1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
4X6RB 1O7FA 5I0UA 5LEJA 2BGCA 1FI2A 2GH2A 2QCSB 1JUHA 1YWKA 5FLIA 2H6BA 3TNPB 4XEZA 1CAVA 3DKWA 3B02A 2IXHA 3R6SA 4WZCA 3H1MA 3NW4A 2BNNA 3MPBA 3M3IA 4JVAA 1V70A 4Z82A 2K0GA 4HVRA 1UPIA 1SEFA 1CAWB 2PYTA 3SCHA 1J1LA 2OZ6A 2QNKA 3DV8A 4A2UA 4CYDA 4FAHA 1X8EA 4L11A 3N4MA 3OTFA 2XL9A 1UW8A 5CADA 3GYDA 3E97A 4QXKA 3U0ZA 1Y9QA 5FLHA 4XFAA 2UYBA 3OGJA 1OI6A 4XFCA 3UKVA 3IBMA 2XKOA 3PVBB 3DL3A 1NE6A 2EVXA 1VR3A 3S7IA 1RUOA 4WBBA 3BCWA 5JSPA 2BNOA 3TNQA 1ZRFA 4IEOA 1RTVA 5E16A 4LULA 3LZZA 2GC0A 1UIJA 2VECA 4MH0E 1U12A 4EV0A 4META 1X7NA 4IEWA 2B9UA 3HIFA 1IPKA 4HSJA 2GU9A 4EWAA 2PTMA 2PHLA 5FDBA 3IIAA 1ZZBA 1H1IA 2MHFA 1YFYA 4QM8A 1J3RA 4TLFA 3E5UA 4KWJA 5HI0A 3LA3A 3QOPA 5JAXA 3I59A 2PAEA 1QXJA 4XFIA 3HQXA 3SMHA 1Q3EA 4I0AA 5FPZA 2PQQA 4R8HA 3CL1A 4MX3A 4E2SA 1O5UA 4MGZE 4J1WA 5J48A 5CU1A 3UKTA 4PIYA 1WA4A 5J3UA 3WW4A 1NYWA 2CAVA 3ROUA 4XF3A 1O3RA 1YFXA 4MZUA 2OYZA 4LLOA 1CAXB 3BPZA 4AVAA 3M70A 3E6CC 3MZHA 3FE5A 1YLLA 4N9IA 2O8QA 5BPXA 4EWEA 4UXAA 4D7SA 5JSOA 2GC3A 4IESA 3LAGA 4LTAA 4AXOA 4ORFA 5I93A 3EHKA 4F8AA 2ZCWA 3H1YA 2ATFA 1HW5A 1TQ5A 2F4PA 4MGYE 4AQ2A 5FQ0B 3CLPA 5KBFA 3CO2A 5FQ0A 5FPXA 1ZNPA 3QACA 1O3QA 2ZKLA 4HBNA 3NSTA 1X8MA 4XF4A 4EWDA 1CAUB 4MV2A 1UIKA 2WC2A 2IXCA 3NKTA 2UY9A 4LA3A 1J59A 5CVRA 2UY8A 5FLJA 2Q4SA 3I54A 5FCCA 1UCXA 4FAGA 5I8TA 1VJ2A 5KHGA 4PIXA 2IXIA 5I8SA 1ZREA 3UKNA 3I59B 3SXWA 3CF6E 2VQAA 2WFPA 1NXMA 1G6NA 4XFBA 3G7DA 1O5LA 4O9GA 4ZU5A 4XF0A 4UBGA 3ELNA 5KHIA 1ZX5A 2FQPA 2K9ZA 3CJXA 2D40A 1OFNA 3D82A 2DCTA 4PIZA 4L2NA 1LRHA 3OF1A 2H6CA 4WVZA 2XKPA 4IEXA 4JTNA 3KGZA 2MPFA 4J1XA 1H1MA 1LKNA 5BV6A 3RZZA 3RYPA 3H7JA 3MYXA 3JZVA 2E9QA 3IDBB 4UBHA 4NVPA 1GQHA 2BNMA 2D93A 4Z07A 3S0MA 2CGPA 2P17A 3FFQA 4IEUA 4RD7A 1YFUA 1DGRA 5LEKA 3E6BA 2ET7A 3LA7A 1ZRCA 5C8WA 3DN7A 4XF9A 1ZZ6A 4XFFA 1ZZCA 3BB6A 2C0ZA 4QGNA 2QDRA 1OMIA 2XHKA 4P9GA 1L3JA 4N9HA 3MDPA 4Q29A 1CAUA 3VHRA 3KMHA 4BYYA 4QX5A 1Q43A 4QMAA 3WW2A 3H3UA 2IXLA 5E1RA 4KU8A 1DGWA 4YRDA 4KU7A 1ZZ7A 1QWRA 2BYVE 1WLTA 4HSLA 3H3ZA 4IERA 4IEPA 3E5QA 5JSRA 4Q0SA 3EBRA 4KWKA 4KWLA 4IETA 4XETA 1PMIA 4FT8A 5J7MA 1ZZ9A 2XL7A 2GZWA 3NVCA 4QGMA 4YNIA 1CAXA 2EAAA 3D0SA 3BALA 1I5ZA 1LB2A 1DZTA 1FT9A 5JCTA 3H9AA 2Q30A 2B8MA 4EROA 5EFUA 1J3PA 1YFWA 5D1IA 1RUNA 2VPVA 3ETQA 2D5FA 1FXZA 2GC1A 3LWCA 4H7LA 2XLFA 4ONUA 4OLLA 1ZRDA 3H50A 3SHRA 2HKXA 1J58A 3BU7A 4XF1A 4I3PA 4I09A 4QM9A 1EP0A 5KHJA 4Q0VA 3ES4A 1ZZ8A 1UD1A 4XFGA 4MGKE 2N7GA 4I02A 4HZFA 2PAKA 5I8YA 3FHIB 2PAMA 2I45A 3H8UA 4IEQA 4D7TA 2PFWA 2OPKA 3OCPA 3C3VA 5F1RA 5I0RA 1O3SA 2Q1ZB 3H7YA 2GC2A 3NL1A 3OD0A 1EY2A 1QY4A 3WW1A 2UYAA 4QGLA 4ZU7A 1Y3TA 4MGIE 1O4TA 2IC1A 4Q0QA 1GQGA 1CAVB 4XFHA 5LRRA 4IEVA 2ETEA 2PA7A 5T3NA 1ZVFA 4LEJA 3O14A 3PNAA 4JTOA 4AVCA 1QXRA 4I01A 4K8FA 2QVSB 3FWEA 2H0VA 3ST7A 2Z69A 3FZ3A 2BEOA 4YSFA 1VP6A 4R52A 4Q0UA 3U10A 5KHKA 2OZJA 3D0JA 2GAUA 1CAWA 4X6QB 1J3QA 4F7ZA 4HVQA 3RYRA 2IXJA 5BUVA 3IDCB 4HVOA 2CV6A 2B5HA 4GULA 1EPZA 3KGLA 1CX4A 1YUDA 2QJVA 3E5XA 4FBFA 1X82A 4AQ6A 3RPQA 4O9EA 3EO6A 3RDIA 2XLAA 3L2HA 3ES1A 3PLQA 4E2GA 4LA2A 3H1WA 4YARA 3HT1A 1RL3A 2EA7A 2Y0OA 3U11A 5C6CA 3EQEA 5I0SA 3FX3A 3LOIA 1LR5A 4MUVA 5LRSA 3SCGA 4HN0A 1XE8A 1XRUA 1EYBA 5BXXA 1NZCA 1SFNA 2CAUA 2V09A 2Q0AA 3RNSA 4KL1A 3SCFA 4HMZA 4BHPA 1WGPA 5JR7B 3I7DA 4Q0PA 5I0TA 2D5HA 1I6XA 1RGSA 4ZU4A 4YYOA 4LUMA 2FMYA 2IXKA 4LUKA 5EZWA 5K8SA 1NE4A 3RYKA 1O3TA 3S7EA 1ZRRA 4I0BA 4HN1A 3EJKA 4E2QA 1IPJA 1YHFA 3NJZA 4I2OA 4BIFA 5AVPA 1XE7A 4IEZA 2HJIA 2KXLA 2OA2A 3LA2A 5I91A 2MNGA 2PHDA 4B29A 5BY5A 3HT2A 4BH9A 2XLGA 4PJYA 1CGPA 2Z2SB 1SQ4A 1DZRA 1Q5OA 2ET1A 3E6DA 3KCCA 5KHHA 4AVBA 4HLTA 3KSCA 1PM7A 4JV4A 4IEYA 3GBFA 3ZDSA 4DINB 3IWZA 3WW3A 1OD5A 3FJSA 1RC6A 3USSA 3CEWA 2XGXA 2O1QA 3ACLA 4OFGA
chains in the Genus database with same CATH superfamily
3AYAA 2YSUB 3AXEA 2NMOA 2WJSA 3TNPB 4XEZA 5FO9B 3CC7V 4UFIA 3NV2A 3KT4A 3CNAA 5LOVA 4GH4B 1J84A 1G6UA 4QHOA 3GZTB 4Z82A 4UVCA 2OCCB 3HR9A 4LC1A 1KB9F 1J1LA 1BMV1 4AG4A 5CADA 3E97A 5FLHA 1H6XA 2JICA 2YC2A 4DZGA 4MW8A 1KU9A 2YUEA 2NNUA 5DN6G 4CEYB 5L7OC 1N1VA 4ES9A 3BCWA 3NKGA 1IBLO 1WW7A 2R072 3B5LB 1ND2A 4AEDA 1ZBE2 5FYTA 2MEV2 3OE7G 1BL8A 1LODA 5FY0A 1BEV2 1H9WA 4B1MA 3Q4HB 1OCOC 2WLLA 4JZRA 3AP6A 2PHLA 4B08A 3ZPYA 2MHFA 4N7UA 4UXNA 4W4ZA 4GA9A 2P22C 2PHRA 1ND3B 1WMXA 1QXJA 3CKHA 5EQUA 1XNBA 4E2SA 4FLUA 2BJSA 1M56C 5J48A 5CA3A 2ZNIA 2CSGA 2JWPA 4KH9A 2ZM6O 4HOOA 3E8GA 4MZUA 3E6CC 3GWOA 4XBLA 1SFYA 4B3RB 3MLKA 4P9JA 2XBO2 5HCAA 4FQZA 2GHYA 1IXBA 5CB4B 5J09A 1RUJ3 4WVMA 4C0BA 4XUNA 2DN9A 1HNXB 3WP6A 1GLHA 2ZGQA 4Y22B 2WS91 1ST8A 5GLTA 2CYFA 4HKWA 3KG2A 3ZS8C 1ZAUA 1BVP1 4PIXA 2QE3A 1SFPA 4IGPA 1GWKA 3C3SA 2P67A 4YW2A 3CF6E 1VF6A 3BAAA 3OPTA 1XPWA 3EXUA 1X4TA 2FYUH 3CCUV 4DXWA 1W04A 3VL8A 4FK5C 1MEC3 4YGDA 5JH7A 1PL0A 3AKSA 3CMGA 1F2NA 3VN4A 2CDOA 2JE7A 5FJKA 1VBA3 4R4ZA 3OUHA 1SZXA 1AILA 3AKRA 4TV8A 4OMDA 1H8TB 4GYCB 5BV6A 2J1SA 3P30A 1YO8A 1B06A 2BNMA 3N9LA 5GZGA 1U5IA 3DYMA 4IEUA 4K35A 1D0GA 