1EZJA

Crystal structure of the multimerization domain of the phosphoprotein from sendai virus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
114
structure length
114
Chain Sequence
ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOCAPSID PHOSPHOPROTEIN
publication title Tetrameric coiled coil domain of Sendai virus phosphoprotein.
pubmed doi rcsb
source organism Sendai virus (strain harris)
molecule tags Viral protein, transferase
total genus 47
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.320 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA01
1.10.287.340 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA02
1EZJA
chains in the Genus database with same CATH superfamily
2Q0AA 1UJWB 2LO1A 1R73A 4O2AA 1I94B 2M7WA 1S5LZ 3JCUZ 2UUBB 5IJ0A 1QBZA 2DYSB 1VQ8V 1HNZB 3JSNA 1SESA 2GHYA 3OUSA 4EKWA 3H1KH 2PY5A 3WG7B 3FAVA 2XAJA 1MOFA 3ML0A 3OFNG 1WA8B 3OE7G 5LP6C 3SPJA 1MZFA 3B4SA 5LP6A 1CP9A 1ZSPA 2HHHO 3ZBHA 1E79G 4FVMA 1JR9A 4LBEC 4GT1A 1OJHA 2BE3A 2XT9A 4AHCA 3JYCA 1XEQA 3TCUA 2R9IA 1D5NA 3VQYA 1KUQA 4N21A 1LUWA 4R7CA 2GUZA 3ABLB 4LFCO 1YJNV 4HAMA 1XNQO 2KG7A 2VQEO 4MT8A 4ZOLA 4GX0A 2XAFA 2Z3YA 2UU9O 2A9HA 2LFSA 1Z5WA 3KG2A 4FIPC 3AG2C 1K92A 4IYHA 3QO7A 3FFQA 1VQLV 1OCCB 4X64B 2JJ1G 4FMTA 3F7VC 4CS3A 3A0BZ 4JYBA 2QWPB 1YIJV 2ZXWB 3C3SA 1FXKC 4X66B 4JI8O 2XOKG 3N2GB 5KMGB 2F93B 3IGAC 4K8XA 4X88A 4I9WA 2Y4TA 3G80A 1N36B 2Y0IA 1SZXA 1XMOB 4JV5B 5IT9N 2BCCH 1WN7A 3CJHB 4P9PA 3APOA 1GO3F 2KSDA 4JI6B 1PKXA 3WB1A 3QTCA 4DW1A 4DR2B 1H2MA 2X6AA 1ZUQA 1IBKO 4YJ2A 4CC6A 5A2QN 1H8HG 4YHHO 3CRRA 1KMIZ 4FLVA 3BFRA 1Q8IA 2AXTZ 1WLEA 2L35A 1WPXA 2CTWA 5J2TB 4OGQB 5BR8O 3ASNC 1ZLZA 5LXTA 1P7GA 1XI1A 1S5JA 5JQGA 1L0LH 5JQGB 3N2KB 5L3FA 4DV0O 3QO8A 4O4JA 4DV5B 5HFLA 3SPCA 3BVOA 1RFYA 4EEQA 2EIMB 4NVPA 4NR1A 3RN4A 4IT5A 2ITDC 5FNVB 1L8DA 2ZDIC 4X62B 1ZL8A 1VQ7V 2H94A 1R3IC 1BL8A 2W0FC 1VQOV 3E2EA 3KKYA 1SKVA 3P32A 4AI8A 1N32B 1IBLB 1XMQO 3TJTA 1MMMA 1S77D 4NXMB 1XREA 4Z1MG 3TGUH 4WFGA 2CGOA 1W0JG 2F4VB 5GTIZ 5H5NA 2P5OA 2GBOA 4W4KA 3E83A 3M99B 4P2ZA 5EYPA 3U10A 4UFZA 5B5EZ 4W4LA 5CA1A 4QPKA 3FB5C 4R6ZA 4X65O 3RFRA 3RVZA 2B5UA 4BR6A 4GKKB 2YEVB 2PTMA 1I94O 4BWAA 5C8YA 4PHZA 3K59A 4B7KA 1KC8W 2UUBO 4B3RB 1TVKA 4O4IA 3UCSC 4DV7B 1HNZO 3CPWU 2YS8A 3G6BA 5LYJB 4ASUG 5EBWC 5KHKA 2B9ZA 1HWYA 1WAZA 2G38A 3CS5A 4LNUB 4X20A 1BMFG 1D2DA 1P84F 5A9GA 2QGNA 5KUMA 2HKOA 1YJ9V 3M7MX 2DYRB 3J7AU 3RVYA 1F4MA 2GTAA 2WA4A 1R3JC 3AG4B 4NTYA 1M90W 3B2EE 2JJ2G 5JCOC 5KA6A 1QCEA 1FXHA 1Q86W 3JALA 1HDJA 1D5AA 3X2QB 1KP3A 3T1YO 1FAFA 1BHAA 3CX5F 3JAKA 1AVMA 3ETGA 3ETDA 4X1KB 4PD4F 1BGYH 2ADPA 2BTOA 3K3WA 4GX5A 1AJPA 1KKCA 2UXBB 5IYBO 4B3SB 1QQCA 2YSUB 4X64O 3TXQA 5J2UA 3W7TA 4X66O 5AG2A 3E8HA 1W2BU 3H1HH 4R8CA 1GN3A 3RYHA 1W0KG 4KXRA 1N36O 3RBZA 3S3XA 4YIPA 1XMOO 4JV5O 5LHIA 4B3TO 4Q6GA 2PI4A 5LMUB 4DR3B 1Y74A 5EBLC 4JI6O 2W6JG 5CMUA 1H2GA 4DR2O 2MW2B 2UUAB 3L72H 3DXRA 3DXRB 4K8ZA 2A06H 4QE7A 1M9NA 3IJ4A 5EC2C 3E22A 