1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
3DV8A 5KBFA 3U11A 2ZKLA 2OZ6A 2BNOA 3PLQA 4AQ2A 4IERA 3RYPA 5FPXA 4TLFA 5LEJA 1OMIA 2Z69A 1RC6A 1CAUB 1J1LA 1LB2A 2FQPA 2GC2A 4PIYA 1ZZ9A 4XF4A 3UKNA 1UD1A 4HN1A 1ZRDA 1WGPA 4I2OA 1O3SA 3WW2A 1FXZA 2O1QA 2OYZA 3SHRA 5FPZA 4XFGA 4AVCA 1EP0A 4XF1A 4B29A 4FAGA 5FQ0A 4BIFA 3GYDA 3D0JA 4FBFA 1ZZCA 2D93A 2IXKA 4QGLA 4L2NA 5EFUA 4IEYA 3UKVA 1ZVFA 2IXLA 2GH2A 4HN0A 5BXXA 1Q43A 1CAVB 4UBGA 3SXWA 2PAMA 4IEWA 1ZREA 3WW4A 4EWEA 4Z82A 2GC3A 1YLLA 3NJZA 3E5UA 2VPVA 3H3UA 2GU9A 1LR5A 3LOIA 4HSJA 5KHHA 4Q0VA 3WW1A 4HMZA 1XE7A 1Q3EA 1YFYA 2QVSB 3KCCA 5C6CA 2PTMA 4ZU7A 1CAUA 3QOPA 1ZX5A 1OD5A 1DGRA 4I02A 3CJXA 3UKTA 4O9GA 2PAEA 2H0VA 4AVAA 3E6DA 5KHGA 2IC1A 5I91A 3CLPA 5C8WA 2PFWA 4OFGA 5I8TA 3H8UA 5I0RA 1G6NA 4EWAA 4IEPA 3MPBA 4IETA 3KMHA 3NSTA 3BPZA 1RL3A 1QY4A 4X6QB 5BPXA 2UY8A 2XGXA 2CAUA 2ETEA 5CVRA 4QMAA 2EA7A 2BNNA 2E9QA 2WC2A 4XF9A 5CADA 4XFAA 1IPKA 4EWDA 1CAVA 4YYOA 3USSA 3EJKA 1O7FA 4MGYE 5JR7B 5BV6A 2Q1ZB 5JSOA 2EAAA 3H1WA 3E5QA 1YWKA 2ET7A 3M70A 2I45A 4IEUA 2DCTA 2IXJA 2B8MA 3OGJA 5JSPA 3RZZA 1J59A 3TNQA 4FT8A 4Q0QA 5JSRA 2XKOA 4XEZA 4ZU5A 1QWRA 3FFQA 1YFWA 2QCSB 2MPFA 2XLFA 2O8QA 3RYKA 1X82A 4DINB 4JV4A 5LRRA 1ZZBA 3CL1A 3S7IA 3EBRA 4GULA 1XE8A 4N9IA 2D40A 3IIAA 5J7MA 1DZRA 1NZCA 5KHJA 1GQGA 1O4TA 3U0ZA 2ZCWA 1J3PA 2Z2SB 3NW4A 1ZRCA 1CX4A 3IBMA 4K8FA 2KXLA 1YFXA 3CF6E 4YSFA 4HLTA 5EZWA 2IXHA 3CEWA 1TQ5A 1I6XA 4D7SA 4J1XA 4R52A 4JVAA 4X6RB 4BHPA 4Q29A 2GC1A 5I0SA 3M3IA 1PMIA 3PNAA 4QXKA 4I09A 2MNGA 4QGMA 3DKWA 1HW5A 3LWCA 3MZHA 3H50A 1YUDA 1X7NA 1L3JA 4HVOA 1DGWA 4YNIA 2D5FA 3D0SA 4I0AA 3BCWA 3S0MA 1X8MA 2K0GA 3IWZA 4MH0E 1O3QA 1ZZ6A 4IEXA 3E5XA 4LULA 2P17A 4LUKA 3NVCA 2CGPA 4HSLA 4Q0UA 5FLJA 4BYYA 1CAWA 3LA2A 1FT9A 1Y9QA 1WLTA 3KGLA 2Q30A 3IDCB 1PM7A 2XLGA 1H1IA 1UIKA 4L11A 4YARA 4QX5A 3IDBB 3S7EA 4EROA 2HKXA 2FMYA 2N7GA 3H3ZA 2OA2A 1SFNA 4LA3A 4I0BA 3EHKA 1LKNA 2QNKA 4LLOA 2BYVE 4Q0PA 4MGIE 4QGNA 2BGCA 1GQHA 2CAVA 5F1RA 4MV2A 2PHLA 3H1MA 3U10A 4CYDA 3E97A 4PJYA 2PA7A 4E2SA 3HQXA 3HT2A 2XL7A 2BEOA 4LUMA 2GZWA 4MUVA 4WBBA 5K8SA 4EV0A 4IESA 3ES1A 3LA7A 1IPJA 4JTOA 2XKPA 2Q0AA 4IEQA 2H6BA 3MDPA 5I8SA 1X8EA 4FAHA 4IEOA 4J1WA 1O5LA 3VHRA 2EVXA 2UY9A 5KHIA 5I0UA 5BY5A 1J58A 1XRUA 5J48A 1OI6A 2QDRA 3EQEA 3G7DA 1EYBA 2ET1A 5LEKA 2D5HA 5JAXA 5FQ0B 2B5HA 3QACA 4N9HA 1JUHA 4XF0A 4XF3A 3B02A 1VR3A 5I93A 1J3RA 3GBFA 2XL9A 4ONUA 3I59B 5FLIA 3ELNA 3R6SA 1U12A 4XETA 5D1IA 5JCTA 3D82A 3ZDSA 2F4PA 1VP6A 1NE4A 3SCHA 4BH9A 1YHFA 2OPKA 2BNMA 2GC0A 3ETQA 2IXIA 4UBHA 2GAUA 4ZU4A 2XLAA 5FDBA 1ZZ8A 3I54A 4META 2K9ZA 3HT1A 5LRSA 3RYRA 1CAXB 4XFIA 2B9UA 1J3QA 3OTFA 2VQAA 4JTNA 4LEJA 2IXCA 2PAKA 3E6BA 2ATFA 3FZ3A 3ACLA 4XFFA 3KSCA 3SMHA 5FCCA 3NL1A 3FE5A 3BU7A 3TNPB 3L2HA 1NE6A 2WFPA 1WA4A 1NYWA 4KWJA 2Y0OA 2OZJA 4I3PA 4AQ6A 1ZZ7A 3MYXA 1ZRFA 3OCPA 3N4MA 5KHKA 3BB6A 3SCGA 3C3VA 1V70A 3DL3A 3ES4A 4PIXA 4Z07A 1LRHA 4WVZA 2C0ZA 4Q0SA 3I59A 3H7YA 4PIZA 5FLHA 3O14A 4I01A 4WZCA 1SQ4A 3FJSA 3JZVA 3RNSA 3H1YA 1DZTA 1QXRA 2HJIA 1H1MA 1ZRRA 4OLLA 3FX3A 4P9GA 4YRDA 5T3NA 4LA2A 4MZUA 4AXOA 1UW8A 3OF1A 1NXMA 4IEZA 4KWKA 4O9EA 4ORFA 3ROUA 2V09A 4NVPA 2UYAA 1O5UA 4D7TA 2Q4SA 1EPZA 1SEFA 1Q5OA 5AVPA 4MGKE 1YFUA 1CAXA 1UCXA 4XFBA 5E1RA 3RPQA 3KGZA 1UIJA 4F8AA 4KWLA 4H7LA 4LTAA 3LAGA 4HBNA 1UPIA 4KU7A 3OD0A 4E2GA 3CO2A 3LZZA 2UYBA 5HI0A 5J3UA 3WW3A 4XFHA 4KL1A 1FI2A 5CU1A 2PYTA 1RUOA 1RTVA 2H6CA 3HIFA 5E16A 3E6CC 1ZNPA 3H9AA 4IEVA 4R8HA 4E2QA 5I8YA 2VECA 3EO6A 5BUVA 4HVRA 2PQQA 3ST7A 4XFCA 1Y3TA 3DN7A 3PVBB 1CGPA 3NKTA 2CV6A 1OFNA 1RUNA 2QJVA 2MHFA 4F7ZA 1EY2A 3LA3A 5I0TA 1O3RA 3RDIA 4A2UA 4KU8A 3FHIB 2PHDA 1I5ZA 4RD7A 3BALA 2XHKA 1O3TA 4HVQA 4MGZE 3H7JA 1VJ2A 3FWEA 4MX3A 1QXJA 1RGSA 4AVBA 4QM9A 1CAWB 3SCFA 4UXAA 4QM8A 4HZFA 3I7DA
chains in the Genus database with same CATH superfamily
3QG5A 1YJKA 1Z0HA 4GWMA 5EPAA 1K5MA 4WM7A 1SC5B 5JXJA 4PA6A 5IJ9B 2YSUB 5E1AC 2E31A 1YXBA 3B4SA 1FXZA 1YQCA 3AX4A 2O1QA 4GCZA 5C9AC 4QHBA 2OTLV 2X6BA 5C93A 3DTUB 1TME2 1H4HA 3INAA 5DG1A 2IXLA 2R9IA 2ILMA 1RVF1 3SJAC 3GGLA 3E86A 2J1EA 2V1DA 2ARCA 4JX0A 3VL9A 4MXWA 2CU5A 2W46A 1D0HA 1EBOA 3JSLA 3VBBA 5BNPC 2X7RB 3DXRB 4E9KA 2ZKNA 4FZ0A 1EV13 3ZMUA 5H5NA 5F2SA 1ND3B 3RYCB 4Q4V2 1D2QA 1H30A 4MHRA 2HWB2 4I02A 1TMF1 5T52A 4IGGA 4CP2A 4ZZ8A 1RXGA 2NR5A 3JBG3 2JE8A 3CLPA 1AYN3 3I5DA 1V9U2 1TUBA 2RDSA 1IBLO 2JEXA 1KMIZ 1RL3A 2QM7A 5BPXA 2YXHA 1DGSA 5LA2A 2UXNA 3N36A 4DQAA 1W9WA 4GIQA 2R1BA 1SDDB 1I5PA 3OM3B 4YGCA 1JYNA 1RSOB 1TME3 2Y6GA 2P2KA 4DR6B 2WKKA 2PY5A 1G9BA 1TAEA 4CCCA 3OMNB 4KG8A 2X53S 3GBGA 1GQGA 2LO1A 4XAAA 2WT0A 3HKBB 3BIWE 4N8MA 2E63A 1XSQA 4QPGA 2CNAA 3LPGA 3VBSC 5AC92 2Y69B 3R4DB 5FYBA 4LNUB 4Q4V3 4M01A 3DGEA 4IQPA 3AYAA 2WWJA 4LF8O 4AG4A 1W8TA 2HWB3 4EFBA 3J9SA 5DAVA 4QDRA 3AMMA 4A6SA 3D0SA 1O9GA 1DIWA 5FY7A 1V9U3 4IEXA 1RINA 4QWNA 4P2ZA 5JI9A 4HFSA 1YDXA 3HPNA 4JRLA 2OW4A 3JD0A 1WLTA 4L11A 3QCWA 1Y6XA 4QX5A 2VCBA 3M2MA 1LHVA 4UXNA 4R9BA 2XBO2 4K0KB 4URTA 2IFRA 3L75H 2VQFO 2JB8A 3CXHF 