5KXDA 4EFBA 4WM7C 2FCUA 3ZN6A 4RHV1 2NP0A 2VL4A 4OHWA 3JSLA 2PY5A 3BB6A 5FZOB 4JGYA 4BAYA 5HFLA 1IBMO 4DXZA 3WQBA 2DQ3A 4QB2A 1PL4A 3GB7C 2YG0A 1XBLA 4QT6A 3SPGA 5DAPA 2W08A 4FFIA 4PA4A 1YIPA 1OCZC 1M93A 3B01A 4DY5A 3VBSC 1N3OA 3NVCA 2ZEXA 1AXKA 1I5ZA 1LB2A 1FFXA 2E3CA 1LOCA 2DBNA 2VZUA 3ZMSA 4K1YA 3PJQA 1OLRA 3OBAA 1W0NA 3J8F3 3L9DA 1URXA 5EZYB 2ZD9A 1Q6HA 1STMA 4W4KA 1G7YA 4YPJA 3H1IH 4QDQA 5FYMA 3IT8A 1W39A 3RYIB 1QEXA 1DG6A 3MUZ1 3DYPA 1HNXO 1IG0A 3H7YA 1NT0A 1QY4A 5JJJB 3JUUA 4QGLA 4CE8A 5CA0A 1BZKA 2IBZH 1UNBA 2VCBA 4LITA 4IV3B 5DUUA 4GWJA 1BCXA 4GMP3 3T0BA 4HK8A 3RMXA 1G4YB 1LJ7A 3W20A 3FWEA 1W0OA 3M7MX 3NQHA 4OHXA 3I97A 5F7UA 1OF3A 3V0BA 2IFWA 2WLIB 3IDCB 2F93B 4FLWA 1W6MB 2VCCA 5FWEA 3W5MA 2BFUS 1P7BA 3UO2A 2N74A 1N34B 1VARA 3QVNA 1JOBA 2VMCA 2YFZA 1WB7A 4AI3A 1W6PA 2DYRB 2D2CB 5K1XA 4TT3G 4LO6B 3W7WA 2F4LA 2HG5C 4WM8B 1Q8SA 4ZIBA 3BTZA 1PGL2 1JVMA 4QPIB 1OBNA 4EZHA 2RS51 3U07A 4UFJA 1C8M1 4QU1A 3NJZA 5BNNC 3P6BA 1X33A 4JI1O 1KECA 2V4AA 3I2GA 1Q8QA 5F6KA 2IUWA 2A9HA 4GKXA 2ZAAA 4Q4V1 4L8QA 5EV7A 1V54B 4Z2AA 3N27A 5B66Z 2WT2A 4CEWA 5HV0A 4IEYA 4AQYO 1XMOO 1RC6A 1KRIA 4PDVA 5IVCA 4LFBB 1REFA 1RUG3 2WRAA 4P08A 1WCUA 2A3YA 2JS3A 2JVDA 3G6BA 1DYKA 4XHXA 3AJYA 4UCVA 5C8CA 2PELA 2RVAA 3ZIWA 3CRRA 1UAIA 4NN0A 2Y4TA 3K0GA 3CBNA 3SGIA 5C33A 1ASJ3 4HVRA 1UPIA 5LYJB 2ZGOA 2LGQA 4K8RB 4A2UA 4UCRA 2ZHMA 2CK3G 2RV9A 4C91A 2WQZC 3HN3A 2Q68A 3OUJA 5EYPB 3J81N 2Y64A 2ZX4A 2C24A 5DQ0A 2LQTA 4Y5Z0 1I0HA 2DWDC 2GC0A 2XAJA 3TJTA 3VDCA 4GZRB 3HIFA 1FATA 3AFKA 4IGQA 4EZ4A 4EWAA 5L3CA 4X8PA 1PMJX 1LNQA 4F4LA 3DC6A 3PUAA 2XOMA 2G19A 5JH7B 1OA2A 4COYA 2H94A 5FZHA 1IGOA 4TN7A 5FY8A 1S0VA 1RUF3 5FPZA 4NYKA 2RHPA 2VQFO 5J3UA 2UWBA 2A7WA 3H1HH 1K5SA 1YZBA 3K58A 1R1A3 4BXFA 2D6PA 5KXEA 1XNTA 1IHMA 3JD0A 4UXAA 4UW5A 1N36O 2Z42A 3NNJA 3LSDA 5B1AB 5T5OA 5JMOA 4FOWA 2ATFA 3U14A 4WVMB 4COWA 3RSJA 3VDBA 1PK6A 4ASUG 4SBVA 1IQDC 4P30A 4CDQC 5FY5A 3MBWA 4QKNA 5FY7A 5FUNA 1FS0G 1UZWA 5IAXA 4KUMA 4KI5M 1YI2V 3KB5A 1K3EA 1HW7A 4XXAA 1XILA 4INDA 2VC9A 1NG0A 2DVGA 5HPOA 2JDAA 3RS6A 1KP3A 4IHJB 1RUF1 2ZM6B 1RMU2 2Y48A 3ZJZA 4BB3A 3ELNA 2ZAHA 1YF2A 2H6CA 4BMEA 1Y74A 4CDWB 1Z0HA 3THTA 1P7GA 2Q0OC 2XJSA 1AJQA 2ITCC 2D6LX 1I94B 1UYZA 2OT5A 3F5TA 1JYNA 4RHV3 5JXHA 3SPJA 2W92A 2ZPXA 5LEKA 2BWCA 4QPGC 4YZ3A 2NLJC 1CONA 1FX5A 2VTFA 5CIRA 1HNZB 3UNPA 1SKVA 2LROA 3AMQA 4OUEA 4N9HA 4A4AA 1CN1A 5F3IA 1W6OB 1EN4A 1D4VB 1DTOA 3MDSA 2IZWA 5BNOB 3KCXA 1KXGA 3WCRA 4W6WA 3CXHF 5DAQA 1NA1A 4YW7A 4KWLA 5F3GA 1EFRG 3MIGA 1PO11 1NUKA 2GZWA 2PMWB 4YNIA 3ZKYA 4NPRA 1L7QA 5CG9A 1S5LZ 1R083 1CD3G 4EROA 2V72A 1OCRB 2QQUA 5JVDB 3SJBC 3ETPA 1RUH1 1HX6A 3JQXA 1BLZA 2M6YA 1WWYA 1PKXA 2WLPA 2NN8A 2UXBB 2XPJA 1GP6A 3ZO0B 5DDJ2 1QR8A 5KLVH 4HZFA 1AR62 1YI9A 3POIA 4DUZB 2PFWA 5LBCA 1OURA 1D7PM 3HQRA 1YIJV 5LK7B 4J80A 3CJIA 4CU8A 5FPAA 1AYN2 3DUIA 3N7KA 4XFHA 4P9YA 4J11A 4JAUA 5IT9N 2W1UA 4BXSV 2ADQB 4DYLA 4XUPA 1SDDB 3K9SA 4XTMA 4NIGA 4OZOA 3U10A 1JYXA 5FZKA 1OJHA 5A32B 2Q8EA 3PU8A 3L74H 1UPGA 3T1HB 4CDUA 4J9ZB 4L0PA 4CZSA 5CYYA 4X1YA 4FOYA 1DGSA 5DDJ1 3S5AA 2VXRA 3VZMA 2OTLV 1KS4A 3H1WA 4ZS2A 2F23A 5FO7B 3PIJA 1RSOA 3FB7C 4AI8A 2VUCA 3T2QA 3CRMA 4QIWF 4KG0A 2O14A 2JG9A 2OIIA 3RNSA 5JPNB 2FDGA 1US6A 3AK1A 4BHPA 5JR7B 3OR6C 4GX0A 4E4ZA 4M3CB 4WBNB 4I0BA 3IN9A 2BBAA 2P4KA 1AROP 2EIEA 1MS3A 3MF6A 4I4TB 4BK4A 4DR1B 4IL7A 3LA2A 1O4ZA 4FLZA 4XBNA 2J1VA 4PJYA 2LP7A 1K33A 4IYHA 5A32A 3O0XA 1VAKA 1FFTB 5DUXA 4JV4A 4XBFA 2XUMA 3ZDSA 4CDWC 4PA9A 3ZHVA 1EV11 1CEZA 3G4SV 2XGXA 3UGHA 4OFGA 2PI5A 4X6RB 3TETA 1R3LC 2QCSB 4CU9A 1M4UA 2H6BA 2JG8A 1Y4MA 4O2BB 5FXXA 4MVRA 1RINA 1OV9A 4HONA 2X05A 1G8MA 4OPAA 1TA8A 1G9FA 5FMCA 3JD2A 5K9YA 3WDYA 4YHHO 3K75B 2OZ6A 2ZGSA 2E32A 3DXRB 2WIIB 1HN0A 1JFFA 3UM7A 1AF9A 4W4LA 3GCWA 4XFCA 2YY1A 3GF6A 2LW1A 2UWAA 2XKOA 2WLHA 1VF5B 3OJBA 2YGLA 1QBZA 5F2SA 1AR71 3ZHUA 2BNOA 3TNQA 5DUWA 2DQ0A 1P4RA 1QR9A 4QKBA 4PA3A 2WKKA 3BN6A 4N43A 2YYOA 1GP4A 3W58A 3URFA 3AYEA 3RZKA 3MF9A 2BTQA 5A7OA 2RDSA 1SQFA 4QDSA 1HQLA 2HWB3 3O1OA 1K97A 4U3JA 1W8UA 4XJ8A 1GZ9A 1COV3 2VBDA 1NTKH 1JOYA 1YFXA 4LFAO 4AVAA 3SEEA 2EIKB 3KHBA 3FAVB 2C26A 2ILMA 5JSOA 4P9WA 5FKCA 1RUI3 2VZPA 4XACA 4YY3B 2IVJA 1N47A 1QHTA 2F4PA 1PNKA 4AQSA 2CDPA 1L0LH 2A71A 2Y26A 1FXKC 3V0AB 3ZSKA 1ZBA1 1FJGO 3WG7C 4GKJO 2QA4V 4NOTA 1CAUB 4FI9A 4X1IB 2ITDC 1LU1A 5JR2A 2V1DA 2Q8CA 3D36C 3PJYA 3HPLC 5BXZA 3PURA 2AEZA 1A34A 4LF9O 3FHQA 4LBKA 1IZ3A 3APOA 4RFRB 3K3WA 4QQLA 4YGBA 3AG2B 1LOAA 1PGSA 2VQAA 3S3WA 5IYZB 4BQ4A 3O0WA 5E88A 1OPMA 3SDLA 3CJXA 1L7LA 2K9ZA 4CU7A 1Y7BA 1B35B 1WA8B 2Z4FA 4JTNA 3OR7C 2MPFA 2D3SA 2CTPA 3NO8A 3H3LA 3SH5A 3H7JA 3GDBA 2ZIMA 4FPGA 4AL9A 4FOVA 3CCVV 4WF9V 1ZWIC 1VEWA 1UMZA 3KCYA 1FD9A 2XQXA 3BEHA 3CD6V 3J8F2 1IS4A 3JATB 1QJZA 5GZDA 3FUQA 2LFRA 1KD7A 3FKSG 5FZBA 3MDPA 4RAIA 1ODMA 1Q6UA 4Q4X3 3M7AA 2VMGA 2W47A 5J2UB 4QDRA 2PXJA 4XE9A 4DV1O 1OOPC 2OQ7A 3USUB 5A1AA 4O4JA 1US3A 4X20A 1JU3A 4YZ5A 1FYUA 1V6NA 2WFF3 5J7MA 1NXD1 2HYKA 4K7JA 4B3SO 3AK3A 4BU2A 3TXQA 1N32O 