2BSKA

Crystal structure of the tim9 tim10 hexameric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9
publication title Crystal Structure of the Mitochondrial Chaperone Tim910 Reveals a Six-Bladed Alpha-Propeller.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 73
sequence length 73
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 2bskA00
3CJHA 3CJHB 2BSKA 3DXRA 2BSKB 3DXRB
chains in the Genus database with same CATH superfamily
1H38A 5KUMA 2IM9A 4KXRA 4FFBA 2UUBB 5IJ9A 4JI2B 2VWKA 1N4CA 1JCHA 2V7QG 4IHJA 1SZXA 4B3SB 4DYLA 4K35A 4GKJB 5JH7A 4NXMO 4Z1VA 2UXCB 4GZRB 2K9PA 5KHGA 2HHHO 2LO1A 1NBMG 3FB8C 5EBWC 4GX5A 3OTFA 4EEQA 1SKVA 3ZCCA 3JALA 3BY6A 3AK3A 5JJNB 3AG3B 3AG4B 4TQDA 1PPJH 4J9ZB 3JAKB 4MS2A 5LMNO 3LUTB 5EBMC 1AP5A 2ZE5A 4E4EA 4DV6O 3CYOA 1XREA 5EK0A 3JASB 1UJWB 4YJ2B 4B7EA 1AROP 3FYIB 2R9IA 3RYCA 3G4SV 1YIJV 4OX9O 4ZIBA 1H2SB 2IU3A 2W0XA 1RSOA 4O4HA 5KA6A 4J42A 1XNQO 3OGCC 4UXNA 4X1IB 1WP7A 2JEUA 1YJWV 1NR7A 4JASA 2DOSA 1V55B 2Q5ZA 1KKCA 5CN0A 3RVYA 3GWKC 2P67A 1K73W 4J10A 1MNGA 1RM1B 2VQFB 1WP8A 1K34A 1Q43A 1XHZA 4CC5A 4L87A 5LHIA 1LUWA 3TJTA 2OIEA 3D3QA 2P4KA 3R66A 1XMQO 4LFCB 4WFGA 4EFBA 2OCCC 1R3JC 4YY3B 2JEXA 3RFRA 1O9GA 2RNBA 3JSNA 4IGGA 3OTOO 4FMTA 1VQ9V 3W7XA 1VQ6V 1IBMO 5CA1B 3CXHF 1R3IC 5IYBO 4X1KA 4JI8O 1OJHA 1WA8B 1PNMA 4DRXB 4Z1MG 3CMAV 4OPAA 4FLXA 5L3DA 5IWAB 3UKMA 3ABKB 4F4LA 4TT3G 3AG7A 2R70A 1MZEA 2AXTZ 4UVBA 2AZ0A 1LR1A 3C3SA 4JYBA 3KZIZ 3UO2A 4JYYA 5KHJA 2QE7G 1K5SA 3JARB 1N8RW 1GM8A 1RFYA 5ITZB 1HP8A 3X2QB 3BHPA 5IJ0A 1QLEC 2EULA 1AI7A 3KKYA 2E5LO 1M57C 5JWPA 2OTJV 4GYCB 5KX5A 4JI3O 5D5QA 4CS4A 5LBQA 3K3WA 1JA8A 4JYAB 1PL0A 3CHXA 1AR4A 5IY5B 2ZDIC 1THZA 1IXMA 1XNRO 2EIKC 2QTSA 4DV4O 3OAAG 3H01A 3RW0A 1RPRA 3OW2U 2UXDB 3WB1A 3WFVA 4JI4O 1PL4A 2BOCC 4I50A 4PA6A 4F6RB 2Q0AA 1VF5B 2JJ1G 1UFIA 2ZXWC 4PA9A 1Q90D 1XL4A 4MW8A 3A0BZ 3P3NA 1VIBA 1H8HG 1VQ7V 1KP2A 1QQCA 3JAWB 4HNAB 2A9HA 3SR2C 2UUCO 1IBKO 3F7VC 4D7SA 4K0KO 4DR6B 3SJBC 5LOVB 2EX3A 4I9QA 5B5EZ 5KAFZ 2E74B 4DK1A 2HP8A 3QTCA 4LF7O 1V9PA 1MSDA 3SYOA 3QF7A 4KL1A 3E89A 5F2VO 1G1XB 1W0JG 4DR3O 3D8CA 3CCQV 1DTOA 3JAKA 1XEQA 1RPOA 5H2FZ 1H2MA 2PI5A 1QR9A 1K4CC 4DV3O 5C93A 4C7UA 3JASA 5LHGA 4FLYA 1AR5A 1AJPA 5CA3A 4YJ2A 3CSXA 4LF4B 3JD2A 2PGGA 4IYHA 4FLTA 1E1QG 1OCZC 3CMEV 2VQEO 3ABLB 3IJ4A 1S0VA 4UFZA 1Y67A 2YS8A 2Q7EA 4B3MB 3A8TA 2WA4A 4MVQA 1TVKB 4QE9A 2OWOA 1QNMA 1JJOA 4FM2A 3OE7G 4QPKA 4WF9V 4X1IA 3JATA 3AG1C 1SQXH 1W2BU 4ZHQB 1Q6IA 4LCUC 4NB5A 1VQMV 2RJZA 3JCUZ 4PA3A 4X65O 2LGQA 2ITDC 1N34B 3K0DA 2OCCB 2IH3C 3VOUA 1VQOV 3APQA 3M99B 4BW5A 1F51A 3OEHG 4H33A 2Y69C 1Q3EA 5JCOC 5CA1A 3APOA 3ZHSA 3DGEA 1VQKV 2H94A 2Q4PA 4G2KA 3IFXA 2WLIB 1WA8A 3T4DA 4DRXA 3J7AU 3SYAA 4TQFA 4MW3A 3CCEV 2R72A 3OEEG 3DSQA 4TV8A 2Y48A 3U11A 4JAAA 3T1CA 3ML0A 4FVMA 4R8CA 4X66O 1S5JA 1VMGA 2CTRA 3UCSC 2NR5A 1MABG 3NXSA 4DR4B 2RMKB 4O2BB 4FM0A 4KHPO 3JARA 4NTWA 4B3RB 3IC7A 5IYDO 4H37A 1QLEB 1YF2A 2WAMA 1D5AA 2ZR3A 1M57B 5KHKA 3K06A 4D6TH 4LNUB 1NI8A 1EZJA 1AILA 3EVKA 1OCOC 4ZOLB 1YZBA 5HFLA 2AHYA 1R3KC 2ZNJA 5BXZA 1WPBA 4DUZO 1HNXO 3U10A 2EIKB 2QR4A 1SQQH 1HNWB 3S3WA 4NXNO 4JI6B 5LA6B 2WWWA 1J95A 4UVCA 4JI7B 2HFEC 1M1KW 1W59A 3LDDA 4IIJA 2DW4A 4X62O 2ZXWB 1OCCC 4DV7O 1VP7A 2MK3A 1JJ2U 1SERA 2EJ7A 3ASOC 4JPRA 4F6RA 1P7BA 1Q86W 2BE3A 3S3XA 2YUAA 2P90A 3M7MX 4RQEA 2XTAA 2WSSG 3AK1A 4BIOA 3LDEA 3K79A 1I94O 3JAWA 4HNAA 4B7KA 5EZYB 1ZX3A 3G6BA 2F43G 2HR3A 4P9PA 1J5EO 1I08A 3FFQA 2JJ2G 4O2AB 4TUYB 2EJRA 2OIGA 4PA7A 5EC2C 1QCEA 2ZT9B 4O4IB 4YXWG 3K5OA 1VF6A 1SQPH 1Y6XA 3G80A 4WFHA 1DGSA 5KAIZ 1F4NA 4RWUA 4UCSA 1S76D 5JQGB 3UQ8A 1Y76B 3JD0A 3K59A 3K04A 2Y4UA 5BY1A 2GV9A 4JAUA 3E2EA 2HG5C 3THOA 5K1PA 4Q20A 4IL6Z 1PNLA 1OCZB 1DF4A 