3B00A 3PHMA 2JDPA 3AG7A 5BNPB 2P6CA 4AFBA 4ZKIA 5LYJA 2L35A 4JI5O 3NV2A 4MUVA 4WBBA 1RUG1 4IGPA 4WFHA 2EX3A 1WP7A 4FPKA 3VHOA 4XCBA 1VQ4V 1XYOA 4RO2A 5FO7B 1PD3A 1AF9A 1NTKH 5IK5A 5AC93 4BQXA 4XTMA 2Q7EA 1VQKV 4XUTA 2B5HA 3NAPA 4CBCA 2OT7A 1SKVA 4YM2A 3AMQA 1TG7A 3R66A 4QE7A 3I59B 2RR11 4YPJA 2RNBA 4B4RA 2XJUA 4XETA 3TCUA 3IKWA 1CD3G 3WV6A 1OD3A 4RWUA 1D4M1 3B01A 2TUNA 5JIAA 1STMA 3BN6A 2XBO3 2W08A 3ZMOA 2E53A 4ZU4A 1Y7BA 4X8AA 1NY72 3CE2A 1KGYA 5CB4B 3CCSV 4GB32 4U3FH 3B77A 1S0CA 4NHKA 3F5WC 3M8LA 3FE5A 1H4GA 3SYQA 3AP6A 4CCNA 2VL4A 3ABMC 2O8OA 4TWTA 3VBSB 3UNPA 2VVFA 4NPMA 4JQTA 1NUKA 5C4WA 3MYXA 5DUXA 1YIPA 3WQ7A 5A3LA 1A78A 3L9DA 4COVA 4N21A 2CH7A 1ND2A 4M4RA 5LK5A 2ZOEB 4JI3O 4Q6GA 3MHHC 4M0HA 3ZHRA 2PHUA 2ERFA 1V6IA 2YI9A 2Q7HA 4MTXA 4N53C 3FX3A 2WZEA 4MT8A 2JEMA 1S3JA 1G9AA 1SA0A 2JDIG 1Q5OA 3ZYFA 3RPQA 4XFBA 4KI5M 2Y4TA 4X89A 3K4ZA 4ZS3A 3R05A 4GWJA 3BHPA 3L9JT 5KAIZ 5K1XA 5FNVB 1F4MA 4C90A 5FPLA 3ABKB 4GB33 3K08A 5BUVA 2DV9A 5LP6A 4Q4X1 2H3OA 3D6EA 1OA3A 1CXZB 4NXMB 4GKKB 3UYJA 3LQCA 3BALA 1ZAUA 1QJX1 2WT2A 3RS6A 3JD3A 2WQZC 3LF7A 1Q8IA 1Q8QA 3JCIA 2YC2A 4XDJA 1VBB1 3SCFA 2G38A 3B5LB 4I50B 1S0EA 4Y26A 1Q8OA 1W3XA 4CCMA 2ZKOA 2PGGA 2CUGA 1HV0A 1VQ6V 4UFMA 1UMZA 2BU9A 2AHYA 3E1F1 4W6WA 1SPPA 3WY6A 4C91A 2Y33A 3BA9A 3ZN0A 3K57A 4GMP0 3H1JH 1Q43A 1P7BA 3PU3A 1NLSA 2UXCO 4PQ9A 3X29B 4Y4YA 3ABMB 4JPRA 1T5EA 4TYSA 1AR5A 3LOIA 3JASA 3WW1A 1BCCH 1VMGA 3W7WA 3ZS8C 1RUH1 1K34A 4JI1B 3URFA 4N53B 1HRV2 3UKTA 2UWAA 4AE2A 2VNRA 4AVVA 4NWWA 3H8UA 3ZX7A 1S2KA 3ABUA 1I94O 4YIOA 3KT7A 3GXUA 1LEDA 1DGRN 3U14A 1CAVA 1S1AA 5IVVA 4LT5A 1IPSA 1AX1A 1FJGB 1QEXA 1S5JA 2IXJA 3RZZA 2ZE5A 1LU2A 4XACA 3IB3A 4FPPA 4QKDA 4TUYB 4GX2A 3TN91 1C8M1 2RHPA 1M9NA 4PDLA 3ZXEA 4JHTA 3SQOA 1S72V 1A6CA 3O12A 2RMU1 4QKBA 1J3PA 5E8AA 4LHSA 1D5NA 1QQCA 4JI6B 2HLEA 5EZWA 2IXHA 3TETA 3K77A 4JGYC 1AL22 1Y9MA 1MACA 1W6OA 2Q73A 1QJU1 4HG6B 3B7MA 2MW2B 4DMIA 3LWCA 1GLHA 2PHWA 1HRV3 4ZHQA 1ACCA 3KZ4C 3CC7V 4I7ZB 5EIBC 4X65O 1VBD2 2DTYA 2WN3A 3ZXKA 2Q6AA 1W8ZA 1UMIA 2VTXA 4N7IA 3JD71 1XQ8A 4GKYA 1PM7A 1KU9A 3OGVA 1LENA 1B04A 3BEHA 5KUMA 3GZTB 1S2BA 4DW1A 1N1SA 5CBFA 5FRAA 1XNKA 1SFNA 4I0BA 2Y48A 2Q8VA 3I3MA 3O1OA 1FAFA 1VBA1 2CAVA 4PD4F 1LHNA 1KECA 1UNBA 1W04A 3POEA 3ZM8A 2UWBA 1RVF2 3M7MX 1KB9F 3HB3B 4FLZA 4S2DA 3ZRSA 3JQWA 3K5NA 1OKOA 4Q8KA 5CNAA 1RUI1 2ZCEA 4FAHA 2ZEZA 2RV9A 1AL23 1WCQA 1OI6A 1HR0O 3EQEA 1EYBA 5FZ9A 1HQWA 2QBXA 4ZI7B 3EVKA 3ZEDA 1IQDC 1TMF2 3NJYA 1VBD3 4FFBB 1H8HG 1N4CA 4O4LB 1I5XA 1IX9A 3RGBA 3D82A 3N9LA 4DIQA 2F4PA 2YBSA 1NE4A 3QD6A 2WIIB 4XUNA 2QZ2A 4MTGA 2VQUA 4PV1B 4AGGA 5KC5A 1AJKA 2DCJA 4X62O 4W4KA 2WFF1 3SH5A 4XFIA 4YGBA 4M3CF 2IXCA 1HQLA 4A42A 2E7QA 1M90W 4QGPA 2WWUA 4XFFA 3BYWA 5FCCA 4P02B 2PZSA 3O0VA 2UUAO 4BQ1A 4JGYB 1RVF3 1K4DC 3FB8C 2Y0OA 3AVRA 1ZRFA 4AFCA 1VF6A 3SCGA 4JI0O 1QGLA 1G86A 4KGQA 4I01A 3ZN4A 4PBPA 3RNSA 3H1YA 2QWQB 5CFCC 3PIGA 4LOSA 3ZHTA 5EZYB 3T0AA 1E5IA 1F4NA 2ARBA 1GZ9A 2DWEC 1TMF3 4LCUC 1FFXB 5CA1B 1RFYA 4W50A 3J4UH 4YG6A 4H7LA 2YPJA 1JQ0A 3ZXFA 5FYTA 1Y76A 5HI0A 3KS7A 1YVWA 4AL9A 2WO2A 1N32B 1FI2A 1BBT1 2BOJA 4UFHA 2X6AA 3KVBA 4TV9B 1NLQA 4O4IB 4DZGA 3H1KH 5APAA 3ZHSA 1RJ8A 3I2JA 3NKTA 3SLIA 1JW6A 3LCPA 1RUNA 1UU4A 2C9AA 4QJFB 3CIHA 3UJOA 1RUJ1 2CSGA 1GU3A 3ZDVA 4HYOA 1RUG2 4LBQB 1GZTA 3C7OA 4LWSA 3RVZA 5CKMA 4DW0A 1DLLA 5HBAA 4QM8A 4HZFA 2GP3A 3WF4A 5FOJB 1QLNA 1V55C 3IAPA 4AEJA 2IFWA 1REDA 1OMIA 1NJIW 3BOWA 4LITA 5JLVA 4H33A 4K3UA 4I2OA 3Q8AA 5LGTA 4ASUG 1W6MA 4B29A 4BIFA 4DB5A 4R4XA 1AX0A 2RR12 3GHMA 3N7JA 2XAJA 5IWAO 3LFIA 2I07B 2HFEC 5KUKA 1D4M2 5LMNB 1VQ9V 4ASLA 1H1AA 3S6PA 3MFAA 1W6NB 5HV0A 2QKCA 2QVSB 3RZMA 2ADPA 3OGIB 4WM8C 3SPGA 1KD7A 4AI9A 2RVAA 1KDMA 4PLOA 5L36A 1OD5A 5IK7A 3UO3A 3WNPA 3V65A 1RUG3 3SPIA 1SRYA 5CFCB 3WDUA 1WW6A 4S2GA 5GZGA 3VQVA 3MPBA 3POGA 4UFLA 1CZVA 1YO8A 2B9ZA 3K3OA 3J7HA 1RUD1 4XFAA 5JWPA 1OPOA 1OC1A 5BV6A 5LBEA 4J11A 2GP5A 3T1LA 1R1BA 2JJ2G 3ABZA 3T3YA 1QWRA 2RR13 4K6BA 1CP9A 4JGZB 4FTEA 1HNWO 2WLIB 1D4M3 1ULGA 3A0BZ 4WFEA 3CS5A 4CEWA 1BXHA 1FV3A 4CDQA 1XNRO 5F5AA 1I7FA 2ZGPA 5B4XA 5JJJB 2WLKA 3VHPA 2WRAA 3A23A 1QIQA 1SBDA 1V55B 5CMUA 2B5UA 1YUDA 4DRXA 3S0MA 3DYMA 1O3QA 3WF3A 2ZX1A 1VBB2 2QFEA 2CGPA 4HSLA 2XT9A 3T4DA 4BYYA 3KGLA 2VCCA 4MSVA 5F6KA 5GZEA 2H0BA 3MD0A 4BB3A 4L92A 5BR8B 3NR7A 4FPHA 4GUNA 1WMXA 1JZ2A 5DXDA 1NXD1 3OGSA 3OB8A 4WM8B 4FM1A 5K8SA 4N43C 4FLVA 3A8TA 1WKYA 3RYIB 4EB6A 5J09A 4LC1A 1V6OA 3I2FA 2FCTA 2LM3A 3DXUA 4P00B 3W7UA 4YW3A 1CPMA 1F15A 1Y4WA 2AACA 1PO11 2JDUA 2IJIA 1PNFA 1VBB3 3T1YO 4B4PA 3FBMA 1GM8A 4LF4B 5K9YA 4BQ2A 5KAFZ 3F7VC 4YJ2A 3T1HO 2WSVA 5DN2A 4QPJA 3K58A 4AAXA 5HPOA 4GKJO 1BHBA 4LBMA 2XLAA 2UXBB 4META 3HT1A 1BHAA 2KG7B 3B2EE 2JDHA 4UFZA 1SQXH 4NRPA 4Y1UA 1AR82 1DFQA 1J5EO 5FK8A 3VUOA 1RM1C 5KMGB 3TN92 1C8M2 1K5QA 4RS5B 3T2TA 3DXTA 4YIPA 1XEQA 3HEIA 2ZGQA 1DYKA 2RMU2 3AP7A 2WJSA 4NYKA 4LFCB 1F5FA 1F7YA 1I5YA 2HKOA 3AK1A 1PL0A 4XQDA 5IVEA 4TT3G 1RUH3 4XUOA 3KLSA 2WNVA 2ZAAA 3DCQA 4OUMA 4YRDA 1G7YA 1QJU2 