1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
3U0ZA 2UYBA 1ZZ6A 4Q0PA 1CAVB 1O7FA 1YFWA 4I2OA 3C3VA 3KCCA 4QGLA 4FAHA 1ZREA 4PIYA 3H8UA 3LA7A 3MPBA 1EPZA 4HN1A 4GULA 1ZZBA 2XL9A 4MUVA 4BIFA 1CAXA 1YUDA 2Z2SB 4R52A 3NSTA 5EFUA 3G7DA 1CGPA 5JAXA 5I0RA 4ZU7A 1TQ5A 2IXJA 3SCHA 4R8HA 4FT8A 4YYOA 4P9GA 4QX5A 2FMYA 3BALA 3EBRA 2IXHA 3UKVA 3FWEA 3WW1A 3JZVA 5E16A 4EROA 4F8AA 4EWEA 2VECA 3UKTA 4LLOA 2UY9A 1DZRA 3IDBB 2MPFA 3RPQA 1RC6A 3FZ3A 5FLIA 1NZCA 4KWJA 1NXMA 2XLGA 2XLAA 2VQAA 4MH0E 2CGPA 1H1IA 4I0AA 2MNGA 5T3NA 1CAWA 1OMIA 1YFUA 4XF3A 4LUMA 2BNOA 1EP0A 5EZWA 3BCWA 5BPXA 4LUKA 2DCTA 2IXIA 1J3QA 4O9GA 3CL1A 1FT9A 1ZX5A 3CJXA 3SCGA 5CADA 3MDPA 2PHDA 2ET7A 3H3ZA 4ORFA 1RL3A 3KSCA 2K9ZA 3UKNA 5JSRA 5KHHA 3D82A 3M3IA 1CAWB 4IESA 1O5LA 1Y9QA 3KGLA 3LA2A 3E5QA 2GC2A 2IC1A 4MX3A 3DKWA 4ZU4A 2OZJA 1O3QA 4AVBA 1FXZA 2D5FA 1WA4A 1ZZ9A 3IWZA 5C8WA 3BPZA 4HMZA 3QOPA 2UY8A 3RDIA 1XRUA 3MYXA 4XFBA 1WLTA 2K0GA 2BGCA 4HSJA 2QDRA 4IEOA 2GAUA 4HLTA 2BNMA 2QVSB 4L11A 2BNNA 2PAKA 4KL1A 3OTFA 2H6CA 5HI0A 4CYDA 3E6CC 3CO2A 1CAUB 3H1WA 2N7GA 1ZRDA 4HBNA 1GQGA 3QACA 4YSFA 5LRSA 2B8MA 2F4PA 1OI6A 2GU9A 3ACLA 3LZZA 3RYKA 3RYRA 4EWDA 1QXRA 4EV0A 5K8SA 2Z69A 5LEJA 5AVPA 5BXXA 4OFGA 1ZRCA 2H6BA 3FX3A 5FPXA 4XFGA 2PTMA 1WGPA 3I54A 1ZNPA 3DN7A 4LA2A 5I0UA 5FQ0B 3S0MA 4MGIE 2XGXA 4IETA 5I0TA 1YFXA 1VR3A 1RGSA 2PQQA 4X6RB 3TNQA 1ZZ7A 1UIJA 4LTAA 4YNIA 3FFQA 3HIFA 2PAEA 1V70A 5I0SA 3EQEA 1LRHA 3NKTA 4HVQA 3RNSA 5FDBA 5KHIA 2B9UA 3IIAA 3NW4A 5I91A 4AQ6A 1OD5A 3WW4A 4UXAA 1I5ZA 2BEOA 4MGKE 2OPKA 3FJSA 1UW8A 4MZUA 3CF6E 1FI2A 2PHLA 2UYAA 3OGJA 2ATFA 3H9AA 3LOIA 4HN0A 3E6DA 4XFIA 1IPJA 1GQHA 3ES4A 5BUVA 1QY4A 3B02A 2D40A 4JTOA 4Q0UA 2GC1A 4AXOA 2Q1ZB 4L2NA 2QNKA 3E6BA 4RD7A 4J1WA 1G6NA 3HT2A 5LRRA 1RUOA 5C6CA 3H1YA 5JSOA 1UPIA 2D93A 4QMAA 4WVZA 4HVRA 1DGRA 1J1LA 3E97A 2XHKA 2GC3A 3GBFA 4A2UA 3O14A 3EJKA 1L3JA 2I45A 1ZVFA 4XETA 2B5HA 4KWLA 2ZCWA 4BYYA 4QM9A 1I6XA 1X7NA 3NVCA 3USSA 3GYDA 5JSPA 1J3PA 1VJ2A 3E5UA 1J3RA 3OF1A 2D5HA 4AQ2A 1QXJA 4F7ZA 5FLJA 3CEWA 2C0ZA 3SHRA 4X6QB 3SXWA 3IDCB 2Q4SA 5E1RA 1X82A 3H7YA 3KMHA 2IXLA 1NE4A 4D7TA 1CAUA 1X8MA 1IPKA 4Z82A 3EO6A 4MGYE 3HQXA 3U10A 2PYTA 4UBHA 1VP6A 4UBGA 1ZZCA 1O3SA 2XKOA 4OLLA 3H1MA 1PM7A 2GH2A 1NYWA 2QJVA 3N4MA 4MGZE 1J58A 5BV6A 2XL7A 1UD1A 4Q0VA 3BU7A 5I8TA 5J7MA 2O1QA 4IEXA 4E2SA 1XE7A 3LA3A 2KXLA 4D7SA 2CAUA 4IEPA 4YRDA 4HSLA 2XKPA 3SCFA 4I02A 2HJIA 1SQ4A 5FQ0A 1RTVA 3SMHA 2Q30A 5I8YA 5JCTA 4I01A 3NL1A 2OA2A 4Q0QA 4AVCA 1RUNA 4HVOA 4JVAA 4XFCA 1LKNA 2O8QA 2MHFA 3H50A 3U11A 1XE8A 4XF1A 5FLHA 1JUHA 5BY5A 1Q3EA 1HW5A 4LEJA 4I3PA 4J1XA 4QGNA 1PMIA 4BHPA 2ZKLA 1CAXB 1H1MA 1QWRA 4KU8A 2EAAA 2H0VA 2CV6A 3TNPB 2GC0A 3NJZA 3WW3A 5LEKA 1ZRRA 4LULA 2VPVA 3ROUA 2Q0AA 5D1IA 3FHIB 5FPZA 2BYVE 4O9EA 3H7JA 5I93A 1ZZ8A 2QCSB 4K8FA 5CVRA 4TLFA 3H3UA 2PAMA 4XF9A 5CU1A 4I0BA 4IEQA 4DINB 2E9QA 1EYBA 2CAVA 4XFFA 3M70A 5FCCA 1O3RA 1ZRFA 4ONUA 3WW2A 4E2QA 4YARA 1UIKA 1O4TA 2IXKA 4IEVA 1Q5OA 3I59A 1YLLA 1YWKA 4Q29A 2Y0OA 5KHKA 3E5XA 3ES1A 4QGMA 5J3UA 1YHFA 2ETEA 5I8SA 1U12A 4I09A 4XF0A 3ETQA 3DV8A 4MV2A 5J48A 3HT1A 4WBBA 2PFWA 4E2GA 1OFNA 4QM8A 1YFYA 4QXKA 1O3TA 4WZCA 4IEWA 2FQPA 2EVXA 4FAGA 1CAVA 2EA7A 2OYZA 4XF4A 4JV4A 3PNAA 4IEYA 4XEZA 2P17A 3ELNA 5JR7B 3ZDSA 2ET1A 3LAGA 1Y3TA 4JTNA 4B29A 1LR5A 3OCPA 5KBFA 1NE6A 2GZWA 3D0SA 3I7DA 4HZFA 1X8EA 4Q0SA 1UCXA 4EWAA 2OZ6A 3VHRA 2WFPA 2XLFA 4NVPA 4IEUA 2HKXA 3KGZA 1J59A 3L2HA 4BH9A 5KHGA 3DL3A 3D0JA 4IERA 4XFHA 2PA7A 4N9IA 3MZHA 1DZTA 3BB6A 1SEFA 2IXCA 4KU7A 5F1RA 5KHJA 4PJYA 2WC2A 3RYPA 4PIZA 1SFNA 1O5UA 3EHKA 1Q43A 4AVAA 3LWCA 1EY2A 1CX4A 3PVBB 4FBFA 4N9HA 3FE5A 1DGWA 3I59B 3R6SA 4IEZA 3RZZA 4PIXA 3CLPA 3IBMA 4LA3A 1LB2A 3OD0A 4ZU5A 4XFAA 3S7IA 4META 3ST7A 4Z07A 3S7EA 4KWKA 2V09A 3PLQA 4H7LA
chains in the Genus database with same CATH superfamily
1R1ZA 1BSMA 4Q0PA 1EAH1 4BPZA 4CP0A 3C3VA 2R072 2LO1A 4MTOA 2ZHLA 4JTDB 3H8UA 1G8WA 2GDFA 5FYHA 4NJ4A 2LROA 3NO8A 2Z2SB 1XDCA 4X20A 2B7YA 2FMDA 4O2AA 3SCHA 3I3QA 4X8PA 4DV1O 2ZEZA 3CMEV 4IE0A 1H6YA 3AEIA 3JASA 1ENVA 4F8AA 1BQ0A 3OMAB 1LGNA 1LOAA 4D7YA 1OVPA 2OTLV 3ZYRA 1JMUB 1QJU3 1W0KG 2ATKC 1WJZA 1NXMA 2XLAA 4BK5A 3THTA 4DXSA 2RS12 1ZUQA 2EIGA 5CNAA 5KAIZ 5F5QA 3G6EV 1FV3A 1JW6A 4BQWA 4EN0A 5CFCB 3NJXA 3VZJA 1OF3A 5FZ4A 2ODMA 2EZOA 4AQYB 4O2BB 1AJOA 2QQMA 4Q8KA 3ZRWB 3HD8B 1OHHG 1VQ6V 4QU2A 2NLRA 4CEWC 4FMTA 3WDVA 4AYUA 2B1GA 2VWJA 4UVCA 3IWZA 4OI0A 4X1YA 3VQVA 2BZDA 2B1IA 3ZX7A 3MYXA 2JDPA 1XQNA 4WF9V 4DV5B 5FZDA 2QDRA 2GAUA 4QKBA 5FXXA 2WAOA 4OZXA 4JI1B 4IE6A 2KA3A 4E4ZA 5B4NA 1VBB3 2ZGKA 5IVBA 3B00A 5JDBA 3WF3A 3AG3B 3VN4A 1QJY3 4CUAA 3ACLA 5CA0A 4K8RB 2RVAA 3D8CA 2DYSC 1V6OA 1OA2A 1GQPA 1UYZA 3O65A 1G4YB 3SPJA 1WGPA 3DPRC 5J9PC 3KT4A 4K1YA 4IXLA 4Y4YA 4BQ3A 3STLC 1RPOA 2B9VA 2Q1FA 5BNOB 4GKYA 3N7MA 1ND3B 4RHV1 1IX9A 2B4KA 1DQ4A 1N1YA 2WNVC 1RVF3 4CEYA 4GH4A 1H2SB 1GZWA 1PNKA 2RDQA 1Q6IA 4LF4B 1HRI2 1YJWV 3GWOA 4DV0O 3WDXA 3GZEA 4XDOA 4R6ZA 3I3EA 4DK1A 5CB4A 3ZN1A 2GC1A 4AXOA 4QX0A 1SQGA 