4S2DA 3M8LA 3JCZA 1RUNA 2X8KA 3ETQA 2J1AA 2D5FA 1N33O 1FXZA 3RBZA 1N34O 3CRCA 3OSDA 2NM1A 4JGZC 1ZRDA 2ORXA 3SHRA 2L9LA 1UJWB 3BU7A 3OGRA 1FMD3 4QM9A 1W8WA 3M8AA 4PDLA 1Y6XA 4I02A 1HDJA 1NCQC 2RS13 4GX5A 5D8AC 2QKCA 4X1YB 3C3VA 4A6OA 4O2AA 1EAH2 2BSKA 4DIQA 4A45A 2R1DA 1TNRA 5DXDA 4AAXA 5C8CB 4PCRA 2VG9A 3BTAA 4N21A 3W7XA 4TZDA 4OCTA 3K5MA 4IE4A 2W39A 3ZYGA 4Y33A 1X9PA 4YSFA 3K5OA 1WJZA 3FYIB 2KR2A 3QD6A 2GP5A 1J3QA 4E8DA 3HEIA 2Y0IA 3NAPC 3N2KA 3AG1C 1KQRA 1JYIA 3AMHA 3WFVA 4D6QA 2PHXA 2BOCC 4N43C 2TUNA 3RW0A 3TAYA 3FX7A 2K46A 3HKBB 4U36A 4CCKA 1IDSA 1VF6C 4LFCO 1JOJA 2HWE2 5LRSA 3SCGA 1ASJ2 1RB8G 4FOQA 5BXXA 1SFNA 3RYHB 2Q0AA 1TVGA 1JQ0A 4JX0A 3BODA 3VBRC 3AZXA 1IURA 3LSSA 4AEJA 2DBIA 4DUWA 2HWF3 1O3TA 1ZRRA 3VHPA 3MD0A 2Q5TA 2WLQA 4DXRA 2ZEWA 1OLME 4ZZ5A 1VBC3 2OA2A 2R063 2K2SA 3WF0A 2PHDA 3QO5A 5FP7A 2JEUA 2VRZA 1S0EA 1YDXA 2DVBA 4DR6O 3OPZA 4URTA 2A06H 1YQ2A 1WKYA 2HWE3 3T4HB 5A3NA 3M2MA 1NS1A 4GWNA 1S77D 3KV5A 1YIFA 4FXGB 2RQ6A 1AHSA 2VQ0A 5ABJA 1GUIA 3AL6A 4ZY9A 1GZCA 4O4LA 2CGNA 2KKWA 1V70A 4W50A 3BFRA 4JI4B 2CNAA 2K0GA 2GUZA 1KQSU 1OC1A 1HQWA 2Z3YA 1O59A 1NKGA 3C7HA 3WF3A 2ZINA 3ZOIA 1S0FA 3OTFA 3B8NA 3KZIZ 3NRUA 3K79A 4PDWA 1RHI2 4D6SA 2G1MA 2RDRA 1RUOA 4MW3A 1S0IA 2VQFB 4WFAV 5E16A 3P5BA 1LR1A 3LDCA 1U12A 5FPBA 4IEWA 2VOVA 4M3CF 3N9MA 4OI1A 1LHOA 2GSMB 2J1RA 3NAPA 4LF9B 2WYFA 2EIJC 2VR4A 2WNVC 5A7QA 1W2AX 4X20B 1H1IA 4ARXA 4A44A 3JYCA 3WD5A 4RQPB 4UVAA 4BQ3A 4TLFA 1VP7A 2XJUA 1H6YA 2X09A 1QJEA 3I5DA 2DW4A 4WFEA 4JI0O 1Y43B 4LBOA 5IYYA 4MGZE 1BBT3 5AG2A 1WA4A 4K20A 5J98B 1ACCA 4ASLA 1RFYA 1WCDJ 3BPZA 2R49A 3NV3A 4FFGA 1LNSA 3WINE 1OCOB 4HL0A 2L35A 4F8AA 5K7PA 5LATA 1VBA2 2DVFA 1OH4A 5FQ0A 2C9KA 5J2TB 1AL21 3ORJA 1TVKB 3CCMV 4R9BA 2ETNA 4JI0B 4TV8B 1EV13 2WNEA 3JAKB 2WZ8A 1NQJA 3A0RA 5LA6A 3HR0A 2Z79A 3NNLA 4UUJC 5BMVA 1UZVA 1MQTB 1JZ5A 3K0DA 1DFQA 3VBUB 3JD3A 5FK7A 4HK9A 2YS8A 5J96B 2BFUL 3I59B 3MHSC 4A3XA 3AP7A 4XJZA 1LGBA 3HKDA 2PF4E 4XDPA 2HEPA 1DZQA 1OFSA 3GJBA 4K21A 1PK6C 4JASA 5DG1A 4DUYO 5IT6A 4UFZA 1S76D 4J1XA 1PV0A 4RGKA 5JJEB 4ZZ8A 1VMJA 3RZZA 1GH6A 5GLVA 3AP9A 1IKPA 1B35C 1DDLA 3SYOA 2J1EA 5K0UC 1V55B 2D6NA 3FFQA 5BR8B 3LIHA 1F8VA 2ZE6A 4MGTA 3ZX6A 1QNYA 1DF0A 3AMMA 3NJYA 4LBQB 5ANQA 4V2WA 2VUJA 4DRRA 5FZGA 5BMVB 5LMNO 5FPRA 5LHHA 4K6BA 1VIBA 2ZE5A 1TVKA 4FVVA 4KU7A 4I50A 1HN1A 3PMSA 1H4GA 1IBMB 1U97A 3LKJA 4JRLA 1BMFG 2E5LO 4K3UA 3ASNC 4DB5A 2XQRA 5K1PA 1A8MA 1W2NA 1NLRA 3LCPA 2B8MA 1PIV2 3H1LH 1J3PA 5A1FA 2DUQA 5JOWA 3UO3A 3AKQA 1GSLA 2RJZA 4JAVA 5E8AA 1SMVA 3LFMA 4CVUA 4NIDA 4BIOA 1WBLA 1DLCA 3ZIXA 1F35A 3CS5A 1ZZ8A 1JODA 1JFFB 1YJNV 3AG4C 1RMU3 4LE4A 3RG0A 4CCCA 2WABA 3VQYA 5IFTA 2DOSA 1GN4A 4QGPA 3TGUH 1S2EA 3JXSA 5JOZA 4H14A 5LA0A 3N3HA 1IX9A 4QX0A 2QTSA 2UYAA 1YRZA 2JG8B 2YROA 2E75B 3OGSA 2ETEA 5CKMA 1EUTA 2C9AA 5IJ0A 1K9MW 5L9BA 1POV1 2EZOA 2QZ3A 3WNKA 4EE2A 2YU1A 3D0JA 4LO4B 2VJXA 4QX8A 5BNNB 1YXWA 3AL5A 3CCQV 2Q1MA 1JJOA 1YQCA 1JTZX 3EVKA 2HLEA 5LY1A 4EB6A 2RMU2 2XVLA 4QHZA 1FPN1 2UXCO 2RR13 3RMYA 2VU9A 3WF4A 4MUVA 2EULA 2Q8OA 1EAH3 1EYBA 3MICA 2ZGNA 3OGIB 3VBOA 1RUG2 1APNA 4AI1A 3S5QA 3GZUC 4LT5A 4QJFB 4KBZA 3RRDA 3O1VA 1V0AA 1AXYA 3JD72 3ZN4A 1J5EB 3JD4A 4OXSA 3AX4A 4J6GA 2WNOA 2XH6A 3WB0A 4EKWA 4BWOA 4COZA 1LULA 2CDYA 3JCUZ 5DAXA 2KSDA 3NJVA 5DDJ3 5C9AA 1UU5A 3DYOA 3AZWA 1SLTA 5JQGB 3BRCA 3O1TA 5J2UA 5L3BA 1QGLA 1UYYA 5KHHA 2E5LB 3WNLA 2WS93 5FZIA 1WW6A 1SS3A 3T2MA 1SHWB 3ACLA 3T2OA 4I9WA 3UGGA 5GKAC 1WMEA 5C4WA 2LRPA 2Q7HA 1XNCA 1O8SA 2R30A 3B7MA 3WP3A 2RG4A 3RVZA 4CP9B 2Y6HA 3VV1A 2HWF2 4X66B 3VHOA 4CCJA 2ERFA 3AG7A 3E89A 3DV8A 1PNGA 3UT0A 1K4DC 5LW9A 5IVBA 2FDJA 5FFOC 4MTOA 1X50A 1SQXH 3FLRA 4CUGA 1CR7A 3J80N 3UL2A 1HJFA 5JI9A 4DV5O 1ZRFA 3THPA 3FBYA 4MH0E 2ARAA 2VUAA 3ABKC 4HSJA 3S57A 2B4KA 4X1IA 5LGUA 2VW2A 5FZ6A 1ZZBA 2XASA 4NAMA 4FP2A 1JZ8A 5FYHA 4UV8A 4KWJA 2VY0A 2FZ1A 4K0KO 3I59A 3SMHA 3T4VA 3ZIAG 3VBUA 3DECA 1VBB2 3IPVA 3KF5A 1NQTA 1F9KA 4BWAA 2VZQA 3RVHA 1HDKA 1ZLZA 2WNVB 4ORFA 3VZOA 2JX9A 3USUA 1OA3A 4DY3A 2EICA 1AR63 5A6QA 4FPPA 1SLLA 2EBOA 2HJDA 1S0BA 3BTXA 1ZRIA 4ARYA 3PMEA 2FBEA 3HNYM 4QX2A 3NKTA 4XC9A 3QNEA 5C93A 3BVOA 1Q7YW 5EJ3A 2A5ZA 3ZN5A 1ZBE3 3O12A 5FYZA 4BQYA 2ZS6B 3JSNA 4HANA 1WN7A 3SJCC 5KHGA 3I55V 2P1BA 5E6HA 2Y38A 1DHKB 3O9OA 2WFF2 1I9RA 3JAWA 4TLGA 1Q90D 4DUXA 4JDMA 2VMIA 1R6NA 1LHVA 4AFMA 1W0KG 3SEPA 5ACA2 2OCCC 1O4YA 1O8PA 3RYCA 4IEXA 1W90A 3LSUA 4LO8A 5KAIZ 1W06A 5ISLA 4A41A 3E8HA 4PLMA 2IVIB 4NVPA 4CXYA 2LFSA 5LOVB 2YXHA 4RR3B 1NKDA 3KQRA 1H2KA 1P49A 1ZRCA 3AG3B 1JYTA 2GNDA 5D8AA 2UXCB 2HWB2 2KQXA 2C0ZA 4O4HB 1KD1W 2FDKA 3SYAA 1CAUA 1COV2 3DXTA 4RHV2 5T5PA 2ZABA 3V0AA 3N36A 1MS9A 4BA6A 4CCEA 4JYBA 1VF7A 2YDEA 4IEPA 2ID4A 3WUDA 4BW9A 2DFBA 3EBRA 5IK4A 3ZM8A 3E8BA 1KBHA 4JI5B 1ZZ9A 4PA7A 4YGEA 2E74B 2HBTA 3DF0A 4ZKTB 4H33A 1N3QA 5FZ4A 5JCTA 2Y4UA 5JMCA 2DDUA 3ZFFB 2CUGA 2Q30A 2WQ4A 1N1SA 2HWD3 4XMIA 2AACA 1XL6A 5GW7A 1V00A 1KJLA 4N53A 1GMMA 4FPFA 5BR8O 1MVQA 5EK0A 2P37A 3KD4A 2Y34A 4BR6A 1MZ5A 1U5XA 2XBO3 3TWIA 