4O2BB 1MSDA 2B1GA 4JPRA 2Y69B 3VQXA 1FS0G 3AG1C 4MS2A 2DW4A 4I55A 3ZX6A 4GLXA 4JI7O 2VWKA 1IXMA 4MW3A 1XHZA 3OEHG 4CH5A 4J41A 4DV5O 1G1XB 3T4ZA 2ZT9B 3E8FA 2N05A 1XL6A 1Q5OA 4U7NA 4D6TH 2PYJA 1MA1A 4TV9B 1Z2GA 4X62O 1JVMA 2QA4V 5LHHA 3ZRWA 1HW7A 1JA8A 3ZN1A 1YSCA 3IC9A 4HYOA 1N32O 1AI5A 1IBLO 2HVKC 2DJVA 4ZHQA 2GV9A 4NXMO 2QE7G 2F4VO 2UXDB 3GB7C 3B09A 1IVSA 1Y66A 4B08A 5BY1A 4FM2A 3T1HB 4FFKA 3FB8C 4ICGA 1PV0A 1NU1H 2LW1A 1JCHA 1SQVH 2WWWA 3W7WA 3JARA 5B66Z 4O4HA 3ZJZA 1NR1A 4O4HB 5L3GA 1Q6IA 1AI6A 4GKKO 2IH1C 4TWKA 2DQ3A 5B3SB 3FB7C 4GZRB 1UPGA 2CTPA 4JZGA 4FFBA 4DV7O 4DRXB 3O9OA 5ITZB 1OCZC 1N34B 3B8MA 3T2MA 2QKCA 4LFCB 2IJHA 5JJJB 4F6RB 3BPZA 1PL0A 3ZEDA 4ZBMA 3ZHSA 4QE9A 1GN6A 3M8AA 5GW7A 4MTFA 4CH4A 4X8AA 1TAEA 4J9YB 1YXBA 2Q67A 2QR4A 3KZIZ 3CCSV 1JJ2U 2A0LA 5B1BB 2WLNA 2IU3A 3HKEB 5B1AB 3SYQA 1PP9H 4TSFG 2JS5A 3JAWA 5IYCO 4MSWC 1V9PA 4IL6Z 4R50A 2JS3A 1XILA 2WLHA 1KP2A 1AROP 5CB4A 2L6LA 4FZ1A 3R65A 1JJOA 1RM1C 4I50B 4Z1VA 4LH6A 4O4LA 1S0VA 2UXBO 4B3SO 3F5TA 3KCYA 4YJ3A 1BS3A 3AG7A 4PA4A 3HR0A 1NVPB 2ATKC 1DTOA 1OCRB 2QKAA 1IBKB 5IY5C 3G6EV 2UXCB 1JOYA 4I9QA 3F7YC 3E35A 1Q82W 4F6EA 2QM4A 4EFBA 1Y67A 2WLLA 1I08A 3E89A 4UB6Z 4I5SA 5LGTA 2LQTA 1K9MW 2ZR2A 3CB2A 4DR3O 1AP6A 1Q43A 3OTOB 1M56C 5LA6A 1V55C 4BW5A 1KD1W 1V54B 2JGUA 5JVDB 5EC1C 4LP8A 4B3MB 1J5EO 1JFFA 1KKDA 1JFFB 1HR0B 1WP7A 3ZIAG 2GSMB 4K3AA 1QLEC 3SJAC 3JD2A 3U11A 2DE0X 2P67A 3CCVV 2KB1A 2Y48A 1L1FA 1NTMH 3K9AA 4G28B 4A5UB 4K35A 4Q20A 4TT3G 4FM1A 4FLUA 3BRCA 4KL1A 3RYCA 4RUEA 4RUFA 3JATA 4JYAB 4JI0B 3BAAA 1SZTA 2ZE7A 3UQ8A 3OMAB 1NKDA 2N04A 4FK5C 1ORQC 2F66C 5CA0A 5KUKA 1PNKA 4UV9A 3EHBB 4O2AB 1GRJA 4WFFA 1VQ4V 2AZ0A 2GDSA 2XASA 4J7JA 3IC7A 3STZC 1K97A 2JVDA 5IJ0B 4JYYA 2UXDO 1F23A 2P90A 4WF9V 3FAVB 3T1HO 3SYOA 1YHQV 1K5QA 3JSLA 1SQQH 3VQVA 1ZAUA 5LP6B 1VMGA 3SYPA 1LR1A 1XUQA 2LJ2A 2HJFC 2AHZA 2ZNIA 3CD6V 4JI3B 2XAQA 3CEIA 3CCRV 3OD4A 2ZKOA 4UCRA 3OMNB 1EN5A 2Q6AA 1N34O 2ZINA 2GUZB 3H1IH 4NYKA 3HKDA 3LDEA 3T1YB 2KKWA 2IU0A 5BMVA 1NR7A 2KG7B 1E1QG 4U7OA 5IYZA 2HR3A 2P6JA 4ZOLB 3CSXA 1GM8A 3DC5A 2D2CB 3AK1A 4TOIA 1CPYA 1XOUA 2PGGA 3JASA 3AG2B 3B8NA 2P06A 2RN9A 1GN2A 2AW9A 4RAIA 1K7DA 2CAZC 3OTFA 1FXKA 4BIZA 4DR6B 1H2SB 5JH7A 2YXHA 2F95B 5L3BA 2WAMA 4TUYA 4DUZB 3FYIB 4B3TB 1L0NH 4JYCA 3NR7A 2XAGA 4I4TA 1DF4A 1GKFA 4TQDA 4CS2A 5EIBC 2YI8A 4LF4B 2E74B 2HVJC 2BTQA 3CE2A 1BQ0A 4KUMA 4YJ2B 2UXCO 2F23A 3WB0A 4X1IA 3CCEV 3VBBA 3ABKC 1K3EA 4TV8A 4EFEA 2Y0PA 1P49A 4JI7B 5LXTB 2VQFB 1SQBH 1EFRG 3ASNB 4GYCB 1IZ3A 3VOUA 3LUTB 4O4JB 1MNGA 3OTOO 2ODMA 2HP8A 4DXWA 2QSAA 3HB3B 1B04A 1TUBA 3D3IA 1NTKH 4B3MO 3SPGA 1HR0O 4LFBB 2ZDIA 1ZL8B 2WPDG 5JJNB 2WLKA 3MHSC 1DF5A 4JI2B 4PDVA 1I0HA 5KHJA 2EIMC 4ZKIA 1Y76A 2N74A 1K5SA 1Y76B 4JTDB 3CCUV 3ZMZA 3LSSA 3UT5A 4LFAB 2EIKC 1I5XA 1PNLA 4JYAO 2JDIG 2FTKA 4JI0O 1R6TA 1JPXA 5EYPB 5CBFA 5IDJA 1B06A 1BQZA 1H2LA 2F43G 3UM7A 3CMEV 5CA1B 2W0XA 2VWJA 1KBHA 4WFEA 1Q7YW 2OCHA 1AR1B 5C8YB 3JD0A 4XDLA 4LF9B 1DK1A 