1Q3EA

Hcn2j 443-645 in the presence of cgmp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 192
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q3eA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q3eA02
4BH9A 4B29A 1EP0A 1FXZA 4QM8A 4KWKA 1VR3A 1L3JA 3EBRA 4FBFA 1NE4A 3FHIB 1GQHA 1H1MA 2D5FA 5FPXA 3RDIA 4H7LA 2HJIA 2IXIA 5E16A 5C6CA 3IDCB 3S7EA 2BNMA 3IDBB 2BNNA 4XFFA 4Q0QA 3C3VA 1ZVFA 2GC1A 2OA2A 3FWEA 4JTOA 4HVQA 1O3QA 4TLFA 1RGSA 1VP6A 3D82A 3L2HA 5EFUA 1JUHA 2ET7A 2PYTA 2C0ZA 3CEWA 2Z2SB 1ZRRA 4D7SA 4HLTA 3H3ZA 1X7NA 1XRUA 5E1RA 3RZZA 4ZU5A 2EVXA 2XLGA 2EA7A 2CAVA 2BYVE 4A2UA 3RNSA 4AQ2A 2B5HA 2I45A 2ATFA 4IEZA 1I5ZA 3EHKA 3MYXA 4MX3A 3E5UA 1O3SA 3LA7A 2B9UA 3U11A 2H0VA 4IEWA 5C8WA 5JAXA 2Q4SA 4EWAA 4IEXA 5LEKA 1ZRDA 3E97A 3H1MA 3RYPA 4YSFA 2PAKA 4YYOA 3DL3A 2IC1A 4FAHA 4QGNA 4Q0PA 3SCHA 5JSOA 2O8QA 1YHFA 2B8MA 1NXMA 4AQ6A 1HW5A 3BALA 5FQ0B 4E2GA 2BNOA 1ZZ7A 1CAUA 3IIAA 3SHRA 2ZCWA 3E6CC 4I02A 3KGZA 4AXOA 4E2QA 2MPFA 5JSRA 3E5XA 1LRHA 5I93A 2WC2A 3E6DA 1TQ5A 5T3NA 2EAAA 3E5QA 4ONUA 3MPBA 4UXAA 1V70A 3ETQA 2N7GA 2Z69A 3EO6A 1SFNA 5FPZA 1X8EA 1O5UA 1CAWB 5I8YA 3HT1A 5F1RA 2QCSB 4YNIA 4BYYA 1YLLA 1OMIA 4Q29A 4F7ZA 2UYAA 4UBHA 4XF3A 4MZUA 2GH2A 2FMYA 4CYDA 5FDBA 4HZFA 3MZHA 1RC6A 2GAUA 2PHLA 3CL1A 1QY4A 4QX5A 2UY9A 4J1WA 4WZCA 4IEOA 2PTMA 1CX4A 2D93A 1OI6A 4IEUA 2BEOA 5D1IA 4KWJA 4OFGA 3B02A 4XETA 4XFGA 4KWLA 1CAWA 5JR7B 5J3UA 1YUDA 2D40A 5BV6A 3UKNA 3S7IA 2PQQA 2CGPA 2VPVA 3NJZA 1G6NA 3DKWA 2PHDA 1ZREA 4Q0UA 1EY2A 4I0BA 1QXRA 4ORFA 2XLAA 5CU1A 2IXCA 3SCGA 1ZRFA 1J3PA 1FI2A 3LOIA 3O14A 4PIXA 3FFQA 2ETEA 4HN0A 2F4PA 1Y9QA 5HI0A 3BCWA 4J1XA 5FQ0A 3QOPA 4HVOA 1Q3EA 2DCTA 3NW4A 5AVPA 5I91A 1IPKA 2OPKA 3NSTA 3FZ3A 4ZU7A 3H3UA 5FCCA 4I3PA 1NYWA 2H6CA 1XE8A 2GC2A 3M70A 2CV6A 4JVAA 4HMZA 5I0SA 1X8MA 5KHIA 4I01A 2OYZA 1YFXA 4I09A 4JV4A 3OTFA 4LULA 4RD7A 2ZKLA 3MDPA 4JTNA 1Q5OA 2E9QA 3D0JA 3H9AA 2HKXA 3LWCA 1U12A 4HBNA 1UIKA 4EV0A 4AVBA 1DZRA 3VHRA 4QMAA 4IEVA 4GULA 2IXJA 5I8SA 5BUVA 4R8HA 5I0UA 4IESA 4L11A 1WLTA 3M3IA 4ZU4A 4KU7A 3TNQA 3ST7A 3RYKA 1LKNA 2QVSB 4MGIE 3CO2A 3LZZA 3H7YA 2BGCA 1NZCA 3PNAA 2XGXA 4HN1A 1J3RA 3LA2A 2KXLA 2UY8A 1ZRCA 1ZZ6A 1VJ2A 3DV8A 1YFUA 4F8AA 3FX3A 4XF0A 4MV2A 2XKOA 1CAXA 5JSPA 3N4MA 4AVCA 4LTAA 1ZNPA 3IWZA 4Z07A 3WW2A 2V09A 2K0GA 4HVRA 5J7MA 3WW1A 1IPJA 1ZX5A 4WVZA 4Z82A 1PMIA 1ZZCA 5KHKA 4IEPA 1PM7A 1GQGA 3ACLA 4MGZE 4BIFA 1RTVA 3I7DA 3S0MA 1YFYA 4O9EA 2GC0A 1OFNA 4E2SA 3E6BA 4META 2K9ZA 5BXXA 1O3RA 3HT2A 1CAUB 1CGPA 4AVAA 4YARA 4DINB 1Y3TA 1CAVA 5CVRA 1LB2A 1J3QA 2VQAA 2GC3A 3BPZA 1QWRA 4KU8A 5KBFA 1J59A 4Q0VA 4QGMA 3UKTA 3FJSA 3JZVA 4PJYA 5CADA 3RPQA 2UYBA 4IETA 3LAGA 3D0SA 1UD1A 1I6XA 5FLIA 3ROUA 3I59A 3TNPB 5JCTA 2IXKA 4IERA 3CF6E 2Q30A 3ES1A 4P9GA 1UW8A 3OF1A 3PLQA 3QACA 3SXWA 1XE7A 4Q0SA 3BU7A 3H50A 4HSLA 3NVCA 4I2OA 1LR5A 1UIJA 2O1QA 4PIYA 5LEJA 2QDRA 3IBMA 4XFHA 2H6BA 5J48A 2MNGA 4I0AA 2XLFA 1EYBA 4LUKA 5BY5A 1RL3A 3DN7A 1SQ4A 4EROA 1O4TA 4YRDA 1CAXB 3GYDA 1O5LA 4XFBA 5I0TA 3PVBB 4MGKE 4D7TA 3G7DA 5LRRA 3KGLA 3OCPA 2CAUA 4N9HA 2QJVA 2FQPA 3SMHA 2P17A 3KSCA 4IEQA 3WW4A 4LEJA 3SCFA 4X6RB 4XEZA 5FLHA 1Q43A 2IXHA 3H1WA 4XF1A 4XFIA 4IEYA 4EWDA 3NKTA 1UPIA 3FE5A 4QXKA 3HIFA 5KHJA 1J58A 4MH0E 3H8UA 2XHKA 4XFCA 4FAGA 3HQXA 5LRSA 2XKPA 1DGWA 2GU9A 2OZ6A 4OLLA 4LA2A 4XF4A 3WW3A 1DZTA 5FLJA 4K8FA 3LA3A 1SEFA 3KCCA 1YWKA 1ZZ8A 3I59B 3OGJA 2IXLA 2PAMA 1RUOA 4QGLA 4HSJA 3I54A 2Q1ZB 4X6QB 3USSA 2Y0OA 4R52A 4XFAA 2MHFA 3U10A 1O7FA 4EWEA 4UBGA 4WBBA 2D5HA 1QXJA 1O3TA 4QM9A 1EPZA 4LLOA 1NE6A 3UKVA 1UCXA 1H1IA 3CLPA 3H1YA 1WA4A 2GZWA 3EQEA 1ZZBA 5KHHA 3BB6A 4O9GA 1X82A 2ET1A 4PIZA 5BPXA 5I8TA 2VECA 3KMHA 1CAVB 1DGRA 4XF9A 3EJKA 4KL1A 4BHPA 2PA7A 4L2NA 5EZWA 4LUMA 4N9IA 1J1LA 2PAEA 3OD0A 3NL1A 2PFWA 4NVPA 3RYRA 1YFWA 2OZJA 3ES4A 2QNKA 5K8SA 3U0ZA 1WGPA 3CJXA 3ELNA 4MGYE 1FT9A 2XL9A 4FT8A 2Q0AA 3R6SA 3H7JA 4MUVA 1RUNA 5I0RA 1OD5A 3ZDSA 5KHGA 1ZZ9A 3GBFA 2WFPA 4LA3A 2XL7A
chains in the Genus database with same CATH superfamily
2ARAA 1Q8PA 4XIOA 3TXQA 1L3JA 3EBRA 2RCVA 1VBA2 4L9BA 2X5IC 3RBZA 5EJ1B 1RUC2 4CH4A 5C6CA 1EUTA 4YM0A 3IDBB 4GLXA 2D3SA 2UWBA 5F3CA 5IJ0A 4F6RA 2WAAA 2GC1A 2HWE3 3FWEA 1HP8A 1Q6UA 1LJ7A 1ULOA 2ZD9A 3ZN4A 4QWNA 1C1FA 2BP6A 4B3RB 2VULA 1R3IC 3RZZA 4O4IB 2EVXA 1OT5A 1Q82W 1LU2A 4L8JA 4ARXA 2ZM6O 3AP6A 5FZ8A 5IATA 3CQOA 5FNVA 5FK7A 4YSFA 1F23A 1Y74B 4LF8O 3G71V 4QGNA 3AYDA 3CJIC 1QLEB 1OCZC 2XB6C 4LFCB 3BALA 2RDQA 3IIAA 3B01A 2A6XA 4Q1RA 1KD1W 4JI8O 3GJBA 3ZXDA 2P22C 1D7PM 2Q8OA 1LRHA 5FZDA 4AF9A 4IIJB 1PIV1 1HV0A 2QWNB 4WVVA 1R092 2Z69A 2IFRA 5FZ0A 4TSVA 2WO3A 2VO5A 1OMIA 2X6AA 5FBZA 4XTPA 1MS8A 1G8WA 1PVC1 1AR82 4FFBB 3R0RA 1RC6A 3RI8A 2H94A 1M56C 5L7OC 4CDWB 5HFLA 4IEOA 1WMDA 2HWF2 2XOKG 3G4SV 4UCOA 3H8RA 3E22A 3GNEA 4EE2A 1WB8A 1LECA 1M57C 4CVUA 4BQ1A 3U07A 2ZE5A 3PVEA 2WLJA 4ORFA 4B8EA 1AJQA 5F6KA 2Q1MA 1OQDA 4PELA 1POV0 2ETEA 1KECA 2DMXA 2YU1A 3NV2A 4RO2A 3ZXFA 3QOPA 2R071 4HFSA 4I50B 3JQWA 3OR6C 5CA1A 3J4UH 1NYWA 2WR9A 4JVAA 4UT5A 2UXBO 1HLCA 1VMFA 