1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
3PVBB 3QACA 4YRDA 2UY9A 1FXZA 1LB2A 4QM8A 5E16A 4PIXA 3MYXA 4XFHA 4EWEA 1EPZA 5LRSA 5I0UA 2XHKA 5BUVA 2FQPA 2D40A 3OD0A 2UY8A 1WA4A 3MDPA 5JSPA 1VP6A 4FT8A 5KHJA 4XF9A 1NXMA 1EYBA 5FQ0B 5E1RA 4KWJA 2ET1A 2OZ6A 1Y9QA 1RTVA 3H3UA 2BGCA 1DGRA 5LEKA 2F4PA 3TNPB 2OA2A 3FZ3A 2CV6A 2I45A 4MGKE 3OTFA 4HSJA 4Q0UA 5I0SA 4QXKA 4AXOA 2Y0OA 3FFQA 1UCXA 5EZWA 3NVCA 2QDRA 1YFWA 2Q1ZB 4BH9A 3G7DA 2UYBA 2PFWA 1UW8A 1H1IA 3BU7A 3U10A 3GYDA 3ZDSA 4I01A 1G6NA 1ZZ6A 3CO2A 2PYTA 3BALA 4NVPA 3DKWA 2ATFA 5J48A 4HVOA 4QX5A 1O5LA 1CAVB 3GBFA 4MV2A 4BYYA 3KGLA 4K8FA 3H3ZA 2DCTA 4HVQA 4Q0VA 4AVAA 1UD1A 5FPZA 1VJ2A 1DZTA 2QNKA 3DL3A 1O7FA 4WZCA 5FLJA 1ZX5A 5D1IA 1CAWA 3HQXA 1O3RA 5KBFA 2UYAA 2GAUA 5KHHA 1CAXA 5I93A 1CGPA 1ZZ8A 4MZUA 1ZRCA 1J58A 2H0VA 2PA7A 4FAHA 4OFGA 1X8EA 2GU9A 3I7DA 4UXAA 2ZKLA 1O3TA 4GULA 1RUNA 5BXXA 3E6BA 2K0GA 3RPQA 4AVBA 3LA3A 1RL3A 2QCSB 3IDBB 1PMIA 5CADA 2MHFA 3ES4A 4O9EA 4I09A 2XKPA 1I6XA 5C6CA 4XFIA 4O9GA 3USSA 2CAUA 5I8SA 2GC2A 2PHLA 1CAXB 4PIYA 2XLGA 3E97A 4X6RB 1ZRDA 4XFFA 4H7LA 1QWRA 4ZU4A 5BY5A 2B5HA 3H8UA 4P9GA 4XF1A 3RYPA 1EP0A 3RNSA 4YYOA 2P17A 5JAXA 2PAEA 3I59A 3VHRA 1ZZCA 2GC0A 1OD5A 2XLFA 3UKVA 5KHKA 2CAVA 4QGLA 1VR3A 3FWEA 4HLTA 3S0MA 1CAUB 4F7ZA 3ELNA 3MPBA 2BYVE 4XF4A 1UIJA 4TLFA 2EVXA 2XLAA 4XFBA 4IEOA 3LA7A 4YSFA 5I8YA 3NW4A 2H6BA 5I8TA 1LKNA 4JVAA 2GZWA 1FI2A 4LULA 1YFYA 4A2UA 4E2SA 5LRRA 3UKTA 3EO6A 4WBBA 2HKXA 4ORFA 5JSOA 1O4TA 1Q5OA 1U12A 4EV0A 2ZCWA 2WFPA 3OGJA 2ETEA 2K9ZA 2PTMA 4Z07A 1YWKA 4PJYA 3NKTA 1QY4A 1Q3EA 5HI0A 4HN1A 1V70A 1Q43A 3RYRA 2IXIA 5JSRA 3HIFA 1OMIA 5AVPA 2Q0AA 3D0JA 5EFUA 2D5HA 2IC1A 3M70A 4WVZA 4MGYE 4MGIE 1SEFA 4XFCA 2XGXA 3EJKA 4XEZA 1YLLA 1XE7A 1O3SA 1YFXA 5LEJA 3D0SA 1GQGA 1QXJA 4XF3A 4IERA 3E5UA 2PHDA 3IBMA 3SXWA 4ZU5A 1FT9A 3WW1A 2GH2A 4Q0SA 1J59A 3R6SA 4JTNA 3EHKA 1EY2A 3NL1A 2E9QA 4PIZA 2IXKA 4JV4A 3H1YA 4HBNA 3SCGA 4LUKA 4LTAA 1UPIA 3IDCB 4YNIA 4MUVA 2O8QA 3O14A 4HZFA 1NZCA 5JR7B 4Q0QA 3QOPA 4FAGA 3PLQA 1DZRA 2PAMA 3FX3A 3H9AA 3LAGA 3OF1A 5FDBA 1CX4A 4KWLA 5J3UA 2H6CA 1XE8A 2O1QA 4I3PA 4MGZE 2OZJA 3E6CC 2D5FA 1RGSA 1X82A 4META 3OCPA 1NYWA 4EWDA 4AVCA 1X7NA 1UIKA 3LWCA 4XFAA 4Q0PA 1CAWB 5K8SA 2MPFA 2EAAA 3U11A 3M3IA 3D82A 5J7MA 3ETQA 4MH0E 3SCHA 4UBGA 2CGPA 4KU8A 5FLHA 2IXHA 3BPZA 4DINB 2Q4SA 3B02A 3LZZA 4J1WA 4HN0A 4IEPA 1GQHA 5FCCA 4B29A 2VPVA 1NE4A 4D7SA 3SHRA 2EA7A 2OYZA 2BNNA 3FHIB 3L2HA 3NJZA 1SQ4A 3WW3A 4I0BA 2IXJA 4CYDA 4E2QA 4I02A 4YARA 3IWZA 4XETA 4QGMA 3KGZA 3DN7A 1L3JA 5FQ0A 4E2GA 3S7EA 4F8AA 1Y3TA 1J3RA 2Z69A 3BB6A 3RDIA 4EROA 1YHFA 5BPXA 4IEXA 4IEWA 2QJVA 4ONUA 2FMYA 3CF6E 4IEVA 3DV8A 3EBRA 3FE5A 1JUHA 2BNMA 2PQQA 5CU1A 3WW2A 4KL1A 2GC1A 5T3NA 4IEYA 4N9IA 3MZHA 1J1LA 1RUOA 4JTOA 3KCCA 1YFUA 2XL9A 3I59B 3N4MA 2BNOA 5I0RA 3CEWA 5FLIA 3KSCA 1YUDA 4AQ2A 4IEZA 3EQEA 1WGPA 3BCWA 1PM7A 4QMAA 1CAVA 1XRUA 1O3QA 3ST7A 1ZNPA 4BIFA 4UBHA 2Q30A 1ZRFA 4R52A 3H7JA 1IPKA 2B9UA 5JCTA 2KXLA 3ES1A 5F1RA 4XF0A 4LEJA 3HT1A 4LA3A 2Z2SB 1OFNA 5KHGA 3IIAA 1LRHA 3KMHA 2QVSB 2PAKA 5CVRA 2OPKA 4IESA 4Q29A 2VECA 5BV6A 4KU7A 2V09A 4R8HA 4IETA 1TQ5A 2WC2A 4MX3A 1OI6A 1H1MA 3RYKA 3RZZA 4I0AA 2C0ZA 4AQ6A 4HVRA 4HSLA 3C3VA 4IEQA 4L11A 1WLTA 2B8MA 2D93A 2IXCA 3H1WA 4HMZA 4KWKA 4QGNA 3ACLA 2ET7A 3LOIA 4EWAA 1ZREA 1IPJA 3PNAA 3HT2A 5C8WA 1X8MA 5I91A 4I2OA 3NSTA 4BHPA 1LR5A 1QXRA 2GC3A 3LA2A 1ZZBA 3FJSA 3U0ZA 5KHIA 1I5ZA 1J3QA 4N9HA 3ROUA 3UKNA 1ZZ7A 2MNGA 2IXLA 4OLLA 1SFNA 5I0TA 1HW5A 3E5QA 3CJXA 3E5XA 2N7GA 4LLOA 4XFGA 3H50A 4QM9A 1RC6A 4J1XA 4D7TA 5FPXA 1ZVFA 4FBFA 1J3PA 3S7IA 4ZU7A 3SMHA 2XL7A 3E6DA 1ZRRA 2BEOA 3SCFA 1CAUA 1O5UA 3CLPA 2HJIA 3H7YA 4X6QB 4Z82A 1ZZ9A 3H1MA 4LA2A 3TNQA 1NE6A 3JZVA 4RD7A 1DGWA 4L2NA 4IEUA 4LUMA 3WW4A 3I54A 3CL1A 2VQAA 2XKOA
chains in the Genus database with same CATH superfamily
1GN3A 4TYSA 3ZMOA 4EZHA 4COVA 1ZBE3 2VCMA 4PDRA 2GNDA 1R3KC 3LD8A 5D8AA 3F5WC 3DXRA 4YZ2A 2YIDA 2UY8A 2R042 2W95A 2YS8A 4EYUA 1XUQA 2XONA 4FFBA 1WUVA 4N21A 1BBT2 3A7QA 5HBAA 3B8MA 4HKLA 3ZYRA 3NVCA 2CAZC 3ICXA 3MEPA 4ARYA 1FKAO 3VDDC 2HEVF 3G7DA 3ZRWB 3S3XA 1H1IA 2A6ZA 4CCCA 3LSDA 2R7EB 4LP8A 1RUF1 3WX5A 3KS7A 3BALA 3WNOA 4UFIA 4HVOA 1Q8OA 1EFRG 3PIJA 3ZN6A 3HBZA 2DCTA 4JGYA 3K77A 2IUWA 5FYBA 4LK7A 4DUZB 2JD9A 2WNVB 3W59A 3PJSK 3C2UA 4BIOA 4ZKIA 2GTAA 2QKDA 3QVNA 1PK6A 4Q4W1 1J58A 5DZFA 2H0VA 3UM7A 4XJUA 1P4RA 3EVKA 4OFGA 3OBAA 4GWIA 1F4AA 4UXAA 1Q7YW 3TEYA 4QPGB 2VMHA 3H8XA 4AEDB 2VQTA 2XHNA 5EBWC 5HV4A 3SNMA 1FPOA 2Z4FA 4O2AA 3WZ1A 2RS11 4J42A 3VLBB 1Y9GA 5CIRA 4KI5M 1AL22 2EINB 4YVSB 4QX7A 4EQVA 5L9BA 3E97A 2QDOA 4WFAV 4XCAA 5LA6B 4P9LA 4N53A 5FYSA 4J25A 3RYPA 5FL7G 4TQFA 1GRJA 2ZTNA 3INAA 4PI2A 1RP3B 1KB9F 5SV5A 4CH6A 2LO1A 1COV1 2Q1FA 4LR4A 1KMIZ 3VQXA 2VMFA 4W8JA 2LP7A 5CKMA 3APBA 1Y43B 4KXRA 1ORQC 1CWPA 3POBA 1V6IA 2E63A 4A7YA 1UU4A 5FY7A 3LDRA 4FCAA 3WOGA 1Q8IA 2VU9A 1O4TA 4KBBA 4DV1B 2PLV2 2ZT9B 4K0KO 5IYCO 2CTVA 2ZE7A 1Q43A 5J2UB 2BW8A 1KUQA 2Q0AA 2UUCB 4WVZA 2H0BA 4MGIE 4FFKA 1AP6A 