2BSKA

Crystal structure of the tim9 tim10 hexameric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9
publication title Crystal Structure of the Mitochondrial Chaperone Tim910 Reveals a Six-Bladed Alpha-Propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 27
structure length 73
sequence length 73
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 2bskA00
3CJHA 3CJHB 2BSKA 3DXRA 2BSKB 3DXRB
chains in the Genus database with same CATH superfamily
3TETA 3DTUB 4N21A 2FYUH 1WNSA 1Q81W 1I5XA 4WFEA 3CCRV 4QJFB 2L6LA 3FD9A 1Y74A 1Y74B 4X89A 4DV1O 2W0FC 3SJCC 2PI4A 3U10A 4FLVA 1K73W 2IJJA 4I7ZB 4HBNA 1QLEB 3ZHQA 1D5AA 2NN4A 3CWBH 4NXMO 4O4HA 2Y4UA 4CS3A 1SETA 1I5YA 5BR8O 4LF4O 4H37A 3T1YB 2O57A 3B8MA 4I55A 1M5IA 4J11A 3CCSV 1P84F 1VQLV 1YITV 4BW9A 3A0BZ 3ICXA 5B3SC 2VQEO 1H2LA 3DGEA 5E79Z 5CMUA 1OZ0A 1TAEA 2OWOA 4I50B 4IIJA 1MOFA 4IIJB 3BY6A 2PF4E 2ZE5A 5IYDO 2R72A 2JIZG 3CEIA 4FMTA 1OCRB 3WB2A 1SF9A 4MVMA 3CJHA 1AJQA 5B1AC 3U0ZA 3ETDA 2BSKB 3EFFK 4MVZA 1P49A 3K5MA 4I4TA 5LBQA 3BCCH 5LP6B 2YIBA 5LP6A 2F93B 1MG1A 2ZNIA 2CTWA 2AGAA 3SJQC 2EIMC 4LFBB 2Z5UA 5CA1A 5CA1B 2WLLB 4DR1O 4ASUG 3CRAA 1L0NH 1S5JA 2PUSA 3OT7A 2QR4A 3J80N 1F23A 3ABUA 3JARB 2Q69A 1JPXA 1V9PA 2JDIG 2JGDB 4O4LA 2GUZA 3RVZA 4DR3O 1KB9F 1RSOA 1RSOB 4ZKIA 3STZC 1M9NA 1JCHA 3QF7A 3WB1A 1R73A 3OM3B 1AP5A 3K57A 2FB5A 4R50A 2HKOA 3K58A 4ZI7A 4ZI7B 4CH3A 3OEHG 3AK2A 3CXHF 4X66B 4YIOA 1KBHA 3IFXA 3JSNA 4LF6O 1WB7A 4FLUA 4MTFA 2R9AA 1HNWB 4LFBO 4MVQA 2Q7HA 4LNUA 4LNUB 1R3IC 3RYFA 1XMQB 2XNDG 4DR6B 2QKSA 1AI7A 5LA6B 1SQFA 2BCCH 3BABA 3G80A 4TT3G 5H9CA 4EFBA 1R3JC 4A5UB 1EN4A 2LP7A 3VQXA 1Z5WA 2PTMA 1VQOV 1SERA 1NTMH 2EZPA 3K5NA 1RPOA 1W0KG 4DW0A 3OGCC 2ZDIC 4X66O 3P32A 1QCEA 1PD3A 4B3SB 1DLBA 2ITDC 2RDCA 1B04A 1XBLA 4F6RB 5CB4A 5CB4B 4NXNO 1I94O 1HNWO 4QNHB 4FLYA 4CC5A 3VQYA 2Q5ZA 2P06A 4WCEV 1XMQO 4DR6O 4R6ZA 1EN6A 4JAVA 1BQ0A 3ZCCA 1U96A 3T1HB 5L3GA 3RBZA 4LF5B 2UXDB 1P4RA 2YEVA 1BGYH 5IDJA 1OCCC 4EKWA 1S76D 2XTAA 4JI3O 3ZMUA 1ZL8A 1N8RW 4UCTA 3OMAB 1THZA 2QTOA 4RUFA 2VWJA 4MTGA 2NNUA 3JAKB 3SYQA 4U7NA 4X64B 3W7SA 5CBGA 3AG2C 3SPJA 2QWPB 3N2GA 3SR2C 1F4MA 2P67A 3CSXA 3MHSC 4PI0A 5DM6V 3IGAC 3S3XA 3ETQA 1FJGB 1MZEA 1QR8A 3T1HO 1S0VA 1AI4A 2UXNA 4IYIA 4LF5O 4LFCO 2QEXV 4FK5C 5KLVH 3ABMB 1EBOA 1NR7A 1IXBA 2QDOA 4DYLA 2P90A 3JD2A 4QPKA 2GTSA 5KHHA 2JS5A 2DYSB 3D8CA 3DXRB 3E83A 2UUAB 4DV3B 1R6KA 1O9HA 2R9IA 4CS4A 4X64O 2E74B 4K35A 4B3TB 3A8TA 2YDEA 1B3QA 1XNRB 2ZD9A 2B1IA 3FYIB 1ZX3A 4IYHA 5FNVA 5KMGA 2JEXA 2YSUB 2EULA 4ZHQA 4ZHQB 5JJEB 3C3TA 3GWKC 4UCUA 3ABKC 4PELA 1FJGO 2N74A 4EEQA 1NZ6A 1K7DA 2IBZH 5LL6Y 2OCCC 4YY3O 4KXRA 4O2BA 3OEEG 1P7GA 4FLWA 1KYOF 4PV1B 2BOBC 1I0HA 3RFRA 4IHJB 3RVYA 5JCOA 3AK3A 1AROP 3JYCA 2QSAA 2IW5A 5EC1C 3D36C 3RW0A 1VF6C 4IGGA 1GN4A 2XAFA 3F5WC 3HPLC 5LGTA 3L73H 4O4IA 4O4IB 4YJ3B 1CXZB 4LH6A 3OR6C 3ABLC 4JASA 1MSDA 2DE0X 1WPBA 4GX0A 4FM2A 4LC1A 5B1NA 3E86A 4LF8B 3UT5A 1NVPD 4DV6B 3F7VC 3RGBA 1XQ8A 5KUMA 1URFA 4LWSA 3L74H 3THOA 5KHGA 2ADQB 3TCUA 2MK3A 5L3EA 1GM9A 4TV8B 3FB7C 4GKJB 5CA3A 1B6QA 3SPIA 5EZYB 2K9PA 5KHIA 5IYCO 1QNMA 4X1YA 4DO2A 4YJ2A 1NT2B 4UCRA 4YHHB 4CH6A 4RAIA 1H2MA 1M56C 2KKWA 1Y76A 1Y76B 4X8AA 3ZRSA 1FFXB 2QM4A 2JJ1G 1HNZB 3ZHVA 4X1KB 1YZBA 1MZFA 4JI2B 4X65B 2A79B 4YIPA 2M7WA 1MA1A 5JQGB 3O9OA 1SQQH 2OT5A 4O2AA 4O2AB 3CMAV 1YHQV 1EZVH 1AR4A 5ITZB 2ARHA 4MW8A 4O4JA 3LDEA 4JTDB 1HR0B 2F4VB 3BA9A 2RN9A 4E2LA 2D3OW 4WFHA 1VIBA 4E4EA 1VF5B 1Q6HA 2ZR2A 1QVGU 1VQ6V 3B09A 1DK1A 1XMOB 4NTYA 1K3EA 2LW1A 3CRMA 1RFYA 2ODMA 4JI7B 1FXKC 1OCOB 3X2QC 1FXVA 4J10A 3F5TA 4X20B 2ITCC 2HG5C 2EBOA 2DN9A 4FJCC 1R6TA 2EILB 4J7ZA 2LJ2A 3WU2Z 1N34O 1HNZO 2BTOA 4DR4O 1YJ9V 1AJPA 2FKXA 4X65O 4JI2O 4UV8A 5LGNA 1S77D 