2WZR3 4PBPA 4S2FA 3MICA 5FZOA 1D2SA 4HG6B 4WFEA 2GNTA 2GNDA 1KC8W 1N36B 1MS4A 2A3YA 1NXD1 3S6PA 1WP8A 3UO2A 2BSKA 4GKJO 1FD9A 4XC9A 4MOAA 5SV5A 5JOZA 2UWAA 2RMU1 1YFUA 5DN2A 5BNNC 2XKOA 1VBD3 1Y67A 2VUDA 2Q67A 1JX9A 3MDSA 1OF3A 4CPBA 1GRJA 4J42A 1SBFA 1RUJ3 2LO1A 1RTVA 2DYSB 5IFTA 2VUCA 2GC0A 4Q4W2 2Y4UA 3V64A 1ULFA 3BIWE 3IMNA 1U97A 4K20A 3THPA 1Y3TA 5HCHA 1BEV1 4PDRA 1OLMA 5T5OA 1HB4A 1AZDA 5KXEA 2P6HA 2RJKA 1R1A2 1CJPA 3LSUA 2PYLA 4PA3A 3JQXA 1QHTA 5C3OA 1LODA 4IERA 1UU4A 3ES1A 2VZ1A 3JAWA 1UW8A 2G19A 4WVWA 3I56V 5DG2A 4J41A 1SQXH 1VAKA 3WDXA 3SEEA 3J7MA 3ZFGC 3IAYA 1HJGA 3ZSLA 2VJXA 4LNUA 4B7EA 1ZA7A 4GX0A 4IDZA 1WPBA 3VBRA 2JKXA 4UXNA 1DQ1A 5IJ0B 1QJX2 5I0TA 3DYOA 3O7OA 3CCQV 2DYCA 3SYPA 4NIGA 2ZGQA 4XBQA 4R6ZA 3USUB 4N21A 3KF3A 4DR1B 1HDJA 1VALA 4QKNA 4WM7A 1Q43A 3STZC 1S5HC 1CZSA 1MVEA 5HCAA 2R0FA 4U3FH 4I55A 4K9SA 4GD4A 3KVAA 1H4HA 5A3PA 1KKDA 1PX4A 2YHJA 3H3LA 4EB6A 4CRQA 4GH4B 1D2DA 1MS0A 2OKXA 3TBDA 4X62B 3T0BA 3BUCA 1RIRA 3CCEV 4PDMA 3I54A 4HSJA 2FDFA 5JUVA 4XFAA 1UZZA 4HK8A 5DAPA 2HFEC 3OFNG 3ZYIB 1PM4A 5LP6B 4CEYC 1BSMA 4JAAA 4QQLA 4JI1B 2E53A 4MVQA 5LHIA 3LFMA 5DDJ2 2OQ6A 5C5UA 5EZWA 1D4M3 4XOGA 4AYUA 4C0BA 3C2UA 1XI1A 4CU8A 5K8SA 1PNFA 4AEMA 1CR7A 3O12A 2E3CA 2AC1A 4CUBA 3B2EE 2VH9A 1PO21 4TUYB 3ZN0A 2VXRA 4TLGA 4LA3A 2VMHA 5BNPB 1QH6A 1E1RG 4UVBA 4PQ9A 3QO5A 1OA3A 1QCEA 3KZIZ 2WLIA 3POWA 4DV2O 2KD7A 4YW1A 1Q6HA 3HB3B 1LHNA 4JGSA 4DR4B 3HN3A 1RGSA 4AFAA 4B4QA 4HAMA 1FXKA 2HWD1 1XILA 1X7NA 2HEPA 2E7QA 2BYVE 2AEZA 1DYOA 3CDZB 1AYM3 1W0PA 1JPXA 4FJCC 4FOYA 5GLTA 1WLCA 5JAXA 4W4ZA 4GX5A 5LEKA 4I0XA 1B6QA 1KQSU 4JTCB 2RS31 2I2SA 2UUAB 1T6BX 2XQXA 1DK1A 4IYHA 1GTOA 3M3OA 4OHWA 1M06G 3V0AA 4YLZA 2A5ZA 1F4HA 2VR4A 2RJZA 1OFSA 3CKHA 5FPZA 1O5UA 1HWYA 3BOPA 4XJ8A 3ABTA 3QH7A 2BWAA 2YU2A 4DY5A 5J09A 2AZ5A 1A34A 2HJFC 2Z3YA 3WF3A 3MI8A 1C4RA 1SQFA 4GWMA 4RHV1 3ZCCA 3E89A 2WQ4A 1O91A 1K4DC 4KWJA 4FPLA 3VBFA 1F2NA 2O57A 3ZFFA 5L9RA 5GTIZ 3I8TA 3LOIA 4HN0A 3J9SA 4DYLA 1TUBB 1OH3A 4JCKA 2XDVA 5JI9A 3O1MA 3U14A 2JEXA 1HIXA 4P9LA 1LGCA 2E7TA 2CUGA 2JGUA 1C3HA 1EAH2 1OCRB 1OCOC 2QTWB 1Q5OA 2E9QA 4O4HA 3F95A 1K8AW 4QDQA 4EV0A 3W9AA 1VF6C 2Y64A 4ITCA 5BUVA 1Z7S1 4Y4YA 3HAGA 4F4LA 5I0UA 1VB4A 3OOXA 4M3CE 1VF6A 3JASA 1RUG1 4W4KA 1V6OA 3HKEB 4NRMA 3VB9A 1Z0HA 4QX8A 1GZCA 1JZ2A 2PI5A 1AB3A 2UY8A 4TXWA 4F8AA 2VQEB 1WW7A 2YFUA 1CAXA 4LTAA 4FLYA 1SLAA 4NHXA 2HP8A 5J7MA 5LA9A 3JCZA 1LHVA 2PHXA 1BMV1 2EIDA 4UFKA 1OKQA 4CXYA 3I7DA 1D5NA 1A32A 4Y1YA 2UXXA 1QVGU 3GXUA 1YYNA 3AL6A 5CG8A 4EQVA 4LO7A 4FTBA 2ZZJA 4XE9A 1FFXA 3RZJA 2V1DA 3POGA 2GC3A 4NHMA 2OCHA 3QO7A 1OJHA 1W2BU 4OX9B 2RDCA 5FR3A 1Z2GA 4TT3G 3CCLV 3TEWA 3D0SA 1R083 5ITZA 3TWIA 3JYCA 2R1DA 2D44A 5A6XA 1ACCA 1N47A 2JWPA 1Y4MA 1WCKA 4Y33A 3QACA 1FS0G 3TEXA 3H1KH 4LBMA 5CB7A 1V55B 4FLTA 5IHRA 2JDYA 4MHRA 5FKCA 1HNWB 4JZGA 2JE9A 2HEWF 5FMCA 3A4UA 1RJ8A 2XJSA 5IYCO 5DPNA 1IDSA 3OUHA 1W6NB 3CD6V 2HWD2 3PUQA 4QB2A 1QJEA 4FPOB 1URFA 4CEWC 4IEQA 3PU3A 1R6TA 4Z2WA 4O4JB 1V9PA 4QGPA 2VZSA 1MNGA 5D8AB 1DTOA 2BBVA 1Q8OA 3FB8C 5CFDC 3H1IH 1SLIA 5DAQA 2XKPA 2OZ6A 3ILFA 5KX5A 1WD3A 3WW3A 4LO4B 3AB0A 3CXHF 1BQ0A 3WF1A 5CA0A 1UY4A 2ZDIC 1PP9H 5DECA 2ZE6A 2C9KA 1AXKA 4JGZA 3EHBB 3FUQA 5JH7A 2DW4A 1Z5WA 2GZWA 1W9SA 2Y6GA 5FMOL 1HRV3 2JDIG 1HR0O 3GHMA 4XACA 1LOEA 3C3TA 5JJEB 3RYRA 2DWRA 4RHV2 3GBWA 2NN8A 4CCEA 4C1WA 3BKZA 2EBOA 2YEVA 5IFPA 1H0BA 5F3EA 1X9TA 3GBFA 3ZKUA 4X9QA 2Q68A 1YJ9V 4WBNB 2EF6A 1NE4A 3VDDB 3WZ1A 2FHRA 2LTNA 2NN4A 2W0FC 4MG2A 1OOPB 2ZXWB 1XNKA 1SQBH 3B8MA 4Q0QA 4DV5O 4LBNA 3C3VA 3MUY1 1MACA 3UL2A 4CDWC 2G9FA 5L7OB 1M56B 4DRXB 4H2AA 1JXNA 1SETA 2PN5A 2QBXA 2XJUA 2ZGTA 1DQ0A 4AE2A 4TOIA 4PHZA 1PGW1 2BJSA 3TYJA 4O4LA 3HD8B 1DGSA 5CAZA 3G80A 4X20A 5FZKA 5FXXA 2JEMA 3ETDA 3HMYA 3K2OA 1O8PA 1MZ6A 4AW7A 2WZPP 5FZLA 3ICXA 4DPNA 2QQWA 3RYPA 2GP3A 1QJY3 3OM3B 4B1MA 1Y6XA 4K1YA 4BQWA 4D94A 4FAHA 2EIEA 1YXWA 4FMTA 1H8TA 1IOAA 2RR11 3ZHTA 3SQOA 2BNOA 5IVEA 3SHRA 3PMSA 2D6NA 1Z7S3 3DGEA 1QHDA 3K08A 4DV2B 4AI9A 1PK6A 2R49A 3WY6A 4SBVA 3JD71 1LEDA 3VBHC 2A9HA 1SFNA 4XIKA 2QCSB 5GW7A 2IFWA 4F3JA 5CKQA 2PF4E 3F5WC 4F7ZA 3WSOA 4Q26A 4Q20A 3B9CA 3G6BA 5A7QA 4QJFB 3N2KA 1WPXA 3NAPA 5IY5C 4BB3A 5C8CC 1QJZA 1DF0A 1UMHA 3O1RA 4JI1O 2BEOA 5D1IA 3ZYHA 2GN3A 3J7HA 1Y76A 2EJRA 4XETA 5C4WB 4DK1A 2ZAHA 2FDKA 3A22A 1HN0A 4E8CA 4AEDA 5C9AB 4JDOA 3DKWA 2WNUB 3X29B 3SC7X 4Z1MG 3P32A 4Z8BA 3AJYA 1Y9QA 5HI0A 2WLNA 1EN5A 3MF6A 4YVSA 2JIZG 5AVPA 5HXMA 5I91A 2LM3A 3UM7A 1FJGB 4KGGA 3RYIA 4EJRA 4YVSC 1JMKC 3U75A 4MVRA 4I01A 2OYZA 2F4VO 4P5YA 4RS5A 2ZGUA 2B39A 4JV4A 5BMVA 4CEYA 1GWMA 4BLJA 1VARA 1RM1C 4HBNA 1W8NA 3GVMA 1S2EA 5JCOC 3VQVA 3MW4A 4QMAA 2TUNA 1H1AA 4YGEA 5EXOA 4CU9A 3VZNA 3LNMB 2CHHA 4LH7A 3CEIA 4TWKA 3DXRB 3HQRA 3LPFA 4XUQA 1YQCA 1NS1A 1Q56A 1MEC1 2KXLA 1HDKA 1N34O 2ZHLA 2A73B 1UY3A 1AVBA 3T1MA 1NQDA 3CRAA 1AR92 2X05A 2JDKA 1ZBA3 1W9FA 3AG7A 3KCXA 4CUCA 2W92A 2JG9B 1NTZH 5JVVA 3IC9A 4KUMA 5TSWA 4CTEA 4CP2A 1HN1A 4K8ZA 3SISA 5FO9B 1LESA 2NQYA 2D3OW 3AK1A 2WZ8A 1FYUA 3WP6A 2VQAA 