1RYYA 3L70H 5FPOA 4IEZA 1LNSA 5GLVA 5F37A 1ZA7A 5D21A 1FX5A 4MVRA 2UYAA 2DCKA 1RUC1 4ZS2A 1M4WA 4F8AA 1Y74B 4K3AA 3ZFEC 4EN9B 1UPIA 2RJKA 4AEMA 5HXVA 4RHV1 1UOJA 3KF5A 4P9XA 3QNEA 2Y6JA 3AP9A 5SV8A 5B1AC 1GNYA 3BTYA 1S0IA 3JD72 4XPVA 4OUEA 1RTVA 3GZUC 1ZNPA 3KF3A 3H9AA 4R8HA 4CUAA 4N43B 3BTAA 5C4WC 1OF4A 1AR83 5DAXA 2YXLA 1Y3TA 2FTKA 2EICA 3TN93 1C8M3 1BQZA 5I0TA 5C3RA 1O3RA 4MVOA 5KX5A 5JDBA 4H3WA 3MV01 1P8JA 5IAVA 1LUWA 2RMU3 1PPJH 2RCVA 1LUVA 5GW7A 5EBLC 3IPVA 2ZQMA 3RRDA 2QJ1A 1RUI2 5A33A 3ZN6A 4LQRA 4K8ZA 3AG4C 1QJU3 3HKEA 3KM5A 1F8VA 3K75B 5F2WA 2R041 1GTOA 2P6HA 3AC0A 4S2FA 2XNDG 1KDKA 3DEMA 4KNCA 2YBPA 4XFGA 4B3RO 1QBZA 4CCOA 4K7JA 1Z2GA 4IEYA 2J1VA 4O2AB 2ZAHA 3RW0A 2DDUA 5LP6C 3NNJA 1U5IA 3JD73 4C0BA 2GV9A 2DQ0A 1BMV1 4CP9A 4CPBA 2JVDA 4J6GA 5A3UA 2WFF2 4K9SA 2Z5UA 3K03A 3PJYA 1V9PA 1XNQO 3T2MA 2AZ2A 3HAGA 4NB5A 3WVJA 5DAWA 1HN0A 4J80A 2QE3A 1IG3A 4JI4O 5F5QA 2ZGNA 1AR61 2FL4A 1VP7A 2JDKA 1VQNV 2W94A 2G4IA 1RUI3 4COZA 1TA8A 4DV3O 2A7AA 3ZFEB 4DR1B 5CKNA 3IM0A 2IU0A 3HKCA 4HPKB 2EAAA 4YW7A 5B1AB 5A3PA 2ET7A 1GFF2 1OZ0A 4LHKA 4RUEA 3MIBA 2YC0A 3ZYIB 5GLUA 2ZNIA 2BTOA 5ABJA 4XZPA 1RUF1 2Y64A 3BABA 4XHXA 3GB7C 5C4WB 1OCOC 1FYJA 4TWKA 2VU9A 4QB2A 4PDWC 1BBT2 1A8DA 4ES8A 4P9PA 3A4UA 3WP4A 4YSFA 4OZXA 5GALA 2WFF3 4XURA 4H7MA 2YIAA 4NROA 5KA5A 1DGWX 4CCDA 1QF3A 5JVVA 5A3OA 3AJZA 2O57A 1SA0B 1N3OA 2E6VA 4CP1A 2NN8A 4YXWG 3WU2Z 1RUJ2 3N7MA 4HVOA 4IHJA 2UUCO 3E8BA 1SBFA 1VB4A 1S0GA 1X4TA 3AG4B 5DQ0A 1PVC1 3ZN5A 4OI2A 4X64O 4INDA 3NVCA 3H1LH 1FV2A 1MOFA 3OGRA 2JDMA 4FJCC 1WMDA 4NTXA 3F5TA 3KCYA 5CIRA 1AR71 2Q30A 3W5MA 3IDCB 3MGUA 4JHZA 3ICXA 2OCCC 4LBEC 2KM2A 1BZWA 3JU9A 1LU1A 3WNLA 5F5CA 1ORQC 4DR5O 1W8WA 3R0RA 2BTQA 4P5HA 5JR2A 2JGUA 3CCUV 3USUA 4O65A 2PQSA 3B9CA 1PK6A 5JH7B 3KT4A 1U5ZA 1H8TC 5DUVA 3I3EA 2R16A 1ZM1A 1BBT3 4LH6A 2ZT9B 3W7XA 3LDCA 4HK8A 1GN3A 1H6YA 1CQ9A 4FPOB 3VHRA 2YI8A 4DR7O 1R6KA 4CXXA 4GJZA 2VS0A 5LZ6A 3ATGA 1RUJ3 4HKWA 5DUUA 1NVPB 3NV1A 1GWLA 3CJHA 1A32A 3V0AA 1YIFA 2LJ2A 2ZGTA 2R7EB 1UX6A 2EIKC 1NCQA 4QHZA 2Q5ZA 3VBHA 5A7WB 2VVEA 1IG0A 1W8UA 2HWF1 4XIKA 3SGIA 1WJZA 3NV3A 5EK0A 1RUD2 1WUVA 2BNMA 3JASB 4NRQA 1YI9A 3TGUH 4UT5A 1OCOB 4GD4A 5FZ7A 2DBIA 4UCUA 4UBHA 4MW3A 2VMGA 3JATB 2CDOA 2E5LO 4PDWB 4MYEA 4FZ1A 2PAKA 3E6BA 5CG9A 4IV1A 3VLBB 4FQ4A 3LDRA 3V0BB 3SC7X 2CDPA 4I9QA 3JAMN 2CY6A 1UYZA 5KHKA 4FLUA 1GV9A 1GM7A 4Q0SA 2GTAA 5KC6A 1IBKO 1YYNA 4AEDC 3RZHA 1W06A 1U0AA 3WNMA 2CTRA 1RB8G 4U3JB 1K9MW 1A34A 1NQDA 2AH2A 1S0BA 5C3QA 4OHYA 2DWRA 4NRMA 2RJ2A 4KH9A 4NVPA 2OCCB 1UCXA 4QQ2A 1AX2A 4GMP1 3VBOC 3GBWA 4KU7A 4D8MA 1K8AW 1JXNA 2VWKA 1Y67A 4GALA 4D6SA 2P3KA 2Q1MA 5F3EA 3POJA 2BUKA 1RUD3 1OLMA 4A44A 2X05A 4LFAB 2Y26A 3ECQA 5JUVA 5LY1A 1H8TB 2EJ7A 3EXUA 3J26N 5I8YA 4E4ZA 2GN7A 4YW6A 1W6OB 3ZVXA 3AMHA 1VF6C 2WSSG 2I2SA 1XL4A 4ZHQB 4JKKA 3KV4A 4XHBA 1JU3A 3ETPA 3BRCA 1EM1A 4PA3A 1XYPA 4MHUA 3WX5A 1V6JA 2ORXA 3B9IA 3LUTB 4QM9A 3IAYA 3KKYA 5FY8A 5JQGB 3WLUA 3LDDA 2ZJCA 1DTOA 2EIKB 4IE5A 4TLFA 2Z69A 1UOFA 2YV8A 3G80A 2D6PA 3SPJA 2GC2A 3MI8A 3UKNA 2RMKB 4Q26A 3ZXDA 1VMJA 5LXTA 2YGMA 3HQRA 2YS8A 4DV0B 4UUJC 3UO2A 2WAOA 1PO12 1EP0A 5HFLA 3D0JA 2PMWB 3E89A 1KYOF 3D3QA 4RQPA 2F66C 4ICGA 2GH2A 5EHDA 2GMPA 1XBLA 3TEXA 4QDSA 2IU3A 2EIGA 3THDA 2A71A 1HJGA 2R071 1QQP1 3AB0A 2YXSA 2XVLA 1RPRA 2XXZA 1HWYA 1COWG 2W87A 1JODA 4AEDB 5IJ9A 4JTCB 4WVVA 5A6QA 2UU9B 3N9OA 2E7AA 2RJZA 2ES3A 5KHGA 5C8WA 3L2YA 1YEWA 4UCVA 3B94A 5EC1C 4B3NA 3CRCA 4QHOA 3NSTA 3CC2V 4FPGA 2P06A 4X9QA 4XXPA 4JKMA 2GUZB 4JV5B 3VBOB 2Y6KA 4EWDA 3ZXGA 1XHZA 1CEZA 1PZ8A 3J8F1 4XDQA 4GYCB 3ILFA 2FKXA 1PO13 3HR9A 5JJNB 4W6YA 3BFRA 4MTFA 5IATA 3GM8A 1ND3A 3RYCA 2RJLA 5KWRA 4JV4A 1MMMA 2R70A 3CXCU 2V5YA 4FM0A 4YZ4A 3JYCA 4DNYA 1O4TA 3NW4A 4LO4B 2BOBC 2QR4A 5FXVA 5LBFA 3CF6E 4KQ7A 3ZRWB 4XE9A 2R061 4IT5A 4Z1MG 1YHQV 4JVAA 1ZA4A 1V6LA 2DE0X 3PNAA 3SYPA 1SETA 1FMD1 1UZYA 1YJLA 1V6NA 2VZ3A 3WDYA 4OZOA 4NXNB 3ACGA 3IWZA 1RSOA 1L7QA 5ANQA 4AI3A 5IFTA 5IVBA 2VD7A 2P17A 1W8NA 3HD8B 2QWRB 4JI2B 2XLGA 4K40A 3CRRA 5L3GA 1NR7A 5BY1A 3ZMTA 1KP2A 2FMYA 3THPA 2VULA 5JPMB 1HRI1 1LOFA 3NJVA 3ZSJA 3HKBA 2R042 3EHKA 1NAEA 1FOD1 2ZX2A 2Q0OC 3SYAA 3N7KA 2BYVE 3ORJA 4EFEA 3ZJZA 4NIAA 1QDCA 3Q8BA 3RJRA 2QQNA 1W6QB 4NO4A 4LNUA 4CYDA 2XJVA 4MOAA 4YZ2A 4QQHA 4DS0A 4LWSB 3JAWA 3OYWB 1PGL1 4EV0A 3SJBC 3BVOA 5FBZA 2ZMKA 1BMV2 3RJ2X 1LCLA 2GH8A 2Q5TA 1COV1 5FZ4A 2ZACA 1OLME 3T1MA 1VF5B 1N33O 2NLJC 3G67A 2BVVA 3MDSA 2BTVC 3OBTA 3THOA 1ENQA 4ATFA 2WAMA 4KGGA 2X8KA 1AR62 4F6EA 3R6SA 2KKWA 5BNPA 3KVAA 5FZEA 2E3CA 5K1PA 1WCSA 2R043 1B09A 1BEV1 4YG0A 1TVKA 4B3MB 4Q2FA 2A9HA 1NOVA 4X8NA 5T5JA 1EFRG 1MS4A 3IDEA 1N36O 2P1BA 2I74A 5EYYA 2RG4A 3ZR5A 2HEVF 3ZMVA 4I3PA 5LA0A 5KXBA 3AVSA 2VZRA 1J84A 3I59A 1XL6A 4B1MA 1SZBA 3TBDA 5G04L 3WT3A 1TUEB 3WG7C 2VZUA 4DFSA 3HNMA 4EE2A 2VBPA 3A0KA 1NI8A 2J1SA 3JCZA 4XW3A 1R3LC 3J7NA 2QDNA 5CB4A 2DOSA 4J9ZB 4X1KB 1PVC2 1AR63 3LAGA 2WNEA 5LW9A 2ZGRA 2KD7A 1SLLA 5J3UA 3RYFB 4XCAA 1AR72 3WW3A 3WCSA 3FAVB 1CJDA 1PNGA 1SMVA 