4KL1A 2QA4V 3FAVA 3FAVB 1NTKH 2V4DA 2EIKB 3GWOA 4TSFG 4J9YB 1VQ7V 3A0RA 1HR0O 3CC4V 1ZAUA 1JA8A 1LUWA 4UVBA 3M7MX 4RUEA 5KX5B 3SPCA 3KCXA 1XMOO 2CTRA 2IH3C 4PDVA 2HHHB 1HW7A 4DR2B 3A0HZ 4JI7O 2DWDC 1N32B 2B9ZA 2ZCEA 2FL4A 1S5HC 2NLJC 1BQZA 5L3FA 4Z2WA 1Q90D 1KU9A 2DQ3A 1RP3B 4PHZA 5D5PA 2KSDA 3ZMVA 4F4LA 1N0NA 3ASOC 3E8FA 2X7RB 3EHBB 3T2MA 4DRXA 1GO3F 2A9HA 4BAYA 2EINB 1OCZC 4PDLA 1K5SA 4QIWF 3G4SV 3K79A 4J7KA 2Y48A 4JYBA 2RQ6A 2VRZA 3JATA 4JZ2A 3FX7A 1K92A 3JAWA 4UUJC 2OYQA 3JCUZ 4LF7O 3RYIA 3RYIB 2HHHO 4H44B 2HFEC 4P9OA 5H2FZ 1N32O 2DOSA 3VBBA 1JX9A 1XEQA 4Q6GA 2Q9LA 5KAFZ 3CB2A 1PV0A 4P30A 4J41A 2IJKA 2Z3YA 1XNQO 4O4HB 1ZLZA 1GN2A 2HVJC 2ZXWC 4QE7A 4B3RB 1GRJA 3P30A 1VARA 4I55B 3FKSG 1G4YB 4JAUA 2A3QA 3LDCA 1F51A 2Y69B 1TUEB 3M99B 5JH7A 3K0DA 2X0LA 2E75B 2EIJC 4FZ0A 2AZ0A 3UO3A 1HNXO 1CPYA 1MABG 1VEWA 5GTHZ 2XAQA 1K4DC 4DV7B 3JD1A 2DJVA 4QGPA 2ZDIA 2IU0A 1Y67A 1BZKA 1QLNA 2F1MA 5JVDA 3HKBA 3OTFA 5JVDB 2Z0AA 2P4VA 2G38A 2PGGA 1GMGA 2YIAA 4JI4B 2V1DA 3H1KH 3PJSK 4JI0B 2N04A 5EIBC 3OTOB 3BFRA 1GN3A 1G8MA 2GBOA 3CJHB 1Q6UA 3ZBHA 1NR1A 1A32A 1AP6A 3AG1B 3T1YO 1M1KW 1BHAA 4GLXA 4B3RO 2YIBD 2EJRA 4I4TB 3ASNB 4JI5B 2UU9B 2A0LA 1ROPA 1FFTB 2Q0OC 2GDSA 4KHPB 1J95A 5FL7G 5LOVA 5LOVB 4FLZA 3JAMN 2XT9A 2X6CA 1SZTA 5L3DA 3HKCA 1ZUQA 2Q7GA 5KA5A 2IH1C 4JTAB 3CRCA 2GUZB 4O4LB 1JMKC 3K06A 3P3PA 2WA3A 3RN4A 1M57B 1QBZA 3BEHA 2UUBB 4P9PA 2XOKG 1TGOA 2WLHA 1X4TA 1V54C 4JI1B 1Q7YW 1NU1H 3ZIAG 1YXBA 3CD6V 4JI5O 4K0KB 1H2GA 1TA8A 4X9QA 1WAZA 3RYFB 1SQPH 1L1FA 2HLDG 3K9SA 3E8GA 3BA8A 4FM1A 2JK5C 4AI8A 2UUCB 1AR5A 2YUAA 4GZRB 3HKDA 2LGQA 3KCYA 4JI6B 2WPDG 2FTKA 4IT5A 4JV5B 4MW3A 1Z2GA 2NR5A 3CX5F 5IY5B 1QLEC 1VP7A 5B1BB 2UUBO 1E1RG 1W59A 3CCQV 4JI1O 1JOYA 2H8PC 3ABKB 2BOCC 1VMGA 3F7YC 1PP9H 2FMLA 3ZX6A 2P5OA 4NR1A 4DK1A 3K0GA 4B08A 1SA0A 1SA0B 5CBFA 3N27A 4LF9B 2OTJV 2HP8A 1BHBA 3C3SA 4WFGA 2UXBB 3APOA 3ZMSA 1COWG 1N4CA 3D36A 1I7FA 1VF6A 3IC9A 1Q43A 1RM1C 1ZSPA 1OCRC 2W0XA 2YEVB 1ENVA 3D3IA 1PKXA 3FB6C 1JJOA 2YI8A 3NR7A 5J2TA 3UM7A 5J2TB 1KD1W 5GW7A 1KKCA 1ZL8B 2ZM6B 2WLJA 3W7XA 3VOUA 1SKVA 4GX2A 2HJFC 2QTSA 3ZHRA 4I9QA 3R66A 4BIZA 2XHBA 3CCUV 3TGUH 1WN7A 2QWRB 3S3WA 3CCEV 1LR1A 4B3SO 2VS0A 4CBCA 3N2GB 4JYAB 1L0LH 4B7EA 4NKGB 3CRQA 4R8CA 5A2QN 3UCSC 3L75H 2LFRA 4HAMA 1FKAO 4FFBA 3ZS8C 4IL6Z 3T1CA 1QHTA 2CH7A 1VQNV 3SYPA 4MVUA 3GB7C 2WAMA 3ZN1A 1R3KC 1HP8A 1NTZH 2OTLV 5BMVA 2ETNA 4PD4F 2UXDO 1JVMA 4W4KA 4NTWA 4I0XA 1QU7A 3SPGA 4G2KA 1WA8A 1WA8B 3R65A 3W7WA 1BS3A 2Q0AA 1CP9A 3ZN0A 4AILC 4WFFA 3SPHA 3JALA 4U7OA 1ZWIC 4FFKA 2RJZA 4CH5A 1R3LC 5IWAB 5LYJA 3QO5A 2CTQA 4H13B 2KG7A 1E79G 2E76B 1Q3EA 5FNVB 3H1JH 4D6TH 3T4DA 5KMGB 1K9MW 1Q82W 3HKEA 1L8DA 4ZOLA 4ZOLB 2UXCB 4DV2B 1PL0A 3AG4B 2JEUA 4H0LB 2P7TC 2Q6AA 3G67A 1QR9A 1YEWA 1VQ4V 4CH4A 2BTQA 1XL6A 5CN0A 4Q20A 1MMMA 1AB3A 4O2BB 5BY1A 2WSSG 4R7CA 4FVMA 1H2NA 4B3MB 3EXAA 4GT1A 3CHXA 2QJ1A 1RPRA 2DYRB 2RNBA 4KUMA 2UUAO 3GVMA 4N23A 1K97A 4DV3O 4FM0A 3EVKA 5TISZ 4FIPC 5LHGA 4B3TO 3WG7C 4EFEA 3U11A 1QVFU 3ZJZA 1XNRO 4PI2A 1SRYA 1K4CC 5JJNB 3K08A 3KZIZ 4OXSA 4TQFA 3AG3B 3D3QA 3NXSA 3B8NA 1AJNA 5B66Z 3LSSA 1IDSA 2F66C 2QKCA 3ML0A 2YXLA 5AG2A 3C90A 4WFAV 3UT5B 3ZRWA 3ZRWB 1OV9A 4GCZA 4NVPA 4BW5A 1NVPB 3FB8C 4X62O 1XL4A 4TUYA 4TUYB 5DEDA 4EB6A 4G28B 3SYAA 2DMXA 3B77A 1TUBA 4LWSB 1ZTEA 3DSQA 2YXYA 1GKFA 1IXMA 1VQ8V 3CYOA 2QWNB 1HWYA 2QWQB 3STLC 1BE3H 2QM7A 1DTOA 1WJZA 4RQFA 3ABTA 4X1YB 4YJ2B 2Y0PA 1H2SB 3ZHTA 4DR7B 1MSWD 4TOIA 2ILMA 3ZHUA 4DXWA 1R1BA 3AEIA 3ABMC 2JS3A 4LF8O 3UO2A 4DV0B 4DV6O 3KG2A 4X1IB 4X1IA 2CGOA 2RMKB 3H1LH 2OCHA 2DYSC 1T5EA 4O4JB 4GX5A 5J9PC 4K3AA 1SESA 2EX3A 4HZ3A 1R6NA 4AQYB 1JR9A 1GAXA 1YF2A 2ZXWB 3E22A 4GKJO 1YCIA 4GKKB 3DC5A 4JYYA 3LNNA 2E5LB 3W7TA 1OHHG 