3OPTA 4JZRA 1W99A 1C3HA 4U2AA 3D0SA 3ACGA 2MEV2 3JBG2 3E83A 2VZTA 5FFOC 5AFEA 2WLHA 4JV5O 4JGZB 1NAEA 2GN7A 4M3CA 1MS5A 1W6NB 1RUC1 4TZDA 1QBZA 1CXZB 3X2QC 3CPWU 2R061 1K4CC 1O9GA 1PL4A 1F51A 2JG8C 4EEQA 1QCEA 4CS3A 2P4EA 2WA3A 2WYFA 4DY3A 4CPBA 1G9DA 1L7QA 1DGRN 2ZHKA 2FDGA 5CFDA 3LAGA 3GWKC 1D2SA 3GDBA 5FDBA 1ENXA 2VG9A 4O2BB 4O4IB 2J1RA 2I07B 3S30A 3FB7C 2X5IA 4XHBA 2UU8A 5EYYA 4AHYA 4FPPA 2E3CA 4BR6A 1OPOA 3T1CA 3T1HB 2A06H 1OCOB 1JYWA 3HKDB 3S6PA 4F4LA 5DAPA 3L2HA 4XJ9A 1WW5A 3ECQA 1VBA1 2P4VA 1BT8A 1Y3TA 1R083 5F2VO 1RJ7A 2HBUA 1J3RA 5GLVA 2VMEA 2JB4A 1K97A 2B1IA 2D2CB 1YTFB 2Y60A 3ILRA 2ZDIC 3Q4HB 1TMF1 5T5OA 4LFCB 3VGIA 4MVUA 2D6LX 1UFIA 2FMDA 3ZRWA 3DYOA 3DEMA 3CEWA 4PT6A 1F9KA 3LFMA 3K59A 4Q8KA 2P3JA 5BNOC 5EYXA 3R4DB 4IEZA 3JCUZ 4H3WA 1UX6A 5A1FA 2OCHA 4DXZA 3JD0A 1SFYA 2EICA 3H7JA 4IV3C 2XBO1 3SH3A 2WNVA 1TME1 1J1TA 2YYOA 1H0BA 1Z5VA 1LRHA 4WBNB 1NG0A 1IBKB 1CJPA 5ACA2 4FVMA 1YI9A 1A34A 1OKQA 3W7XA 1ULEA 5EC1C 2EIKB 1G9FA 3AYEA 4QPGA 3ZSMA 1ZLZA 5T55A 3AL5A 1JI6A 5LK7B 3ON7A 2DYCA 3SYQA 1JA8A 4B7EA 1I1EA 3LIHA 3VBOB 4QB6A 1I5PA 1W90A 4JRLA 4YVSA 3WUCA 5K7PA 4CUAA 3VDAA 5LA6A 1IXBA 2R1DA 2P06A 1L0NH 4S2DA 5EK0A 1YHQV 4F6EA 4LHLA 4O7XA 1S55A 1GNHA 4UCTA 3HQUA 4Y1VA 1QLNA 4Z82A 4NHLA 2WFF1 4LUMA 4BQXA 3B94A 3O65A 2XHBA 2EALA 4UV8A 4YM0A 3W58A 2J1SA 2CU5A 2RV9A 4BQ5A 3NJVA 2OWOA 5KHJA 5J2UA 2D3RA 5A9GA 2WIIB 1P7BA 1RVF1 3JB8A 4AI1A 2PGGA 5EYPB 3H1LH 2AYHA 2CV6A 5DN6G 3N35A 4XOGA 2F1MA 3OBZA 2EIMB 3N9NA 4JGZA 2WA4A 1AJPA 1GZTA 1W6NA 1E57A 4COYA 4IYHA 3ZMUA 2WNUB 2RCVA 1AYN2 5JOWA 3OUSA 1VBC3 3F7YC 1WP8A 2XASA 1N36B 1OH3A 1ALYA 1AR81 4QX3A 5C4WB 2XOMA 1R092 4CDWC 3BYWA 1YXBA 2QE3A 3H3ZA 2WT0A 1RHI3 2EX3A 4IIJB 3ABLB 1QQP2 2VTFA 4O2BA 1VJ2A 4O4IA 1F15A 4PBOA 3WDWA 1XYOA 3MUY1 3TEZA 5KHHA 5B3SC 3C3SA 4KBZA 5K1PA 2PA7A 1HIXA 1S0FA 3VOUA 3HKDA 1N34O 2Y26A 2RM22 1Y9MA 1YSCA 4K40A 1FPN2 2ZGNA 2AEZA 5DEDA 4LLFA 1CQ9A 3NAPB 4I09A 3J4UH 1NY72 1I6XA 1J95A 1A6CA 3ZFGA 4UOJA 1LHVA 2R9RB 2B4KA 3TYJA 4QB2A 3M1HA 5DUWA 2JDMA 3ZSLA 4KNCA 2KR2A 3Q4HA 3H8UA 3OPWA 2R071 1UNBA 4RQEA 4P9GA 3MUZ1 3Q8CA 1XYNA 1QJZA 2W91A 5IK5A 3HR9A 4LO8A 4YW4A 5JMOA 3AVRA 1KQSU 2J22A 2ID4A 1FYJA 1K5MC 1AROP 1VR3A 2E75B 3WQ1A 3D8CA 2AACA 3VBSB 4FZ1A 2CH7B 3N9LA 5I8TA 4V2VA 2HG5C 4AW7A 4AWDA 3AP7A 4PF1A 1BMFG 4QX8A 4LHSA 2RDRA 4WBNA 4Z07A 1R64A 3NMBA 2RR11 2ZR3A 4NROA 5CG8A 1ULPA 3D0JA 2E31A 1M06G 2CDYA 5JQGB 4BK4A 2B39A 1YYNA 4FTBA 3VBOA 3OW2U 2FDKA 4UVAA 3PUQA 1JMKC 3ZS8C 4X1YB 1UYYA 4XQDA 1EUTA 5JLVA 4PF5A 1JJ2U 5J2TB 5IYYA 3O14A 4DR6O 4AOCA 2Y4UA 4ISRA 1VE0A 1XE8A 4I3PA 1EAH3 3K48A 2PZSA 3BCCH 2DFCA 4YJ3B 1IGOA 4CDUC 2ZABA 3D82A 3WNLA 5T5PA 4CEYB 4EFBA 1YRZA 3FL7A 3KD4A 3O9OA 5GLZA 4AEMA 2DCJA 5K1XA 1MG1A 1Q81W 3ZEDA 2TNFA 3HKBB 1MZEA 3KGZA 3E8BA 2O14A 3I2FA 3NNMA 4B4PA 2Z69A 4MVOA 4JYAB 4L8JA 1H1AA 5EYPA 3AKQA 2WLMA 4BJ0A 5IVVA 4L9BA 1GMGA 3VQYA 4QQ2A 5T50A 3VQWA 5DG2A 2AGSA 5B66Z 1APNA 5T3NA 2Z0AA 4OX9O 1FMD1 4LBLA 1XQNA 2ZXWB 5I0DA 3E86A 2VZSA 1OV9A 2IBZH 4LBMA 2WNUA 3APOA 4XUPA 2OTJV 4IGPA 1W2NA 3ORJA 4WCEV 2Q7EA 4AQ2A 5C4WA 1O59A 4QMAA 2W1QA 1GM7A 1J5EO 3VBFB 4UF0B 2PHFA 4Y4RA 4YW6A 5FOBB 4IIJA 3Q9OA 3K75B 1RUG2 1RM1C 2BBVA 1DG6A 4OMCA 2QFEA 1HRV1 3SJBC 3OJBA 1R6KA 1R3LC 4PD4F 5LASA 1K8AW 5FYZA 1XNRB 1SLAA 2ORZA 2FDFA 2AHYA 1AUYA 4CVUA 1O6UA 1SLLA 3V0BB 1IKQA 3BGAA 1R1BA 3O1VA 3ASOB 3RZZA 2PN5A 1DGWX 1RITA 3NAPA 4PJ0Z 1VALA 2IXCA 2Q8CA 1SRYA 3ACLA 3AG4B 1TNRA 1FFXB 1QJU1 1LR5A 2GC3A 4M4RA 2ZEZA 5LA9A 1K3IA 3WHUA 2WSSG 1PVC3 1TNFA 1E5SA 1S2BA 5DAXA 3CJIB 1B35C 4L99A 1IVSA 4LF5O 2AZ0A 1J3PA 2HWE2 5IYZB 2P4KA 1JOPA 1O9HA 1CD3G 3APQA 3T4ZA 1PL0A 2Q7HA 1RMU3 3VBSA 4JI7B 1WAZA 2CH7A 3CCLV 3L75H 1BJQA 4FP2A 4MGQA 5T54A 3V64A 4OI0A 4OI2A 2D44A 1LNQA 1O8PA 1Q8SA 1ZUQA 4MXWB 4FOVA 1NA1C 5BNNB 1P8JA 4Q6GA 1H2MA 4Q4Y2 3A0KA 5GJ6A 5FQ0B 3GXUA 5C3QA 2IVJA 2BGCA 2W2IA 4WVVA 5LEKA 2RS32 3EB7A 5JQGA 3FZ3A 2RMU3 3WNNA 4DR5O 2ZR2A 2GP5A 3I5DA 3WDVA 3AEIA 3WFVA 5CG9A 1XEQA 1UOJA 4QQPA 4X1YA 1SF9A 2QBXA 4CC5A 3RYIA 1QHDA 3AZWA 2FDHA 1H38A 5JOZA 5FZOB 5J2TA 5J48A 2RQ6A 2WS93 1K7DA 3NJXA 4XAEA 1BVVA 2X6AA 5A3TA 2AH2A 5D1IA 4YJ3A 4YFWA 5LMUB 1GZWB 2DTYA 4CP2A 2P34A 4CEYA 5ANNA 1N1TA 2JJ6A 5IW0A 1PO22 1NCRC 1W0KG 1UY2A 5BXXA 4UCUA 1RL3A 2WZR1 5GONB 3IDBB 4J7JA 1PMIA 4Y20B 5AG2A 5FWEA 1BEV2 1W39A 2BGOA 5KMGB 3HKBA 2LTNA 3CC7V 2XKPA 3HN1A 3I3EA 2BWAA 5IAXA 1NKGA 2RG4A 1W8WA 2QWPB 1JXNA 1OQEA 1MS4A 1IG0A 2JEUA 1AJKA 5BY5A 1F5JA 1KD1W 4Y1UA 1OD3A 1QJEA 4AHXA 4XDPA 3Q8AA 4B1MA 5FZ4A 5KUMA 3CC2V 2A70A 1YDXA 3AXDA 5KHKA 1EZJA 4F7ZA 2LRPA 4ABMA 1L1FA 3VBFA 1XOYA 1MACA 4IEOA 4UF0A 3A22A 4OGQB 3NW4A 3UESA 1GR3A 5C9AB 5DZGA 3SYCA 3HB3B 5JSOA 1O4ZA 3RYHB 3BVOA 2PELA 1XB9A 5AC93 1GOHA 3G80A 1NX9A 2JKBA 3PJQA 2E7QA 1S77D 3V0BA 3K06A 3KZIZ 1CZVA 4BIZA 4IE4A 3VZNA 1BQ0A 2X6BA 3TXQA 4XFCA 5L7OB 1V9U2 5JPNB 5C33A 2XJQA 3IC7A 3ZKUA 1AXZA 3J26N 2HEYF 1RHI1 1FFXA 2VNRA 2VMGA 3R6SA 2VZVA 2CGOA 5IWAB 4CU9A 4V1PA 4XAAA 3E35A 1M5IA 3CJIA 3K5NA 1RUJ2 