2BSKA

Crystal structure of the tim9 tim10 hexameric complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9
publication title Crystal Structure of the Mitochondrial Chaperone Tim910 Reveals a Six-Bladed Alpha-Propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 27
structure length 73
sequence length 73
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 2bskA00
2BSKB 3CJHB 3DXRB 2BSKA 3CJHA 3DXRA
chains in the Genus database with same CATH superfamily
3L70H 4TV8B 3ZMUA 1R3IC 4DV5B 4X8AA 3E8GA 1EN6A 1KB9F 3QO8A 5J2TA 4EEQA 3ZN0A 1VP7A 4X66B 1MA1A 4B7EA 4JYYA 1FYJA 1JQ0A 4CC5A 4HNAB 4JAVA 4LH6A 3JAKA 4PI0A 4DO2A 5LL6Y 2ZR2A 4CH4A 4J41A 2ZIMA 4KXRA 2HVJC 2ZD9A 4DV1B 1FFXA 2GV9A 4IIJB 1DF5A 5FNVA 1FKAO 3H9VA 1S3JA 2EIMB 3HKBB 2NNUA 3ASOB 2DN9A 4IGGA 3L71H 1WNSA 3LUTB 3KKYA 1S5JA 2YDEA 2Q6AA 2BOBC 2RMKB 2OIGA 2AZ2A 4DYLA 2CDYA 2QM7A 1Q3EA 2QWQB 3OW2U 2HG5C 2VQEB 2QE7G 4NXNO 3ZBHA 4H33A 3DSQA 3IJ4A 1AJPA 2HR3A 2XTAA 5JVDA 2UXCO 2LO1A 3J81N 3FB6C 4KHPO 4I0XB 4DRXB 4X65B 4MVSA 3E83A 3ZJZA 2JGDB 1NH2D 4FLYA 4DR5B 3OT7A 1HDJA 1K3EA 2XAGA 2UUAO 3FKSG 2UXDO 3CRMA 4DR4O 1MZEA 2B5UA 1GH6A 1K5QA 5JQGB 5DECA 2F4VO 1WP7A 3E22B 3CPWU 3A0HZ 2X0LA 4LF8O 2UXNA 4JF3A 2ZQMA 1BE3H 1VMGA 1ZX3A 2A06H 4P2ZA 1JOYA 3W7WA 2YS8A 1IBKO 3RYIA 1KU9A 2Q9LA 4MVOA 2VQFB 4ZOLA 4X1YA 4X88A 3VOUA 1XNRB 2QTOA 2ZDIC 3WG7C 2QWNB 2ZINA 2EZOA 1YITV 2AHZA 1BCCH 2EINC 4UV8A 2A7WA 3WB1A 1V54B 4NTWA 1TUEB 1Q8IA 1VEWA 3H1HH 4IYHA 1GN2A 1OCCC 3T1HO 3ZMZA 2WLLB 5LMNB 3IFXA 1WJZA 4JV5B 1R6KA 4BIOA 2P22C 2QKSA 3BCCH 1HNXB 4JI8O 1M9NA 1QU7A 5IE9A 3ABMB 5EZYB 5B3SC 1XNQB 4O4IA 1G4YB 2DWEC 1L1FA 2LW1A 1JJ2U 4AQYB 4H44B 5EIBD 3R66A 1TAEA 1GM7A 4RQFA 3J7AU 4ICGA 4OGQB 4DR1O 1G8MA 3BA9A 3RVZA 1P4RA 1N0JA 2E74B 2FYUH 1YJ9V 4BW9A 4AHCA 2H3OA 4FVMA 3CB2A 1YZBA 1RSOB 3SYOA 5KMGB 4FLUA 1WB8A 2EILC 2IH3C 5IJ9A 3OTOB 1SQXH 3CC7V 1Q6UA 2PYLA 3ICXA 1I5YA 4MTFA 3T1YB 4YHHB 1HNZB 1AVMA 2IJIA 2Y4UA 4LF7O 1GN3A 5GW7A 1P7GA 1SERA 3RYCB 3AG1C 1OZ0A 4BWAA 3ZHVA 4DR2B 4GLXA 2PI5A 3VQVA 3C90A 1FXKA 4MTXA 3FFQA 1GO3F 3B2EE 1KP2A 4NXMO 4NVPA 5CA1B 1ORQC 2YXYA 4LNUB 4K8XA 4H13B 4QPKA 4PDLA 2B1IA 4N21A 1VQ7V 1XMOB 1BQZA 1S5HC 3G4SV 5LP6B 4G2KA 4GKKB 3A0BZ 3OGCC 2B9ZA 3FD9A 3I55V 4EFEA 1NT2B 2BCCH 4GKJB 1M57C 5GTHZ 4TQDA 4LFAB 2CE4A 3Q4HA 4NXNB 4DV6O 1VF6A 1SQGA 2M7WA 4YIPA 2Q0AA 3APOA 1YTFB 4FFKA 5EC1C 4DR7B 2DQ3A 1FXHA 4D7SA 2ZT9B 2PUSA 1F4NA 4QGPA 4KHPB 4UV9A 4YY3O 1SRYA 3EFFK 3SYPA 4N23A 5L3FA 3LSSA 2Q4PA 3RYFB 4UCOA 1XMQO 5JCOC 2CTQA 3ZEDA 3KCYA 3KZIZ 2UXDB 1KQSU 3SPIA 1US6A 3E8BA 2AW9A 2X7RB 4I9WA 3GVMA 2WLNA 2AHYA 3G6EV 1M56C 2P4VA 1D5AA 2JEXA 3IAYA 1S77D 1QVGU 2R9RB 1YCIA 4FM0A 1XHZA 1Y4MA 1N0NA 4MW8A 2EJRA 3ZX6A 4JTAB 3K58A 3ZCCA 1IX9A 4O4JA 4RO2A 1KKDA 2VRZA 3E8HA 4EFBA 4PA9A 3IGAC 2XUMA 3ABTA 4WFBV 4TSFG 1XL4A 4I50B 1FXVA 4J9YB 5CA0A 1Q6IA 2LFRA 5C93A 1GMGA 3HKDA 4I55A 1D2DA 3E89A 2PY5A 3CMAV 1QLEC 2CH7B 3PJSK 4IHJB 4JYBA 4CZZA 2Q67A 4B3RO 2OIEA 4X66O 3ZHUA 4CH6A 1YDXA 4JI3O 2BE3A 3BHPA 2KQXA 3T1HB 2HJFC 3OGIB 2YI8A 2EIJB 4DV1O 3GB7C 3SPCA 4U7OA 1EZVH 3SYCA 1H2GA 1SA0A 3JD0A 2PTMA 4U3JB 3DXRB 3OMIB 1ROPA 3HB3B 4A5UB 4PV1B 1H2MA 2UXXA 3CCJV 3MHHC 3DC6A 5H6QA 3QNEA 4RWUA 3VQXA 1CPYA 4QNHB 4MS2A 5EBLC 3U10A 1BL8A 1Y74A 3JASB 1TUBB 3JATA 5LA6B 4QJFB 2A79B 3RGBA 4MW3A 1SESA 1K8AW 4H37A 3P30A 3BABA 1PNKA 4O2BB 4X65O 3C3TA 1E79G 1NTMH 3AG4C 1SS3A 3CRCA 2JGDA 2KG7A 4KUMA 2V1DA 4DR5O 4GT1A 1OCOC 3ZHQA 3ETGA 3OAAG 3THOA 4FK5C 5LP6C 4UB6Z 4LF7B 5LXTB 3FB5C 1QNMA 1I08A 2IM9A 2ZKOA 1FAFA 2HP8A 4KL1A 4LCUC 4BW5A 3QO5A 2Q68A 3BVOA 5A2QN 3AG3C 4NXMB 3STLC 4FLWA 3IC7A 1AI4A 1WLEA 1AI5A 1SQVH 1ZL8A 5KA6A 1ENVA 5LHGA 2VQFO 1K97A 5IJ0A 1B06A 3SDLA 5LYJB 1FS0G 4O4HB 1EFRG 