3BPZA 1TVGA 3CBNA 3E86A 2B42B 4RYDA 5LW9A 4YJ2B 2HWC3 5CADA 3RPQA 1CXZB 4BQ2A 1DZQA 3K06A 3WG1A 5JCTA 4AI1A 1YIJV 1XREA 2ZX1A 1KKCA 3CPWU 4YZ1A 3Q9OA 3SXWA 5CB4B 3I2GA 4GKJB 2QQJA 2VZVA 3OTOO 4DV4B 1UZVA 4XFHA 4AEJA 2HR3A 1GU3A 2UXCB 4RFRB 1OUSA 3LF7A 4GZ9A 1SQ4A 4ZKIA 1UPSA 1O4TA 3KM5A 5J9PC 1FOD1 4OUSA 5LRRA 2BOJA 4LHLA 1IBLB 4LORA 1PL4A 3AVSA 4CU7A 3DC6A 2L35A 2CWMA 2FCVA 2XVGA 1BCCH 2BERA 4LITA 4DV3O 2X53S 3I3DA 4FLWA 4QE9A 1ND2B 1TEIA 2Y26A 5KHJA 1H6XA 4RL7A 3H8UA 2XHKA 4FAGA 3VGIA 4I0WB 2OXBA 2WRAA 1V6IA 3K03A 5LYJA 3SPCA 3I59B 3ZXKA 1VBC2 1RUF2 2QQPA 3JAMN 1PZ9A 2Y4TA 4RS5B 3FLTA 1YIFA 2RS12 4XBLA 5FPOA 5EC2C 3THOA 4N7UA 1H1IA 3RYIB 3BB6A 4QNHB 4YVSB 4FVVA 2WWSA 2JJ1G 1I94O 4P9YA 4UFLA 3ZFGA 5AFBA 3OD0A 5FK8A 3NL1A 4K3UA 3VD9A 1NKDA 1VQ9V 3AXEA 4QDRA 3WNPA 2CDOA 4GXLA 1G9AA 2Z5UA 2DBNA 4XQ4A 3VOUA 3T4VA 1VQLV 3VL9A 1BZKA 3L75H 3LDCA 4LBQA 1ULCA 1CIWA 5F6LB 1H4GA 3UT5B 1BBT1 5FY8A 4GALA 4EZ4A 1ND3A 3S7EA 1Q8SA 4X8NA 4XFFA 4CCOA 1W90A 3SJBC 2W08A 2QTOA 3AKRA 2VM9A 4CUGA 3AG2C 3OPWA 3ZFEA 1UO9A 3RZGA 4HLTA 3VD7A 1XRUA 5L9VA 1PK6B 5IVBA 3BI3A 2ATFA 1JJOA 1Z78A 3MIFA 2Z5WA 1V9U1 1TUEB 3RYHB 1AR63 2JS3A 3H1MA 5DUUA 1SFPA 1RUC1 1B35C 3SCHA 3MF9A 1RUH2 1J84A 1JUIA 1CJDA 3R4DB 4H14A 1R093 3SPIA 1JHJA 2ZR2A 1CEZA 3OYWB 3OG2A 3K0DA 1TQ5A 4XUTA 5AC91 2EIBA 4MADA 3MEPA 2IH3C 4BYYA 3I2OA 1LAJA 3M7MX 5L7OA 5C3PA 2BRTA 2B1GA 5E1AC 4FPHA 5F32A 3TAYA 2UY9A 1F5JA 1C1LA 4QPYA 1CX4A 4BIZA 4XFGA 1RVF3 1XNBA 5LK7B 2VD7A 4UFJA 1O6UA 3VBOC 5CU1A 4N23A 3JUUA 3ZYPA 3AFKA 4IL7A 3O14A 1WUVA 5G05L 4AOCA 4LFAB 2QKSA 4J1XA 3FB5C 4YPJA 2DCTA 5A7SA 3THTA 1DQ5A 1ZL8B 3Q8AA 3WDVA 3FC0A 3LGRA 2GC2A 2VCBA 1N32B 1KEXA 4RSUA 2MK3A 1F8VA 2RDRA 1GWLA 1XOYA 2IU3A 1REDA 2P34A 4KG0A 3VBSB 4JTNA 1XUQA 3SJAC 1VMJA 4JDNA 4N7IA 5LGTA 1MABG 3WVJA 4CBCA 1Q8VA 2CDYA 4RGKA 4RQPC 2P7TC 4XTMA 1UIKA 2JRIA 5FOJB 3ACGA 4A45A 1N33B 4ZXKA 2JICA 2F66C 4PF1A 1DLCA 4YGBA 2YFZA 3JALA 4D6RA 3SLIA 4NPLA 2YIDA 5B5EZ 3LZZA 1VBD2 2A3WA 1T5EA 3PNAA 1WLEA 5D8AC 3I2HA 2VVFA 3UT5A 2VCMA 1VBE1 3CMGA 2ZNIA 2WNVC 4XVHA 1W6NA 2KA3A 3ABKB 1VBC1 3GZUC 4QPIA 1IPJA 4WVZA 1VLNA 4Y5TA 2W46A 2RS11 2PI4A 5FO7B 5BNNA 1GN6A 1RINA 3B3QE 4E2SA 3VBFC 4META 3QTCA 1V6MA 2WS92 1C57A 4XZPA 4LHSA 5GTHZ 1RUE1 3UJOA 1GN3A 3K77A 1R1A3 2QM8A 1GP5A 2VZQA 3D36C 1R6NA 1NCRA 2ZGOA 1ASJ2 2WINB 2DU1A 1J59A 3MLKA 1R64A 4BR6A 3LDDA 3GWKC 1N1SA 1JI6A 2JX9A 4BJ0A 1FFXB 3JBG1 5FTTC 4BWOA 4NHKA 2QDNA 3CNAA 1QQP3 1H9WA 1LOAA 1LR5A 4DEQA 3T1YO 3ZFEB 1OSGA 1YJKA 4JI5B 4CXWA 4ZI7B 1ND3C 2I07B 2QDOA 1N33O 1BEV2 3MLJA 3ECQA 1BK0A 2CAUA 5KMGB 2CNAA 3HKEA 2HLDG 4H0LB 1ROPA 1JZ3A 3M2MA 5FLHA 4CCMA 3VD3A 2EIKC 1NCQB 4IEYA 3OGVA 4NXMO 4B1LA 1MS3A 1VEWA 4LO6B 5EV7A 1AR61 1XHZA 4JQRA 3IAPA 2X10A 1ZZ8A 4ES8A 5GLWA 1MZFA 3OY8B 3HKCB 4N53C 2HWB1 2G1MA 3B9IA 3OPZA 1O7FA 4PI0A 3AVRA 4JYBA 4PA4A 1CX1A 3ILRA 3THCA 2RS51 3FMGA 3T0AA 3ZIXA 1PHMA 2NNUA 5KHHA 5A3UA 4DB5A 3KMHA 2XWBB 3ZYRA 4NMIA 3DF0A 1PIV3 4Z92B 3LNNA 1DGRA 3CU7A 5DUXA 1YITV 3BVOA 1NZIA 1GZWA 4LR3A 1KU9A 4IV1C 3LQCA 1WW5A 3ZSEA 3N36A 4D3WA 5FXZA 4R9AA 3I2IA 3APBA 4J80A 3JD2A 3DXUA 1KDKA 4PI2A 1Q8IA 5L19A 1XNCA 3E8GA 4IYIA 4XHXA 1FXZA 1ZTEA 4U7OA 3TN93 4Y3OA 1RVF1 1X4TA 4CS4A 5F2SA 2MEV3 1P7BA 4AFDA 2DVDA 3FLRA 3DXRA 4TTGA 1YNAA 1XB9A 1O3QA 4RQFA 1GFF2 5DDJ1 3POYA 3BY6A 1K73W 2B46X 4LO8A 2A75A 2Y0PA 3M8LA 5J1XA 1JUHA 3AKSA 2VCCA 4MVOA 2NP0A 1VIBA 5FOBB 4MTFA 3ZSKA 4MXWA 1JW6A 4ATFA 5J36A 1W9YA 3HBZA 2XLGA 5FZIA 2UXNA 3AMQA 4AQ2A 5HCFA 3AMPA 3V0AB 3EHKA 1PO22 3VDBA 3BCCH 4YJ2A 5KXCA 3C7HA 1AJKA 3JSNA 3A0KA 2IUWA 2QWPB 3PVNA 1X59A 1Y9MA 4COYA 2W91A 1YQ2A 4Z2AA 2J1AA 3WG3A 5JXIA 1XJAA 3E5XA 2WNUA 1MQTC 2PHUA 4UXAA 1J1TA 2VZUA 3A8TA 2SBAA 3L71H 1X8EA 2WO1A 1DIWA 4YNIA 4SLIA 3MFAA 4IXLA 1ZBE1 1HKDA 4CZZA 2XAHA 5DQ0A 4LNVA 4CYDA 1ODNA 2ITDC 3B5LB 3LSEA 4BLIA 2Y0IA 1QY4A 3N9QA 5FUNA 2WS91 1HRI3 1YIPA 2JDNA 1GP6A 5B66Z 5FYHA 2VTFA 5IWFA 2C6SA 2GTAA 1RUE2 3LB9A 2CTVA 1BLZA 2Z79A 1CAWA 2JE8A 5LA0A 1CONA 1TMF2 1G1XB 5BNOA 5JOYA 2UXDO 3AG1B 1SMVA 1GMGA 2IXCA 3JBG2 4QQPA 5A1LA 4DMIA 5DZEA 1KFXL 4FIPC 4TV8A 1FKAO 2ZEZA 3AP5A 1JZ4A 2W94A 1AX2A 2J7MA 3WNXA 1PGL1 4LHKA 2WLKA 1PMHX 2C24A 2ENRA 5K0UB 5KHIA 3JARA 3JSLA 3ORJA 5FPVA 4CC5A 1W8OA 2F1MA 4WM8B 5LA2A 1M93A 5FBJA 2HKXA 3LWCA 4GQ7A 2CYFA 1DZRA 4LBJA 4AEDB 4I55B 4GH4C 3M3QA 1K9MW 4Q4X2 1Y76B 2CTQA 5F39A 4P2ZA 4EFEA 1BKZA 5CISA 3USUA 4WVMB 1JZ6A 4EFBA 3HPNA 3VQYA 2CU5A 2JIGA 4AAPA 4RN5A 3W59A 4FFGA 5AVAA 2HWB2 3Q8CA 4QXCA 5B2GB 2K0GA 4HVRA 2YEVB 4YJ3A 4FLUA 1R1ZA 4QT6A 1RXFA 3KT4A 5A6YA 3ABMC 4Y20B 5GLZA 1GN4A 3IAQA 1H30A 3VBSC 2LUWA 3JAWB 4BQ5A 1YVWA 1GYKA 4JI0B 4AI0A 1NUKA 4DINB 2CAZC 3AL5A 5A70A 5H6QA 1HB2A 3AMMA 1NLSA 3WDTA 4CCDA 5LMNO 2R9AA 1GICA 5FP3A 5FZEA 2JJ6A 3E8HA 2A71A 4BQ4A 1QJFA 3D8CA 3VD5A 5H9SA 3MAQA 3ROUA 2EXKA 5HV4A 3HN1A 4QX2A 2QQLA 4GMP0 3L72H 4NTWA 2YYOA 3NVCA 2PYJA 2VZTA 3N9PA 4DQAA 4I7ZB 3IBMA 2C26A 1OF4A 4I0AA 1QF3A 4LUKA 1RL3A 2QQIA 4JI3O 2IBZH 2WWJA 4JV5B 2W1UA 2G9ZA 4O4JA 1FMD3 3HNBM 5FMOS 4AHXA 