3WUCA 4TZDA 2VMCA 1JZ4A 3DN7A 2AEYA 1OQDA 5DMYA 4DRXB 1EY2A 2OKXA 2XJPA 1XU1A 3OR6C 3WXPA 2JIZG 3ZBHA 2RDRA 1S0JA 1SS3A 3N9QA 1E57A 1KFUL 1R6TA 3ZRXA 4H14A 4CS3A 1WMEA 1WA8B 2ZZJA 3PLQA 4CP0A 5FPXA 1RC6A 1C3HA 1CAUB 3FL7A 1OV9A 1ZZ9A 4JDMA 5FNVA 1ZRDA 1NQJA 4UF0A 4YW5A 3T30A 1PVC3 3WOGA 1K5JA 3U07A 3ZFGC 4QGLA 2UUBB 2QM4A 2BWCA 2HWF2 4XJAA 4GX5A 4XDPA 4GWNA 4HN0A 1WPXA 1AR73 2PAMA 5IYZA 3KV5A 3WW4A 1AB3A 1YJ9V 2EXHA 1QU7A 5BMVB 1OQEA 4I0XA 1LR5A 5KHHA 3MIHA 3BPSA 4PF1A 2HJFC 3U75A 3OBAA 4I50A 4COWA 2PTMA 3PJSK 3HVDA 5JPNB 2QQMA 3WG7B 4XQWA 1XOYA 3VZLA 2WAAA 1ZYBA 4BDVB 2ZXWC 1NT0A 4X1IB 2PAEA 4J9YB 4AVAA 1CWPA 4CU8A 2VZSA 4JZRA 2WINB 4UV9A 5LY2A 4YJ2B 4ZXKA 4DR6O 3ZIXA 4UAPA 3BKZA 3OAAG 4YZ1A 2VZTA 5CYYA 2V4VA 4MGYE 5IVFA 2XJSA 4Z1VA 4W4LA 2D44A 2B45X 4Q0QA 5FP3A 4ZU5A 5AFBA 4OYUA 2HWF3 2VJXA 5FMOS 1UKRA 3CSXA 4N53A 3ZMSA 1ZRCA 2PLV1 1CX4A 4DPNA 3N9NA 4PA7A 1WZXA 3GJBA 2DUQA 4RGGA 3SR2C 5A70A 1WD4A 5DZGA 5JXIA 1HB2A 4XZUG 4FOWA 4BHPA 2DU1A 5I0SA 1MEC1 1D2SA 1PMIA 3K5LA 4GLXA 1WCDJ 4Y4RA 4CCJA 4TQFA 1AXKA 1X7NA 3D36C 4K0KO 3IMNA 4LP8A 2XASA 5C71A 1KQSU 2IVIB 3LE0A 4Z8BA 4TUYA 2HWB1 4EN7B 5KA6A 4XJ8A 4FP3A 4IGOA 2B1GA 1FT9A 3ZFGB 1PMHX 4FVVA 4LR4A 1QJZA 3O1PA 1UKGA 1ULPA 2OA2A 4AK3A 4DR3B 2BRTA 3BUCA 2FZ2A 3FMGA 2ZHMA 2TBVA 4GMP3 4PI2A 1RUE1 5JXHA 5FZMA 1V0AA 2WA4A 1LOCA 3GVMA 3WDWA 1XILA 3HQXA 3HT2A 1YI2V 5FXWA 4DUVA 2R072 1QQP2 1GP4A 1IXBA 3A7QA 3ZN6B 4AOCA 4LKEA 4XYXA 1P84F 3H1IH 2ZXWB 3VV1A 3MDPA 4IEOA 2EVXA 3HKEB 3G6EV 1AILA 4XDKA 3RSJA 1I3HA 3C3TA 2BP6A 3STZC 3K5OA 4OXSA 3ETDA 4YHHB 4BM8A 5FLIA 1W6PB 2DTWA 3C7HA 2A6VA 3CCEV 5E88A 2XB6C 2D3OW 2NYYA 3O1MA 2EIJC 1YHFA 5B3SC 2FDFA 1G9DA 2GC0A 2RS31 4K8XA 4ABMA 3J8F2 2X09A 1AXZA 3B3QE 2OYQA 2W6JG 1JJOA 2ZA9A 4FCAA 3FB7C 1QJEA 2YMZA 3T4VA 1DDLA 1WA4A 1MG1A 1NZ6A 4L8JA 2R073 1QQP3 1EN5A 4PIXA 4YY3B 5FLHA 3Q8EA 4QPWA 2R062 4O4LA 3FJSA 2A3YA 5A32B 3HKCB 1ZSPA 3VBHC 1QXRA 2YYOA 1H1MA 1ZX3A 1GQPA 3PJQA 2ZS6B 5EBWC 1XDCA 3WSOA 5DAQA 3MICA 2WLJA 4ORFA 3VQYA 2V09A 2JIGA 1O5UA 3NNGA 3GNEA 3M7AA 4Y5Z0 5H9CA 1W8OA 3N9PA 5B4NA 1UIJA 2QQKA 4UFIA 5CA0B 3B8MA 5FY4A 1W0KG 2W1UA 3LZZA 4NXMO 1DQ2A 4GKKO 3ZRVA 1RUOA 3JALB 4LPLA 2LUWA 5C8YB 1JBCA 3J8F3 4XBQA 3PMEA 1NX9A 1HRI2 1PV0A 4K20A 5CISA 2AZ0A 5F39A 2XWJB 1FOD2 4AYUA 5F3CA 1NY71 2DN9A 4A7KA 1C8NA 4GB31 4OI4A 3T2OA 5EZYA 4F6RA 3KV6A 2A06H 4GH4C 2PXJA 1PGL2 1HDKA 3H7JA 3H42B 3UT0A 5CA1A 1BQPA 2UXDB 4TV8B 3G6BA 3BAAA 4Y22B 3K79A 2R063 2CGNA 2ZM6B 3SKVA 4AQ2A 1V6MA 3D3IA 1COV2 2XONA 5A7NA 2CE4A 4PCRA 3RWNA 2NMNA 4AFMA 4GX0A 2FQPA 4PHZA 4B3TB 1O3SA 4J42A 4TV9A 1ULFA 2EIJB 5B3SB 4O4IA 3O1UA 1UY0A 3OEAA 1E5RA 4FLXA 3OR7C 4LBOA 1S76D 4IYIA 2WLQA 4QXHA 3AM2A 4URAA 4JI1O 2WLLA 3WP3A 5CBLA 1ZREA 2JG8C 4XAEA 2C4XA 4Z82A 2XR4A 4LBQA 4CUBA 2XOMA 2VQEB 3ML0A 3E5UA 1HRI3 1XU2A 2EIMC 2W52A 1BEV2 2AR6A 1FOD3 4LMFA 3D8CA 1Q8SA 3M8AA 5GZFA 4MSWC 1X9PA 4R9DA 1GYKA 2F6BA 1PMJX 1VPHA 3VBHB 1FJGO 2IVJA 1M1KW 5IYYA 3CP1A 5FZ8A 2VE1A 4LKFA 3FD9A 1Q6IA 1ZRIA 4QAWA 2EA7A 4N23A 4BJ0A 2E9QA 1COV3 3CQOA 1O7FA 1UYPA 4RQPC 3X2QC 3E5QA 1BT8A 2W2IA 2Q8DA 2W1QA 1E1QG 1W6NA 4JI6O 3FFQA 1D5AA 2E51A 4QE9A 2XVGA 4BU2A 1ZZBA 4JCKA 3OJBA 2GDFA 5GTIZ 1DZRA 3THTA 4C0HA 4UCOA 5FMBA 4R9AA 5CFCA 5IJ0B 2KXLA 1YFXA 2GN3A 4GH4B 3JARA 4BOWA 4HLTA 1BEV3 3NKGA 2LP7A 1KBHA 2B9VA 1RIRA 5FZFA 1MZ6A 3U1XA 5C8CA 2A70A 2MEV1 3MZHA 2DVFA 3VGIA 2JGDB 3VKNA 4PI0A 4LLFA 4QB6A 1X8MA 3E5XA 2NP0A 1AP5A 1HRV1 1UOGA 3TEZA 4JKLA 2QQPA 4OQ9A 4LNVA 4JGZA 3SISA 3UGFA 1SLTA 2VW0A 3DUIA 5CG8A 3B40A 2QWNB 2DCZA 4IDZA 2JG8B 2FMLA 3AFGA 1VIWB 1JS9A 1OH4A 2DVAA 4Q0PA 2EIMB 1Q8VA 1XMQB 2A3XA 5EBMC 5H9RA 5ITZA 1WN7A 1S5HC 1LULA 3FUOA 1MR5A 4DUZB 3N35A 2CAZC 4YWAA 2H6BA 2UY9A 4E8DA 2BZDA 4B08A 5FY0A 3VDAA 1YRZA 4SBVA 3IT8A 2A1XA 5LEKA 5FBJA 2JG9A 1K12A 5I93A 3PUHA 4RQPB 2VAUA 3X2QB 4DK0A 4LBLA 4WVMB 2YIBA 1U12A 4ARXA 1RXFA 1FKAO 2JDAA 5FZ6A 4BW5A 3VBRA 3VZKA 4WM8A 1LHUA 2OPKA 1K42A 5HXMA 2GAUA 1QNYA 3WB1A 2JJ6A 3RYIA 3N7LA 3WEZA 3AG3C 2B9UA 4LEJA 2ZHKA 4FOQA 4B1LA 4LXLA 4FSJA 2WZ8A 4MVZA 1QDOA 1KITA 2OUHA 4MTOA 2YU1A 1PHMA 4Y20B 2PLV2 1NLRA 5FJHA 4FPYA 2C0ZA 4Y1ZA 3OOXA 2IH1C 1SQ4A 1KJRA 1VQMV 1KEXA 1W8FA 1OCZC 1MEC2 1WLEA 5EJ1B 3UT5A 5T3NA 4MZUA 5LMUB 2R1DA 3OW2U 1N32O 1NXMA 3ASNC 4CEYC 5L7OC 2E74B 3W7SA 2KG7A 4UW3A 1SEFA 2QQOA 1ODNA 2FB5A 4UYBA 1CPYA 3DC6A 3S57A 5KMGA 3LSUA 4LF6B 1N1VA 4RS5A 1OPMA 4MGSA 1AI6A 1BVVA 1PGSA 5E16A 3WF0A 1LOGA 1DGLA 2CWSA 2ZX0A 1YZBA 5FYIA 3NJXA 4HVRA 1QKQA 4R6ZA 4LORA 3K9SA 3JD2A 1D0GA 2J42A 1F31A 1RUE2 4KXRA 4DV2B 3LA3A 4XXAA 1JN2P 4PJ0Z 5FMCA 4RD7A 2WZPP 2BWAA 1FNYA 2HEWF 1MS5A 4IIJB 2DFBA 2GALA 5IUQA 2PLV3 4OPHA 4A3XA 2WZR1 3J81N 3AKPA 3ZFFC 2ZDIC 1RHI1 1U5YA 1Y74A 3OGCC 3CJIC 3STLC 3OUSA 3U11A 5IVYA 4J7ZA 1MEC3 2Q8OA 2DUPA 1LB2A 4I55B 3SJCC 4PIYA 4K1YA 3QO5A 5LMNO 4DV5B 2M7WA 4N43A 2GMMA 3QO8A 2BJSA 4K8RB 2X29A 4ZBMA 2D6OX 4DK1A 5FMDA 1ZBE1 3BIEA 3JAWB 1OVPA 3AG3B 1MZFA 1PNMA 1MNGA 5JOZA 2ZABA 1KXGA 1JA8A 5EIBD 2Y0IA 2RS32 5IFPA 4CH6A 