA 3FX7A 1X33A 2H8PC 4O4JB 1KKDA 4YZ1A 1Q82W 4GX2A 3PJQA 1NX9A 3I55V 3VUOA 1JFFB 4JHTA 2ZXWC 2ZXQA 3DCQA 4X9QA 3NNLA 1MS0A 3OGSA 5HCHA 3IN9A 1QNMA 3J8F2 3X2QC 1OFSA 3FBYA 2ZGMA 5DUUA 3CC2V 4IEPA 3QG5A 4RS5A 4AQYB 2A3YA 4FPKA 1QHDA 1Y74B 5C9AC 2HJFC 1EAH1 2WNUB 2NZ9A 3CMAV 5EJZB 5ACA2 2X53S 4URTA 1VB2A 2ZA9A 3RZLA 1HB4A 4L87A 4AVTA 2AHYA 1F4NA 4Y5TA 5JIUA 4BDVB 3NAPA 3GM8A 4LFCB 4MGKE 5LBFA 1MMMA 3OTOO 3T1YB 1VP7A 4LF6O 1XNAA 1WA6X 4BQWA 1MVQA 4X64B 2R1DA 4MH0E 5DMYA 4CPBA 1EPZA 1OQEA 4NUBA 2VW1A 2JG8A 3OAAG 3T4DA 3CCSV 1OC1A 4DR2B 1DHKB 3ZR5A 2FZ2A 1BJQA 2WN2A 4KHPB 4MXWB 1V0AA 3F95A 2QQVA 2XGXA 3W7WA 4AR2A 5GTHZ 4PDWA 4DXRA 3HKBA 2DUQA 3E83A 3ITQA 2C1FA 1W9SA 5FYZA 1R1BA 4JQTA 4D7YA 4JV4A 5E1AC 4DV2O 3RZZA 1GICA 3N4MA 4Y1YA 5DDJ2 4LF4O 4LBKA 1W0JG 4LIVA 4XCBA 3BVOA 4X8PA 3URFA 3RYRA 4PJYA 5H9PA 5KAIZ 1Q7YW 4UB6Z 1OCRB 4RFT0 4B08A 3B4SA 1RC6A 1YC61 2AYHA 4PQ9A 2JB8A 2BNNA 1SZTA 3EHKA 4XFGA 2IWGB 1BK1A 4H55A 2L6LA 1JOJA 1UWWA 3RSJA 4CEYA 1F5FA 5IJ9B 4B7KA 4XHXA 3P1IA 3VGIA 4S2FA 2R7EB 4HVQA 4CCJA 1QGLA 1ZUQA 5FZ7A 3W21A 2YXYA 1ND3B 2GDSA 1VQMV 1X59A 3ZEDA 4NHYA 4NRPA 5ABJC 2RM22 1LHVA 1ONAA 4DYLA 3WX5A 4PDRA 2VWJA 1QMJA 5CNAA 5J9PC 5CG9A 5FZ4A 3U37A 5JZGA 3SR2C 3OG2A 1ND2C 5KHGA 3VBHC 5L7OB 3RZMA 5JWPA 3LPFA 1HV1A 1GZTA 3ZPYA 1PO11 2B9ZA 2ARXA 3UGGA 1WLWA 1B6QA 3U10A 4O9EA 3ZKYA 4WFAV 1JZ7A 4HBNA 3H1MA 3K3OA 4LUKA 2RMU3 2ZQMA 1VP6A 2E31A 3W7TA 2QQJA 4K8RB 4ZZ5A 4MT8A 3G67A 3R4DB 3ABKC 4O2AB 4OMCA 2DQ3A 1RUC2 1FXVA 3IPVA 4CDUC 3WZ1A 3DKWA 3CZJA 5F8PA 2PAEA 4E27A 5CB4A 1QEXA 4XZUG 3ZFEC 4FBFA 2UUAB 2RQ6A 1JOYA 3SYPA 5FUIA 1SLAA 5T55A 3HKCB 1M56B 1H2LA 4JAVA 3WP5A 4LO8A 1N47A 2BUKA 1RYYA 3WR0A 1SHWB 4OHYA 1US6A 4JI5O 1C8NA 3GALA 1KS5A 2XHKA 2FKXA 1W6OA 3CO2A 3VBOB 3IPVB 4LBJA 4CH5A 1NQDA 4IIJB 1H6XA 1XYOA 4NHMA 2V4VA 4FJCC 3OGCC 5SV8A 1A3KA 1LULA 1OQDA 1E79G 1BMV2 1KD7A 3QH7A 1YWKA 1Y7BA 1AR71 3ZSLA 4I9WA 2YBPA 1I5PA 3WXPA 5L3BA 5LOVB 3POGA 4Y1XA 3FUOA 4D3WA 2B39A 1UYZA 4OQ9A 2YBSA 3EXAA 4YJ3B 1BBT2 5CB4B 2D2CB 2LUWA 2AREA 3CC7V 2BCCH 1W03A 3H8OA 3GB7C 3AG3B 4XFAA 4U3FH 2AEYA 5C3SA 1MSWD 1Z5VA 3SH3A 2A6VA 3E5XA 2C24A 3ACFA 1W8NA 2D3OW 1VQ4V 4H14A 1MS4A 2J1UA 3OTFA 4AZZA 3AZWA 1KUQA 1NR1A 2MEV1 2LRPA 2ZOEB 5GLTA 2Q4PA 1ZZ7A 2HWD3 1HX6A 2JD4A 3USUA 1RUJ1 1TNRA 4LITA 1VBC3 4OHXA 3L70H 2OIGA 2XAFA 3I2OA 5DN2A 1F9KA 2OVUA 4UI9L 2HWB3 2DWRA 4OZXA 5EPAA 2NPIA 3LSDA 1CJDA 1KYOF 1BEV1 2Q7HA 1WWYA 4QXHA 1GKFA 1CAXA 1OCRC 