1CX1A 3B09A 4JAUA 3O1RA 2YUAA 1MZFA 4J6GA 2CTPA 1VBE1 1U5YA 3I56V 1TME3 1RUD1 3IZOA 3VQXA 3DXRA 4A2UA 2HWE1 1W2NA 5IJ9A 5JSPA 1E5SA 4BAYA 2JE8A 2JDYA 5B3SB 5BXZA 1US2A 4LKFA 2XBO1 1AX0A 1MEC1 2WS93 2XWBB 3ZX6A 3OM3B 4Z82A 4MGYE 2F95B 2ZNIA 4GX5A 4XABA 1OPOA 4DUYO 4RR3A 1Q6UA 3OPZA 3OT7A 5FKCA 2BTOA 4CU9A 1PNMA 2QKDA 2KXLA 2UXBB 5A3MA 4Y26A 2AACA 4GWIA 4UI9L 1YDXA 1HRV3 4FOVA 4FM1A 1HNZO 4QB2A 3HJRA 1SMVA 2CTVA 3T1YO 2VNGA 2R073 4MXVA 2ZX3A 2DU0A 3JATA 4AVCA 3H1LH 3H50A 1XE8A 3QH7A 4LBQA 3KV6A 2ZX4A 4X9QA 5FZ6A 1PMIA 5E88A 1UZYA 3F2ZA 1H1MA 3WSOA 2AENA 1V6JA 4QJFB 1MACA 5IYBO 1MS9A 1CZTA 1JR9A 3C7GA 3W9AA 1JVMA 4XUQA 3KS7A 2H3OA 1IGOA 2CAVA 5FJKA 1LECA 5LASA 1K33A 4IEVA 5C9AC 3VBFC 1WLDA 1MA1A 3VLBB 5I8SA 5LBEA 1HRI1 2DBNA 4LORA 1AR61 3AKPA 2JD9A 4QQ2A 4K3AA 2F17A 4JQRA 2WFF3 1OCZC 1F35A 1NQJA 2BVVA 1LAJA 3CEIA 4EN7B 1QJZA 1C8M2 1GM7A 4FAGA 1CAVA 4K6BA 2LGQA 1Q8PA 1YTFB 3OUIA 1JYXA 1C3HA 3NMBA 4HZFA 2ARAA 4HPKA 2W91A 3ZSEA 4K21A 2Z5UA 5M0TA 2UUCO 4Y1XA 1MQTA 4F83A 1MZ6A 4IERA 3ZR5A 3I97A 5B2GB 4LFCO 2CL2A 3E83A 2QM7A 4PLNA 5ITZA 1XNDA 4FP3A 2FZ1A 2GH8A 4HT1T 3OBZA 4TLGA 1JJ2U 5J2TB 1JOYA 1VMGA 4P9PA 1QH7A 1PVC3 5IY5B 2DN9A 4ZBMA 1W8HA 3OUJA 5CA0B 1VRBA 3W20A 3G6BA 3PLQA 1QBZA 4NRPA 2ITDC 1HQLA 4H44B 4KGGA 1LGCA 3OBRA 4IV3B 4J11A 1CAXA 5LA1A 2BW8A 2ZR3A 3EXAA 3OTOB 5AC93 4I0XA 4HAMA 5BNOA 1AR72 4TWKA 1MG1A 2BQPA 3LDRA 3CD6V 4WVMA 2FZ2A 1Z0HA 2EIMB 3I2IA 1X33A 4Q4X3 3ZMTA 5DXDA 4AI0A 1D4M2 1VIBA 3M99B 3PN1A 1FAFA 1OKQA 3J81N 2QWRB 3D3AA 1QJY1 5AFBA 4YVWB 5HV4A 4AEKA 2YZ4A 2IXIA 1KFUL 4O9GA 4B4QA 5CADA 2G19A 3ZSJA 1XNQO 1I94O 1WBFA 3GJAA 3I2GA 4HNAB 2GP5A 2UUBB 1C28A 1GSLA 2W0FC 1XE0A 3ILRA 2EF6A 1CAWB 1UAIA 1GNHA 5BNOC 3HQUA 5A3UA 3DTUB 3EMRA 4LFAB 4FFGA 5BMVA 3CCQV 3W58A 4UAPA 5EC1C 3ABZA 1Y9GA 4CDUB 1CZVA 3WG7C 2BNNA 4YWAA 4CYDA 3ZXLA 3OGRA 4IGPA 3E6CC 4YFZA 1BVP1 1SF9A 3JD0A 3QTCA 4JI4O 5FP3A 1Y74A 5CBFA 2YIBD 1GAXA 4O4HB 2Y8KA 1MS5A 3DEMA 1LU2A 1Y66A 2QM8A 4TQDA 1UYPA 1LEDA 2H6BA 3EVKA 3ETEA 4M01A 4B3SB 3I54A 2AEYA 4HOOA 3PUQA 2P90A 1BXHA 1K8AW 1UIJA 4YNIA 2Q69A 2R9AA 4W50A 3RZJA 4LHLA 1AR73 2Q8VA 1ENQA 3FAVA 5GALA 4MGKE 3G71V 1VP7A 4L8JA 1HB4A 3TETA 1KQRA 1AR1B 4BMEA 1GLHA 5F3CA 2X7RB 5C33A 2D40A 3RGBA 2YB7A 4Q0UA 1A8MA 1QF3A 3A2FA 5LK7B 1FYJA 1VAKA 4P9LA 2LJ2A 2C1FA 4XUTA 1AJNA 4UW6A 1R1BA 4CUGA 1N32B 5D21A 3GBFA 3DGEA 3ZFGC 4I0WB 2LW7A 4ASMB 1EN6A 1QLEC 1RXFA 4E4DX 3F5TA 1NR1A 2P22C 4DQAA 1R081 5EZYB 4YHHO 1DLBA 2CTWA 5A80A 1S72V 4HZ3A 1XYOA 1AROP 1C1FA 5DPNA 5ITZB 4FPEA 4RHV2 3BY6A 5CYYA 4MVSA 4Z2AA 2JVDA 3OY8A 3ZVXA 1PMHX 5A3WA 4I02A 1K12A 1RUJ1 1VRH3 4UVAA 4P14A 1VQNV 1S3JA 2YC0A 3A22A 3GCXA 1F5FA 1JU3A 4DEVA 2WAAA 4DUXA 5FWJA 2B5UA 2QKSA 3TNPB 1F31A 4UW3A 1COV2 4TSFG 2V4AA 4AGVA 3OW2U 3AJYA 4L87A 4GKXA 2QCSB 1OVSA 3SC7X 3RZKA 5C3RA 5CVRA 3H3UA 2Q7GA 3T3YA 1B35A 1EYBA 4JI2O 4D69A 2RE9A 1PGW2 1SHWB 4YARA 3HKCA 2QZ3A 1T6GC 2EIKC 4WM7A 2Y0OA 1NKDA 2DVDA 4CDQA 1HNWO 3SJQC 3P32A 5HFMA 4LBJA 4RGKA 3ZKYA 1YZBA 1XNRB 2F23A 1AX1A 4A7YA 1PZ7A 1QR9A 4O4LB 1FX5A 2QWPB 3LAGA 2ZMKA 2VZRA 4I9QA 4XIOA 3T1HO 3W5MA 1FPN3 5A6QA 2Z79A 3LEIA 2XJPA 2WR9A 2K1EA 4TUYB 1PZ9A 2D3PA 3BB6A 1JZ3A 1UYXA 1K42A 4DXWA 3J8F3 4JI7B 2VMGA 2ZXQA 1B35C 5F3EA 4FQZA 4DOUA 3L70H 3OD0A 1QQCA 2A6XA 1QQP2 3VDCA 4G27B 5C4WA 1JYNA 3CCJV 4J7JA 5L36A 2EIDA 1FPN1 1GOHA 1YVWA 1ZBA1 2WA3A 3S3WA 1HNZB 2AZ2A 4YVSB 4ZU7A 2IXJA 1I94B 3CC2V 4FT8A 4CEYB 4KBBA 4W6WA 5A6XA 2FMYA 5K9YA 3OUSA 4YG0A 2RJLA 4Y1VA 2D3OW 1V54B 4EWEA 3T2PA 1YJKA 1DZRA 4WFBV 4QX1A 3ECQA 3RSJA 1WCSA 1BZKA 4XTMA 2XLGA 1T6BX 4X1KB 5BPXA 3HNYM 3G67A 1BBT2 1P84F 1V55C 3MDPA 3VZMA 2EILB 4NO4A 3IPVA 2YBSA 1V9U2 3NJYA 1PGL2 4FFBB 2A75A 4LK6A 4DR5O 1UZWA 3ZM8A 3KGLA 5EYPB 2MEV1 2WLHA 4OHYA 1VBC1 3M3EA 5J36A 5APAA 5HXMA 3RDIA 2W6JG 1SLTA 2JG9B 4NTWA 4TQFA 2ZBJA 2XG3A 3ZXFA 4CP9A 3MDSA 2AC1A 3RS6A 5A7QA 1YJLA 2CU5A 4I7ZB 5FY9A 1MVEA 1OA3A 2R063 2Z4FA 1W8TA 4N43B 3OYWB 3MIGA 3DXTA 2XJQA 1YJ9V 4AI3A 4WBNA 3ASNB 1RUC1 1TG7A 3KF5A 5FPUA 4IW3A 1IBLO 2V73A 3ZPOA 1H0BA 4DUZB 1R083 2HWB1 4FFBA 2JEUA 2GMMA 5KXBA 1KYOF 4UV8A 4IETA 1R3KC 3O1OA 2PQQA 2QQPA 2VTXA 3JU9A 1DU3D 2KQXA 5FDBA 4WFFA 3LFMA 4RGGA 1DP0A 3OJBA 1BMV1 3BA8A 5A2QN 4F6EA 5LYJA 1YIJV 2YFZA 1GM9A 1KU9A 4Y1ZA 3TN91 1JOJA 1WAZA 1KD1W 4Y24A 2PHLA 4DR1O 2K9PA 2ATFA 2RR12 1FOD3 1W8ZA 1ROPA 1W6OB 3ABLB 2FDKA 1JX9A 3DYMA 3B69A 2UURA 1R6NA 3TK1A 4QT6A 4OI1A 3KZ4C 4Q27A 2YHJA 2QWNB 1S5HC 3RG0A 1JUIA 2VQEO 3SYQA 4QPGA 4AVTA 5C3PA 1IHMA 1L3JA 4BYYA 1X7NA 1X59A 2XNDG 5ANQA 1DQ0A 3E5UA 2GTAA 1FATA 1NQDA 4JYBA 5LBBA 2C0ZA 3VBBA 2XONA 1RUI1 2QEXV 3H7YA 2ZX1A 4A7ZA 2Y60A 3VZNA 1AYN2 1LNSA 3KCXA 2DFBA 3D36A 1J5EO 2QE3A 1PX4A 1FXVA 3RYFA 1PZ8A 2GH2A 4CXWA 3N4MA 1J58A 5FBZA 4E2SA 1NCQA 4IV3C 4CU6A 4YZ1A 1QGLA 1W6MA 2AZ5A 2J1TA 3C2UA 4LQRA 2YXSA 3U37A 1DQ1A 2JDKA 3ZRXA 1DLCA 4NKGB 2RMU3 1BEV2 1MOFA 4R9AA 1RUNA 4QPJA 5IVYA 5FZKA 2PLV1 1RPRA 1QJEA 1Q3EA 4TSVA 4NIGA 4AEMA 1QIQA 3LDCA 1HP8A 4NWWA 3U75A 4CCKA 2QKAA 1PX3A 1G9DA 3C3TA 