2O8QA 4JZ2A 4RO2A 4XDLA 3PLQA 3M3EA 4O65A 5IYZA 2OZJA 1RGSA 2I74A 3ZMTA 2QQOA 1S5HC 1AL0G 5H9CA 1DF4A 4FPJA 1I08A 1LOCA 4P9PA 4JI2B 3POYA 2P2KA 4HN0A 1GQHA 4MXWA 1NE4A 2QQWA 5BNNA 1H30A 2OIIA 2YPJA 5FTTC 1PO13 2VUJA 1WP7A 5A6YA 1TA8A 3GM8A 3OEEG 1ZBA3 2EILB 5FQ0A 4CCLA 4GZRB 2ZCEA 2JGDB 4DV2B 2QQMA 2UU9B 5FPAA 3TXSA 4UFMA 1RUF2 2VXRA 4CP9B 1QR8A 4H33A 4HKWA 3EBRA 3CBNA 3RFRA 3IN9A 4DV7B 2Z3YA 1FOD3 2ZMKA 2CYFA 2Y4TA 3I59B 1YCIA 3ABUA 5I0RA 2C24A 1PHMA 5FZOA 4Q4W2 3G67A 2HFEC 1O3QA 1MEC2 1K5QA 3MLLA 2DUQA 2B9UA 3LEMA 4UFKA 3E89A 1WPXA 4O61A 4GCZA 3T0BA 5KHGA 4D6TH 1IS6A 1GZWA 2QVSB 2PHWA 4DO2A 2VW1A 4RL7A 3H42B 2FL4A 4DS0A 2E5LB 5FV3A 2XR4A 3FYEB 1IBLO 4BA6A 2RHPA 1W6PA 1Q86W 2VUCA 1SDWA 5GONA 4Y20A 1OOPB 1PNMA 3HMYA 3RQ0A 5KMGA 4XZUG 3OT7A 5DUUA 3CMEV 4NAOA 1URFA 1SERA 3AK0A 4IL7A 4KWKA 2CGNA 4H0LB 3UV9A 1COV2 3KLSA 4OQ8A 1EAH1 4YY3B 1I5ZA 3JSLA 1MVEA 4Y1XA 1MZ6A 1JCHA 1HR0B 2Y6GA 2Q1MA 4LLOA 5IFPA 1EM1A 4PA6A 5DMYA 2NLRA 1GFF2 3HJRA 2G19A 3HBKA 4FO9A 2E32A 1US2A 5TSWA 4L2NA 3CRQA 3POFA 5C9AA 2DWEC 4LF8O 3RYHA 1H8HG 1MNGA 1JS9A 2DBIA 2FQPA 1SLIA 1WA4A 2WL1A 1Q8VA 1XREA 5CFDC 1RUC2 1NQJA 5E1RA 1ODMA 4D6SA 2R062 2N74A 3WXPA 2W68A 1Y9QA 4QHZA 4ZPIA 1D7PM 2X5IC 1CIWA 5L7OA 1A8MA 2SLIA 2I45A 1TGOA 1WB7A 1W2TA 1YIJV 4Q0UA 4QXKA 4LO6B 1VAVA 4SBVA 2P3IA 3MIEA 1WBLA 5J96B 2VQFB 1VEWA 3GYDA 2CUGA 2DDUA 3T1YO 3I3DA 4CDQC 3CS5A 3THDA 5KXBA 2AZ5A 3VDCA 3BN6A 4MV2A 1F8VA 5JIAA 3NV3A 1UXZA 5HCFA 3TETA 3MHHC 4W4ZA 3GB7C 2YUEA 3IFXA 3WCSA 4RR3C 3WCRA 1H6XA 1VBA2 2HH9A 3TBDA 1ZRCA 2GSYA 1YQ8A 1NT2B 5IAVA 4FAHA 2WLNA 1W04A 3I7DA 5A7PA 3MPPG 2VE1A 1PVC1 2JKXA 2XMLA 5BZBA 1WZXA 1XOUA 1TMF2 2C9AA 5IY5C 4R6ZA 4B1LA 1NLQA 3LOBA 5GTIZ 4Z2WA 2QWNB 2JGDA 4JAVA 5E8AA 1HQWA 1D5NA 3DECA 2IFRA 2Q6AA 4LITA 4I55B 4CP9A 2MEV3 3JBG3 4TXWA 1QVGU 2VXJA 4JHTA 3FFZA 3VB9A 5KAFZ 4P02B 2XDVA 4M4PA 4YVWB 4OUSA 1JPXA 3O1PA 1W9YA 2XBO2 2OCCB 4QPGC 3ZXEA 5FZKA 5JAXA 3I59A 2GC0A 1TME2 3OR6C 4Y33A 1LCLA 2W5FA 5GZCA 3ZYIB 2EXJA 2CAVA 2A79B 3FWEA 5B1BB 1CAUB 3LGRA 2BYVE 4XF4A 4FPFA 4GMP1 5DN2A 3OGIB 1EPWA 2EINC 1BCXA 4NOTA 1C4RA 4RSUA 1ZA4A 3ZFEC 2UXDB 2P3YA 2H3OA 2C5DA 3ZSJA 5JJNB 4SLIA 2VBPA 4M0NA 1A3KA 1W6MB 4Z92B 4TOIA 4FM0A 4XTPA 3NJYA 5J98B 1OOPA 4FLXA 5T5LA 3AYAA 4HONA 1KDKA 2BWCA 4Y1YA 1W03A 2WS91 4OMDA 1YFXA 2Y69C 3E5UA 3MIDA 4IHJB 1VQ4V 3NQHA 2OT5A 2GH2A 4LCUC 1XNDA 1OA4A 4JTNA 4JV5B 1XL4A 3DPRB 3HPLC 3SCGA 2WFF2 2JD4A 3QH7A 4OI4A 1OKOA 2YROA 3RYCB 2V5DA 1FXKB 2W3JA 2JIZG 2ZHNA 3OF1A 2L6LA 4K3AA 1POQA 1X7NA 4H2AA 4XFAA 3KHCA 4I9QA 1QNMA 5DAQA 3T4HB 1SS3A 4JGZC 2G9FA 5FXWA 1GMMA 1HX6A 3N7LA 3CCUV 1I5XA 1C57A 1RVF2 1PNLA 1C28A 2WSUA 2OYZA 2BNNA 2V5YA 2Z42A 4B3SO 3PVEA 4AGRA 5CA3A 4DRRA 3ZRXA 3IWZA 3U14A 3MGUA 4DV0B 1NTKH 1KC8W 1ZRIA 3CCVV 1W8OA 1AR82 4GKJB 4ONUA 3VDDB 2IH3C 4FM2A 1W8ZA 3ABTA 2LW8A 3ZXKA 1AZDA 5CBGA 5BY1A 1ND3C 1GV9A 2HWC3 1OCOC 2HHHO 1TEIA 3SR2C 3UNPA 3AMHA 2F93B 3KG2A 2VCBA 1YUDA 4FPLA 2IU0A 3PVOA 4Y26A 4BLJA 1WGPA 1JVMA 4JKKA 4HETA 4NXNO 5GTHZ 3ZXAC 2X29A 3ZFGC 1XNAA 3B9CA 3POEA 4XDJA 4C1WA 2VW2A 3IJ4A 1GH6A 1KS4A 3FBYA 3SJQC 2HVKC 2BZDA 4RQFA 2W0XA 1TVKB 3L71H 3GZUC 2ADQB 2PAKA 4AFCA 2B45X 3LPFA 4FPCA 3OMAB 1WCDJ 2WC2A 1OT5A 1OUXA 4XE9A 1W8UA 1W0PA 2KG7B 1SCRA 5C3SA 4HNAB 2C0ZA 2R072 1PNFA 4BQWA 2WZEA 2PI5A 1WW4A 5L3FA 3HT2A 2P6HA 1CN1A 4LO5B 4QU2A 1UN1A 2CHHA 4I55A 2Y34A 3HN3A 4DV5O 1HW5A 1T2XA 1CZTA 4O4LB 4YVWA 4HG6B 4LWSB 2BQPA 3FLRA 4DXSA 5FO8B 1OA3A 4IGOA 2JWPA 3N2GB 2XH6A 3E6DA 1ULGA 2VJXA 1PO11 1M9NA 3K04A 4XBQA 1CAUA 4LO7A 3W21A 3VBOC 1U5YA 4YW1A 1ZBA1 3LDCA 1LNSA 1W8HA 4TT3G 3BABA 5E88A 3OYWB 4YRDA 1JZ2A 1LB2A 2IWGB 5C70A 1AVBA 4GUNA 5FZLA 2VH9A 1SQFA 5LRSA 5BUVA 3OD0A 1THZA 1JR9A 4E4EA 3UO3A 3NNFA 4NWWA 4FT8A 4C0HA 1NXMA 4JI3O 1FOD1 1W9WA 4KWJA 1JYXA 3MIHA 3ZYHA 1CIYA 3SH5A 2BVBA 2AENA 2HJDA 5ERLA 1MR5A 4HSJA 3X2QB 3WT3A 4IHJA 4X88A 1S0VA 3AVSA 2A9HA 4B3TO 4XJZA 3POJA 3DPRA 3BU7A 3WR0A 4K35A 5IUQA 1IS5A 2YMZA 2ATFA 1CX1A 1W8FA 3RYCA 1CAVB 4L97A 2ZEYA 5EIYB 1AB3A 1RPRA 2VZ1A 4F3JA 5JCOA 1TVGA 4XTMA 2B9VA 4XBFA 1KJLA 2ZX3A 2CTWA 1O7FA 3WB0A 3W7UA 2UYAA 2ZACA 1Z7S3 4S2HA 1ZZ8A 4N43C 5M0TA 1S5LZ 3VD4A 1W06A 3M8LA 2JJ2G 3AK3A 3DXTA 3LA3A 3O0XA 1S2EA 1US6A 2MHFA 5C4WC 1FMD2 4DZGA 1BL8A 3GZAA 3USSA 3ABLC 4E8CA 1ZWIC 3ZYGA 3HOBA 3RYFB 3LDEA 2YXHA 5FZFA 4XCBA 3AL6A 1ZRDA 2X53S 3VDDA 5FUPA 4IE0A 4ZZ8A 4IE6A 2DBNA 4MW3A 1MS3A 2A7AA 4A3XA 3E8FA 3PMEA 4XF1A 3RNSA 5IWFA 2WLLB 2LQTA 4HT1T 4LBQB 1N33O 1QIQA 4JAAA 4I4TB 4X64O 5FZDA 2ZEWA 3WF2A 2B5UA 4IV3B 1CZSA 5HXVA 4S2GA 1NZIA 2EVXA 2HKOA 1HV0A 3KT4A 4LBNA 1XL6A 3RSJA 5I8YA 1F5FA 4JI6O 4GA9A 2HKXA 3RZLA 4EV0A 3N2KB 3OSDA 3BI3A 2QA4V 1TVKA 5KUKA 4NTWA 5FAXA 2R9IA 3POGA 4PJYA 4HN1A 3LEGA 1QJU2 2IXIA 2YIAA 3PU8A 1YNAA 3ETPA 2KG7A 4HNAA 4MGYE 5FP7A 2Q8EA 2CDPA 1QH6A 2YC4A 1SHWB 2A3QA 4FXKB 3VBSC 3CMGA 5H9RA 4HK9A 3TRSB 2QM8A 5A3LA 5GZFA 2GH8A 1V6JA 1L8DA 4LF7O 4AFMA 2AXTZ 1KFUL 3FD9A 4AAXA 3AKRA 1XMOO 4LUKA 4O4LA 4LWSA 5KXEA 2Y0IA 3QOPA 3WY6A 5JXJA 2ZHLA 