2CTWA 1XNRO 3D36C 1FD9A 2BSKB 4BAYA 1JA8A 4JAAA 2ZE8A 4JI4O 1R1BA 2WLMA 4JZ2A 2ZNIA 4UFZA 1O9HA 4ZI7B 1TVKB 5LMNO 3LSQA 1NU1H 1AP6A 2Y48A 4JV5O 3B09A 4PJ0Z 4PDMA 1HNXO 3CE2A 2PYJA 2CTPA 4I5SA 5EZYA 2JJ2G 3N2KA 3M99B 3WG7B 4JI2B 3B40A 4FJCC 4G27B 1ZLZA 2H94A 1XMQB 3WB0A 1Y76B 1PNMA 3E8FA 1Q7YW 2MW2B 1J5EO 3WFVA 1BSMA 5B1NA 1OCCB 2OTJV 3SJCC 2PF4E 1PNLA 3N2GA 1PP9H 3APQA 1AI7A 1K92A 3SJBC 1R6NA 5J2UB 4WFFA 1NTZH 1V55C 2OCHA 2IJHA 1IBMO 2ZE7A 2FTKA 5B3SB 4B7KA 1WPXA 3JAWB 2QTSA 1GN4A 4YHHO 3G6BA 5JH7B 1I5XA 1JFFB 2KB1A 3A8TA 4OX9O 4R8CA 3HKCB 2XAFA 3R65A 1MOFA 1BHAA 4B3RB 4PDVA 1Q81W 3DGEA 2ZE6A 5LGTA 2DJVA 4J7ZA 5BMVB 5F2VO 4DR2O 4RUEA 4TUYB 3K03A 3K04A 1PM9A 2EILB 1M1KW 4JI6O 4JI3B 5KHGA 1LNQA 5D5PA 4P30A 1DF4A 2ARHA 2IU3A 3W7XA 5CA1A 3CMEV 2DW4A 2JRIA 2JIZG 1KMIZ 1AR1B 4J10A 4HZ3A 5JJNB 1NVPD 4PHZA 2R72A 3K59A 1R73A 3K57A 1RFYA 4J9ZB 1XMOO 5KLVH 1I0HA 4JAUA 1VQMV 1RM1C 3LNNA 4GKKO 2YSUB 5L3CA 5IY5B 3AG1B 4QE9A 3TK1A 3OFNG 1DK1A 2MK3A 4GKJO 1HP8A 3CXHF 4LFAO 1AILA 1ZWIC 3FAVB 3RWRD 3SYAA 2F93B 2N74A 3CC2V 1HR0B 2Y0IA 2V4DA 4DR7O 1XL6A 2FMLA 4X1KB 3W7TA 3TXQA 2WLHA 1D5NA 4BIZA 2RCVA 4PA6A 3CRAA 1L8DA 5CN0A 4HAMA 2DYRC 1QVFU 3SR2C 4F6RB 2ADPA 3CX5F 3OEEG 5J9PC 1KKCA 2ZE5A 5CB4B 1I7FA 3TGUH 2NLJC 3T4DA 4CH3A 3QF7A 4LFCB 3CCSV 4R50A 4JYCA 2F95B 3S3WA 2OWOA 1M57B 5H6RA 3B8MA 3GWKC 5IYZB 2W6JG 1P49A 4JPRA 4WBNA 4DK1A 5ITZA 3JCUZ 3F5TA 3VBBA 3BA8A 3SJAC 1E1QG 2HVKC 3H1KH 2ZNJA 4MTOA 1VQPV 1QLNA 1F7YA 2CUGA 2EULA 1XUQA 2YEVB 4U3FH 5IYDO 2C2AA 4LH7A 4FM2A 1GRJA 4GYCB 1GKFA 1M56B 4JI4B 3RBZA 5H9CA 3TJTA 3AG7A 2HJDA 2LFSA 3CEIA 1K4CC 1H2NA 4B3TB 3CRQA 3N27A 3G71V 1K73W 2WLKA 1KC8W 1AP5A 4JYAB 4K0KB 5EYPB 2IJJA 5FPRA 2HEPA 1W2BU 2WLIB 1IVSA 3T4ZA 2WAMA 4U3JA 3M8AA 1QLEB 2P7TC 1Y67A 2BTQA 4ZHQA 3ZHRA 4X1IA 4B08A 1U97A 1ZSPA 4R6ZA 2LW7A 3L73H 3MAQA 1J5EB 2P06A 5KX5B 2W6IG 5LA6A 5KAFZ 3CJHA 3K0DA 3B4SA 2BOCC 3P3PA 2G38A 1BGYH 1NQTA 2H8PC 5EBMC 4Q20A 3ZMTA 3E86A 5LOVB 4TWKA 2X6BA 1Y6XA 1IBMB 4IYIA 4MVUA 1VQNV 4FMTA 1G6UA 3A2FA 1J95A 1OJHA 4CBCA 1MMMA 3JALB 4U7NA 3K5NA 3D8CA 2E5LB 4OX9B 5IY5C 3CCQV 5IYBO 5LXTA 1IZ3A 3C3SA 4GX1A 5L3GA 4GX0A 1VQOV 1VF5B 2QWRB 4JI6B 4I7ZB 4DV3B 5LBQA 5KHHA 1PPJH 1XREA 3AG4B 2CAZC 5GTIZ 2Q69A 3H1IH 5J2TB 4P9OA 1XHXA 5EIBC 2HKOA 1WA8A 1SQFA 2HFEC 1OCOB 3JAKB 3JARB 4DV0B 1W59A 5KUMA 3QTCA 3RYHB 1B3QA 2ETNA 4Z2WA 1N8RW 4I4TA 3VQYA 2UUBB 4TV9A 3AG2C 3BAAA 1RP3B 1SC5B 2E3CA 3AG3B 4ZI7A 3RW0A 1DTOA 4WF9V 4NKGB 2GUZB 4NR1A 3EXAA 1FJGB 1BZKA 2AGAA 1E1RG 1O9GA 4KP4A 3EHBB 4J80A 1TA8A 2O57A 4TOIA 1K5SA 3LSUA 3RN4A 4UVBA 4JI2O 3VQWA 1MSDA 5GONA 5H2FZ 5CBHA 2JVDA 3OMNB 4UCUA 2Q7GA 1NJIW 2P90A 4XDJA 2ZCEA 1NZ6A 3K08A 3QVNA 2EJ7A 1G1XB 3GWOA 5BY1A 5KUKA 1BHBA 2V7QG 2YIDA 2OYQA 4F6EA 2LP7A 4XDKA 4PD4F 4OPHA 3ZN1A 2CK3G 1S72V 1I94O 3G80A 2WA3A 2LGQA 1RPRA 3E2EA 1MABG 2ZXWB 1HNWB 2QDOA 3UM7A 4ASUG 4DV4O 3ABLB 3I5DA 4FLZA 3DTUB 3AK2A 1N32B 4TV8A 1P7BA 3ZRXA 3HKCA 3ETQA 1W0KG 3RT3C 3F5WC 3RYIB 1L0LH 2ZR3A 3JD3A 4X9QA 5KHKA 1H38A 1UJWB 4YIOA 5BMVA 4W4KA 4HNAA 3U11A 5IYCO 1JJOA 1CXZB 1V55B 4EB6B 5E1AC 1WN7A 5E79Z 4RUFA 4J7KA 3AEIA 4IIJA 4YJ2B 4PA4A 2E76B 3TETA 1UPGA 2GBOA 3CYOA 4XBFA 5BZBA 2QWPB 4D6TH 1H8HG 2RDCA 3HKBA 4DV2O 1VARA 2ODMA 5IWAO 2F66C 1F4MA 1OCZB 1Q5OA 4KFMA 3F7VC 1IXMA 2DMXA 1S76D 4UCTA 3CXCU 1GM8A 5B1OA 3HR0A 1YTFD 3O65A 5K1PA 2WWWA 3BFRA 3FAVA 1HR0O 1SZTA 3OMAB 2Y69C 1QR9A 3FYIB 1AR5A 3CCMV 2B1GA 3FYEB 4I0XA 4DRXA 1BQ0A 1LUVA 2Q73A 1URFA 1JCHA 1RM1B 2E75B 1KP3A 4F6RA 4GUNA 5EBWC 2OT5A 4W4LA 1B04A 3JD2A 4LFCO 4IL6Z 1PL4A 5JQGA 4JASA 3E22A 4X62O 1OCRC 3ML0A 3P3NA 5IYZA 3W7UA 3CSXA 4UCSA 4DR6O 4UXNA 2ZM6B 3ABUA 4IT5A 2DYSC 2DYRB 2EIKC 3D3IA 1KBHA 4JTDB 5EK0A 1FXKB 3T1CA 3K79A 1R3KC 