4XBFA 2ERFA 5JH7B 1Y76A 4LFAB 1PZ9A 3K5OA 1FPN3 3E6DA 1BS3A 4IERA 4LF8O 4KU7A 5B5EZ 1K12A 2VU9A 1F35A 4QWNA 2GMMA 3SYOA 1NE6A 1COV2 1TME1 4PDWB 4N21A 3VKFC 3PVOA 3PJSK 1H1AA 3AG4C 2BOCC 4AAXA 2P17A 2K9PA 4G28B 5LEJA 1F2NA 1HQWA 2JKBA 3MPBA 4JI6B 3FB5C 2XQXA 2EICA 1IS5A 2CY6A 4FP2A 3JD73 1PL0A 5JZGC 4CCCA 2JRIA 1LOFC 1QJU3 2WAMA 5BNOB 5DDJ3 3VDDA 4UCRA 4R8CA 4GX1A 3K57A 3WQ7A 1B04A 4A3ZA 1NCRC 4B1LA 4P14A 5G04L 2R063 4RQEA 1BQ0A 4GKKB 1TZOA 4YJ2A 3AG7A 3S7EA 2P90A 1G7YA 3O5SA 2QDRA 2ARCA 3IAQA 4DOUA 1XQ8A 4CXXA 1WP7A 3VBSB 5L3EA 1HNZO 1SETA 1ZZ9A 2UXXA 4R4XA 5CISA 3G6JB 3W59A 4RSUA 1GRJA 2UXBO 4X1IA 2JEMA 3A0KA 2QR4A 1WGPA 2ZMNA 3ZFEA 1SDWA 4QKFA 3AK2A 1UKRA 1VBD2 2JGDB 2P6JA 5IJ0B 4UCTA 2CL2A 4QXBA 5ACA1 1O3RA 4WZFA 4UFHA 1AR61 1KECA 1YI7A 5LK7B 5FMOL 4NTXA 5FPBA 5FYBA 5JJJB 1SF9A 4YWAA 1LOAA 4XMIA 5LBEA 4TLFA 2XKPA 3MIHA 5LHIA 1BL8A 2CH7A 1VQ9V 1Y4MA 4IEVA 2ZGUA 2JDZA 3ATGA 3T1HO 2VNGA 2VZ1A 3OJBA 4CDXA 1KRIA 5FZHA 4QDSA 4GB33 1YDXA 1IKPA 1FXZA 3M4FA 2E7QA 3NJVA 2HYXA 1SACA 4KGQA 3ZRWA 3MIFA 2GSYA 5F3IA 1GLHA 2WLKA 5CFCC 2P6HA 3JCIA 5C7GA 1OSGA 5C8YA 1M93A 1O8SA 5DAPA 1V54B 4RQPB 1HRV1 5CKMA 3WB0A 3NAPC 4QB1A 4JI4O 4CDXB 1SQQH 5B1AC 3FUQA 4YVSC 4J6GA 4FFFA 4LO5B 4RHV1 4AVBA 1CPNA 1S0FA 4AHWA 4CUBA 2Y38A 4MTXA 1PO13 3M3QA 2LW7A 1B09A 5IDJA 5FP8A 4FLVA 1M4WA 3JYCA 1UZYA 4XUNA 1W59A 4LA3A 3ZKUA 2RDQA 1JVMA 5LOVA 4IESA 3ZXAC 1IBLB 3CP1A 3E35A 1IBLO 2QQMA 5BNPA 1GZWA 3SMHA 4QPIB 1S0DA 3KT7A 1H1MA 1ZX3A 4CUGA 1RB8G 4BH9A 3OGJA 1V55B 2RMU1 3OMNB 3BUCA 1ENRA 2WFF3 4O7XA 1BHBA 2VMHA 1HJGA 4AFAA 5CA0B 2UU8A 3AXDA 1XC6A 2GZWA 4UVCA 3TXQA 3NKTA 2IXJA 2I74A 3TK1A 3LF7A 4L92A 3LCPA 2ZNIA 1KP3A 3VL9A 5EP9A 3FAVA 2GC0A 4O4HA 4Y20B 3L9DA 3GF6A 3LOIA 1JZ6A 3O1RA 5F3GA 1GN3A 3THTA 4JKKA 3N7LA 1HRI3 3FFQA 2XVLA 4JTAB 1FATA 2CGPA 1Q90D 3POYA 2QE3A 1QHTA 4LBNA 1C28A 2F6BA 3TYJA 3RNSA 4P9OA 1AJPA 1UMZA 1QOOA 3HWJA 4E8DA 4O9GA 1CX1A 2GP5A 4JGYB 1F4AA 1D0GA 2AHZA 2DVDA 2Z0AA 4M3CF 3SHRA 3B77A 4UAPA 2FMYA 1IBMB 1WUVA 4DO0A 1S55A 4LR4A 2UYBA 3ABKB 1XILA 4YNIA 2A79B 3OD0A 2PFWA 2EJ7A 3C7HA 3T4HB 3A0HZ 5BV6A 3LNNA 1RMU3 5T52A 3QO5A 2DTWA 5ABJA 4NWWA 2JE9A 5LA6A 4LPLA 2X09A 3WP6A 5JVDB 4GCZA 1NU1H 3SPIA 2R071 1Q8VA 2WZR2 4JGZA 1QJZA 2R9RB 2IU0A 1UKGA 2JEXA 4GMP1 2A6ZA 3OMIB 1BVVA 1Q8OA 5DQ0A 1LUVA 5I0TA 2HJIA 4XFBA 5KA6A 1Q8PA 4Q4W1 1LU2A 3WB2A 5FP9A 3AP4A 1N0JA 1NVPD 5A32B 4MTGA 4BLJA 4QX0A 4EFEA 1FMD2 3VZOA 1JZ8A 3H1YA 1DQ2A 4CCNA 