3J26N 5JXJA 4DUWA 1N4CA 5FXVA 3NR7A 4B3RB 5C4WB 1JZ8A 2W1UA 3HVDA 2IXKA 4JC1A 2Y64A 1GP5A 4QGMA 4I0XB 4S2GA 1NY72 2ZCEA 1Y6XA 4FFFA 4FLUA 5J48A 3DUIA 1ASJ1 4WBBA 4AHXA 4QXKA 3OAAG 5E6HA 1YQ5A 1DF5A 2CWSA 5EBMC 1PD3A 4XEZA 1GH6A 4F4LA 5L7OA 5EBLC 1LR5A 2Q8OA 5H9QA 1X8EA 4O7XA 4QPGB 2EXIA 2JJ6A 2P37A 3NAPA 2WFPA 1H1AA 4CPBD 4K40A 4RAIA 4C0HA 1W6NA 5F1RA 4PJYA 1EM1A 3LDBA 2OT5A 3CX5F 2ZGPA 3AJZA 4ZHQB 2DQ0A 3TCUA 2BVBA 2A0LA 2Q9LA 4LA3A 1R3IC 3H01A 4LOTA 3KLSA 4IGOA 2PI4A 2JRIA 5JMOA 3PVNA 2ZEXA 3AK1A 1QOTA 2FDHA 2QGNA 1I7FA 4Q4W1 1O7FA 1YFWA 2Y26A 3W7TA 2IJJA 4KHPO 1EN4A 1F5JA 1PNGA 2GN3A 2XVKA 2VMIA 3WDWA 3CHXA 1ZZBA 5EIYB 1AI4A 3LE0A 1JBCA 1DF0A 3G7DA 3F7YC 5I0RA 2GNBA 1Q81W 3KWVA 2JX9A 3WP4A 1G9CA 4PQ9A 3OGCC 5F32A 1SLCA 3VD7A 1HRI3 5H5NA 5C93A 2VTXJ 1WPBA 5GONA 4UT5A 4MH0E 1VQ9V 1UQXA 1HR0B 2IM9A 4LUKA 2DCTA 2ZE8A 3CL1A 5BZBA 4B08A 3ENRA 1ULEA 4J9YB 1BKZA 3QO5A 1VQ7V 1CQ9A 4FQ4A 3USUA 4Q4Y1 4CH4A 1FXZA 1AZDA 5GTHZ 2JD4A 4AEDB 4CU7A 1EUTA 2Q4PA 1VBD2 4HLTA 4C8DA 4L11A 5HV0A 1RUI3 2VQEB 5A1LA 1MS4A 4XAEA 5CB7A 3H1JH 3CO2A 1H6XA 4DR7O 4HBNA 1O4ZA 3SISA 3VBRC 3ZXAC 3JBG2 3JYCA 2OTJV 4BB3A 3JASB 2AZ0A 4MOAA 1SA0A 3MIFA 5B1AC 1KP3A 1R64A 4F6RB 2UUBO 1KJLA 4IYIA 1DZQA 1UX6A 4OHWA 2XAHA 2XGXA 5FZ3A 3AC0A 1YFXA 5TSWA 1M57B 1V6KA 4I55B 2BCCH 2PAEA 1FOD1 1UY3A 2WNVA 3NKTA 2ZACA 1XNRO 4AAPA 3O1UA 3HB3B 1DIWA 3ZMUA 3FBYA 5FV3A 4NIAA 4QDSA 3WW4A 3HR9A 4UXAA 3JARB 2W9XA 3NNGA 3ZN0A 1E79G 3QNEA 5JOYA 3N2GB 3FJSA 2C26A 3BA9A 4B3MB 1AXZA 4AR2A 3ZFFC 2DYRC 3OGJA 1LGBA 3M8AA 1IQAA 3WB2A 5DUVA 4WFGA 2JS5A 2E7QA 1VMFA 2EJ7A 1ZBA2 2DQ3A 1OPMA 1SERA 5FUPA 5FO8B 2KM2A 3WNKA 1NQTA 5JSOA 4CDQB 1BBT1 1OOPA 3ZHVA 4IE7A 2R061 2WBKA 2HG5C 1PMJX 2WNVB 3JXSA 2VOKA 2Y69C 4ZI7B 1BYHA 5BY1A 2BWAA 5KXCA 3ASOC 4CTEA 3J7NA 3ABKB 1H8TC 4DRXB 3K9AA 3IN9A 3MUY1 1ZWIC 1RINA 2RMU2 1EFRG 1HJGA 1UF2C 2VOVA 2WLIB 2YIBA 2Y6JA 5LWBA 3EO6A 1Q8VA 2VMFA 1GBGA 3WCSA 1NTKH 4O4HA 5HCBA 1S2KA 1M56B 4X89A 3K08A 1RUI2 2V4VA 4NXNO 1NJIW 2HLDG 3ABLC 3E86A 4Q4V2 4NIHA 3TEZA 1FFXA 4O4LA 4ZHNA 1XE7A 1PO23 2JJ2G 1D0HA 3K59A 1GNZA 4GX1A 4XJ9A 2OW4A 3TRSB 2HWF1 5FQ0A 1MVQA 3NL1A 3CCVV 4L92A 5FZBA 5K4LA 2P3KA 1H8EG 1OCZB 1FNZA 1DQ2A 1XNBA 2GUZA 3OR6C 1V54C 3I2KA 4NHMA 4PLOA 1UOGA 2IH1C 4I3PA 5H9SA 1IG0A 4J25A 5FYZA 5FMCA 4FFKA 1ZBE3 2H0VA 3PIJA 2WLKA 1GYKA 5I93A 1QXPA 4UW4A 5FZOB 3RQ0A 4LE3A 1LODA 5LL6Y 1D4M3 3N7LA 4DR6O 5IE9A 1K34A 2VVFA 5FJHA 5KHKA 1SBDA 4GMP0 1GWLA 4A41A 2O57A 3CZUA 1NZ6A 1UY4A 4TT3G 4LF7O 3WNLA 3RZLA 3KF3A 3PNAA 1JZ7A 4NOTA 5BNPC 2QUOA 1OSGA 2XXZA 1EAH3 5IVCA 1ZA4A 2HKXA 5GLUA 2E53A 4X1IA 2VGDA 4PA3A 3HKBA 2OPWA 3APQA 4PIZA 4HG6B 1TNFA 2CDYA 1EV13 3BEHA 3FHAA 1CP9A 5FZEA 1RJ7A 5DZEA 3W59A 1NCRA 1N47A 1L7RA 2D7FA 4PF1A 1MQTC 3JALB 3R4SA 3A0KA 1UXXX 2BE3A 4PV1B 2DDUA 4CS3A 2WWSA 4H3WA 2JG9A 2MK3A 5AC91 1AR4A 3VL8A 1HNXO 3I3MA 2RR13 2YS8A 4OMCA 1GTOA 4HN1A 1JU4A 4ZKIA 5FY4A 1LJ7A 4AFCA 1BBT3 3VDDC 4DV7O 3IMMA 3ZYBA 2AREA 3CJHB 3IFXA 1HRV2 2DJVA 2P4EA 1LHVA 3H8XA 4LHSA 3A0NA 3K2OA 1BCXA 3WNXA 4CEWB 5JH7B 4AQSA 1NZIA 2UXNA 4B1MA 4JYYA 1XC6A 1B6QA 3ACFA 5T3NA 2VY0A 1LR1A 5A33B 3INAA 3T2TA 3E8BA 3GZUC 4HL0A 1OHFA 1WW5A 1ST8A 1URXA 2XHBA 3BFRA 1L1FA 5FPLA 1QCEA 2CYFA 4JYAB 4NROA 3PUHA 3MIBA 4R9DA 4MX3A 3DKWA 2HWC3 1GRJA 3LEKA 1ZX3A 2R6QA 4GKJO 2VBPA 3QOPA 5KMGB 1XOYA 3VBSA 2V5DA 2PAKA 3DF0A 1AP5A 4LFBO 3P5BA 5HI0A 3MUZ1 1WNSA 2E75B 3KD4A 2WLLA 1DLLA 1UOBA 2P3YA 4RHV3 2IJIA 4JI5B 2B8MA 1U96A 1VQKV 1EV12 3R05A 3KVAA 4ISRA 1WCQA 3H9VA 3RYKA 5G04L 4EEQA 5BXXA 2M7WA 4OUSA 4K3UA 4Q4V1 5L3BA 1BHGA 3DN7A 4LA2A 4XZPA 4JHZA 1ZZ7A 4QKFA 2WLIA 1W3XA 2NR5A 4CCCA 1W2AX 1XSRA 3J80N 4B3TB 4XDQA 2EIJB 3GCWA 4DV6O 1W0JG 1UW8A 4GD4A 3T1CA 1NR7A 2YV8A 4CDWB 5EC2C 4AHZA 3HN3A 1QY4A 1GU3A 4IL6Z 5JQGA 2YUEA 4DW0A 2QNKA 4IV1C 4B3TO 4KXRA 3POSA 4I50A 3NQHA 4ASLA 2QZ2A 3CKHA 4COUA 1K5JA 2J1SA 2YROA 5LMUO 2B46X 1X9PA 3V56A 4K35A 4NXNB 5IFTA 3V0AA 3I2OA 5BR8B 5KX5B 3OF1A 1VQ5V 4OI4A 1JYCA 1TME1 4ISQA 3DPRA 3POEA 1AR62 4CP9B 2ZGRA 1DTOA 1XUQA 2WLMA 5E89A 3I2JA 3AFKA 1G7YA 2ZMLA 4Q1RA 2BTQB 1BHAA 3MF9A 3DC6A 3V0BA 2HWF3 1JXNA 2JICA 2NP0A 1UD1A 1VF6A 2L35A 2YI8A 4UCRA 3B9IA 4D7SA 5ABJC 4WM7B 2CAUA 3ZIWA 5L9BA 2WQZC 1B3QA 3ZHSA 2VCAA 4W8JA 1RVF1 5C8YB 4BWAA 2EINC 2NN8A 3HKEA 2FYUH 2GSMB 1LCLA 5EIBD 4DIQA 4ZS3A 3ZFEA 4Q4X1 1SQPH 5EV7A 3HN1A 1OJHA 1EV11 2OQ6A 4AQTA 1QNYA 4GYCB 1RJ8A 2JB4A 1H2LA 4LF9B 3K3OA 5B1BC 1AR93 4FPOB 2UWBA 2CUGA 1IS6A 1E5RA 1REDA 1IBMB 4RN5A 4INDA 4FK5C 3OBAA 5GJ6A 2RDSA 2FTKA 5FNVA 3EFFK 1MZEA 2IFRA 1SDWA 1JZ2A 5LATA 1LHWA 4E4SA 4KMQA 4D6SA 4UW5A 3UL2A 1W0OA 1LU1A 3HT1A 2UXDO 2YYOA 1QOOA 3QLQA 2VG9A 1TGOA 2OS2A 3EYPA 2CK3G 2OYZA 2PELA 3AXDA 3E8HA 1RUC2 5JR7B 3MAQA 3QO7A 4E27A 2HWE2 2GZWA 4PBOA 1UO9A 4EWAA 2OZ6A 5LK5A 2VZSA 4FO9A 4Y20A 3T1MA 3VHRA 2ZAAA 5ACA1 1D4M1 5FP9A 2Y34A 1JH5A 1AYN3 2F4VB 2IXCA 3V64A 4IE4A 1IZ3A 1JYTA 3RYPA 2AYHA 1LOFA 1Z2GA 3JB8A 2ZS6B 2XQRA 1YO8A 2R32A 2H8PC 4X65O 1PHMA 4LO6B 2BPA2 3B7MA 3A0HZ 2PYJA 3Q4HA 4F6RA 