4UB6Z 4R9DA 1L0LH 4DR6B 5J3UA 3N2GA 4KP4A 2ARAA 4K21A 4ES8A 1UIKA 4PLMA 3ZYJB 1TG7A 2BJSA 1XYPA 3JU9A 3PUHA 2YXLA 5A3NA 4YW2A 4CCNA 1YQ6A 3SISA 3FHQA 5FCCA 3J8F3 2VM9A 4DB5A 1XQ8A 3OG2A 1SQ4A 4K9SA 4DNYA 2IXJA 3SLIA 2YB7A 1WLEA 3BTZA 4AILC 4E2GA 1W6OB 4ATFA 4LK6A 2Q69A 5CFCB 1QR9A 4LH6A 1TUEB 1N4CA 1DU3D 1QMJA 2JECA 5BPXA 3AZVA 4IEVA 4KMQA 4JCKA 1HNWO 3K5OA 3G6EV 4IE5A 2QQKA 4OX9B 1RUOA 4K8ZA 4DR1O 3LIGA 1JH5A 3VHPA 3M3QA 4CDWB 4IT5A 2XAHA 5IATA 1GM9A 3ZOIA 4ZHNA 1CAVA 3OUFA 2HWE3 3K0GA 4M00A 3K4ZA 1EV13 1Q90D 2WZR2 5A3WA 1S0JA 4AG4A 3ASIA 2LW1A 1PD3A 3RN4A 4E4HA 3ZX6A 2ADPA 2ZKOA 4AR2A 3ETEA 4X20B 1VRH3 5A2QN 1K73W 1DTOA 2ZXWC 1UZVA 4XJAA 1MABG 2DVDA 4R8HA 4TSVA 1IPSA 3MV01 5FO9B 3WG7C 4I0AA 4Q4Y3 3E2EA 2UXNA 4JTDB 3OMNB 3M99B 4QAWA 2ZNIA 1BXHA 4BPZA 2ZDIA 3T2OA 4FFHA 3RYFA 3U75A 5LATA 3BU0A 1V6MA 3K2OA 2WLLA 2RDQA 4LBQA 1K5MB 4LF5B 2XXZA 1DBNA 1QKQA 3ASOC 2QQNA 3S7IA 4K8RB 4XUTA 4I4TA 5JPMB 3SCFA 2L9LA 3H7YA 4OPAA 1N8RW 1ZZ9A 4IV3A 2DCZA 3TNQA 1DGWA 5DDJ3 3I97A 3QO7A 1WMDA 2UWCA 2YI9A 3T08A 1ROPA 2WLIA 3N2KA 4BXSV 4PA3A 3CJIC 2XHKA 1QJFA 2QKSA 1RHI2 2Z79A 2HWC1 2BSKA 1QVFU 1VQLV 1X9PA 2VMCA 4V2WA 2F4PA 4FFGA 5FY8A 3O12A 5J9PC 2WQ4A 3CXHF 2P67A 5BNPB 4YJ2B 2QGNA 4FPEA 2NN8A 2R0FA 4RS5C 2WQZC 2P90A 5EPAA 3ZDVA 4U3JB 5BNNC 1W2OA 2KSDA 3GBWA 1QXPA 4EE2A 3OUHA 4OHVA 3IDAA 4C7UA 3AP6A 3AMNA 3AYCA 1UD1A 4CDUB 2VMIA 2QNKA 4Q20A 5F7UA 4MGTA 1VF5B 3X29B 5HV0A 1OLME 2R1BA 2ERFA 3OUIA 4AI9A 3E6BA 1D4M3 1OJHA 1WMFA 4QDRA 2IJKA 4DOUA 5IE9A 3L70H 5FBJA 3S5QA 1WKYA 2NMNA 5L9VA 4O9GA 1W6OA 4R8CA 5CFCA 3D3AA 2QE7G 4RHV3 4XFFA 3LEKA 1W59A 3BA9A 4OQ9A 3RBZA 5L19A 3OB8A 5CBLA 1EP0A 3AK2A 2CSGA 2BTVC 4YYOA 4IE7A 2HWB3 4JZGA 3N9QA 1ZZCA 3HEIA 1JBCA 2ARCA 1V6KA 2YBSA 5FZ9A 1K9MW 4HLTA 1PGSA 3ELNA 4Q4X1 1UY3A 2VQUA 4XFBA 3LA7A 4FZ0A 3J81N 1CPYA 1LUWA 1U5ZA 1Z5WA 3AB0A 4LULA 4WM8C 2G9ZA 4WVMB 2A7WA 1PX3A 2ZGOA 2W46A 4X20A 5DG1A 1R1A1 2BRTA 3AG3B 1R3IC 4XILA 4TSFG 1EAH2 3R0RA 5AVPA 2QZ3A 4PDVA 1ZM1A 2LGWA 1LTEA 4D0QA 4AQYB 2RNBA 4IL6Z 1VQPV 4A4AA 2VVEA 1NKDA 2Q5ZA 2WJSA 5CKQA 1WN7A 4GAZA 1SBFA 5FR3A 1VB2A 3OTOB 2R72A 4QE7A 1ENSA 4J7KA 3IDCB 3HQRA 3CQOA 3N7MA 4OUMA 2K9PA 1K5MA 5J36A 1MQTC 4K1ZA 2PAMA 1G86A 2VNVA 2J7MA 3IAYA 3VDBA 1DYOA 1XPWA 4Q4W3 1AR61 5L7OC 3O0WA 4P9YA 5LOVB 3M4FA 4RAIA 5K8SA 3F5TA 4L0PA 4AFAA 1NA1B 2D6NA 2XJRA 3AP9A 4NAMA 2RS13 4J1WA 4G28B 2XUEA 1OCZC 4D7SA 2VNGA 5CYYA 4XDQA 2AZ2A 1I0HA 2QKCA 1XJAA 4H37A 5BMVB 3RDIA 4H13B 1OVPA 4DXTA 5BNPA 3RWKX 5LGNA 1YJLA 4XC9A 1UF2C 4YJ2A 2QWQB 3ABMC 1COV3 2GC1A 2DVAA 4GLXA 2QQJA 3MZHA 1KFXL 2GBOA 4U3JA 3UK9A 1LHWA 3FN9A 1QNYA 1WNSA 2EILC 1YJNV 4UCVA 2CY6A 4X89A 1KU9A 3E8HA 4LF9O 1AJQA 3WB1A 5JDBA 1PVC2 5DZEA 4CDUA 4HYOA 4DUXA 1H9PA 4XF0A 5IK8A 3MFAA 2W39A 3CCJV 1NCRB 4I5SA 4AI2A 2Y6JA 1SZBA 4NRPA 4RYDA 5CA0B 3GZEA 3H8OA 1IBLB 2YICA 4IV1A 4QU1A 4HSLA 1SZTA 1U5IA 3A23A 4L11A 4A45A 4NTYA 3NV1A 2NNUA 1EUUA 2R063 2CNAA 4R9CA 2J1AA 5IHRA 5GLWA 1ZREA 3SEEA 3ACFA 3B4SA 4BHPA 3BUCA 5KHIA 2MNGA 3MBWA 5ITZB 2DV9A 2FZ2A 2FZ1A 3E5QA 3I3BA 3CJXA 4GKXA 2EIDA 5FY0A 4EN6B 4J1XA 5A80A 2RMU2 3J8F1 5JI7A 1OOPC 3RRDA 1YJWV 3CLPA 2HJIA 2WKKA 3K79A 1NE6A 4XDOA 2OYQA 5DAVA 2N05A 1MSWD 5LHIA 1JZ6A 3OGSA 3H3LA 2B1GA 1DLCA 4NJ4A 3IMNA 2VWKA 3O1RA 2W92A 1GLHA 1VBA3 4WVMA 3OM3B 2WS92 4EWEA 4BISA 2K2SA 2F4VO 4A6OA 3MDPA 4HL0A 2W52A 4OVEA 4XF9A 3A0HZ 1C5HA 2WT2A 2ET1A 3OGVA 2PMWB 2WLJA 4AEJA 1N1SA 1VLNA 2J1VA 4QHBA 5FZBA 2WBKA 3KB5A 1NH2D 1B3QA 3FFQA 4G3YC 1EV11 2KD7A 2QTOA 1JYCA 3UGHA 3B09A 3ETDA 5C3RA 1OLRA 2KA3A 4LFBB 3SPCA 1ZZ6A 1VRH1 3T4VA 3T1YB 4JRAA 1Y74B 1YEWA 2RDCA 2CTPA 1GZ9A 1UQXA 1UJWB 1ULDA 2X05A 3DL3A 5LOVA 1ZX5A 1G9CA 5KBFA 1N32O 1HB3A 2XAQA 3ZMZA 4DUYO 1C1FA 3U37A 1NA1A 1PZ9A 4GX0A 4LJHA 2KQXA 2ZKLA 4GULA 3MLJA 2YG0A 2XG3A 5CB4B 3GCWA 3THOA 5CADA 3UGGA 4ASKA 3QH6A 4D7YA 2JE7A 5J1XA 4A3ZA 3K08A 5F2SA 3JCZA 5IJ9B 5BMVA 2YI8A 4H7MA 2ZQMA 3VKNA 1H2NA 1REDA 4H7LA 5DDJ1 5EJZB 3O1OA 1Z78A 3DUIA 2E51A 3T2MA 3VZLA 1Y76B 5F5QA 2ZS6B 1CEZA 3K51A 5A3MA 2WFF3 3VD7A 1PMJX 3S0MA 1LOEA 2ODMA 1W0JG 3MPBA 4NPMA 4W6WA 3IPVB 3CRAA 3GJAA 4CXWA 1RINA 4WFGA 2M6YA 1FNZA 2VO5A 3SITA 1YFYA 1AYM1 3O0VA 2ZAAA 4ORFA 4N8MA 4I50B 1UYZA 1NCRA 1RFYA 4YVWC 1RVF3 4CTEA 1YZBA 2Y8KA 1AF9A 3KCYA 5CA0A 2A75A 3N7JA 3ZIWA 2HYKA 3I2KA 5HXMA 2ARXA 4FFFA 4FLWA 5B1BC 3CYOA 5FZ1A 3D4KA 5CB7A 2D3SA 2BBAA 2IVIB 3QG5A 2JG9C 1DQ0A 1QXJA 1ULFA 2D6PA 2ZEXA 4RQPC 4DUZO 3OAAG 5FZIA 1PO12 3S57A 3AZYA 3OUJA 5ITZA 4CCDA 3CIHA 4LTAA 1ZBA2 5FBZA 2WR9A 5A33B 4G9SB 1SQXH 4M3CE 4X9QA 3K4DA 1SDDB 4CUBA 1CX4A 1D4M1 3QNEA 4B3RB 3AP4A 3E6CC 5EQUA 3RJ2X 4DQAA 1X82A 1ZL8B 3LWCA 4Q0PA 4WFEA 1FOD2 4HKOA 4JI0O 3VBRC 5J7MA 3ETQA 4MH0E 3SCHA 4UBGA 4Q4V3 4UW4A 2A71A 2PQSA 2CGPA 4OHYA 1IOAA 4RHV1 3DPRC 3DYMA 4YGCA 2Q0OC 5CFDB 4I0BA 4PA4A 2A6WA 4B3SB 1ODNA 1L3JA 2HWB1 2NMOA 1C1LA 2VOWA 1RB8G 3KVAA 2R073 4MTFA 5C7GA 2XVLA 1S0CA 1PV0A 3VHNA 4XQ4A 5C93A 3FE5A 1C8M1 3WW2A 1AR1B 4QXCA 5F5IA 4N9IA 1DGSA 4C1XA 4CDQB 1UMHA 2ZZJA 3POSA 3I2HA 