1GQPA 2V5DA 2A3QA 3LEMA 2N74A 2XNDG 3ZJZA 3U4SA 2R062 3I3BA 3SH5A 1XU1A 2GUZB 3B2EE 1XQNA 5EZWA 5JR7B 3WDTA 5AC92 3NQHA 3ZDSA 4CDWC 3E8BA 4DQAA 5KLVH 3HN3A 1KXGA 3WP4A 5L3GA 3N2GB 2BFUS 4BIUA 5HI0A 3DC5A 2EIEA 1DZRA 3ST7A 3BABA 4FPPA 3KQ4B 2B7YA 2X8KA 3WT3A 1EY2A 4L99A 1XL4A 3O9OA 4WV8A 1LU1A 1J1LA 5CMUA 4L0PA 4N9HA 3CRMA 4O4LB 1TE1B 1JOPA 3B9CA 3VHPA 1MQTA 4FFBB 3WF2A 3R4UA 1WW6A 3G71V 1QF3A 3Q4HA 1RUF3 5A7SA 1JR9A 1W9TA 4R50A 1X82A 2MPFA 5K0UA 5B3SB 4WVWA 1YJNV 2WUHA 3K06A 3J80N 4HPKB 2OWOA 3AG2C 4J11A 4AQ2A 5T5LA 5KXCA 4QPJA 4CVUA 4JASA 4MSWC 2IUWA 5A1FA 3KCYA 1JQ0A 3POEA 5I8TA 4MGTA 2Y8KA 3AB0A 1V9U1 3VDBA 5IYBO 3M3OA 1VBA3 3ZHSA 3VBSC 3P32A 3FMGA 3MZHA 2Y64A 1W6MB 1JZ2A 5E6HA 5IVYA 2VUCA 4OFGA 3JAKA 3IDEA 3VQWA 4ITCA 2XG3A 4HVRA 3E6BA 3HKEA 3QO8A 4LHLA 1NVPB 1CAUB 1XHXA 2OZ6A 4JPRA 3GHMA 1YCIA 1OUXA 1PK6B 3VD3A 1D4M1 2ZGNA 1ZZBA 3O0XA 3WG7C 1S0EA 4IXLA 4JKLA 4YYOA 3AP9A 4MVTA 3VDAA 2R30A 4JV5O 4BPZA 1WA8B 4MSVA 1Y6XA 2QUOA 3B00A 1HQLA 4E2QA 4A6SA 1C8M1 5E16A 5FYSA 1GMGA 1AYN1 1CX4A 2XXZA 1XNRO 1YF2A 1YXBA 2BERA 1QOSA 4BR6A 4DR3O 3J7MA 1AJOA 1JJ2U 2D43A 2ZHLA 3STZC 2WFPA 5G05L 4IE7A 1V6IA 1HDKA 2E63A 3EVKA 2GV9A 2ZX3A 3VV1A 5AFEA 1Q81W 1ZRRA 1Q8QA 1AI7A 2D6OX 1C4RA 1S1AA 2ETEA 1M1KW 1RUNA 5CA1A 1K5QA 4JI5B 2QZ3A 4OPHA 1W0KG 2TEPA 2EAKA 2FDIA 4IT5A 4AFMA 4TUYB 5ABJB 1YXWA 4DNYA 3OUSA 2K2SA 4JKMA 4FLYA 2PHWA 1PNKA 4MVMA 1RUI2 2XQRA 1CPYA 5HFLA 3H1LH 4XF4A 4KNCA 3S3WA 1M4UA 3TN92 5CKNA 2IJIA 1VBE1 3VBOC 1ZAUA 2EINB 2VMGA 4Y5SA 3D5OA 4UT5A 1X8EA 5CEHA 1RUD2 5IK5A 4XDJA 1W8OA 4AEDB 2VMEA 2XLAA 5FY5A 1YQCA 1MEC3 4HFSA 4P08A 5FZFA 3TEYA 1M56C 1R3JC 3RZHA 4DV4B 3RYCB 5GJ6A 5CBHA 2PGGA 1FMD3 2WN3A 2ZACA 5FXVA 1AR72 1Y9MA 3QLQA 2VOKA 3W7UA 3MGUA 1W9FA 2BGCA 2Q67A 3QCWA 4S2HA 3GWOA 2FQPA 4Q4X2 4GIQA 3TN91 2FDHA 1MACA 3JUUA 4XJUA 4AEJA 5C3PA 4RS5B 3RVHA 5A33A 1Y4WA 5J48A 4XUOA 1BGYH 1VQ5V 2VZUA 4R4ZA 4TN7A 5F39A 2JDIG 4I3PA 5FUNA 3WW4A 2GTSA 1UL9A 3JATB 4QKBA 3WHUA 3NV1A 2CGOA 4NXNO 4U7NA 1IS4A 2P3JA 3B02A 1RUE2 4KG0A 2H6BA 1IX9A 4WFHA 5C9AA 4RFRB 3OCPA 2VAUA 4JF3A 1P8JA 2ZAHA 4H7MA 1N1SA 4O65A 1N34B 1LOGA 3LE0A 2FCVA 1WB7A 4PDMA 3SNMA 4EB6B 1FJGB 1OKOA 4LK7A 1T5EA 1F51A 3BAAA 1LHWA 1B35A 1LGNA 1W2TA 5DAXA 3CBNA 1GSLA 2FD8A 1L7QA 4HONA 5IAXA 4GH4C 1HJFA 1UIKA 4EWDA 3AKRA 1KKCA 2RR12 2UU9B 1IS3A 1SEFA 2DYRC 3WFVA 1AI6A 1E1QG 2F43G 4CP2A 1GO3F 3KF5A 4CDUB 5GTIZ 1W39A 4KHPO 2Y60A 2PLV3 4EKWA 2EAAA 3AL6A 4U2AA 3RYFA 