5BXZA 2K1EA 5B1AB 4AI8A 4JI7O 4K35A 3SPHA 5IT9N 1R3LC 2P5OA 3UKMA 3T2MA 2FL4A 1BMFG 4B3TO 1SQBH 1ZTEA 1XILA 1VQ8V 4J42A 3CCVV 2WLLA 3E35A 5EC2C 3ZS8C 4JYAO 4MSWC 2AZ0A 3RVYA 1U96A 4WFAV 4K0KO 4R7CA 3CP1A 2ZIOA 3MHSC 4JI5B 1CEZA 2VWJA 3KG2A 2K9PA 1NI8A 3CCRV 1XEQA 2JK5C 2ZXWC 3SPJA 5D5QA 3JAMN 3ZIAG 5L3DA 2QM4A 3ABLC 1DLBA 1BT8A 1YF2A 2QM8A 1VQ9V 4Z1VA 5KX5A 1RSOA 2Q7EA 1K34A 3OEHG 5KMGA 4DR3O 1WB7A 1EZJA 4YXWG 4ABMA 2UXBB 1NH2B 2PI4A 3ABKC 4B3SO 1YEWA 1I94B 3B77A 1Q82W 5LOVA 4FM1A 3K5LA 4DW0A 5H5NA 4DUYB 4RAIA 3PN1A 1Q86W 3H1LH 2YI9A 5KAIZ 4LF5B 4DV4B 5B66Z 1AROP 4Q6GA 2JGUA 3BPZA 1NR7A 4FZ0A 3O9OA 2E5LO 1AJQA 2IU0A 4O4JB 4FFBB 2L35A 4L8JA 2LQTA 1OCZC 3ZHSA 1WAZA 2YICA 3RYCA 3X2QC 1H2SB 2F43G 4LP8A 5CA0B 1T5EA 1IXBA 4DV3O 3M7MX 3HKDB 4I55B 3UT5B 1N34B 4LNUA 1Q6HA 3JSLA 3UO3A 4QPJA 1L0NH 3STZC 1SETA 1SQPH 2DWDC 1THZA 4YJ3B 3SJQC 3DC5A 3K5MA 2QKAA 3JARA 4DV0O 4DV2B 5LP6A 4FIPC 1M4UA 4UUJC 3HPLC 5IWAB 5B1BC 3RYHA 2UUBO 3LDEA 1JMKC 2IBZH 4DV7O 1NTKH 1SA0B 4X20B 4UCRA 1QCEA 4E4EA 1FJGO 2GUZA 2VS0A 2AXTZ 4CS2A 1Y74B 2N04A 2XOKG 3JATB 3I56V 5BR8O 4LF4O 3D36A 4GX2A 5C8YB 4X64B 2OCCB 3RYFA 2WA4A 3U0ZA 3K5OA 1FXKC 1GK9A 3AG2B 1YJWV 1AJNA 5B1AC 3P32A 3L72H 2KG7B 4LF6B 4LF9O 5LMUB 4JZGA 4OPAA 1Z5WA 4X62B 5LGNA 4UCVA 2XASA 3ZRWB 5LHHA 4DR6B 4FLTA 1HNWO 4LR3A 4TT3G 4O4LB 1NKDA 2Z5UA 1S0VA 3ASNC 4J11A 1N33B 5A9GA 4I50A 1N32O 1VF6C 3OM3B 2YC0A 3FX7A 4Z1MG 3K0GA 3ZMVA 1ZL8B 2CH7A 3QO7A 2ATKC 4IHJA 3JCZA 3CCEV 4X89A 5IJ0B 1SKVA 4JI7B 3CWBH 2GDSA 1FPOA 5TISZ 3LDCA 2YIBA 3HKEB 2KKWA 1KECA 2F23A 4HYOA 4TQFA 2WPDG 3L75H 4EB6A 1Y66A 3ETDA 2P6JA 1A32A 4JI1B 1IBLB 4YJ2A 4PA3A 2Q0OC 3DXRA 2Z3YA 5FLXN 1X4TA 4J7JA 4UVCA 1K33A 2Q5ZA 2RQ6A 3K9SA 4GZRB 2JDIG 1M90W 4O2AB 5HFMA 1YVWA 3JASA 1TUBA 3N2KB 4NTYA 2Y4TA 2PZSA 4DR3B 1UFIA 4L87A 4UVAA 4B3SB 4MVQA 4O2BA 4LWSB 4UB8Z 2IJKA 1M5IA 1CP9A 3N2GB 3WB2A 3BRCA 1N36O 3MDSA 3RFRA 1XI1A 2QWOB 1QR8A 2WLJA 3JSNA 1RPOA 2HHHO 3LNMB 2JS3A 1YXBA 2Y69B 2UUCB 2EIMC 2XAQA 2W0XA 1QQCA 3ASOC 1V9PA 2EX3A 4CS4A 1MSWD 2ZM6O 4DUZO 5CA3A 1K9MW 1F51A 1K4DC 4PI2A 1VQ6V 3MD0A 4O4HA 5LYJA 5AG2A 1WPBA 3CRRA 4WFGA 3L74H 2OCCC 2BSKA 4D7TA 4NYKA 3S3XA 1FFXB 1OV9A 5KHIA 3G67A 5FNVB 4DV7B 3KCXA 1OCRB 1AI6A 2XAHA 1DGSA 5IDJA 1TVKA 2XT9A 1YJNV 2X6AA 1GAXA 4BIUA 1R6TA 5FPOA 4JI5O 2DYSB 2Z0AA 4WFHA 4FLVA 2EIKB 4B3MO 3SYQA 1YSCA 5BR8B 2P4KA 4LF4B 4C7UA 2ZDIA 2KSDA 2YXHA 3AK1A 1Q90D 5JVDB 4LBEC 4DK0A 1EN5A 1Y76A 1GTOA 2UXCB 2FKXA 4K3AA 3FB7C 2QSAA 2A9HA 3LDDA 1VIBA 4CS3A 1PL0A 4BR6A 3CC4V 4LF9B 1X59A 2D3OW 1Q43A 1BS3A 3K9AA 2UXBO 2UUAB 5HFLA 4DR4B 2DOSA 5J2UA 4LFBO 5B5EZ 5K1XA 1XQ8A 2OTLV 2W0FC 2ITDC 2F4VB 4DUYO 4F4LA 1V54C 3JAWA 1XOUA 3CS5A 2UU9O 2GTSA 4LF5O 4LF8B 4H0LB 4WBNB 5ITZB 5JH7A 2ILMA 1KD1W 1JFFA 4ZBMA 1N4CA 3JYCA 3OTFA 1P84F 2JEUA 1AR4A 2XNDG 4FFBA 4G28B 3OR7C 4ZOLB 4JI0O 1IBKB 2CTRA 4X1YB 3UCSC 3ABMC 4TUYA 4FLXA 1MG1A 2QGNA 2YXLA 2IW5A 3OUSA 3ZMSA 2A3QA 3ABKB 3ETEA 4GCZA 1N34O 4DV5O 3UT5A 4QE7A 4FPPA 1VF7A 2XAJA 2YIAA 1H2KA 1W0JG 2R70A 5CBGA 4WFEA 2IH1C 2Y0PA 4MVRA 4YJ3A 2ADQB 3TCUA 4JTCB 3L9DA 1H8EG 1GM9A 3OE7G 2R9IA 4XDLA 1AB3A 1Z2GA 2EBOA 3X2QB 1JR9A 1TGOA 4EKWA 4WCEV 5LHIA 1JX9A 4JI8B 4O4IB 1IDSA 4MVMA 4AILC 4X20A 5L3EA 3H1JH 1VQ4V 2P67A 1GN6A 2RN9A 2BTQB 1NBMG 4ZHQB 4X1IB 1PV0A 4NB5A 4DR1B 4X1KA 2VWKA 1IURA 3K3WA 2YUAA 1FFTB 2X6CA 2VQEO 2Q7HA 4DXWA 3CJHB 4CC6A 4X64O 3SPGA 3OR6C 1YI2V 5C8YA 1SZXA 1HW7A 2LJ2A 4CH5A 5JWPA 2FB5A 2Q8VA 2CGNA 3SGIA 5IJ9B 5B1BB 1QBZA 3IC9A 5CB4A 1N36B 1XBLA 2GTAA 5CBFA 1K7DA 4DW1A 1VQ5V 3ZHTA 2F1MA 2D2CB 3CCUV 3NR7A 4LF6O 2N05A 5LMUO 1VQKV 2HHHB 2QKCA 1M93A 1ZUQA 1VQLV 4QIWF 4ZKIA 3CD6V 3BEHA 2JS5A 1NS1A 4P9PA 1KYOF 1COWG 3NXSA 3ZRWA 4DUZB 1MNGA 2QR4A 1XDCA 4JGSA 4E2LA 