3ZO0B 2HHHB 4AF9A 3KSCA 3AP5A 1H2GA 3LUTB 1V0AA 5A32B 2Q8OA 2WN2A 3ALQA 1Y7BA 2V4AA 4JDOA 2FDJA 3CCEV 4RR3B 1Y74A 2DWRA 2X10A 1AR5A 4NXNB 1BCCH 3LKJA 2LM3A 1IPKA 2RR13 5JCTA 4Y24A 1SA0B 2Z2SB 2XJTA 3ZHVA 5B4XA 1XXNA 4LNUB 4DW1A 4Q29A 2ZJCA 2ETNA 5EWSA 5B1NA 2P5BA 1WLDA 2RS53 5IY5B 3H9VA 3AFKA 1GZCA 4MS2A 5CB4A 3WLUA 4D94A 2TUNA 2F6BA 2FDIA 4JKMA 3BVCA 3ZMNA 1LU2A 1VBE3 1SQGA 3VKOA 4HMZA 1K34A 3PNAA 1REEA 5IJ9A 2BFUS 4I2OA 2EZPA 1QOOA 5H2FZ 4MG2A 1IQAA 1Y76A 4DV5B 3MAQA 1RC6A 3O1MA 1X59A 2YXYA 3FB6C 1AX1A 1HN0A 1REFA 3ZX7A 5L36A 4XIOA 1RUE3 4J11A 5IT9N 4EKWA 1SLTA 3ZFEB 1N3PA 3IPVA 3K5MA 2J1TA 4CXYA 5FUIA 3HAGA 1D0GA 2XJSA 4I50A 3J9SA 1ZAUA 3A4UA 1LGBA 3PTRB 4N90A 4DR3B 4QPJA 1VQ9V 5FNVB 4JI3B 1FV3A 1RUH3 2Y69B 1FMD3 4HFSA 4QIWF 1GWLA 4KG8A 3LDDA 1OH4A 4UW6A 1N1VA 4FI9A 4J41A 4RN5A 3ZIAG 4NKGB 2J1EA 2Q1ZB 4BH9A 3I3QA 2PFWA 1OA2A 5FZCA 4I01A 1Y66A 4GJZA 5A33A 3DKWA 4AQSA 3RG0A 4Q26A 1U97A 5K9YA 1HRV3 3PJYA 1K5SA 5KWRA 3WV6A 4COWA 2R70A 1BS3A 5FYTA 5FPZA 2UXBO 2WYSA 1ZL8A 1HWYA 1OCCC 1YJ9V 1YQ5A 3KV5A 1OQ1A 3DF0A 5A7QA 1RUI3 2BTOA 1AX2A 3M3OA 5AVAA 5LHHA 4JTCB 2GU9A 3RPQA 2VD7A 3A0BZ 3IIIA 4P9IA 4XXAA 1QJU3 1VMGA 4BQ4A 1YVWA 2OX0A 3T1LA 3AG1C 1O8SA 1NZ6A 2XVGA 1WMEA 3J7HA 5C71A 2OW4A 1RYYA 3K58A 2DWDC 5F5AA 1ND3B 2XLGA 2GMMA 1SBEA 2MK3A 2W0FC 4W65A 1JUIA 4Q5OA 5C3PA 2PYLA 1JTZX 2YGMA 2FBEA 1NCQA 5LY2A 3BY6A 4CDQA 4JX0A 3DGTA 3RS6A 1HKDA 3P1IA 4X1IB 3ACHA 3ZFGB 1H6YA 3BTYA 5A32A 1DQ6A 4MVMA 2ZOEB 5FWJA 4RR3A 2PHUA 4WF9V 4ES9A 2F4LA 1K3EA 3VKMA 3IGAC 4ARXA 1Y4MA 4QNHB 3UKTA 1SA0A 2VL4A 1VBB3 4JI6B 3JAWA 2VQ0A 3ZMVA 2K9ZA 1GQPA 4LNUA 4U36A 3RJRA 3OY8B 2AREA 2OQ7A 2NZ9A 3OE7G 1KXGA 1N36O 3ZN1A 1M57C 3HD8B 5GALA 5EFUA 5A6XA 1O4YA 2IC1A 1F4NA 5JXIA 1NR1A 4ZXEA 1AI7A 2XGXA 2CL2A 1XE7A 5DXDA 1HNXO 4XF3A 3AKSA 2ZMNA 3OGRA 3W20A 1J59A 4FXGB 3WG1A 1IZ3A 3K03A 4LF7B 4A41A 3BIEA 3ZKYA 4K7JA 3ZHQA 1XMOB 1BK1A 3C7HA 1W05A 1W3VA 3NV4A 2UWAA 1WPBA 1PKXA 4Y5Z0 4IXLA 1G8MA 3T1MA 2R0HA 4YIPA 4MGZE 1NH2B 3ZFEA 5HFLA 2EAAA 4UCOA 2HWC2 5ACA1 3Q8BA 4AGGA 2P22C 2WZR3 3M3IA 4DINB 2VPVA 4XHXA 3NKGA 1I94B 1XMQO 4LOSA 3RGBA 5FNVA 4YARA 1OHFA 4NUBA 1XDCA 4Y4YA 4GT1A 1W3XA 3WP4A 1GO3F 1HNWB 4JTOA 4R4ZA 4MTGA 4ZHQB 4FTEA 1QF3A 3CJHA 4A44A 2JK5C 3B9IA 3OGGA 5FZGA 2B42B 2F23A 1XRUA 2P7TC 2WLPA 4ZOLB 1OVSA 5CFCC 4NHXA 4N43B 3VHOA 3K3WA 1HV1A 3WHTA 1WD3A 1LEDA 2NYYA 2ZPXA 3FLPA 5CVRA 2OPKA 3VZMA 4DYLA 4KU7A 1I9RA 1YQCA 4XBNA 4FMTA 3HKCB 1KJRA 3D36C 4NXMO 4AQ6A 4HVRA 4FIPC 3CU7A 4E4ZA 4JI4B 2V1DA 4UUJC 1RXGA 4YG3A 5LBQA 3B40A 1VB4A 1ENQA 5FYIA 3W5NA 1LUVA 4YWAA 5LK5A 5LBCA 1ND3A 1AI6A 3SJAC 3LEIA 3ROUA 2P6JA 4MSVA 4ATEA 1SPPB 4Q4V1 1SFPA 1HRI3 4CCJA 1KYOF 2W47A 5F32A 1NXD1 3B7MA 4J80A 4CC6A 2I2SA 4LQRA 1H4GA 1VBD3 4X1IA 3RVYA 1EN5A 3TCUA 4XIKA 4D69A 5EZYA 2ARHA 1R1A2 1GOGA 3H1MA 3C3TA 5LGUA 1H2LA 1UPSA 5GKAC 1QLEC 2E7AA 2YC0A 4FPYA 4QKNA 4NHYA 3T0AA 4PA9A 5LB6A 3WNXA 2DYRC 5JIUA 3JD3A 1HQLA 4PIXA 3MYXA 2DU1A 5H9SA 3OY8A 3LSSA 2EAKA 1ZX3A 1VP6A 3NV2A 3WSOA 1UX7A 1WLWA 5BNQA 4FLYA 3JSNA 3PUAA 4CA9A 1NU1H 1S3JA 3VUOA 3A2FA 1Z7S2 4MGKE 1EN6A 3SJCC 3SYPA 1AR62 4R9BA 1RXFA 4I0WB 3SKVA 3AJYA 1M4UA 3ZXLA 4R4XA 4ASLA 4X62B 4JKLA 1XNQO 2Y38A 2QQLA 4NVPA 3AZZA 3H8RA 4P9JA 4U7NA 2RS51 4XJWA 2Q5TA 4XXPA 4HVQA 3A0NA 4DO0A 2QEXV 4K20A 5BNPC 1VBE1 1ASJ3 1CAXA 3RYIB 3CEIA 4Y5SA 3GHNA 4JPRA 1X8EA 3KQ4B 2AR6A 2K0GA 2QCSB 5LHGA 1MZ5A 2VQEO 2O8OA 1NVPD 5ABJC 5C6CA 1D4VB 1DZQA 2GC2A 3BOWA 4PIYA 1DFQA 4JI7O 1RUE1 5KX5B 2KKWA 3AKPA 1VMFA 2HWD3 3CX5F 1MZFA 4BMEA 3EMRA 3CHXA 3WB2A 1HP8A 4N7IA 4OI1A 1K92A 3BFRA 3PIGA 4RA0A 4ZHQA 2HWF1 2P17A 3UKMA 2DURA 4BU2A 4RGAA 1GN4A 3K4AA 1QHTA 2OXBA 4IV1C 2D97A 3JQWA 2TEPA 3ZMSA 4MO3M 4N7UA 2AEYA 4UXNA 1ONAA 4ZOLA 5D5PA 4JASA 1SQPH 1RUH1 4B4QA 1SBDA 4E2SA 4N43A 3EFFK 4O4JB 5FOJB 1WCSA 2WFPA 4QT6A 2DU0A 3T2QA 4XQWA 4DR2O 1OUSA 4RWUA 4PDMA 3WG7B 5JVDB 3RYRA 3HIFA 5HPOA 3HKCA 3F95A 4DMIA 3M70A 5IK7A 5FYUA 4XEZA 5F2WA 1JX9A 1HDJA 5LEJA 3K5LA 3MI8A 5TISZ 2XAGA 3J8F2 2DVGA 2XQXA 4AQTA 5FY9A 4GX5A 3NL1A 3J7AU 3G6JB 1N0JA 3I2IA 2IXKA 2ZIOA 1BMV1 1GTOA 2ZIMA 3RT3C 3ZHTA 3AG3C 4P9WA 1SPPA 4XYXA 1RUI1 3CDZB 3KHBA 1QH7A 4NMIA 2IH1C 3ABKC 3Q8EA 5JZGC 5JOYA 4UWDA 1PPJH 3FX7A 3ZYBA 4HXCA 1AR73 4NPLA 4H14A 3LF7A 3NO8A 5L3EA 5IVEA 4EN9B 3POIA 4KU8A 4PV1B 3MW3A 2QR4A 1LHUA 3RWRD 2E26A 5D21A 3FHIB 2YGLA 3LDKA 1VQ8V 3KV6A 4KUMA 4JI8O 2OQ6A 1EV12 4GKKB 2BE3A 3ZHSA 1HW7A 1W6QB 5LA1A 1BQPA 1JYTA 3BB6A 4QE9A 4NIHA 1YHFA 1VRH2 4RS5B 5LY1A 2MW2B 2R6QA 4C90A 3H1IH 5A3PA 2IZWA 1LGNA 3ZM8A 3BPSA 2VULA 4JGSA 1J1LA 3LSUA 2ZGPA 1VBB1 4GMP3 2VVDA 4ZKTB 5SV8A 1UY0A 4A42A 1E5HA 2X09A 1HNZO 5FYVA 3KV4A 2Y6FA 4YZ1A 5FZ0A 1XE0A 4LF9B 1UPGA 2A3XA 2KXLA 4LEJA 2XAFA 3HT1A 4YW7A 1BE3H 1OFNA 1OBNA 1M56B 1NTZH 3LNNA 3R66A 3IIAA 3VBBA 3KMHA 4GX2A 2JDUA 3VV1A 5IWAO 4BW5A 1KP2A 4QQLA 5E1AC 1B06A 3T30A 5DDJ2 1ST8A 2WO7A 5CAZA 4IEQA 1SESA 5EBMC 1BLZA 4DXWA 4QGNA 4KGQA 5IT6A 2WWSA 5EV7A 1BSMA 1X8MA 4X8NA 3CE2A 3FJSA 3U0ZA 5KX5A 3KWVA 1E1RG 4N9HA 2Q67A 