2IH3C 4DR2O 5FWEA 4P5YA 1RINA 1BBT3 1CAXB 2GSMB 4Q0QA 3WDWA 4LMFA 3APOA 5E89A 4ZBMA 4PI2A 3DECA 2QFEA 1CAUA 3F7VC 4YJ2B 5F2VO 5E1RA 1OXCA 2VXJA 1S2EA 3NNFA 4K8ZA 4DV3B 5L9RA 1DGRN 3BFRA 2P37A 3VKOA 2VPVA 1TMF3 4ZONA 2W5FA 3R4SA 3NV3A 1DLLA 3ACIA 1VQ6V 1M90W 1VBC2 1Y66A 1RUG3 3SPCA 1SCSA 4GAZA 4JI2B 2EILC 4MX3A 5LMNB 1BQZA 4CDWB 2QDOA 2VQ0A 4ZHNA 4AG4A 1VBA2 4AQYO 4CEWB 3PIGA 2RJKA 2R072 4AQ6A 3V0AA 5L3CA 3FLPA 3VQXA 2JDNA 4NIAA 1BK0A 4HPKA 1W8HA 4DRRA 1OA3A 1QQP3 4J9YB 1RVF2 4OGQB 1VALA 2PHRA 4PA9A 2WNVC 5FXZA 1KDMA 1U5XA 1O8PA 2JDPA 1IXBA 2HKXA 1KEXA 1VPHA 2IVJA 1UPIA 2AC1A 4XE9A 2ZX1A 1QCEA 2V73A 3DGEA 2P22C 2BBAA 1RFYA 3BIWE 2IU3A 1LCLA 5DECA 3RQ0A 2EXHA 3WW2A 2NM1A 4XW3A 5A3MA 1PM7A 1NY72 1E5IA 2TNFA 5CAZA 3RS6A 4FTEA 5FZ0A 1SZXA 1Z7S3 4EN7B 3OY8A 4PF1A 2GC3A 3ZMVA 5J96B 5LA9A 3ZMSA 4URAA 4DV7O 2UYAA 4QQOA 4AAPA 2D3RA 3C90A 4WM8A 4JI1B 4BIFA 4QX7A 3I8TA 2G19A 3E5QA 4CCOA 2ZM6O 2WZ8A 3OD4A 4PD4F 2JIGA 2XTAA 4BYYA 5F1RA 2JS3A 2UXCB 1GN2A 1HP8A 1VEWA 1G8WA 2WAAA 2ATKC 5LBBA 1B35B 4WVMB 4V1PA 2BTOA 2VQEO 4BQYA 1S72V 2Y34A 4CUCA 2VTXJ 2YC2A 3N36A 5LATA 1VRH1 2BTQA 2X29A 2DVBA 1ZBA3 5C4WC 3OFNG 4XZPA 2F4VO 1NZCA 2Q5ZA 2RDSA 4WFFA 4E2GA 1J3RA 5I0SA 5LY2A 1UYYA 2J1SA 1I7FA 4YM0A 1AR1B 4BXFA 2SLIA 3RMYA 5FMDA 2Q73A 4J41A 2LP7A 1AHSA 5KC6A 1DIWA 4WM8B 3KB5A 1MQTB 1GAXA 3STLC 2FZ1A 4OXSA 4RHV2 2OTJV 3N35A 5A33B 5EIBC 4EZHA 3FD9A 4UBHA 1R3KC 3EXUA 1IVSA 3FB6C 4J42A 3E22B 4B4RA 2H0VA 4Q4X3 2UXCO 1VF7A 3ZYRA 1N32O 2W47A 3OGRA 1GN4A 4AI3A 3IGAC 4FVVA 1GUIA 2XUEA 3TGUH 1QVGU 2P2KA 1EPWA 1S4CA 4MLOA 4AGRA 4NIDA 2HVKC 1STMA 1ND3C 4CEWA 3VZNA 1W8ZA 1WLTA 4Q8KA 5BXZA 4ABMA 1MABG 1IPJA 1W6NA 1O3SA 1QLEB 3WNMA 3T09A 1FPN1 3MIGA 1W28A 2E32A 2HBUA 4P9GA 4JYCA 5KXBA 5F2SA 1UU4A 1DYPA 5D8AC 1OZ0A 4MGQA 3JARA 3DGTA 2QTWB 4TTGA 5LRSA 1VBE2 1RUG2 1I0HA 1OF3A 5DN6G 3ON7A 1YFWA 2CE4A 3E5UA 5F2WA 1LECA 4Q4Y2 5BMVA 2A6WA 2Q69A 5FMBA 1WPBA 3NL1A 2YGLA 1XL6A 2AUYA 2HWC1 4AI1A 1QJY3 3AFGA 1U5YA 1WP8A 1Y76B 2F17A 1HXS2 1C1FA 4IGPA 5L73A 2D93A 4JI2O 4TLGA 2Y6LA 3O1TA 3WV6A 4NHXA 2CDOA 4QGPA 4J7JA 4Q20A 2HWC2 1P7GA 1AROP 2DYCA 4MUVA 2P6CA 1URFA 3QNEA 2QM7A 3RYFB 2VCBA 1NAEA 1TMF2 3N9OA 3LOBA 3SKJE 1ULPA 3MFAA 1RVF1 4UWDA 1OVSA 2BP6A 5FJHA 4A5UB 2E3CA 1N36O 1X7NA 5BNPC 1P7BA 4A7KA 4BE3A 1W9WA 3EQEA 1NA1C 3MUY1 1HNXB 2QKAA 4ASUG 4GMP3 4WF9V 1YLLA 2E6VA 3MFCA 3BHPA 2MW2B 4JI3O 3CYOA 4UW6A 4FOQA 1RL3A 4JDMA 4X20A 1QJX1 4I02A 4QPIA 2J1VA 3C7GA 