1UJWB 2ZIOA 3IJ4A 4ICGA 2CAZC 1PNMA 5B3SB 2AHYA 4JPRA 3OD4A 4FLXA 4YHHO 1W0JG 1TVKA 1TVKB 3I5DA 4DR5B 2LGWA 5HFLA 3AG7A 1SQGA 3E2EA 3OR7C 3Q4HA 3Q4HB 1BL8A 2ZINA 3OUSA 1V55C 3J81N 3OFNG 2ZE8A 2JRIA 5EBMC 5EIBD 2JJ2G 5LGUA 4XDLA 4J9ZB 5J2UA 2F4VO 5C8YA 5C8YB 1YI2V 2LO1A 4L8JA 4JYCA 1WB8A 4LP8A 2C2AA 5B1AB 4DUZB 3CRRA 1N36B 5CBHA 2IM9A 2WLIA 3TK1A 5IJ0A 1CEZA 4MTXA 3CMEV 4MVOA 4LBEC 3H1IH 1IBLB 3L71H 1YSCA 4X62B 1VQ5V 3JD0A 2EIMB 4F6EA 5E1AC 3SJBC 4OPAA 1YVWA 4DR5O 1EM1A 1EFRG 4DV1B 2GHYA 3KKYA 4UCVA 2Y4TA 1SQBH 3H01A 4D7TA 5IYZB 5IYZA 4DRXB 1PM9A 4JZGA 1H2KA 3B4SA 4P2ZA 3SJAC 3IAYA 2AHZA 4NXMB 4LF4B 2AW9A 3JATB 1IZ3A 4HNAA 4UCOA 2P22C 3JAWB 4DV4B 3L72H 2VQEB 4U3FH 4DR2O 5LMUB 1E1QG 4ABMA 5KHKA 1Q8IA 5BXZA 5JWPA 1DF4A 1N33B 3P3NA 5FLXN 2JGUA 1HDJA 4WF9V 4KFMA 3M8AA 1DGSA 3K5OA 3WB0A 5JH7B 2F43G 1FYJA 2PZSA 1BT8A 2JVDA 1KMIZ 5JJJB 4JTCB 3RYCA 3RYCB 2LQTA 5IE9A 3BAAA 1FAFA 3I55V 5H6RA 2EZOA 4DV4O 1VQPV 1OCOC 2PYLA 4UB8Z 5BZBA 1M93A 2PI5A 3W7UA 2IJHA 2CGNA 3HKBB 3H9VA 3QO7A 4DR1B 1S5LZ 5IYBO 2UXXA 4PA9A 5LMUO 4J7JA 1IX9A 4MVSA 2EILC 3UKMA 1LNQA 3JSLA 4I50A 2EJ7A 1N33O 1AI6A 1JJ2U 3O65A 2ADPA 4DR3B 4UVCA 2WLKA 3T4ZA 2YICA 2IU3A 2EIKC 3J7AU 3JD3A 1SQVH 4K8XA 1NKDA 1VF7A 4UXNA 1UPGA 4I9WA 1RM1B 4UCSA 1OCCB 3K5LA 3LUTB 3LDDA 1XHXA 2BSKA 3HKCB 1XHZA 4B7KA 4LF6B 3B2EE 3ETGA 4DV7O 4PDRA 1D2DA 1QQCA 1PL4A 2H94A 1Q86W 4PA6A 4NYKA 1VQMV 4ZBMA 2WLLA 1M4UA 3AG2B 3JCZA 5C93A 1OJHA 3JARA 4JI4O 4JI0O 1N0JA 3OTOO 5H6QA 4TV9A 4TV9B 5K1XA 1X59A 1YTFD 5DECA 1IVSA 1GN6A 2JGDA 5KHJA 2YI9A 3OAAG 1YTFB 1YIJV 3MD0A 3K59A 4MS2A 5IT9N 2EINC 4BIUA 4JAAA 3E35A 3QNEA 2HJDA 5H5NA 3L9DA 2UU9O 2V7QG 3VQVA 1IBMB 3TXSA 4FLTA 2MW2B 4TQDA 4KHPO 1B06A 2ZE7A 2OIEA 1K33A 1DF5A 3CCJV 4PA4A 2GSMB 4X88A 1XOUA 1J5EB 3HKDB 3K04A 4XBFA 4NXNB 2E3CA 1I94B 1Y6XA 4BWAA 4BR6A 2CUGA 1H38A 1WP7A 3SDLA 4MSWC 1NQTA 2W6IG 1KC8W 4MTOA 5LA6A 5B5EZ 4XDKA 3CS5A 1AI5A 5LHIA 3ZHSA 5LXTA 4QE9A 5LXTB 2OIGA 2DW4A 2DWEC 2M6YA 3LSQA 2Y69C 2XAGA 1Q6IA 2F95B 3PN1A 2OCCB 1IBMO 4JI3B 4K0KO 1W2BU 1K8AW 2X6BA 1IURA 3CXCU 3LSUA 4L87A 4WBNA 4WBNB 4GUNA 1KQSU 2ZE6A 2UUCO 4PJ0Z 1J5EO 4JI6O 1KECA 1Y4MA 1SZXA 4F6RA 4JV5O 5FPOA 1XILA 4JF3A 3OE7G 2WA4A 1XREA 3WG7B 3ABLB 1NJIW 3AG1C 3N2KA 3N2KB 1PNKA 1G1XB 3ASNC 5LP6C 4GYCB 3K03A 4LFCB 4LR3A 2Q73A 3TJTA 4FZ1A 3UQ8A 1KKDA 2XAHA 4WFBV 2GTAA 4J42A 2PYJA 1MNGA 2AZ2A 2VWKA 2YXHA 3CCVV 1SQXH 4MVRA 4CC6A 3BRCA 1VQ9V 2KB1A 3MDSA 3QG5A 5KUKA 1JFFA 1JFFB 4DV5B 4FFBB 4LF9O 2XASA 3HB3B 2CH7B 3JAKA 3ETEA 2LW7A 4HYOA 4AHCA 5BMVB 1M57C 2UXBO 2P6JA 4NB5A 2PY5A 1NBMG 2QWOB 2XAJA 4I0XB 4LCUC 3I56V 1FD9A 1O9GA 3BPZA 2ZM6O 2H3OA 3FB5C 3JALB 3G71V 3APQA 2CTPA 2AXTZ 1M56B 4U3JA 4U3JB 4YY3B 2HR3A 2ZT9B 1WLEA 3VQWA 3K9AA 3ZRVA 3OMNB 3QTCA 1K34A 3ZMTA 5LYJB 2KG7B 5B1OA 1IBKB 3HR0A 4XDJA 1EN5A 4JYAO 3CPWU 4Z1VA 3HKEB 4JI8B 3A2FA 4DV5O 3DXRA 2KQXA 2CK3G 3K3WA 5IY5C 5B1BC 3OUFA 1WPXA 2Q68A 4UVAA 5EBLC 4Z1MG 5L3CA 2BTQB 2HEPA 1SS3A 1FXKA 1FXKB 3JD4A 5CA0A 5CA0B 4FPPA 3X2QB 4I5SA 1XDCA 1Z5VA 5D5QA 4PA3A 1GTOA 1PPJH 1S3JA 3OGIB 1P7BA 3CC2V 5IJ9A 5IJ9B 2Y0IA 1YJNV 3MAQA 4OGQB 3CC7V 2ZR3A 1D5NA 5IWAO 2X6AA 4CS2A 3LNMB 2N05A 1IBKO 4RQEA 1V55B 5L3BA 1YJWV 4IHJA 3DC6A 1JQ0A 1SC5B 4JI8O 1NH2D 1VQKV 1F4NA 2R70A 1NH2B 3WFVA 2K1EA 3TXQA 4J80A 2UXCO 4DV2O 3ZEDA 2L35A 2QKAA 2B1GA 4YJ3A 3FFQA 1EZJA 4RWUA 3L70H 2ZKOA 2Q7EA 1U97A 2YS8A 3OW2U 4B3MO 4EB6B 3BVOA 1TUBB 4UB6Z 1AR1B 5KA6A 4K8ZA 3SGIA 3ASOB 4PDMA 1KP3A 3G6BA 4UV9A 5A9GA 2R9RB 3CCLV 3CE2A 3RT3C 1BSMA 3E89A 5DN6G 1LUVA 1OCZB 1PNLA 4DW1A 4GX1A 3BHPA 1AVMA 4D7SA 4TV8A 4YXWG 1AILA 1G6UA 1F7YA 5EZYA 4G27B 5FPRA 3QVNA 1K5QA 3IC7A 1US6A 1GH6A 2ZNJA 3CP1A 2WLNA 2F23A 1N34B 2HVKC 4OX9B 1FFXA 4DR4B 4X1KA 4H33A 5KAIZ 