1YYNA 2Y6FA 2GN3A 5T5LA 1MS8A 4I30A 5CFDB 1UY2A 1R3JC 1UD1A 3LDBA 2UU9B 4FPOB 2PAKA 1W0JG 1W3VA 2P34A 3OYWA 2KM2A 3CB2A 2HWC1 2G9ZA 2OPKA 3A8TA 3GM8A 1NCRB 1WZXA 2GH8A 5IK8A 4CS2A 3A0BZ 3ABMB 3VBOC 1K8AW 2PA7A 1GOFA 3ZYHA 5L9VA 3BIEA 3O14A 1Y4WA 4AVCA 1KEXA 2A73B 3FB8C 1ZTEA 1VP6A 4W8JA 1WA6X 4NJ4A 3ZXEA 3CRQA 2DV9A 3POYA 4CEWB 4LFBO 2ADDA 3NNMA 1F5JA 1AB3A 3V64A 4XCBA 1AJPA 4M0HA 4N7IA 3QO7A 1B6QA 4CU6A 1W8NA 3M1HA 1JI6A 2RJ2A 5FPLA 2VVFA 4CS3A 5F32A 3IAYA 1AYN3 2ZGRA 3JQWA 4DV5B 5FZDA 3A22A 3CCEV 2JGDA 5CA6A 4WM8A 1VRH3 1NI8A 1W6NA 5JLVA 1NCRA 1R1A1 2Y69B 4R50A 2F95B 4X89A 2D98A 1RGSA 4D7YA 4AEKA 5BNPB 5JZGA 5FY1A 2YXSA 1U5YA 1XYOA 2XHBA 2EJ7A 3RYKA 3WZ1A 1SCSA 3MLJA 4CCOA 4BIFA 2ZJCA 4LF6O 1A78A 4UVBA 5CFDA 4XUTA 4WBNA 2RNBA 4NRQA 4B29A 4QHBA 4AHCA 5BY5A 4DR4O 3QG5A 2AYHA 1F4NA 5CBGA 2OT7A 3QLQA 3VBOB 3E22A 3K5LA 2QBXA 1PM7A 3VHNA 5B1BC 1BHAA 2AUYA 4KMQA 3VD7A 4EN7B 2IM9A 4YIOA 2XAGA 1G9BA 2O57A 4Q8KA 1B04A 4LBMA 1HQNA 4CCLA 1SQGA 5I0UA 2VBBA 5DG2A 2BGCA 4YVWC 4R9DA 1M1KW 4H7MA 5FYBA 3TCUA 3DKWA 1PZ9A 5B1NA 4AF9A 5LY2A 3NW4A 1C1LA 1LOEA 3MPBA 3TEXA 2QFEA 5FY4A 4HXCA 4J7JA 1K7DA 2PYTA 3SR2C 2QNKA 3RZLA 2EIJB 1KC8W 4MHRA 3N4MA 2YBSA 5LHGA 4JKKA 1W2BU 5CBFA 3SKVA 3LNMB 1Y9QA 2ZHLA 5IHRA 3ZMUA 3IB3A 3UKVA 3ZXDA 4BOWA 4ZOLA 2QTWB 4NRMA 4GZ9A 1ULGA 4CDXA 2AGSA 4KGGA 4WBBA 3LUTB 4P9XA 4DNYA 4ASKA 1DYOA 5IVFA 3PN1A 2QKDA 2NN4A 2ZXQA 3MHZA 4DV0O 3Q8CA 2DWRA 3I2FA 3ZCCA 1UY0A 1JZ4A 1RUD1 3ENRA 4QPKA 2P5BA 3EYPA 4X66O 1YFYA 4QM8A 5T50A 2X6CA 1U96A 4DV4B 3JAWB 4AFCA 2NR5A 3IDEA 2D3OW 2BZDA 3DTUB 4LBQD 4ZHQB 4LMFA 2CAVA 5LASA 4FSJA 3ABKB 2WWSA 4LLOA 2YBKA 3LPFA 3STZC 2P6JA 3WF2A 3ZSLA 3ZN6B 5F6LB 2B46X 2WZR3 2E7TA 1FMD2 4N23A 4IV1C 1HW5A 4BK5A 1NBMG 4UAPA 4I50B 5FPXA 3RN4A 1LOFA 1AI7A 2ADPA 4F83A 3B09A 4FFKA 4H13B 1RUJ2 4DR2B 5CVRA 5CKNA 5J1XA 1AP5A 4CEWC 1BZWA 1V6IA 3ILFA 2JIGA 1FXKA 2QQJA 3RT3C 1T6BX 2CTVA 2EINB 3O65A 2R9IA 1GRJA 2EXHA 4XIKA 1NXMA 4AYUA 5EYPA 1O5LA 4DXTA 1GWLA 2JDHA 3WG3A 2J42A 2FQPA 2D40A 1OFNA 2JDNA 1TE1B 1PIV1 1ZL8A 2DMXA 5LWBA 1T2XA 1V6OA 1KMIZ 2LJ2A 1AL23 3I56V 2HP8A 1HLCA 3VUOA 4ET7A 4TWKA 4UBHA 3C7FA 3NR7A 4YGCA 5C5TA 1RVF2 4Z07A 1QDOA 2FDHA 1S55A 1M57B 4MSWC 5A7NA 4QQPA 3B8MA 1HV1A 4IYIA 5FPUA 2Q67A 5IVYA 5F5CA 4XXPA 2VZ3A 1OMIA 2QWRB 1JZ7A 4JPRA 4PDWC 2EIBA 3U4XA 2AHZA 5E1RA 5FLXN 2Q4PA 5EJ1B 5GZCA 5CZKA 4IERA 4Q0SA 2XONA 1XYNA 4XETA 1YQ5A 4I0WB 4H44B 1SERA 3S3XA 2JB4A 4EN0A 4RL7A 3SJAC 5GM0A 2QWNB 1BCCH 4CDQA 4XZUG 4Y24A 2ARHA 1AR83 4D94A 1GN2A 4ATFA 2RMU3 4AI9A 1ULCA 2P6CA 4IE0A 5DMYA 1OQEA 3S30A 1TG7A 2BP6A 1RPRA 3CCRV 1PM4A 3B40A 2YFUA 2D6MA 1ND3C 2PLV3 3WQ1A 3OGVA 4D7TA 1MA1A 1W6MA 3ZRSA 3ZPOA 4LJHA 1GZWA 1OHFA 5I0RA 3UQ8A 2VO5A 2QQVA 2WLIA 2I07B 4COVA 3K46A 3JD73 4XJUA 5LP6B 4H3WA 1QJX2 2LW8A 3OM3B 2DE0X 4NXMB 4ZS3A 3MIFA 4LEJA 1K45A 4PDWB 2BGPA 4JI3O 4RUFA 1LCLA 4HT1T 1QHDA 3RGBA 1HRV1 1JW6A 4MSVA 5A3TA 2OZJA 2JS5A 5IW0A 2JE8A 2WPDG 2JG8C 1IG3A 1CJPA 5CA0B 2GUZB 3RYRA 4XQWA 1N36B 2NZ9A 2B5HA 4GULA 4CDUB 4O4LB 2VUDA 3RYIA 1YUDA 5T5JA 4IL6Z 4MXWB 3LEKA 3CU7A 1GU3A 5A33B 1KUQA 4DFSA 2Y6KA 1WCSA 1W6QB 3DXUA 3WB2A 3FX3A 5FYIA 3LOIA 4DQAA 4LBEC 1VIWB 1XRUA 3FD9A 2CAUA 2CTWA 2J1TA 4JCKA 1WGPA 5I0TA 1PGW1 3AKPA 2FCTA 2SBAA 2VW1A 3AMPA 1SF9A 3LEGA 1K5MA 4NO4A 4GUNA 1NT2B 2VMDA 2LS6A 1LAJA 1KGYA 3ZFEA 2KXLA 3VDDB 4HKOA 5I91A 1L0NH 1VPHA 2R9RB 1PZ8A 2VQUA 4MYEA 2E63A 1OCCC 1PO21 3BY6A 1UOGA 1NZIA 2PYLA 1MEC1 2ZGTA 1EAH1 5FUPA 5IVVA 5L19A 1H8HG 3HKBA 2HJFC 3K4DA 5LEJA 1OXCA 1W9SA 4DV0B 4CH3A 3B02A 1UKGA 4WZCA 2R043 5JWPA 3BABA 3HAGA 4TOIA 2WAMA 2BE3A 2ODMA 2RCVA 1C5IA 2YIBD 2AENA 1JUIA 1SEFA 3CWBH 1F5FA 3V56A 2Y6JA 3T1YB 2A7AA 1LUWA 1SACA 1W8ZA 2WBKA 3U0ZA 3OEHG 2WUHA 3K51A 1OCZB 3B77A 2XTAA 4X64O 4IV3A 1NZ6A 4KGQA 2BSKB 2Y0PA 3D3IA 1RTVA 3A0KA 4QKDA 4YG3A 3O5SA 2LW7A 4META 1X7NA 1AR91 5AC91 2DYSC 2GU9A 3C7GA 1QLEC 2GDSA 5FYUA 2V4DA 5FO8B 1MZFA 4LBJA 2AH2A 1BQZA 1AI5A 2GBOA 1IQAA 1VBC1 3AG3C 3J8F1 2Q8VA 3OOXA 4R8HA 2PUSA 4J1WA 1UZ0A 2IW5A 3DCQA 3LE0A 1NOVA 3AG4B 1YLLA 1WNSA 4X65B 1PP9H 5BPXA 3HBZA 3JALA 5CB7A 3JAKA 2QM8A 4MVMA 3LFIA 3K3NA 5FZ0A 4AQ2A 1JHNA 2C4XA 1JPXA 2Q8DA 4QB6A 4FZ1A 1SBFA 4WZFA 1NCQA 1RUC3 2ZKLA 4NHMA 2VMHA 3NSTA 1N1YA 2JJ6A 4UFLA 4AHWA 4G3YC 1QU0A 2WLLB 3K06A 1QOSA 1J59A 4LA3A 3JB4C 1U5ZA 3HWJA 3RYFB 3I54A 3IAPA 4QX7A 4AHXA 2FL4A 5LGTA 3VZNA 1LTEA 4DO0A 3KVBA 3WVJA 2H8PC 2V73A 1LHUA 1XNDA 3VD9A 1UOJA 5L3GA 2RS12 3OUSA 1WW5A 3ZXGA 4RQPA 4C1XA 2BERA 2EXKA 4B3SB 5KXBA 4L2NA 2XMLA 1VQOV 1LEMA 2QGNA 3FLTA 1OQDA 4P9OA 3KQ4B 2W1QA 1KJRA 2FHRA 3O1RA 3A21A 4CUCA 4JGZB 4LFAB 4LH6A 2ZR2A 1UMHA 2WZR2 4FFBB 2HBUA 4DEVA 4JHTA 2Z5WA 2F43G 1DU3D 1DGWX 4LLFA 3WNMA 4K1ZA 3K5NA 5H9SA 3N9QA 1N32B 1MS0A 5CB4A 4NKGB 1W8FA 1OUXA 2DU0A 2R061 4AILC 2XL7A 2VZ1A 3MW3A 4R6ZA 2EAAA 4Y26A 3G6JB 3GBWA 5A6ZA 2DUOA 3HQUA 1V6LA 4JI8B 1E79G 1DQ1A 4EFEA 4X88A 1W9FA 5D1IA 2IU0A 3RQ0A 1TMF2 3ZR5A 4CDXB 3ETEA 3I2IA 1ND3A 4OLLA 2AZ5A 1D5AA 3MIDA 3RZJA 5JPMB 2BTQB 4DRVA 5GLWA 1RVF3 