2LFRA 3KT1A 2O1QA 5FPVA 3T4VA 4LBLA 2WL1A 1PX3A 1QNWA 4DRXA 3KSCA 5A2QN 1JYCA 4IYHA 1PO22 1Q86W 2Y69B 3B7MA 3TAYA 2ZABA 5CA6A 2IXKA 2CTPA 4QGMA 4QPIC 2X5IA 2RJ2A 3HAGA 3ZMUA 5BZBA 3VBHB 5L7OC 1SZBA 4ARYA 2Q1ZB 3GBGA 1J5EO 2WC2A 5H9SA 5CFDC 3HNMA 1ZZCA 1F7YA 4OUMA 1N34O 2D6LX 3C7EA 1ALYA 4MVRA 1GBGA 3SYQA 5DEDA 3OBAA 4C1WA 5LRRA 2R32A 5FY8A 2QTSA 4IEQA 3WQBA 3TEXA 3N2GA 4NB5A 3D8CA 4UFZA 3OE7G 1UU6A 2Y26A 1XMOB 2VRZA 4D7SA 5EJ1B 3ABLB 3I5DA 4RHV3 2YC0A 1DQ6A 3KLSA 4W4KA 1FXKB 3S57A 2WWWA 1SG3A 2Y6HA 1V54C 4HNAA 4INDA 3PJYA 2VVDA 4FOYA 1H4GA 4IEYA 4B3TO 5GZCA 1SLLA 4PA3A 2ZGOA 5B4XA 2VNOA 5GLZA 4DR7O 2D3SA 1EUTA 2Q6AA 2V1DA 3ZRWB 5JDBA 1H2KA 4O4IA 2W87A 2YI8A 2IXHA 3IIAA 4UV8A 4BWAA 4XYXA 4GMP0 1R1ZA 5FJKA 2PQSA 4Q8LA 3JXSA 4WM7A 2QKDA 2D5HA 1KQRA 3K0GA 1ZL8B 2EIMC 3IM0A 3MW2A 4AI2A 1YTFB 1V9U3 4B3SO 1UCXA 4DR5O 4UVBA 3IT8A 4RUFA 1I08A 4FO9A 1PM4A 4S2DA 3JAKB 2DW4A 4ZU7A 4JVAA 3ZN6B 4QDQA 5GALA 1UMIA 4IV3B 4I50B 5A7PA 4FTBA 5F6LB 2W39A 3T0BA 2WS92 4LC1A 3ZFFA 1H8TA 4HN0A 2R49A 1YQ6A 1RUD1 3DSQA 2DOSA 4PA7A 5GW7A 1F15A 3VBFC 3ZFGA 1YSCA 3ES4A 4NKGB 4GKYA 1ENQA 4M0NA 4Q4V1 2CDYA 1ZBE2 4CRQA 1GP6A 5BY5A 4NRQA 1E5SA 4JRLA 3WCRA 4PCRA 2LS6A 3N9LA 3GZUC 2YEVB 4M4PA 2QSAA 4ZHQA 4DR3B 4OCTA 3HNYM 4QKDA 2MEV3 3ZFFC 1GFF2 1XNRB 1HB1A 1C1LA 1ULEA 4XACA 3AXEA 2NNUA 4BQ1A 5JSPA 3FE5A 5M0TA 2WNEA 4O4LA 3LA3A 2DBNA 3RYIB 3IDBB 3MV11 2HWB1 3E8GA 4Q27A 3NMBA 2HWD2 3B5LB 3AVRA 2VZQA 2X5IB 3RT3C 1W6NB 4N43B 3FZ3A 1W2OA 4QIWF 1K97A 4DV0O 4B3SB 1VMJA 1YUDA 3WG7B 3K79A 1POV3 4IHJB 1W8UA 3SCGA 3ZHTA 2FL4A 3IC9A 4AYUA 1VBB2 3PUAA 1XPWA 4L97A 1VBD1 3LSSA 3MLLA 3K3WA 3F5TA 1W2BU 3HOBA 1EV13 2QA4V 4MZUA 5FPOA 4AVSA 3GWKC 3HPNA 1HNWB 1GP4A 2YB7A 1R1A2 4XOGA 1D2DA 2IZWA 1IKQA 3N9MA 3PU8A 2UWBA 1A8DA 5A7WA 4NYKA 4DRVA 1K3EA 2YEVA 2IH1C 1COV3 1XNCA 2AXTZ 4K6BA 4DR7B 1H0BA 2B9UA 5LL6Y 1UZZA 1MVEA 4B3TB 2V4AA 3O1SA 3DPRC 2IXCA 4UFKA 1FD9A 3A2FA 3RZGA 3V0BB 1V6KA 2EXIA 3OGGA 2E75B 3O0WA 4L8QA 1WKYA 2JGUA 2HWD1 2EIMB 3I2HA 4LT5A 5IY5C 5DM6V 1QJU2 2Q0AA 1WW4A 3OEBA 3TXSA 1QQP1 4ET7A 1PNLA 4E4HA 5FUPA 2CAVA 1DGSA 2ZTNA 1M57C 4YW3A 4ORFA 4QT6A 1H2GA 1NLRA 2PHFA 3L73H 1RHI2 1OHHG 2WT0A 5C5UA 5EIYB 1TME2 2PHTA 3OMAB 3WUDA 2ARHA 3B94A 3WNXA 2B9VA 5JUVA 3BOPA 1CGPA 3SYAA 3ZRVA 2XLGA 1K92A 3OUFA 1TVGA 5C4WA 1LESA 5F7UA 5FZ9A 1E5HA 2VVFA 1UO9A 1RUE3 3KHCA 1TAEA 2QQPA 3PTRB 2D3PA 2W0FC 4GXLA 2QCSB 3THDA 1O91A 3K4AA 1XU2A 4I9QA 3B8NA 1PGW2 4FP3A 1AR93 