1MABG 1KYOF 4GKJB 1TVKB 3CCMV 4O4IB 2RQ6A 4PV1B 2HEPA 4NTWA 2O57A 4DW0A 4UVBA 2EIJC 3QF7A 4UB8Z 2HG5C 3L74H 4X20B 2AGAA 1PPJH 5LOVA 4DR1B 2C2AA 4DR5B 1Q6HA 5L3DA 1XBLA 1YZBA 2YC0A 4FLXA 3UO2A 2UUCB 1VQNV 3SDLA 4JI3O 3S3WA 3HKBA 1HNWB 3K08A 2ADQB 1A32A 3SYAA 3ASOC 3HKCA 5JCOA 2QJ1A 3UKMA 5D5QA 1R6KA 1RSOA 4GX1A 3LNNA 3AG3C 1RSOB 3JALB 4DR7B 1BE3H 4CC5A 1S76D 4L87A 2XTAA 4PDMA 3JAKB 1BSMA 1IXBA 2YI9A 4X89A 1AR5A 4UCUA 2Q7HA 2RNBA 4KHPB 1NI8A 1M57C 1QU7A 3D36C 4FLZA 3CCLV 2XHBA 1SQFA 1BT8A 4PI0A 3J81N 3CRQA 5J2UB 3K5OA 3LDCA 2QTOA 1XNRB 1VQ5V 4GCZA 2CTRA 3THOA 4DR6O 4E2LA 3RYHB 4DUZO 4FZ0A 3UO3A 4ABMA 4J7KA 2X0LA 5KX5A 2YIBA 3JAMN 2IW5A 1Y74B 3I5DA 1R3KC 4PI2A 3BCCH 5E1AC 2V4DA 4LF4O 1FPOA 3L9DA 3LSUA 4MVQA 4JAVA 5FLXN 3ZHRA 4BW9A 4KP4A 1J5EB 1AP5A 3E22B 2ZM6B 3P30A 5B1NA 2OTJV 2EILC 4J42A 3B40A 4I55B 2VQFO 3OM3B 4J11A 4JGSA 2MK3A 3D8CA 3WFVA 3JCZA 3A0RA 4K0KB 1EM1A 1JQ0A 4N23A 3CC2V 4I0XA 4MVSA 4I0XB 2Q8VA 3OEEG 1COWG 2H3OA 5FL7G 2BOBC 4DV6B 4LFBO 1YITV 1ZTEA 2UXXA 3ZRWB 1JX9A 4U3JA 4WBNA 2EZPA 2QWNB 1OCOB 2BOCC 1XQ8A 4JI2O 2QKSA 4PJ0Z 2FB5A 4JI1B 4I7ZB 3IAYA 4RQEA 3B77A 5DN6G 1MZEA 4ZHQB 3Q4HA 1S72V 3K0GA 3Q4HB 3TXSA 4LFAO 2DWDC 1VQPV 1YCIA 2Q7GA 3KCXA 4NKGB 4UXNA 4WFAV 5CBGA 4P30A 4DUYO 3K57A 4JF3A 5JWPA 3JARB 5LMNB 2VS0A 4AILC 5KLVH 4BIUA 4QGPA 2EINC 1TGOA 1VF6C 1P7BA 3OGCC 5LGUA 4LF9O 3ABMB 4GKJO 4DV2B 4FFBB 2M6YA 3TETA 5CA3A 2WA3A 1WJZA 3BA9A 1OZ0A 3MAQA 1WPBA 4MTXA 4PA6A 3MDSA 1W59A 1RP3B 5B3SC 1UFIA 3ZMUA 3K5NA 2WLMA 1WNSA 4B7EA 1N4CA 4DR1O 2XUMA 4DR5O 5H6QA 3LNMB 4DK0A 2UUCO 1M93A 2Q73A 3IFXA 3MD0A 3CC7V 4WFBV 5LBQA 1HNWO 2ZNJA 3DTUB 1SC5B 1R6NA 4CS4A 3T4DA 4J7ZA 2DN9A 2EJRA 4JI4B 4DR7O 1Q81W 1KECA 1O9GA 2QWQB 5KHGA 4OX9O 1SRYA 3CHXA 3H1LH 1VF5B 1NT2B 3JAWB 3BY6A 2WLJA 3SGIA 4AQYO 4XBFA 3OGIB 3C3TA 3F5WC 3R66A 1JMKC 5TISZ 3G4SV 5CB4B 5CN0A 2YUAA 4H0LB 3K0DA 4DV4B 1AI7A 4QPJA 3STLC 1RM1B 5B1AC 4O4LB 4YY3O 4KHPO 1SA0A 5H9CA 4IHJA 4YJ3B 1HNXO 2A7WA 4FLWA 5GONA 4H33A 2IJKA 1FD9A 2X6CA 1U96A 1T5EA 1XNRO 4MW8A 4LWSA 1AJQA 3RYIA 1LNQA 2WSSG 5IY5B 3JD3A 1H8EG 2QTSA 3E86A 3ZRVA 2AZ2A 4DR4B 2BSKA 3L73H 3GVMA 3JD1A 1RPRA 2WLLB 4QIWF 3P3NA 4P9OA 5BZBA 2FKXA 2CE4A 2JK5C 4PDRA 2F1MA 5LA6B 1V55B 4EB6A 1PM9A 2NN4A 3FKSG 3K5LA 5HFMA 3RW0A 4Z2WA 2R72A 3ETQA 1WB8A 2EJ7A 4HNAA 4ZIBA 2ZM6O 1N33B 3OUFA 1OV9A 1O9HA 2OIGA 1QLEB 2B1IA 4RWUA 1M5IA 2WLIA 5KA5A 4NTXA 2WLIB 2DMXA 2PUSA 1XL4A 1FKAO 1X59A 4K0KO 4TQFA 2Z0AA 1WP8A 2QWOB 1YTFB 1YEWA 4IIJA 1VF7A 1ZX3A 1SF9A 1VQMV 2RCVA 3E8GA 4XDJA 3RYCB 3JATB 1SS3A 3O65A 2OCCC 4DV6O 3JD4A 1X4TA 3SJQC 1H38A 4JI1O 3SPIA 5CA0B 1QLNA 2PF4E 5IYDO 3WU2Z 4JTCB 1CEZA 2JEXA 2Z5UA 4QNHB 4UVCA 2HFEC 5EZYA 4WCEV 2EX3A 1K73W 1NH2B 1NZ6A 2ZE8A 4IGGA 1VQKV 3CRMA 5F2VO 4UV8A 2LFRA 1YTFD 3G67A 3EVKA 2DYSC 5LMNO 1J95A 2OYQA 3QNEA 4KFMA 1VQ9V 4CH6A 3WG7C 3G71V 1GM7A 2PZSA 4DV2O 2KQXA 3EXAA 1GAXA 1F51A 3RT3C 1DGSA 1WA8A 4LC1A 1CXZB 4LR3A 2IBZH 4PDLA 1NTZH 4LF5B 1K4DC 1VQ6V 1VARA 3HKDB 2K9PA 