3KG2A 1ENXA 3GCXA 3R4UA 1FXVA 4D6SA 2LGWA 1LEMA 1EN4A 2QKDA 1KB9F 2P6JA 5EBWC 1RITA 1MZ5A 2L9LA 1GP4A 2GN7A 2E51A 4AEKA 3N7MA 1PNGA 4EN0A 1FJGO 3AKPA 1AYN2 4BMBA 3WD5A 3ZHRA 1N0JA 4XDLA 3OMAB 4BIUA 1ULGA 1BVVA 5FZOB 2UURA 2VW2A 2BVVA 1QXJA 1DLBA 1IURA 2CE4A 3AEIA 2ZBJA 2BWCA 1KUQA 1ZZBA 4IE7A 3RYHA 3TN91 2EILC 2ZMLA 4HK9A 4BHPA 2PAEA 2PFWA 5LMUB 1ZBE3 5JZGA 2YIBA 4LHNA 4OPAA 4X64B 5JJJB 1R1BA 1K7DA 1LUWA 4L92A 2PLV2 5D8AA 3GBGA 1VRH2 2GSMB 4NIDA 3BOWA 1HXS1 1IG0A 1VR3A 4UCVA 4WM7C 3HR0A 4LF9B 3FBMA 2HJIA 3OBRA 3CCJV 4ZBMA 4XPVA 4BOWA 4DOUA 1WN7A 2RS33 5DUWA 3EYPA 1SQGA 4PT6A 4BK4A 5BNOC 3DTUB 1GZTA 2YB7A 1Y43B 3B7MA 4EN7B 1QJU3 3BODA 1KITA 4AI3A 4LIUA 3CEWA 1ZRRA 2R32A 1LULA 4FPCA 3H8XA 1CD3G 3RWKX 1QJY2 1VP7A 2I45A 3SH4A 4JHZA 3E5UA 5ITZB 1TNRA 4RS5C 2QEXV 3AC0A 1XXNA 1COV3 3IM0A 4FFFA 2O8QA 1Y74A 4LKFA 1YHFA 1AX1A 2FBEA 5LGUA 4E2GA 3D36A 4A7ZA 1NCRC 1C8M2 2P3IA 5E88A 2W5FA 1RHI3 2BOCC 5GALA 2ZKOA 1N3QA 4J6GA 4FTSA 2MPFA 1SLLA 2E32A 2WLPA 2EAAA 1SCRA 1H2SB 2RN9A 4XXAA 2QWOB 4RUEA 3HT1A 2GBOA 4DW1A 5F1RA 1S5JA 4RWUA 3ZMVA 1OQEA 2LW8A 1J5EB 2KR2A 4CH6A 3OMNB 3PN1A 1A8MA 3GZEA 4MHUA 3ZXGA 1QEXA 2JDPA 1G9FA 1FPN2 4LOSA 3ZMSA 2O14A 3VBBA 3RVYA 2FCUA 5C93A 2ZEWA 4PF5A 2RR12 4WF9V 4OFGA 4CPBD 5LY2A 4BM8A 5A3MA 5L3EA 2WA4A 1AROP 3O1VA 2G38A 4QAWA 5CB4A 1K5SA 1X36A 1LOFC 1QXRA 4CDQA 1ZRFA 3ABUA 4O4HB 4PIXA 5A7NA 1MVQA 4CDQC 1B35A 2WJSA 4LO5B 2VNOA 2PXJA 5EIYB 1RMU2 4I0XB 1HJFA 4I4TA 3J8F1 5DN6G 1SPPB 4L8QA 1A3KA 4NHLA 4P5HA 4QX1A 4WFGA 2EXIA 4OULA 4XHBA 2B5UA 3DC5A 1IS5A 2X6CA 1RUC3 3VBUA 4G4FA 5IYBO 1CPNA 3ZR5A 3UV9A 3MIEA 3ZFFB 1N1VA 1XBFA 4IEVA 5I8SA 4NIIA 1QGLA 2CY6A 2HLEA 4A5UB 3VHPA 1V0AA 5GZEA 2P1BA 3SR2C 4JYCA 3AK3A 3H7YA 1NZCA 1H8HG 4B3TO 5KUKA 1AYN1 1ZRCA 4R4XA 5FO8B 1PVC3 4NRQA 3LE0A 1W8HA 3VZLA 3GHNA 2D97A 4V2WA 4TUYA 3IWZA 5FV3A 4XJZA 5A2QN 3RJRA 4P9PA 2OIEA 4GCZA 2LP7A 1FFTB 3UK9A 1JCHA 3KF5A 1WAZA 5KHKA 2R9RB 1HV1A 1A8DA 1AR72 1SKVA 3MGUA 4UVAA 3OEEG 3AZYA 4MW8A 4BQXA 3B69A 3S30A 3W7UA 3QVNA 1GNYA 1CAVA 2QWRB 3KZ4C 1J3QA 2CK3G 3G6JB 3T4ZA 4K21A 1CZVA 2E26A 1BJQA 3RG0A 5FZAA 1V54C 2GSYA 4V2VA 4RQPA 4GZRB 4CCKA 4JGYC 5K1XA 3I55V 5ANNA 3AG3B 5JQGA 4Q4V2 5IJ9A 2A3XA 2WNEA 4CDXB 4UW5A 1F4MA 4JI2O 4YG6A 5CKNA 5IY5B 4QHBA 5D5PA 3K4ZA 2WLIB 4DUZO 3NAPB 5LMUO 3N2KB 2ZPXA 2JDHA 4M01A 3NV3A 5BNPA 2Q1FA 3N9OA 1XL4A 4YIPA 3O0VA 3H1WA 1AR1B 5LBCA 2E7AA 4DXSA 1E5HA 2C4XA 4Q6GA 4DO0A 2H3OA 2ZHKA 4LT5A 1P8JA 4N53A 4MT8A 2QM7A 1MZEA 1DZTA 4ZOLA 2P4EA 4O2AB 1SEFA 2R16A 1AJOA 3PTYA 4ZKTB 4JF3A 2RDNA 2QWQB 4JI4B 3U10A 3F2ZA 1YI7A 1Q90D 1HXS3 2ET1A 4AILC 3CP1A 5K0UC 2PQSA 4XW3A 3WB0A 2YSUB 4FSJA 2RQ6A 2QQUA 4LUMA 4QB1A 4AG4A 1J1LA 1K5MB 3DXTA 4GH4A 4ZZ5A 1S1AA 4ZS2A 1WGPA 4UV9A 2VQFO 4JKKA 2A3QA 1GK9A 1SLCA 1VBA3 4DV7O 1JR9A 1OD5A 3NNFA 3QBQA 4WM7B 4RR3B 1HW7A 1RUF1 4NXNB 1RUJ2 3ZVXA 1IPSA 1VBB1 3IDCB 2W6JG 3VDDA 4Y5Z0 1PNMA 3L2YA 3H01A 2X5IA 1COV1 2ZXQA 5A7PA 2OA2A 2TNFA 2VRZA 3K79A 3ZHQA 4FVMA 1GMMA 4XYXA 2DWEC 4XJUA 1I5YA 5LMNB 4YVWC 3J8F2 4CU6A 2EILB 3MYXA 1D2QA 1V6KA 2XVKA 2Q4SA 3B40A 4M4RA 4IEXA 2VS0A 3E97A 4R7CA 1CPYA 1W59A 3GJAA 1SDDB 4JGZB 1KXGA 4ISRA 2FMLA 3LCPA 4GB32 5F7UA 3A7QA 3A0HZ 5FYUA 1S0EA 4XDJA 1ZZ7A 1NQTA 2QQVA 1QH7A 5DABA 3PU8A 3T2MA 1LNSA 4OMDA 2OVUA 5CFDB 3A2FA 3ABZA 2JG8B 5LGNA 1SS3A 1BZWA 3IDEA 3OJBA 2N7GA 3WDWA 5T5PA 3EO6A 4Q4Y2 4TQDA 5I8YA 4YM2A 1BHBA 4YW2A 5A7WA 3ENRA 3O65A 5JPMB 2GAUA 3P5BA 5FYZA 4PCRA 1GR3A 1G4YB 1KJRA 3BYWA 2PTMA 3T08A 1SBDA 1OI6A 3C7GA 3N35A 2VMGA 1KYOF 2EJ7A 2ARBA 1QR9A 3CJHB 1LNQA 1SERA 3OGSA 5KA6A 3W7WA 2UU9O 2XMLA 4IE6A 5ACA2 4IIJA 5BY1A 4WFBV 4BIOA 4GWNA 5DDJ3 1N4CA 4AZZA 3VKNA 4O2BB 3KV5A 4EEQA 1YQ6A 3WP3A 3VQXA 1WMFA 4OPHA 1R3JC 2CTPA 1SACA 1OLME 1YO8A 4Q4V1 1JTZX 3H3UA 4I3PA 1L7RA 3ZRWA 3MIHA 2BBAA 4X1YA 4JRLA 2OPWA 4U2AA 3R66A 5BNQA 4YXWG 1F4AA 4O4IA 1VQOV 5FZ1A 3LEKA 3E83A 3JD3A 1MG1A 4XMIA 1EV12 4DR2O 3E22B 2VXJA 2ZEYA 4D6QA 4F6RB 2LFRA 1UZWA 2QVSB 3CO2A 4DK0A 4CDWA 3I97A 1IX9A 2B7YA 3KD4A 1OLRA 2Y6FA 3BRCA 1XYOA 4C0HA 2A7WA 5JDBA 4FPKA 4G3YC 5JSPA 3SITA 3ZIWA 1Q81W 5IYZA 4M3CB 1H38A 4UFMA 1ZZCA 4PDWB 3VD4A 2WS93 1HRI1 2EULA 4WM8C 4GWIA 1V6JA 1L1FA 3W7XA 2WSSG 1BK1A 4IE0A 4XDOA 3QNEA 2CL2A 3FAVA 1KP3A 3ETGA 2E5LO 1JYXA 3MUZ1 1X33A 3DPRA 3ASOB 1VQPV 1BS3A 1JODA 4IGQA 1FOD3 2Y8KA 1POQA 2JGDB 5EZYB 3GGLA 4XCAA 5IT9N 1W8FA 1VBA1 5CFCB 4J7JA 4FOVA 4MXVA 4AQYO 1TVKA 1ONAA 4I2OA 2ZX4A 3K57A 5CBFA 1VBB3 4DXWA 1AXZA 3VBFB 1YC61 3IN9A 4QQOA 3WCRA 1Q7YW 1W0KG 5JVDB 1ST8A 5B1BB 5IVJA 3WB1A 1W2OA 1N36O 4B3MB 1M9NA 3IC7A 3KGLA 3OCPA 5F5AA 3SMHA 2YI8A 4ABMA 1W2NA 1DG6A 3ABKC 2DUOA 1ASJ1 1LHUA 4X65O 4QDSA 5H5NA 3B00A 1PM9A 4ZHQB 3IKWA 2F93B 1VMGA 3UQ8A 4HONA 1J58A 1Q8QA 4XFCA 4BW9A 5IJ9B 2V4DA 1F7YA 2GDSA 2FYUH 2HG5C 4E8DA 1NY72 5EBLC 1SRYA 4LF7B 4OVEA 4JI7O 2AZ2A 1QNYA 2PAMA 4RQPB 3W20A 4XBFA 4HPKA 3P1IA 4EWEA 1JQ0A 4OXSA 1O3TA 3T4DA 1D4M2 1VIWB 1CAVB 4NWWA 4C90A 4NR1A 1DFQA 2DURA 3AK0A 3Q4HB 1PO11 3BA8A 2WABA 2P5BA 4WFAV 1AR81 1SQVH 4FXKB 1LU1A 2YUEA 3HOBA 1XNAA 