4LR3A 1COWG 1TUBA 4FM1A 1FJGO 4DR2B 1A32A 4RUEA 1L0NH 5B1NA 5LHHA 3T2MA 2CTWA 1FXHA 1AB3A 3FAVB 2MW2B 2JGUA 4NTXA 1GMGA 2ADPA 3JCZA 4QPJA 2RN9A 1TVKA 3F5TA 5DN6G 1TUEB 1KD1W 2K1EA 1NTMH 2XAHA 4JTCB 3CC2V 3MHHC 2WLJA 4ZHQA 4LF9O 4DO2A 5K1XA 2QM7A 4LF6O 2YI9A 5H6QA 3QO8A 4ASUG 4XDLA 2HHHB 5L3EA 2D2CB 2X7RB 4DV0O 4J41A 3Q4HB 1NTZH 3RWRD 2AZ2A 2RQ6A 1R6TA 3H9VA 5BR8O 4D7TA 3FB5C 3HKDB 3RN4A 3UO3A 2Y69B 3CEIA 4X64O 5H5NA 4O4LA 1NVPD 4DV6B 4YIOA 2Q7HA 2UUAO 1HW7A 1FFXB 2E3CA 2YIDA 5KLVH 2EIMC 3FB7C 3HR0A 1XMOO 2Z5UA 4JI5O 5H6RA 4UB8Z 4LFBO 1K5QA 1K92A 4OX9B 1G8MA 1HWYA 2XNDG 4O4JB 1Z2GA 2W6IG 4CH4A 5CBHA 3L70H 2ZM6O 1XNQB 4ZI7B 3RT3C 4H44B 5FLXN 2OCHA 1DF5A 4J9YB 2ZR2A 4PD4F 2CDYA 4YJ3B 1JVMA 2B9ZA 5IT9N 2FTKA 1IBLO 1OCOB 4CS3A 4WBNB 3ICXA 3HKEB 1OCRC 4LNUA 2XAGA 4ZOLA 4DR5O 2PYJA 2YC0A 4JYCA 4JV5O 1HNZO 2X6CA 1IBMB 5J9PC 1LUVA 3MDSA 4BR6A 4X89A 3OUSA 4AQYO 2FMLA 2E76B 4QGPA 4YIPA 2Y0IA 3BABA 2CH7B 2WPDG 4CC6A 1N32O 1OCCB 2DN9A 3W7SA 3ASOB 2BTOA 3ZMVA 4PHZA 4BIZA 1S3JA 4HAMA 1XL6A 3ZRWB 3AK2A 3MD0A 3BAAA 2BSKA 3I55V 3OR6C 4DV1O 4MVUA 1LNQA 3TXQA 5KMGB 5AG2A 3TETA 4PA4A 2WLMA 5EZYA 4DV5B 3ZBHA 2UUBO 2N74A 2XAJA 2AGAA 1ZLZA 2EIJC 1SRYA 1R1BA 1K4DC 1KU9A 4B3SO 1ZWIC 4GKJO 3B8MA 4UCRA 4O2AA 4TUYA 2QWQB 2UXCO 1KBHA 2F1MA 4JGSA 4O4IA 3NR7A 3EHBB 4JI3B 4LF8B 3B2EE 1M5IA 2Q73A 1FFTB 3BA8A 1YITV 2ZE6A 5C8YB 5CA0B 4GX2A 1WLEA 5JQGA 1Y76A 3ZX6A 4KUMA 2EZPA 2QJ1A 4X20B 5LGNA 3OD4A 3DXRB 3ZHQA 3TXSA 5LXTB 2VRZA 4Q6GA 4JI4B 4NYKA 2IJIA 5DM6V 1M90W 1Q8IA 4FK5C 3VQWA 3B4SA 3ZN0A 3E22B 4IYIA 2Y4TA 3SDLA 1Q7YW 1KP3A 4P9OA 1CP9A 4JAVA 2Z3YA 2UUCB 1N36B 1H8EG 1EN6A 2GDSA 3ETEA 5EC1C 4DW1A 4R7CA 3GVMA 3CB2A 3OFNG 1NTKH 3FB6C 4ICGA 5LP6C 4RUFA 4N23A 2WLHA 1TGOA 1EZVH 2CTQA 1I5YA 3EFFK 4UCUA 5B3SC 3MHSC 2EILC 2YIBA 2WLKA 4YY3O 1BHBA 1H2KA 2UU9B 3HKDA 2HJDA 5JCOA 3CC4V 4DR7O 4DV3B 4JTDB 2EIMB 5KHHA 2GTSA 1QR8A 1FFXA 2LFRA 1H2GA 1Y74B 2YIAA 1MMMA 3SJCC 3ZHUA 3LSSA 1WPXA 4CZZA 3VQXA 1I7FA 3B40A 4W4LA 2VQEB 5IWAO 5FNVA 3OMIB 4W4KA 3ETQA 2YDEA 4EB6B 4O4JA 2EBOA 1JPXA 3RGBA 4FLWA 3H1IH 4MVOA 2D3OW 4WFFA 4UCVA 1R6KA 4UV9A 5LGTA 1CPYA 3RYIB 2F93B 2B5UA 4ZI7A 1D2DA 4YJ3A 1JMKC 4LF5B 3STZC 2HKOA 2ZIOA 1YDXA 3AG2C 1ZL8B 4QIWF 1OCRB 2YIBD 4TV9B 3UM7A 3JSLA 4OXSA 1YI2V 3ZMZA 4R50A 3HKEA 4X9QA 2BOBC 3ZS8C 1NVPB 4AILC 4TWKA 1EN4A 4WFBV 2ODMA 4JYAO 4UVAA 3E86A 1AI4A 3HPLC 4MSWC 5IYCO 2OT5A 5L3GA 3KCYA 2NLJC 3CRCA 3ABMC 1FXKC 4DXWA 2UXDO 3RBZA 4E2LA 4BWAA 1BL8A 2XAQA 1L8DA 4CH6A 2A3QA 3QO5A 1B6QA 3KCXA 1XQ8A 2EZOA 1SETA 3ZRWA 4X66B 1I0HA 4NTYA 3CCLV 3ABUA 1IXBA 1KYOF 5BZBA 3SPJA 5KMGA 4AI8A 1UPGA 2EIJB 4DR6O 2M7WA 2FKXA 3JD4A 2F23A 2N05A 4ZKIA 4KFMA 1Z5WA 3GWOA 3ZMUA 2PI4A 1N33O 1HR0O 4MVSA 2KQXA 5JJEB 5DEDA 2CUGA 1FAFA 5JVDB 2GBOA 5D5PA 2QGNA 1VQ8V 4GKKO 3R65A 4DUZB 1HNXB 4PELA 4U7OA 5GTHZ 3ZHVA 5J2UB 3RYFB 1P7GA 2Q7GA 3G6EV 2LW1A 4I55B 2KKWA 3ABTA 3J81N 2KSDA 4JI0O 1H2LA 4WFAV 3W7TA 3CRAA 3HKCB 2A06H 5LXTA 3A2FA 4MTGA 4QNHB 5LMUO 2IU0A 2W0FC 2JS3A 3ETDA 5A2QN 5CBFA 3BFRA 4DUYB 3E22A 3I56V 4I0XB 5ITZA 2DQ3A 3OMNB 1R3LC 2P06A 3FX7A 3VQVA 3HKBB 5IJ9B 2F4VO 2DYRC 4BAYA 5CB4B 5LP6B 3LSUA 2NNUA 2UXXA 1GTOA 2XAFA 4OGQB 5B3SB 2EILB 1VQ4V 5FPOA 5LGUA 2E75B 1BT8A 5KA5A 4PI0A 1B3QA 1X4TA 4TOIA 1IX9A 2GHYA 2LJ2A 2FYUH 3OM3B 3PN1A 2P22C 2B1GA 2HJFC 1L1FA 1MSWD 4Z2WA 4DV2B 3SJAC 1BZKA 4GT1A 1QU7A 1PD3A 4UCTA 3JAMN 1Y74A 1BCCH 1WB8A 2ZIMA 5EBLC 1GKFA 1Y4MA 1U96A 2FL4A 4K8ZA 1KUQA 4L8JA 3P32A 4JF3A 4EB6A 1WAZA 1PNKA 1KB9F 4I5SA 4N21A 2B1IA 1BGYH 4XDJA 5LOVA 4DR4O 3RYIA 3T1YB 3CX5F 1KC8W 3ZJZA 2KB1A 5GW7A 4B3RO 5EIBC 3M8AA 1S5LZ 4LF6B 3PJSK 1BE3H 3SPCA 3AG2B 1SZTA 4DV0B 1GN6A 1ZL8A 1SQVH 4B3TB 2WA3A 1PM9A 4J80A 4H13B 2UXBO 5L3BA 2QKAA 5CMUA 4X64B 4J11A 