5DN6G 2BTOA 1PD3A 1N33O 3CCLV 4O4LA 5JJJB 1S5LZ 3J80N 2QA4V 5JCOA 4ZIBA 3TXSA 4RQEA 2YEVA 3B8NA 2ITCC 2RJZA 1QHTA 2NR5A 3EVKA 5FL7G 2YIBD 4GX5A 1WA8B 3WU2Z 1R3JC 4NTXA 1NVPB 2LGWA 2R9AA 3OUFA 3HKEA 2CGOA 5KHJA 4I4TB 2L6LA 2M6YA 2QEXV 4TV9B 5JJEB 5EYPA 2HLDG 4JI1O 1IBLO 4B3MB 2WLIA 2GHYA 3ASNB 1KUQA 1HWYA 2WSSG 2GSMB 3Q4HB 2XHBA 3UO2A 3FB8C 3A0RA 1OHHG 5CMUA 3AK3A 1SQQH 3JD4A 4DV6B 1H2LA 2PGGA 4LC1A 1EM1A 2DE0X 4PA7A 3H01A 3ZRSA 3JD1A 4FZ1A 4O2AA 4OXSA 2A0LA 1XNQO 4YY3B 3W7SA 2EZPA 1YIJV 2NN4A 4AQYO 5KA5A 5DM6V 2DQ0A 1NR1A 1YHQV 1EN4A 3UQ8A 2JJ1G 5GONB 4I9QA 1LUWA 2EINB 3CHXA 1B6QA 5DEDA 1LR1A 4HBNA 3OD4A 4LFBB 4LWSA 1ZAUA 4K8ZA 3BY6A 3D3QA 4PDRA 2UU9B 1F23A 1SF9A 2RNBA 4MVZA 1MZFA 4MT8A 3OTOO 1JPXA 3F7YC 3JALA 1WP8A 3ZRVA 5LGUA 2EIJC 1EBOA 3QG5A 5L3BA 4JI0B 4MTGA 1PKXA 3T1YO 3K06A 1JVMA 4PELA 2QJ1A 2UUCO 1Z5VA 1HNZO
chains in the Genus database with same CATH topology
2BSKB 3CJHB 3DXRB 2BSKA 3CJHA 3DXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK B;  3CJH B;  3DXR B;  2BSK A;  3CJH A;  3DXR A; 
#chains in the Genus database with same CATH topology
 3L70 H;  4TV8 B;  3ZMU A;  1R3I C;  4DV5 B;  4X8A A;  3E8G A;  1EN6 A;  1KB9 F;  3QO8 A;  5J2T A;  4EEQ A;  3ZN0 A;  1VP7 A;  4X66 B;  1MA1 A;  4B7E A;  4JYY A;  1FYJ A;  1JQ0 A;  4CC5 A;  4HNA B;  4JAV A;  4LH6 A;  3JAK A;  4PI0 A;  4DO2 A;  5LL6 Y;  2ZR2 A;  4CH4 A;  4J41 A;  2ZIM A;  4KXR A;  2HVJ C;  2ZD9 A;  4DV1 B;  1FFX A;  2GV9 A;  4IIJ B;  1DF5 A;  5FNV A;  1FKA O;  3H9V A;  1S3J A;  2EIM B;  3HKB B;  2NNU A;  3ASO B;  2DN9 A;  4IGG A;  3L71 H;  1WNS A;  3LUT B;  3KKY A;  1S5J A;  2YDE A;  2Q6A A;  2BOB C;  2RMK B;  2OIG A;  2AZ2 A;  4DYL A;  2CDY A;  2QM7 A;  1Q3E A;  2QWQ B;  3OW2 U;  2HG5 C;  2VQE B;  2QE7 G;  4NXN O;  3ZBH A;  4H33 A;  3DSQ A;  3IJ4 A;  1AJP A;  2HR3 A;  2XTA A;  5JVD A;  2UXC O;  2LO1 A;  3J81 N;  3FB6 C;  4KHP O;  4I0X B;  4DRX B;  4X65 B;  4MVS A;  3E83 A;  3ZJZ A;  2JGD B;  1NH2 D;  4FLY A;  4DR5 B;  3OT7 A;  1HDJ A;  1K3E A;  2XAG A;  2UUA O;  3FKS G;  2UXD O;  3CRM A;  4DR4 O;  1MZE A;  2B5U A;  1GH6 A;  1K5Q A;  5JQG B;  5DEC A;  2F4V O;  1WP7 A;  3E22 B;  3CPW U;  3A0H Z;  2X0L A;  4LF8 O;  2UXN A;  4JF3 A;  2ZQM A;  1BE3 H;  1VMG A;  1ZX3 A;  2A06 H;  4P2Z A;  1JOY A;  3W7W A;  2YS8 A;  1IBK O;  3RYI A;  1KU9 A;  2Q9L A;  4MVO A;  2VQF B;  4ZOL A;  4X1Y A;  4X88 A;  3VOU A;  1XNR B;  2QTO A;  2ZDI C;  3WG7 C;  2QWN B;  2ZIN A;  2EZO A;  1YIT V;  2AHZ A;  1BCC H;  2EIN C;  4UV8 A;  2A7W A;  3WB1 A;  1V54 B;  4NTW A;  1TUE B;  1Q8I A;  1VEW A;  3H1H H;  4IYH A;  1GN2 A;  1OCC C;  3T1H O;  3ZMZ A;  2WLL B;  5LMN B;  3IFX A;  1WJZ A;  4JV5 B;  1R6K A;  4BIO A;  2P22 C;  2QKS A;  3BCC H;  1HNX B;  4JI8 O;  1M9N A;  1QU7 A;  5IE9 A;  3ABM B;  5EZY B;  5B3S C;  1XNQ B;  4O4I A;  1G4Y B;  2DWE C;  1L1F A;  2LW1 A;  1JJ2 U;  4AQY B;  4H44 B;  5EIB D;  3R66 A;  1TAE A;  1GM7 A;  4RQF A;  3J7A U;  4ICG A;  4OGQ B;  4DR1 O;  1G8M A;  3BA9 A;  3RVZ A;  1P4R A;  1N0J A;  2E74 B;  2FYU H;  1YJ9 V;  4BW9 A;  4AHC A;  2H3O A;  4FVM A;  3CB2 A;  1YZB A;  1RSO B;  3SYO A;  5KMG B;  4FLU A;  1WB8 A;  2EIL C;  2IH3 C;  5IJ9 A;  3OTO B;  1SQX H;  3CC7 V;  1Q6U A;  2PYL A;  3ICX A;  1I5Y A;  4MTF A;  3T1Y B;  4YHH B;  1HNZ B;  1AVM A;  2IJI A;  2Y4U A;  4LF7 O;  1GN3 A;  5GW7 A;  1P7G A;  1SER A;  3RYC B;  3AG1 C;  1OZ0 A;  4BWA A;  3ZHV A;  4DR2 B;  4GLX A;  2PI5 A;  3VQV A;  3C90 A;  1FXK A;  4MTX A;  3FFQ A;  1GO3 F;  3B2E E;  1KP2 A;  4NXM O;  4NVP A;  5CA1 B;  1ORQ C;  2YXY A;  4LNU B;  4K8X A;  4H13 B;  4QPK A;  4PDL A;  2B1I A;  4N21 A;  1VQ7 V;  1XMO B;  1BQZ A;  1S5H C;  3G4S V;  5LP6 B;  4G2K A;  4GKK B;  3A0B