2QFEA 4B4RA 4CDUB 1UAIA 5K4LA 5JCOA 1BHGA 4DFSA 1POV3 2IW5A 1S0IA 1ZZ9A 1L0NH 3NJXA 1SZXA 3OGGA 4B29A 2QUOA 4M0NA 2GV9A 4K35A 1OH4A 5E16A 4HKLA 3AZZA 1JBCA 5JMCA 2VTXA 4W50A 3S3XA 2YDEA 1HNXO 4NPMA 3VN4A 3LSDA 2BTQB 4OUEA 1MMMA 1Q6IA 1QR8A 2A6YA 1R091 1PO23 3RJ2X 4LR4A 1TME2 3KV4A 2DQ3A 2ZM6B 2ADQB 3MW3A 5C8WA 2VMDA 4FO9A 5LBEA 1K45A 2HYKA 2PHTA 4B3RO 2PAKA 4BXSV 4YM3A 5A1FA 5KUMA 2A70A 5FLXN 1ODMA 3DL3A 2EZOA 3MBWA 1EV11 4FQZA 4XAEA 5B3SB 3CZUA 1QDOA 1B35B 1UYPA 1E1QG 5FYTA 2DVBA 2YY1A 4DEVA 3HVDA 3E6CC 5EYYA 1XEQA 3F7YC 5JSRA 5C3SA 2Q6AA 4EB6B 2DVFA 1W9WA 3VBRC 4A41A 1XL6A 1XU1A 1V70A 1PK6C 2XBO1 4MVMA 4XQDA 1IBMO 3ATGA 3THDA 5F3GA 4AGRA 2GALA 5KR7A 1HX6A 1UXZA 3I2KA 3R4SA 1DYPA 5FP4A 5FDBA 4KFMA 1NR7A 3CL1A 1SZBA 4KI5M 1LOCA 1MR5A 4W6WA 5JVDA 5B1AC 4JI2B 3N7KA 4LNUB 4U36A 5J3UA 1TZOA 5DZGA 2QGNA 1N32O 3FHAA 4W65A 4YHHO 1TVKB 4JC1A 1EY2A 5A80A 4DV1B 3SCGA 1OC1A 5FYYA 5DEDA 2F4PA 4I30A 2ZGMA 3BCWA 1YDXA 1B3QA 4MLOA 3ZXLA 3N27A 1G7YA 4RHV3 2OPKA 1I1EA 1W05A 2WBKA 4C8DA 3N2GB 4Y5SA 1PKXA 1N0NA 3ZHUA 1EUUA 4DUYO 2WDBA 4K1ZA 3DPRB 4F83A 3TOJA 3OTFA 1QJX1 3RI9A 1YI2V 1SA0A 3T1HO 3M1HA 1U12A 5FYVA 4Q4X3 1ZSPA 3TXSA 2DDUA 1W8TA 5HXVA 2I74A 4XDQA 2ARCA 2WNVB 3QG5A 4FQ4A 2ZABA 4G27B 3RYKA 1LKNA 4JHTA 3M8AA 4N8MA 1ND2C 3BA9A 4XDKA 2OCCC 2HBUA 5F3IA 1AR4A 3W7SA 3TGUH 3LIHA 3JAKA 5DM6V 1R1A1 3NAPC 4YW7A 3C3SA 1YJNV 4AFCA 2CTRA 3UJQA 1GM7A 1RSOB 2X09A 3FB6C 3LEMA 5KXBA 2PUSA 1PM7A 3ACLA 2O0OA 2Y6HA 4QPWA 3F5TA 1VMHA 5A33A 3V0BA 5H9RA 4CP9B 3WNOA 2C1FA 2HWE2 4R9DA 3FHQA 5T50A 3BGAA 5CA1B 2D3RA 4HETA 4QGMA 3K0GA 5GONB 1DP0A 2ZGNA 1UZYA 2UYBA 1REEA 3V0BB 4O2BA 1XBLA 4O61A 3IZOA 1M57B 1S0BA 3GZAA 1OQ1A 1O8SA 2BDRA 4QE7A 2C2AA 4I9QA 1DF5A 2JB4A 1VQ8V 4CA9A 5LCWL 4CCNA 2WQ8A 2QJVA 4HZ3A 2EXJA 2FQPA 3C7FA 1TME1 3HPLC 2VZRA 3MIGA 4XJAA 1M4UA 4QXHA 1D4VB 2IJJA 1QNMA 5A3NA 5CBHA 4X65B 2A6VA 2XAGA 3FN9A 1XU2A 5LRSA 2XAFA 2K9PA 3CYOA 1XQ8A 3CJIB 4LKDA 3OR7C 2VC9A 4PBOA 4A6SA 1NH2D 4JI7B 2Y0OA 3LDBA 4XUOA 1X9PA 2P5OA 1OBNA 4AI8A 1POV1 4QM9A 2WWUA 2VZPA 4DV0O 4NAOA 3AX4A 3CLPA 1GQPA 2XBO2 3NWKA 2ARXA 1W2UA 4B3NA 1WZXA 2LRPA 2VCAA 3O1PA 5FNVB 4KL1A 3CC4V 4DV3B 4Y1UA 1SQQH 1LHOA 3ZOIA 1SZTA 4DV6B 2EIMB 3ES4A 3UO3A 1QOTA 2XQRA 3A0BZ 3AG4C 2ADPA 3ELNA 2RV9A 4YFZA 4YJ3B 3R6SA 1LCLA 1AI5A 5A3TA 5B4XA 2X5IB 1EP0A 4FM0A 3W21A 4FBFA 1IGOA 4DR5B 2RS32 4H7LA 2FL4A 2Q8EA 4LF4B 4Y4RA 5C8CB 4RR3A 2QTSA 3K9SA 3NO8A 2DVGA 1ZLZA 2VNGA 4HVQA 1ENQA 3ZRVA 1VP6A 1AP6A 4FK5C 1IS3A 2SLIA 2ET7A 4QD2A 4DV5B 4JZ2A 2Z2SB 2AYHA 3VBHB 1W6PB 3UYJA 1R6KA 5CA3A 3WUDA 1WW4A 1RFYA 4HYOA 3ZDVA 3PURA 1NH2B 1Z7S2 3NJVA 3WV6A 1NTKH 3MV11 1F31A 4YIOA 4DR7B 2UUBB 4IHJA 4Q4W3 1E5RA 1L8DA 4ASLA 2BQPA 2G9GA 4OZXA 3SJQC 4FLXA 3WF0A 1KQRA 2Y6KA 2WC2A 4GAZA 1AJNA 1NLRA 3RMYA 4CZSA 3Q8EA 4LBKA 3ETQA 1ULEA 5HCBA 2VNVA 2BTQA 2Q8VA 1CAWB 1RUI2 1QJY1 2A7AA 3NNLA 3RW0A 1BMV2 4N90A 4R9BA 5B1OA 1YQ8A 3BAAA 1YXBA 4LF4O 3L73H 2DQ0A 5JIUA 3IFXA 4AHCA 3WX5A 2R041 3SH5A 4QX5A 4F6EA 4LF8B 1QXPA 2JD4A 5DAXA 4DR5O 2ZXWC 1FV2A 2YXYA 3FBYA 1BBT3 1AI4A 2XH6A 2QE3A 1IBKO 3I3QA 2VMFA 5IWAO 4AR2A 1JOBA 4COVA 2PHDA 3NNJA 1LTEA 2KQXA 1J3PA 1FI2A 2Q8CA 2QQNA 5E79Z 3QCWA 1NT0A 4TN7A 1LOFA 4URTA 3K46A 2VQTA 1QU7A 3A0NA 4X1KA 4QKFA 1A78A 2XAJA 1I0HA 5JIAA 3RSJA 4ZU7A 1IS6A 1FNYA 1YSCA 2P06A 1X8MA 3P3NA 4BXFA 5GKAC 1YFXA 4I09A 2JG9C 3D0JA 4I9WA 2Q5TA 4MYEA 2ORZA 4LPLA 4J7KA 4P14A 4ZS3A 2VMCA 4MXWB 3KB5A 3VHRA 5CA6A 2IXJA 3VZMA 4DIQA 1P7GA 4GX1A 2HKOA 4OCTA 4NROA 5FWEA 4UFZA 4FXGB 4L11A 2PHFA 2TBVA 4ASKA 1WCQA 2WQZC 4M0HA 4CE8A 2BGCA 4ZPIA 2CGOA 5BXZA 5F2WA 3FB7C 5DXDA 2OT5A 1MSWD 3ZXAC 4UCSA 4LXLA 3L70H 2V09A 1S3JA 1AR73 4XXPA 1C5IA 1WMXA 4ICGA 3R05A 1JYNA 2J22A 5DAVA 5CBGA 2X6BA 2DCZA 3ASNB 2R061 5CFCA 1AP5A 5BXXA 2BW8A 4CUAA 2NPIA 1CAUB 4IHJB 3ME2A 4FPJA 1RB8G 4MS2A 3GCWA 4DV7B 1SPPA 1GM8A 1H2NA 5DAWA 3NV4A 3O1SA 1WLWA 3T1CA 3HKCA 2WNUC 5FLIA 2YC4A 3CRQA 1HQWA 1FNZA 4XZUG 5T52A 1QMJA 5JI7A 1URXA 3IMMA 1S0CA 3BU7A 4HXCA 3WG4A 3LFIA 1IBKB 1UIJA 5LEJA 4JAUA 4FPYA 4NXNO 4FOWA 3AP4A 3LDKA 3O0XA 1JH5A 2OWOA 1FYJA 4AL9A 4FM2A 1QNWA 4BE3A 2BOIA 3N7JA 2GUZA 4AHWA 3Q8FA 1H6YA 3CX5F 2ADDA 2LJ2A 3JD1A 4LEJA 2W68A 3J26N 4TWTA 5F5QA 3LSQA 2CGNA 2WSVA 2ETNA 1G8MA 2OW4A 1WMEA 1M5IA 4IV3C 1H8VA 1XYPA 5LXTA 3VQWA 1VPHA 2E63A 3ETPA 5APAA 2ZE8A 3PIGA 1I9RA 4ASUG 1OUXA 1W2TA 4KWUA 4K8FA 2RS13 4OZOA 3ABLB 1GLHA 2UUBO 2A6WA 2Y38A 4R52A 4WBBA 2WZEA 1RP3B 3TRSB 1OCOB 1OCRC 2UWCA 2JENA 1F51A 2WFF3 5K7PA 3TJTA 3OEAA 4XF9A 3CJIA 4LFAO 1QLNA 3SKJE 2OZJA 3CE2A 2VL4A 2D6KA 3CJHA 2D3PA 3UGHA 4UV8A 2XL9A 2Q0AA 1WCDJ 4QPIB 5FYMA 2XXZA 3WF2A 5L3CA 4BH9A 4L87A 4AK3A 2Z0AA 2HHHO 4QM8A 3VDDC 3AKQA 1W6QA 4DUVA 2WIIB 2BE3A 2ZACA 4NUBA 2XR4A 2VAUA 1R3KC 3KS7A 2JDAA 2DCJA 1SLTA 1NAEA 3MIDA 3ZKYA 2PELA 1MA1A 2P4VA 4PJ0Z 2QR4A 1BYHA 1VQ7V 3SNMA 2NR5A 4TLFA 2CH7B 1QQCA 5EIBC 1YEWA 1AI7A 1UOBA 3HBKA 5JZGB 4B3TB 5LY1A 2CAVA 2F23A 2JG8A 2A79B 4YFWA 4OQ9A 1Z5VA 1HB3A 1K3EA 4JYAO 4MX3A 1P84F 4BQ3A 3RZLA 1D0HA 4EWAA 2ZX3A 2DCKA 2VMEA 4DV0B 4YYOA 