3K5LA 3K9AA 1PP9H 1N0NA 5BMVB 3KG2A 1FD9A 1RP3B 4K3AA 1PKXA 1Q6UA 1HNWO 3H1HH 4FIPC 4OPHA 3ABMB 1FXKB 3RVZA 3SYCA 4JI6O 2XOKG 3P30A 1P4RA 3WG7C 4JI7O 3C3TA 3CRMA 2JRIA 3H1KH 3SJQC 3ABKC 4DR1B 1XBLA 1IZ3A 2ZINA 2DJVA 1EM1A 3ZHRA 1US6A 1VARA 2UXNA 3AG1B 2ZM6B 2RCVA 1ROPA 2DWDC 4P2ZA 2NN4A 4NXMB 5H9CA 1AI6A 2YXLA 4NVPA 1BSMA 1NR1A 3K5MA 4FZ0A 4GX0A 1JQ0A 5IJ0B 1GM7A 2Q9LA 4U3JB 5GTIZ 1AR1B 3DC6A 2ADQB 1OHHG 5IE9A 2RDCA 1QVGU 1BS3A 4HYOA 4X88A 5KX5B 2JIZG 5LMNB 3N2GB 4PJ0Z 3D36C 2CTPA 4DR5B 1AP6A 1ZTEA 1MA1A 2BTQB 3L71H 1FKAO 5JVDA 3K08A 1ZAUA 4CS2A 4JV5B 1HNZB 2Q67A 1V54C 3ASNC 4J7ZA 5J2UA 3RYFA 1CEZA 2WLIA 4I4TB 1JFFB 3K0GA 4I55A 1K33A 2Q8VA 3CE2A 4FPPA 4YHHO 1MZFA 3HKCA 4DR2O 4KP4A 4PDLA 5L3FA 2BCCH 2LW7A 3T1HO 4O2BA 2L35A 3CPWU 1URFA 2N04A 3EXAA 2PZSA 2QTOA 1S72V 2DQ0A 2DYRB 3HKBA 1R6NA 5CB4A 4PDMA 3W7UA 1XMQB 5LP6A 3K03A 3CS5A 3ZRXA 3HB3B 3E8GA 2C2AA 1OV9A 3G67A 2JK5C 3OTOB 2ZKOA 5B1BC 3QNEA 1GN2A 2ZDIA 2QM4A 1VF6C 4JI8B 4WFEA 2W6JG 4G27B 2X0LA 4BIUA 1F23A 3E8HA 2ETNA 2Z0AA 4MVMA 2YEVB 5B1OA 1B06A 5LA6A 3CJHB 2CE4A 4JI1O 1K8AW 4CH5A 2ILMA 2G38A 3CP1A 4U7NA 3H1LH 5CBGA 1M4UA 4EFEA 4QE7A 4LFAO 2P7TC 2JDIG 2ZD9A 3BVOA 1DLBA 1YTFB 2AHZA 2YXYA 3L73H 3ABLC 2LP7A 1R73A 3T4ZA 5FL7G 5GONB 4AHCA 1E1RG 1GO3F 4LBEC 5E1AC 4MVZA 4JI2O 1IDSA 2F95B 1K97A 1SS3A 1S5HC 2E5LB 3JATB 2QWOB 4X1YB 1ENVA 4MTXA 3CD6V 4PI2A 3O9OA 3TCUA 1H2NA 1M93A 2XASA 1XOUA 4GX1A 1P84F 1DK1A 2QSAA 1YHQV 1YEWA 5J2TB 2R9AA 4DW0A 1XNRB 1QHTA 5LYJB 4DV4B 1FYJA 1BMFG 3AEIA 3LDCA 2ZE8A 3CCRV 4LC1A 4DR7B 2VWJA 3W7WA 2QWNB 1SQGA 5BMVA 1MOFA 2LFSA 4LH6A 3WG7B 1FXKA 2M6YA 3A0RA 3LNNA 3FAVA 5HFMA 4TV8B 1T5EA 2A0LA 1IBKB 1Z5VA 4K0KB 1YVWA 2F66C 1GM9A 2H3OA 2IBZH 3OR7C 4PV1B 3IGAC 3B8NA 2QM8A 2YXHA 2VQFO 4DV5O 1G4YB 2Q68A 2JGDB 2GUZB 4LF7B 3N2KB 3Q4HA 3WB2A 3BRCA 4U3JA 4LFCO 1WN7A 1SC5B 1D5NA 3G71V 4DR3B 3FYEB 3OGIB 3N2GA 4QJFB 1AVMA 4LF8O 2BTQA 4GUNA 4PDRA 1WJZA 3CCUV 1V54B 3ASNB 4HBNA 1QVFU 2VS0A 3OMAB 4I4TA 3TGUH 1K3EA 1JFFA 4LH7A 4LP8A 3E35A 3QO7A 4CH3A 4FLZA 4IIJB 3IAYA 4UUJC 5A9GA 2H8PC 2PYLA 3D3IA 4WCEV 3K5NA 3ZIAG 1Q6HA 3CWBH 2P4VA 4TSFG 1NH2D 3IC9A 4J7JA 2WLLB 5JJJB 1VF7A 1IURA 2A79B 1ORQC 5E79Z 2KG7B 3ETGA 1OZ0A 2L6LA 1N36O 1FS0G 1ZUQA 4LWSB 4UV8A 5EYPB 1XHXA 4X65B 2Q6AA 4WBNA 1QLNA 2QKSA 3J80N 1G6UA 2Y0PA 1N33B 1HR0B 3OUFA 4JTAB 5B1BB 3JD1A 5IYZB 5B1AC 2X6AA 3C90A 2XHBA 1M56C 2JS5A 1VQPV 2HLDG 3B77A 2CAZC 4U3FH 4GKKB 1YCIA 4UB6Z 1XI1A 3SPHA 2UU9O 4F6EA 4I7ZB 3CC7V 3BPZA 2YEVA 3GB7C 2DYSC 3FKSG 3CJHA 3RYHB 1CXZB 1GK9A 1SESA 4JI0B 2CH7A 4JZ2A 1VQLV 5TISZ 1YXBA 1MG1A 4PDVA 1TUBB 2JVDA 2WLNA 4IT5A 2ZQMA 1AJQA 2YSUB 2FB5A 4H0LB 5LMUB 3P3PA 3L9DA 4MT8A 4KHPB 4R6ZA 2Q69A 1B04A 2OTLV 5GONA 4XDKA 2YICA 4J7KA 1WB7A 1X59A 1SA0B 3OT7A 1K7DA 3VBBA 2ZNIA 2F4VB 1EFRG 3E8BA 4P30A 4X1YA 4FFKA 3DC5A 3JD3A 2V4DA 3ZRSA 4LF5O 1GAXA 2XUMA 4ABMA 2QWPB 3CRQA 5L3CA 4RQFA 1F7YA 5C8YA 1NU1H 5CA0A 5J2TA 2CK3G 2ATKC 5LYJA 4NXNB 5KHIA 3I5DA 1KMIZ 3F7YC 4O4LB 4X20A 3UT5B 4EKWA 2QA4V 4BW9A 2V1DA 3DXRA 2HVJC 4LF4O 1P49A 4X62B 4DV7B 2CGNA 1KECA 2IJHA 2P5OA 2PUSA 1FPOA 2PY5A 4MTFA 2O57A 3STLC 1YTFD 1KKDA 1GN4A 4B3MO 1GN3A 1Y66A 3BA9A 3ZEDA 3SYQA 1JX9A 2EINC 1I94B 5LL6Y 3U0ZA 4FFBB 1SQBH 3A0HZ 3E8FA 1BHAA 3ZRVA 1J5EB 1QBZA 1AJNA 1GRJA 4IHJB 3LSQA 1Q5OA 5JH7B 1AI5A 4FZ1A 1JOYA 2IJKA 3K58A 1M9NA 1W0KG 2DWEC 4G28B 5EIBD 1PV0A 4B08A 1XDCA 3SGIA 3CCJV 2JGDA 1N34O 3JALB 2GUZA 3N2KA 2PTMA 1FXVA 3CRRA 3D36A 1NKDA 3AG3C 3AG4C 2UXBB 4FLVA 5IDJA 2QKCA 3ZMTA 4I9WA 2QWRB 3FD9A 2GTAA 4NKGB 2Q0OC 3L74H 3TK1A 1S77D 1NQTA 4GLXA 1FJGB 5FPRA 3QVNA 3RYCB 3JYCA 1BQZA 2HVKC 3L75H 3WB0A 4HZ3A 4UCOA 1Q82W 3BEHA 2R9RB 3DTUB 1E79G 1RSOB 4O4HB 2QEXV 2BSKB 2P6JA 1SF9A 3SYPA 1YJNV 3ZN1A 4DUYO 