1NG0A 3AEIA 2GC1A 4LHSA 2ZNJA 1HQNA 2J1RA 3VZMA 2JVDA 1PK6A 5K1PA 5CYYA 1LAJA 5FXXA 4Y26A 1B06A 3WW3A 1AR5A 1HNXO 3WY6A 2OIIA 5LYJA 2WYFA 4TOIA 4YW1A 4DK1A 1N36B 4MVSA 4OVEA 4TSVA 1EAH2 4CE8A 4DUZB 3BA8A 4NPLA 4C8DA 4H3WA 3DN7A 4AQTA 1IBMO 2ZKOA 3BU0A 2OW4A 4K3UA 1IURA 4XDPA 3Q8CA 1XEQA 3D4KA 4RS5C 2NN4A 1EYBA 3CLPA 5JMCA 3T2OA 1R6NA 4XIKA 3TCUA 2WFF2 2VUDA 5D1IA 4LNUA 5TISZ 2ADEA 2OXBA 1ZBE3 4XF0A 4V2VA 5FOJB 3ZSEA 4NR1A 4DXSA 2QWPB 1S3JA 3M1HA 2VUJA 1M06G 4AW7A 1RXGA 1UAIA 3RYHA 2C5DA 2VMCA 4BK5A 4FXKB 2BTQB 3VHNA 2ZCEA 1ZRIA 3NJYA 4D0QA 1WA4A 3S7IA 4CS2A 1VIWB 4X20B 1W6OB 2R042 3CL1A 3E8FA 1SESA 4ZKTB 3KG2A 3U0ZA 4X6RB 3GNEA 2ZEZA 5FZLA 3CS5A 2CUGA 5HCAA 3ABTA 3NAPB 4HETA 4BQ3A 4I0AA 1EM1A 4LKFA 1UD1A 4HN1A 2HEPA 1YIPA 2E74B 3CPWU 3AK0A 3OR7C 4JQRA 3AK3A 3WDUA 3RI8A 4LF7B 3M70A 3B09A 5FQ0B 1NXD1 5EWSA 3PNAA 2VZRA 1JZ5A 1K5JA 5KC5A 1YJWV 4XAAA 5F5CA 2AW9A 2ARAA 5A7OA 2O14A 1RUI1 4JYAB 1ROPA 2HEWF 3CIHA 3KD4A 5IVVA 1K4DC 5A6XA 4K3AA 3PMEA 4HVOA 5IW0A 1ZL8A 3CJIB 2P3KA 3HKEB 4KWUA 4JI7O 4YM3A 3V64A 1PD3A 4B29A 1AF9A 4YG0A 1OT5A 3A7QA 1KP2A 2EVXA 4MOAA 1NTKH 1G9BA 4AHXA 3A4UA 2EX3A 4CEYC 3C7FA 2JE7A 3OYWA 1Y3TA 5FZ3A 4NTWA 5IK7A 3GJAA 5FY0A 2E26A 4Q4V2 1UYXA 3AP7A 4NAMA 1FOD1 1LRHA 3ZSKA 3ABUA 1AYM1 4XETA 2PAMA 3AL5A 4KXRA 3ETQA 3T1HB 4ZI7B 4AHZA 1AILA 5A3WA 5FYTA 4AVVA 4YHHB 4IEZA 4XUPA 1RMU2 2BOIA 3RYKA 5EYPA 1W8WA 2CYFA 3DKQA 4HG6B 5FLIA 3JU9A 5B1BB 1WPXA 2Z79A 1CR7A 2GU9A 2XOKG 1JMUB 3NNMA 2YXLA 4K1YA 5J3UA 1BVP1 2ES3A 3DPRA 1UOGA 2BOJA 4W65A 3L2HA 3RJRA 3VHOA 2GUZA 2YUEA 2VBBA 3X2QB 4M00A 4Y22B 4LHNA 3EFFK 2OS2A 2UXBB 3LZZA 5A32A 2L35A 2JS5A 4DO2A 1COV1 1US3A 2C26A 1BQPA 2QWOB 4K9SA 4CXWA 3CXHF 1BHAA 1F4HA 2R9IA 5GLVA 5C4WB 1RXFA 1P4RA 1U97A 3LDDA 4GKKO 4J7ZA 1FXHA 2WPDG 1PK6C 3O65A 4UVAA 4YRDA 3K2OA 2GMEA 5H5NA 1GZ9A 3POBA 1JUIA 2NYYA 4TWKA 5FZ1A 4OMDA 2J1EA 5FPRA 1ASJ1 3J8F3 4P9JA 3THPA 2UY8A 4EN0A 1SMVA 1VF5B 2VGDA 3FHAA 1GOGA 1JH5A 3SCHA 1N1VA 3W5NA 4ARXA 1KFUL 1OUSA 1SLTA 3P6BA 4QPYA 1QH6A 3GZTB 1TG7A 5A3PA 3WCSA 4NE9A 1KGYA 2LQTA 2DF7A 4Y33A 1OBNA 2XBO2 3KKYA 2YGMA 2RE9A 5IYZB 5AC91 1URXA 3N27A 5LMNO 2D40A 5FO9B 4CU8A 4D6SA 4Q4Y1 5DZFA 1RHI1 2BJSA 2DVAA 1O9GA 1DZQA 2R043 4JTCB 2VOVA 3KZ4C 4BWOA 3VLBB 2A75A 3LQCA 4NHKA 5JSOA 2W9XA 1RUF1 3CEWA 4LFAO 3I3EA 1ZVFA 4EV0A 5KHJA 2IFWA 1GANA 5CIRA 4HT1T 4DV1O 5IVBA 3E8HA 3OR6C 1Z7S1 4MO3M 1V9PA 2LGWA 2RS12 4DV3O 3BCCH 5T5OA 3DF0A 3NWKA 2ORXA 3JZVA 5EZYB 