2UXCO 4I2OA 4CZZA 5IK5A 4OCTA 3WF0A 2FMLA 1C1LA 1D5AA 1EPZA 4IL7A 3ZDVA 5KC6A 1ASJ2 1YUDA 2DYRB 1PM9A 4GIQA 4KP4A 1RYYA 5JZGB 1PO21 3NSTA 4YFWA 1SBEA 4XQDA 1D4VB 1H2NA 2WL1A 1AR5A 4GCZA 1RUG2 3TXQA 4FOQA 2XHNA 2XBO2 4Q4Y3 1I1EA 3FWEA 1M5IA 3B3QE 4LLOA 3BYWA 2HEWF 3W7WA 1H2GA 5IAVA 4A3ZA 1XOUA 1H1IA 5FY7A 4I0AA 4PJ0Z 3S5AA 2D6KA 1MQTB 4AVVA 4MVRA 3CU7A 3Q9OA 4YZ5A 3T1HB 1XBLA 1J3QA 4N7IA 2G9FA 3WDUA 3VL9A 2ZXWB 2QQVA 5AC92 3OB8A 4TUYA 1R6KA 4HK8A 4V2VA 1Q82W 3H3ZA 5FPRA 4IDZA 1J95A 4DV3O 1BLZA 3AKQA 3DGTA 5JI7A 3UT5B 1LOEA 4MS2A 5T5JA 1AL22 1CD3G 2W92A 4QAWA 4BQ1A 4ZOLA 2PF4E 2ZTNA 1W06A 4AVBA 1GWMA 1WA4A 2BSKA 3AL6A 3BPZA 1LUVA 1F4HA 1XRUA 3C7OA 1WLTA 3THPA 3I4IA 3B8MA 2AXTZ 1DF4A 2BNMA 4N7UA 5LOVA 1L7LA 5D2AA 1VBA3 4JKMA 3UJOA 1P4RA 4JDOA 3TAYA 1XJAA 1JYIA 4I4TB 4M3CE 2P3IA 5CIRA 5IVVA 3RYIB 5JPNB 3UT0A 3O1VA 1SG3A 1AYM2 3WD5A 3PU8A 4LF4O 3PL0A 1RSOB 1G6UA 5GZFA 4CBCA 1WMXA 5EWSA 4R7CA 2IZWA 1HQNA 3JBG1 5FQ0B 4O2AB 1CN1A 5DDJ1 5FO9B 3RVHA 4LTAA 5I0SA 1V70A 3EQEA 4DR5B 1DYPA 1YYNA 2VW1A 1S0EA 1S4CA 1YQ6A 4NTYA 3JUUA 1SETA 4YLZA 4CUBA 1I5ZA 2YPDA 4DFSA 2PYLA 4WV8A 3SLIA 3AM2A 3V65A 2OPKA 4MZUA 2N05A 3QO8A 4A44A 2OX0A 2DU1A 3B02A 4N43C 3FB8C 4PDMA 1FKAO 4D3WA 4QXBA 1R6TA 4CDUA 1DGSA 1R3JC 3HKEB 1GP4A 4JX0A 4J80A 2WO3A 1DBNA 1OUXA 2E76B 3AG1C 1LULA 3HKDA 4N53C 5EHDA 2BERA 1OCCB 5FMDA 4EYUA 1LEMA 4XQ4A 4DR2B 1N32O 2XTAA 4NRQA 1E1QG 4YVWC 3QF7A 3ME2A 1PGW1 2ZQMA 3N9MA 3JAMN 3AMQA 4R4ZA 3AG4C 1H9WA 3SHRA 4X6QB 2Y6HA 5L7OC 5E1RA 4W4ZA 1VRH2 2C4XA 2EIJC 4JZ2A 2LALA 1IPKA 2RS33 2RG4A 1DGLA 1CZSA 5DDJ2 3LPGA 4MW8A 1O8SA 4M3CB 1L0NH 3OOXA 1XHXA 4QPIB 5BV6A 1YIFA 2UWAA 4IV1B 4CDUC 2O1QA 3EHBB 3K9SA 4IE5A 4J9ZB 1ZL8B 3D4KA 4HPKB 2XKPA 3WNNA 2R9RB 3IMNA 1WBLA 2GN7A 5H9RA 3THCA 5JCTA 5LY1A 2OA2A 1VE0A 4HVOA 1KBHA 3NNFA 2WZR1 2MHFA 5FP4A 1JZ5A 1W8OA 1ZBE1 4LBKA 5BNPA 5DABA 2CAZC 4LHNA 2EAAA 1BK0A 2GC0A 3WW3A 4PLMA 2ILMA 3FHIB 4A5UB 3H7JA 5ANNA 3WT3A 1TMF2 1GO3F 4CCJA 4HK9A 5LA0A 3AMMA 4DINB 1A6CA 1Q86W 4IIJB 1O3RA 2QWOB 3X2QC 3BVOA 4XYXA 5CBLA 3NRUA 3RRDA 1NCQC 4IV3A 2WQ4A 4COYA 5J3UA 3USUB 2X6BA 3UCSC 4YVSA 4I09A 1D2DA 3I49A 1WP7A 1IBKB 1DFQA 4R9BA 1SCSA 1Q8IA 1RMU3 1YFYA 4GWJA 3ZS8C 3AK0A 4LF8B 3K06A 1DYKA 2CY6A 4DY5A 1DCSA 2UXBO 4XF4A 1SS3A 3DKQA 4IEYA 2WYSA 3KQRA 4ZXEA 1A3KA 2A3XA 4ZXKA 1W8FA 4Q6GA 4WZFA 4CVUA 3T08A 1RUE1 3VDDA 5JJNB 1N1TA 3PUIA 5JMCA 4K20A 5IJ9B 3IDAA 3MFAA 3VDBA 1OLRA 4AVAA 3MPPG 1CX4A 1DGWA 4S2FA 1NA1A 1RUC3 3IBMA 5F3GA 3RWRD 4DRVA 4OPHA 4PI0A 5CAZA 2R70A 1SFYA 3BHPA 1RUE3 1RUF1 1AYM1 3J9SA 2L6LA 3DC5A 3FKSG 3S5QA 3CCSV 1PIV1 1H8TA 3GHMA 1SLAA 2NLJC 3A8TA 2V1DA 4R52A 1AL21 4LLFA 4Z1VA 4UOJA 2YG0A 3RFRA 1IURA 1PO13 4EROA 3PHMA 2BWCA 3UKTA 4LFCB 2XAGA 3R0RA 1OLME 4AI8A 5H6RA 2UWCA 2ZJCA 4PT6A 3CC7V 3FYIB 1VBC2 1SQFA 2CGPA 1BQPA 1RUH3 3A23A 2G38A 4HKOA 3JD3A 1OMIA 1BJQA 2WWWA 4PELA 4LUMA 1JQ0A 2K46A 4X62O 3VBRB 5IVEA 3MBWA 2WPDG 3SCGA 1QEXA 2ET7A 3N7KA 5J1XA 1SA0B 1YI9A 4FOYA 1C5HA 3KSCA 4BIUA 4QPWA 4NXMB 5F5AA 5GLWA 5B1OA 2BJSA 3LGRA 4IESA 1GUIA 3UETA 1RHI1 1TVGA 4XDJA 2BUKA 4P30A 3AYDA 4XXAA 3WUCA 3PMEA 4YZ2A 1YQ8A 4M4PA 2BGCA 3HKBB 5J98B 4MHRA 1DYOA 2QVSB 2EIMC 4YW7A 4JTAB 4RQPC 4U36A 2DVGA 2LS6A 1R73A 3H1WA 5A7NA 2LM3A 3ZIAG 2N7GA 2B9ZA 1XNCA 1WLEA 4JYAO 1UJWB 3UKMA 3ETPA 2PMWB 4UFHA 3BTXA 1W04A 2WNUC 3LZZA 3VBRA 4Y33A 4EV0A 2ZOEB 5JUVA 2UUAO 2EULA 1J84A 5AVPA 4JV5O 4OFGA 4NXMO 1ZRCA 4BIZA 3WG4A 3AZYA 1HX6A 1RUJ2 1KXGA 1VR3A 5J2TA 2J1VA 4X6RB 2P5OA 1S2EA 1U97A 4ZONA 2ADPA 2ZEYA 1NG0A 5LMUB 3C7HA 4BU2A 5FYUA 4LO8A 5GW7A 2JGDA 1NH2D 2O0OA 2QTSA 4DUYB 2HWD3 1OOPB 3H9AA 4LIUA 3VHPA 2NYYA 2BOBC 1YRZA 3K4DA 1Y4MA 4DV6B 5DG2A 3MIEA 3AP6A 2F4VO 1QQP1 3NJVA 4JPRA 4NPRA 3CCLV 1L0LH 2HWF2 2W2IA 3CRQA 1GMGA 5JVDB 1HKDA 3O14A 1DQ6A 5DAVA 2P4KA 1RM1C 3NVCA 3GYDA 1IXMA 5JIAA 2E6VA 1CEZA 4QU1A 1UZVA 5LA6B 1PVC1 5FY8A 1F4MA 3ETGA 4IIJA 1I3HA 3J7AU 2DTWA 5FK8A 5FZ8A 1GMMA 1WCDJ 4C1WA 3MW2A 3AYEA 1DG6A 4UBGA 4D8MA 2XKOA 1K5MC 2DUPA 1OXCA 4OLLA 3MHZA 1N34B 1PM7A 1NYWA 2DWDC 2DCJA 1VF7A 3CZJA 3ABUA 4MTFA 1O9HA 2QJVA 2HEPA 4CDQC 1BT8A 4Q0VA 4BR6A 4YY3B 3QVNA 1OCCC 5JXGA 4LKEA 1NOVA 4LF9O 1JYWA 1WD3A 1TVKA 3SCFA 2HJIA 1RTVA 2TEPA 2DVAA 5DN2A 1Q6HA 2O8QA 2XAJA 4XBNA 1YITV 3OPTA 2WSUA 1YCIA 3K57A 2CV6A 4U2AA 1ZRRA 3NNLA 1Z5WA 1IDSA 2FB5A 3J7LA 2VMCA 1QKQA 1BZWA 3VZOA 4H37A 3PIGA 4URTA 4QE9A 1V9U3 2ZHKA 4LKSA 2VUAA 4XJAA 2PAMA 1X9TA 1BMV2 5CEHA 5J2UA 5IJ0A 3SQOA 2A6YA 2P6JA 5T50A 4ABMA 4XDKA 1FMD2 4WFEA 3I59A 2Y4TA 1W3VA 1YLLA 1I5PA 4XCAA 5CMUA 1RMU1 1N3OA 1U5IA 3VV1A 2YXHA 2A73B 5CFCA 2VTFA 3S30A 5FOBB 4IEWA 2B39A 4J10A 4RYDA 5KWRA 2R042 1VBB2 3ELNA 2ZGOA 1S0JA 2JIZG 1HRV1 2LP7A 2ITCC 2DUOA 3S57A 1TUBB 3STZC 2VVEA 4LFAO 2DCYA 2W1SA 4KFMA 3RYHB 3KZIZ 1DZTA 2BTVC 4COZA 5FKBA 3N9NA 3CCMV 2HBTA 2AEZA 2BFUL 3I59B 3CCUV 4L99A 2XBO3 4Q4Y2 2C9KA 3IM0A 1R1A1 4I9WA 5T5PA 3S7IA 1V55B 3D36C 4CA9A 2V09A 2AGAA 5FZOA 3ACGA 1AJKA 4FVVA 4K1ZA 5DN6G 3CNAA 1M4UA 2RS13 3I3DA 4ATEA 5LHHA 4LF5O 3RW0A 2WABA 3MPBA 