4I3PA 1KFXL 3JU9A 1WB8A 5I8YA 2B42B 4U7OA 2K1EA 2C2AA 1HKDA 4IEQA 4GKKO 5F3EA 4MXWA 3CJHB 1WLDA 2ZE7A 1K34A 3NL1A 1D4M2 1O4TA 4HFSA 2JDUA 5LRRA 5KWRA 4I7ZB 4XDJA 1PIV3 1ZVFA 3MIEA 3AK2A 1I5PA 1UU6A 4NTYA 3MHHC 2ZMNA 4CEYC 1IKQA 4H0LB 4A42A 1CP9A 1MOFA 1CAWA 3KV4A 4YM0A 4DV4O 4S2GA 4CRQA 4AGGA 5IJ9B 4AQ6A 3DPRA 4YARA 4W65A 3ETGA 1UU4A 4DR3B 2EA7A 4LF5O 3U11A 5KR7A 1MS1A 4AZZA 3DGTA 1AZDA 2FMDA 2VZSA 4QWNA 5B1BB 2VOXA 3WB1A 3SCFA 4XDLA 3POGA 4HPKB 1J5EO 3CE2A 4B1LA 2A0LA 1SRYA 2YI9A 1NE4A 1OSGA 1XDCA 3THOA 4X1KB 4GALA 4EEQA 1G86A 3T2PA 1BHBA 5A3LA 5IJ9A 5KA6A 4M3CA 2FB5A 2VCMA 1UPSA 1BBT2 4PBPA 1W9YA 4IGGA 1Q5OA 3K4AA 3OFNG 3KCCA 3CYOA 1AXZA 3OEEG 4DINB 4E4DX 1FKAO 3UV9A 4F3JA 4X9QA 3B3QE 1KKCA 3L75H 1SPPA 4IT5A 2YIBA 4LH7A 3A23A 4AGVA 3UJOA 4YW1A 1EV12 4JI2B 4ZKIA 2GP3A 5E1AC 1XNKA 3SITA 1ENQA 4QPWA 4Q1RA 2E7QA 1WLEA 2AZ2A 4CDUC 4Q4Y3 4P9LA 1CVNA 1XHXA 3RWRD 3OGJA 1HRV3 1ZBA3 3R4UA 1W2TA 2LALA 2GNBA 3IBMA 5IATA 3VKOA 2BU9A 1NQDA 3QCWA 4XJAA 3ZFGA 1AR93 1UIJA 2BVBA 2B9UA 3CC4V 3BCCH 4NPLA 3NMBA 3C7EA 2O0OA 2F66C 2OPWA 2YXYA 3H9VA 5FTTC 2PYJA 3WT3A 2BOBC 1WMFA 3T09A 4OYUA 1FPOA 2UXXA 4CC6A 4AK3A 1M57C 3T1YO 3E5UA 2FKXA 1S0DA 3QOPA 4XFIA 3HQXA 4Q4W3 4LQRA 3I2KA 1RHI3 4K8ZA 3FE5A 4N9IA 4ZHQA 4NTWA 2VZVA 1HXS1 1XNQO 1PNFA 2NLRA 4X8NA 2ZT9B 5LXTB 2EINC 3PUSA 1UL9A 3HD8B 4OQ8A 2MW2B 1VBB3 4JGZA 3MI8A 2W0XA 4HBNA 3WP5A 3ZRWB 1E5SA 3VD3A 2TBVA 3UYJA 4OGQB 2R071 1GOGA 5FLJA 4Q5OA 4XYXA 4LR3A 3J9SA 4IV1B 5FYCA 5A7WA 4LK6A 3X2QB 2P3IA 2QE7G 5B4XA 4HETA 2IXIA 3RJ2X 3UKNA 1F15A 3I49A 1THZA 1PZ7A 2JDZA 3CDZB 5KUKA 4MXVA 2WFPA 3I3BA 1XXNA 4C0HA 5IVEA 2HEWF 2WZR1 2PQSA 2DCTA 3PHMA 1C8M2 4GX1A 1QKQA 2JJ1G 3Q4HA 4N53C 2GNTA 1PO12 1NCQB 4LF4O 1GQHA 3QH6A 2DFCA 5FNVB 3SPIA 3T30A 4BZ4A 2P17A 4KP4A 2YICA 4FLVA 3FHAA 1GBGA 3K2OA 3TN91 4QU2A 4XF9A 4LCUC 3Q8FA 5C3OA 3BA8A 4YZ4A 4QE9A 4D6TH 5IUQA 3POFA 4Q29A 1H2GA 4LO7A 2DYSB 2LTNA 3ABUA 4GWIA 1PVC1 3B2EE 5GJ6A 5FZCA 1ENRA 2BPA2 5JI7A 2RJLA 4FM1A 1SZTA 2Y33A 4HKLA 5CFCC 3GJAA 4J41A 1YCIA 3ACFA 1W59A 5LBEA 1SETA 3P3NA 4PF1A 4XQDA 1FT9A 4LBLA 1W6NB 4FM2A 4F6RB 4RWUA 2VCAA 2R16A 3HNMA 4YZ1A 3G80A 2JGDB 2FCVA 1JBCA 5EC2C 1YI7A 1XE0A 3IAQA 2JD9A 3TN93 2R9AA 3RI8A 3SH3A 2P7TC 4V1PA 4I4TA 2A1XA 4FP3A 4XHBA 4D6RA 3H8UA 2VXJA 3LEIA 4Y1YA 2JK5C 3U78A 3WSOA 5EBLC 2GC2A 1LGCA 3MFCA 3AP4A 1SG3A 1N8RW 1GQGA 3VD5A 4BIZA 3J26N 2SLIA 2G9FA 3LNNA 4P5YA 5H2FZ 3ZXKA 3O1PA 1LOBA 4R52A 2ZX3A 3B00A 4P02B 1QH7A 3K3OA 4QQHA 4X6QB 2WDBA 4MVUA 2B39A 1N4CA 5SV8A 5D5PA 4PBOA 3CCLV 1MZ6A 2HWB1 1VMGA 3APQA 1YEWA 4FPEA 3B93A 1I1EA 3T1CA 4LA2A 1VBE3 2GTSA 1RXFA 4LHLA 3WG4A 3KVAA 2EX3A 4HNAB 3ZHQA 5LBQA 4GB31 2RN9A 3LPGA 1YITV 2F6BA 4PLNA 1AJNA 4DV1B 4HMZA 1CZTA 2D5HA 1XL4A 1RUI2 3S7EA 3KV9A 4HN1A 4LNUA 5IYDO 4JZ2A 2JECA 4TUYA 4B4PA 1S0JA 1QJU2 3KS7A 5SV5A 4FLTA 3BUCA 1DQ5A 3OW2U 3T08A 1SQQH 2WWWA 4JYAB 4ZI7B 4QPIA 1JMUB 1WBFA 1FNYA 1AUYA 4HLTA 4QPGB 2ZDIA 2OIGA 2HKOA 3I3DA 2JG9C 2WN3A 2Y60A 1KFUL 1UX7A 1QJY1 3CEWA 1QJU3 1MVEA 5HXVA 1XI1A 3MV01 2LO1A 3L70H 4YJ2A 3G71V 2ZKOA 3CIHA 3EFFK 4OVEA 4FFBA 2QTOA 4AVVA 3H1MA 1VQPV 1VQ5V 1O9HA 1BK1A 4FFFA 3I3MA 3G6EV 4I5SA 4FAHA 3AVSA 3CZUA 4XFAA 3DPRC 2WO3A 3QO8A 4YVWA 1LOFC 3ABTA 3OY8B 1OOPB 1Y76A 4LOTA 2MEV3 1K5JA 4YM3A 3L9JT 3S6PA 5IDJA 3PIGA 3D36A 4IIJB 3CJHA 4GT1A 4HZ3A 2QJ1A 3J7AU 1GFF2 3APBA 2V5YA 5FZ1A 1MACA 1COV1 1VBA1 1YSCA 5FDBA 4KHPO 4XILA 4LP8A 3J7MA 2XOKG 2D43A 2XJTA 3HKEA 4DV6O 5BZBA 1WD3A 4CUBA 4I0AA 3CL1A 4RUEA 4WFGA 4AHZA 3BIWE 2EAKA 4JI7O 3KHCA 3AC0A 1NH2D 4LBQA 2FMLA 4EWEA 4DR5B 4D7SA 3EHBB 4TSFG 2PN5A 2PHTA 5GZFA 3K48A 5G05L 4A7ZA 4DR2O 4YW4A 2R0FA 2VTXA 4QPJA 4WFHA 2W6IG 3F5WC 4KQ7A 2R72A 1W8HA 3FL7A 1GP5A 4GCZA 4OPHA 2GNMA 3VQVA 1AI4A 4PQQA 2ZHKA 2QWQB 1ZREA 1SA0A 2ZA9A 3SXWA 1JZ6A 5FZ9A 3L71H 1A32A 3B4SA 1G6NA 1ND2C 4AEDC 4O9GA 1FXKB 1AYM3 5LBFA 1JA8A 3A2FA 3ZFGC 1URFA 4PIZA 3H0OA 3THCA 3C90A 5IVJA 4N8MA 3MUY1 5H9PA 3L73H 3ZXJA 1JYCA 1RUC1 1GO3F 4BIUA 3IDBB 2EJRA 3E1F1 5HXMA 3BGAA 4RD7A 2W46A 1BEV1 5A6YA 1DGRA 3ASNB 3E6BA 2XJPA 5FZ3A 3E2EA 1G9CA 1ENSA 4PLOA 1VRH1 2Q6AA 5A80A 2ZX1A 1LHWA 1NCRC 3VHRA 1VAMA 5D5QA 4QX5A 1Q43A 1SBDA 3OEBA 2IXLA 3X2QC 1DLBA 4R8CA 1RUJ1 1PHMA 3NV4A 1Q8IA 4X62B 2FTKA 3FB5C 1PMIA 4A7YA 2RDQA 5ANNA 5FP4A 4Q4X2 2XJQA 1GTOA 2QSAA 3R4SA 3HN1A 1OVPA 5G04L 4GJYA 1RUH2 1I5YA 4CPBD 4HAMA 1I5XA 1GNHA 3H50A 3C3TA 3J7NA 2HKXA 5FP3A 3ZN0A 3F2ZA 5C71A 2XG3A 4D69A 4NIIA 2EILB 1WLWA 3O1UA 3ZR6A 2I45A 3SH4A 4U3FH 2JIZG 1CPYA 2UWCA 5DAWA 1QIQA 4JGSA 4XBQA 3AKTA 4XAAA 4XW3A 4L97A 4OZXA 2W6JG 5ABJB 3VLBB 1AR82 1AR73 1FXHA 4OX9B 1Y76B 1C57A 4CCMA 1OOPA 1K92A 4IEVA 4Y1ZA 3HMYA 3CC2V 2ZQMA 2Z69A 4UCOA 3GZAA 1RUG1 4Q0UA 3CP1A 1VBD2 5D21A 2IWGB 3ML0A 1OVSA 3ATGA 3WEZA 2ZXWB 2IXJA 1DQ0A 4HVOA 3ACHA 1DYPA 1EPZA 3MO4A 4JKMA 4CP1A 2QJVA 2CWSA 2DCJA 3MW4A 1AP6A 3RPQA 3JARB 4DV2B 2JENA 2K9PA 3EO6A 3V0BB 2IFRA 2W2IA 1ZSPA 2FD8A 3WDXA 2QM4A 3EQEA 4RO2A 3KZ4C 3TN92 1FJGB 2JXAA 4L9BA 5FMDA 4HN0A 3IC9A 3PTRB 1NZCA 1DGLA 5HCHA 1NTZH 