Z;  3OGC C;  2B9Z A;  3FD9 A;  3I55 V;  4EFE A;  1NT2 B;  2BCC H;  4GKJ B;  1M57 C;  5GTH Z;  4TQD A;  4LFA B;  2CE4 A;  3Q4H A;  4NXN B;  4DV6 O;  1VF6 A;  1SQG A;  2M7W A;  4YIP A;  2Q0A A;  3APO A;  1YTF B;  4FFK A;  5EC1 C;  4DR7 B;  2DQ3 A;  1FXH A;  4D7S A;  2ZT9 B;  2PUS A;  1F4N A;  4QGP A;  4KHP B;  4UV9 A;  4YY3 O;  1SRY A;  3EFF K;  3SYP A;  4N23 A;  5L3F A;  3LSS A;  2Q4P A;  3RYF B;  4UCO A;  1XMQ O;  5JCO C;  2CTQ A;  3ZED A;  3KCY A;  3KZI Z;  2UXD B;  1KQS U;  3SPI A;  1US6 A;  3E8B A;  2AW9 A;  2X7R B;  4I9W A;  3GVM A;  2WLN A;  2AHY A;  3G6E V;  1M56 C;  2P4V A;  1D5A A;  2JEX A;  3IAY A;  1S77 D;  1QVG U;  2R9R B;  1YCI A;  4FM0 A;  1XHZ A;  1Y4M A;  1N0N A;  4MW8 A;  2EJR A;  3ZX6 A;  4JTA B;  3K58 A;  3ZCC A;  1IX9 A;  4O4J A;  4RO2 A;  1KKD A;  2VRZ A;  3E8H A;  4EFB A;  4PA9 A;  3IGA C;  2XUM A;  3ABT A;  4WFB V;  4TSF G;  1XL4 A;  4I50 B;  1FXV A;  4J9Y B;  5CA0 A;  1Q6I A;  2LFR A;  5C93 A;  1GMG A;  3HKD A;  4I55 A;  1D2D A;  3E89 A;  2PY5 A;  3CMA V;  1QLE C;  2CH7 B;  3PJS K;  4IHJ B;  4JYB A;  4CZZ A;  2Q67 A;  4B3R O;  2OIE A;  4X66 O;  3ZHU A;  4CH6 A;  1YDX A;  4JI3 O;  2BE3 A;  3BHP A;  2KQX A;  3T1H B;  2HJF C;  3OGI B;  2YI8 A;  2EIJ B;  4DV1 O;  3GB7 C;  3SPC A;  4U7O A;  1EZV H;  3SYC A;  1H2G A;  1SA0 A;  3JD0 A;  2PTM A;  4U3J B;  3DXR B;  3OMI B;  1ROP A;  3HB3 B;  4A5U B;  4PV1 B;  1H2M A;  2UXX A;  3CCJ V;  3MHH C;  3DC6 A;  5H6Q A;  3QNE A;  4RWU A;  3VQX A;  1CPY A;  4QNH B;  4MS2 A;  5EBL C;  3U10 A;  1BL8 A;  1Y74 A;  3JAS B;  1TUB B;  3JAT A;  5LA6 B;  4QJF B;  2A79 B;  3RGB A;  4MW3 A;  1SES A;  1K8A W;  4H37 A;  3P30 A;  3BAB A;  1PNK A;  4O2B B;  4X65 O;  3C3T A;  1E79 G;  1NTM H;  3AG4 C;  1SS3 A;  3CRC A;  2JGD A;  2KG7 A;  4KUM A;  2V1D A;  4DR5 O;  4GT1 A;  1OCO C;  3ZHQ A;  3ETG A;  3OAA G;  3THO A;  4FK5 C;  5LP6 C;  4UB6 Z;  4LF7 B;  5LXT B;  3FB5 C;  1QNM A;  1I08 A;  2IM9 A;  2ZKO A;  1FAF A;  2HP8 A;  4KL1 A;  4LCU C;  4BW5 A;  3QO5 A;  2Q68 A;  3BVO A;  5A2Q N;  3AG3 C;  4NXM B;  3STL C;  4FLW A;  3IC7 A;  1AI4 A;  1WLE A;  1AI5 A;  1SQV H;  1ZL8 A;  5KA6 A;  1ENV A;  5LHG A;  2VQF O;  1K97 A;  5IJ0 A;  1B06 A;  3SDL A;  5LYJ B;  1FS0 G;  4O4H B;  1EFR G;  2CTW A;  1XNR O;  3D36 C;  1FD9 A;  2BSK B;  4BAY A;  1JA8 A;  4JAA A;  2ZE8 A;  4JI4 O;  1R1B A;  2WLM A;  4JZ2 A;  2ZNI A;  4UFZ A;  1O9H A;  4ZI7 B;  1TVK B;  5LMN O;  3LSQ A;  1NU1 H;  1AP6 A;  2Y48 A;  4JV5 O;  3B09 A;  4PJ0 Z;  4PDM A;  1HNX O;  3CE2 A;  2PYJ A;  2CTP A;  4I5S A;  5EZY A;  2JJ2 G;  3N2K A;  3M99 B;  3WG7 B;  4JI2 B;  3B40 A;  4FJC C;  4G27 B;  1ZLZ A;  2H94 A;  1XMQ B;  3WB0 A;  1Y76 B;  1PNM A;  3E8F A;  1Q7Y W;  2MW2 B;  1J5E O;  3WFV A;  1BSM A;  5B1N A;  1OCC B;  2OTJ V;  3SJC C;  2PF4 E;  1PNL A;  3N2G A;  1PP9 H;  3APQ A;  1AI7 A;  1K92 A;  3SJB C;  1R6N A;  5J2U B;  4WFF A;  1NTZ H;  1V55 C;  2OCH A;  2IJH A;  1IBM O;  2ZE7 A;  2FTK A;  5B3S B;  4B7K A;  1WPX A;  3JAW B;  2QTS A;  1GN4 A;  4YHH O;  3G6B A;  5JH7 B;  1I5X A;  1JFF B;  2KB1 A;  3A8T A;  4OX9 O;  4R8C A;  3HKC B;  2XAF A;  3R65 A;  1MOF A;  1BHA A;  4B3R B;  4PDV A;  1Q81 W;  3DGE A;  2ZE6 A;  5LGT A;  2DJV A;  4J7Z A;  5BMV B;  5F2V O;  4DR2 O;  4RUE A;  4TUY B;  3K03 A;  3K04 A;  1PM9 A;  2EIL B;  1M1K W;  4JI6 O;  4JI3 B;  5KHG A;  1LNQ A;  5D5P A;  4P30 A;  1DF4 A;  2ARH A;  2IU3 A;  3W7X A;  5CA1 A;  3CME V;  2DW4 A;  2JRI A;  2JIZ G;  1KMI Z;  1AR1 B;  4J10 A;  4HZ3 A;  5JJN B;  1NVP D;  4PHZ A;  2R72 A;  3K59 A;  1R73 A;  3K57 A;  1RFY A;  4J9Z B;  1XMO O;  5KLV H;  1I0H A;  4JAU A;  1VQM V;  1RM1 C;  3LNN A;  4GKK O;  2YSU B;  5L3C A;  5IY5 B;  3AG1 B;  4QE9 A;  3TK1 A;  3OFN