1VPHA 1SFNA 1W6PB 4BQ3A 4JI2O 3QBQA 4OZXA 2CWMA 3U4XA 4XUOA 1AYM2 5FPXA 4DRVA 4YPJA 1KECA 4LKFA 4DV2O 3VBHC 4WM8B 5K0UB 2UU9O 1XSQA 1S72V 2JXAA 1UMIA 1A32A 3D6EA 3HNYM 4PI0A 4GWNA 1LOAA 4O4JA 3B01A 1H8VA 4DV3B 4DK1A 2UXCB 3N9OA 5JVDA 2F4VB 2WINB 3JASB 1DGRA 3DC5A 4JYBA 3TN91 4DR4B 3RVZA 4FPKA 2DUOA 1IKPA 4YFZA 1WBFA 1OF3A 1PNGA 1QJY1 3JATB 4W4LA 2C9KA 4DV6O 1D4M2 4MOAA 4AFBA 1OURA 5FMCA 1HLCA 4AI3A 1MQTB 2E5LO 3QLQA 2WZ8A 3JD4A 4C91A 3FBMA 4UFHA 1EBOA 3GBFA 2V7QG 4AHWA 4DXRA 4KFMA 4RHV2 4R7CA 3L72H 2VMDA 4AFDA 1Q6HA 2JVDA 2HWB2 4KGGA 4YY3O 1OCZB 3OEBA 1UY4A 4OUEA 3N27A 4B3MO 5APAA 3T09A 1HQNA 4URAA 3RZHA 1V9U1 4LH7A 1C8M2 3ZCCA 3W9AA 4QB1A 1HRI1 1B09A 1ULCA 1W6QA 5JR2A 4CRQA 4MLOA 1VBD1 2GTSA 3ABMB 4CSWA 3ZFFB 4FQZA 4RS5A 3ASNC 4PCRA 3FMGA 1RUJ1 2NP0A 1COWG 2HBTA 4PQ9A 4OHWA 4XW3A 1V00A 1P49A 1JYNA 3VD3A 4TQDA 4MHRA 3UKVA 1VIWB 5FPVA 2ITCC 5GLUA 4NB5A 1LKNA 1MS1A 4DK0A 4D6RA 1AXYA 2XB6C 4WBBA 3AMMA 3K57A 5FP4A 1U96A 1XNBA 4ZXKA 3P3PA 4NN0A 2EJRA 4L8QA 3NKTA 3BODA 1QY4A 1D2DA 3MLKA 2VQFO 1WW7A 1A8DA 2ORXA 2A5ZA 2ZMLA 3ABZA 2XT9A 2D5HA 4B7KA 1HB2A 4BDVB 4DV4B 3CB2A 1YLLA 5GLTA 2BOCC 1Z0HA 3IBMA 2RS12 1VAMA 4ZU5A 3BHPA 5F39A 3WW1A 3DGEA 4B3NA 1LAJA 1CPMA 1GSLA 3LE0A 1QDCA 4LBOA 4QKFA 3FAVA 1ASJ1 2BCCH 4YNIA 5L3CA 4LBQD 1MEC1 3MIFA 3MD0A 1W2UA 5B1AC 1G7YA 2EF6A 3AKTA 4QKBA 2XJVA 1M93A 5FIXA 2JX9A 3MHSC 1RIRA 1JW6A 2D5FA 1NYWA 4BXFA 3AM2A 5EXOA 1UOFA 4WM8A 5K0UA 3B3QE 1LJ7A 2WN3A 4Y22B 4QHOA 5IDJA 2W08A 4JI0B 1JN2P 4LPLA 3CCQV 4A7KA 2HWD1 4Y5TA 4XMAA 1LECA 3WQ7A 1T6BX 2RJLA 5CNAA 1JFFB 4LKEA 4KWUA 4QGMA 5JMCA 3JASA 3P5BA 5LYJB 4FTSA 4F8AA 3PTYA 3S3WA 5A3OA 5LMNB 3URFA 1TUBB 4UCRA 4IEWA 1K4DC 3JATA 2UXDO 1JUHA 3EXAA 1WWYA 1XSRA 4OPHA 5A70A 4IEYA 1F4HA 4GB31 1YFUA 2XL9A 4I30A 4QKDA 3OD4A 4CCMA 2ZM6O 3MW2A 3N4MA 1NVPB 3H01A 1MQTA 2BV4A 4GH4C 4BLIA 5JJJB 2ZE5A 2QKAA 3L9DA 1X9TA 1RPOA 2W6JG 1JU3A 2R9AA 3E8GA 4FVVA 5FYYA 3EHBB 4ITCA 5KC6A 2P37A 4LA3A 4DFSA 4K3UA 2Y0PA 4QGPA 3TGUH 2LS6A 1NCQC 4X66O 2Q9LA 1N3QA 1NJIW 4GZ9A 4FQ4A 4IETA 1BZKA 3NNJA 5FKCA 4CEWC 1W28A 5FY4A 2WWUA 1PZ7A 4W6XA 3DC6A 4GYCB 3SPJA 4AAPA 2QSAA 2BGPA 2D93A 3H1WA 2C6SA 3LOIA 3ZR5A 3V0AB 1UYPA 5A7WB 2M7WA 4IDZA 3ZFFA 1ZZBA 1IDSA 4F6RB 3FUOA 1AR71 3TK1A 2A6XA 2G9GA 3U07A 2N7GA 1LEMA 3VBUC 5LW9A 3FB5C 2EIBA 2FCVA 2F17A 4HPKB 4ZU7A 2QQPA 4NE9A 4DV0O 2RJKA 3CRMA 3E1F1 4LA2A 1QOTA 1BZWA 4X8AA 2W1SA 4NR1A 4GKJO 2VQAA 2ZGTA 3PVBB 2V4DA 2W1WA 4C0BA 5H6RA 4MVRA 1P84F 2ZGSA 3IM0A 2QWRB 3KVBA 3JARB 4MXVA 2CTQA 4B4RA 2VOXA 4I9WA 1DCSA 3TOJA 4NRMA 3D3IA 4Z1MG 1VF6C 4LE3A 2JG9B 2OZ6A 2UWBA 1RTVA 3H3UA 4QQHA 4RQPB 4FPOB 3B8NA 3TNPB 2JS5A 5FP9A 3OTFA 4AXOA 2Y0OA 1FX5A 4QPWA 3JAMN 4YHHO 2ITDC 1YFWA 5F8PA 1R3JC 4K0KB 4TV9B 5A7SA 1UW8A 2C1FA 2DVFA 4TTGA 1VARA 3LFIA 3ZDSA 3WUDA 4LBKA 3RMXA 2VZQA 2VS0A 3ZPYA 2UUAO 5FMOS 3HKEB 4IUGA 4AEDA 4K8FA 1UYXA 3CZUA 2ENRA 4RGGA 2HLEA 3VBRB 3STLC 3MFCA 1H8TC 3WF0A 3MO4A 2UXBB 4OHZA 1R1ZA 2YBKA 1OPMA 4FLTA 2GAUA 4Y22A 4YGBA 4TN7A 4EN0A 5GZGA 1FAYA 3JD71 2IU3A 1PIV3 1UMZA 3L9JT 3GHMA 1AR4A 1YI7A 3VKLA 1W8TA 1JFFA 4E2LA 1OCRC 1BHGA 1BHAA 5LYJA 3GCXA 2UUBO 4UB8Z 2JDKA 1KRIA 1TUBA 4YXWG 1DIWA 3RVHA 4CS4A 1JYVA 2JDZA 5CKNA 5A7NA 4JTAB 3N7KA 3UT5B 4MW8A 5GM0A 2W94A 3B2EE 5FZMA 1TZOA 4KHPO 4TWTA 3M7AA 1UIJA 1MMMA 1C5IA 2B7YA 2XLAA 3WP3A 2C2AA 5ANQA 4P9XA 3G71V 4NYKA 4A2UA 1V6OA 4QX2A 5FYHA 1XNTA 4QD2A 3D5OA 3OGJA 5C3OA 2YY1A 4OZOA 1AI5A 3I3MA 3WNKA 5JSRA 3SPHA 2R30A 4G27B 3G4SV 3GF6A 2Y6HA 3EJKA 4Q4V2 3GALA 3OFNG 4FLZA 4UVBA 4IERA 2ZD9A 1HNXB 2VNOA 2G1MA 4LKSA 2IJJA 1MPXA 3HNBM 3V0AA 3ZXFA 5A7WA 4LF6O 1EY2A 5FO7B 4LE4A 4F6RA 2FKXA 1DDLA 4EZ4A 5CEHA 5B2GB 4ET7A 5LA0A 1XHZA 1QEXA 2E76B 1AXKA 1M4WA 4FAGA 3H9AA 4HPKA 5J09A 1GKBA 5C5UA 2H6CA 4CE8A 4KQ7A 3O7OA 4META 4AVVA 4QJFB 2ZX2A 2K46A 1SKVA 1S0DA 2WUHA 4UVCA 3H1JH 3DSQA 4G2KA 1QJX3 2EIJB 3PUSA 4CXXA 5IVFA 1JQ0A 1MVQA 3B02A 1AR93 5EC2C 2WO2A 2EA7A 3JARA 3OGCC 1XMQB 4XETA 2GMEA 2RR12 3DN7A 1ZBE1 1STMA 3W7SA 3KKYA 1VQ7V 2JDPA 2JG9A 4IQPA 4RQPA 3GZTB 2F95B 1CVNA 2QWOB 2RS52 2KM2A 1KITA 4KL1A 4QPIB 3C90A 1V6NA 2JDIG 2O57A 3I49A 4Q4X3 1RJ8A 3KCCA 4TV9A 2A6YA 5H5NA 5JI9A 1NR7A 3TEWA 1VBE2 3MW4A 1G9AA 1ACCA 4MGSA 4FFIA 1QQCA 3HKEA 1OCCB 2ZGMA 1H8EG 3ZN4A 4L87A 2Q30A 1R1A3 2YIBA 3VBRA 4AHZA 4WFHA 3R4UA 3TEXA 3L2YA 1UKGA 1SLCA 3SPIA 1TQ5A 2QJ1A 4UV9A 1RUE2 3AG1B 4JQRA 4ZI7B 2FHRA 4C8DA 2A1XA 1JU4A 3NNLA 2A6VA 3HWJA 4NXMB 3AMQA 4XZPA 2HWF2 1FFTB 1IPJA 4JYYA 2QTWB 1EN4A 3U78A 1TE1B 1QXRA 3LA2A 4Z2AA 1F35A 5EIBD 1WLCA 5CN0A 4IGQA 4PA7A 1AR63 3IC9A 2VZOA 1N34B 1RUH2 4XFGA 4IGGA 4QM9A 3MF9A 3ZRSA 3UT5A 2DQ3A 3A21A 4FBFA 2OIGA 1LOGA 2CWSA 4QPYA 4YW5A 2FCTA 3SMHA 1OFSA 1R73A 4LR3A 1GN2A 2A0LA 4WM7C 4FOQA 3I54A 1Q8PA 2PHRA 1W2AX 1NLSA 3JB4C 4TWKA 4QX0A 1EPZA 5I0UA 1HRV2 1GK9A 1M57B 5JOXA 1Y6XA 2ZZQA 5JSPA 3THPA 1SQVH 2Y6LA 2WAOA 5HCBA 3HNMA 1BMV2 2ZINA 1HN1A 5FUNA 1KKDA 1RUI2 1RUD3 2WLIB 2YSUB 3A8TA 2DYSC 2GNBA 5D5QA 1FAFA 1SETA 3KT7A 2QDRA 5FY5A 3ILFA 2HEWF 2BSKB 4K1YA 1G8WA 