1U97A 5BMVB 1US6A 2X7RB 5IYZB 4FPPA 3BEHA 2A79B 1EN6A 1NH2D 2P7TC 1KU9A 2ZCEA 1PNMA 2VRZA 2H8PC 1G8MA 2QWRB 2PYLA 4U3FH 3AK3A 1R1BA 3ABLC 3ZN0A 2Q5ZA 3JASB 3QVNA 2HJDA 5KAIZ 4G27B 2E3CA 4D7SA 4JI4O 5DEDA 5EK0A 4J80A 1FXKB 3L70H 5LL6Y 3J80N 1VEWA 5JH7B 1OCCC 2R9RB 3AK2A 3BA8A 4TUYB 2ZXWC 1E1RG 4DV4O 4CBCA 3ABTA 4J10A 3K9SA 3W7SA 4I4TB 4MVZA 1ENVA 5H6RA 4L8JA 3OMIB 3N2GA 5KMGA 1BHBA 1WB7A 4UCSA 2BTQB 4UVAA 5LHGA 1F7YA 3ZHTA 4DO2A 3LDDA 4X1IB 3CJHA 2CDYA 4DR4O 3D3QA 3FX7A 3A0HZ 4JAUA 4TV8B 1VIBA 3ABKB 2K1EA 1R3LC 3MHHC 2P4KA 3BHPA 3QO5A 5IWAB 2EBOA 3L75H 3RGBA 2V1DA 4H44B 1OHHG 1TUBB 3N27A 2XNDG 5J2TA 4UCOA 2RMKB 3ABUA 3N2KA 1N33O 4C7UA 4NXNB 4JZ2A 1FFTB 2UXNA 4MTOA 5J9PC 3CXCU 3FB6C 3RYFA 5EIBD 3RYFB 1H2NA 1GH6A 1K34A 4OPHA 4F4LA 4JTAB 2Q68A 1ROPA 2QDOA 1I7FA 3SR2C 4PA9A 5FNVA 3SJCC 2RDCA 3UT5B 1KB9F 3NXSA 2EIKB 2Q69A 2JGDA 1IBMB 1GMGA 2JGDB 1SERA 4CZZA 4DUYB 4QJFB 4UUJC 1IDSA 1GN4A 1ZWIC 1FJGB 1DLBA 2QEXV 3ETEA 3CXHF 4OPAA 1EZVH 3DC6A 3A8TA 1G4YB 1QR9A 4JI5B 2IH3C 3PJSK 1NQTA 2CK3G 3ZHVA 2YDEA 4DV3B 4LCUC 2XAHA 2EIJB 2OT5A 2D3OW 2YEVA 1BCCH 4LF6B 2DOSA 1G6UA 4DK1A 1N8RW 5LOVB 4MVUA 2R9AA 4LF8B 1QNMA 1M1KW 3ZRSA 2QM8A 3ZHQA 1N0JA 1LUVA 3CMAV 2YIDA 1B6QA 1SQPH 5LYJA 3HKBB 4FLTA 3ZMTA 2E76B 2RJZA 4LNUA 3HKCB 3I56V 3ASOB 2CUGA 4OXSA 2PI5A 4LF5O 4LF7B 4J9ZB 2LP7A 4GX2A 2DYRC 3AG3B 4OX9B 1YF2A 3OAAG 4X9QA 5IE9A 1TA8A 4AQYB 3AG4C 1AJNA 1AILA 1SQGA 1HP8A 4MVOA 1QVFU 2LGWA 2JRIA 3X2QC 1PD3A 3E8BA 3CCJV 1AB3A 5IJ9A 5GTHZ 4YY3B 5IJ9B 1YI2V 2YICA 1HNXB 3D36A 4X1KA 1M57B 1RPOA 3ZCCA 3ZS8C 2P4VA 2FYUH 3ZRXA 2CGNA 2NNUA 5L3CA 4RQFA 1YVWA 4FJCC 2ZD9A 2CH7A 2CH7B 2W6IG 2ZE6A 1GK9A 5KX5B 3CP1A 3K04A 1H2KA 3APQA 5FPOA 1YJWV 4WFHA 1P4RA 1B3QA 2X6BA 1QHTA 2ILMA 4PA7A 2YIAA 3CWBH 2Y4UA 4ZI7A 4ZI7B 1QVGU 1SETA 3P3PA 1S5HC 2HLDG 3AG1B 5K1XA 2EILB 3CYOA 3CC4V 3ICXA 2Q7EA 3L71H 2ZIMA 5IWAO 2E5LB 3GWKC 2Y69C 4O2BA 2CTQA 5D5PA 1IX9A 2Q4PA 5KHHA 3CRCA 2YIBD 4LH7A 4NXNO 3HPLC 3VQWA 2ZE5A 4G2KA 4U3JB 4WBNB 1S3JA 3EFFK 2DWEC 1GM9A 3PN1A 4DV1B 3QG5A 4TV9A 3FYEB 5H2FZ 1KQSU 3FD9A 1THZA 2NR5A 5C93A 5L3EA 1OCOC 2OTLV 1IBMO 2EZOA 2NLJC 2DQ0A 3I55V 3H01A 3SPHA 2IJJA 3H9VA 4H37A 1FJGO 1IURA 1XDCA 5E79Z 1F4NA 3ZMVA 1VF6A 2EINB 2OWOA 2ITCC 5FPRA 4JI5O 1M4UA 4DYLA 4HZ3A 1Q6UA 5EBMC 4DV3O 4RO2A 4H13B 4FM0A 4PA3A 1OCZB 2HHHB 3ABMC 4LF6O 2R70A 3DSQA 4B3RO 1EZJA 4DRXA 4LF8O 5ITZA 1URFA 2JEUA 5KHIA 1K8AW 3DGEA 1XNQB 4F6RA 2VQEB 1Z5VA 3T1CA 3H1JH 4LF7O 2QM7A 2ZIOA 5KAFZ 2Q9LA 1MSWD 1N0NA 3OW2U 2UU9B 2GTSA 1MG1A 3WB2A 1TUEB 4MVRA 2ARHA 3AEIA 4E4EA 4YIOA 2JIZG 5B1BC 2LW7A 2FMLA 1BZKA 1GTOA 4JI8B 3HKEA 1SA0B 4IHJB 1EN4A 2A3QA 5GONB 1NJIW 2YXLA 1Q90D 1Q3EA 4BAYA 4LWSB 3RYIB 3U0ZA 3GWOA 1PL4A 3CRAA 2Q0OC 4I50A 4X1YA 2BSKB 4MTGA 4X1YB 2AHYA 5DM6V 2EULA 3ZHUA 1OCRC 3LSQA 3W7UA 3OT7A 4PELA 4YHHB 4JAAA 3C90A 1M56B 3K06A 4FLYA 4IYIA 4EB6B 4HBNA 5BR8B 5LGNA 1EBOA 4HNAB 1XHXA 2V7QG 5LMUO 1I5YA 3TK1A 2IM9A 4DV0B 3K5MA 1FXVA 1SQXH 3K03A 3OR6C 3RWRD 3OR7C 1V54C 2P22C 2UUAO 4CH3A 5JVDA 2IJIA 1AI4A 1Y6XA 2E5LO 1AR4A 1K33A 2FL4A 1VP7A 3A2FA 4IIJB 4XDKA 2ETNA 4NB5A 4UCVA 1NVPD 3K79A 3SYCA 2ZQMA 3CCQV 5JJEB 2OIEA 2OCCB 5B1OA 1XMQB 2YXYA 1QR8A 1Y4MA 5CBHA 3K58A 1K4CC 3SJBC 4UCTA 4DV1O 3ZMSA 4GUNA 3W7XA 4MVMA 5EZYB 1FFXA 2LGQA 4BIOA 1FFXB 1NS1A 4YXWG 1YDXA 1FYJA 3BABA 2E75B 5BXZA 4X65B 2ZR3A 1NBMG 4JASA 5K1PA 4D7TA 5DECA