G;  1DK1 A;  2MK3 A;  4GKJ O;  1HP8 A;  3CXH F;  4LFA O;  1AIL A;  1ZWI C;  3FAV B;  3RWR D;  3SYA A;  2F93 B;  2N74 A;  3CC2 V;  1HR0 B;  2Y0I A;  2V4D A;  4DR7 O;  1XL6 A;  2FML A;  4X1K B;  3W7T A;  3TXQ A;  2WLH A;  1D5N A;  4BIZ A;  2RCV A;  4PA6 A;  3CRA A;  1L8D A;  5CN0 A;  4HAM A;  2DYR C;  1QVF U;  3SR2 C;  4F6R B;  2ADP A;  3CX5 F;  3OEE G;  5J9P C;  1KKC A;  2ZE5 A;  5CB4 B;  1I7F A;  3TGU H;  2NLJ C;  3T4D A;  4CH3 A;  3QF7 A;  4LFC B;  3CCS V;  4R50 A;  4JYC A;  2F95 B;  3S3W A;  2OWO A;  1M57 B;  5H6R A;  3B8M A;  3GWK C;  5IYZ B;  2W6J G;  1P49 A;  4JPR A;  4WBN A;  4DK1 A;  5ITZ A;  3JCU Z;  3F5T A;  3VBB A;  3BA8 A;  3SJA C;  1E1Q G;  2HVK C;  3H1K H;  2ZNJ A;  4MTO A;  1VQP V;  1QLN A;  1F7Y A;  2CUG A;  2EUL A;  1XUQ A;  2YEV B;  4U3F H;  5IYD O;  2C2A A;  4LH7 A;  4FM2 A;  1GRJ A;  4GYC B;  1GKF A;  1M56 B;  4JI4 B;  3RBZ A;  5H9C A;  3TJT A;  3AG7 A;  2HJD A;  2LFS A;  3CEI A;  1K4C C;  1H2N A;  4B3T B;  3CRQ A;  3N27 A;  3G71 V;  1K73 W;  2WLK A;  1KC8 W;  1AP5 A;  4JYA B;  4K0K B;  5EYP B;  2IJJ A;  5FPR A;  2HEP A;  1W2B U;  2WLI B;  1IVS A;  3T4Z A;  2WAM A;  4U3J A;  3M8A A;  1QLE B;  2P7T C;  1Y67 A;  2BTQ A;  4ZHQ A;  3ZHR A;  4X1I A;  4B08 A;  1U97 A;  1ZSP A;  4R6Z A;  2LW7 A;  3L73 H;  3MAQ A;  1J5E B;  2P06 A;  5KX5 B;  2W6I G;  5LA6 A;  5KAF Z;  3CJH A;  3K0D A;  3B4S A;  2BOC C;  3P3P A;  2G38 A;  1BGY H;  1NQT A;  2H8P C;  5EBM C;  4Q20 A;  3ZMT A;  3E86 A;  5LOV B;  4TWK A;  2X6B A;  1Y6X A;  1IBM B;  4IYI A;  4MVU A;  1VQN V;  4FMT A;  1G6U A;  3A2F A;  1J95 A;  1OJH A;  4CBC A;  1MMM A;  3JAL B;  4U7N A;  3K5N A;  3D8C A;  2E5L B;  4OX9 B;  5IY5 C;  3CCQ V;  5IYB O;  5LXT A;  1IZ3 A;  3C3S A;  4GX1 A;  5L3G A;  4GX0 A;  1VQO V;  1VF5 B;  2QWR B;  4JI6 B;  4I7Z B;  4DV3 B;  5LBQ A;  5KHH A;  1PPJ H;  1XRE A;  3AG4 B;  2CAZ C;  5GTI Z;  2Q69 A;  3H1I H;  5J2T B;  4P9O A;  1XHX A;  5EIB C;  2HKO A;  1WA8 A;  1SQF A;  2HFE C;  1OCO B;  3JAK B;  3JAR B;  4DV0 B;  1W59 A;  5KUM A;  3QTC A;  3RYH B;  1B3Q A;  2ETN A;  4Z2W A;  1N8R W;  4I4T A;  3VQY A;  2UUB B;  4TV9 A;  3AG2 C;  3BAA A;  1RP3 B;  1SC5 B;  2E3C A;  3AG3 B;  4ZI7 A;  3RW0 A;  1DTO A;  4WF9 V;  4NKG B;  2GUZ B;  4NR1 A;  3EXA A;  1FJG B;  1BZK A;  2AGA A;  1E1R G;  1O9G A;  4KP4 A;  3EHB B;  4J80 A;  1TA8 A;  2O57 A;  4TOI A;  1K5S A;  3LSU A;  3RN4 A;  4UVB A;  4JI2 O;  3VQW A;  1MSD A;  5GON A;  5H2F Z;  5CBH A;  2JVD A;  3OMN B;  4UCU A;  2Q7G A;  1NJI W;  2P90 A;  4XDJ A;  2ZCE A;  1NZ6 A;  3K08 A;  3QVN A;  2EJ7 A;  1G1X B;  3GWO A;  5BY1 A;  5KUK A;  1BHB A;  2V7Q G;  2YID A;  2OYQ A;  4F6E A;  2LP7 A;  4XDK A;  4PD4 F;  4OPH A;  3ZN1 A;  2CK3 G;  1S72 V;  1I94 O;  3G80 A;  2WA3 A;  2LGQ A;  1RPR A;  3E2E A;  1MAB G;  2ZXW B;  1HNW B;  2QDO A;  3UM7 A;  4ASU G;  4DV4 O;  3ABL B;  3I5D A;  4FLZ A;  3DTU B;  3AK2 A;  1N32 B;  4TV8 A;  1P7B A;  3ZRX A;  3HKC A;  3ETQ A;  1W0K G;  3RT3 C;  3F5W C;  3RYI B;  1L0L H;  2ZR3 A;  3JD3 A;  4X9Q A;  5KHK A;  1H38 A;  1UJW B;  4YIO A;  5BMV A;  4W4K A;  4HNA A;  3U11 A;  5IYC O;  1JJO A;  1CXZ B;  1V55 B;  4EB6 B;  5E1A C;  1WN7 A;  5E79 Z;  4RUF A;  4J7K A;  3AEI A;  4IIJ A;  4YJ2 B;  4PA4 A;  2E76 B;  3TET A;  1UPG A;  2GBO A;  3CYO A;  4XBF A;  5BZB A;  2QWP B;  4D6T H;  1H8H G;  2RDC A;  3HKB A;  4DV2 O;  1VAR A;  2ODM A;  5IWA O;  2F66 C;  1F4M A;  1OCZ B;  1Q5O A;  4KFM A;  3F7V C;  1IXM A;  2DMX A;  1S76 D;  4UCT A;  3CXC U;  1GM8 A;  5B1O A;  3HR0 A;  1YTF D;  3O65 A;  5K1P A;  2WWW A;  3BFR A;  3FAV A;  1HR0 O;  1SZT A;  3OMA B;  2Y69 C;  1QR9 A;  3FYI B;  1AR5 A;  3CCM V;  2B1G A;  3FYE B;  4I0X A;  4DRX A;  1BQ0 A;  1LUV A;  2Q73 A;  1URF