5JQGA 4PA7A 1H8EG 3E22B 1BMFG 2XUMA 1FS0G 2B5UA 5EYPA 5EYPB 3G6EV 2ZQMA 5ITZA 3MHHC 4KP4A 2Q4PA 1H8HG 5EK0A 2A7WA 4C7UA 4LFAB 4BIOA 4CZZA 2EIJB 4DK0A 2Q67A 1WP8A 3AG4C 1S72V 1GM8A 4DR7O 1KUQA 2RCVA 3FYEB 3ZRXA 2GV9A 4X20A 1GM7A 3RYHA 3RYHB 4DUYB 1I08A 4DV0O 5LMNB 1GK9A 2DYRC 5JCOC 4NTXA 2ZIMA 5J2UB 2YC0A 2Q8VA 4MT8A 4OX9O 1XI1A 1ORQC 4AQYO 2W6JG 1NI8A 2DQ0A 3ZMZA 1Y66A 4JGSA 3SYCA 2WLIB 5IJ0B 4ZIBA 5GTIZ 2ATKC 2VQFB 4UFZA 4GKKO 1NS1A 1YDXA 2WWWA 2E5LO 2IJIA 5K1PA 4LFAO 1UFIA 3AG3C 4RO2A 1Q5OA 2QGNA 5EBWC 3B40A 5LHHA 5EC2C 4LF7B 3RWRD 3SYOA 5KX5A 1KP2A 3H1HH 1BCCH 2CDYA 2QE7G 3E8HA 3CCMV 1M90W 2LFSA 4W4LA 4DUYO 3E8BA 5LMNO 3OMIB 1XNQB 2A06H 3AK1A 4OPHA 2QM8A 5BR8B 2D2CB 3JASA 3JASB 4HNAB 1V54B 2CE4A 4QPJA 1XUQA 5F2VO 2P4KA 2YIDA 1FPOA 4DUZO 5HFMA 3QO8A 1N36O 2WLMA 2VQFO 2BE3A 1HNXB 4LH7A 1IBLO 4TWKA 5GONA 5GONB 1FXHA
chains in the Genus database with same CATH topology
3CJHA 3CJHB 2BSKA 3DXRA 2BSKB 3DXRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH A;  3CJH B;  2BSK A;  3DXR A;  2BSK B;  3DXR B; 
#chains in the Genus database with same CATH topology
 3TET A;  3DTU B;  4N21 A;  2FYU H;  1WNS A;  1Q81 W;  1I5X A;  4WFE A;  3CCR V;  4QJF B;  2L6L A;  3FD9 A;  1Y74 A;  1Y74 B;  4X89 A;  4DV1 O;  2W0F C;  3SJC C;  2PI4 A;  3U10 A;  4FLV A;  1K73 W;  2IJJ A;  4I7Z B;  4HBN A;  1QLE B;  3ZHQ A;  1D5A A;  2NN4 A;  3CWB H;  4NXM O;  4O4H A;  2Y4U A;  4CS3 A;  1SET A;  1I5Y A;  5BR8 O;  4LF4 O;  4H37 A;  3T1Y B;  2O57 A;  3B8M A;  4I55 A;  1M5I A;  4J11 A;  3CCS V;  1P84 F;  1VQL V;  1YIT V;  4BW9 A;  3A0B Z;  3ICX A;  5B3S C;  2VQE O;  1H2L A;  3DGE A;  5E79 Z;  5CMU A;  1OZ0 A;  1TAE A;  2OWO A;  4I50 B;  4IIJ A;  1MOF A;  4IIJ B;  3BY6 A;  2PF4 E;  2ZE5 A;  5IYD O;  2R72 A;  2JIZ G;  3CEI A;  4FMT A;  1OCR B;  3WB2 A;  1SF9 A;  4MVM A;  3CJH A;  1AJQ A;  5B1A C;  3U0Z A;  3ETD A;  2BSK B;  3EFF K;  4MVZ A;  1P49 A;  3K5M A;  4I4T A;  5LBQ A;  3BCC H;  5LP6 B;  2YIB A;  5LP6 A;  2F93 B;  1MG1 A;  2ZNI A;  2CTW A;  2AGA A;  3SJQ C;  2EIM C;  4LFB B;  2Z5U A;  5CA1 A;  5CA1 B;  2WLL B;  4DR1 O;  4ASU G;  3CRA A;  1L0N H;  1S5J A;  2PUS A;  3OT7 A;  2QR4 A;  3J80 N;  1F23 A;  3ABU A;  3JAR B;  2Q69 A;  1JPX A;  1V9P A;  2JDI G;  2JGD B;  4O4L A;  2GUZ A;  3RVZ A;  4DR3 O;  1KB9 F;  1RSO A;  1RSO B;  4ZKI A;  3STZ C;  1M9N A;  1JCH A;  3QF7 A;  3WB1 A;  1R73 A;  3OM3 B;  1AP5 A;  3K57 A;  2FB5 A;  4R50 A;  2HKO A;  3K58 A;  4ZI7 A;  4ZI7 B;  4CH3 A;  3OEH G;  3AK2 A;  3CXH F;  4X66 B;  4YIO A;  1KBH A;  3IFX A;  3JSN A;  4LF6 O;  1WB7 A;  4FLU A;  4MTF A;  2R9A A;  1HNW B;  4LFB O;  4MVQ A;  2Q7H A;  4LNU A;  4LNU B;  1R3I C;  3RYF A;  1XMQ B;  2XND G;  4DR6 B;  2QKS A;  1AI7 A;  5LA6 B;  1SQF A;  2BCC H;  3BAB A;  3G80 A;  4TT3 G;  5H9C A;  4EFB A;  1R3J C;  4A5U B;  1EN4 A;  2LP7 A;  3VQX A;  1Z5W A;  2PTM A;  1VQO V;  1SER A;  1NTM H;  2EZP A;  3K5N A;  1RPO A;  1W0K G;  4DW0 A;  3OGC C;  2ZDI C;  4X66 O;  3P32 A;  1QCE A;  1PD3 A;  4B3S B;  1DLB A;  2ITD C;  2RDC A;  1B04 A;  1XBL A;  4F6R B;  5CB4 A;  5CB4 B;  4NXN O;  1I94 O;  1HNW O;  4QNH B;  4FLY A;  4CC5 A;  3VQY A;  2Q5Z A;  2P06 A;  4WCE V;  1XMQ O;  4DR6 O;  4R6Z A;  1EN6 A;  4JAV A;  1BQ0 A;  3ZCC A;  1U96 A;  3T1H B;  5L3G A;  3RBZ A;  4LF5 B;  2UXD B;  1P4R A;  2YEV A;  1BGY H;  5IDJ A;  1OCC C;  4EKW A;  1S76 D;  2XTA A;  4JI3 O;  3ZMU A;  1ZL8 A;  1N8R W;  4UCT A;  3OMA B;  1THZ A;  2QTO A;  4RUF A;  2VWJ A;  4MTG A;  2NNU A;  3JAK B;  3SYQ A;  4U7N A;  4X64 B;  3W7S A;  5CBG A;  3AG2 C;  3SPJ A;  2QWP B;  3N2G A;  3SR2 C;  1F4M A;  2P67 A;  3CSX A;  3MHS C;  4PI0 A;  5DM6 V;  3IGA C;  3S3X A;  3ETQ A;  1FJG B;  1MZE A;  1QR8 A;  