1RUG1 3RBZA 4NHXA 2DBIA 3THOA 4Z1MG 4LOSA 5F6LB 3RZHA 1ND3A 1W39A 1CGPA 1TUBA 4CCLA 3JQXA 1TQ5A 1PO22 2JE9A 3MFCA 3GALA 4P9GA 1N1VA 1UPGA 1UKGA 1S76D 5FP7A 3I3BA 5IATA 4AFAA 2JGDB 5GM0A 4GWNA 3KKYA 2J1RA 3PTRB 5C3SA 2WT1A 1O91A 5K0UA 3RPQA 1BEV1 4O4JB 2IW5A 2MNGA 1QHDA 2VZQA 1XU1A 3QD6A 3OPWA 2QWQB 1OCRC 4MVOA 1UY0A 2WO2A 1KKDA 5LGTA 3UO3A 3ASIA 1CPNA 1QLNA 5A6YA 5IJRA 1J1TA 2D98A 2V7QG 3E5QA 4E2LA 4ZU4A 4DR3O 2WLLB 3BODA 2RJKA 3V0BB 4HMZA 1KS5A 3JAKB 4KNCA 1GZ9A 1SRYA 2PHFA 1REEA 3J7MA 4IGQA 4KL1A 2VJXA 4H55A 3BI3A 1A78A 1ZRDA 1NLRA 4YSFA 1POV3 4OX9B 5CBHA 2WINB 3ZCCA 4DV4O 1PL4A 4RS5B 1MEC2 3JB4C 3D5OA 3AP5A 5KXDA 3FLTA 3O0VA 4B4RA 4GMP3 4K8ZA 1QQP3 2LRPA 4MYEA 5FPXA 3ITQA 5I0UA 3S0MA 1IS5A 2J7MA 4EFBA 5A1AA 1A8DA 1W2BU 1VQMV 3FFQA 4GUNA 2Q8CA 4E4HA 1Y9MA 2R041 2HWD1 2LUWA 4XVHA 4W4KA 1AR92 1FXKB 3UGGA 1NCQB 3VUOA 3MW4A 2RJZA 2VZOA 2UYAA 3L2YA 5L19A 1P7BA 4XFIA 1Z7S1 4NPMA 2C5DA 4JTOA 3SNMA 3FX7A 4HKLA 4ZZ5A 1HV1A 3A21A 5CBGA 3KHCA 3E6BA 2R9IA 2XAQA 1N36B 3WHTA 4L8QA 2F4LA 1RUOA 3SKJE 1JZ6A 1QR8A 3WDYA 4UCVA 1HB2A 1M9NA 2G9ZA 1I0HA 3L74H 4B3SO 4DZGA 4NHLA 1BCCH 2ZGSA 4FVMA 1REFA 2VWKA 1VJ2A 4X64O 3TJTA 1CPYA 2D5HA 2EINB 3ALQA 3CEWA 5LBFA 4TV8A 1X82A 1GV9A 1MS1A 3NV3A 3OR7C 1BMFG 4U7NA 4N53B 3HQXA 2PYTA 3AYCA 2ERFA 1OOPC 5D8AC 1PGSA 1NLSA 3LSDA 1IXBA 3H1MA 1F9KA 4C7UA 1AJPA 3BU7A 2CH7B 2Q5TA 3VBFA 3OSDA 5GZDA 4YW6A 3BVCA 1WZXA 3ZYFA 4NR1A 5FL7G 3DYOA 4DNYA 2WWUA 4OQ8A 3QH6A 1V9PA 3FB7C 4QPIA 2ZZJA 1YNAA 1TEIA 4ZY9A 1KUQA 3UJQA 4CC5A 1RUH2 5CZKA 2W68A 5FO7B 4UFMA 4BHPA 3S6PA 4LULA 1AYN1 3CIHA 3BOPA 2EXJA 4OUEA 4K8FA 4B8EA 4IEQA 2E9QA 4FPGA 4XCBA 5ABJB 4WM7C 4QWNA 2YIAA 1UIKA 3UT5A 3SYAA 3LEGA 4ARXA 1UL9A 3ES1A 4HETA 2PI5A 3WFVA 2NZ9A 2JEMA 3DXRB 1H8HG 2PFWA 1OFNA 4XJUA 3ZXEA 4U7OA 1JPXA 5EYXA 3CB2A 3R4DB 2FDJA 3AZXA 4JV4A 1EN5A 2FD8A 4N21A 1FFTB 2NQYA 4FPPA 4UF0A 5IVJA 3F7VC 3D0SA 3I7DA 5BMVB 3MLJA 3LNMB 2J42A 2LFSA 2VZ3A 1OCOB 2DYCA 2Q7EA 4XIKA 3RYFB 2VZPA 4MTXA 1PKXA 2OQ7A 2DYSB 2MW2B 4D6RA 2UUCB 2WC2A 2GSYA 3CXHF 5C4WC 4QDRA 2X0LA 1R092 3RJ2X 1CJDA 3RI8A 1NT2B 4FOWA 4I4TA 3S7EA 2BGPA 4M0HA 3NV4A 2A6WA 3MHHC 1VBB1 2UYBA 3VKLA 4XZUG 2JJ1G 1V6LA 1YHQV 5IDJA 1ENSA 4AI2A 1HQWA 1CPMA 2A79B 2VC9A 5DUUA 1AR71 2P34A 2QQUA 1WB7A 5FY0A 1K9MW 1FMD1 3ZFGA 3WVJA 1SCRA 2VXRA 4MT8A 5JI9A 3FAVB 1J5EB 1D5NA 1W6NB 2VZTA 2N04A 5E16A 3WQ7A 2WT0A 4BXSV 2VW2A 3POYA 2VOTA 1RC6A 1Q7YW 4GLXA 3Q8AA 1UU5A 2NMNA 2VH9A 1RUD2 3JSNA 2VCBA 1PPJH 4D94A 2P3JA 3RN4A 4UFJA 3CPWU 3AVSA 1SQQH 2JDIG 4JI6O 1SLLA 4UCOA 3P6BA 3PJQA 2R0HA 2EJRA 4JGSA 4X20B 3NAPC 1Y9QA 4AHYA 3NKGA 3B9CA 2PUSA 1EBOA 2WQ8A 2RS31 1F2NA 5FZIA 2GNTA 1LHUA 3M3CA 4DR2O 2O8OA 1GN3A 4XQWA 2K0GA 3UK9A 2OIEA 5HPOA 2YU2A 2XJSA 4M4RA 3SH3A 3T4VA 2VMEA 3W7XA 3ZBHA 1GN4A 2W0XA 3K4ZA 2W87A 4EQVA 1O4YA 1LUWA 3CJHA 3K58A 2HLEA 2Q6AA 4XUPA 5FZHA 3ZHUA 1GZTA 3NNJA 1UOFA 2XOKG 3A0RA 2CTRA 3RMYA 1JI6A 4M00A 5FXWA 5A3TA 4PCRA 1S2BA 5IYDO 4JI0O 4K8XA 1CONA 1MMMA 4FJCC 3OMNB 3TNQA 4GB31 1CIYA 1GOFA 2Y4UA 4AI1A 3NNMA 3O5SA 4HONA 4HVQA 4J7KA 2BTQA 2PGGA 1W9WA 3E1F1 4JI1O 4X88A 2VCMA 1DK1A 4OGQB 1JA8A 3K5LA 2BDRA 2P5BA 1PL0A 2CH7A 3VBFB 4DMIA 2IBZH 3N9PA 2XOMA 3WY6A 3VBHA 3LOIA 1EZJA 5LY2A 2DOSA 2OCHA 4DR4O 1NH2B 3WX5A 1QJFA 4F3JA 2ZA9A 5A3NA 5C6CA 1XQ8A 4FLYA 3VHOA 2D93A 2R30A 5JCOA 4GXLA 4MADA 1NAEA 3JCZA 2RS11 4GJYA 1M57C 1M90W 2G1MA 4BQ4A 1O8PA 2QQIA 4XTPA 3SJAC 4M3CA 5GLVA 2CSGA 2HHHB 5F6KA 4AQ2A 4R8CA 2M6YA 3CCRV 1R1A3 4UB8Z 2Q4SA 4AZZA 4BXFA 1W0NA 1QJU1 5HBAA 4U3JB 1NE4A 4CDXA 1UU4A 3ZFFB 1V6MA 4QB6A 4URAA 4LBQD 2ZEWA 1O3SA 2D6OX 4LNVA 2WZPP 3TYJA 1GM8A 4FCAA 2WIIB 2JB8A 3K48A 4J7ZA 3L9DA 5DAWA 3ZLIA 5IT6A 4ZHQA 2XUMA 2A7AA 5J7MA 4UFIA 4QX8A 1JYVA 1HXS1 4HSLA 2X09A 4P00B 3WNMA 3K46A 2IJHA 3H1IH 4DV2O 4LWSB 2Y69B 3T4HB 3B40A 5FLHA 4NAMA 4OZOA 5IYZB 4J1XA 2YEVB 3WG3A 3K5NA 2PHTA 4PDWB 1N33B 1WW4A 1BGYH 1RXGA 1QVGU 3ROUA 2TBVA 3K5MA 5LXTB 4QX3A 3WDTA 1GZCA 4DW1A 3L73H 4OXSA 4TLFA 1X4TA 1V9U1 1BQZA 3K3WA 4LFBB 1C8NA 3WB0A 1ZRFA 4E2QA 2PHUA 3FB5C 1ALYA 1O4TA 2AW9A 1SBFA 3JCUZ 3KB5A 5JZGA 3PUSA 4TN7A 4ET7A 3J8F2 5KUKA 1Z7S3 1HNWB 3IPVB 4NWVA 2FQPA 3JSLA 2EA7A 2ZX2A 5JOWA 2F93B 2ZR2A 3ZDSA 5A7PA 5AFEA 4JTNA 5BNNC 1LHOA 2YSUB 2YGMA 5KBFA 5FZGA 2VNVA 4LO4B 3OBTA 5FREA 3Q8EA 4NVPA 5ACA3 3LUTB 4JQTA 5A7WA 1AP6A 1AXKA 5L3GA 3D0JA 2PA7A 5C71A 1UMHA 1UOJA 1SEFA 3LSSA 3GWKC 4W65A 3SJBC 2EIKB 1OF4A 4E9KA 3K4AA 4IEZA 4GX0A 1DDLA 4PF5A 1LB2A 1THZA 4TOIA 3BIWE 4YM3A 4XJWA 1IBMO 2WS92 4RR3C 1UXZA 4YJ3A 4Z07A 1PNFA 4N23A 2VR4A 2WNOA 1URFA 4RL7A 1R091 5EK0A 1CAVB 1FPN2 1WA8A 4NIDA 4BW9A 2ZKNA 4BM8A 1FFXB 5KAFZ 3AZZA 2X5IC 3BTZA 1OLQA 4H0LB 3RJRA 2RR11 3N3HA 3H42B 2Z5WA 5B4XA 2Q68A 3VB9A 4CS4A 2ZMNA 2KSDA 3C7FA 2D6PA 3JZVA 2A9HA 5GZCA 2UY9A 4AHWA 4DR3B 1S1AA 1C57A 1KITA 2LQTA 1FPOA 4FLZA 4MVTA 5C9AA 4PA7A 3G80A 2NMOA 4OMDA 4QQHA 1ZX5A 1QLEB 2W5FA 3WG7B 3M1HA 4QPKA 3FC0A 1HB1A 5DAPA 2Y6LA 5FZLA 4GALA 1NX9A 3KV5A 2BOIA 4I30A 2D6NA 3N2KB 5FYBA 2XWJB 1IBKO 4CEYC 2PLV3 5D8AB 3WP3A 