2WLLA 1IVSA 2A7WA 3K9SA 4LF9B 1O9HA 1V55C 2KG7A 1NT2B 2IH1C 4RAIA 3LNMB 3WU2Z 4LWSA 1ZSPA 5EYPA 1RM1C 1Q81W 2YI8A 4TV9A 1N0JA 5BR8B 2DMXA 2CGOA 1VQNV 3QG5A 5B1AB 3N27A 2IW5A 4NR1A 1M56B 3SPGA 1EBOA 5IYZA 1NJIW 1U97A 4XBFA 4X1KB 2UUAB 1TAEA 1WNSA 4MTOA 1EN5A 1NZ6A 2ARHA 4MVRA 4FLUA 1XMOB 2DYSB 3F5WC 4JI5B 4DV2O 2LGWA 4X8AA 3H1JH 4CBCA 2GSMB 5DECA 3RYHA 1VEWA 4LFBB 2AW9A 1HDJA 2PF4E 4YHHB 4GCZA 1NH2B 4K8XA 1XUQA 3ZHTA 2QDOA 1VQ5V 3T1HB 3O65A 2IJJA 4FJCC 4A5UB 3CCMV 2ITCC 4RO2A 1SA0A 1IBLB 3MAQA 2XT9A 3X2QC 1YSCA 2HEPA 3T1YO 1TA8A 3SPIA 4ZBMA 2LQTA 4DK0A 2OYQA 1BQ0A 3CXCU 1XILA 4B3TO 5IY5C 1L0LH 1NS1A 1F4MA 1GH6A 4AQYB 3B09A 1YJ9V 1I5XA 3K57A 2ZE7A 2DE0X 4JI1B 1JR9A 3UT5A 1N32B 3BCCH 3E83A 3CCSV 4I50B 1KQSU 3VQYA 4LFAB 5B66Z 2ZCEA 4JZGA 3ZMSA 3CCVV 4DV1B 5FNVB 2EINB 5KUKA 1K9MW 1SQFA 3L72H 4I0XA 4DR1O 2X6BA
chains in the Genus database with same CATH topology
3CJHA 3CJHB 2BSKA 3DXRA 2BSKB 3DXRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH A;  3CJH B;  2BSK A;  3DXR A;  2BSK B;  3DXR B; 
#chains in the Genus database with same CATH topology
 1H38 A;  5KUM A;  2IM9 A;  4KXR A;  4FFB A;  2UUB B;  5IJ9 A;  4JI2 B;  2VWK A;  1N4C A;  1JCH A;  2V7Q G;  4IHJ A;  1SZX A;  4B3S B;  4DYL A;  4K35 A;  4GKJ B;  5JH7 A;  4NXM O;  4Z1V A;  2UXC B;  4GZR B;  2K9P A;  5KHG A;  2HHH O;  2LO1 A;  1NBM G;  3FB8 C;  5EBW C;  4GX5 A;  3OTF A;  4EEQ A;  1SKV A;  3ZCC A;  3JAL A;  3BY6 A;  3AK3 A;  5JJN B;  3AG3 B;  3AG4 B;  4TQD A;  1PPJ H;  4J9Z B;  3JAK B;  4MS2 A;  5LMN O;  3LUT B;  5EBM C;  1AP5 A;  2ZE5 A;  4E4E A;  4DV6 O;  3CYO A;  1XRE A;  5EK0 A;  3JAS B;  1UJW B;  4YJ2 B;  4B7E A;  1ARO P;  3FYI B;  2R9I A;  3RYC A;  3G4S V;  1YIJ V;  4OX9 O;  4ZIB A;  1H2S B;  2IU3 A;  2W0X A;  1RSO A;  4O4H A;  5KA6 A;  4J42 A;  1XNQ O;  3OGC C;  4UXN A;  4X1I B;  1WP7 A;  2JEU A;  1YJW V;  1NR7 A;  4JAS A;  2DOS A;  1V55 B;  2Q5Z A;  1KKC A;  5CN0 A;  3RVY A;  3GWK C;  2P67 A;  1K73 W;  4J10 A;  1MNG A;  1RM1 B;  2VQF B;  1WP8 A;  1K34 A;  1Q43 A;  1XHZ A;  4CC5 A;  4L87 A;  5LHI A;  1LUW A;  3TJT A;  2OIE A;  3D3Q A;  2P4K A;  3R66 A;  1XMQ O;  4LFC B;  4WFG A;  4EFB A;  2OCC C;  1R3J C;  4YY3 B;  2JEX A;  3RFR A;  1O9G A;  2RNB A;  3JSN A;  4IGG A;  3OTO O;  4FMT A;  1VQ9 V;  3W7X A;  1VQ6 V;  1IBM O;  5CA1 B;  3CXH F;  1R3I C;  5IYB O;  4X1K A;  4JI8 O;  1OJH A;  1WA8 B;  1PNM A;  4DRX B;  4Z1M G;  3CMA V;  4OPA A;  4FLX A;  5L3D A;  5IWA B;  3UKM A;  3ABK B;  4F4L A;  4TT3 G;  3AG7 A;  2R70 A;  1MZE A;  2AXT Z;  4UVB A;  2AZ0 A;  1LR1 A;  3C3S A;  4JYB A;  3KZI Z;  3UO2 A;  4JYY A;  5KHJ A;  2QE7 G;  1K5S A;  3JAR B;  1N8R W;  1GM8 A;  1RFY A;  5ITZ B;  1HP8 A;  3X2Q B;  3BHP A;  5IJ0 A;  1QLE C;  2EUL A;  1AI7 A;  3KKY A;  2E5L O;  1M57 C;  5JWP A;  2OTJ V;  4GYC B;  5KX5 A;  4JI3 O;  5D5Q A;  4CS4 A;  5LBQ A;  3K3W A;  1JA8 A;  4JYA B;  1PL0 A;  3CHX A;  1AR4 A;  5IY5 B;  2ZDI C;  1THZ A;  1IXM A;  1XNR O;  2EIK C;  2QTS A;  4DV4 O;  3OAA G;  3H01 A;  3RW0 A;  1RPR A;  3OW2 U;  2UXD B;  3WB1 A;  3WFV A;  4JI4 O;  1PL4 A;  2BOC C;  4I50 A;  4PA6 A;  4F6R B;  2Q0A A;  1VF5 B;  2JJ1 G;  1UFI A;  2ZXW C;  4PA9 A;  1Q90 D;  1XL4 A;  4MW8 A;  3A0B Z;  3P3N A;  1VIB A;  1H8H G;  1VQ7 V;  1KP2 A;  1QQC A;  3JAW B;  4HNA B;  2A9H A;  3SR2 C;  2UUC O;  1IBK O;  3F7V C;  4D7S A;  4K0K O;  4DR6 B;  3SJB C;  5LOV B;  2EX3 A;  4I9Q A;  5B5E Z;  5KAF Z;  2E74 B;  4DK1 A;  2HP8 A;  3QTC A;  4LF7 O;  1V9P A;  1MSD A;  3SYO A;  3QF7 A;  4KL1 A;  3E89 A;  5F2V O;  1G1X B;  1W0J G;  4DR3 O;  3D8C A;  3CCQ V;  1DTO A;  3JAK A;  1XEQ A;  1RPO A;  5H2F Z;  1H2M A;  2PI5 A;  1QR9 A;  1K4C C;  4DV3 O;  5C93 A;  4C7U A;  3JAS