5FBZA 1WLCA 5EJZB 3D5OA 3W21A 1EZVH 2ZHNA 1EPWA 2IXKA 3J7LA 3B9IA 3AYCA 2OW4A 3ZXFA 1Q8PA 4Q4V2 4CP0A 3WX5A 2OIEA 4B3MO 3H1JH 4NRPA 3J4UH 1AR92 1PPJH 1N0JA 4Y4YA 1NVPD 5LMNB 1PVXA 3DKQA 1YTFD 2BUKA 1CWPA 3FUOA 4AFAA 4D8MA 4FTSA 3LQCA 4DUVA 2XB6C 1F51A 1VQ9V 1MS5A 2H0BA 1OD5A 5CMUA 2O1QA 4JYYA 1CX1A 1XU2A 2RDCA 2F17A 4AR2A 2B5UA 1YWKA 2A75A 4V2VA 1ZM1A 4F6EA 4CPBA 5H9RA 4YWAA 4SLIA 5LMUO 1HB3A 1S2BA 1TGOA 2QKAA 4P5HA 3Q9OA 1Z5VA 1I08A 1QOTA 1C5HA 4P00B 2P3JA 1AR1B 3ILNA 4Q4W2 2DYRC 5IK7A 5FZOA 4OUSA 2EALA 2WA3A 1Y66A 4QXKA 2RM23 4XMAA 4MVSA 5C3QA 4L8JA 2KG7B 1DCSA 3BU0A 2YEVB 1QMJA 1SESA 3A0HZ 3IKWA 4JZGA 1JZ3A 3UETA 5BNOC 4Y5SA 3I8TA 2JD4A 1GZWB 1M90W 2G9GA 3K57A 4UB6Z 4GB32 4LKSA 4KFMA 3ZEDA 2Y6GA 1Q82W 2WLJA 1J1TA 4TTGA 2C6SA 4JQRA 5J2TA 4BW5A 4OULA 4JTDB 2YC4A 4IW3A 1SLCA 5FXVA 3ZSJA 2VWJA 4ZHNA 4O4HA 1PO23 1HRI3 3MZHA 1WP7A 4Y1UA 4FIPC 5LHIA 4YFWA 5I93A 2NQYA 4PDRA 5KBFA 1KS5A 3CLPA 4LE3A 1RUE3 2UUCB 1E1RG 3OTOB 3WQ0A 4UFHA 2UY8A 3ABMC 1B35A 1FXVA 1AL22 4G9SB 3SYPA 1CQ9A 1POV3 5CEHA 3R65A 5FK8A 1H0BA 4WFFA 2DVDA 2WWJA 1LENA 3M99B 3J7HA 3KV6A 1L7RA 5KC5A 2ZZJA 2WSUA 4KG8A 4JI4O 2ZIOA 2XKPA 2DU1A 1WCKA 4MTFA 1NR1A 4PI2A 1RUC2 3RYPA 4CS4A 2RR11 3W7TA 1HV0A 1BEV3 3LIGA 4Z1VA 1OCRC 4CEYA 1PO13 1CIYA 4CDXC 1H2LA 4DR6B 1V6MA 5E89A 3N9NA 4AQTA 4NHLA 3NWKA 5FY9A 3JBG2 4JV5O 3LB9A 3WHTA 5L73A 3WW2A 2ARBA 4KU8A 3N35A 4YRDA 3KT1A 1GM8A 4DV3B 4AFBA 1PD3A 1BYHA 1ULDA 3ASOB 5A3PA 5LCWL 2BW8A 5DZEA 4TQDA 2BDRA 2GALA 3JBG3 1EN5A 4GAZA 5FPVA 1LHNA 4Z1MG 1HB2A 5F5QA 4ZONA 1D4M1 5CAZA 1QCEA 4ISQA 3QH7A 3U37A 4LF6B 2IJIA 4RQFA 2XLFA 2YPJA 4KNCA 1G9AA 3OEAA 1XQNA 3CMEV 4UT5A 3RWNA 1Z7S3 4ABMA 2BTOA 5C8YA 2P2KA 1SLBA 5J37A 1KDMA 1Z78A 2Q1FA 3OCPA 4OUMA 2XT9A 4YG6A 2Q1ZB 3OD0A 1HWYA 4RYDA 4UW6A 1SDWA 1OA4A 2WA4A 2OX0A 3WY6A 4K8FA 1W6QA 4FFHA 5LMUB 5FMOL 5FP9A 3LDDA 4M4RA 5IY5C 1D4M3 1SQVH 2ZCEA 2UUBB 3VQXA 4YM2A 5JQGA 2WR9A 2CV6A 3VBRB 5M0TA 1X82A 4AVTA 1WP8A 3L2HA 3ZMZA 3CHXA 3PLQA 2LUWA 3LDRA 1Z7S1 4L99A 4DV7B 1SC5B 4TYSA 1SLAA 4BQ2A 1OLMA 2ZGMA 2V5DA 2DTYA 4NXNB 5ERLA 4N53B 5LP6A 2JG9B 1YJKA 2F4VO 3BI3A 4LKDA 2VQEB 2HVKC 4NR1A 2P4EA 3CCJV 2VWKA 2JDIG 4K9SA 4H2AA 1HB4A 2FDFA 4GD4A 4QX3A 1IPJA 1YHFA 3V65A 2P5OA 4IGOA 1OCCB 3TRSB 4IEZA 2HJIA 3HVDA 4QQOA 5KX5B 2IJJA 4JTCB 4ISRA 2D44A 1AJKA 3HT2A 5BNQA 1WAZA 3WXPA 2DURA 1UFIA 1TAEA 1K42A 3E6DA 4RS5B 1R1BA 1FV3A 5D2AA 1IBKO 3E86A 1P8JA 5GALA 5F8PA 4UFKA 2CAZC 4A3ZA 5IJ0B 4P9IA 2ZBJA 5APAA 4MVQA 3IZOA 5FLIA 3JATA 4NB5A 1AX0A 1EN6A 3R6SA 2ZGKA 4I55A 2RS32 2BNNA 2BOIA 4AE2A 1OQ1A 2J22A 4E4SA 1LEDA 1WPXA 4TWTA 3SYCA 4LO5B 2X5IA 1CAWB 5IFPA 4YFZA 2N05A 4BLJA 1U0AA 3P1IA 4JYCA 3QTCA 2NYYA 3VQWA 3OUFA 4QXCA 3OB8A 2X0LA 3MGUA 2NPIA 3VDAA 3PVBB 2HFEC 1NE6A 4C8DA 1R093 2R062 3IFXA 5HCFA 3ALQA 3ZYPA 3VBSA 1UY4A 1H2NA 3HKCB 4G4FA 2G38A 5GLZA 4B3NA 1GZTA 4QE7A 5K0UB 5FXWA 2VVEA 4CC5A 1R6KA 4IE5A 3ZSEA 2EIGA 3DSQA 1HNZO 2WO2A 3CEIA 5JIAA 2R042 2WNVA 1JN2P 5CU1A 1M9NA 3BOWA 4DXSA 4IV1A 2DTWA 4Z92B 1DLLA 2WYSA 2OYZA 1XOUA 1CAXB 5T52A 2JGUA 1ULPA 2O8QA 2A6WA 3WG1A 3LAGA 4MVTA 3ZRWA 5H6RA 1TME1 4TXWA 1MS4A 1RUE1 5A3WA 3VKLA 4MGYE 3CO2A 4FZ0A 1BK0A 4XF4A 4FLYA 3MLLA 1VBD1 1O6UA 3POJA 1YQ8A 4JI2O 1MEC2 3ZYRA 4IQPA 5FYVA 4XTPA 4GB33 5K4LA 1VJ2A 4FXKB 1OUSA 3WNOA 5DECA 4FPLA 4RFT0 2UXNA 4K40A 4XFBA 4I0XA 2D7FA 1MQTA 5A7PA 5ITZA 3OGGA 1BJQA 1QNWA 3WQ7A 4TQFA 3UJQA 4EJRA 2RMU1 4UFMA 3F95A 5B4NA 2VMFA 1A6CA 2Y69C 1S3JA 2AC1A 2WO1A 4WVWA 3SPHA 3ON7A 3OPWA 2H3OA 3JZVA 4I55B 3ZFGB 3JAMN 2A6YA 4J7ZA 2R041 4QB1A 1OLQA 1YFUA 3TEYA 1V6JA 5C4WB 1AX1A 2XR4A 2EF6A 5C8WA 3MPPG 1NTMH 1NU1H 1ZZCA 1R081 4DOUA 5FJHA 2KA3A 1XNRB 1T6GC 4QMAA 1P84F 1AYM1 3H3UA 1XSQA 4ASMB 1N0NA 5GTHZ 4HSLA 3AEIA 2HEVF 4YVSB 4RQEA 2YB7A 4GH4C 1AR72 1S4CA 1CZSA 5L7OB 1ULOA 3C7OA 4OHZA 5HFMA 3H9AA 4OI4A 3LSEA 5J36A 1YFWA 2XHNA 3ABZA 3WU2Z 1GN3A 4URAA 2GC1A 1GKBA 4ES8A 1IBKB 1W2UA 2WNUA 5KHJA 3TEZA 2YHJA 4PD4F 4NE9A 4EYUA 4QNHB 5CFCB 2VD7A 1Q8OA 2I2SA 4FTBA 1K3IA 4MVOA 5CKQA 3VBFB 5F1RA 1EY2A 1GYKA 4JTAB 4MHUA 5E79Z 1XU1A 2VQEO 4W6YA 2XJVA 2JE9A 3GGLA 1KP2A 3ZMVA 3PNAA 1QXRA 2H0VA 4MGQA 4NHKA 3M4FA 5LA2A 3DPRB 1E1QG 1AR5A 3BPSA 1VQ7V 2ZX2A 2R7EB 3B94A 3AFGA 4AAPA 5BUVA 3ZRXA 5DN2A 4O4IA 1CX4A 4Y4RA 4FBFA 1Z7S2 3N7MA 2AW9A 1W28A 3IMNA 2YIAA 4XIOA 1VALA 5KMGA 1LGNA 4FPYA 4P2ZA 3AZZA 5A7SA 1YTFB 3OUIA 3INAA 5F9TA 5JOYA 3KF3A 3W9AA 4K8XA 5B1OA 4R9CA 2PGGA 4KL1A 3ZHRA 1A3KA 4TV9A 5LL6Y 3I7DA 2UUCO 5A1LA 3U75A 2W94A 1VQNV 4KHPB 3MAQA 4E2QA 5EXOA 5KMGB 4I2OA 2WLMA 2DF7A 1MMMA 5L3DA 1VBE2 1E5IA 3JARA 1PMHX 4QQ2A 2P06A 5DAVA 1VQLV 1ZBE1 1EM1A 2MNGA 4ZXKA 2C5DA 3ZKUA 4BH9A 3KM5A 5AC93 2RS53 2WNUC 2Z2SB 1DZRA 1Y9GA 4MVZA 1WD4A 2OWOA 1UY1A 1DP0A 1VQ8V 4EN6B 1BHGA 2RJKA 4LNVA 3GVMA 3IWZA 3WW3A 5JJNB 2EXIA 2XWJB 4E4HA 1FI2A 2GH2A 4Y20B 3VKFC 3UESA 4WM7B 2OKXA 3GALA 3ABLC 3ZYFA 4BJ0A 2WZEA 3M3IA 4JVAA 4LF7B 5C3RA 3I2DA 3R4DB 1RP3B 2O8OA 1PO22 5BNNA 2UUAB 5FZEA 1W05A 2A6XA 4DRXB 2R0HA 1X8EA 3MIHA 1W9TA 1UW8A 2WNUB 4LKFA 3D3QA 