5G04L 5FZ9A 2B8MA 1NXMA 4P9JA 2CTWA 1RUD3 4LQRA 2J1EA 1S55A 4H33A 2ZCWA 1I5XA 3KGZA 1WB7A 1M90W 3G67A 2GDFA 5CIRA 3AMNA 1K34A 4NTYA 4ONUA 4PA6A 5JWPA 3FYEB 3NJYA 1MSDA 4NXMB 4B4PA 4GT1A 1M4WA 1AR91 1JHNA 2ZZQA 1EZVH 4CEWB 1MQTA 4P9IA 4UBHA 3WG7B 2EICA 2P4KA 3B4SA 2VUJA 2AZ0A 3OAAG 2UU8A 3D3QA 1DBNA 4LK7A 4EN8B 1NT2B 2LW1A 4S2HA 3WNKA 3LEIA 2WNVA 5JR7B 2JECA 2MEV1 1Q86W 2JEUA 4ZZ8A 5C3RA 3MD0A 1PIV2 1G6NA 4Q0UA 5FP8A 3OYWA 2ZIOA 2LALA 3ZHVA 4LF6O 2Y6LA 3SGIA 4P02B 5LZ6A 4AWDA 1RYYA 1L0LH 4WFFA 1W9TA 2OTJV 1H8TC 1WLDA 5FCCA 1XE8A 3APOA 2ZTNA 1JFFA 3OGCC 3TK1A 3SKVA 1XPWA 1AHSA 1O9GA 1MEC3 2VUAA 1EN6A 5IK5A 4O2AA 1NVPB 3SPHA 1OA4A 3J7NA 4LF7O 4N53B 4N43B 2VY0A 1OPOA 3G6EV 3KT7A 1YI9A 4GULA 5FZFA 2VVEA 1IVSA 5EHDA 3MW2A 4X88A 4P9XA 1UYYA 4GX2A 4WVMA 3J81N 2BGPA 5IYDO 1T2XA 1VJ2A 3CHXA 1LHWA 5CEHA 2WLMA 2ZX0A 3T0DA 4L97A 1ZX5A 2UUAO 2W3JA 5H6RA 1BL8A 4DV1O 1YQ5A 3JXSA 4QHOA 5B1NA 4NIAA 1LOGA 3AP7A 2W47A 1VQKV 1CESA 3I4IA 5T5LA 3ZFGB 3CCUV 4ES9A 3HT2A 2HWF1 4AVVA 1CGPA 3JARB 2GNMA 1XSQA 5CVRA 1LB2A 3CZJA 3V56A 5CZKA 3QLQA 4BMEA 1UOJA 2XASA 4GKYA 2WAMA 5FZGA 3DGTA 5F8PA 3HNMA 2VW1A 3I59A 3H8OA 1K92A 5EC1C 5FFOC 5FYCA 3CF6E 1YTFD 4P9GA 1I7FA 2R072 3OF1A 3S3WA 4Q0SA 3H50A 1HRI2 3SJCC 1VE0A 1K5QA 2JVDA 1RUE3 3ZMNA 5LHHA 4OUMA 3ASNC 2WT2A 1BEV3 1EYBA 3DN7A 5IK7A 4EROA 4EKWA 1O5LA 4MTGA 2W2IA 1P49A 5J2TB 5LA6B 4JI6B 4FZ1A 3KSCA 3ZLIA 1IZ3A 4COWA 1FV3A 4KXRA 2IJIA 4U3JA 5A3LA 4O7XA 2PGGA 1DHKB 2D6OX 2BCCH 2F43G 1JYTA 2FDHA 4MH0E 4JASA 3K4AA 4MVUA 3HQXA 1JYVA 2GU9A 4OLLA 4AFMA 1Y66A 2XHNA 5LOVB 1W2AX 3ZM8A 5FLJA 4XILA 3CIHA 4JV5O 3UCSC 1YWKA 3W5MA 3I5DA 1HNXB 3AKTA 4DUWA 3OGJA 4D0QA 3FYIB 3HQUA 2K46A 3Q4HA 4LMFA 2ZHNA 2DUPA 1TA8A 1Y4WA 2GMPA 3POBA 4UBGA 2Y69B 2D5HA 3NV1A 5FY9A 2Y48A 3IIIA 4JGYA 2JE7A 3OBAA 2VZOA 2FKXA 3ZJZA 3EJKA 2ZGSA 2G4IA 2AH2A 1XNTA 5JZGC 1DDLA 4FM1A 4PV1B 2N04A 2ZR3A 2JDZA 3ZMZA 4E4DX 3RS6A 1GKFA 2B45X 2WLLB 3U0ZA 3CJXA 2FTKA 2UU9B 4MGYE 1ZUQA 2ARHA 3B09A 1TAEA 4ZHQA 3KV6A 3RYCA 1V9U2 5JR2A 4RR3C 2VBBA 3RDIA 1GZ9A 2BNMA 2IH1C 1RUH1 4BU2A 3OSDA 1D4M1 1SLBA 1ZVFA 4K3AA 2BV4A 4QU1A 3AP9A 1FMD1 4XJ9A 2DVAA 1TME3 1K5MC 5EFUA 2PYTA 1XNRO 1L7QA 4DXTA 5AC92 3D3IA 3KVBA 3OGIB 2EA7A 3GDBA 2W95A 3RNSA 5LP6C 4CEYB 5JOWA 1S0JA 2J1SA 2OUJA 1I94B 4COZA 2YGLA 1I08A 5CYYA 1VQ5V 1ZBA2 5LK5A 2QKCA 2DYRC 1B04A 1AXYA 1F15A 1E5SA 3OY8A 2HWD3 4GJZA 3HKBB 2YPDA 3WP5A 4UW6A 1PD3A 4IV3B 3Q8BA 2Q7HA 3E5QA 1M1KW 5C9AA 4AVSA 3DSQA 1UMZA 2FD8A 1W8WA 1GUIA 2VZ3A 5FRAA 4Q29A 2HWC2 2KG7B 3JATA 1GV9A 3VKOA 3RYFA 4E2LA 3GWOA 2FMYA 3P3PA 4BISA 3U37A 4HZFA 1U96A 2P3KA 2PHLA 2VOXA 2VBPA 3QD6A 4J1WA 5A1AA 5D5QA 5IVVA 1BMFG 2YBKA 2EIGA 2W39A 4C91A 4J7ZA 2WZR1 1NR1A 3RGBA 2RM22 2W52A 1K5JA 3UKNA 1K42A 2X29A 1Y9GA 2XLAA 4EN9B 4HOOA 3FFQA 4G2KA 1V54B 2PHWA 4E4EA 2WL1A 3INAA 2BZDA 5AFEA 1S76D 1U5XA 2FZ2A 1SF9A 2LW7A 1PZ8A 2FB5A 3SDLA 2PLV3 4HNAA 1VRH3 3W7TA 4X66B 2E5LB 5F5CA 2DYSC 4OI1A 3ZBHA 2RMU3 2P2KA 1W6MB 3WCSA 1WA8B 3VZJA 4DR7O 2XUMA 4QU2A 2HH9A 5FPUA 4Y1ZA 2Q73A 1MOFA 3RFRA 1QBZA 3OGRA 1WP7A 5BNNB 2YUAA 3AYAA 4IV1A 5SV8A 4IESA 2DJVA 2ZJCA 3TCUA 1JU3A 3VKFC 1PZ7A 4OGQB 1KMIZ 2XGXA 4I5SA 2AHZA 1J3RA 3WEZA 4RA0A 5IJRA 3IGAC 3OW2U 2HVJC 1ZZ6A 4WBNA 5DMYA 1GOHA 3FX3A 4XF0A 3UETA 3AZXA 4MV2A 2XNDG 5A7WB 1TNFA 3T3YA 1HQLA 4Y22B 1EAH1 5H2FZ 5CNAA 2XWJB 2YV8A 3K3WA 1FXHA 1G86A 5BZBA 1BXHA 4LH6A 3WU2Z 5F2VO 1YFYA 3ZMUA 4LP8A 1IS4A 2K9ZA 5CFDA 3ZPOA 4PLMA 2DU0A 1O3RA 2PHRA 5ANQA 2QKAA 4C7UA 2BFUS 4QPKA 4AVAA 1LENA 3VDCA 3RVZA 1PO13 2Q9LA 1CN1A 1PNKA 3KHBA 2QZ2A 5KBFA 1RJ7A 4PLNA 3FJSA 2AEYA 3ZX6A 5CA0B 2M6YA 4FLVA 2K1EA 2EALA 5T5JA 4FCAA 3PUIA 3PLQA 3FD9A 1AR62 4AGVA 5FL7G 2R70A 2WAOA 3BEHA 4JDMA 5FXWA 5BY5A 1XMQB 3E1F1 4YRDA 2J42A 3WB2A 1EFRG 5FZ6A 3PVBB 3NNGA 4MO3M 2HWE1 4OHXA 2DTYA 2XJVA 4N9HA 2P17A 3WW4A 3PJSK 3E8FA 4Y1XA 1EZJA 2P90A 1X50A 3DYMA 4E4SA 4E27A 3WT3A 1WBFA 2OCCB 1AYN3 1KGYA 1XNRB 1AR83 2VWJA 1DGWA 1IG3A 1UU6A 3ZN6B 3C90A 4CCCA 5J2UA 5FYBA 1OCZB 5ABJC 4XJWA 1WA8A 3ZN1A 2M7WA 4TV9B 3VL8A 1GO3F 2Q0OC 5FY1A 1AI6A 4GKKB 5FPBA 3USSA 1GM9A 2ZAAA 5K0UA 1GSLA 4FLZA 4LLOA 1K12A 1H8EG 1UCXA 5IWAB 4PIZA 3K75B 2EIJC 4J9YB 1GWKA 2UUCO 4TV8B 3GALA 4KP4A 2PA7A 3WHUA 4OYUA 2DUQA 5LBQA 5FPLA 3VKLA 1SCSA 2QNKA 4AQSA 5BNOB 4BWAA 4NHYA 3E8BA 3H7JA 1XE0A 5A7OA 1PNLA 2WZR2 5C9AC 5KHGA 1ZA4A 2WFPA 4JX0A 2XVLA 3BVCA 3H9VA 2C9AA 1AYM1 3I3BA 3JU9A 3JB4C 5B1AB 2W1WA 5L9BA 2FMDA 5CN0A 3VHNA 4ATEA 1AJPA 2BNNA 4K8XA 5LBFA 5IK8A 1JYIA 3U4XA 2YBSA 3ZRXA 4UCRA 2VOKA 3NQHA 3ZYFA 4R9CA 3L2HA 2VQFB 3GM8A 3ZMOA 4IL6Z 3H3ZA 4JZRA 4ZU5A 3PVOA 1EPWA 4HL0A 3VZKA 1CP9A 1XYNA 3LA7A 2H0VA 1S0FA 4DR3B 1UOFA 4FZ0A 2GP5A 2CDPA 4JI6O 2IC1A 5JSOA 3LPGA 1F35A 5KWRA 1K4CC 2VQUA 4Q4X1 4QX7A 3SYOA 1JVMA 4A3XA 2ZE7A 3F7VC 4AXOA 2X7RB 2UUCB 1BQPA 5I93A 1TMF1 3B93A 1RUI3 2WO2A 5T3NA 1PGW2 3MPBA 3AXDA 3HJRA 2N74A 4QPGA 3ZYJB 1ND2A 5KA5A 1FPN3 1YLLA 5EYPA 2UYAA 5C5TA 1PGL2 3NMBA 1UKGA 1AL0G 2DWDC 5FZ3A 4FTEA 1BHAA 2E6VA 1MS9A 3AM2A 2XJQA 4LFBO 1OOPC 5ISLA 4KNCA 3RYCB 1KJLA 5EYPB 