chains in the Genus database with same CATH topology
1UJWB 1FFTB 1R73A 1PL0A 2UXNA 4MTOA 5J9PC 2M7WA 2X0LA 3FB6C 3CXCU 4ZBMA 4QE9A 2IW5A 5GW7A 1K34A 1QBZA 2DYSB 2Q68A 4JTAB 1R3KC 4MTFA 4F4LA 1ROPA 5E1AC 1VQ8V 1SESA 4X8AA 2GHYA 3OUSA 4J9YB 4EKWA 4PA9A 2Q67A 3CCSV 1JJ2U 2A0LA 5B1BB 3WG7B 4MVQA 2XAJA 4JAVA 1MOFA 2WLNA 3ML0A 2IU3A 3OFNG 4KP4A 3NXSA 3OE7G 5B1AB 3SYQA 2EIKB 4TSFG 2Q69A 4MSWC 4R50A 5IYCO 1GMGA 3P30A 2WLHA 1SERA 3SPJA 4CZZA 1KP2A 4QJFB 1AROP 5B1NA 2OTJV 1CP9A 2EILC 4UUJC 1E79G 1ZWIC 3R65A 3OM3B 1RM1C 4JGSA 1DLBA 2MK3A 4LBEC 3WFVA 2QEXV 4GT1A 3JCZA 3JYCA 1S0VA 3A0RA 3ETEA 2R9IA 3TCUA 1JQ0A 4N23A 4PA4A 1NVPB 2ATKC 1G4YB 4N21A 3CC2V 1DTOA 1QR9A 4MVSA 2IH3C 1OCRB 4R7CA 5IY5C 3PJSK 3G6EV 1NQTA 3OEEG 3ABLB 1COWG 1JOYA 1YJNV 2CK3G 4HAMA 5FL7G 3F7YC 2BOBC 2XAHA 4LCUC 4MT8A 3E35A 2EIJB 1Q82W 2OT5A 4GX0A 2XAFA 2Z3YA 1YITV 2UXXA 2D3OW 2YEVA 3ZRWB 1JX9A 2WLLA 2A9HA 3E89A 2EZPA 2LFSA 4I5SA 1OCOB 2BOCC 5LGTA 3KG2A 1N8RW 2QKSA 2ZR2A 1K9MW 4FIPC 3AG2C 1K92A 4RQEA 4MVUA 3QO7A 1VQLV 1M1KW 1OCCB 3B77A 3ZRSA 5DN6G 2JJ1G 4FMTA 3F7VC 4JYBA 1YIJV 1M56C 2QM8A 3CMAV 1V55C 2ZXWB 1S72V 1B6QA 4BW5A 3K0GA 1KD1W 1FXKC 1V54B 2DWDC 1VQPV 2XOKG 5EC1C 3ZMTA 4LP8A 1KKDA 3IGAC 3I56V 3ASOB 4X88A 4UXNA 4I9WA 4OXSA 2GSMB 3ZIAG 4WFAV 5CBGA 4P30A 2PI5A 4J9ZB 4JF3A 1QLEC 2LP7A 2DYRC 3AG3B 4GX2A 3OAAG 3AG4C 3JD2A 1AJNA 3CCVV 2P67A 4P9PA 1GO3F 2KB1A 2Y48A 1L1FA 3K9AA 4MVOA 1PKXA 4BIUA 1QVFU 2EINC 1P7BA 4G28B 3OGCC 4Q20A 5LGUA 3ABMB 4TT3G 2X6AA 3X2QC 1PD3A 3E8BA 3CCJV 3TETA 1YI2V 1H8HG 4RUEA 4RUFA 5CA3A 3D36A 1M57B 1RPOA 1WLEA 1OZ0A 3ZCCA 1SZTA 4MTXA 3ZRXA 4PA6A 1WPXA 2NNUA 3OMAB 5B3SC 5L3CA 3ZMUA 4RQFA 3ASNC 2WLMA 1NKDA 4FK5C 4FJCC 1ORQC 5H6QA 5L3FA 5KUKA 2ZD9A 1PNKA 3LNMB 3QO8A 3EHBB 4UV9A 3MD0A 5HFLA 3IFXA 3CC7V 4WFFA 1VQ4V 2W6IG 3SPCA 4WFBV 1GK9A 2XASA 5LBQA 3IC7A 3STZC 1K97A 3CP1A 2EIMB 3DTUB 3K04A 1R6NA 1F23A 1YJWV 2P90A 3T4DA 2ITDC 2EJRA 4WFHA 2ZDIC 4WF9V 1VQ7V 1KECA 3SYOA 1Q81W 1P4RA 2X6BA 2H94A 1R3IC 1YHQV 1BL8A 2W0FC 1K5QA 1SRYA 4PA7A 1VQOV 3BY6A 2WLJA 4XBFA 3E2EA 3F5WC 1QVGU 3P32A 1SETA 1S5HC 3G4SV 2HLDG 5CN0A 3SYPA 3AG1B 2EILB 3K0DA 1S77D 2HJFC 1AI7A 2AHZA 3CYOA 3CD6V 4Z1MG 4QPJA 4WFGA 3STLC 5B1AC 1RM1B 1W0JG 3CC4V 5H9CA 2XAQA 2Y69C 4H33A 3E83A 3M99B 4P2ZA 3CCRV 3OMNB 2IJKA 2Q6AA 2X6CA 4MW8A 4QPKA 3LDEA 1AJQA 3FB5C 1LNQA 2WSSG 2IU0A 3JD3A 5IY5B 4R6ZA 1H8EG 1NR7A 3E86A 3ZRVA 1E1QG 4U7OA 2HR3A 2P6JA 3RVZA 2B5UA 1GM8A 3HPLC 2YEVB 4G2KA 3JD1A 1RPRA 2WLLB 4QIWF 1S3JA 4P9OA 5BZBA 1KC8W 3EFFK 1CPYA 2DWEC 2JK5C 1GM9A 3AG2B 3B8NA 3CPWU 4PDRA 3FYEB 1KQSU 4RAIA 