A;  5LHG A;  4FLY A;  1AR5 A;  1AJP A;  5CA3 A;  4YJ2 A;  3CSX A;  4LF4 B;  3JD2 A;  2PGG A;  4IYH A;  4FLT A;  1E1Q G;  1OCZ C;  3CME V;  2VQE O;  3ABL B;  3IJ4 A;  1S0V A;  4UFZ A;  1Y67 A;  2YS8 A;  2Q7E A;  4B3M B;  3A8T A;  2WA4 A;  4MVQ A;  1TVK B;  4QE9 A;  2OWO A;  1QNM A;  1JJO A;  4FM2 A;  3OE7 G;  4QPK A;  4WF9 V;  4X1I A;  3JAT A;  3AG1 C;  1SQX H;  1W2B U;  4ZHQ B;  1Q6I A;  4LCU C;  4NB5 A;  1VQM V;  2RJZ A;  3JCU Z;  4PA3 A;  4X65 O;  2LGQ A;  2ITD C;  1N34 B;  3K0D A;  2OCC B;  2IH3 C;  3VOU A;  1VQO V;  3APQ A;  3M99 B;  4BW5 A;  1F51 A;  3OEH G;  4H33 A;  2Y69 C;  1Q3E A;  5JCO C;  5CA1 A;  3APO A;  3ZHS A;  3DGE A;  1VQK V;  2H94 A;  2Q4P A;  4G2K A;  3IFX A;  2WLI B;  1WA8 A;  3T4D A;  4DRX A;  3J7A U;  3SYA A;  4TQF A;  4MW3 A;  3CCE V;  2R72 A;  3OEE G;  3DSQ A;  4TV8 A;  2Y48 A;  3U11 A;  4JAA A;  3T1C A;  3ML0 A;  4FVM A;  4R8C A;  4X66 O;  1S5J A;  1VMG A;  2CTR A;  3UCS C;  2NR5 A;  1MAB G;  3NXS A;  4DR4 B;  2RMK B;  4O2B B;  4FM0 A;  4KHP O;  3JAR A;  4NTW A;  4B3R B;  3IC7 A;  5IYD O;  4H37 A;  1QLE B;  1YF2 A;  2WAM A;  1D5A A;  2ZR3 A;  1M57 B;  5KHK A;  3K06 A;  4D6T H;  4LNU B;  1NI8 A;  1EZJ A;  1AIL A;  3EVK A;  1OCO C;  4ZOL B;  1YZB A;  5HFL A;  2AHY A;  1R3K C;  2ZNJ A;  5BXZ A;  1WPB A;  4DUZ O;  1HNX O;  3U10 A;  2EIK B;  2QR4 A;  1SQQ H;  1HNW B;  3S3W A;  4NXN O;  4JI6 B;  5LA6 B;  2WWW A;  1J95 A;  4UVC A;  4JI7 B;  2HFE C;  1M1K W;  1W59 A;  3LDD A;  4IIJ A;  2DW4 A;  4X62 O;  2ZXW B;  1OCC C;  4DV7 O;  1VP7 A;  2MK3 A;  1JJ2 U;  1SER A;  2EJ7 A;  3ASO C;  4JPR A;  4F6R A;  1P7B A;  1Q86 W;  2BE3 A;  3S3X A;  2YUA A;  2P90 A;  3M7M X;  4RQE A;  2XTA A;  2WSS G;  3AK1 A;  4BIO A;  3LDE A;  3K79 A;  1I94 O;  3JAW A;  4HNA A;  4B7K A;  5EZY B;  1ZX3 A;  3G6B A;  2F43 G;  2HR3 A;  4P9P A;  1J5E O;  1I08 A;  3FFQ A;  2JJ2 G;  4O2A B;  4TUY B;  2EJR A;  2OIG A;  4PA7 A;  5EC2 C;  1QCE A;  2ZT9 B;  4O4I B;  4YXW G;  3K5O A;  1VF6 A;  1SQP H;  1Y6X A;  3G80 A;  4WFH A;  1DGS A;  5KAI Z;  1F4N A;  4RWU A;  4UCS A;  1S76 D;  5JQG B;  3UQ8 A;  1Y76 B;  3JD0 A;  3K59 A;  3K04 A;  2Y4U A;  5BY1 A;  2GV9 A;  4JAU A;  3E2E A;  2HG5 C;  3THO A;  5K1P A;  4Q20 A;  4IL6 Z;  1PNL A;  1OCZ B;  1DF4 A;  4LR3 A;  1COW G;  1TUB A;  4FM1 A;  1FJG O;  4DR2 B;  1A32 A;  4RUE A;  1L0N H;  5B1N A;  5LHH A;  3T2M A;  2CTW A;  1FXH A;  1AB3 A;  3FAV B;  2MW2 B;  2JGU A;  4NTX A;  1GMG A;  2ADP A;  3JCZ A;  4QPJ A;  2RN9 A;  1TVK A;  3F5T A;  5DN6 G;  1TUE B;  1KD1 W;  2K1E A;  1NTM H;  2XAH A;  4JTC B;  3CC2 V;  3MHH C;  2WLJ A;  4ZHQ A;  4LF9 O;  4DO2 A;  5K1X A;  2QM7 A;  4LF6 O;  2YI9 A;  5H6Q A;  3QO8 A;  4ASU G;  4XDL A;  2HHH B;  5L3E A;  2D2C B;  2X7R B;  4DV0 O;  4J41 A;  3Q4H B;  1NTZ H;  3RWR D;  2AZ2 A;  2RQ6 A;  1R6T A;  3H9V A;  5BR8 O;  4D7T A;  3FB5 C;  3HKD B;  3RN4 A;  3UO3 A;  2Y69 B;  3CEI A;  4X64 O;  5H5N A;  4O4L A;  1NVP D;  4DV6 B;  4YIO A;  2Q7H A;  2UUA O;  1HW7 A;  1FFX B;  2E3C A;  2YID A;  5KLV H;  2EIM C;  3FB7 C;  3HR0 A;  1XMO O;  2Z5U A;  4JI5 O;  5H6R A;  4UB8 Z;  4LFB O;  1K5Q A;  1K92 A;  4OX9 B;  1G8M A;  1HWY A;  2XND G;  4O4J B;  1Z2G A;  2W6I G;  4CH4 A;  5CBH A;  3L70 H;  2ZM6 O;  1XNQ B;  4ZI7 B;  3RT3 C;  4H44 B;  5FLX N;  2OCH A;  1DF5 A;  4J9Y B;  2ZR2 A;  4PD4 F;  2CDY A;  4YJ3 B;  1JVM A;  2B9Z A;  5IT9 N;  2FTK A;  1IBL O;  1OCO B;  4CS3 A;  4WBN B;  3ICX A;  3HKE B;  1OCR C;  4LNU A;  2XAG A;  4ZOL A;  4DR5 O;  2PYJ A;  2YC0 A;  4JYC A;  4JV5 O;  1HNZ O;  2X6C A;  1IBM B;  5J9P C;  1LUV A;  3MDS A;  4BR6 A;  4X89 A;  3OUS A;  4AQY O;  2FML A;  2E76 B;  4QGP A;  4YIP A;  2Y0I A;  3BAB A;  2CH7 B;  2WPD G;  4CC6 A;  1N32 O;  1OCC