4COUA 2OQ7A 4GKXA 1LOBA 2D40A 1UJWB 2GMMA 3S7IA 4NN0A 1OKOA 1QJX3 2PQQA 2V72A 2GH8A 3JD72 4LBLA 2Z42A 3M7AA 4YY3O 5L73A 1APNA 3IDAA 3LIGA 2JS5A 1GZWB 1ENVA 2FDJA 2LS6A 2VOTA 4OMCA 3WUCA 4H7MA 3FZ3A 1RUG3 1GKBA 2ZEXA 3M70A 2R042 1VAVA 3DUIA 2E75B 4EN6B 1F4NA 4FI9A 3OE7G 2ZKLA 5B4NA 5GLUA 3HNYM 3JCIA 3FLPA 3CMAV 5LOVA 1FAFA 4GYCB 1EAH3 4AVBA 2K2SA 3K3NA 5JLVA 5CKMA 4CSWA 3KKYA 3U1XA 2FDIA 2VWKA 1NCQA 1WLTA 4Q2FA 3TNQA 4U3JB 4IGOA 1H2GA 4M3CF 3M99B 1FATA 1UYXA 1UKRA 2CSGA 3MFCA 2YXHA 1NBMG 4ZI7A 1UL9A 3UKMA 2BVBA 4LF6B 4Y26A 4OHZA 1UF2C 4QPGB 4Z82A 3LDEA 5L3GA 4H3WA 3UESA 5B1BC 5IVYA 4IEPA 3NRUA 3K51A 4MGZE 4CH5A 4W4LA 3CC7V 3S0MA 1V55C 4XQWA 5KC5A 1WKYA 2JIJA 5BMVB 4KQ7A 2KM2A 2ITCC 2IJKA 3MHZA 1OV9A 2GNBA 5A32B 1UOGA 4LE3A 3OB8A 4UCTA 4KG8A 2RDSA 3LOBA 2D6LX 2ZA9A 4YZ5A 1XDCA 1J5EO 3ASOC 2XJTA 5A9GA 4NWVA 1NU1H 1I6XA 3X2QC 1COWG 5F37A 4NOTA 4QX0A 5KXDA 1N3OA 1AYM2 1WW6A 2Q5ZA 1R73A 1R082 4HSLA 4QKDA 1OVPA 1N3PA 5EQUA 3LSSA 2HBTA 3I49A 5J48A 5C4WA 2JK5C 1ZX3A 1YF2A 3LEGA 3B77A 5LWBA 2VQ0A 5KAIZ 3MO4A 4JYAB 4GJYA 3POEA 3VBRB 3JALB 1WWYA 3NKTA 3FE5A 2OT7A 4N43A 2ZDIA 1IBLO 4XF4A 5H9CA 5BYNA 5B3SC 1C8M1 1JZ8A 1OA2A 4QX3A 1AL22 3VBSA 1XNDA 2Q1ZB 1HXS2 2YG0A 4NIHA 2WFF2 2JKBA 4UW3A 4D7YA 3WF4A 3T2TA 3FUOA 1JFFB 3E35A 3H1HH 3OTOB 3PJQA 3PTRB 3BTZA 1OURA 4O9GA 5BPXA 1ZL8A 1TMF3 5FWJA 3J7AU 1PPJH 4D69A 2YBPA 2OTLV 1S2KA 1Y7BA 3VUOA 4UFHA 4HT1T 4RFT0 1UQXA 5J2UB 5C3QA 4MVTA 1FPN1 1WBLA 3ZN6A 4H37A 1T6GC 4O4LB 4CS2A 3WINE 4DW0A 4K6BA 2F6BA 3HEIA 5DZFA 3SEPA 3ZDSA 1MPXA 1BQZA 4X89A 2VE1A 1P4RA 3FHIB 3QH6A 5FAXA 4LF9O 3RMXA 5JPNB 4UB8Z 1GNHA 5L3DA 3LKJA 4JKMA 1GOGA 2ZOEB 2BSKB 4CDUC 3CCVV 2NM1A 3KQ4B 3A21A 4IV1B 1RXGA 2BPA2 4AAXA 4FFIA 1HNZB 4GA9A 2C0ZA 3BPSA 1FOD2 3U78A 5E1RA 3CC2V 4Q8KA 3WNLA 3WNMA 2LQTA 4DR3O 5J96B 1FXKC 2IZWA 5LB6A 1W6MA 1I5ZA 1NLQA 3ZN5A 2B9UA 2DOSA 5EIBD 5FXVA 2JG8C 5GLVA 3T4HB 3H0OA 4MW3A 4ZIBA 5JH7B 4FPEA 4TZDA 4I50A 5FUIA 3WR0A 2RJLA 2J1RA 4JGZC 4BDVB 2FDGA 4X62O 4J11A 1NA1C 3DECA 1XNQO 1O4YA 1JN2P 1V6LA 1NI8A 3L9DA 4X8PA 4P9OA 5FYIA 1N34B 5IYYA 1W3XA 4OI2A 2NYYA 1IKQA 4Y20A 3FKSG 3WFVA 1CVNA 1E57A 3CMEV 1VF7A 1ENSA 4JI8B 3POJA 1QOSA 1XNQB 4TYSA 1F9KA 1YJLA 2C5DA 1NTMH 3ZEDA 1ND3B 1N1TA 2KKWA 1AR71 4TQFA 4RGGA 4WZCA 4XABA 4BPZA 4LBQB 3VDAA 4M4PA 2KG7A 1JZ7A 3B02A 1UY0A 2DFBA 2R063 4BK5A 2ZGLA 4NPRA 1BVP1 4QPIC 1TGOA 1JYWA 3KHCA 1HNZO 3ZIAG 4WM8A 2QSAA 3ZXEA 3ACIA 1Q3EA 1JYCA 1LGNA 1DU3D 1R081 3H1JH 2ORXA 1SBEA 1AILA 2H6CA 3EFFK 1G9BA 4HMZA 3CCSV 3OBTA 4HKOA 5A32A 4LBQD 2WT1A 4JI0O 2EZPA 4L99A 4LKSA 4RD7A 4JKLA 1THZA 5FJKA 4AHZA 2IM9A 5LYJB 2AW9A 3CRRA 3CCRV 3OEBA 3GZTB 2MEV2 3ABLC 1RPRA 5LXTB 3SYCA 1REFA 4YG0A 3BABA 2LROA 3IJ4A 3M3IA 5IUQA 1VF5B 3OT7A 1QU0A 4AQYB 4Y24A 5GZFA 3WQ0A 2DV9A 3WQ7A 1AL21 2VMIA 1O9HA 4K8RB 2D98A 4Z07A 3LDRA 3MPPG 3ZX7A 2WA3A 4JI5O 5JXHA 5M0TA 3T1YB 1W03A 2J1UA 1IXMA 4ZONA 4BIFA 4W6XA 2RVAA 3ETEA 3E6BA 4IV3A 4OHYA 4CDXC 5K1PA 4UAPA 3RT3C 5FZMA 2XJRA 3WQBA 4HKWA 3ZYGA 4NKGB 4YARA 4GIQA 4LJHA 1JOPA 2HEYF 4JGYB 1SQPH 4LLFA 3B94A 4R4ZA 5C33A 1IXBA 1H2LA 3UKTA 4CCJA 3JZVA 2DBIA 2R073 4PJYA 1BCXA 1VBE2 1TUBA 1G6UA 1HR0B 5T55A 3K9AA 5A6QA 4NAMA 2QQOA 1RUJ1 3OD4A 2UXDB 4MVZA 3O1OA 2Y33A 3ITQA 1B09A 3WNNA 2XJPA 1JJ2U 2ZNJA 4IE5A 2QDRA 1VAMA 1COV2 1W8ZA 2N05A 3OUFA 2Q8DA 4RGAA 2TEPA 2F17A 4IE4A 1W3VA 2R30A 1C8M3 2ZS6B 4D7TA 1RHI2 1PVXA 3KT1A 2V4AA 1XMOB 4X6RB 3IPVA 2Y34A 1B06A 2YXLA 3QF7A 4XF1A 4CP0A 4NE9A 1U5ZA 1UPIA 4K0KB 4INDA 4P30A 2E76B 4YW4A 2B4KA 1VBD1 3V65A 3VLBB 3UNPA 3AJZA 2NZ9A 5A3OA 2XG3A 1OHFA 3VBOA 4LFCO 4QKBA 1K97A 2AGAA 1ZAUA 1I5PA 1YHQV 4LF5B 4XURA 3UKVA 2EINC 1I3HA 1RUF3 5FY7A 3LUTB 4QB6A 3MV01 2JJ2G 5FZ7A 3AFGA 3ILNA 3C8XA 4XAAA 4L2NA 4YVWB 4N9IA 4RQEA 4YZ2A 2ERFA 5FP7A 1CIYA 1GNZA 4NVPA 4KBBA 2VBDA 2B9VA 1FT9A 2YROA 2HWB3 4Q8LA 1TG7A 4OHVA 1IQAA 2WN2A 1NZ6A 4R50A 2ATKC 4PA7A 1HNWO 2BGOA 4D8MA 1GQHA 1H1MA 5FPXA 1OCCB 5KMGA 2R7EB 2RS52 5J2TA 5T54A 1PL0A 3O5SA 3STLC 1DGLA 3RRDA 3BTAA 3CRCA 5EWSA 4ARYA 2WUHA 5FJHA 4KHPB 4DXRA 5IK4A 3T09A 4IUGA 2VQEO 3D82A 4YY3B 2ZMKA 3OBZA 3ZO0B 5ABJA 2OYQA 3KQRA 3HWJA 2GHYA 5CMUA 4UCUA 4Q4Y1 2BUKA 2H0BA 1W99A 1SHWB 2B5HA 3ZHSA 4YWAA 5IVCA 4UWDA 1PMJX 2HHHB 4FFKA 2J1TA 4UOJA 2AGSA 1O3SA 4JAVA 3U11A 1PVC2 4L0PA 1VQNV 2XHBA 1AR93 3MHHC 2F95B 1YJWV 2GMEA 2DFCA 1NCRB 1DF4A 2ZKNA 1JZ5A 5EPAA 3GB7C 4AQ6A 3RZKA 1O59A 1XSRA 3P30A 1FMD2 4TV9A 2VGDA 3KV9A 4I02A 1YTFB 2RHPA 4X20B 4B08A 3E6DA 4WZFA 3DKQA 3EVKA 5CBLA 4KGQA 1AX0A 4AFBA 2AR6A 4BA6A 3WHTA 4FPFA 4QIWF 1WCUA 3A23A 5HPOA 4XF3A 3WQ1A 3L74H 5JXGA 2W0XA 1OOPA 4DRRA 3ML0A 2YIBD 3H1LH 1ZBA1 4IGPA 1ZWIC 3RWNA 4Q4V3 1JOYA 4IEUA 2X0LA 1OCCC 2E31A 2XPJA 4MTXA 3AG3C 4KWLA 3ACHA 1UY1A 2XBO3 2A0LA 2HWF3 4CXXA 3MIBA 1GH6A 3HR9A 5D2AA 1LUVA 2Y6JA 1RVF2 4RAIA 3AG4B 3ZXJA 3PUSA 5A3WA 2EIMC 2HWC1 1ZBE2 3NW4A 4KBZA 3S5AA 4KMQA 5FIXA 3KLSA 3JD4A 2CV6A 4TSFG 4PQQA 4UI9L 5HBAA 3D4KA 5ERLA 4GWJA 2EINB 1DQ4A 4C1XA 2L6LA 2F4LA 5FUPA 4B3SO 3MHSC 3RZMA 4EZHA 3H42B 1VBC3 1SDWA 2RM21 5KX5B 4S2GA 