2VPVA 3LDEA 4QB1A 4P9YA 2PF4E 1NG0A 1XBFA 1UU6A 4OHXA 1RUE3 3UK9A 5A6ZA 3AK3A 4P9LA 1JOPA 1AR1B 3LSSA 1XPWA 1WAZA 4Z92B 4XMAA 2W92A 1OCZB 2CDYA 2YICA 4AI2A 1YCIA 5DECA 5B1NA 4GT1A 2YEVB 1UMHA 3K4DA 2PN5A 2XOKG 1ENRA 2QKSA 5I8TA 3ASNB 4CEYB 5L7OB 1Z5WA 4EYUA 1QOTA 5F8PA 3ABKC 1TE1B 4O2AA 3CCJV 1PIV1 4UCTA 1UZVA 1BGYH 4P9OA 4K21A 1Q6HA 1TVKB 5CN0A 3WHTA 1JZ8A 5JSPA 4PDRA 2P6JA 3AKQA 5JSRA 2XKOA 2QTSA 4JDOA 1YFWA 3ILRA 1BL8A 4FFGA 4X1YB 3O5SA 3H0OA 3K48A 2RDNA 2AW9A 3GWKC 3UETA 4LBKA 1KQRA 4LK6A 5FP9A 1M93A 4NJ4A 1HKDA 2RS33 2AGAA 2VMFA 4Q20A 4FP2A 3K46A 1MABG 1BSMA 3ZFFB 4Q29A 3N9MA 3CJIB 3ZFEA 3NRUA 4QXKA 1N3QA 4QGMA 4ZIBA 2TNFA 4HPKA 1GK9A 3TXSA 2OQ7A 4FPCA 4MVSA 1OKQA 3AYEA 3FBYA 1GMMA 3QH6A 1VIBA 2K0GA 2ZGSA 1ZZ6A 3LNNA 2EIEA 5BR8O 4B3SB 4B3RB 1QXPA 5D8AC 3ZKYA 1UIKA 2F4VB 4Q4W1 3O65A 4EZHA 3I8TA 3K3WA 2GBOA 2QNKA 2Y8KA 4M4PA 2ATKC 1PNLA 2GDSA 3LSEA 4E2SA 4PT6A 5A3WA 2VOTA 2ZGKA 3ES1A 2VVDA 5EJ3A 2LFSA 5KXCA 3OUFA 1IVSA 4YVSA 3HOBA 1ENSA 3VKMA 3A0RA 2QDOA 2WDBA 5I8SA 4J1WA 2N74A 2W68A 4LO8A 2X0LA 4DV1B 3ZIAG 5BY5A 3FKSG 4JI4B 1JR9A 4LF4O 4UF0B 3HNYM 2ZIMA 5IVJA 1RPOA 4YM3A 1Y9GA 3LOBA 1VAKA 3I49A 2UXBO 2TEPA 2UURA 4P08A 2ITCC 5IYZB 4CE8A 3BODA 1ZTEA 4I4TA 5JH7A 3GZEA 3CCRV 3ZDSA 1BMFG 3FFZA 4I0XB 3TRSB 5H6QA 4O2BB 3ETQA 2IXIA 3WUDA 1OUXA 4JASA 2HYXA 3I54A 5L3BA 1QLEC 4UVBA 1J3QA 4JYBA 2QQUA 2VG9A 1THZA 4BIOA 1GNZA 2ZGLA 2C2AA 4Z2WA 5T5OA 2WFPA 5T55A 4OMDA 1LESA 2ZX4A 4UOJA 2HWD1 1EZVH 1NTMH 2EALA 2YU2A 1K92A 2L9LA 4D7YA 4WVZA 4UW6A 5A7WA 1DQ4A 3MBWA 3J7LA 4NKGB 4WZCA 1GICA 3RWKX 1P49A 1HQNA 1YQ8A 1ZRRA 2WO1A 3AG2C 1IS5A 4AFDA 5D8AB 2JB4A 3W5NA 2MEV2 5K7PA 2VO5A 3JATA 4D7TA 4H55A 1NTZH 1KD1W 2W91A 1YFUA 4C1WA 4FK5C 1GP5A 4PDWA 4XDLA 3ZN1A 3V0BA 3OD0A 1NKDA 4GAZA 2PYTA 1WA6X 1SQQH 2ZMNA 4E4DX 1CN1A 1K45A 5BNOC 2ETNA 2VXJA 5C3PA 1M06G 4CDWC 2PQQA 2Z0AA 4CDXC 1CX1A 2WWSA 3A0HZ 1MZ5A 4FFFA 4U3JA 1OVSA 4F7ZA 3CHXA 4L97A 1AR81 5A3NA 2A5ZA 2XAHA 4AFAA 1JI6A 3Q4HB 2OX0A 2F95B 5AVAA 1H2MA 3ME2A 5KBFA 3SH3A 3CEIA 3FLRA 4W4ZA 3OSDA 2HP8A 4O61A 4QX7A 1SQFA 1G6UA 2Q8CA 4XF4A 1UD1A 1MQTC 2MEV3 1H8TA 4UB6Z 4W8JA 4P30A 1BQ0A 2VUJA 4BA6A 3AYCA 3APQA 4AVCA 3LSQA 3C8XA 3GYDA 1QLEB 2E7TA 4BXSV 1FXKC 4QPIB 2MK3A 1ZVFA 4FFKA 2E5LB 3T09A 2GSMB 1ZLZA 4ZZ5A 4QPYA 2IBZH 4DXRA 3M4FA 4WZFA 1DF0A 4FLWA 5J9PC 5CAZA 3CBNA 1B35C 2HG5C 2WLHA 3J7AU 3ZKUA 1QH7A 1UN1A 2F1MA 5JQGA 4HMZA 4PLMA 5B2GB 1LHOA 2ARAA 2LALA 5FZKA 3R4UA 1OCRC 3UKMA 2FBEA 1IS3A 4DR1O 1DGRA 4CCLA 3AG2B 2WL1A 1P7GA 3KG2A 3ENRA 2ZX3A 3WP6A 5I91A 1G6NA 1Q81W 1YIJV 1HXS2 4YVWB 1QY4A 1SLBA 5CVRA 2B42B 1X59A 5CADA 4FPLA 1IS4A 2H94A 2ARHA 2WLPA 3T4ZA 3H1WA 5IYBO 2HJDA 4IEUA 3LD8A 2FHRA 4XEZA 5BNOB 2F17A 1CIYA 3MIDA 1N34B 4CDWB 5IWFA 4AEDA 1Q6UA 4AHCA 4CDXB 4IYHA 2Z5WA 2D40A 4AWDA 2Z4FA 1PM9A 2Z2SB 2VY0A 4DUYB 2VZOA 1UO9A 1NZIA 4WBNB 3PTRB 1QNMA 2ITDC 1EPWA 1IHMA 4JGSA 2DVBA 5T5PA 2DYSC 2GUZA 3VBOA 2WQ8A 2KSDA 3OG2A 4I09A 3SPCA 2MNGA 1DP0A 1CZTA 4LO6B 5H9PA 4YNIA 3AZZA 1CESA 3M1HA 3BCWA 2ID4A 1OURA 2LW7A 4XJUA 1MQTB 4CZSA 2WZR2 4LULA 1RHI2 3VD3A 1HXS3 2BQPA 4LUKA 5FAXA 1K3IA 1CAWA 1JPXA 1SFPA 4QT6A 5IVCA 4BQWA 1FXKB 5A3TA 3SPHA 2HKXA 3IC9A 3WG3A 2CGOA 3ZRWA 1OF3A 1CVNA 3CMEV 4TTGA 4RA0A 4RQEA 2N04A 1UYYA 5CBHA 4F6RB 1B35B 1ZBE2 4KG0A 1GQHA 3MIEA 3TB0A 3H1MA 2KB1A 1SCRA 4WF9V 4E4EA 2GZWA 1I0HA 4I30A 1OCRB 5FR3A 2Q0AA 5C8CC 4GQ7A 1SG3A 1W2NA 1JX9A 2E76B 3KZIZ 1T6BX 1UPSA 4Q27A 1O5LA 2EF6A 5KHIA 4AQYB 3S5AA 1G9CA 2ZGUA 1G4YB 2C26A 3G7DA 2G1MA 1PX3A 1CIWA 3AEIA 1YF2A 3RZKA 1AYM1 4JGZC 1QR8A 2WZR3 1RHI3 4X66B 3T0DA 2WLLB 2JS3A 2CTPA 1W6QA 2QKAA 3OYWA 1PIV2 1AXYA 4RUFA 4XJWA 3WB2A 1N0JA 3ZXLA 4BW9A 4IV3A 2OIEA 5FDBA 5JMCA 2Y6LA 3SDLA 4K1ZA 3K0GA 2VW1A 3WINE 1RMU1 2VQAA 2WNUC 2ZE8A 3ZHVA 2NN4A 4HETA 1ZBE3 3ACLA 3SMHA 2FDKA 5CFDC 5JIUA 5C3OA 1LGCA 3DECA 4KWJA 3ZHQA 2DYSB 3FB5C 2VTFA 3W21A 5C7GA 4XVHA 4HNAB 3OCPA 1NA1A 3BB6A 3DL3A 3ASOC 4W6XA 4Z07A 2WPDG 3O14A 2JG9C 4D94A 1PL4A 2ZHLA 2IJHA 4X88A 2CWMA 4IE0A 2J1RA 2P34A 1UF2C 4FPJA 3VZMA 3SKJE 4KWKA 4LFAO 3AMNA 2JDZA 3ROUA 2BGPA 3VBRC 4QKNA 3I2OA 2KA3A 5DZEA 3OTOO 4UI9L 1Z78A 4HBNA 5K0UC 3TEYA 3S3XA 3PTYA 3W58A 1UZZA 4HONA 4OX9B 1JFFA 4WFFA 3M3QA 1PIV3 5LATA 2QWPB 2R6QA 2OWOA 4XFHA 3JARB 2GNBA 2XJTA 4MXVA 2YGLA 1TEIA 4Q4W2 1TVGA 1TGOA 4IL7A 3P6BA 1AJQA 1NVPD 5FPAA 1V00A 2JDNA 1M57C 2RS11 5C8CB 5DAPA 1XNDA 1XHXA 3VZOA 4NE9A 2YUAA 4RR3C 3E8GA 2VMDA 2W39A 3EFFK 4LFBB 1YQ2A 3VHNA 1C57A 1HX6A 2IM9A 5DEDA 4DV0O 1PGW1 4X1KA 1Y66A 3ZLIA 4OQ8A 1C28A 5IY5C 3MF6A 2R0FA 5HCBA 2E26A 5FZBA 4EN0A 3RYFA 4XC9A 3CB2A 5A1LA 2ZEXA 4MVMA 1YC61 3FAVA 3WW2A 4RS5C 3OBRA 1Z7S1 1Y43B 2VOWA 4DRVA 5L19A 2YUEA 3GWOA 4BE3A 5ITZB 3I2KA 1BHGA 1GBGA 3CCVV 4ASMB 5F2VO 5A1AA 1QU0A 1GZWB 2WNUB 5BXXA 3E2EA 1RP3B 2UU9O 4Q4W3 5CFDB 2R30A 5FXZA 3HWJA 3NJZA 4A41A 1EAH1 5JVDA 1KC8W 5JZGC 1BVP1 1WA8A 3OPTA 1W05A 3ASOB 2E75B 2Q68A 4ZOLB 3ZSEA 2JG9B 4JV5O 2WBKA 1CAUA 1CR7A 5A3MA 3WNXA 1HDJA 1QJFA 3PU8A 4DV7B 4YW1A 3WNOA 3TJTA 3LSDA 3LEKA 3E22B 2HWD2 