2RS52 5C8WA 2X5IA 4V2WA 2VU9A 2ZAHA 5FXZA 3UM7A 2F6BA 1YIPA 1AR81 2D2CB 1YSCA 4DRXA 1JHJA 1WW7A 2WN2A 5TISZ 4AEJA 1UZ0A 3JCIA 3V0AB 2F4PA 4B7KA 1VAMA 2GHYA 2YIDA 1GN6A 1QXRA 2NM1A 3LIHA 2EICA 3WNPA 5F9TA 5LEJA 2H94A 2CTQA 2WDBA 1YQ2A 5IYCO 3A7QA 4XFGA 1QHTA 2UU9O 3ZYHA 3S3XA 3F5WC 4GMP1 3VD5A 3WQ1A 1M93A 2GUZB 1W8WA 5C8CA 5K7PA 2HVJC 1ZLZA 4CEWA 5FYSA 1POV1 5CN0A 5B1AB 5B3SC 4PDWA 1KP2A 5CFDA 3CF6E 3MICA 1XMOO 1NS1A 5JZGC 1Q8QA 1XREA 1PO12 1F4NA 1VIWB 3BRCA 5IWFA 5LBCA 4X1KA 1NTZH 3ZN6A 2PHWA 4LK7A 5LZ6A 2P6HA 3TOJA 4P9OA 1ODMA 1FXHA 1G6NA 2RJ2A 5J2UB 1J83A 1W0PA 2OUJA 4HVRA 3E35A 4K0KO 1PIV3 1TVKB 3ILFA 2VAUA 4QHBA 4QIWF 1OC1A 2Y6KA 4GZ9A 5KMGA 4OI2A 3RVZA 2VQFO 2D6MA 3B5LB 5GZEA 1W90A 3K0GA 4GH4C 4LE4A 3SEPA 4XW3A 3KG2A 4K7JA 4RGAA 1BEV3 1JODA 3I5DA 2ZDIC 3KMHA 3SGIA 4AVSA 4JGYB 4AHCA 1W05A 2AGSA 4JKKA 1VP6A 4RS5A 1ZZCA 4FTEA 2PHXA 4QE7A 1MSDA 2QM4A 4G28B 4LITA 1SQBH 5LYJB 3RYHA 2YDEA 3VBSB 1D0GA 4QKNA 2ADQB 2DFCA 5I8TA 5HXVA 2A70A 2K2SA 2W6IG 3U78A 2QA4V 3H3LA 1RUG3 1W6QA 1TE1B 1SQ4A 4CDXC 4LR4A 2JK5C 4I01A 4Y5SA 3LF7A 2JS3A 1XNKA 2H0BA 1OT5A 2E5LB 5FYYA 1A32A 1GK9A 4LEJA 2ZHMA 2DW4A 1ULFA 1CAXB 1BL8A 3L9JT 3PUAA 3QBQA 3AP4A 2Q0AA 2BYVE 5JCOC 3VHNA 2VMDA 3HBKA 1QJU2 3TN92 4YGBA 4EN8B 1QJX1 3O1TA 3BABA 2GMPA 5CG9A 2ADDA 2A71A 2WO1A 3UO2A 4QQPA 4ICGA 4MXWB 1BS3A 2CGOA 4CH6A 1LOBA 1WMFA 4KWUA 1VBD3 1ZA7A 3MV11 5IK4A 2OT7A 3GHNA 3FMGA 5CKQA 5C8YA 3ZYJB 1JZ4A 4LH7A 2X10A 3JAKA 3J4UH 5C3OA 4N8MA 5AVAA 1VBA2 4P9WA 1HIXA 1LESA 1W6PA 4I50B 1W6MB 1C5IA 4QXHA 4CZSA 5FZ9A 1KQSU 3I2HA 3TB0A 2OWOA 3IIIA 3R4UA 4Q0SA 4XMIA 4G2KA 3KHBA 2D3RA 1OQEA 4EZ4A 1DGRN 4K0KB 4BH9A 5KHGA 2DVFA 3MHSC 1WUVA 5CA3A 1H2MA 3L72H 1FYUA 4JDNA 3UGFA 3VBOB 5KHJA 3JD72 4XBQA 3LDKA 2Q73A 4YZ3A 4NE9A 1N0JA 2WFF2 1E1RG 2FHRA 4OPAA 1DHKB 2VOWA 3CBNA 1UY1A 3ABMC 2BBAA 3T0BA 1R1A2 4DV2B 1H38A 5FWEA 1K3EA 4QQLA 4NHKA 3T4ZA 4ZU5A 2V4DA 5EP9A 2EX3A 1OH3A 3HMYA 4BA6A 2ZE6A 2QBXA 3U0ZA 4V1PA 4W6XA 3T1YB 4ATFA 4DR4B 5IYYA 4ZPIA 1ZYBA 3SH4A 3PDQA 3DCQA 4RSUA 2A6ZA 4BIFA 3LDDA 3TWIA 3R66A 2JDHA 2ZIOA 3ZXKA 1RHI3 1BHBA 1VBD1 1GP6A 4YIPA 3WW1A 1ONAA 3MV01 2VECA 1TA8A 4JI3O 2VNRA 2HP8A 1B09A 1XI1A 3VBUC 1XYPA 2VQAA 1S5LZ 3SPHA 1ZTEA 2N74A 3UESA 1EP0A 5FYIA 1HN0A 1VQOV 2VQ0A 2VBDA 2J1EA 5JIUA 4RS5C 2PHDA 1VB4A 3W5NA 4BIOA 3GM8A 4FPYA 4LR3A 2RS32 2K9ZA 2ZDIA 3ML0A 3UKNA 4ZS2A 4YGEA 1NXD1 3E89A 5DDJ3 3E22B 1QJY2 2XDVA 4CUCA 4U3FH 2GC2A 3U1XA 2IC1A 2VL4A 2LGWA 1QU7A 2KKWA 4XJZA 4UCTA 3VQWA 2W39A 1P8JA 4D6QA 4LH6A 3KCYA 1KC8W 1YI7A 1KJRA 5C5TA 1XMQB 2Y33A 5LB6A 4QKDA 3DPRB 3MO4A 3PU3A 2ZGLA 4YXWG 1K4CC 3L71H 3TGUH 3D3QA 1Q56A 1E5IA 5F2VO 2OUHA 4S2HA 3CXCU 5LRSA 4KUMA 4MSVA 2I07B 4AQYO 3VQYA 2CNAA 2ZGTA 3WOGA 2JE7A 4NRMA 3W7SA 2E26A 1W2TA 3CRRA 2QDOA 1LOGA 4PDWC 3CCEV 5FOJB 4AK3A 1X50A 1K5SA 5EZYA 1S0FA 3EXUA 3WV6A 3FB6C 3HIFA 4RFT0 3H1HH 1AUYA 1LRHA 1JOBA 1FJGB 1RIRA 3ZFGB 2JG8C 3NW4A 2WZEA 1N0NA 2IJKA 2QQJA 5F2SA 3ZFEB 2AHZA 1UMZA 1XEQA 4G3YC 4FPFA 4QXCA 4BQXA 3MIHA 3BIEA 2XAFA 3T0AA 4PDVA 4A4AA 4MHUA 5A7OA 5EJZB 4LPLA 4XUNA 2Z3YA 1UY2A 4X8AA 2X05A 1HN1A 4I3GA 2VE1A 3WUDA 3ATGA 2JKBA 5KX5A 1S0IA 4HKWA 3T09A 2C6SA 5CG8A 3POGA 3PVOA 3GB7C 3SITA 4EJRA 5IK8A 1PK6C 2ADEA 2R72A 2VZVA 3WEZA 2VS0A 3K5OA 4QD2A 1ENRA 1ZVFA 1ULOA 3USSA 4JZRA 3VZKA 1J3RA 2VRZA 1D2SA 4CXYA 4P9XA 3R65A 3I2DA 3UQ8A 3IDCB 1OQ1A 1FS0G 4RUEA 4AAXA 3OGVA 5D5PA 3N7JA 4FFHA 4TV9A 4D7TA 4W4LA 4DV1B 3U14A 1UPSA 2MEV2 1XB9A 4G4FA 2B45X 4GA9A 4CU8A 4YG3A 2ZIMA 4JGZB 1G86A 3H8RA 3IB3A 1HWYA 1C4RA 3RWKX 3BGAA 3TN93 3AG1B 4YRDA 4E4EA 2ENRA 1ZRIA 2QQOA 1QH6A 1XL6A 4DXZA 1AYM3 5I8YA 4XC9A 4Q4X2 5H9CA 3K0DA 2ZM6B 1TAEA 4Q0QA 1VLNA 3SPCA 4NIIA 3AG7A 4UV9A 3U11A 5BY5A 1WKYA 1RVF2 2HWB3 3AZWA 3N2GA 1F8VA 5FBJA 3WG1A 3B94A 4NN0A 5FNVB 5KLVH 4O9EA 1ZZ8A 5CKNA 1KRIA 4CDWA 5BYNA 3VKNA 5IYZA 2ZPXA 3P3NA 4I5SA 4XFFA 4FPCA 4AFBA 2WLQA 4NMIA 5H9PA 4EZHA 3WW2A 2TUNA 2IU3A 5JR2A 3ABMB 2VUDA 4XAAA 1YWKA 1VQ4V 2R16A 3CS5A 1U12A 4NTXA 3DV8A 2JEXA 1W03A 4GAZA 4MGSA 2ZNJA 1G8MA 4JYCA 1O3TA 1VQPV 1W9FA 1SQVH 3APOA 2A7WA 1GR3A 1YXWA 4XHXA 4QDQA 4H14A 4GKKO 1V6IA 4LBLA 2NNUA 2TNFA 4WVVA 4TTGA 1S0CA 3SEEA 1HV0A 4P9YA 5C70A 1H9PA 4RUFA 3KGZA 5EXOA 1RM1B 4C1XA 4IUGA 2BOCC 2E31A 2GNMA 3JBG3 1SFNA 2CDPA 2W08A 3ZSLA 4MVQA 1KEXA 3AK2A 5DUXA 4BLJA 3AVRA 2R062 2VM9A 3VBHC 5L3EA 4IYHA 2XUEA 2P2KA 1RUJ3 1VRH1 5L3CA 2RN9A 3FUOA 3OYWA 2VOXA 4HANA 3E8GA 1JS9A 2W95A 2WSVA 5KA6A 1EAH2 3KCCA 1VBA1 3HBZA 5BNPB 4BJ0A 4MUVA 3OG2A 3MLLA 1ZL8A 1ZBA3 3NAPB 3IJ4A 1WP8A 1XNTA 3T2QA 4CCMA 4YYOA 4H2AA 4EB6B 3EBRA 3UKVA 4AI9A 3CJIB 2YXYA 1QJX2 2C2AA 1OD3A 4LP8A 3FZ3A 1HJFA 1NA1B 1OV9A 4CSWA 3ZN6B 2I74A 4YM0A 3CWBH 4WM8C 2RMU1 3ORJA 2PXJA 3Q8BA 2WNUB 3FUQA 5FRAA 3M7AA 1PIV2 2WLPA 4WFHA 3P1IA 3U07A 4QHZA 4A45A 3SYCA 4ORFA 3ASNC 3DXUA 2X8KA 1O6UA 4P5YA 5JSRA 3AZVA 1C8M3 2VZUA 4JGYC 2D6LX 2A1XA 2YFUA 4DK0A 5C9AB 1KB9F 1XBFA 1BK1A 1YJNV 1JJOA 2E51A 5DAQA 2VULA 1ND3C 1O3QA 4Q4V3 2D5FA 4FXGB 4WCEV 4S2DA 3CSXA 1W2UA 2QQKA 3H1KH 1FD9A 