1THZA 4ASUG 5EBWC 5C93A 1K7DA 1V55B 3FKSG 1FXKA 5L3EA 1HWYA 1OCOC 3RW0A 5HFMA 4BIZA 2OTLV 1BMFG 3OUFA 2EZOA 2NLJC 2DQ0A 5KUMA 5L3BA 2WAMA 3H01A 2HKOA 3FYIB 3SPHA 3I55V 1YJ9V 2IJJA 1QLEB 2DYRB 2B1IA 4JYCA 4H37A 3RVYA 2XAGA 1F4MA 2WLIA 1DF4A 1GKFA 1R3JC 2WLIB 3AG4B 5KA5A 1M90W 1XL4A 2JJ2G 1F4NA 5KA6A 1QCEA 3ZMVA 1FXHA 2EINB 1Q86W 1YTFB 2ITCC 2HVJC 1VQMV 4KUMA 3X2QB 1KP3A 3E8GA 4XDJA 4HZ3A 1BHAA 3ETGA 3CCEV 3ETDA 5EBMC 4RO2A 3VBBA 2OCCC 3ABKC 4PA3A 3JD4A 1K3EA 1OCZB 3SJQC 3ABMC 3K3WA 4GX5A 1EFRG 1H38A 1AJPA 3ASNB 3SPIA 1EZJA 1QLNA 3VOUA 5IYDO 5IYBO 4JTCB 3LUTB 1CEZA 2JEXA 2YSUB 2Z5UA 4QNHB 4UVCA 2HFEC 4WCEV 4DXWA 3HB3B 3W7TA 2JEUA 3D3IA 1K73W 1NH2B 1K8AW 3E8HA 3DGEA 3SPGA 1W2BU 4R8CA 1VQKV 3T1CA 2ZDIA 1W0KG 2WPDG 2QM7A 2WLKA 4UV8A 3RBZA 1MSWD 2LFRA 3OW2U 3MHSC 5LHIA 1YTFD 1DF5A 1MG1A 2PI4A 4PDVA 2DYSC 1TUEB 4MVRA 3AEIA 2EIMC 4ZKIA 5EBLC 1J95A 1K5SA 2W6JG 4JTDB 1H2GA 5CMUA 3QNEA 3CCUV 4KFMA 2JIZG 1VQ9V 5B1BC 3WG7C 3G71V 1GM7A 3ZMZA 3LSSA 1GTOA 1F51A 2EIKC 1I5XA 1PNLA 4LC1A 4QE7A 1M9NA 2JDIG 2FTKA 5EC2C 1NJIW 1JPXA 2B1GA 4JPRA 2Y69B 4PDLA 5CBFA 5IDJA 1K4DC 1FS0G 1VQ6V 2F43G 3UM7A 3CMEV 3AG1C 4MS2A 4BAYA 2DW4A 3GWOA 2X7RB 1IXMA 4FPPA 4MTGA 3BEHA 4MW3A 2A79B 4WFEA 3OEHG 1Q7YW 1NH2D 2AHYA 5DM6V 1AR1B 2P7TC 1PNMA 3JD0A 4XDLA 3T4ZA 3E8FA 1MABG 1OCRC 1G8MA 2H8PC 3CCMV 3ABLC 4U7NA 1XL6A 3LSQA 3ZN0A 3W7UA 4PELA 4UVBA 2EIJC 4G27B 1JVMA 1M56B 3K06A 2QA4V 5LHHA 5EK0A 3ZRWA 1FXKB 3ZN1A 1YSCA 2HG5C 1EBOA 5LGNA 2C2AA 2V7QG 5L3DA 1I5YA 4HYOA 3TK1A 1OCCC 2R9RB 1AI5A 1FXVA 1VQNV 2ZXWC 2HVKC 1E1RG 3K03A 3OR6C 4CBCA 3OR7C 1V54C 3ABTA 2QE7G 3W7SA 4MVZA 3K08A 1ENVA 5H6RA 2IJIA 3GB7C 3OMIB 1AI4A 3ASOC 3SYAA 1Y66A 3UKMA 1BHBA 1K33A 1R6KA 4GX1A 3AG3C 1S76D 4L87A 3FB8C 4UVAA 4XDKA 5LHGA 4DO2A 4PDMA 1JCHA 2WWWA 3LDDA 1NVPD 3K79A 3W7WA 3SYCA 2ZQMA 3CCQV 3ZJZA 1NR1A 5L3GA 4JAUA 1AI6A 2OCCB 5B1OA 4X89A 2IH1C 3ABKB 1QR8A 4TWKA 2K1EA 2DQ3A 5B3SB 3FB7C 1Y4MA 1R3LC 3MHHC 5CBHA 3QO5A 1K4CC 1M57C 2EBOA 3ZMSA 3CCLV 3W7XA 4MVMA 2V1DA 1OCZC 1OHHG 3B8MA 3LDCA 2XNDG 3T2MA 2QTOA 4YXWG 1VQ5V 4GCZA 2IJHA 3ABUA 2ZR3A 1NBMG 4JASA 4E2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZJ A; 
#chains in the Genus database with same CATH topology
 2Q0A A;  1UJW B;  2LO1 A;  1R73 A;  4O2A A;  1I94 B;  2M7W A;  1S5L Z;  3JCU Z;  2UUB B;  5IJ0 A;  1QBZ A;  2DYS B;  1VQ8 V;  1HNZ B;  3JSN A;  1SES A;  2GHY A;  3OUS A;  4EKW A;  3H1K H;  2PY5 A;  3WG7 B;  3FAV A;  2XAJ A;  1MOF A;  3ML0 A;  3OFN G;  1WA8 B;  3OE7 G;  5LP6 C;  3SPJ A;  1MZF A;  3B4S A;  5LP6 A;  1CP9 A;  1ZSP A;  2HHH O;  3ZBH A;  1E79 G;  4FVM A;  1JR9 A;  4LBE C;  4GT1 A;  1OJH A;  2BE3 A;  2XT9 A;  4AHC A;  3JYC A;  1XEQ A;  3TCU A;  2R9I A;  1D5N A;  3VQY A;  1KUQ A;  4N21 A;  1LUW A;  4R7C A;  2GUZ A;  3ABL B;  4LFC O;  1YJN V;  4HAM A;  1XNQ O;  2KG7 A;  2VQE O;  4MT8 A;  4ZOL A;  4GX0 A;  2XAF A;  2Z3Y A;  2UU9 O;  2A9H A;  2LFS A;  1Z5W A;  3KG2 A;  4FIP C;  3AG2 C;  1K92 