1G6NA 2XWJB 3CO2A 3WG2A 1CONA 3I2OA 4QX5A 1B04A 1XNQB 1XI1A 3K3NA 1JOBA 4Q27A 4AVAA 2VUAA 2VCAA 3NXSA 5FLJA 4FLVA 2DF7A 2ZE8A 4LF4O 3AZXA 3HQXA 3ZVXA 1T6GC 1DHKB 4NHKA 2DTWA 1X50A 1UXXX 2ADDA 5CZKA 4FPHA 4CUGA 1WJZA 4OHXA 2ES3A 2VQEB 5FMOL 5FPLA 2V4VA 3USUB 1NLRA 1CESA 1VBB2 1GNYA 1VQOV 2W87A 5BR8O 3ZN0A 1POV0 3FHAA 2B5HA 3DTUB 1R081 3DCQA 1PP9H 5B5EZ 3W7TA 4QPIA 2FD8A 1WCKA 3I4IA 3QD6A 1OD5A 2GNMA 4MYEA 2PHTA 3KCXA 4M3CF 3ZSEA 4YG6A 5T5JA 1M90W 2VC9A 5FZ7A 5GZDA 4YSFA 4RFRB 2ZNJA 1PGL1 3EO6A 3JD2A 1U12A 3I2GA 4FSJA 2BOJA 1LENA 5HI0A 4E8DA 1V70A 4DR2B 2TBVA 1OMIA 3LDBA 4ZI7A 3AG7A 5JUVA 3B69A 1J5EB 1SEFA 1VMJA 5IYBO 4AHCA 3F7VC 5FYMA 5KR7A 5FPUA 1X4TA 4AL9A 2BOBC 3EHKA 1VP7A 2LGQA 1FJGO 1VF7A 4JV4A 2PY5A 2A73B 1F2NA 1GU3A 4QPKA 3VZOA 2GALA 4MVSA 2GMPA 3THTA 4W50A 2ADEA 2CDOA 1PIV1 3IDEA 4QDQA 2ILMA 2ZKNA 4FP3A 2VZRA 1QLEB 4WFBV 3KT1A 4K8XA 4CCOA 4AVCA 5EJ3A 1VQNV 1CAWB 2EXIA 4LXLA 3U11A 2DYRB 4ZONA 5D2AA 1XNKA 3ZXDA 1IQDC 1LHOA 3TN92 1X36A 4IEPA 2RMKB 4QWNA 1VQ5V 3OEAA 3AFGA 3SYAA 1QJY2 3ZXGA 2ZGUA 1IHMA 2A3YA 4I02A 4JI8B 5FZEA 2NLJC 2YXSA 2UXXA 5CBFA 1D0HA 4YLZA 4WFFA 1PZ8A 5LP6B 3WG3A 2FMYA 1SMVA 3BEHA 4E27A 1LULA 4ICGA 5F37A 4HANA 4Y3OA 4OULA 1R6NA 3CCRV 3BIWE 5FP8A 4BK5A 4ZS3A 2QQUA 2G4IA 2VW0A 1AYM3 3BAAA 3WP5A 5F6KA 4AQYO 1HNZB 1GANA 2Y6KA 3FC0A 4KG0A 3JQXA 1VBC1 2OKXA 4BIFA 4DR5B 1S76D 4UBHA 4R52A 4P9OA 1IBMO 2JICA 4MTXA 5A6QA 1QDOA 5DAWA 5FXZA 1HRI2 2IJHA 3OTOO 1PGW1 3VZKA 5KA5A 1VBD2 5LGTA 3JCIA 4CH3A 4MX3A 1MOFA 5ABJB 2E6VA 5D8AC 1LHNA 4NHMA 4LNVA 2XVKA 1CR7A 3UQ8A 2RDSA 1E1QG 1DQ5A 1WLTA 2JRIA 4CH5A 3T2PA 5F6LB 3USUA 3D3QA 2DFBA 4GD4A 5L3DA 5JJEB 5C8WA 3ZR6A 1XILA 5IVJA 3QO5A 4XABA 1M56C 1FD9A 1V54B 1Q6IA 2IXLA 4OLLA 1ND2B 4ZS2A 2WLQA 4FK5C 5LBEA 3O1TA 1QJX1 4JI1O 3ZXJA 3KM5A 4IV1B 1AR91 1D2QA 5BXZA 1UZZA 5LA2A 4EN7B 3C7GA 4JGYC 2JE8A 4RD7A 1VRBA 3FB8C 3LSQA 2VTXA 3C3VA 1BGYH 1G6UA 4GKYA 1PK6C 4LBJA 2FB5A 1HXS3 5A6ZA 2CK3G 3D36A 3W7WA 1DGLA 2JDYA 4PLOA 4YGEA 1EZVH 1RSOB 5FZHA 3CSXA 3EYPA 1GWMA 1C8M3 3L74H 4I3GA 4CUCA 2HP8A 1ASJ2 4A7ZA 1N1YA 5K0UC 3ZHUA 5I0SA 3WD5A 3Q8FA 2IW5A 5KLVH 4JQTA 3LPGA 4DV6B 1UZWA 1QNWA 4MTOA 4N53C 3ILNA 2X7RB 2GDFA 3SH4A 2DCKA 3U10A 1NTMH 3ABKB 1J83A 5H6QA 5JZGB 5C8YB 3QTCA 3C8XA 3RZMA 4BMBA 1NUKA 1O5LA 1S0EA 3LSEA 5E79Z 1HJFA 1ENRA 4Q0VA 2HWD2 2R043 1DZTA 5E6HA 4WZCA 3LNMB 3ITQA 3NRUA 4CDXB 1CAWA 3CNAA 1R6TA 3BTAA 2EJ7A 1OSGA 1V55C 2EIEA 1BBT3 2BU9A 1O3TA 4B3MB 1OZ0A 1N0NA 4LFAO 1U5XA 3I8TA 4CP1A 4BQ2A 4GB32 2Y33A 4JI5O 2PHLA 1SC5B 2YEVB 5LP6A 4CZSA 3AC0A 3WQ0A 4AK3A 1JOJA 3SGIA 4BM8A 2BDRA 1UZYA 5B1OA 1JZ3A 2PAEA 3VHRA 3B93A 4M01A 1PX4A 1V6LA 4YW3A 4YZ5A 5DUVA 2IFWA 2YPDA 2H6BA 3ZFFC 5KXDA 2GZWA 1FI2A 5LRRA 4PELA 2YC2A 4P5HA 1OHHG 1AL23 2OT7A 2ZCWA 1OQDA 5DECA 2GUZB 4ISQA 1RUD1 4BQ1A 2ETEA 5DPNA 4Y1ZA 4Z1VA 3K0DA 4U3FH 3JUUA 2ZBJA 1WA8B 4LFBO 4EJRA 4P5YA 4UFZA 5ABJA 1IURA 5C8CB 3KQRA 1AR72 5KXCA 4LIVA 2ZXQA 2WNEA 3K9AA 1GQGA 3SXWA 3WU2Z 4WVWA 5F3GA 2XTAA 3OR7C 2E9QA 4QDSA 1AVMA 4PIZA 1ND2A 3OBRA 4PDWB 2EZOA 1UPIA 3LQCA 2PLV3 4MUVA 2F66C 1S0IA 5H9PA 3VL9A 4E4SA 4HZFA 2VOKA 2WLKA 1F23A 3U1XA 3VBHB 4PBPA 4YG0A 4UAPA 2AHZA 3CRCA 5HFMA 4DR7O 3WNMA 4LO4B 2FYUH 2OTLV 1HB1A 4LIUA 2WNVC 3MICA 3IAQA 4LORA 2QM4A 1YXWA 3OBTA 1RMU1 3WNPA 2P5OA 2VRZA 2BVVA 1DF0A 1GKFA 4W4KA 3ZSKA 5FJHA 4AEDC 1CJDA 1UY1A 1YIPA 4L92A 1RSOA 2Y48A 1AHSA 1XHXA 4I0XB 3SQOA 2P1BA 5K4LA 2X0LA 4Q2FA 4DRXB 5J37A 4LF8B 4YVSC 1GP4A 5LCWL 5BYNA 3OPZA 2VBBA 3HVDA 2RMU1 2PI4A 3IAPA 2QUOA 5FLIA 2ZM6B 2D6KA 5DUXA 5JZGA 5C8YA 1YI2V 1PM7A 3ST7A 3JD72 1ZNPA 1ZRFA 2B46X 3ES1A 3GBGA 4UT5A 1ZSPA 4CDXA 4UCSA 1SQBH 4J10A 2FTKA 2EULA 5BV6A 3MIGA 4ZY9A 2V09A 4S2FA 5CA6A 4X66B 1OI6A 3KV9A 3H0OA 2DE0X 3AG2B 4YGDA 4BE3A 4RGKA 4B3RO 5FYCA 2ET7A 2QDNA 3ASNB 4CCEA 4DPNA 2GV9A 4N23A 3NSTA 2YEVA 3K46A 1KKCA 3I55V 2H8PC 1XNCA 5T52A 4FLUA 4AE2A 3CWBH 4X65O 3FLTA 2D7FA 4R50A 4Q8LA 3T2TA 2PUSA 3T4DA 2VY0A 4D7TA 5ACA3 5L3GA 1FS0G 3VQVA 2BEOA 3M2MA 5HCAA 3KF3A 1E5RA 2EBOA 5F3EA 5JH7B 2UY9A 2ZX1A 4TLGA 3RW0A 2GUZA 4NIDA 3SPGA 1GWKA 3UETA 4J7ZA 4JYCA 2JDHA 4F83A 3WG4A 4A6SA 1WA8A 1E5IA 3C7OA 1S5JA 1AJNA 4GALA 5AC91 3GVMA 5C8CA 1V9PA 2JIJA 3R05A 4DY5A 2C4XA 2NR5A 2VBDA 3O1UA 5L73A 1KBHA 2JE9A 5KC5A 1YIFA 2WWWA 1QOSA 1W9FA 2X8KA 1UCXA 5EZWA 2WPDG 5IFTA 1VQKV 4YHHB 5B1AB 5FZ6A 4PDWA 1NI8A 4DUWA 3N3HA 5IJRA 3WDXA 3M7MX 2UUAB 3CCMV 3CXCU 4BYYA 4DIQA 3WINE 4CH4A 3VBHA 4COZA 5IVBA 2HR3A 4R9AA 1ZBE2 4MZUA 4GWMA 4BZ4A 3WDUA 3OMIB 4LMFA 5F9TA 3AXEA 1VIBA 2GHYA 1RUNA 4O4HB 5DABA 3LB9A 5DQ0A 3V65A 3AJZA 2WZPP 2EIKC 4BOWA 1AYN3 2AC1A 3VL8A 3ACIA 1DQ4A 4AZZA 1HDKA 1R093 2LROA 2Q8DA 2SBAA 2UUBB 4I0XA 5IJ0B 4IYIA 1QQP3 4DRXA 1WCUA 1UU6A 1WA6X 3N9MA 4GH4B 2NPIA 4DR3O 2XLFA 2YZ4A 3K9SA 4AI0A 1HXS1 1JHNA 4QGLA 1W6MA 3VKFC 1A78A 2RM23 1YC61 2WT1A 4KHPB 1VQ6V 1FPN3 4CU8A 4G4FA 1KDMA 4DEVA 4NPRA 5C5TA 2N04A 5IK4A 4DV1O 5FRAA 4YZ4A 1NCQB 2AW9A 1KD7A 3VN4A 3DKQA 4XUNA 3CD6V 1YWKA 3JYCA 2YU2A 3UL2A 4CEWB 2JG8B 2WAMA 2UUCO 4D6QA 3RI9A 