3MICA 1FPN2 3MUZ1 3FJSA 3BVCA 1LOEA 2DBIA 1L0LH 3I56V 3BODA 4NPMA 2V4DA 4UOJA 3LSEA 2ZX4A 3H50A 2EZPA 1OPMA 4I2OA 1I3HA 4FPHA 3LPGA 4PA6A 4DUXA 4LBMA 4DR4O 4FPLA 3CQOA 2X05A 5C8CC 5F6KA 3OPZA 4NPRA 5FL7G 5B66Z 4QM8A 2UU9O 3FHQA 4XQDA 4CU7A 4MS2A 3POIA 4UUJC 1TUEB 4N43C 2BW8A 4RAIA 4RQFA 1FJGO 3JBG1 4X88A 3VDDB 1OCZB 4KWLA 3OT7A 4Z07A 2WZPP 3ZXFA 4Q4W3 4Y24A 4CDUA 4U3JA 5EC2C 2EIJC 1MS9A 4QXCA 4BXSV 2WWSA 3N2KA 3D3AA 2ZPXA 2NN8A 4ZI7A 1SPPB 2ZD9A 5B2GB 3WG2A 4H33A 1OA4A 4MYEA 1JXNA 3S5QA 4AHYA 5J98B 2VR4A 4P9LA 4QU2A 3TEWA 1GWKA 2WNOA 1MA1A 1JBCA 1Y43B 2BVVA 4I01A 3WNLA 2R6QA 1D0HA 4RGGA 3UCSC 5FNVA 1DQ5A 2FDGA 3JARB 3TETA 4KL1A 5H9RA 4K20A 2BOBC 4RUEA 2R0FA 2RNBA 3WNPA 2ZGSA 1AZDA 3POFA 3K4DA 2VOWA 1UY1A 1F8VA 2H3OA 4LF5B 2P4EA 4DV4O 2ZEXA 3VKMA 1JPXA 1MEC2 3LD8A 2P3YA 4CCKA 2ZR3A 4NRMA 2G9GA 1DFQA 2BWAA 2IXIA 4LH7A 1NJIW 3KVAA 3NV2A 1LTEA 1I6XA 4FFKA 3G6EV 1UPGA 4KFMA 4MGZE 3RPQA 1XRUA 2KB1A 4JGSA 1S0BA 2RR13 3GBWA 1GNHA 5DABA 1JHJA 2IC1A 5CFCA 4DR1B 4OI2A 5KA5A 1UPSA 5F5AA 3WDYA 4GX0A 4WBBA 1UY2A 4CTEA 2DWDC 1Q5OA 2WWJA 4LF5O 1A34A 3O0VA 1OCCB 4KP4A 1FMD1 2QM8A 3UKMA 2JDYA 2W68A 3ICXA 4LLOA 4ASMB 3HKCA 3NR7A 1M5IA 2YV8A 1RPOA 4ZY9A 3K4ZA 4OI4A 1ND2B 4Z1VA 5KHKA 3PVNA 4I4TB 4YG6A 3SYCA 2BQPA 5BNNC 4Z2WA 3LDRA 4O61A 1XJAA 3PUQA 3ILRA 4XFCA 4LFBO 1FAYA 1XYPA 4XMAA 4PJ0Z 4WFGA 3KZIZ 4DXWA 3MEPA 5JJNB 1SQXH 5LK5A 5LP6A 2CWSA 4Q1PA 4XIOA 4C0HA 3L74H 3EJKA 4COYA 2ZGLA 3EBRA 2ITDC 1QLEC 5BNNA 1DG6A 2PYJA 5EYXA 4EN6B 2RHPA 4DRXB 5FZBA 2O8OA 1GU3A 2K0GA 5KWRA 2YFUA 4LK6A 5DAWA 1JYIA 4RR3C 2YHJA 2J42A 5IWFA 3AYCA 1RUE1 5ACA3 4GKXA 5LW9A 2LGQA 4LF4B 1BMV1 4JV5B 2I2SA 1WCDJ 5EK0A 1GKBA 2DQ0A 2DFCA 4EEQA 1LHNA 4XFIA 3BTZA 2VBDA 2RDNA 3O7OA 3ZIXA 2JENA 3KVBA 4KG8A 2CAUA 2VQUA 1IHMA 3AMNA 1C5HA 2WNVA 1QQCA 4CH4A 3O14A 3I7DA 4DR4B 1QIQA 4AL9A 1PVC2 2P5OA 5FP3A 5FQ0A 2Q8VA 3OBZA 2DYSC 4LR3A 4HKOA 4A7YA 4WBNB 1X8MA 5BPXA 2HWE2 1YZBA 3CD6V 1UIJA 2D97A 1CQ9A 1IXMA 1ND3A 4HSLA 3D0SA 2YS8A 3ZM8A 1AR82 3MHSC 3Q8EA 2VQTA 3IIIA 2OKXA 2P1BA 1BLZA 2EXJA 2ZZQA 1D2QA 5GM0A 1FYJA 2V5YA 3HQRA 3AVSA 3JASB 3D0JA 3ZYFA 4DV1B 1HR0B 2JJ1G 3ETGA 3K59A 4HAMA 4W6XA 1PIV1 4N23A 1CZTA 4CDQB 5JI7A 3N2KB 4RGKA 4SBVA 4YPJA 2OUJA 3LDCA 4XQWA 5A6ZA 1LENA 1NCQC 1WMXA 4N53C 1KJRA 3HBZA 4R7CA 3VN4A 3PTYA 1POV0 3JB4C 3F5WC 4FPYA 5IATA 3K9SA 2JDMA 2WO3A 5DUWA 2BE3A 2R9AA 3V0BA 4K21A 5EIBD 4QXKA 2ZIOA 4D7TA 2YICA 3JAWB 3LDEA 3HB3B 2OCCC 2TBVA 3ZIWA 1C5IA 