A;  4IYH A;  3QO7 A;  3FFQ A;  1VQL V;  1OCC B;  4X64 B;  2JJ1 G;  4FMT A;  3F7V C;  4CS3 A;  3A0B Z;  4JYB A;  2QWP B;  1YIJ V;  2ZXW B;  3C3S A;  1FXK C;  4X66 B;  4JI8 O;  2XOK G;  3N2G B;  5KMG B;  2F93 B;  3IGA C;  4K8X A;  4X88 A;  4I9W A;  2Y4T A;  3G80 A;  1N36 B;  2Y0I A;  1SZX A;  1XMO B;  4JV5 B;  5IT9 N;  2BCC H;  1WN7 A;  3CJH B;  4P9P A;  3APO A;  1GO3 F;  2KSD A;  4JI6 B;  1PKX A;  3WB1 A;  3QTC A;  4DW1 A;  4DR2 B;  1H2M A;  2X6A A;  1ZUQ A;  1IBK O;  4YJ2 A;  4CC6 A;  5A2Q N;  1H8H G;  4YHH O;  3CRR A;  1KMI Z;  4FLV A;  3BFR A;  1Q8I A;  2AXT Z;  1WLE A;  2L35 A;  1WPX A;  2CTW A;  5J2T B;  4OGQ B;  5BR8 O;  3ASN C;  1ZLZ A;  5LXT A;  1P7G A;  1XI1 A;  1S5J A;  5JQG A;  1L0L H;  5JQG B;  3N2K B;  5L3F A;  4DV0 O;  3QO8 A;  4O4J A;  4DV5 B;  5HFL A;  3SPC A;  3BVO A;  1RFY A;  4EEQ A;  2EIM B;  4NVP A;  4NR1 A;  3RN4 A;  4IT5 A;  2ITD C;  5FNV B;  1L8D A;  2ZDI C;  4X62 B;  1ZL8 A;  1VQ7 V;  2H94 A;  1R3I C;  1BL8 A;  2W0F C;  1VQO V;  3E2E A;  3KKY A;  1SKV A;  3P32 A;  4AI8 A;  1N32 B;  1IBL B;  1XMQ O;  3TJT A;  1MMM A;  1S77 D;  4NXM B;  1XRE A;  4Z1M G;  3TGU H;  4WFG A;  2CGO A;  1W0J G;  2F4V B;  5GTI Z;  5H5N A;  2P5O A;  2GBO A;  4W4K A;  3E83 A;  3M99 B;  4P2Z A;  5EYP A;  3U10 A;  4UFZ A;  5B5E Z;  4W4L A;  5CA1 A;  4QPK A;  3FB5 C;  4R6Z A;  4X65 O;  3RFR A;  3RVZ A;  2B5U A;  4BR6 A;  4GKK B;  2YEV B;  2PTM A;  1I94 O;  4BWA A;  5C8Y A;  4PHZ A;  3K59 A;  4B7K A;  1KC8 W;  2UUB O;  4B3R B;  1TVK A;  4O4I A;  3UCS C;  4DV7 B;  1HNZ O;  3CPW U;  2YS8 A;  3G6B A;  5LYJ B;  4ASU G;  5EBW C;  5KHK A;  2B9Z A;  1HWY A;  1WAZ A;  2G38 A;  3CS5 A;  4LNU B;  4X20 A;  1BMF G;  1D2D A;  1P84 F;  5A9G A;  2QGN A;  5KUM A;  2HKO A;  1YJ9 V;  3M7M X;  2DYR B;  3J7A U;  3RVY A;  1F4M A;  2GTA A;  2WA4 A;  1R3J C;  3AG4 B;  4NTY A;  1M90 W;  3B2E E;  2JJ2 G;  5JCO C;  5KA6 A;  1QCE A;  1FXH A;  1Q86 W;  3JAL A;  1HDJ A;  1D5A A;  3X2Q B;  1KP3 A;  3T1Y O;  1FAF A;  1BHA A;  3CX5 F;  3JAK A;  1AVM A;  3ETG A;  3ETD A;  4X1K B;  4PD4 F;  1BGY H;  2ADP A;  2BTO A;  3K3W A;  4GX5 A;  1AJP A;  1KKC A;  2UXB B;  5IYB O;  4B3S B;  1QQC A;  2YSU B;  4X64 O;  3TXQ A;  5J2U A;  3W7T A;  4X66 O;  5AG2 A;  3E8H A;  1W2B U;  3H1H H;  4R8C A;  1GN3 A;  3RYH A;  1W0K G;  4KXR A;  1N36 O;  3RBZ A;  3S3X A;  4YIP A;  1XMO O;  4JV5 O;  5LHI A;  4B3T O;  4Q6G A;  2PI4 A;  5LMU B;  4DR3 B;  1Y74 A;  5EBL C;  4JI6 O;  2W6J G;  5CMU A;  1H2G A;  4DR2 O;  2MW2 B;  2UUA B;  3L72 H;  3DXR A;  3DXR B;  4K8Z A;  2A06 H;  4QE7 A;  1M9N A;  3IJ4 A;  5EC2 C;  3E22 A;  4O2B B;  1MSD A;  2B1G A;  4JPR A;  2Y69 B;  3VQX A;  1FS0 G;  3AG1 C;  4MS2 A;  2DW4 A;  4I55 A;  3ZX6 A;  4GLX A;  4JI7 O;  2VWK A;  1IXM A;  4MW3 A;  1XHZ A;  3OEH G;  4CH5 A;  4J41 A;  4DV5 O;  1G1X B;  3T4Z A;  2ZT9 B;  3E8F A;  2N05 A;  1XL6 A;  1Q5O A;  4U7N A;  4D6T H;  2PYJ A;  1MA1 A;  4TV9 B;  1Z2G A;  4X62 O;  1JVM A;  2QA4 V;  5LHH