1OI6A 3VKNA 5A9GA 1IS6A 3VZLA 4JV5B 4E8CA 1NR7A 4IHJA 4RN5A 3S7IA 5FYSA 2GMMA 3T1MA 2AXTZ 4EQVA 3ZRVA 5JSPA 2Q9LA 5DPNA 4J9YB 3ZYIB 1F4MA 4LULA 2E51A 4XDOA 3A7QA 3PUIA 4P9PA 3VBHB 1US2A 5L7OA 5A70A 1GNZA 1C3HA 1CPMA 2PTMA 1D5NA 1PK6B 1RUI1 2PHUA 3RWKX 4L92A 5KAFZ 1PX3A 5GZEA 1YVWA 1ZUQA 5FZ7A 3TEWA 1E5RA 2HWD1 3LA3A 3R05A 2QZ2A 1Q3EA 1POQA 4JGYB 4CDQB 1UN1A 3RZHA 1BGYH 2ZMLA 1VQ4V 4XF3A 1HRV2 1COWG 3CQOA 5JVVA 4X62O 1OKQA 5GLUA 1MG1A 2PLV1 1QJX1 1GKFA 3H1YA 2RMKB 3T1LA 4DK1A 4YLZA 2PZSA 1JYWA 5FBJA 3O7OA 1F4HA 4DR7B 3KWVA 1C8M3 4IV3C 3QBQA 3JALB 5C3PA 1W0PA 5JZGC 3LGRA 1REDA 2ZX0A 3O0VA 2Q4SA 2ZGLA 3VDDC 4MS2A 4FAGA 3OMAB 1E57A 5GONB 2B1GA 4AI0A 4S2FA 1DQ4A 3C8XA 5FAXA 1SA0B 2J7MA 2WQ8A 4ZU5A 4M3CE 1PM9A 4AI2A 3BYWA 4H37A 2MK3A 4UBGA 1ZX5A 5ABJC 3ZMNA 4UF0B 4KBBA 3OF1A 4PJ0Z 1JJ2U 5JCOC 3LDKA 3FN9A 3HKDB 1R091 3TYJA 2D93A 5JXJA 1ONAA 4DW1A 3IM0A 1D2QA 5EIYB 5GONA 4H55A 2AGAA 2ET7A 5L36A 3T4ZA 2WAOA 1UYPA 2QDRA 2XHKA 4TSVA 1L3JA 2VZOA 1R6TA 2OUJA 2XJRA 3ZFFC 2XUEA 2ZGUA 3I3EA 1ZA7A 3N7LA 2ADEA 3QF7A 2BYVE 5KXCA 3CZJA 4BQXA 3E5QA 4I9QA 4IETA 2JKXA 4JI8O 4FPKA 4AVSA 1RUE2 2BQPA 3N2GB 1UY3A 3LDEA 4RQPC 1M06G 5DZGA 2CE4A 4IIJA 2OS2A 1DIWA 4YG0A 3SKJE 1UQXA 4TV9B 2W5FA 2HH9A 1RM1B 2XVGA 2A3WA 5C9AB 3AG2C 4YVWB 5F2WA 1W6PB 5C9AC 4I09A 1EP0A 4XFGA 3ZFEB 1S5HC 1ALYA 1NA1C 1WPBA 2PAMA 1RUH3 1K5MB 4HG6B 3VBHA 3IJ4A 4DR3O 1XMQB 4R9AA 2QQOA 3ACGA 3H01A 4S2HA 4B3RO 1M5IA 2EIMB 4MGIE 2DCYA 2IC1A 4Q0QA 5CNAA 4Z8BA 4XDKA 4YJ2B 4LWSB 5IWAB 2UURA 4B7EA 2BEOA 1PGL1 5BYNA 2Y8KA 3K03A 4DRXA 5KHKA 1OHHG 1TUBA 4NXNO 1RIRA 2HWC3 5A2QN 2E53A 3SNMA 5BNPC 1VRH2 4U2AA 4TUYB 5H9CA 2XLAA 4WM7A 1Q8VA 3WLUA 1JX9A 1YJWV 1MZEA 5F37A 3AK0A 1W2OA 3M3OA 4Q4Y1 1WUVA 1XE8A 4JI3B 4YXWG 4ITCA 1REEA 1CXZB 2V09A 4YY3O 3OMIB 1YC61 5F3CA 4YW6A 5F39A 4J10A 1FFXB 2CL2A 3EJKA 2E7AA 1RSOB 5L9RA 2Z5UA 2AREA 2RDNA 5FWJA 5FZFA 3OD4A 2XAFA 4XJWA 1UXZA 3ZN1A 1XJAA 4GMP1 3MIBA 4GMP0 4KWUA 3JASB 3B9CA 2P90A 2YBPA 1GR3A 4GKKB 3PL0A 4NIAA 5DEDA 4AVBA 4A5UB 3FJSA 2GTAA 3H42B 1O7FA 1KKDA 2ZXWC 1FOD2 1VBC2 2W9XA 2P3YA 3N2KB 2KD7A 2VNVA 2AZ0A 1L1FA 4BDVB 4CH5A 3NJXA 1RJ8A 4FJCC 3R0RA 4CYDA 1POV0 1VBB1 1F7YA 1X9TA 4M01A 5TSWA 1FPN3 4DEQA 3F7YC 2QQIA 3ICXA 2IH3C 4DS0A 1ULEA 5FZLA 4BISA 1HJGA 1ROPA 3UK9A 3IIIA 2D6KA 4E27A 4IEOA 4D3WA 3ILRA 4Q26A 2QM7A 1BBT1 1UXXX 2VW0A 4Y3OA 5EP9A 2JIJA 4FQ4A 3A0NA 2A3XA 2VZRA 3WDWA 2AHYA 4M4PA 3HOBA 1BE3H 1DK1A 3IIAA 4BQ1A 1AR61 1J3RA 1GQPA 5HI0A 5I0DA 5KA5A 5JAXA 5BNOA 5ACA1 2PQQA 5A6XA 1W6OA 3WG7B 4MX3A 2ZZQA 3UKTA 4PIYA 1VQMV 2HWE1 3ROUA 3E83A 2JDPA 5LA6B 3MW2A 2VQTA 5LB6A 2A70A 1J83A 1MPXA 5DUVA 2DUPA 4X8AA 3Q8EA 5A3OA 5FL7G 4O4JB 4YVSA 4DV2O 5FQ0B 1YQ6A 2LGWA 2GSYA 1S1AA 1O3QA 5JXGA 2QR4A 4RGGA 3HPNA 3HKCA 2IXCA 3D6EA 3VB9A 4Q1PA 4LORA 4LK7A 5L3FA 1UCXA 3L2YA 5TISZ 1LOGA 1SZBA 4NHYA 5FOBB 1XEQA 4E4EA 1JYVA 4YIPA 1A8DA 4B8EA 2A3QA 2X29A 1WCQA 5C4WC 1AJOA 3GCXA 5KHIA 3D82A 2WWUA 3F7VC 5CBLA 4WVZA 5LK5A 2E26A 2E33A 4OQ9A 3NV1A 5ITZB 4BE3A 4MT8A 1I7FA 4UW4A 3O1SA 4GH4A 2CGPA 5LXTA 4BPZA 3THDA 1NY72 1JMKC 3DN7A 4WCEV 1QQCA 1YJ9V 1HR0B 4Q6GA 1V6KA 3VL9A 3CMAV 3LSQA 4LIUA 3ZDVA 4PHZA 3VOUA 1MQTC 1N33B 2C1FA 4NIHA 4B4QA 1XNQB 1JR9A 1AI6A 3JD1A 2WT0A 4KWKA 3MEPA 3H8RA 2YI8A 3FAVA 1FYJA 4Y20A 1C1FA 4JQTA 1VQKV 3MV11 3VBFC 4M00A 1DZTA 4P14A 3RZGA 5EFUA 5DM6V 4Q27A 5F5IA 1ASJ1 1L8DA 2VPVA 1AVBA 4OX9O 3E22B 1FOD1 4ONUA 3FFZA 2WFF1 2YEVA 1D2DA 1J58A 1QJY2 3GZEA 1R1ZA 4NWVA 3ES4A 3FBMA 1VRBA 4O7XA 2N7GA 1K4CC 1V9PA 2I74A 4JAAA 1FNZA 1TUEB 4XPVA 5FYYA 2JDKA 3NXSA 3PVOA 5JZGB 1BQ0A 3VKMA 3AG1B 3SQOA 1Y3TA 4E2LA 1C8NA 1XHZA 4UCUA 3I2JA 1SPPB 2BV4A 5GTIZ 3LD8A 3SISA 3SLIA 3PDQA 3AZYA 4LF4B 2XBO1 2PI4A 2UUBO 1TME3 1MR5A 3T1HO 4XABA 4CTEA 3DXRA 4AOCA 2OCHA 4Q2FA 1UF2C 1XB9A 1QJY3 2ATKC 2QWPB 2CGOA 2X5IB 2YIDA 1XYPA 1FPN2 3KGLA 4B7KA 2VNRA 4O9EA 2F1MA 1TME2 3ES1A 5C8YB 1OF4A 3HT1A 4XUOA 2ZDIC 4X1KA 5C6CA 1QLNA 5I0SA 1PX4A 3K9AA 1OKOA 4UCTA 4Y5TA 2ES3A 5H5NA 4PI0A 4RS5A 2XXZA 1CJDA 3C2UA 4JDNA 2CTQA 5EIBC 4Y1XA 2D97A 3VBFA 4YZ2A 4DV6B 5K8SA 4U7NA 3OYWB 3POWA 1GICA 1DBNA 1JXNA 5AVPA 1OT5A 3ZXAC 2VS0A 5JXIA 1NA1B 1XQ8A 1HB1A 1K5MC 2EIDA 1ENVA 1NVPB 2HWF1 1JS9A 4JDOA 3JCIA 5AVAA 4X64B 3OT7A 1JOPA 3GBFA 4RA0A 2R6QA 4LR4A 5CN0A 3AXDA 1NX9A 2VNGA 5EHDA 1UO9A 4LF8B 1W99A 1JUHA 2ZOEB 1RITA 3IGAC 3WNPA 5FNVA 4LIVA 3HNBM 2JDYA 1IS3A 4IXLA 1H2SB 1BKZA 4KXRA 2PLV2 1J95A 3POSA 1UWWA 5LGNA 1IXMA 1QDCA 1TUBB 2R1BA 1Y67A 3LF7A 3SCHA 2YGMA 4CDWA 4L11A 1R3IC 1VB4A 2RS11 4IUGA 3GYDA 1N3PA 2UYBA 1PVC2 4MADA 3ZHTA 1B09A 1GMGA 4WVVA 2P4VA 1VR3A 4XCAA 4RR3A 1G1XB 1XSRA 1QLEB 1W3XA 4XURA 1S2KA 4EV0A 1ZBA2 1HRI2 1IPKA 2ZR3A 4O61A 2QQWA 4Q4W1 3RYCB 2W1WA 1WA8A 1DQ2A 3RJRA 2EILC 1UZZA 3IMMA 3OGCC 4I0XB 2ZEZA 2PAEA 4AW7A 4ICGA 1K12A 3X29B 5JDBA 4DR1O 1O5UA 1Y9MA 4XOGA 4NPMA 5EBMC 4DW0A 3WDTA 2UXDB 1O3RA 1R092 4LF5B 1MNGA 2W87A 4COUA 2R073 2GC3A 4N90A 4JI7B 3ZMOA 4AXOA 3ZLIA 5B3SB 1BXHA 1RUD3 3T0DA 4NUBA 1PNLA 1HNWO 5FZAA 5JOXA 5B5EZ 2GN7A 1H1AA 3AM2A 4EWDA 