A;  1JCH A;  1RM1 B;  2E75 B;  1KP3 A;  4F6R A;  4GUN A;  5EBW C;  2OT5 A;  4W4L A;  1B04 A;  3JD2 A;  4LFC O;  4IL6 Z;  1PL4 A;  5JQG A;  4JAS A;  3E22 A;  4X62 O;  1OCR C;  3ML0 A;  3P3N A;  5IYZ A;  3W7U A;  3CSX A;  4UCS A;  4DR6 O;  4UXN A;  2ZM6 B;  3ABU A;  4IT5 A;  2DYS C;  2DYR B;  2EIK C;  3D3I A;  1KBH A;  4JTD B;  5EK0 A;  1FXK B;  3T1C A;  3K79 A;  1R3K C;  5BXZ A;  2K1E A;  5B1A B;  4AI8 A;  4JI7 O;  4K35 A;  3SPH A;  5IT9 N;  1R3L C;  2P5O A;  3UKM A;  3T2M A;  2FL4 A;  1BMF G;  4B3T O;  1SQB H;  1ZTE A;  1XIL A;  1VQ8 V;  4J42 A;  3CCV V;  2WLL A;  3E35 A;  5EC2 C;  3ZS8 C;  4JYA O;  4MSW C;  2AZ0 A;  3RVY A;  1U96 A;  4WFA V;  4K0K O;  4R7C A;  3CP1 A;  2ZIO A;  3MHS C;  4JI5 B;  1CEZ A;  2VWJ A;  3KG2 A;  2K9P A;  1NI8 A;  3CCR V;  1XEQ A;  2JK5 C;  2ZXW C;  3SPJ A;  5D5Q A;  3JAM N;  3ZIA G;  5L3D A;  2QM4 A;  3ABL C;  1DLB A;  1BT8 A;  1YF2 A;  2QM8 A;  1VQ9 V;  4Z1V A;  5KX5 A;  1RSO A;  2Q7E A;  1K34 A;  3OEH G;  5KMG A;  4DR3 O;  1WB7 A;  1EZJ A;  4YXW G;  4ABM A;  2UXB B;  1NH2 B;  2PI4 A;  3ABK C;  4B3S O;  1YEW A;  1I94 B;  3B77 A;  1Q82 W;  5LOV A;  4FM1 A;  3K5L A;  4DW0 A;  5H5N A;  4DUY B;  4RAI A;  3PN1 A;  1Q86 W;  3H1L H;  2YI9 A;  5KAI Z;  4LF5 B;  4DV4 B;  5B66 Z;  1ARO P;  4Q6G A;  2JGU A;  3BPZ A;  1NR7 A;  4FZ0 A;  3O9O A;  2E5L O;  1AJQ A;  2IU0 A;  4O4J B;  4FFB B;  2L35 A;  4L8J A;  2LQT A;  1OCZ C;  3ZHS A;  1WAZ A;  2YIC A;  3RYC A;  3X2Q C;  1H2S B;  2F43 G;  4LP8 A;  5CA0 B;  1T5E A;  1IXB A;  4DV3 O;  3M7M X;  3HKD B;  4I55 B;  3UT5 B;  1N34 B;  4LNU A;  1Q6H A;  3JSL A;  3UO3 A;  4QPJ A;  1L0N H;  3STZ C;  1SET A;  1SQP H;  2DWD C;  1THZ A;  4YJ3 B;  3SJQ C;  3DC5 A;  3K5M A;  2QKA A;  3JAR A;  4DV0 O;  4DV2 B;  5LP6 A;  4FIP C;  1M4U A;  4UUJ C;  3HPL C;  5IWA B;  5B1B C;  3RYH A;  2UUB O;  3LDE A;  1JMK C;  2IBZ H;  4DV7 O;  1NTK H;  1SA0 B;  4X20 B;  4UCR A;  1QCE A;  4E4E A;  1FJG O;  2GUZ A;  2VS0 A;  2AXT Z;  4CS2 A;  1Y74 B;  2N04 A;  2XOK G;  3JAT B;  3I56 V;  5BR8 O;  4LF4 O;  3D36 A;  4GX2 A;  5C8Y B;  4X64 B;  2OCC B;  3RYF A;  2WA4 A;  3U0Z A;  3K5O A;  1FXK C;  1GK9 A;  3AG2 B;  1YJW V;  1AJN A;  5B1A C;  3P32 A;  3L72 H;  2KG7 B;  4LF6 B;  4LF9 O;  5LMU B;  4JZG A;  4OPA A;  1Z5W A;  4X62 B;  5LGN A;  4UCV A;  2XAS A;  3ZRW B;  5LHH A;  4DR6 B;  4FLT A;  1HNW O;  4LR3 A;  4TT3 G;  4O4L B;  1NKD A;  2Z5U A;  1S0V A;  3ASN C;  4J11 A;  1N33 B;  5A9G A;  4I50 A;  1N32 O;  1VF6 C;  3OM3 B;  2YC0 A;  3FX7 A;  4Z1M G;  3K0G A;  3ZMV A;  1ZL8 B;  2CH7 A;  3QO7 A;  2ATK C;  4IHJ A;  3JCZ A;  3CCE V;  4X89 A;  5IJ0 B;  1SKV A;  4JI7 B;  3CWB H;  2GDS A;  1FPO A;  5TIS Z;  3LDC A;  2YIB A;  3HKE B;  2KKW A;  1KEC A;  2F23 A;  4HYO A;  4TQF A;  2WPD G;  3L75 H;  4EB6 A;  1Y66 A;  3ETD A;  2P6J A;  1A32 A;  4JI1 B;  1IBL B;  4YJ2 A;  4PA3 A;  2Q0O C;  3DXR A;  2Z3Y A;  5FLX N;  1X4T A;  4J7J A;  4UVC A;  1K33 A;  2Q5Z A;  2RQ6 A;  3K9S A;  4GZR B;  2JDI G;  1M90 W;  4O2A B;  5HFM A;  1YVW A;  3JAS A;  1TUB A;  3N2K B;  4NTY A;  2Y4T A;  2PZS A;  4DR3 B;  1UFI A;  4L87 A;  4UVA A;  4B3S B;  4MVQ A;  4O2B A;  4LWS B;  4UB8 Z;  2IJK A;  1M5I A;  1CP9 A;  3N2G B;  3WB2 A;  3BRC A;  1N36 O;  3MDS A;  3RFR A;  1XI1 A;  2QWO B;  1QR8 A;  2WLJ A;  3JSN A;  1RPO A;  2HHH O;  3LNM B;  2JS3 A;  1YXB A;  2Y69 B;  2UUC B;  2EIM C;  2XAQ A;  2W0X A;  1QQC A;  3ASO C;  1V9P A;  2EX3 A;  4CS4 A;  1MSW D;  2ZM6 O;  4DUZ O;  5CA3 A;  1K9M W;  1F51 A;  1K4D C;  4PI2 A;  1VQ6 V;  3MD0 A;  4O4H A;  5LYJ A;  5AG2 A;  1WPB A;  3CRR A;  4WFG A;  3L74 H;  2OCC C;  2BSK A;  4D7T A;  4NYK A;  3S3X A;  1FFX B;  1OV9 A;  5KHI A;  3G67 A;  5FNV B;  4DV7 B;  3KCX A;  1OCR