B;  2DN9 A;  3W7S A;  3ASO B;  2BTO A;  3ZMV A;  4PHZ A;  4BIZ A;  1S3J A;  4HAM A;  1XL6 A;  3ZRW B;  3AK2 A;  3MD0 A;  3BAA A;  2BSK A;  3I55 V;  3OR6 C;  4DV1 O;  4MVU A;  1LNQ A;  3TXQ A;  5KMG B;  5AG2 A;  3TET A;  4PA4 A;  2WLM A;  5EZY A;  4DV5 B;  3ZBH A;  2UUB O;  2N74 A;  2XAJ A;  2AGA A;  1ZLZ A;  2EIJ C;  1SRY A;  1R1B A;  1K4D C;  1KU9 A;  4B3S O;  1ZWI C;  4GKJ O;  3B8M A;  4UCR A;  4O2A A;  4TUY A;  2QWQ B;  2UXC O;  1KBH A;  2F1M A;  4JGS A;  4O4I A;  3NR7 A;  3EHB B;  4JI3 B;  4LF8 B;  3B2E E;  1M5I A;  2Q73 A;  1FFT B;  3BA8 A;  1YIT V;  2ZE6 A;  5C8Y B;  5CA0 B;  4GX2 A;  1WLE A;  5JQG A;  1Y76 A;  3ZX6 A;  4KUM A;  2EZP A;  2QJ1 A;  4X20 B;  5LGN A;  3OD4 A;  3DXR B;  3ZHQ A;  3TXS A;  5LXT B;  2VRZ A;  4Q6G A;  4JI4 B;  4NYK A;  2IJI A;  5DM6 V;  1M90 W;  1Q8I A;  4FK5 C;  3VQW A;  3B4S A;  3ZN0 A;  3E22 B;  4IYI A;  2Y4T A;  3SDL A;  1Q7Y W;  1KP3 A;  4P9O A;  1CP9 A;  4JAV A;  2Z3Y A;  2UUC B;  1N36 B;  1H8E G;  1EN6 A;  2GDS A;  3ETE A;  5EC1 C;  4DW1 A;  4R7C A;  3GVM A;  3CB2 A;  3OFN G;  1NTK H;  3FB6 C;  4ICG A;  5LP6 C;  4RUF A;  4N23 A;  2WLH A;  1TGO A;  1EZV H;  2CTQ A;  1I5Y A;  3EFF K;  4UCU A;  5B3S C;  3MHS C;  2EIL C;  2YIB A;  2WLK A;  4YY3 O;  1BHB A;  1H2K A;  2UU9 B;  3HKD A;  2HJD A;  5JCO A;  3CC4 V;  4DR7 O;  4DV3 B;  4JTD B;  2EIM B;  5KHH A;  2GTS A;  1QR8 A;  1FFX A;  2LFR A;  1H2G A;  1Y74 B;  2YIA A;  1MMM A;  3SJC C;  3ZHU A;  3LSS A;  1WPX A;  4CZZ A;  3VQX A;  1I7F A;  3B40 A;  4W4L A;  2VQE B;  5IWA O;  5FNV A;  3OMI B;  4W4K A;  3ETQ A;  2YDE A;  4EB6 B;  4O4J A;  2EBO A;  1JPX A;  3RGB A;  4FLW A;  3H1I H;  4MVO A;  2D3O W;  4WFF A;  4UCV A;  1R6K A;  4UV9 A;  5LGT A;  1CPY A;  3RYI B;  2F93 B;  2B5U A;  4ZI7 A;  1D2D A;  4YJ3 A;  1JMK C;  4LF5 B;  3STZ C;  2HKO A;  2ZIO A;  1YDX A;  3AG2 C;  1ZL8 B;  4QIW F;  1OCR B;  2YIB D;  4TV9 B;  3UM7 A;  3JSL A;  4OXS A;  1YI2 V;  3ZMZ A;  4R50 A;  3HKE A;  4X9Q A;  2BOB C;  3ZS8 C;  1NVP B;  4AIL C;  4TWK A;  1EN4 A;  4WFB V;  2ODM A;  4JYA O;  4UVA A;  3E86 A;  1AI4 A;  3HPL C;  4MSW C;  5IYC O;  2OT5 A;  5L3G A;  3KCY A;  2NLJ C;  3CRC A;  3ABM C;  1FXK C;  4DXW A;  2UXD O;  3RBZ A;  4E2L A;  4BWA A;  1BL8 A;  2XAQ A;  1L8D A;  4CH6 A;  2A3Q A;  3QO5 A;  1B6Q A;  3KCX A;  1XQ8 A;  2EZO A;  1SET A;  3ZRW A;  4X66 B;  1I0H A;  4NTY A;  3CCL V;  3ABU A;  1IXB A;  1KYO F;  5BZB A;  3SPJ A;  5KMG A;  4AI8 A;  1UPG A;  2EIJ B;  4DR6 O;  2M7W A;  2FKX A;  3JD4 A;  2F23 A;  2N05 A;  4ZKI A;  4KFM A;  1Z5W A;  3GWO A;  3ZMU A;  2PI4 A;  1N33 O;  1HR0 O;  4MVS A;  2KQX A;  5JJE B;  5DED A;  2CUG A;  1FAF A;  5JVD B;  2GBO A;  5D5P A;  2QGN A;  1VQ8 V;  4GKK O;  3R65 A;  4DUZ B;  1HNX B;  4PEL A;  4U7O A;  5GTH Z;  3ZHV A;  5J2U B;  3RYF B;  1P7G A;  2Q7G A;  3G6E V;  2LW1 A;  4I55 B;  2KKW A;  3ABT A;  3J81 N;  2KSD A;  4JI0 O;  1H2L A;  4WFA V;  3W7T A;  3CRA A;  3HKC B;  2A06 H;  5LXT A;  3A2F A;  4MTG A;  4QNH B;  5LMU O;  2IU0 A;  2W0F C;  2JS3 A;  3ETD A;  5A2Q N;  5CBF A;  3BFR A;  4DUY B;  3E22 A;  3I56 V;  4I0X B;  5ITZ A;  2DQ3 A;  3OMN B;  1R3L C;  2P06 A;  3FX7 A;  3VQV A;  3HKB B;  5IJ9 B;  2F4V O;  2DYR C;  4BAY A;  5CB4 B;  5LP6 B;  3LSU A;  2NNU A;  2UXX A;  1GTO A;  2XAF A;  4OGQ B;  5B3S B;  2EIL B;  1VQ4 V;  5FPO A;  5LGU A;  2E75 B;  1BT8 A;  5KA5 A;  4PI0 A;  1B3Q A;  1X4T A;  4TOI A;  1IX9 A;  2GHY A;  2LJ2 A;  2FYU H;  3OM3 B;  3PN1 A;  2P22 C;  2B1G A;  2HJF C;  1L1F A;  1MSW D;  4Z2W A;  4DV2 B;  3SJA C;  1BZK A;  4GT1 A;  1QU7 A;  1PD3 A;  4UCT A;  3JAM N;  1Y74 A;  1BCC H;  1WB8 A;  2ZIM A;  5EBL C;  1GKF A;  1Y4M A;  1U96 A;  2FL4 A;  4K8Z A;  1KUQ A;  4L8J A;  3P32 A;  