2HH9A 2PFWA 4OFGA 3VBRB 3LNMB 4HXCA 3ZMZA 4QQOA 2UY8A 2XGXA 1OH3A 2D98A 4XMIA 3WQ1A 1U96A 1R3KC 2VQ0A 3WG2A 3J7MA 2EXKA 3EMRA 5K0UB 5IW0A 5FP4A 2YZ4A 2ZTNA 1W59A 3HN3A 4P9IA 3UQ8A 5BMVA 3M70A 2I45A 5FYMA 1W9YA 3B09A 1BCXA 2B8MA 1X9TA 3OGJA 4MVUA 1LECA 3TNQA 2YXYA 4FT8A 1PP9H 2OVUA 5EYPA 3PVEA 4CU6A 2XLFA 5KXEA 1YITV 3OEBA 1KP3A 2HBUA 1LTEA 1M57B 4GXLA 3CL1A 3S7IA 5FYSA 1XE8A 2JKBA 1NZCA 3AKSA 2W1SA 4NHXA 4RR3B 4DR2B 4X1IA 4M3CB 3A21A 2BSKB 3VDCA 1AJOA 4NXNO 4CVUA 4O4HB 3UT5B 4D7SA 4R52A 4CH3A 1HNXB 4OCTA 2Y6FA 2AENA 2UXXA 5T5LA 2J1AA 3HNBM 4JI2O 3ZR6A 4ES9A 2J7MA 5IY5B 3APOA 3H50A 3DGTA 3VD9A 1DGWA 1QR9A 5IJRA 4CS2A 1N3PA 2HWD3 1VLNA 3FB6C 1HB4A 5B1BC 4Q0UA 1KS4A 2WLNA 4I5SA 1Y9QA 3SITA 1FFTB 1WNSA 1OFSA 2RS51 1K3EA 1KS5A 2N7GA 1LOBA 4LF5B 1ZBA1 1UXXX 2IWGB 1WMFA 1LKNA 3AZYA 5BNNC 4QGNA 4N90A 5JZGB 5F1RA 4JI7B 2LW8A 2ZEWA 4PJYA 4O4JB 3CMGA 4O7XA 2R0HA 1VALA 1EN6A 4OMCA 4FOYA 4XQ4A 1GN2A 2WA3A 5L9BA 3KCXA 1R1A1 1I08A 1SQVH 1BS3A 4IEQA 2J22A 2FYUH 3BCCH 4BQ3A 3S30A 4I9WA 3D3AA 5I0UA 4L9BA 3HPLC 3ZFGA 5KR7A 2DQ3A 3P30A 1XJAA 4KHPB 3NXSA 1NCRC 1W0PA 5FO9B 5J2TA 1JUHA 4L8QA 2DYCA 3P3PA 1DF4A 2ZINA 4ONUA 4KMQA 4B3MO 3ELNA 5IAXA 3AMPA 2ADEA 1JHJA 4PBOA 3MW2A 3ETGA 1HW7A 5IK4A 1WBFA 1U5XA 4J41A 4PF5A 3N2GA 2ZGMA 1HJFA 3CCQV 1FYUA 5LRSA 1PKXA 3S5QA 2OXBA 3IZOA 4U7NA 1N8RW 4HOOA 4AILC 3ZSKA 4YZ5A 3KSCA 4YVSC 4DV6B 1L1FA 3L2HA 2Z3YA 2CYFA 1MA1A 5C9AB 1U97A 3FC0A 5LOVB 1W9TA 2FD8A 3A0NA 3A2FA 4J25A 3ES4A 4FOVA 1W6PA 1B6QA 1XMOB 3JZVA 1NU1H 2JE9A 2FZ1A 1HB3A 3DC5A 2GHYA 1YNAA 2DVGA 4X20A 5B1BB 5LA6A 5LASA 2HHHB 4J7KA 4OI1A 3SEPA 4HKLA 4MGKE 1WBLA 5IT6A 2VH9A 3P5BA 1DU3D 3POWA 1Q86W 5GONB 4LKSA 2XTAA 2EXIA 1POV0 1VRH2 4XABA 2K9PA 4DXZA 5BNNB 4DOUA 2HVKC 1GOFA 3T08A 2H6CA 3HIFA 1AI7A 3AJYA 2JD9A 4AI1A 2P90A 3D36A 4JYAB 3EO6A 4QKFA 3ST7A 1JYTA 3NV4A 2BPA2 4QQPA 5A32A 5GJ6A 3I3QA 3PUSA 1H8EG 4A2UA 2VTXJ 4P5YA 1KKDA 5FYVA 4MGZE 4JDNA 1LAJA 4DR4O 3CNAA 3RI9A 5FZIA 1NCRB 3WZ1A 4DEVA 4LF9B 2P5OA 4KFMA 2Q4PA 4LKDA 1QCEA 4BQ5A 1HIXA 1XYNA 5IYCO 5CA0A 3NO8A 2D7FA 3OMAB 2UUBO 1NH2D 3I3BA 1XNTA 2F43G 1SESA 3AXEA 3WNKA 2K2SA 3JALA 1WGPA 1FPN1 5C8YA 1AYM2 1MVEA 2LW1A 2R32A 5FQ0A 5KXDA 5CA3A 3N27A 1XNAA 2VW2A 1EZJA 4OHZA 3ACFA 2VOXA 4RGKA 4JI8B 1YJNV 1VRH3 1W03A 1BKZA 4BQ4A 5L3EA 4YVSB 4RGAA 1L7LA 2HLDG 2VMEA 4TV8A 2QZ3A 5M0TA 4Y22A 3W59A 2VNVA 1RMU2 4JQRA 4NAOA 2WLMA 3NMBA 4ZU7A 3LDKA 4WFBV 4F4LA 1MS8A 2NPIA 5ACA2 5FZOB 4I4TB 3ON7A 3V56A 1BZKA 2AEZA 3VL8A 2EIDA 3OGGA 2CTQA 3DPRC 4P9WA 3OFNG 2ETEA 4QMAA 4DV4B 4XF9A 4AR2A 2X6CA 4Y33A 1AYM3 1BK1A 2VNGA 1URXA 4R8CA 4E8CA 2BV4A 2XMLA 4QD2A 1QMJA 3JUUA 5FXXA 4DYLA 1X82A 2ZBJA 3L72H 1S0DA 3TK1A 5CEHA 3K4AA 3AK0A 5A9GA 5EC2C 3MO4A 2QE7G 3ILNA 4NUBA 3VD5A 1CONA 1L0LH 5DM6V 1RMU3 3OT7A 2RS12 4X6RB 2ADQB 2XHBA 1GN6A 5FOBB 5J96B 4R50A 5DABA 1WB8A 5ACA3 2D5FA 1H2GA 5LGNA 4BLJA 4DR3O 3IGAC 1PGW2 1GR3A 1XSRA 5H9SA 1OLRA 1C5IA 1WPBA 4DRRA 1QH6A 1GAXA 2FMDA 4BQYA 5JCOA 5IJ0A 2KR2A 2Q1FA 4BR6A 4KBZA 4BIUA 2YFUA 3J80N 3JB4C 1HNZO 4GH4A 2WYSA 1Z7S2 2W0XA 5L3CA 3RT3C 2V7QG 5DPNA 4MGQA 3ZOIA 1S5LZ 1YQ6A 3VD4A 2JIJA 1JZ6A 2NZ9A 5LHIA 2A6XA 5C3SA 4HT1T 5A7OA 3ZX6A 2JGDA 3HMYA 5A7PA 1F2NA 3TOJA 2DFCA 3F2ZA 1EAH2 1XI1A 4YHHO 1UU5A 4DY5A 2RS13 1XRUA 1Q8PA 4FXGB 1AROP 3DPRB 2HEYF 2FDHA 4GKXA 4CCEA 1AVMA 3IC7A 4NOTA 4IL6Z 5IK8A 3WB0A 4P14A 4PA4A 2JG8A 3K3NA 4CUCA 2WS91 4PQQA 4WV8A 1YTFD 2PHFA 2VMIA 3C7GA 1R6NA 4Y5SA 3KQRA 4FTSA 3FLPA 1KJLA 4MVQA 4H13B 3KB5A 4QX1A 2FDGA 4BH9A 1R3JC 4LHLA 2BOCC 1M4UA 5LWBA 3VDDA 1VBE1 4WCEV 3WCRA 3PUQA 4OULA 1Z7S3 4I0WB 5EXOA 4CZZA 2ZEYA 4AGVA 4YY3O 3N2KA 5J1XA 3VOUA 3HBZA 1GO3F 3MLLA 1GKBA 3KD4A 2LROA 1W99A 2BGOA 2R49A 2EILC 5FYCA 1E79G 3IFXA 1OOPC 2V72A 1ALYA 3L74H 1S2EA 4LF7B 2VCAA 5AFEA 5ERLA 1EAH3 5LCWL 4WVMA 3DKQA 4LBJA 1ZL8B 1DZTA 4YZ3A 2W9XA 1AR91 3WG4A 2BFUL 4IE7A 3JCUZ 1QJY1 2Q4SA 3MV11 1R081 5AVPA 1K97A 4IV3C 4DXSA 4OPAA 5HFMA 5J2UA 3ABLC 4FFIA 1OLQA 2ZMLA 2YC4A 3ACHA 1FD9A 2AC1A 1DQ0A 1LJ7A 3ACIA 1US2A 2QA4V 5GLTA 4Y20A 2RS52 4FPFA 1BLZA 3WG1A 5B1OA 1ZBA2 2UXDO 3L73H 3RMXA 2W5FA 4OHVA 1NA1C 5FMOL 2ZM6O 2MHFA 2YIDA 4H0LB 1OT5A 1VEWA 2XHKA 1YQ5A 4EKWA 2C6SA 4B3TO 2VZVA 5GLWA 4CPBD 3CRMA 3OY8B 1CAWB 2WQ4A 1R1A2 3T1CA 3D4KA 2ZKLA 1VB2A 2BNOA 5IDJA 5FPUA 4IERA 5L73A 1C5HA 4XJZA 3UGGA 2VZPA 2XUMA 4AQTA 4FVMA 3SHRA 2VQEO 4L0PA 2LS6A 1BJQA 1MVQA 4BK5A 2IXKA 3W20A 3TWIA 3UKVA 3GCWA 3H8OA 2DUOA 4G27B 1JYXA 2GMEA 3VBFA 4DUWA 4IIJA 2D6MA 2GC3A 2RS53 2AUYA 4ITCA 2EILB 1OOPB 4FPEA 1ZBA3 3C7EA 1W39A 2RQ6A 1LODA 1JH5A 2AREA 5LA9A 3CD6V 4JAAA 3KCCA 2A3QA 5HCHA 1W9SA 3WD5A 1N1TA 2AYHA 1ZX5A 5G05L 3I56V 4I55A 3G71V 1SLIA 1UZWA 3CJXA 1MS1A 2H0VA 3E6DA 4G3YC 5H9QA 4CDUA 2QQLA 1R1A3 5I0RA 3BPZA 3VN4A 4UCSA 3TAYA 3RN4A 1SQGA 2CAUA 2JRIA 2YROA 4LO7A 2DJVA 4IV3B 4EZ4A 1MSWD 3KQ4B 3ABLB 3O7OA 3CC4V 1UFIA 1SCSA 1DQ6A 2HEPA 5IYDO 1WW4A 1W3VA 3SEEA 4MLOA 4ZHNA 1J59A 2LQTA 1W8HA 1IBLB 1GANA 4BMBA 3GALA 4KBBA 3VKLA 3HJRA 4A4AA 2EIBA 3ZPOA 3RYHB 1NA1B 4GULA 1VAVA 5FYZA 