3T1H O;  1S0V A;  1AI4 A;  2UXN A;  4IYI A;  4LF5 O;  4LFC O;  2QEX V;  4FK5 C;  5KLV H;  3ABM B;  1EBO A;  1NR7 A;  1IXB A;  2QDO A;  4DYL A;  2P90 A;  3JD2 A;  4QPK A;  2GTS A;  5KHH A;  2JS5 A;  2DYS B;  3D8C A;  3DXR B;  3E83 A;  2UUA B;  4DV3 B;  1R6K A;  1O9H A;  2R9I A;  4CS4 A;  4X64 O;  2E74 B;  4K35 A;  4B3T B;  3A8T A;  2YDE A;  1B3Q A;  1XNR B;  2ZD9 A;  2B1I A;  3FYI B;  1ZX3 A;  4IYH A;  5FNV A;  5KMG A;  2JEX A;  2YSU B;  2EUL A;  4ZHQ A;  4ZHQ B;  5JJE B;  3C3T A;  3GWK C;  4UCU A;  3ABK C;  4PEL A;  1FJG O;  2N74 A;  4EEQ A;  1NZ6 A;  1K7D A;  2IBZ H;  5LL6 Y;  2OCC C;  4YY3 O;  4KXR A;  4O2B A;  3OEE G;  1P7G A;  4FLW A;  1KYO F;  4PV1 B;  2BOB C;  1I0H A;  3RFR A;  4IHJ B;  3RVY A;  5JCO A;  3AK3 A;  1ARO P;  3JYC A;  2QSA A;  2IW5 A;  5EC1 C;  3D36 C;  3RW0 A;  1VF6 C;  4IGG A;  1GN4 A;  2XAF A;  3F5W C;  3HPL C;  5LGT A;  3L73 H;  4O4I A;  4O4I B;  4YJ3 B;  1CXZ B;  4LH6 A;  3OR6 C;  3ABL C;  4JAS A;  1MSD A;  2DE0 X;  1WPB A;  4GX0 A;  4FM2 A;  4LC1 A;  5B1N A;  3E86 A;  4LF8 B;  3UT5 A;  1NVP D;  4DV6 B;  3F7V C;  3RGB A;  1XQ8 A;  5KUM A;  1URF A;  4LWS A;  3L74 H;  3THO A;  5KHG A;  2ADQ B;  3TCU A;  2MK3 A;  5L3E A;  1GM9 A;  4TV8 B;  3FB7 C;  4GKJ B;  5CA3 A;  1B6Q A;  3SPI A;  5EZY B;  2K9P A;  5KHI A;  5IYC O;  1QNM A;  4X1Y A;  4DO2 A;  4YJ2 A;  1NT2 B;  4UCR A;  4YHH B;  4CH6 A;  4RAI A;  1H2M A;  1M56 C;  2KKW A;  1Y76 A;  1Y76 B;  4X8A A;  3ZRS A;  1FFX B;  2QM4 A;  2JJ1 G;  1HNZ B;  3ZHV A;  4X1K B;  1YZB A;  1MZF A;  4JI2 B;  4X65 B;  2A79 B;  4YIP A;  2M7W A;  1MA1 A;  5JQG B;  3O9O A;  1SQQ H;  2OT5 A;  4O2A A;  4O2A B;  3CMA V;  1YHQ V;  1EZV H;  1AR4 A;  5ITZ B;  2ARH A;  4MW8 A;  4O4J A;  3LDE A;  4JTD B;  1HR0 B;  2F4V B;  3BA9 A;  2RN9 A;  4E2L A;  2D3O W;  4WFH A;  1VIB A;  4E4E A;  1VF5 B;  1Q6H A;  2ZR2 A;  1QVG U;  1VQ6 V;  3B09 A;  1DK1 A;  1XMO B;  4NTY A;  1K3E A;  2LW1 A;  3CRM A;  1RFY A;  2ODM A;  4JI7 B;  1FXK C;  1OCO B;  3X2Q C;  1FXV A;  4J10 A;  3F5T A;  4X20 B;  2ITC C;  2HG5 C;  2EBO A;  2DN9 A;  4FJC C;  1R6T A;  2EIL B;  4J7Z A;  2LJ2 A;  3WU2 Z;  1N34 O;  1HNZ O;  2BTO A;  4DR4 O;  1YJ9 V;  1AJP A;  2FKX A;  4X65 O;  4JI2 O;  4UV8 A;  5LGN A;  1S77 D;  4KL1 A;  2QA4 V;  3FAV A;  3FAV B;  1NTK H;  2V4D A;  2EIK B;  3GWO A;  4TSF G;  4J9Y B;  1VQ7 V;  3A0R A;  1HR0 O;  3CC4 V;  1ZAU A;  1JA8 A;  1LUW A;  4UVB A;  3M7M X;  4RUE A;  5KX5 B;  3SPC A;  3KCX A;  1XMO O;  2CTR A;  2IH3 C;  4PDV A;  2HHH B;  1HW7 A;  4DR2 B;  3A0H Z;  4JI7 O;  2DWD C;  1N32 B;  2B9Z A;  2ZCE A;  2FL4 A;  1S5H C;  2NLJ C;  1BQZ A;  5L3F A;  4Z2W A;  1Q90 D;  1KU9 A;  2DQ3 A;  1RP3 B;  4PHZ A;  5D5P A;  2KSD A;  3ZMV A;  4F4L A;  1N0N A;  3ASO C;  3E8F A;  2X7R B;  3EHB B;  3T2M A;  4DRX A;  1GO3 F;  2A9H A;  4BAY A;  2EIN B;  1OCZ C;  4PDL A;  1K5S A;  4QIW F;  3G4S V;  3K79 A;  4J7K A;  2Y48 A;  4JYB A;  2RQ6 A;  2VRZ A;  3JAT A;  4JZ2 A;  3FX7 A;  1K92 A;  3JAW A;  4UUJ C;  2OYQ A;  3JCU Z;  4LF7 O;  3RYI A;  3RYI B;  2HHH O;  4H44 B;  2HFE C;  4P9O A;  5H2F Z;  1N32 O;  2DOS A;  3VBB A;  1JX9 A;  1XEQ A;  4Q6G A;  2Q9L A;  5KAF Z;  3CB2 A;  1PV0 A;  4P30 A;  4J41 A;  2IJK A;  2Z3Y A;  1XNQ O;  4O4H B;  1ZLZ A;  1GN2 A;  2HVJ C;  2ZXW C;  4QE7 A;  4B3R B;  1GRJ A;  3P30 A;  1VAR A;  4I55 B;  3FKS G;  1G4Y B;  4JAU A;  2A3Q A;  3LDC A;  1F51 A;  2Y69 B;  1TUE B;  3M99 B;  5JH7 A;  3K0D A;  2X0L A;  2E75 B;  2EIJ C;  4FZ0 A;  2AZ0 A;  3UO3 A;  1HNX O;  1CPY A;  1MAB G;  1VEW A;  5GTH Z;  2XAQ A;  1K4D C;  4DV7 B;  3JD1 A;  2DJV A;  4QGP A;  2ZDI A;  2IU0 A;  1Y67 A;  1BZK A;  1QLN A;  2F1M A;  5JVD A;  3HKB A;  3OTF A;  5JVD B;  2Z0A A;  2P4V A;  2G38 A;  