2B42B 4XFBA 4QB1A 4AFMA 3F95A 1G1XB 3KV4A 4DR6B 1HXS3 1CESA 3PMSA 2QQLA 2DVBA 3IC7A 4U3JA 1WWYA 4CDXB 1S0VA 1KDMA 3AX4A 5A6ZA 1OI6A 4LO5B 2ZE7A 2JGUA 5FP8A 4NYKA 3WF4A 1DGWX 5IW0A 2X29A 5GLTA 3N9LA 1RUH1 1FXKC 3NWKA 1NT0A 3GJBA 3VZLA 3L75H 3T0DA 1WA8B 5LGNA 2UU8A 3FX3A 2DCKA 5LMNO 3SH5A 1PK6B 4YM1A 4N90A 5JPMB 4ES9A 1RUE2 4MG2A 3BKZA 4UCUA 4O4IA 3ACIA 2X6CA 4HFSA 4JASA 5LCWL 4RWUA 1H4HA 4NHYA 4OQ9A 1HB3A 1UWWA 4ITCA 3LKJA 4XOGA 4D0QA 3HNMA 3JD1A 4FIPC 3WLUA 4JI4B 2BEOA 3AL5A 1HW7A 1Z78A 2CWMA 2FL4A 1AILA 3KM5A 2QR4A 3CMGA 4GKKB 4CCDA 4UB6Z 1ULGA 3GBWA 1SKVA 4FI9A 3LOBA 4X1YB 2D44A 3U4XA 1T2XA 1W8NA 4H33A 1MPXA 3IAYA 1OH4A 2VCCA 5LA2A 5CFDC 4KHPB 2LW1A 2EBOA 4EN6B 3WHUA 1Y43B 4XMAA 5EJ1B 1J1LA 4YG6A 2HR3A 2EALA 2A6VA 1Y76B 4DXRA 5C8CC 1SPPA 2ZCWA 1K97A 2HEYF 4C0BA 2KD7A 4FLWA 4ZZ8A 4QPYA 2PLV2 1OCRB 1EZVH 5FMBA 5IJ0B 4GB33 1NTMH 4LF8O 5B1NA 1CR7A 2ZX0A 4RQEA 2QJ1A 1KFXL 1E5HA 4XBLA 4Y5Z0 3FLPA 1CAUA 3B2EE 2WRAA 1APNA 4UBHA 4XDLA 4YJ3B 1CXZB 2QSAA 5A3PA 2QFEA 3HOBA 4UCSA 5A7WB 2DV9A 2G9GA 3JAWA 2EIEA 4MGZE 4CP1A 4GH4B 2ZM6O 1GFF2 4WBNB 4BQ5A 4YJ2B 5EYYA 4JI3B 2IFWA 1JTZX 3ZSKA 2UXXA 1KKCA 3RMXA 3VOUA 4Q5OA 4JI8B 4NPLA 3AMNA 4KH9A 4YW3A 1N1SA 5CB4B 3OEBA 1M56C 1P49A 3FFZA 4DV3B 3SDLA 1OZ0A 1LKNA 3T2OA 1JUHA 4X66O 2VUJA 1S55A 3WZ1A 1QWRA 4KU8A 4C90A 5CISA 1JCHA 2EXKA 3WNOA 2WZR3 1M1KW 2BRTA 4XURA 3J7HA 1KMIZ 3K51A 4J42A 1GN2A 4WVWA 2XJRA 5EPAA 5CU1A 3CC4V 5EJ3A 5FPOA 1FNYA 4BK4A 2W52A 2R1BA 3W21A 5FCCA 2HWD2 2YXLA 1Q5OA 3N2KA 2XJVA 5JVDA 4CRQA 2UXDB 2WYFA 4UFKA 4MV2A 4GZRB 4FZ0A 3RYCA 1VPHA 4XDPA 2RDNA 1EUUA 1N8RW 1NLQA 1X36A 2EVXA 3E22A 4JAAA 2UXCB 4ZOLB 2WSSG 2XASA 1Y74B 4EE2A 1K3IA 5J09A 1PVXA 2GALA 4AFDA 2QE7G 1CWPA 3AKSA 4XFHA 1RITA 4N9IA 5LW9A 4GWMA 4KU7A 4AGRA 3BOWA 2Y0IA 3A0BZ 3OY8B 5FYCA 1K5QA 4RA0A 4CPBA 3ZRWA 2RHPA 4YGDA 2GTSA 4BW5A 4LXLA 4DB5A 4DO2A 4IHJA 5EBWC 5L73A 4P2ZA 4META 3ST7A 3C8XA 1I08A 3VBOA 4MVUA 3SPIA 1K73W 3POJA 4UXNA 4ASKA 1ZREA 1GANA 2F66C 2Y48A 2ZGNA 4GULA 4L0PA 4OHZA 2WWJA 5EFUA 5E79Z 5FY5A 3M8LA 4DO0A 5KR7A 4PBPA 5IAXA 2E5LO 2HWC1 1COV3 2XVLA 2EILC 5IHRA 4UWDA 5I0DA 4ZKTB 5B66Z 2W47A 1Y4WA 3ICXA 1W8UA 4Q4W2 2RS51 2SLIA 3IDBB 4EN9B 5CA6A 3ZMOA 3NV2A 1KGYA 1CJPA 3IAQA 3VDDB 1CAWA 4DXTA 4XF3A 4JRAA 2HWB2 3ZN4A 1AR82 1AL0G 5D8AA 5A9GA 5KA5A 1W6PB 2E32A 2X5IB 1VBE3 1RL3A 1AI7A 4J41A 4O4JA 5DQ0A 1W59A 2DWEC 1UN1A 1O5LA 1PM4A 2D97A 5DM6V 2OZJA 4YHHB 2VBBA 4P02B 4ZI7A 4Y20B 1VQLV 4O61A 2YI9A 1S0GA 4LMFA 5LMNB 1V0AA 4MLOA 2VQFB 3NV1A 2H6CA 1AF9A 5FY1A 3AKTA 4B3RO 1XILA 4AL9A 5DEDA 1CAUB 3AFGA 1GQGA 1WMEA 1NA1C 4BCUA 3AP7A 1XXNA 5K0UC 1OCOC 2R0FA 4UVBA 5JLVA 1UX7A 5K8SA 2XH6A 2Z69A 5FFOC 5JXHA 3RWNA 5KC5A 4RQFA 1W2OA 2RMKB 4NAOA 4JKLA 4MGIE 4RQPB 4JI0B 2IWGB 3FLRA 1UYYA 5KXEA 1W9YA 4JV5B 1Z5VA 3RNSA 3IIAA 4YGCA 1TNRA 2JDMA 3ASOB 4R50A 2Q8EA 2WNEA 1XNQB 2VW0A 2JXAA 2OIGA 3VD9A 3N35A 1WN7A 2E63A 4SLIA 4YVSC 1H8VA 4HN0A 3OEHG 1K92A 1GQHA 1B06A 4DV4B 4YW4A 1KECA 2QTWB 4B3NA 3VD3A 3HT2A 1PP9H 3B4SA 1IS4A 3H1YA 2FCTA 1ND2A 1YC61 3K77A 5T55A 4QMAA 4KG8A 5LGUA 1DGRA 4EFEA 1IS3A 3FD9A 3HWJA 3ZEDA 3OTOO 3T1LA 4XETA 3FHQA 3HR0A 2EIBA 4XPVA 4JAVA 4AILC 4LBNA 2YPJA 5GTIZ 5LHGA 5IWAB 3POWA 4R4XA 2FDIA 3MGUA 5BNQA 1AR83 4M0NA 2E33A 2VVDA 2IXLA 2RS53 2RCVA 4HXCA 3U10A 2RDCA 5DECA 4DR1B 5DZFA 4X1IB 1UKRA 1E57A 4Q8LA 1IKPA 2XL7A 3FL7A 4CCOA 1OLMA 1GNYA 2R1DA 3OUHA 2Q7HA 5H2FZ 4H7MA 2FCUA 5CFDB 1AI5A 5A7SA 3ZXJA 1NCRB 2GNDA 3M3QA 4PD4F 1A34A 4BMBA 3OUFA 2P06A 4JGZC 5F7UA 4MGTA 4DUVA 5A1FA 1P7GA 2WKKA 2G4IA 5GLZA 2RQ6A 1GKFA 1TZOA 2VZ1A 4BISA 1RMU2 3K04A 3NJZA 5F37A 4LIVA 5H6QA 2OVUA 2XB6C 5DG1A 4BOWA 2CGNA 1YI2V 3DYPA 2DURA 1AVMA 4LKDA 1K4DC 4I0BA 1POV0 1N3PA 4ONUA 1R3LC 2W46A 4COWA 3CE2A 1YXBA 2KR2A 4QX7A 5IUQA 3WCRA 2AUYA 4BDVB 3ETQA 1XSQA 1QNMA 2IH3C 1S0BA 4FLVA 4TYSA 2ZD9A 1IVSA 4MO3M 5FAXA 1L8DA 5LA6A 3O7OA 1JFFB 3ZMSA 5GZGA 1NE6A 1V6NA 1AX2A 2F43G 2HH9A 2R49A 3GF6A 3NXSA 5EYPA 5LA9A 5JJJB 2X53S 4LNUB 2WLNA 4FPLA 3K75B 1PGL1 3MZHA 3ZIXA 3ACHA 2YC2A 1QOSA 3LSQA 2XQXA 1O5UA 3G4SV 1G9FA 3FE5A 4TV8B 1SZXA 3RZZA 2NPIA 3CQOA 2RM23 4X65B 3P30A 4DV5O 4XFAA 1AR63 2ZINA 4KWKA 4LO7A 4H7LA 3Q8FA 1US3A 1MS0A 4TZDA 4YW2A 3DSQA 1YQCA 4JCKA 4XHBA 5FZMA 4GJZA 2WN3A 5FIXA 5JAXA 4AOCA 4QX5A 1SC5B 1US6A 1Q8SA 3VDAA 3IT8A 3CDZB 5DMYA 3GZAA 5IVFA 2GMEA 3HKDB 2GBOA 2JWPA 2YGLA 3PURA 1UZZA 1WCUA 1ND2C 5FLIA 4KWJA 2JIGA 3H8OA 2XVGA 3M7MX 5J37A 3ZSMA 1YFUA 2A5ZA 2FDFA 4Y4RA 2PHRA 2XR4A 3CJIA 4AEDC 3CJXA 3O9OA 1OURA 5LP6C 3ZXGA 4P5HA 2P7TC 5KHHA 3I2FA 4X8NA 3SR2C 3M3IA 1W28A 1OUSA 2F1MA 1LENA 3OEEG 1ZZ9A 1VMJA 4QPIC 5JQGB 3BPSA 4HSJA 2JG8B 5HCAA 4JRLA 1NVPB 3LD8A 2RDRA 3WP5A 4Q20A 5BNNB 1OFSA 2O14A 4CXXA 2R043 1I5XA 1ULDA 3QACA 5FTTC 4FM0A 3ZKUA 4CP2A 1Y76A 2L9LA 3ZYIB 2Q5ZA 2HVKC 2HWE3 4FM2A 4R9CA 4YY3O 4QHOA 3RYRA 4EWDA 4WM8A 1LOFC 4AGGA 2IU0A 3UYJA 4O2BA 2CDOA 2SBAA 2YY1A 2VD7A 5K1PA 2WA4A 4OUMA 1COV1 4CC6A 1SZTA 2Z42A 4K9SA 3C7EA 2RV9A 4EB6A 4RR3B 2QTOA 2ZGUA 5KHIA 1VF5B 2B9UA 5D5QA 3JAWB 2PY5A 3JD71 