B;  1AI6 A;  2XAH A;  1DGS A;  5IDJ A;  1TVK A;  2XT9 A;  1YJN V;  2X6A A;  1GAX A;  4BIU A;  1R6T A;  5FPO A;  4JI5 O;  2DYS B;  2Z0A A;  4WFH A;  4FLV A;  2EIK B;  4B3M O;  3SYQ A;  1YSC A;  5BR8 B;  2P4K A;  4LF4 B;  4C7U A;  2ZDI A;  2KSD A;  2YXH A;  3AK1 A;  1Q90 D;  5JVD B;  4LBE C;  4DK0 A;  1EN5 A;  1Y76 A;  1GTO A;  2UXC B;  2FKX A;  4K3A A;  3FB7 C;  2QSA A;  2A9H A;  3LDD A;  1VIB A;  4CS3 A;  1PL0 A;  4BR6 A;  3CC4 V;  4LF9 B;  1X59 A;  2D3O W;  1Q43 A;  1BS3 A;  3K9A A;  2UXB O;  2UUA B;  5HFL A;  4DR4 B;  2DOS A;  5J2U A;  4LFB O;  5B5E Z;  5K1X A;  1XQ8 A;  2OTL V;  2W0F C;  2ITD C;  2F4V B;  4DUY O;  4F4L A;  1V54 C;  3JAW A;  1XOU A;  3CS5 A;  2UU9 O;  2GTS A;  4LF5 O;  4LF8 B;  4H0L B;  4WBN B;  5ITZ B;  5JH7 A;  2ILM A;  1KD1 W;  1JFF A;  4ZBM A;  1N4C A;  3JYC A;  3OTF A;  1P84 F;  2JEU A;  1AR4 A;  2XND G;  4FFB A;  4G28 B;  3OR7 C;  4ZOL B;  4JI0 O;  1IBK B;  2CTR A;  4X1Y B;  3UCS C;  3ABM C;  4TUY A;  4FLX A;  1MG1 A;  2QGN A;  2YXL A;  2IW5 A;  3OUS A;  3ZMS A;  2A3Q A;  3ABK B;  3ETE A;  4GCZ A;  1N34 O;  4DV5 O;  3UT5 A;  4QE7 A;  4FPP A;  1VF7 A;  2XAJ A;  2YIA A;  1H2K A;  1W0J G;  2R70 A;  5CBG A;  4WFE A;  2IH1 C;  2Y0P A;  4MVR A;  4YJ3 A;  2ADQ B;  3TCU A;  4JTC B;  3L9D A;  1H8E G;  1GM9 A;  3OE7 G;  2R9I A;  4XDL A;  1AB3 A;  1Z2G A;  2EBO A;  3X2Q B;  1JR9 A;  1TGO A;  4EKW A;  4WCE V;  5LHI A;  1JX9 A;  4JI8 B;  4O4I B;  1IDS A;  4MVM A;  4AIL C;  4X20 A;  5L3E A;  3H1J H;  1VQ4 V;  2P67 A;  1GN6 A;  2RN9 A;  2BTQ B;  1NBM G;  4ZHQ B;  4X1I B;  1PV0 A;  4NB5 A;  4DR1 B;  4X1K A;  2VWK A;  1IUR A;  3K3W A;  2YUA A;  1FFT B;  2X6C A;  2VQE O;  2Q7H A;  4DXW A;  3CJH B;  4CC6 A;  4X64 O;  3SPG A;  3OR6 C;  1YI2 V;  5C8Y A;  1SZX A;  1HW7 A;  2LJ2 A;  4CH5 A;  5JWP A;  2FB5 A;  2Q8V A;  2CGN A;  3SGI A;  5IJ9 B;  5B1B B;  1QBZ A;  3IC9 A;  5CB4 A;  1N36 B;  1XBL A;  2GTA A;  5CBF A;  1K7D A;  4DW1 A;  1VQ5 V;  3ZHT A;  2F1M A;  2D2C B;  3CCU V;  3NR7 A;  4LF6 O;  2N05 A;  5LMU O;  1VQK V;  2HHH B;  2QKC A;  1M93 A;  1ZUQ A;  1VQL V;  4QIW F;  4ZKI A;  3CD6 V;  3BEH A;  2JS5 A;  1NS1 A;  4P9P A;  1KYO F;  1COW G;  3NXS A;  3ZRW A;  4DUZ B;  1MNG A;  2QR4 A;  1XDC A;  4JGS A;  4E2L A;  5DN6 G;  2BTO A;  1PD3 A;  1N33 O;  3CCL V;  4O4L A;  5JJJ B;  1S5L Z;  3J80 N;  2QA4 V;  5JCO A;  4ZIB A;  3TXS A;  4RQE A;  2YEV A;  3B8N A;  2ITC C;  2RJZ A;  1QHT A;  2NR5 A;  3EVK A;  5FL7 G;  2YIB D;  4GX5 A;  1WA8 B;  3WU2 Z;  1R3J C;  4NTX A;  1NVP B;  2LGW A;  2R9A A;  3OUF A;  3HKE A;  2CGO A;  5KHJ A;  4I4T B;  2L6L A;  2M6Y A;  2QEX V;  4TV9 B;  5JJE B;  5EYP A;  2HLD G;  4JI1 O;  1IBL O;  4B3M B;  2WLI A;  2GHY A;  3ASN B;  1KUQ A;  1HWY A;  2WSS G;  2GSM B;  3Q4H B;  2XHB A;  3UO2 A;  3FB8 C;  3A0R A;  1OHH G;  5CMU A;  3AK3 A;  1SQQ H;  3JD4 A;  4DV6 B;  1H2L A;  2PGG A;  4LC1 A;  1EM1 A;  2DE0 X;  4PA7 A;  3H01 A;  3ZRS A;  3JD1 A;  4FZ1 A;  4O2A A;  4OXS A;  2A0L A;  1XNQ O;  4YY3 B;  3W7S A;  2EZP A;  1YIJ V;  2NN4 A;  4AQY O;  5KA5 A;  5DM6 V;  2DQ0 A;  1NR1 A;  1YHQ V;  1EN4 A;  3UQ8 A;  2JJ1 G;  5GON B;  4I9Q A;  1LUW A;  2EIN B;  3CHX A;  1B6Q A;  5DED A;  1LR1 A;  4HBN A;  3OD4 A;  4LFB B;  4LWS A;  1ZAU A;  4K8Z A;  3BY6 A;  3D3Q A;  4PDR A;  2UU9 B;  1F23 A;  1SF9 A;  2RNB A;  4MVZ A;  1MZF A;  4MT8 A;  3OTO O;  1JPX A;  3F7Y C;  3JAL A;  1WP8 A;  3ZRV A;  5LGU A;  2EIJ C;  1EBO A;  3QG5 A;  5L3B A;  4JI0 B;  4MTG A;  1PKX A;  3T1Y O;  3K06 A;  1JVM A;  4PEL A;  2QJ1 A;  2UUC O;  1Z5V A;  1HNZ O; 
#chains in the Genus database with same CATH homology
 2BSK B;  3CJH B;  3DXR B;  2BSK A;  3CJH A;  3DXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...