1IBMO 4MADA 5KHJA 3HKDA 1D4VB 1UWWA 4LHNA 1US6A 2YEVA 2YBKA 4NHLA 2Q69A 2N05A 3R4SA 4CEYA 5L7OA 2BCCH 4UVAA 4J10A 1FATA 1N1YA 1D2DA 2G19A 4HK9A 1DHKB 1W2TA 3LEMA 4RYDA 5FKBA 3IJ4A 1DCSA 1WLWA 4FLYA 4F3JA 4I0AA 5FZGA 1JFFB 3FUQA 2DMXA 2ZR3A 1LNQA 3OMIB 5F3GA 4X1YA 3I2DA 3K06A 1GOGA 5E6HA 3P32A 5IT9N 1S4CA 3MHSC 1XMQO 2PELA 4LF8B 4YARA 2QUOA 3MIFA 3IDBB 4MO3M 1JZ7A 2PHRA 1FPN2 4E27A 1JUIA 4DUZO 1WLCA 1K5MC 1OUSA 3QH7A 4WM7C 3ZFFA 2ZDIA 4QIWF 2BGCA 1O8PA 4MV2A 2PHLA 3CJIA 1N47A 1O4ZA 2DURA 4H2AA 2BEOA 5E79Z 3CRAA 3MLJA 2VQFB 1PO21 4JTOA 4YJ3B 1W0NA 3O1RA 5HCAA 1F4HA 1B3QA 1KFXL 3QBQA 4QU1A 2RN9A 2EULA 4YLZA 4P9JA 4C7UA 5FO8B 1OXCA 1CPNA 4JI5B 3NWKA 4AAPA 1ENXA 2D5HA 5GTHZ 3CU7A 1K73W 3FLTA 5C33A 2VOKA 4JYCA 2PHXA 3AP5A 4DXTA 2OQ6A 2W47A 5D1IA 4AW7A 1K7DA 1VAMA 3SCHA 3WDVA 4OHWA 4BISA 1HN1A 2P37A 5JVDB 2X10A 4Q4X2 3KHCA 3APBA 2ZZQA 3L71H 1FPN3 1CAXB 1GRJA 1JOBA 2WSUA 3I2GA 1QJX2 1XREA 1XNCA 1BYHA 5FZLA 3UL2A 3BU7A 3TNPB 3FHQA 4COUA 1OBNA 4XBFA 1UY1A 1AR4A 1NYWA 2HWE1 3ZXJA 5LMUO 1A8MA 1FXVA 3B8NA 1GP6A 2OZJA 4LK7A 2A79B 1F4AA 3UV9A 4AHZA 2CTWA 3H8XA 3C3VA 4E4SA 5FWEA 3H7YA 3JSNA 2PYJA 4L87A 4LF6O 4IUGA 1UL9A 4AEKA 4O2BA 4UWDA 4BMEA 4O9EA 2NNUA 1Q82W 4BPZA 5EYPB 2RDCA 4JRAA 2DF7A 4QPGC 2Q9LA 3WP5A 5E1RA 5LA1A 3KGZA 2CHHA 1W0JG 4KWLA 1MPXA 4JI3B 4Q4Y1 2H8PC 5E89A 4ZY9A 5FFOC 3CO2A 3UCSC 2BFUS 4U36A 1K5MB 4DV2O 4WM7B 2UYBA 4Q4X3 4EN6B 1RUH2 2PYLA 3HR0A 3SYCA 1EUTA 2KQXA 4IEVA 4E2QA 2JWPA 1QJX3 1K5SA 1CGPA 2JD4A 3BY6A 3CYOA 1VF7A 5FYUA 1GMGA 4W65A 2ZD9A 3RDIA 5C5TA 4FMTA 2C5DA 1IQAA 1I5ZA 1X33A 3CPWU 3I2IA 5D8AA 4CU9A 3P1IA 3AL6A 3NQHA 2BE3A 3LEIA 4DV5O 1VJ2A 4MX3A 1QXJA 2FDIA 1C4RA 4MXWB 1H6XA 4RL7A 2HYKA 3T4HB 1M56C 1GWKA 4BAYA 4A6OA 2VZ1A 5FYYA 4GZ9A 4HN1A 5FZ1A 3IMMA 4XUQA 2E32A 1I9RA 1IURA 2OYZA 2D3PA 3RZGA 1OA2A 2WS92 1TUBB 1FXHA 2D93A 5FREA 4AVTA 3NAPC 2VC9A 1ROPA 3H01A 1NR1A 3F7YC 4NMIA 5HV4A 1VBE2 2VUDA 2PI5A 2A6ZA 4HSJA 3Q4HA 3O1VA 4NIDA 2EZOA 5J2TB 4JTAB 1IGOA 1YXWA 3AXDA 2GTSA 3CMAV 5F7UA 4Y1YA 1Q90D 2UXCB 1DG6A 1H2NA 1IXMA 4O9GA 1ST8A 2BBVA 2RM21 4CU7A 3HQUA 4QPGB 1HB1A 2C1FA 4QPIA 2WT1A 2P3JA 3N2GB 2BNNA 5A2QN 3JAKA 1AR92 4YYOA 3SJQC 2YG0A 3Q9OA 1ND2C 2QQVA 5GZCA 3ITQA 3RFRA 1L7RA 2ZGOA 1VBA2 2Q7GA 4GZRB 1QJY2 2OS2A 3DYPA 2WS93 1R082 3LEGA 3ABTA 3D5OA 5FWJA 3LIHA 3VBUA 1VQ7V 2MPFA 1W2UA 2QQJA 1J83A 3WDTA 3KV9A 1I94B 1SZXA 1EUUA 3AYDA 3EBRA 2IJKA 2VBDA 3THCA 2WUHA 4IE6A 3U0ZA 1BK0A 4K8FA 3K2OA 1VBE3 1C1FA 1W0OA 1JOJA 4YVWA 3CEWA 1XUQA 4X20B 5LA6B 2OIIA 4J1XA 3OE7G 4B3SO 4GWIA 1CZSA 5LYJB 3VKOA 2D97A 1M56B 5FZ0A 3DKWA 4Y1VA 4QQLA 2F4VO 1JYIA 2WABA 2XWBB 1JTZX 2P3IA 3AZWA 1N0NA 1VBC1 3LIGA 3B93A 4NIIA 1RM1B 1NBMG 4COYA 3ZYPA 5BNOA 3PUAA 2VCMA 4CDWA 4TN7A 2IJJA 1VQ8V 1R64A 4CDXA 1AR93 4CA9A 2WNOA 4H44B 4JTDB 1H2LA 3NAPB 1VBA3 4UFKA 2QQIA 1QJY3 4WBNA 4X65B 2A0LA 1R083 4MGIE 1GNHA 4DV1O 1GZCA 4WFAV 1E1RG 1I1EA 1GWMA 5FKCA 2PA7A 4A3ZA 3FN9A 3MPPG 4QX8A 1MQTA 3POFA 2V4AA 3RG0A 4HAMA 1YJWV 1V54C 1SF9A 3PL0A 2DBNA 2QQWA 1W28A 1JHNA 3VZJA 2XDVA 4PDMA 1FXKA 2YHJA 5JAXA 5FQ0B 4N9HA 3T0BA 2FCUA 4LR3A 2YY1A 1POV1 2CH7B 5JCOC 1ND2B 5FPVA 4FXKB 2XL9A 4XBNA 4C1XA 4FTBA 2VXRA 1B35A 4FI9A 2AXTZ 5BXZA 1HR0B 4XIOA 1O6UA 1DLBA 3VD7A 3ZYBA 4GX1A 4MG2A 2WYFA 1ZZ8A 4V2VA 3GJAA 3RQ0A 4DUXA 1DF5A 3OPWA 3OTFA 2OTJV 4AI0A 2VWJA 5CZKA 2VBBA 2M6YA 1J1TA 5TSWA 5HCFA 1GKFA 3O9OA 1JYVA 4UCRA 2ORZA 3G4SV 2JECA 3PVNA 5DDJ1 4NAMA 2VM9A 3N3HA 2AGSA 1ULEA 1JVMA 4X62B 4D6RA 5EWSA 4OI0A 3MUZ1 3TXQA 1KUQA 3I55V 5LP6B 1AHSA 1SBEA 3ZMNA 4QX3A 1LEMA 4Z2AA 2UUAB 3LFMA 3AKRA 1UW8A 4C8DA 2P4KA 2WN2A 1LR1A 4JI0B 2BVBA 3Q8CA 4JZGA 2QM8A 4Y1XA 3VDDC 2X5IA 1ULOA 5BYNA 1X50A 2PI4A 2VMHA 1ULCA 2W95A 2VQTA 5A7SA 1AI5A 4TQDA 1REFA 3WNNA 5DG2A 4HNAA 5FJKA 3NNFA 5C5UA 4QDQA 4XDOA 2VECA 4DY3A 2VNOA 2F4LA 4XFCA 4FQZA 1SPPB 4M0NA 2DYRC 2QJVA 1V54B 5FY9A 3S3WA 3FHIB 3AK2A 5DZFA 3CZJA 2FDJA 1PM4A 1PO22 4AVBA 2D2CB 3I7DA 2D3RA 5BNQA 2OZ6A 3ZYGA 5LBBA 4UVCA 5FUNA 3AZVA 5LEJA 5GLZA 2JE7A 1YI7A 2JENA 1VARA 3LGRA 4HL0A 5JJEB 1MS3A 1W2BU 2P22C 1VMFA 4ZKTB 5FPZA 3CKHA 4XF1A 4FAGA 2P3YA 3LKJA 3OEHG 4L2NA 4JAVA 1SFYA 2A7WA 1CAVB 3QVNA 1CJPA 2AZ5A 4BCUA 1DYOA 3I2HA 1YLLA 2RE9A 2YFZA 2CL2A 1LOAA 2D6KA 4NPLA 2GU9A 2HVJC 5FV3A 2JICA 4SLIA 2EZPA 2LTNA 5FUPA 1YFYA 2R9RB 5IWAB 1YSCA 3MW3A 2ZE7A 1E5HA 3RMYA 2IH3C 2LGQA 4V1PA 1EN4A 3QOPA 3FX7A 4RN5A 2VUCA 4Y24A 1UPGA 5F6LB 2QGNA 2HWE2 3AKTA 1K4CC 1PO23 3HBKA 1GM9A 4CXYA 2GNMA 4IETA 4Y3OA 5A6YA 4X6QB 1FS0G 3VDDB 1GZWA 3OTOB 1N34O 2WNUA 2WC2A 2DU0A 5FPRA 3EJKA 4D6QA 5JR7B 5CFDA 3N2KB 4G28B 5IE9A 3KHBA 4DUYO 2DCTA 3BOPA 3VBFC 2NQYA 2DCYA 4QNHB 5EP9A 2O8QA 4ZOLA 4Q4Y2 4IGQA 3C90A 3VZNA 1LGNA 3DYOA 4N9IA 3RZJA 3T2PA 5J7MA 2D6LX 2DYRB 1MSDA 2ZCWA 1SLAA 3UGHA 3ZHUA 3E22A 2QTOA 4WFGA 2HWC1 1AZDA 2CK3G 4AQSA 3C2UA 1PVXA 3RI8A 5F3IA 2G9ZA 2GSYA 2DWDC 4CDUC 5TISZ 3M3IA 3DSQA 1HNWB 4OGQB 5K0UA 4G2KA 3AP4A 1O4YA 3GHNA 2HWE3 5J2UB 1SQPH 1XNRB 1ODMA 4A7ZA 4YGDA 4AHWA 1H9WA 3POYA 5AG2A 1DQ1A 1H0BA 2ODMA 5FLJA 2ENRA 