1GWKA 2P1BA 4AQ6A 4ASUG 4TXWA 4PDLA 1COWG 3HPNA 2WUHA 4XXPA 2C9AA 2FBEA 5E1AC 4FTBA 1GKBA 1Z7S2 5IK7A 1JMKC 5ERLA 2QDNA 2ORZA 5K0UB 2UUAB 1F23A 1S77D 1UMIA 2W3JA 4B1LA 1ASJ3 2WNUA 3POFA 1IBLB 1VAVA 1BVVA 3AG4B 1WLWA 4L2NA 4LC1A 4RD7A 4H13B 5FPAA 1MSWD 2ID4A 3LIGA 2HKOA 5L7OB 1UPIA 2XT9A 4WVZA 1VEWA 5KUMA 3ETDA 4QQOA 2I45A 2B5HA 1PV0A 1WLCA 2J1UA 2EXHA 3N36A 1J3PA 3WF1A 5FYMA 3ZFEC 2V5YA 3VGIA 2JIJA 2VQTA 2Q0OC 3AG2B 4TWTA 2QQWA 2OIIA 5JVVA 2PQSA 1SPPB 5JWPA 4D6TH 1YTFD 2ARXA 5DAXA 5T52A 5C8CB 2Q8DA 2OYQA 4UYBA 4Z2WA 4PA6A 2ETNA 2OKXA 3OMIB 2RM22 3LA3A 3D6EA 5E8AA 1NU1H 4IEPA 1QDCA 4JI5O 3BTAA 4O4IB 2W94A 2Y0PA 3URFA 2IVJA 3SYPA 3SMHA 2C24A 3WQBA 2BOJA 1PNLA 1F4AA 4Q4W3 2ZABA 2UU9B 3KT7A 4Z92B 3LSUA 5A3LA 5GONB 2JKXA 3ZOIA 5HCFA 2VPVA 5A32B 2E74B 3FYEB 3CRAA 4Y1UA 3TXSA 4MSWC 1VBE2 3K3NA 2HHHO 3GNEA 4XF9A 1W99A 4DPNA 5L9VA 1D7PM 2ZKOA 3M70A 3QG5A 4IV1A 3RVYA 2PN5A 3JQWA 3KV9A 3E5XA 5F2WA 1YHFA 2ETEA 3LNNA 4ES8A 5F5IA 4EKWA 4OHXA 1KDKA 3VBHB 3ILNA 4E2GA 1L7QA 4QM8A 4WVMB 4UUJC 1MNGA 3B93A 1K7DA 1MZ5A 3MW3A 2YU1A 3O1PA 4LBQB 3OGGA 1AVBA 3M2MA 1K45A 5DUWA 2LW8A 1UCXA 5LXTA 2GP3A 2XLFA 2J1AA 4N53A 3BN6A 1J59A 4PA4A 1ZAUA 2DWRA 3N27A 5LP6A 2ARCA 4P9IA 4XBFA 4AEDA 4YJ2A 1PK6A 3IAPA 3CJIC 4LJHA 2HJFC 3P3PA 1EY2A 3PVBB 4FBFA 4N9HA 4PA9A 3TBDA 4I55A 3UGHA 1RHI2 2XJUA 3PJSK 4C91A 3ZN5A 3RYIA 3AB0A 3ZHQA 3ZPYA 4WM8B 4CCNA 3B01A 3BUCA 4KGQA 5FR3A 1ZZ6A 3OEAA 4FAHA 3VBSC 4PIYA 3LA7A 4X64B 3ZO0B 5LOVB 4CH3A 4MW3A 2W1WA 2Z0AA 4DS0A 3BCCH 3BALA 5CFCC 4DV7B 2IXHA 3IGAC 3ZRVA 4A3XA 1TUEB 1LTEA 4A6OA 1NZCA 5JOZA 1OA4A 4FXKB 4KG0A 4AG4A 2BNOA 3AK3A 5EZWA 3TEYA 5FUNA 3LFIA 5FK7A 3APBA 2AHYA 1W9SA 1XYNA 4OHVA 4LF6B 4YW5A 1VQ8V 5T54A 3D82A 2Y38A 3CP1A 4JTCB 4LF5B 3LA2A 1NI8A 4E8CA 2JECA 4Z8BA 4XILA 2YMZA 3WB1A 4P9JA 5B5EZ 2A3QA 3T4DA 4AWDA 1IOAA 3BAAA 3MI8A 2BP6A 1ND2B 1C8M1 2HFEC 3D3IA 3ZMZA 4YIOA 2VXJA 2P67A 5C5UA 1ZM1A 2HJDA 1NCRC 4YM2A 3UV9A 1W9TA 4Q2FA 2GU9A 2WT2A 5AG2A 1K5MA 3G6JB 1O59A 2XJTA 2CE4A 4DRRA 2OXBA 3VKFC 5CA1A 4X62B 1LHNA 1VALA 2KG7A 5CKMA 4Y1YA 3ON7A 4JI6B 1F7YA 4PQQA 4A6SA 4PHZA 2DMXA 5A70A 1GZWB 3K79A 5I0TA 5BR8O 3GVMA 3AXEA 1RGSA 4PDRA 3KQ4B 3GXUA 5FYVA 4XE9A 1IG3A 4IQPA 5I91A 4JGZA 2ARHA 2ZE5A 2YBPA 3ZYGA 2BV4A 2FKXA 1NY71 1V00A 2DE0X 1IPJA 3RZMA 5BUVA 4JHTA 4JF3A 4QNHB 4AF9A 2GDSA 5A33A 3T30A 3X29B 1NKGA 4LBMA 2Q1ZB 4OX9O 1Q8OA 4MVMA 3HNBM 4KBZA 5LRRA 3JD4A 1VBC3 4XACA 2V72A 1H4GA 1F51A 2E3CA 3OFNG 3VBUB 3VKOA 3I8TA 2XPJA 2GC3A 1HDJA 1ZSPA 3GGLA 3EJKA 4BZ4A 3JD73 4BE3A 1QJX3 3AP9A 4QM9A 1NBMG 2OCCB 1R093 2A3WA 3WR0A 1ORQC 5FZCA 3IKWA 1DQ5A 3M4FA 4LT5A 3OE7G 3HKCB 3SXWA 1MS8A 2Y6FA 3CMAV 1YF2A 1MS3A 3T2MA 4MTGA 1PO11 5DZGA 4LNUA 5JOXA 5G05L 2AH2A 1XMQO 3O1SA 1JN2P 3THDA 1TME2 4W6YA 5C3QA 1AL23 1UU6A 3ZRSA 1FXKA 1WCKA 2ES3A 2EZPA 4MVZA 4LWSA 1WW6A 2Q67A 1I5YA 4RQPA 3X2QB 2GV9A 4YW1A 5FZFA 2P4VA 4GKJB 1LOCA 2A06H 5J96B 1XHZA 2Q30A 4JZGA 4CS2A 3RYCB 2WZ8A 4JVAA 1K5MB 2LTNA 3AG2C 2PZSA 4XF1A 1HW5A 2QQNA 5JH7A 3KVBA 4QGNA 2ZKLA 5SV5A 3ABKC 1H8TB 2P6CA 5FPZA 4FPHA 5FZ0A 1CVNA 5SV8A 3CRMA 1FV2A 5LHIA 4X66B 3OGIB 2ORXA 1JHNA 5FMOS 1SDDB 4FLXA 3HAGA 4FPJA 2NN4A 1VB2A 3ZJZA 1HR0O 4Q29A 1U0AA 3VKMA 1AB3A 1O9GA 2AR6A 3WP6A 5FYTA 3ZFFA 4CDWC 1H30A 5FZAA 1B35B 1VMHA 4LF7B 3JALA 4CCEA 1N36O 1QU0A 3H0OA 4WZCA 1I9RA 3ABTA 2R071 3LDEA 1M4WA 3OD4A 2P17A 1TMF3 2ET1A 1EPWA 4FSJA 4AE2A 1GICA 3PJYA 1LNQA 3MEPA 2E7TA 3FN9A 2EAKA 1NVPD 4JI7O 1QVFU 3L2HA 3N9QA 3IDEA 4Q26A 4IHJB 4QGPA 1B04A 3B77A 5ISLA 3K03A 1TMF1 3EHKA 3LWCA 5FMOL 2YEVA 3WINE 1NUKA 3R6SA 4PIXA 1MEC3 2WS91 3W7UA 1R082 5JJEB 1SFPA 5F5CA 1ULCA 4AW7A 1RSOA 3O0WA 3E2EA 2ZHNA 4QGLA 1SLBA 3E8FA 2JDNA 2XL9A 1RUD3 1SQXH 5A3OA 5JXIA 3TEWA 4IT5A 2Y6GA 1RUF3 3Q4HB 4CH5A 4IGGA 2VMHA 3POIA 3RI9A 4R8HA 5A32A 4DYLA 4JI2B 2ZXWC 4FZ1A 5IT9N 4DUZO 4L97A 3O1MA 3ZMVA 1OQDA 1PVC2 2CHHA 4OVEA 1N3QA 5CA1B 3VBOC 1UFIA 4HNAA 5ABJA 3WG2A 1VARA 5L3FA 2MPFA 1XU2A 2FCVA 5IFPA 2A3YA 1VF6C 2HBUA 4M3CF 2DF7A 3POBA 4OULA 2YC4A 3AMPA 4RO2A 1N34O 1SACA 3BCWA 1FAYA 5B1BB 1AR91 1FT9A 3LCPA 5T5LA 4SBVA 3Q8CA 3ZYPA 1Y67A 5LBQA 2E7AA 1XPWA 1G9AA 2ARBA 1JFFA 3PVEA 4PI2A 1KD7A 2KB1A 3JARA 2IVIB 2BU9A 5FLXN 2QKCA 1HNXB 3LB9A 3U4SA 4B7EA 3AMHA 3RZGA 4UFLA 3BU0A 1W6OA 3MIDA 4XUOA 2UY8A 2MEV3 1U5ZA 4YZ4A 4B3MO 4QX2A 4IEOA 4ARYA 4O65A 2ZGMA 3OTFA 5LP6B 2DTYA 1AXYA 5EQUA 1WPXA 3O12A 3ZR6A 4BQYA 5C7GA 4A42A 3BTYA 4RFRB 4DY3A 4FTSA 1D2QA 2RNBA 3HEIA 2YBKA 4Y22B 2PTMA 1ZNPA 3MF6A 5T5OA 5EIBC 1W6QB 4TV9B 4KI5M 4GQ7A 3JATB 1HXS2 3FBMA 2DCZA 5GKAC 1RFYA 4YVWA 3HQRA 3CRCA 1IQDC 1MABG 4FLTA 2JG9C 1OKOA 4CE8A 2WLJA 4DEQA 1STMA 1N33O 1OD5A 2D43A 4DR7B 5FZ1A 2HYKA 1F15A 1FI2A 1SZBA 3QCWA 4BWOA 3MLKA 1RB8G 3E6DA 3ES4A 3SKVA 5HFLA 1XMOB 1JOPA 3AG3C 3CYOA 4N43A 4ZIBA 4E8DA 1RUF2 1FMD3 1S0DA 4J1WA 2WO7A 1KS4A 3SJCC 2Q1MA 1QMJA 2YICA 3A4UA 4Y22A 4YPJA 2R7EB 3J8F1 2ZGQA 4MXWA 2BGOA 1HDKA 4FPKA 3E97A 2XHKA 1AJQA 2WJSA 4KWLA 1I6XA 3UNPA 4P08A 5L9RA 5FPBA 2BSKB 4GX2A 4JI8O 3OGSA 5F3IA 4Q1PA 4F7ZA 1QXJA