2PGG A;  1GMG A;  2YIA A;  4JI4 B;  2V1D A;  3H1K H;  3PJS K;  4JI0 B;  2N04 A;  5EIB C;  3OTO B;  3BFR A;  1GN3 A;  1G8M A;  2GBO A;  3CJH B;  1Q6U A;  3ZBH A;  1NR1 A;  1A32 A;  1AP6 A;  3AG1 B;  3T1Y O;  1M1K W;  1BHA A;  4GLX A;  4B3R O;  2YIB D;  2EJR A;  4I4T B;  3ASN B;  4JI5 B;  2UU9 B;  2A0L A;  1ROP A;  1FFT B;  2Q0O C;  2GDS A;  4KHP B;  1J95 A;  5FL7 G;  5LOV A;  5LOV B;  4FLZ A;  3JAM N;  2XT9 A;  2X6C A;  1SZT A;  5L3D A;  3HKC A;  1ZUQ A;  2Q7G A;  5KA5 A;  2IH1 C;  4JTA B;  3CRC A;  2GUZ B;  4O4L B;  1JMK C;  3K06 A;  3P3P A;  2WA3 A;  3RN4 A;  1M57 B;  1QBZ A;  3BEH A;  2UUB B;  4P9P A;  2XOK G;  1TGO A;  2WLH A;  1X4T A;  1V54 C;  4JI1 B;  1Q7Y W;  1NU1 H;  3ZIA G;  1YXB A;  3CD6 V;  4JI5 O;  4K0K B;  1H2G A;  1TA8 A;  4X9Q A;  1WAZ A;  3RYF B;  1SQP H;  1L1F A;  2HLD G;  3K9S A;  3E8G A;  3BA8 A;  4FM1 A;  2JK5 C;  4AI8 A;  2UUC B;  1AR5 A;  2YUA A;  4GZR B;  3HKD A;  2LGQ A;  3KCY A;  4JI6 B;  2WPD G;  2FTK A;  4IT5 A;  4JV5 B;  4MW3 A;  1Z2G A;  2NR5 A;  3CX5 F;  5IY5 B;  1QLE C;  1VP7 A;  5B1B B;  2UUB O;  1E1R G;  1W59 A;  3CCQ V;  4JI1 O;  1JOY A;  2H8P C;  3ABK B;  2BOC C;  1VMG A;  3F7Y C;  1PP9 H;  2FML A;  3ZX6 A;  2P5O A;  4NR1 A;  4DK1 A;  3K0G A;  4B08 A;  1SA0 A;  1SA0 B;  5CBF A;  3N27 A;  4LF9 B;  2OTJ V;  2HP8 A;  1BHB A;  3C3S A;  4WFG A;  2UXB B;  3APO A;  3ZMS A;  1COW G;  1N4C A;  3D36 A;  1I7F A;  1VF6 A;  3IC9 A;  1Q43 A;  1RM1 C;  1ZSP A;  1OCR C;  2W0X A;  2YEV B;  1ENV A;  3D3I A;  1PKX A;  3FB6 C;  1JJO A;  2YI8 A;  3NR7 A;  5J2T A;  3UM7 A;  5J2T B;  1KD1 W;  5GW7 A;  1KKC A;  1ZL8 B;  2ZM6 B;  2WLJ A;  3W7X A;  3VOU A;  1SKV A;  4GX2 A;  2HJF C;  2QTS A;  3ZHR A;  4I9Q A;  3R66 A;  4BIZ A;  2XHB A;  3CCU V;  3TGU H;  1WN7 A;  2QWR B;  3S3W A;  3CCE V;  1LR1 A;  4B3S O;  2VS0 A;  4CBC A;  3N2G B;  4JYA B;  1L0L H;  4B7E A;  4NKG B;  3CRQ A;  4R8C A;  5A2Q N;  3UCS C;  3L75 H;  2LFR A;  4HAM A;  1FKA O;  4FFB A;  3ZS8 C;  4IL6 Z;  3T1C A;  1QHT A;  2CH7 A;  1VQN V;  3SYP A;  4MVU A;  3GB7 C;  2WAM A;  3ZN1 A;  1R3K C;  1HP8 A;  1NTZ H;  2OTL V;  5BMV A;  2ETN A;  4PD4 F;  2UXD O;  1JVM A;  4W4K A;  4NTW A;  4I0X A;  1QU7 A;  3SPG A;  4G2K A;  1WA8 A;  1WA8 B;  3R65 A;  3W7W A;  1BS3 A;  2Q0A A;  1CP9 A;  3ZN0 A;  4AIL C;  4WFF A;  3SPH A;  3JAL A;  4U7O A;  1ZWI C;  4FFK A;  2RJZ A;  4CH5 A;  1R3L C;  5IWA B;  5LYJ A;  3QO5 A;  2CTQ A;  4H13 B;  2KG7 A;  1E79 G;  2E76 B;  1Q3E A;  5FNV B;  3H1J H;  4D6T H;  3T4D A;  5KMG B;  1K9M W;  1Q82 W;  3HKE A;  1L8D A;  4ZOL A;  4ZOL B;  2UXC B;  4DV2 B;  1PL0 A;  3AG4 B;  2JEU A;  4H0L B;  2P7T C;  2Q6A A;  3G67 A;  1QR9 A;  1YEW A;  1VQ4 V;  4CH4 A;  2BTQ A;  1XL6 A;  5CN0 A;  4Q20 A;  1MMM A;  1AB3 A;  4O2B B;  5BY1 A;  2WSS G;  4R7C A;  4FVM A;  1H2N A;  4B3M B;  3EXA A;  4GT1 A;  3CHX A;  2QJ1 A;  1RPR A;  2DYR B;  2RNB A;  4KUM A;  2UUA O;  3GVM A;  4N23 A;  1K97 A;  4DV3 O;  4FM0 A;  3EVK A;  5TIS Z;  4FIP C;  5LHG A;  4B3T O;  3WG7 C;  4EFE A;  3U11 A;  1QVF U;  3ZJZ A;  1XNR O;  4PI2 A;  1SRY A;  1K4C C;  5JJN B;  3K08 A;  3KZI Z;  4OXS A;  4TQF A;  3AG3 B;  3D3Q A;  3NXS A;  3B8N A;  1AJN A;  5B66 Z;  3LSS A;  1IDS A;  2F66 C;  2QKC A;  3ML0 A;  2YXL A;  5AG2 A;  3C90 A;  4WFA V;  3UT5 B;  3ZRW A;  3ZRW B;  1OV9 A;  4GCZ A;  4NVP A;  4BW5 A;  1NVP B;  3FB8 C;  4X62 O;  1XL4 A;  4TUY A;  4TUY B;  5DED A;  4EB6 A;  4G28 B;  3SYA A;  2DMX A;  3B77 A;  1TUB A;  4LWS B;  1ZTE A;  3DSQ A;  2YXY A;  1GKF A;  1IXM A;  1VQ8 V;  3CYO A;  2QWN B;  1HWY A;  2QWQ B;  3STL C;  1BE3 H;  2QM7 A;  1DTO A;  1WJZ A;  4RQF A;  3ABT A;  4X1Y B;  4YJ2 B;  2Y0P A;  1H2S B;  3ZHT A;  4DR7 B;  1MSW D;  4TOI A;  2ILM A;  