1IZ3A 3UM7A 1HXS1 4RR3A 3U4XA 3S7EA 4M3CA 2BSKA 4DO2A 5GKAC 1G8MA 2JXAA 4Q8LA 4O4HA 2YDEA 2AHZA 4K35A 4Q4Y3 4B8EA 4AQYO 1SLCA 5CKQA 3EB7A 5LHGA 2XH6A 1O8SA 5EV7A 3O0WA 1HV1A 3BGAA 3LA7A 4XILA 5JMOA 2XQXA 5FY5A 4D69A 1DYPA 4AZZA 5T50A 1IDSA 1R73A 4X66O 4FM2A 1J58A 5J48A 2GNTA 3DXRA 2V4DA 1AL0G 1RUC2 1O9HA 2ET1A 4XF0A 4RHV2 4PDVA 4JC1A 3I97A 5F9TA 2ZXQA 4TSFG 2RM22 4BK4A 3VBFB 3TEWA 5EYXA 5GM0A 5JZGA 3MUY1 4O4JA 3NNMA 3E35A 5FK7A 2UU8A 4YM1A 1WLDA 1A3KA 2P4VA 1TZOA 2G9FA 1X36A 4CSWA 4IXLA 2W0FC 5EIYB 2B39A 2K9ZA 4ZPIA 4LE3A 2Y60A 5GZDA 2NLRA 3T1YB 3FHAA 4JTNA 3T2QA 4XBLA 3FZ3A 1S0VA 5LBCA 3JXSA 2K1EA 1Y76B 4Q5OA 1NE6A 3T1HB 1IOAA 4CCKA 4CDUB 2ZIOA 4GKJB 4OVEA 4AQ6A 1ZZ7A 3H9VA 3CCMV 4ATEA 3OUHA 1F23A 1O59A 1LRHA 4BZ4A 3TYJA 1F35A 1J5EB 2B7YA 1FPOA 1T6GC 3SH4A 2Y4UA 1FNZA 3E8FA 4KUMA 2IZWA 1L0NH 4RAIA 2A6WA 4OX9O 1RUC3 5L3FA 1DZQA 4LA2A 4A5UB 4DXWA 3OF1A 4CEWC 1WD3A 4CDQC 5LBQA 5SV5A 4RHV3 1F51A 1VBC2 4CH4A 1R3IC 3ZSMA 2RM23 4AGRA 2K46A 1ASJ1 3PVOA 1SERA 3HKDB 4LIVA 3JB8A 5C9AA 2A6YA 4KL1A 2XG3A 3C7FA 5T54A 4LFBO 1HLCA 5LOVA 4EEQA 4ISRA 2A75A 5ANNA 3AZXA 1W6MB 5LGUA 4LIUA 1SACA 4TXWA 4PLNA 4D3WA 2CV6A 5L9RA 2ARXA 4NPRA 1M5IA 4KU8A 2NMOA 3M3EA 1O3TA 4HVQA 1AI4A 3CCLV 1G8WA 4MVTA 2P7TC 4LBQD 1AVBA 4UW4A 5GONA 1XE0A 3DV8A 4TLGA 1NH2B 4TOIA 1LGBA 1J1LA 5BNNA 1RUF2 2VZQA 3WHUA 1KRIA 2BBAA 3IN9A 5I0DA 5FZ3A 3KWVA 1VBC3 3O0XA 4JAUA 5ISLA 3C3SA 4FBFA 1ZZCA 3WDXA 1US3A 3VKFC 1G1XB 4NIGA 1LHWA 1WP8A 1NT2B 3IDAA 3CZUA 4DV7O 1NCRA 4KP4A 2XQRA 1PNKA 1LOEA 4OUSA 4Q0VA 3QTCA 1XE7A 1OA4A 1XOUA 5FPBA 2EXJA 2F23A 4XJ9A 4QU2A 4YFWA 1BE3H 3WQBA 4HZ3A 4M3CE 5DDJ2 1R091 1WCKA 3MAQA 4FO9A 2OT5A 2OIGA 3FYEB 2QTWB 3VBSA 4CEWB 3K04A 2IC1A 4TSVA 4CDQB 1XNQB 3H8RA 3KMHA 2W3JA 2C9KA 4F83A 4IE4A 1H2KA 1K33A 1PZ9A 3EHBB 3USSA 2CTVA 5LHHA 1RUF3 1UQXA 4LJHA 1UZ0A 5JSOA 2JJ1G 4YM0A 5FZCA 4DR2O 4YW2A 1HP8A 4ZONA 4BWOA 1POV3 3RWRD 2D6NA 4NR1A 1W2AX 2WNVC 1DQ5A 1ULDA 2Y6HA 4DV3B 3RYKA 4I3GA 1HNXO 5LRRA 1OJHA 1SQBH 3IIAA 1XB9A 1UYXA 2WR9A 4DO0A 1F5JA 1ZWIC 3QO7A 4BWAA 1QOSA 1AP6A 3I4IA 5FZOA 4CTEA 5A80A 2XHNA 3OPZA 4HKOA 4DR4B 1TQ5A 5B5EZ 3M99B 4JZ2A 1MS0A 4AI8A 4LFCO 1HW5A 4QPIC 1L3JA 2VGDA 2XAGA 4R9CA 5DDJ3 3O1SA 4LF5O 2FCVA 4NN0A 4MH0E 2VRZA 4EB6B 1NKGA 2ADDA 3F95A 3I3DA 1QHDA 1GUIA 4Q1PA 4JI7O 4AHYA 3VBUC 1E5SA 4S2HA 5J37A 2UUCB 4EROA 5FP8A 4LH7A 3ASIA 4RFT0 2YB7A 4LA3A 5EQUA 1EV11 3MHZA 1VE0A 4X64B 2EINC 3ETEA 2P4EA 2YIBD 3BVCA 1MZEA 3U10A 3E97A 4YVWC 1F9KA 4YGEA 1R1ZA 2XL7A 3K9AA 4KHPO 3ZYRA 2EBOA 2B46X 1NQTA 4IESA 1UY2A 3JBG1 1IPJA 2XKPA 1JMUB 1AYN1 4DR5B 3PIJA 5A7QA 3BA8A 5B66Z 2JDYA 2EAKA 2J1TA 5LL6Y 3CDZB 3JQXA 1VQOV 2QDRA 4L99A 2UWCA 4PELA 4U7OA 1MS9A 5FY1A 3GZAA 5CA6A 5BZBA 4G4FA 3BTZA 2L6LA 4R4ZA 3A22A 1VR3A 4H37A 1J3RA 3JD4A 1YTFB 1TME1 1NS1A 3NNLA 4DR7B 3LPFA 2E33A 2V73A 1Y4MA 4AF9A 4YG3A 4DV6O 2WNVB 3G6JB 5FZDA 2XJRA 3AL5A 5C70A 5A1FA 2C24A 4QX2A 1JZ5A 2RDQA 2SLIA 1S77D 2QSAA 3M3CA 1SZTA 4JYYA 5KLVH 4QXBA 4NHMA 2ATFA 1UY4A 1XMOO 3MIGA 3DPRA 1VQLV 3NL1A 3ZYHA 5DN6G 4Q4V1 1UAIA 3POBA 4MGTA 1QHTA 1O91A 2XJQA 2HHHO 5JI7A 4JF3A 3MF9A 2WO3A 5ABJC 1V70A 1V9U1 3K51A 2BERA 3JAKB 2WWWA 2HWC2 2GNDA 3Q8FA 2ZHNA 4OLLA 2Y38A 1SDWA 1XQNA 1UXZA 1GH6A 5KX5B 1JCHA 5A6XA 3CWBH 3VBUB 4E2LA 1OSGA 1EPZA 4Y5TA 4FIPC 4ASKA 3CRQA 4JYAO 3IPVB 1IBKB 1JU4A 5A33B 1REEA 1HNZB 1UY3A 2PHTA 1XXNA 3OBZA 2EINB 3CX5F 2ZR2A 3EXAA 5CU1A 5LB6A 4MS2A 5FLXN 2O0OA 1RITA 5FZAA 4CC6A 4LF9O 5AC91 2A73B 2R72A 1ZL8A 1PZ7A 2QWOB 5D5QA 1AJNA 4CC5A 4UFJA 1DLCA 4M00A 4CP9B 1DBNA 1C1LA 3POIA 4UXAA 5JOYA 2HWC3 3E83A 1PK6C 5L3DA 3VQXA 2JKXA 2X5IC 3OUJA 3ZCCA 3RYPA 3KT1A 4JI8O 2VOVA 3OUIA 2P5BA 4RSUA 2XBO1 4B7KA 2Q8EA 1GN4A 2JS5A 3W7TA 1W90A 3GF6A 1DK1A 2EJRA 4X8PA 3ZYJB 5FYHA 3K59A 2LGWA 5JOXA 4QX0A 4ZI7A 3OD4A 3ALQA 1SHWB 5EFUA 1J95A 5FL7G 4FFBA 3H3LA 4UBGA 3SXWA 4IEWA 4GA9A 1NCQC 1S0FA 2XUEA 3WF2A 3ZPYA 4EWEA 5LK7B 3P3NA 1VRH1 3H3UA 4Q1RA 3OY8A 1QNWA 1UX7A 1OHFA 1Q3EA 5ABJB 1FMD2 5C6CA 2QKDA 1AUYA 2ZE6A 1WW5A 3FYIB 4DEQA 4B7EA 1V6KA 4UB8Z 4DV4O 4NHYA 1H2SB 1WB7A 3QF7A 4QXCA 3IIIA 5L9VA 1WWYA 1VQ5V 4IV1C 3MLKA 4JGYA 2OCHA 4EWAA 1VQPV 4IEPA 4QPKA 3M3OA 3IAQA 4AVSA 3PMSA 3AG1C 2JK5C 1T2XA 1IPKA 4UV8A 2Q67A 2W6IG 1PX4A 4XUPA 2Q1ZB 3DF0A 5JXGA 5FIXA 4IHJB 1YWKA 4LBNA 4G9SB 1OOPA 2YPDA 1JMKC 3MFCA 4A45A 2QCSB 1ENVA 1FFXA 1ASJ2 4XOGA 4CRQA 4DINB 1L8DA 1TNRA 1JYWA 3H1HH 3ZIWA 3EYPA 2JEUA 1URFA 1VRBA 3IBMA 4EQVA 3WQ0A 4NTWA 5D2AA 1D7PM 4ZXEA 3OEEG 2G9GA 3BU0A 2BTQB 1FMD3 1I6XA 3VQWA 3PN1A 2WO7A 3USUB 4EJRA 2GC1A 1H9PA 1QVGU 1PK6B 3MW4A 1GOHA 1JJ2U 2XAFA 4D0QA 2X5IB 4YFZA 2A3WA 4N7UA 4EN8B 4WVWA 4FFHA 1IKPA 5ACA1 3RYHA 3LA2A 1OCCC 1H1IA 1Q56A 3CJHB 3B69A 3V0AB 1Z5VA 3H3ZA 4NIHA 2ZPXA 4PA9A 1P4RA 1NCQB 3UJQA 3VB9A 3LB9A 3WF1A 2DW4A 4LLOA 2JX9A 5F5IA 1ASJ3 4HANA 2PUSA 1S55A 4LO5B 4BLIA 3POSA 3HN1A 1UJWB 1VMHA 1H8VA 4LUMA 4CS4A 3GCXA 5H6RA 1POQA 3K5MA 5JOWA 5H2FZ 2F93B 1G9FA 2IUWA 4AHXA 3K0DA 1X8EA 4IV1B 3LDBA 2V5DA 2XAQA 1GSLA 2ZNJA 3O1TA 3U78A 2QEXV 4LOTA 3RBZA