4JF3 A;  4EB6 A;  1WAZ A;  1PNK A;  1KB9 F;  4I5S A;  4N21 A;  2B1I A;  1BGY H;  4XDJ A;  5LOV A;  4DR4 O;  3RYI A;  3T1Y B;  3CX5 F;  1KC8 W;  3ZJZ A;  2KB1 A;  5GW7 A;  4B3R O;  5EIB C;  3M8A A;  1S5L Z;  4LF6 B;  3PJS K;  1BE3 H;  3SPC A;  3AG2 B;  1SZT A;  4DV0 B;  1GN6 A;  1ZL8 A;  1SQV H;  4B3T B;  2WA3 A;  1PM9 A;  4J80 A;  4H13 B;  2UXB O;  5L3B A;  2QKA A;  5CMU A;  4X64 B;  4J11 A;  3K5L A;  3K9A A;  1PP9 H;  1N0N A;  5BMV B;  3KG2 A;  1FD9 A;  1RP3 B;  4K3A A;  1PKX A;  1Q6U A;  1HNW O;  3H1H H;  4FIP C;  4OPH A;  3ABM B;  1FXK B;  3RVZ A;  3SYC A;  4JI6 O;  2XOK G;  3P30 A;  1P4R A;  3WG7 C;  4JI7 O;  3C3T A;  3CRM A;  2JRI A;  3H1K H;  3SJQ C;  3ABK C;  4DR1 B;  1XBL A;  1IZ3 A;  2ZIN A;  2DJV A;  1EM1 A;  3ZHR A;  1US6 A;  1VAR A;  2UXN A;  3AG1 B;  2ZM6 B;  2RCV A;  1ROP A;  2DWD C;  4P2Z A;  2NN4 A;  4NXM B;  5H9C A;  1AI6 A;  2YXL A;  4NVP A;  1BSM A;  1NR1 A;  3K5M A;  4FZ0 A;  4GX0 A;  1JQ0 A;  5IJ0 B;  1GM7 A;  2Q9L A;  4U3J B;  5GTI Z;  1AR1 B;  3DC6 A;  2ADQ B;  1OHH G;  5IE9 A;  2RDC A;  1QVG U;  1BS3 A;  4HYO A;  4X88 A;  5KX5 B;  2JIZ G;  5LMN B;  3N2G B;  4PJ0 Z;  3D36 C;  2CTP A;  4DR5 B;  1AP6 A;  1ZTE A;  1MA1 A;  2BTQ B;  3L71 H;  1FKA O;  5JVD A;  3K08 A;  1ZAU A;  4CS2 A;  4JV5 B;  1HNZ B;  2Q67 A;  1V54 C;  3ASN C;  4J7Z A;  5J2U A;  3RYF A;  1CEZ A;  2WLI A;  4I4T B;  1JFF B;  3K0G A;  4I55 A;  1K33 A;  2Q8V A;  3CE2 A;  4FPP A;  4YHH O;  1MZF A;  3HKC A;  4DR2 O;  4KP4 A;  4PDL A;  5L3F A;  2BCC H;  2LW7 A;  3T1H O;  4O2B A;  2L35 A;  3CPW U;  1URF A;  2N04 A;  3EXA A;  2PZS A;  2QTO A;  1S72 V;  2DQ0 A;  2DYR B;  3HKB A;  1R6N A;  5CB4 A;  4PDM A;  3W7U A;  1XMQ B;  5LP6 A;  3K03 A;  3CS5 A;  3ZRX A;  3HB3 B;  3E8G A;  2C2A A;  1OV9 A;  3G67 A;  2JK5 C;  3OTO B;  2ZKO A;  5B1B C;  3QNE A;  1GN2 A;  2ZDI A;  2QM4 A;  1VF6 C;  4JI8 B;  4WFE A;  2W6J G;  4G27 B;  2X0L A;  4BIU A;  1F23 A;  3E8H A;  2ETN A;  2Z0A A;  4MVM A;  2YEV B;  5B1O A;  1B06 A;  5LA6 A;  3CJH B;  2CE4 A;  4JI1 O;  1K8A W;  4CH5 A;  2ILM A;  2G38 A;  3CP1 A;  4U7N A;  3H1L H;  5CBG A;  1M4U A;  4EFE A;  4QE7 A;  4LFA O;  2P7T C;  2JDI G;  2ZD9 A;  3BVO A;  1DLB A;  1YTF B;  2AHZ A;  2YXY A;  3L73 H;  3ABL C;  2LP7 A;  1R73 A;  3T4Z A;  5FL7 G;  5GON B;  4AHC A;  1E1R G;  1GO3 F;  4LBE C;  5E1A C;  4MVZ A;  4JI2 O;  1IDS A;  2F95 B;  1K97 A;  1SS3 A;  1S5H C;  2E5L B;  3JAT B;  2QWO B;  4X1Y B;  1ENV A;  4MTX A;  3CD6 V;  4PI2 A;  3O9O A;  3TCU A;  1H2N A;  1M93 A;  2XAS A;  1XOU A;  4GX1 A;  1P84 F;  1DK1 A;  2QSA A;  1YHQ V;  1YEW A;  5J2T B;  2R9A A;  4DW0 A;  1XNR B;  1QHT A;  5LYJ B;  4DV4 B;  1FYJ A;  1BMF G;  3AEI A;  3LDC A;  2ZE8 A;  3CCR V;  4LC1 A;  4DR7 B;  2VWJ A;  3W7W A;  2QWN B;  1SQG A;  5BMV A;  1MOF A;  2LFS A;  4LH6 A;  3WG7 B;  1FXK A;  2M6Y A;  3A0R A;  3LNN A;  3FAV A;  5HFM A;  4TV8 B;  1T5E A;  2A0L A;  1IBK B;  1Z5V A;  4K0K B;  1YVW A;  2F66 C;  1GM9 A;  2H3O A;  2IBZ H;  3OR7 C;  4PV1 B;  3IGA C;  3B8N A;  2QM8 A;  2YXH A;  2VQF O;  4DV5 O;  1G4Y B;  2Q68 A;  2JGD B;  2GUZ B;  4LF7 B;  3N2K B;  3Q4H A;  3WB2 A;  3BRC A;  4U3J A;  4LFC O;  1WN7 A;  1SC5 B;  1D5N A;  3G71 V;  4DR3 B;  3FYE B;  3OGI B;  3N2G A;  4QJF B;  1AVM A;  4LF8 O;  2BTQ A;  4GUN A;  4PDR A;  1WJZ A;  3CCU V;  1V54 B;  3ASN B;  4HBN A;  1QVF U;  2VS0 A;  3OMA B;  4I4T A;  3TGU H;  1K3E A;  1JFF A;  4LH7 A;  4LP8 A;  3E35 A;  3QO7 A;  4CH3 A;  4FLZ A;  4IIJ B;  3IAY A;  4UUJ C;  5A9G A;  2H8P C;  2PYL A;  3D3I A;  4WCE V;  3K5N A;  3ZIA G;  1Q6H A;  3CWB H;  2P4V A;  4TSF G;  1NH2 D;  3IC9 A;  4J7J A;  2WLL B;  5JJJ B;  1VF7 A;  1IUR A;  2A79 B;  1ORQ C;  5E79 Z;  2KG7 B;  3ETG A;  1OZ0 A;  