3ZHU A;  4DXW A;  1R1B A;  3AEI A;  3ABM C;  2JS3 A;  4LF8 O;  3UO2 A;  4DV0 B;  4DV6 O;  3KG2 A;  4X1I B;  4X1I A;  2CGO A;  2RMK B;  3H1L H;  2OCH A;  2DYS C;  1T5E A;  4O4J B;  4GX5 A;  5J9P C;  4K3A A;  1SES A;  2EX3 A;  4HZ3 A;  1R6N A;  4AQY B;  1JR9 A;  1GAX A;  1YF2 A;  2ZXW B;  3E22 A;  4GKJ O;  1YCI A;  4GKK B;  3DC5 A;  4JYY A;  3LNN A;  2E5L B;  3W7T A;  1OHH G;  1UJW B;  2ZIO A;  3IJ4 A;  4ICG A;  2CAZ C;  1PNM A;  5B3S B;  2AHY A;  4JPR A;  3OD4 A;  4FLX A;  4YHH O;  1W0J G;  1TVK A;  1TVK B;  3I5D A;  4DR5 B;  2LGW A;  5HFL A;  3AG7 A;  1SQG A;  3E2E A;  3OR7 C;  3Q4H A;  3Q4H B;  1BL8 A;  2ZIN A;  3OUS A;  1V55 C;  3J81 N;  3OFN G;  2ZE8 A;  2JRI A;  5EBM C;  5EIB D;  2JJ2 G;  5LGU A;  4XDL A;  4J9Z B;  5J2U A;  2F4V O;  5C8Y A;  5C8Y B;  1YI2 V;  2LO1 A;  4L8J A;  4JYC A;  1WB8 A;  4LP8 A;  2C2A A;  5B1A B;  4DUZ B;  3CRR A;  1N36 B;  5CBH A;  2IM9 A;  2WLI A;  3TK1 A;  5IJ0 A;  1CEZ A;  4MTX A;  3CME V;  4MVO A;  4LBE C;  3H1I H;  1IBL B;  3L71 H;  1YSC A;  4X62 B;  1VQ5 V;  3JD0 A;  2EIM B;  4F6E A;  5E1A C;  3SJB C;  4OPA A;  1YVW A;  4DR5 O;  1EM1 A;  1EFR G;  4DV1 B;  2GHY A;  3KKY A;  4UCV A;  2Y4T A;  1SQB H;  3H01 A;  4D7T A;  5IYZ B;  5IYZ A;  4DRX B;  1PM9 A;  4JZG A;  1H2K A;  3B4S A;  4P2Z A;  3SJA C;  3IAY A;  2AHZ A;  4NXM B;  4LF4 B;  2AW9 A;  3JAT B;  1IZ3 A;  4HNA A;  4UCO A;  2P22 C;  3JAW B;  4DV4 B;  3L72 H;  2VQE B;  4U3F H;  4DR2 O;  5LMU B;  1E1Q G;  4ABM A;  5KHK A;  1Q8I A;  5BXZ A;  5JWP A;  1DF4 A;  1N33 B;  3P3N A;  5FLX N;  2JGU A;  1HDJ A;  4WF9 V;  4KFM A;  3M8A A;  1DGS A;  3K5O A;  3WB0 A;  5JH7 B;  2F43 G;  1FYJ A;  2PZS A;  1BT8 A;  2JVD A;  1KMI Z;  5JJJ B;  4JTC B;  3RYC A;  3RYC B;  2LQT A;  5IE9 A;  3BAA A;  1FAF A;  3I55 V;  5H6R A;  2EZO A;  4DV4 O;  1VQP V;  1OCO C;  2PYL A;  4UB8 Z;  5BZB A;  1M93 A;  2PI5 A;  3W7U A;  2IJH A;  2CGN A;  3HKB B;  3H9V A;  3QO7 A;  4DR1 B;  1S5L Z;  5IYB O;  2UXX A;  4PA9 A;  5LMU O;  4J7J A;  1IX9 A;  4MVS A;  2EIL C;  3UKM A;  1LNQ A;  3JSL A;  4I50 A;  2EJ7 A;  1N33 O;  1AI6 A;  1JJ2 U;  3O65 A;  2ADP A;  4DR3 B;  4UVC A;  2WLK A;  3T4Z A;  2YIC A;  2IU3 A;  2EIK C;  3J7A U;  3JD3 A;  1SQV H;  4K8X A;  1NKD A;  1VF7 A;  4UXN A;  1UPG A;  4I9W A;  1RM1 B;  4UCS A;  1OCC B;  3K5L A;  3LUT B;  3LDD A;  1XHX A;  2BSK A;  3HKC B;  1XHZ A;  4B7K A;  4LF6 B;  3B2E E;  3ETG A;  4DV7 O;  4PDR A;  1D2D A;  1QQC A;  1PL4 A;  2H94 A;  1Q86 W;  4PA6 A;  4NYK A;  1VQM V;  4ZBM A;  2WLL A;  1M4U A;  3AG2 B;  3JCZ A;  5C93 A;  1OJH A;  3JAR A;  4JI4 O;  4JI0 O;  1N0J A;  3OTO O;  5H6Q A;  4TV9 A;  4TV9 B;  5K1X A;  1X59 A;  1YTF D;  5DEC A;  1IVS A;  1GN6 A;  2JGD A;  5KHJ A;  2YI9 A;  3OAA G;  1YTF B;  1YIJ V;  3MD0 A;  3K59 A;  4MS2 A;  5IT9 N;  2EIN C;  4BIU A;  4JAA A;  3E35 A;  3QNE A;  2HJD A;  5H5N A;  3L9D A;  2UU9 O;  2V7Q G;  3VQV A;  1IBM B;  3TXS A;  4FLT A;  2MW2 B;  4TQD A;  4KHP O;  1B06 A;  2ZE7 A;  2OIE A;  1K33 A;  1DF5 A;  3CCJ V;  4PA4 A;  2GSM B;  4X88 A;  1XOU A;  1J5E B;  3HKD B;  3K04 A;  4XBF A;  4NXN B;  2E3C A;  1I94 B;  1Y6X A;  4BWA A;  4BR6 A;  2CUG A;  1H38 A;  1WP7 A;  3SDL A;  4MSW C;  1NQT A;  2W6I G;  1KC8 W;  4MTO A;  5LA6 A;  5B5E Z;  4XDK A;  3CS5 A;  1AI5 A;  5LHI A;  3ZHS A;  5LXT A;  4QE9 A;  5LXT B;  2OIG A;  2DW4 A;  2DWE C;  2M6Y A;  3LSQ A;  2Y69 C;  2XAG A;  1Q6I A;  2F95 B;  3PN1 A;  2OCC B;  1IBM O;  4JI3 B;  4K0K O;  1W2B U;  1K8A W;  2X6B A;  1IUR A;  3CXC U;  3LSU A;  4L87 A;  4WBN A;  4WBN B;  4GUN A;  1KQS U;  2ZE6 A;  2UUC O;  4PJ0 Z;  1J5E O;  4JI6 O;  1KEC A;  1Y4M A;  1SZX A;  4F6R A;  4JV5 O;  5FPO A;  1XIL A;  4JF3 A;  3OE7 G;  2WA4 A;  1XRE A;  3WG7 B;  