4AVSA 1LOFA 4UW3A 3NR7A 4RUEA 1FXKA 2D3PA 2ZAHA 2PYJA 4CU6A 3JAWB 3QCWA 5FZ8A 3P6BA 2R041 3VBUB 4LF6B 2WO1A 3H1YA 5FXVA 5EJ1B 2EIMC 4YIOA 2V73A 4JDNA 2E7TA 4BWOA 1DP0A 4E4DX 3IKWA 4NO4A 4ZIBA 2WNUC 1BBT1 2JDNA 3SC7X 2WABA 2VOTA 5FMDA 1VAKA 5FJKA 1AILA 3HR0A 1JOYA 1W0NA 5LWBA 2ZGLA 3OCPA 1MA1A 1IXMA 2JJ1G 5FZAA 1DYKA 4P30A 1BQZA 1NS1A 2FCUA 3LCPA 1C8NA 1DLLA 4HZ3A 2WWJA 3T1HO 2ZE6A 1HJGA 4JC1A 5JH7A 2BTQB 4B29A 5FMBA 3SHRA 2WQ8A 4OCTA 3ZYFA 1TAEA 1JHJA 4H44B 5BNOB 5JVVA 1IS3A 3WF3A 2Z5UA 2D6MA 3NAPC 1S2KA 1Q82W 1KS5A 4IEXA 1F31A 2HWF3 4IW3A 1SQQH 1S0GA 1JODA 4LFCO 3DV8A 3UJQA 2EIJC 3H1KH 2PQQA 2Z5WA 1WB8A 3E22B 3RZKA 3WQBA 4X8PA 2BNOA 1AL21 1GOFA 4B8EA 5KA6A 3ETGA 2XAJA 3WF1A 1LODA 3JAKB 3ENRA 3J7LA 1H8TB 5IYDO 2BPA2 2XNDG 4BB3A 2R32A 2WAAA 1S1AA 4B3TB 1IBKO 2ZX0A 4Q1RA 4QPIC 2VGDA 3CJHB 3PVNA 4MSWC 2J42A 2VECA 1DF5A 5L3BA 2DW4A 1LESA 1JZ5A 4O4HA 2DJVA 1OCRB 3U4SA 1ZTEA 2VR4A 3RYKA 2HEPA 3RI8A 1WMXA 1R082 4OYUA 2FMLA 2PLV1 2B8MA 4Q1PA 1NQTA 1S4CA 1DLBA 4WV8A 1XU1A 3EXUA 4HAMA 5IJ0A 1J3QA 3BKZA 2D43A 1RUG3 2VZPA 1KQRA 3JALB 3KZ4C 3IZOA 3OYWA 3H50A 4GH4A 1I94O 3VZJA 1PGL2 2MEV1 3JBG1 1I7FA 1IS4A 3IMMA 4BQYA 3OEHG 3POWA 5CISA 3BRCA 3N9PA 4X6QB 3UCSC 3IT8A 2RVAA 3O5SA 1VMHA 2D3OW 3I2JA 1BYHA 5FPOA 2O0OA 4K6BA 3QACA 4ASMB 3UGFA 1DQ2A 1AJOA 4OXSA 3SYOA 4FPGA 4QM8A 5E16A 4CEYC 1N33B 1H9WA 2R49A 2D40A 3ZIXA 4CEWA 5DM6V 5KAIZ 1U0AA 2JG8A 2QZ2A 5EHDA 5EZYB 4X64B 1LU1A 1EYBA 3J7NA 4YM1A 1SLBA 3WVJA 4I7ZB 3STZC 2EXKA 5GZEA 5F5CA 4DUVA 4MVQA 1FATA 1E79G 5B3SB 1PIV2 1QU0A 4X1KB 3CMAV 4UFLA 4CBCA 1ULOA 3VBUA 4HK8A 3J7MA 2UYBA 3S5AA 2JDAA 1UAIA 4CU7A 5F3IA 4FOWA 5G05L 3J80N 3ZJZA 1JJOA 2IM9A 4COUA 4BIUA 2WRAA 5EBLC 2HVJC 2OUJA 2E33A 5CMUA 4JI4O 3VBFC 2Q73A 1DYPA 2RS33 4LF4B 5I93A 5LBFA 1GYKA 2BTQA 2LJ2A 4XUQA 4XACA 2XQRA 1VF6A 1O91A 3AMPA 5BNOA 4NTXA 2JEXA 1PM4A 4XFIA 2VZUA 2DQ0A 3I2DA 2GP3A 1CAXB 1ZA7A 2AUYA 1UU5A 2JIGA 4EB6B 2Q8VA 4U7OA 1FXVA 3AG4C 3F2ZA 5BR8B 3ZBHA 3WDYA 5CBHA 3E22A 4CCKA 1VBC2 4MADA 5LZ6A 5FK8A 3QF7A 2VCCA 2K1EA 5A1AA 3O1SA 1GP5A 2BERA 1MS8A 1OLQA 1H2KA 5LL6Y 1GICA 1PO23 1GNZA 1CPNA 1JZ7A 4B08A 4YM3A 1PGW2 3JAKA 1W2BU 2J1UA 4TLFA 1G1XB 4QX1A 1H8TA 2DVBA 2OPWA 1BEV3 4JVAA 3DXUA 5IVYA 3IB3A 3MV11 2RE9A 1Q5OA 2ARBA 2XWBB 2AGAA 1NT0A 2DUPA 2XOKG 2PTMA 1FYUA 4DR1B 3TN93 1Q3EA 4DEQA 2GDSA 4JHZA 3VD5A 4E9KA 4X62O 1QJY3 4NIAA 4CPBD 5CA1B 3M3CA 4MHUA 4LC1A 1QJX2 3T0DA 3ZYPA 2PHDA 1AR92 5H9QA 3VD9A 3CZJA 3WF4A 1POV3 2QQVA 1MSDA 3I56V 4Q0SA 4FOYA 2UURA 1LR1A 4W6YA 4HBNA 1FJGB 4H55A 3JALA 4EN8B 3P30A 3RZJA 1DZRA 3UJOA 4KWLA 3MDSA 2O1QA 4WM7B 1M1KW 4EWDA 1YJKA 1DK1A 1AYN1 5JXGA 4BAYA 1BKZA 1AI4A 4Q4X2 3H1HH 2CTRA 2ZGQA 1V9U3 1R091 2Q4SA 3SEPA 1NQDA 4JAUA 2GNTA 2ZGRA 1QQP1 3V56A 1MS0A 3WW3A 1YO8A 4CYDA 4CS2A 4E2QA 1W8NA 4CDWA 3DYPA 2NM1A 2NQYA 1RUJ3 4PLNA 4JYAO 2YDEA 2DYSB 2BFUL 1RM1B 1K12A 2RM21 2CE4A 1FPN1 4XJ8A 4RUFA 3FKSG 4BWAA 3JD1A 4X1KA 1NY71 3L73H 5ISLA 2ZA9A 4LOTA 1S0BA 4LHNA 2XJPA 1I5YA 3BCWA 2H94A 5L9RA 4Z8BA 5B4NA 3N36A 4P2ZA 5FPRA 4URTA 5F3CA 3QO8A 3GWOA 5LP6C 4NWVA 1IBMB 3OOXA 3WDTA 5C9AC 1GBGA 1XNRO 1RUF3 2QQIA 3MF6A 1UKRA 1B35B 2W9XA 3CP1A 3ZPOA 1Z7S1 4GMP0 1LOBA 3ZLIA 1J84A 2JB8A 2VVFA 1WW6A 2ZGKA 3CKHA 3ZHRA 1MEC3 1DQ1A 1GUIA 4EB6A 2GN3A 1ZZ7A 3CC4V 2ZHMA 1PM9A 5FPBA 5AFBA 3TWIA 3GJBA 4FJCC 2BOIA 5FKBA 4A5UB 4AGVA 4JI1B 3K3OA 3PN1A 1Q8QA 1L7LA 2YV8A 4GKKO 1IG3A 1NBMG 1RUD2 2XL7A 1XC6A 3ZRVA 3SDLA 1FXHA 2NN4A 2R16A 1UWWA 2VZ3A 3CRRA 3R4SA 2XKOA 4TV8B 5JXHA 4XMIA 1SCSA 3AK1A 1QU7A 1V54C 1OXCA 2B9ZA 2OUHA 1FXZA 2ATKC 1ND2C 1VQMV 4XFHA 4XBLA 4UI9L 3RWNA 2XUMA 1UL9A 2JS3A 5G04L 1GAXA 3PDQA 4AEKA 1US3A 3ML0A 3PMSA 2W1UA 3M8AA 2EIGA 5CA1A 4GWJA 2HLDG 1FV2A 2OA2A 4GB33 2LFSA 3SKJE 3BTXA 3WP6A 1PNKA 1AX0A 3TJTA 1PVXA 1UOGA 4MT8A 4NRQA 4AVTA 2WDBA 4M0HA 1UZ0A 5GW7A 1YF2A 3C7EA 2PYTA 4YM2A 1W0OA 3GNEA 4NIGA 3KGLA 3RMYA 2P6CA 1OLMA 1SACA 1RMU2 3R65A 4WM7A 1RUC3 1Z2GA 5LXTB 5LMUO 2C26A 1URXA 1O3RA 1CGPA 4QXHA 1YTFD 3RZGA 3ZN5A 1HB4A 1T5EA 2KB1A 3CCSV 1XBFA 3FYIB 4AI8A 2HYXA 4ASUG 1GN6A 1AP5A 4AVBA 1RUG1 4XDKA 1CP9A 4WZFA 3TB0A 3ATGA 4JDMA 2DOSA 3ES4A 4O9EA 2XPJA 4LFAB 5FLXN 2VOVA 1YQ2A 2CAUA 5I8SA 2W6IG 2RJ2A 2DMXA 4JI5B 2IJIA 2WO3A 4CDXC 1BHBA 4X6RB 4PHZA 1L7RA 3NWKA 5FZ3A 1QWRA 3AX4A 4ZU4A 2RN9A 3PU3A 5JWPA 1G9BA 4LKDA 4DV3O 2Q68A 3G6BA 4TUYB 2E53A 5E89A 1JZ8A 2UXCO 2ZX4A 4YZ3A 5FY1A 4P14A 2D6OX 2VUDA 4UYBA 1OF4A 3WEZA 4D3WA 3UT0A 3AYDA 1TMF3 1SZXA 4DR4O 1K33A 4BCUA 4INDA 3GGLA 1KEXA 2LALA 2YIBD 3JXSA 1LGCA 2RJZA 4J9ZB 2Q7GA 1FNYA 1Y67A 4NIIA 2HWE1 5FP3A 4D8MA 2BP6A 5D8AB 3DXRB 2PHXA 2Y64A 1B35A 2Q4PA 1OC1A 4KH9A 2XJUA 3THCA 4DW0A 2LUWA 1B6QA 4CZZA 1JZ4A 2XBO3 3P32A 3PURA 1TME3 1K45A 4FFBB 4GXLA 1O3SA 5EIBC 2A3WA 1Q6UA 4GJYA 5A1LA 2JEMA 4Q4Y1 1FT9A 3W5MA 1F7YA 1N3OA 1BVP1 3BA8A 4GIQA 2YHJA 1WCQA 5EP9A 1XU2A 2RS31 3MIBA 2PF4E 2YFUA 1NZCA 2EXHA 4Q0QA 5JR7B 1ZYBA 3FX3A 5C8CC 3ZN6B 2DCYA 4JGYB 3HPNA 5HCHA 5A3UA 4ZZ5A 3JD73 2MPFA 4AYUA 4J6GA 2VTXJ 4DR7B 1PK6B 5AC92 4P08A 3FAVB 4TV8A