3N7KA 1BE3H 5A7QA 4FQ4A 2IJKA 2VW0A 5J2UB 1YFXA 4ZXKA 1L0NH 3A21A 5L9VA 1OOPA 1FOD2 4LH6A 5SV5A 4BCUA 4L2NA 3OGIB 2PA7A 2VMDA 4QQHA 3ZLIA 1GZWB 4MGIE 1H6YA 1IG3A 3WW1A 2WAOA 3MHHC 1GYKA 3AFKA 4YM1A 5D5PA 2YIAA 3ZN4A 1YITV 3BA9A 2UWAA 3I97A 1Z2GA 3ZN0A 4MGSA 4UW5A 1W0PA 2QWNB 2BWCA 5FBJA 5FYYA 2BZDA 2ZDIC 3LEGA 1U5IA 3BI3A 2QWQB 3BGAA 2PUSA 2YYOA 2IM9A 2UXNA 3PDQA 3ZBHA 3GGLA 1YFUA 3I3MA 5IAVA 3QH6A 1WCKA 3NSTA 2JECA 2ADPA 1FKAO 4LE3A 4G9SB 2XVKA 3O1MA 5LASA 4XDQA 5IVEA 4ASKA 4BOWA 2AZ2A 2GBOA 3A22A 3AMMA 5IYCO 4UFLA 3CJIC 2ZINA 1VR3A 4YHHO 3I4IA 4QM9A 2WLLA 4NO4A 5FLHA 3LDBA 2Y4UA 4JI8O 1VLNA 4IV3A 2VG9A 4I09A 3A0NA 3ZRXA 2W2IA 1OCCC 2K46A 3O1VA 3TRSB 2V09A 1RUH3 4R52A 1HW7A 1CAVA 2DYSB 4B4PA 1W3XA 1NBMG 1RTVA 4XQ4A 4XF3A 1OCOC 5LY1A 1HXS3 5JVDA 4JI7B 3LIGA 5EJ3A 2VXRA 3O1UA 4JZRA 4W6WA 5LA0A 2XL7A 4N7IA 4FPCA 4DR6B 3HN1A 2W46A 3D6EA 5J37A 4JYAO 1MS8A 5C93A 2Q1MA 4N8MA 2A3XA 2BSKB 2OA2A 1ZBE1 5FP7A 3VBUC 3PLQA 5FTTC 4EB6A 4YG3A 1PGL2 1EFRG 2HWE3 1AP5A 2HHHO 3RJ2X 2P67A 5FZIA 3BB6A 2UUBB 4LF7O 4Y22A 2RS11 3VD7A 3OOXA 4PDVA 1NH2B 1IGOA 4N43A 1AR83 1GV9A 4O4HB 4Y20A 1CIWA 2IVIB 3RDIA 3TJTA 3LKJA 3ZFEB 2A1XA 2W92A 4CCMA 3MPPG 3DXTA 1NXMA 5C70A 3CCRV 1VARA 4RA0A 3G80A 4JI4B 3ECQA 2BDRA 3THCA 1G86A 4AE2A 3A0BZ 4UCSA 5HBAA 3IMNA 2VZPA 3NW4A 4BW5A 1J58A 5HV0A 2VCMA 5CU1A 1F31A 4I7ZB 4JAAA 3AKPA 2ET7A 3DTUB 5BYNA 2JKXA 1TVKB 1R1A1 2JB4A 1J95A 2ZZJA 4KI5M 3JALA 4GQ7A 5A80A 1DZTA 4X62B 5FV3A 4ZS3A 4COWA 3S30A 4FMTA 2M6YA 4BU2A 5FDBA 1S5LZ 3SJBC 3J81N 1L1FA 1TGOA 2PF4E 3H1JH 5FZ8A 4WVVA 1N4CA 2VL4A 4CC6A 2KA3A 2ENRA 2XT9A 4HOOA 4K1ZA 3K75B 1FI2A 3ZXGA 1ODMA 1QJU1 3SLIA 2Y6KA 4KMQA 5GZEA 4YVWA 3OGVA 2W91A 2X6CA 1YFYA 4EQVA 3SEPA 2Q9LA 3JSLA 2HWF2 3LGRA 4FM1A 3FYEB 1HW5A 3SGIA 1ZLZA 3LEIA 5FZEA 5ITZB 3AMQA 3ZIAG 2RJLA 4UCOA 1HNZB 3CC4V 5KUMA 3M3EA 3OUHA 3I2KA 3T3YA 1YTFD 1APNA 4JGZB 4FPEA 4H44B 1ULFA 3ALQA 5C9AB 3Q8BA 1SRYA 1ASJ2 1GWLA 5JZGB 4I3GA 3RG0A 2WLHA 1S2BA 4V2WA 2YY1A 4GALA 2OPKA 4LIUA 2PAKA 2WLQA 1R73A 1CN1A 1CWPA 1QU0A 4I0XB 2XJUA 2WRAA 3SH4A 4FFHA 1WBFA 2PHLA 2VZVA 5IJ9A 5LP6C 1Y9QA 1BEV3 1XNTA 2QKSA 5J36A 1ULDA 2ZAAA 5LYJB 1WB8A 4E2SA 2PYTA 3KV6A 2ILMA 3WG4A 4JI6O 1W90A 4QPGB 5JQGB 4OQ8A 4H2AA 1DQ4A 4I5SA 3ACGA 4DUWA 4XF1A 2K9ZA 2VBPA 2ZHMA 4NVPA 3USUB 2A7WA 5LHGA 3ZSMA 5LXTB 3KS7A 1EN5A 4R9DA 2HEYF 4R9AA 1MZ5A 4CP9B 2GP3A 2QQOA 3I2FA 1I5XA 2G4IA 3VBFB 3NNGA 1V6NA 4QU1A 2CSGA 2I07B 4QAWA 4B7EA 3WB1A 4OYUA