3ABL B;  1NJI W;  3AG1 C;  3N2K A;  3N2K B;  1PNK A;  1G1X B;  3ASN C;  5LP6 C;  4GYC B;  3K03 A;  4LFC B;  4LR3 A;  2Q73 A;  3TJT A;  4FZ1 A;  3UQ8 A;  1KKD A;  2XAH A;  4WFB V;  2GTA A;  4J42 A;  2PYJ A;  1MNG A;  2AZ2 A;  2VWK A;  2YXH A;  3CCV V;  1SQX H;  4MVR A;  4CC6 A;  3BRC A;  1VQ9 V;  2KB1 A;  3MDS A;  3QG5 A;  5KUK A;  1JFF A;  1JFF B;  4DV5 B;  4FFB B;  4LF9 O;  2XAS A;  3HB3 B;  2CH7 B;  3JAK A;  3ETE A;  2LW7 A;  4HYO A;  4AHC A;  5BMV B;  1M57 C;  2UXB O;  2P6J A;  4NB5 A;  2PY5 A;  1NBM G;  2QWO B;  2XAJ A;  4I0X B;  4LCU C;  3I56 V;  1FD9 A;  1O9G A;  3BPZ A;  2ZM6 O;  2H3O A;  3FB5 C;  3JAL B;  3G71 V;  3APQ A;  2CTP A;  2AXT Z;  1M56 B;  4U3J A;  4U3J B;  4YY3 B;  2HR3 A;  2ZT9 B;  1WLE A;  3VQW A;  3K9A A;  3ZRV A;  3OMN B;  3QTC A;  1K34 A;  3ZMT A;  5LYJ B;  2KG7 B;  5B1O A;  1IBK B;  3HR0 A;  4XDJ A;  1EN5 A;  4JYA O;  3CPW U;  4Z1V A;  3HKE B;  4JI8 B;  3A2F A;  4DV5 O;  3DXR A;  2KQX A;  2CK3 G;  3K3W A;  5IY5 C;  5B1B C;  3OUF A;  1WPX A;  2Q68 A;  4UVA A;  5EBL C;  4Z1M G;  5L3C A;  2BTQ B;  2HEP A;  1SS3 A;  1FXK A;  1FXK B;  3JD4 A;  5CA0 A;  5CA0 B;  4FPP A;  3X2Q B;  4I5S A;  1XDC A;  1Z5V A;  5D5Q A;  4PA3 A;  1GTO A;  1PPJ H;  1S3J A;  3OGI B;  1P7B A;  3CC2 V;  5IJ9 A;  5IJ9 B;  2Y0I A;  1YJN V;  3MAQ A;  4OGQ B;  3CC7 V;  2ZR3 A;  1D5N A;  5IWA O;  2X6A A;  4CS2 A;  3LNM B;  2N05 A;  1IBK O;  4RQE A;  1V55 B;  5L3B A;  1YJW V;  4IHJ A;  3DC6 A;  1JQ0 A;  1SC5 B;  4JI8 O;  1NH2 D;  1VQK V;  1F4N A;  2R70 A;  1NH2 B;  3WFV A;  2K1E A;  3TXQ A;  4J80 A;  2UXC O;  4DV2 O;  3ZED A;  2L35 A;  2QKA A;  2B1G A;  4YJ3 A;  3FFQ A;  1EZJ A;  4RWU A;  3L70 H;  2ZKO A;  2Q7E A;  1U97 A;  2YS8 A;  3OW2 U;  4B3M O;  4EB6 B;  3BVO A;  1TUB B;  4UB6 Z;  1AR1 B;  5KA6 A;  4K8Z A;  3SGI A;  3ASO B;  4PDM A;  1KP3 A;  3G6B A;  4UV9 A;  5A9G A;  2R9R B;  3CCL V;  3CE2 A;  3RT3 C;  1BSM A;  3E89 A;  5DN6 G;  1LUV A;  1OCZ B;  1PNL A;  4DW1 A;  4GX1 A;  3BHP A;  1AVM A;  4D7S A;  4TV8 A;  4YXW G;  1AIL A;  1G6U A;  1F7Y A;  5EZY A;  4G27 B;  5FPR A;  3QVN A;  1K5Q A;  3IC7 A;  1US6 A;  1GH6 A;  2ZNJ A;  3CP1 A;  2WLN A;  2F23 A;  1N34 B;  2HVK C;  4OX9 B;  1FFX A;  4DR4 B;  4X1K A;  4H33 A;  5KAI Z;  5JQG A;  4PA7 A;  1H8E G;  3E22 B;  1BMF G;  2XUM A;  1FS0 G;  2B5U A;  5EYP A;  5EYP B;  3G6E V;  2ZQM A;  5ITZ A;  3MHH C;  4KP4 A;  2Q4P A;  1H8H G;  5EK0 A;  2A7W A;  4C7U A;  4LFA B;  4BIO A;  4CZZ A;  2EIJ B;  4DK0 A;  2Q67 A;  1WP8 A;  3AG4 C;  1S72 V;  1GM8 A;  4DR7 O;  1KUQ A;  2RCV A;  3FYE B;  3ZRX A;  2GV9 A;  4X20 A;  1GM7 A;  3RYH A;  3RYH B;  4DUY B;  1I08 A;  4DV0 O;  5LMN B;  1GK9 A;  2DYR C;  5JCO C;  4NTX A;  2ZIM A;  5J2U B;  2YC0 A;  2Q8V A;  4MT8 A;  4OX9 O;  1XI1 A;  1ORQ C;  4AQY O;  2W6J G;  1NI8 A;  2DQ0 A;  3ZMZ A;  1Y66 A;  4JGS A;  3SYC A;  2WLI B;  5IJ0 B;  4ZIB A;  5GTI Z;  2ATK C;  2VQF B;  4UFZ A;  4GKK O;  1NS1 A;  1YDX A;  2WWW A;  2E5L O;  2IJI A;  5K1P A;  4LFA O;  1UFI A;  3AG3 C;  4RO2 A;  1Q5O A;  2QGN A;  5EBW C;  3B40 A;  5LHH A;  5EC2 C;  4LF7 B;  3RWR D;  3SYO A;  5KX5 A;  1KP2 A;  3H1H H;  1BCC H;  2CDY A;  2QE7 G;  3E8H A;  3CCM V;  1M90 W;  2LFS A;  4W4L A;  4DUY O;  3E8B A;  5LMN O;  3OMI B;  1XNQ B;  2A06 H;  3AK1 A;  4OPH A;  2QM8 A;  5BR8 B;  2D2C B;  3JAS A;  3JAS B;  4HNA B;  1V54 B;  2CE4 A;  4QPJ A;  1XUQ A;  5F2V O;  2P4K A;  2YID A;  1FPO A;  4DUZ O;  5HFM A;  3QO8 A;  1N36 O;  2WLM A;  2VQF O;  2BE3 A;  1HNX B;  4LH7 A;  1IBL O;  4TWK A;  5GON A;  5GON B;  1FXH A; 
#chains in the Genus database with same CATH homology
 3CJH A;  3CJH B;  2BSK A;  3DXR A;  2BSK B;  3DXR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...