4CP1A 2WO7A 1SFYA 3POIA 4Q4W1 2A6ZA 3VBUC 4S2DA 4XUPA 3TETA 1CWPA 2CH7A 4PDVA 3BU0A 1S77D 2YMZA 3ZYBA 2ZT9B 5GZCA 1EBOA 1D5AA 4JTDB 3IB3A 4KU7A 1GN2A 1E79G 4Y22A 3OUIA 1DYKA 2E33A 3I3MA 3K58A 3N3HA 4MGIE 4DUYB 4ASMB 4HN1A 3AK2A 2FCTA 2V5YA 3LA2A 1U0AA 5H9PA 1W6QB 3WG2A 1H2KA 3N4MA 1VRBA 3K3OA 1BT8A 4DR4O 2VTXJ 1UU5A 3M3CA 3WW1A 1RM1B 4DR6B 3I2DA 3BN6A 3ALQA 2OIGA 2D6MA 4X8AA 4XUNA 2EX3A 1S2BA 1U5IA 3FL7A 4IW3A 1KS4A 1PO12 1QQP1 4XDPA 4DZGA 2AACA 4NYKA 4MVSA 4HNAB 3OPTA 5L3FA 4JQTA 3AYCA 3OEHG 1CZTA 1QWRA 1ZYBA 1KDMA 1US3A 1CQ9A 2KSDA 3BTXA 2VNRA 3LAGA 1XMQO 5A33B 1US2A 3IT8A 1ASJ3 5JMOA 3RQ0A 2ZINA 4QXBA 3D3AA 5C4WC 1XE7A 3NNMA 3MLLA 5IAXA 1V00A 1LGBA 4PIYA 3K5NA 2D6PA 1IKPA 2P6CA 2H6BA 4A3ZA 2EAKA 1RUH3 2B1IA 1CAXB 4QQHA 3WDYA 4XFBA 1VQ4V 3S5QA 4MGKE 4M00A 2P3JA 5EJ3A 4FFBA 4XBNA 4A6OA 3RYFB 4GMP3 5FY4A 1ZRIA 5HFMA 4JRAA 3JATB 4QQ2A 4Q4Y3 1N8RW 2Q7GA 4EWDA 1UYZA 4NO4A 1SC5B 2QQKA 5EJZB 4IT5A 3ON7A 1PGSA 3ZMTA 3I2JA 2R0HA 3T2QA 4PA9A 4E4HA 5C7GA 1DLLA 1SA0B 1GAXA 2DYRB 3KCCA 1AR5A 5AG2A 3BTYA 4AEDC 3HKBA 1N1YA 2IXLA 4K40A 4G28B 4NTXA 3CB2A 4YG3A 1IQDC 4BZ4A 5L3BA 3ZSJA 4LBOA 4WCEV 2F4VB 1NE6A 3DPRC 5I8TA 5H9QA 2ZGRA 4K0KO 4FP3A 2ODMA 4KH9A 4JPRA 1QDCA 1BE3H 1UPGA 4WFHA 3POSA 5C70A 2IVIB 4ZXEA 2RNBA 2XTAA 1H9PA 4MUVA 1RUNA 5I0RA 3AZWA 3L9JT 3DCQA 3B8NA 4KWKA 3K59A 4MSWC 2IXIA 3K48A 3TN92 1EV13 1UMIA 1DQ6A 5E6HA 1W06A 5JXJA 2WLLA 4D7SA 2ILMA 2HEVF 3UGGA 4FOQA 4IEZA 2ID4A 3T30A 1NJIW 4R8CA 1W0NA 1VRH1 1KRIA 2W87A 2Y69C 4X1IB 3SPGA 5D21A 2BTVC 3RZHA 1NQJA 5C71A 3OMIB 5IAVA 1OVSA 2ZHMA 4YW5A 1HW5A 1IHMA 5C8YA 1S5LZ 3CCMV 2NLRA 5FQ0B 1CAUA 4D6TH 3DYPA 1JU4A 4H13B 4DV4O 3PIJA 3SPJA 1OD3A 2UXBB 4AVTA 2JG9A 3RWRD 1FXKB 5KAFZ 4Q27A 5FMDA 4MGQA 1GOFA 1OLQA 1PX3A 4X64O 4BAYA 2QM4A 2V5DA 3MZHA 1W0OA 2WYSA 2WSUA 2VOVA 5LA6A 5GZDA 4J9ZB 2AUYA 5FZHA 1MS5A 5GM0A 5IW0A 1QQP2 3WLUA 2UXCO 2D93A 2OX0A 5BR8O 5FZ4A 2DN9A 4PDLA 3JD73 2PLV1 3M4FA 1WCSA 3VHOA 3W5NA 4XCBA 3K5OA 4CDUA 2V7QG 5EBMC 3NJZA 4UYBA 1XQNA 1JS9A 1RUG2 2WT0A 4IQPA 2IJHA 2LGQA 2E74B 1C5HA 1NKGA 5FQ0A 2R043 5C8YB 3K5LA 3JCUZ 2PY5A 2XOMA 1IPKA 2QJ1A 2IU0A 3JBG3 2R6QA 3CSXA 2RE9A 2A1XA 5I0SA 1WA6X 3NKGA 3C7OA 2Q7EA 3OUJA 4X1IA 4AHYA 4MGTA 4JYYA 3KWVA 2IWGB 3WDUA 1W04A 4LULA 4UFIA 2YICA 4DR2B 3MDPA 3T1LA 4E4ZA 3ABMB 2YS8A 2D2CB 3H9AA 1GANA 1ULPA 2W9XA 1TE1B 1RUD1 4JI3B 3VZOA 1W6OB 5C8CA 4GMP1 2XT9A 2BTOA 3J8F3 4DO2A 2WN3A 4G9SB 2W1SA 5F9TA 1ALYA 2JXAA 3JB8A 4RUFA 4ZHNA 2ZQMA 4FFHA 5DG1A 5JOXA 4Q1PA 3I3EA 2XAQA 2R1BA 1XC6A 1MS1A 1KS5A 4O65A 4NB5A 1ZNPA 3WW2A 2NLJC 4N43C 1PMIA 3BHPA 2NMOA 3EMRA 2LFSA 4GB33 1GQGA 3GF6A 2RG4A 2O8OA 5J37A 1OFNA 3ZFEC 3WP4A 3A0RA 2YZ4A 4Y1VA 2AREA 2JGDA 5EZYA 1S0GA 1US6A 5LA1A 4AQTA 4JTAB 2R9IA 2VU9A 1DCSA 2R72A 2WNOA 1W28A 1H8TB 5CFCC 3UT0A 3FX7A 1C28A 3TB0A 2QA4V 4KU8A 1OXCA 4A7KA 2P3YA 2GTSA 2ZGPA 1YRZA 3AG1C 3T1HB 4IETA 1UD1A 4LWSA 1E5IA 1AVMA 1W6PA 1W8UA 1S4CA 2IXKA 3VBHA 2Q30A 5L36A 3VKMA 4IGGA 3K5MA 1RMU1 5IVFA 3ASIA 5BR8B 4J10A 4M3CA 4YZ3A 2WLHA 2ZGKA 4DR6O 2XLFA 3S57A 4DRXA 3N9NA 4PDWC 4QPGC 2BOBC 5FP9A 5ACA3 1F5FA 1KBHA 1SG3A 3WG7C 4J25A 2DF7A 5IDJA 4YZ4A 2AXTZ 1JA8A 2B9ZA 3K4DA 2MW2B 4XEZA 3AMHA 4A4AA 3BFRA 3D5OA 1WD4A 1MQTB 4CEWA 2BFUL 4XFIA 3PL0A 4URAA 5FPAA 3DEMA 4LFBB 4YGCA 1SESA 1AL23 1LR1A 2A06H 1D0GA 5E89A 5FPRA 3PJYA 1NA1B 4H55A 3ZSMA 5GZGA 4LA2A 3LA3A 3RVHA 4UVCA 2DCYA 1RUOA 4QGLA 2MHFA 1G9CA 1J95A 1W0JG 1IBMB 1WJZA 4BW5A 1NG0A 4X1YB 2Q69A 2ZMNA 2W6IG 1CPMA 3ZRWB 2JD9A 3VV1A 4ET7A 4K7JA 3H1YA 1UY2A 3AZVA 1VQMV 1X82A 5FZCA 3E2EA 2VECA 1UZ0A 1RUI1 5K9YA 4CP9A 1G9DA 1W39A 4Z1VA 2QE7G 3ZS8C 5TISZ 4W6YA 5CG9A 2V73A 2P37A 3ZPYA 2VW0A 1HRV2 4OQ8A 4FT8A 1RSOA 4CCLA 5EP9A 5A6ZA 1XHXA 3CRMA 1ORQC 4B3SB 3UGFA 2XL7A 3WXPA 4Q5OA 3POFA 2WFF1 5BNPC 4FPPA 2D5FA 2CWSA 2AHYA 3EXAA 1XOUA 2YPJA 1KD7A 4JI4O 1OHHG 1GBGA 2WLQA 5KC6A 4JTOA 1C8NA 5KLVH 4DRVA 2WWWA 3EB7A 1ZM1A 1S0VA 4A2UA 5F5IA 4LIVA 2YI9A 1QJU2 3OUSA 4UW4A 4P00B 3SH3A 2OS2A 4IEWA 1QKQA 5GONA 1ZRDA 4P08A 1RUD2 3ZRSA 4U7NA 3BIEA 4DUZB 1VBB2 4ZY9A 3N2GA 1KFUL 1L7LA 4Q0PA 1QIQA 3PHMA 4MGSA 4YGDA 2DTWA 1H2MA 1QOOA 4YW3A 1QVFU 1K33A 3J7LA 3J80N 2P67A 4E2QA 5DUVA 2IVJA 4CC6A 1VB2A 1ULDA 1NCQC 2Q4PA 1NA1A 3CS5A 2EIKB 2D43A 5LBBA 2YC0A 2KB1A 5GJ6A 2PMWB 2RMKB 1S0DA 4CS3A 4KHPO 3URFA 4GKKO 4FP2A 4MZUA 2GH2A 3JAKB 3AG2B 4OX9O 4DV6O 5FY5A 2VOWA 2R062 2V4VA 2VVDA 2GUZB 4LCUC 3P6BA 1RPOA 3JASB 3JD0A 4W8JA 4ISQA 3ACFA 4LK6A 3LD8A 4FPGA 1YUDA 5BV6A 2X8KA 4H44B 4QHZA 3WOGA 4DNYA 1A6CA 4DXZA 1S72V 2CGPA 2VPVA 4LE4A 4BCUA 3X2QB 3R65A 1HQNA 1ZREA 4I0BA 3O0WA 2FZ1A 1NOVA 3T2OA 1K5MA 4OI4A 4B3MO 5JJNB 4CH3A 4WV8A 4UF0B 3ZR6A 4LWSB 2DE0X 1UWWA 4HVOA 1YCIA 2EXHA 4XMAA 2RJ2A 3O9OA 3PMEA 3NSTA 4MTOA 3PUAA 2Z4FA 1MEC2 4MSVA 4BQYA 2HYXA 3HKDA 4LC1A 2EIJB 4LF5O 1V9U3 5FMBA 3U4SA 1V6NA 1WNSA 5FKBA 4DY3A 1RMU3 4ZOLB 2BU9A 4E9KA 4OI0A 1UX6A 4B7KA 5ABJB 1K3IA 4R8HA 5IE9A 4EYUA 4NRPA 5E8AA 1HB1A 4GB31 3KCYA 4ZU4A 5I0DA 3ST7A 3I2FA 5AC93 3C7EA 5FREA 3O1UA 4DR1O 1XMOO 3CWBH 3RN4A 4HANA 2JDUA 4AI2A 4I3GA