2L6L A;  1N36 O;  1FS0 G;  1ZUQ A;  4LWS B;  4UV8 A;  5EYP B;  1XHX A;  4X65 B;  2Q6A A;  4WBN A;  1QLN A;  2QKS A;  3J80 N;  1G6U A;  2Y0P A;  1N33 B;  1HR0 B;  3OUF A;  4JTA B;  5B1B B;  3JD1 A;  5IYZ B;  5B1A C;  2X6A A;  3C90 A;  2XHB A;  1M56 C;  2JS5 A;  1VQP V;  2HLD G;  3B77 A;  2CAZ C;  4U3F H;  4GKK B;  1YCI A;  4UB6 Z;  1XI1 A;  3SPH A;  2UU9 O;  4F6E A;  4I7Z B;  3CC7 V;  3BPZ A;  2YEV A;  3GB7 C;  2DYS C;  3FKS G;  3CJH A;  3RYH B;  1CXZ B;  1GK9 A;  1SES A;  4JI0 B;  2CH7 A;  4JZ2 A;  1VQL V;  5TIS Z;  1YXB A;  1MG1 A;  4PDV A;  1TUB B;  2JVD A;  2WLN A;  4IT5 A;  2ZQM A;  1AJQ A;  2YSU B;  2FB5 A;  4H0L B;  5LMU B;  3P3P A;  3L9D A;  4MT8 A;  4KHP B;  4R6Z A;  2Q69 A;  1B04 A;  2OTL V;  5GON A;  4XDK A;  2YIC A;  4J7K A;  1WB7 A;  1X59 A;  1SA0 B;  3OT7 A;  1K7D A;  3VBB A;  2ZNI A;  2F4V B;  1EFR G;  3E8B A;  4P30 A;  4X1Y A;  4FFK A;  3DC5 A;  3JD3 A;  2V4D A;  3ZRS A;  4LF5 O;  1GAX A;  2XUM A;  4ABM A;  2QWP B;  3CRQ A;  5L3C A;  4RQF A;  1F7Y A;  5C8Y A;  1NU1 H;  5CA0 A;  5J2T A;  2CK3 G;  2ATK C;  5LYJ A;  4NXN B;  5KHI A;  3I5D A;  1KMI Z;  3F7Y C;  4O4L B;  4X20 A;  3UT5 B;  4EKW A;  2QA4 V;  4BW9 A;  2V1D A;  3DXR A;  2HVJ C;  4LF4 O;  1P49 A;  4X62 B;  4DV7 B;  2CGN A;  1KEC A;  2IJH A;  2P5O A;  2PUS A;  1FPO A;  2PY5 A;  4MTF A;  2O57 A;  3STL C;  1YTF D;  1KKD A;  1GN4 A;  4B3M O;  1GN3 A;  1Y66 A;  3BA9 A;  3ZED A;  3SYQ A;  1JX9 A;  2EIN C;  1I94 B;  5LL6 Y;  3U0Z A;  4FFB B;  1SQB H;  3A0H Z;  3E8F A;  1BHA A;  3ZRV A;  1J5E B;  1QBZ A;  1AJN A;  1GRJ A;  4IHJ B;  3LSQ A;  1Q5O A;  5JH7 B;  1AI5 A;  4FZ1 A;  1JOY A;  2IJK A;  3K58 A;  1M9N A;  1W0K G;  2DWE C;  4G28 B;  5EIB D;  1PV0 A;  4B08 A;  1XDC A;  3SGI A;  3CCJ V;  2JGD A;  1N34 O;  3JAL B;  2GUZ A;  3N2K A;  2PTM A;  1FXV A;  3CRR A;  3D36 A;  1NKD A;  3AG3 C;  3AG4 C;  2UXB B;  4FLV A;  5IDJ A;  2QKC A;  3ZMT A;  4I9W A;  2QWR B;  3FD9 A;  2GTA A;  4NKG B;  2Q0O C;  3L74 H;  3TK1 A;  1S77 D;  1NQT A;  4GLX A;  1FJG B;  5FPR A;  3QVN A;  3RYC B;  3JYC A;  1BQZ A;  2HVK C;  3L75 H;  3WB0 A;  4HZ3 A;  4UCO A;  1Q82 W;  3BEH A;  2R9R B;  3DTU B;  1E79 G;  1RSO B;  4O4H B;  2QEX V;  2BSK B;  2P6J A;  1SF9 A;  3SYP A;  1YJN V;  3ZN1 A;  4DUY O;  2WLL A;  1IVS A;  2A7W A;  3K9S A;  4LF9 B;  1O9H A;  1V55 C;  2KG7 A;  1NT2 B;  2IH1 C;  4RAI A;  3LNM B;  3WU2 Z;  4LWS A;  1ZSP A;  5EYP A;  1RM1 C;  1Q81 W;  2YI8 A;  4TV9 A;  1N0J A;  5BR8 B;  2DMX A;  2CGO A;  1VQN V;  3QG5 A;  5B1A B;  3N27 A;  2IW5 A;  4NR1 A;  1M56 B;  3SPG A;  1EBO A;  5IYZ A;  1NJI W;  1U97 A;  4XBF A;  4X1K B;  2UUA B;  1TAE A;  1WNS A;  4MTO A;  1EN5 A;  1NZ6 A;  2ARH A;  4MVR A;  4FLU A;  1XMO B;  2DYS B;  3F5W C;  4JI5 B;  4DV2 O;  2LGW A;  4X8A A;  3H1J H;  4CBC A;  2GSM B;  5DEC A;  3RYH A;  1VEW A;  4LFB B;  2AW9 A;  1HDJ A;  2PF4 E;  4YHH B;  4GCZ A;  1NH2 B;  4K8X A;  1XUQ A;  3ZHT A;  2QDO A;  1VQ5 V;  3T1H B;  3O65 A;  2IJJ A;  4FJC C;  4A5U B;  3CCM V;  2ITC C;  4RO2 A;  1SA0 A;  1IBL B;  3MAQ A;  2XT9 A;  3X2Q C;  1YSC A;  2HEP A;  3T1Y O;  1TA8 A;  3SPI A;  4ZBM A;  2LQT A;  4DK0 A;  2OYQ A;  1BQ0 A;  3CXC U;  1XIL A;  4B3T O;  5IY5 C;  1L0L H;  1NS1 A;  1F4M A;  1GH6 A;  4AQY B;  3B09 A;  1YJ9 V;  1I5X A;  3K57 A;  2ZE7 A;  2DE0 X;  4JI1 B;  1JR9 A;  3UT5 A;  1N32 B;  3BCC H;  3E83 A;  3CCS V;  4I50 B;  1KQS U;  3VQY A;  4LFA B;  5B66 Z;  2ZCE A;  4JZG A;  3ZMS A;  3CCV V;  4DV1 B;  5FNV B;  2EIN B;  5KUK A;  1K9M W;  1SQF A;  3L72 H;  4I0X A;  4DR1 O;  2X6B A; 
#chains in the Genus database with same CATH homology
 3CJH A;  3CJH B;  2BSK A;  3DXR A;  2BSK B;  3DXR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...