4MV2A 2VMEA 3SJQC 3OMNB 2OYQA 2UY9A 3ITQA 2W0FC 4LBNA 1UOFA 3CJIC 4NXMO 3D4KA 2CY6A 1R1A2 3G67A 2X6AA 3VGIA 5I8SA 5F2VO 1MSWD 4BQ5A 3GXUA 1NY71 3G7DA 1RYYA 1W9WA 1C28A 1GANA 3WF1A 4XF0A 4JYAO 3PU3A 5C8CC 1T5EA 5FIXA 4LHNA 1LRHA 1QVGU 1D2SA 1TZOA 1IS5A 1RJ7A 4OHVA 2M7WA 1O9GA 2HWD2 3AMNA 3KGZA 4X65O 2ARCA 2RS31 2A79B 3H8OA 4R7CA 5LYJA 3UT5A 1ENXA 4CZZA 5FZMA 3OBTA 3EB7A 4AGRA 1LUVA 5LA9A 1IBLB 5AFEA 1QXPA 1LU2A 1H9PA 4DUZO 2UU9O 4QGNA 1OD3A 5B3SC 3GHMA 3WOGA 2ORZA 3KMHA 4BYYA 5EPAA 1AR81 1K5QA 4LXLA 2HVJC 1F23A 2HHHB 4L87A 1QWRA 1R64A 1WLTA 1ZA4A 3WDUA 3UKMA 2X53S 3M3EA 5JSRA 3ZFEC 4CP2A 3PVNA 1XMQO 4QGMA 4GX2A 1Z2GA 5CFDC 5CA1B 2TNFA 5FV3A 5C3SA 4YW5A 1VBD3 1G8WA 3PUHA 4JHZA 3LWCA 1UX6A 2D3PA 1QOOA 2DVAA 3OY8A 1W8TA 4PA6A 4A7KA 5KUMA 1E5HA 5KX5A 1OZ0A 1S0GA 5KC6A 3NAPB 1H8VA 3OAAG 4PELA 2QKSA 1SCRA 1S0CA 2OTJV 1TEIA 1OH3A 3GNEA 4LHSA 5IE9A 4AWDA 2VULA 2MEV1 2Y6LA 4PT6A 2X7RB 3TK1A 2GDFA 2E76B 1QH6A 5HBAA 1GNYA 1QVFU 5T3NA 1QF3A 1PNMA 1BVVA 2QWOB 1AYN1 2QVSB 2Q69A 3FZ3A 1QJX3 2P3KA 1VBE1 3L72H 1Z5WA 2GAUA 3FC0A 3VD4A 5IYBO 4HVQA 1NJIW 1M56B 5DABA 1QQP3 2RE9A 3DC5A 5BY1A 2FZ2A 4JI6B 2A6VA 3RDIA 3VDDA 1XNRO 2ZACA 1XNAA 2HLDG 1VMHA 1DGRN 2V4VA 4B3TB 4LWSA 5EZYA 4CH4A 5J9PC 4CA9A 2QUOA 4J42A 4DR5O 1GN6A 1YNAA 3STLC 1V9U2 4C7UA 3DGEA 2HHHO 1I6XA 3WNXA 1FV2A 4LUMA 2QQMA 2WLNA 4AFDA 2ENRA 5A3UA 3PTYA 4MLOA 1QQP2 3AVRA 1QJU1 1W8OA 2ZMKA 4CCDA 2JKBA 2VGDA 4DV7O 1SQ4A 3JD71 5HCBA 2XWBB 5IYCO 3AP5A 4RR3C 4OI0A 4G28B 1BS3A 4R4XA 2HR3A 4BMBA 2VAUA 1BT8A 2VE1A 4NWWA 3N2GA 1I94O 3WP4A 4Q4Y2 2W68A 1HXS3 4XQ4A 2B7YA 1S5JA 1CAVA 1AX2A 3K59A 1YHQV 5FR3A 3SYQA 4NROA 5B1AC 2VH9A 1FAYA 5IAVA 3ZYBA 3AB0A 1H4HA 1D0HA 4NHXA 1EZJA 1H30A 1RMU1 2XL9A 1RUF2 4JGYC 3K04A 2OUHA 3ACIA 3W5NA 2QDOA 2CH7B 5LP6C 2W95A 2X6BA 1ZYBA 3WNNA 5T55A 5CA1A 2VECA 1LESA 4LFCB 3RYFA 3CXCU 2GMPA 2W52A 4LOSA 3W7SA 3NNGA 1BQPA 1BMV2 3OBZA 3TBDA 4UF0A 1AVMA 3H1KH 1VE0A 3CPWU 3WHUA 1JH5A 3BVCA 2WAAA 2CHHA 5EBWC 4FPCA 1UKRA 4HYOA 3T4DA 4WFBV 4CBCA 5FREA 1NAEA 3WW4A 1NYWA 3VZKA 4CUAA 2BOJA 4B3TO 1WW4A 5CG8A 3M70A 2AR6A 4IESA 4LTAA 1B3QA 1ORQC 4CH6A 4O65A 4MTXA 4XZPA 2ZCWA 1PVC3 1TQ5A 4IE7A 5A3MA 2X5IC 3HKEB 3AYDA 2HYXA 1ZNPA 3QACA 3FYEB 4YM1A 3PVEA 1X8MA 1GM9A 2WC2A 1UIKA 2DCKA 2P6HA 1X59A 1DF4A 4BM8A 1VMFA 3LEMA 2IH1C 3CCSV 5EYXA 1ZL8B 4IDZA 4EN8B 2R70A 5ACA3 1O91A 2W91A 3DEMA 3BOPA 4GLXA 4QD2A 2CH7A 2YV8A 3GBGA 5JIUA 3ZSMA 1XC6A 2VZTA 2WSVA 5IWAO 2HWC2 1GM7A 1H8TA 2YZ4A 2Q7GA 2RS33 1S72V 3WV6A 1SQBH 2PHWA 2JB8A 2ZE8A 1BSMA 2WZPP 4XJ9A 3SC7X 3MYXA 2E9QA 5IYZA 3ASOC 3ASIA 3AZVA 2ZKNA 5AFBA 1IOAA 3LA7A 2ARXA 4MOAA 2KG7A 5LA1A 5FZ8A 1IVSA 1KDKA 4XFFA 1R082 3JB8A 3W7UA 4P9GA 1H2MA 4GIQA 1VAVA 1UOBA 3ZXLA 2VTXJ 4JI1B 1M4WA 3WDVA 2W3JA 1ODNA 4MO3M 2B9ZA 2CU5A 3D3AA 4FTEA 4C1WA 4B4RA 1CAXA 1UMIA 4UWDA 4QXHA 1F4AA 4NTXA 4U3JB 4GJZA 2QDNA 4ZOLB 4XF1A 3U4SA 4Q0VA 3ABLB 2ZGPA 4DO2A 3RVYA 5IY5B 5A33A 3FHIB 2AEYA 3WUCA 3VBSB 2QQPA 3HB3B 3RZMA 4FM0A 2BRTA 2ZEYA 4MGSA 4DK0A 4OI2A 2CTRA 4ZU7A 3TXSA 3T3YA 2JEXA 3U1XA 3RYHA 2B1IA 2R32A 2XDVA 1WMDA 3D8CA 1PGW2 4JTOA 5C5UA 4I01A 2YC0A 4CXXA 1V9U1 3ST7A 5JCOA 3CX5F 1UZYA 5FUIA 5DZFA 1QQP1 4AEMA 4C90A 2Z0AA 3Q8BA 2WO7A 3WR0A 4O4IB 4FPHA 5CBHA 5FXZA 1XOYA 1QU7A 1YJLA 3E5XA 3VZJA 4D0QA 1KYOF 1OPOA 2VOWA 4ZXEA 4MTGA 5LBBA 2LM3A 3B69A 3ECQA 1RM1C 5CISA 5BNPA 5AC92 2L6LA 1XBFA 4OMCA 1X36A 3SPCA 3POBA 4DR4B 3O1MA 5FP8A 1YXBA 3WG2A 4YJ3A 1NLSA 2RR12 3GHNA 1H38A 4ZI7A 4Q0PA 4O2AB 4Q4X1 4Y1VA 2FMYA 4NMIA 1GAXA 5EZWA 1TNFA 3TOJA 4GXLA 4NAOA 5H9QA 4JKLA 5CFCA 1W03A 3P32A 2EIMC 3K4ZA 4Z2WA 2UUAO 2HEYF 1CGPA 5HV4A 1R3KC 2DJVA 3I3QA 4QAWA 3ZX7A 4QPIC 1CESA 3N7JA 4WM8C 2OQ6A 2UXBO 3I2HA 4DMIA 2BCCH 3HJRA 3BA9A 4DPNA 4ZPIA 3EXAA 2RM21 2XAQA 4EN9B 2IXHA 2X10A 1EUUA 2OXBA 2VM9A 2TEPA 3UT5B 4PDMA 3E8FA 1H8TC 3WCSA 4AQYB 1XMOB 4FLXA 2D3RA 3Q8AA 3ME2A 3I2OA 4LF7O 1MABG 4PQ9A 1FOD3 3DL3A 1ULFA 2EVXA 2WS92 2W1SA 2Q7EA 4UCSA 1RUD2 3LZZA 3ZFFA 1RHI1 5A7WB 2YXLA 4JC1A 4GKYA 5IK5A 4DV3O 3K08A 2QQLA 1AL0G 2B45X 1IPSA 1VB2A 2BGOA 2FDIA 2XNDG 3JBG1 5F5AA 3P3PA 2Q73A 4FVMA 3KT7A 5FPOA 2NMNA 1LECA 3T0AA 1GV9A 3RFRA 4XDQA 1F31A 2BVVA 2VOTA 4UW3A 2RM22 4WV8A 1HR0O 3K77A 4F6RA 5JVDA 4XVHA 2Q5ZA 4Q8LA 2N04A 2ZNJA 4JI5O 4CSWA 4K0KB 2QQKA 3FB6C 3KLSA 3UGFA 1TMF1 4Y22A 1KITA 4ATEA 1GOHA 3T2TA 1NH2B 1V55C 3POEA 2EXJA 3EHKA 1GWMA 2QQNA 1R73A 5IWFA 2YPDA 1JU4A 2EZPA 4A6SA 4IE6A 5EWSA 3VBUC 4YVSC 1AYM2 2GV9A 5FCCA 1RXGA 4UOJA 5I8TA 5C70A 2WT1A 2BBVA 3H8XA 5FKBA 1FMD1 1H8EG 5FMBA 5T54A 2BWAA 3E35A 1UYXA 2PHFA 2QEXV 3KKYA 4BCUA 5H6QA 1DQ6A 3HBKA 1DF5A 3GWKC 4XUQA 5FOJB 5K0UA 2ZTNA 3M3CA 1Y74B 2JDMA 1XUQA 2KB1A 1TMF3 2IJKA 2CWMA 4N43B 1H1MA 1LKNA 4AHYA 5FMOS 4I3GA 4OHYA 1ND2B 4AEDB 5FRAA 2A6ZA 1NLQA 2B9VA 2D6OX 4MG2A 4JI6O 3CRAA 3S0MA 1K73W 4FO9A 3UCSC 1XREA 4UV9A 3BTYA 1AR4A 1VLNA 5LZ6A 3IDAA 2YMZA 2E31A 2JRIA 1C4RA 1I3HA 1SBEA 1ZZ6A 3IPVB 3ZMTA 3ZBHA 4DR7O 3LOBA 3CSXA 4BLIA 4UYBA 3BKZA 2OVUA 4QX1A 1DGWA 1ZZ7A 1QNMA 3H3ZA 1MSDA 1RVF1 4LHKA 4GWMA