A;  3ZRW A;  1HW7 A;  1JA8 A;  3ZN1 A;  1YSC A;  3IC9 A;  4HYO A;  1N32 O;  1AI5 A;  1IBL O;  2HVK C;  2DJV A;  4ZHQ A;  2GV9 A;  4NXM O;  2QE7 G;  2F4V O;  2UXD B;  3GB7 C;  3B09 A;  1IVS A;  1Y66 A;  4B08 A;  5BY1 A;  4FM2 A;  3T1H B;  4FFK A;  3FB8 C;  4ICG A;  1PV0 A;  1NU1 H;  2LW1 A;  1JCH A;  1SQV H;  2WWW A;  3W7W A;  3JAR A;  5B66 Z;  4O4H A;  3ZJZ A;  1NR1 A;  4O4H B;  5L3G A;  1Q6I A;  1AI6 A;  4GKK O;  2IH1 C;  4TWK A;  2DQ3 A;  5B3S B;  3FB7 C;  4GZR B;  1UPG A;  2CTP A;  4JZG A;  4FFB A;  4DV7 O;  4DRX B;  3O9O A;  5ITZ B;  1OCZ C;  1N34 B;  3B8M A;  3T2M A;  2QKC A;  4LFC B;  2IJH A;  5JJJ B;  4F6R B;  3BPZ A;  1PL0 A;  3ZED A;  4ZBM A;  3ZHS A;  4QE9 A;  1GN6 A;  3M8A A;  5GW7 A;  4MTF A;  4CH4 A;  4X8A A;  1TAE A;  4J9Y B;  1YXB A;  2Q67 A;  2QR4 A;  3KZI Z;  3CCS V;  1JJ2 U;  2A0L A;  5B1B B;  2WLN A;  2IU3 A;  3HKE B;  5B1A B;  3SYQ A;  1PP9 H;  4TSF G;  2JS5 A;  3JAW A;  5IYC O;  4MSW C;  1V9P A;  4IL6 Z;  4R50 A;  2JS3 A;  1XIL A;  2WLH A;  1KP2 A;  1ARO P;  5CB4 A;  2L6L A;  4FZ1 A;  3R65 A;  1JJO A;  1RM1 C;  4I50 B;  4Z1V A;  4LH6 A;  4O4L A;  1S0V A;  2UXB O;  4B3S O;  3F5T A;  3KCY A;  4YJ3 A;  1BS3 A;  3AG7 A;  4PA4 A;  3HR0 A;  1NVP B;  2ATK C;  1DTO A;  1OCR B;  2QKA A;  1IBK B;  5IY5 C;  3G6E V;  2UXC B;  1JOY A;  4I9Q A;  3F7Y C;  3E35 A;  1Q82 W;  4F6E A;  2QM4 A;  4EFB A;  1Y67 A;  2WLL A;  1I08 A;  3E89 A;  4UB6 Z;  4I5S A;  5LGT A;  2LQT A;  1K9M W;  2ZR2 A;  3CB2 A;  4DR3 O;  1AP6 A;  1Q43 A;  3OTO B;  1M56 C;  5LA6 A;  1V55 C;  4BW5 A;  1KD1 W;  1V54 B;  2JGU A;  5JVD B;  5EC1 C;  4LP8 A;  4B3M B;  1J5E O;  1JFF A;  1KKD A;  1JFF B;  1HR0 B;  1WP7 A;  3ZIA G;  2GSM B;  4K3A A;  1QLE C;  3SJA C;  3JD2 A;  3U11 A;  2DE0 X;  2P67 A;  3CCV V;  2KB1 A;  2Y48 A;  1L1F A;  1NTM H;  3K9A A;  4G28 B;  4A5U B;  4K35 A;  4Q20 A;  4TT3 G;  4FM1 A;  4FLU A;  3BRC A;  4KL1 A;  3RYC A;  4RUE A;  4RUF A;  3JAT A;  4JYA B;  4JI0 B;  3BAA A;  1SZT A;  2ZE7 A;  3UQ8 A;  3OMA B;  1NKD A;  2N04 A;  4FK5 C;  1ORQ C;  2F66 C;  5CA0 A;  5KUK A;  1PNK A;  4UV9 A;  3EHB B;  4O2A B;  1GRJ A;  4WFF A;  1VQ4 V;  2AZ0 A;  2GDS A;  2XAS A;  4J7J A;  3IC7 A;  3STZ C;  1K97 A;  2JVD A;  5IJ0 B;  4JYY A;  2UXD O;  1F23 A;  2P90 A;  4WF9 V;  3FAV B;  3T1H O;  3SYO A;  1YHQ V;  1K5Q A;  3JSL A;  1SQQ H;  3VQV A;  1ZAU A;  5LP6 B;  1VMG A;  3SYP A;  1LR1 A;  1XUQ A;  2LJ2 A;  2HJF C;  2AHZ A;  2ZNI A;  3CD6 V;  4JI3 B;  2XAQ A;  3CEI A;  3CCR V;  3OD4 A;  2ZKO A;  4UCR A;  3OMN B;  1EN5 A;  2Q6A A;  1N34 O;  2ZIN A;  2GUZ B;  3H1I H;  4NYK A;  3HKD A;  3LDE A;  3T1Y B;  2KKW A;  2IU0 A;  5BMV A;  1NR7 A;  2KG7 B;  1E1Q G;  4U7O A;  5IYZ A;  2HR3 A;  2P6J A;  4ZOL B;  3CSX A;  1GM8 A;  3DC5 A;  2D2C B;  3AK1 A;  4TOI A;  1CPY A;  1XOU A;  2PGG A;  3JAS A;  3AG2 B;  3B8N A;  2P06 A;  2RN9 A;  1GN2 A;  2AW9 A;  4RAI A;  1K7D A;  2CAZ C;  3OTF A;  1FXK A;  4BIZ A;  4DR6 B;  1H2S B;  5JH7 A;  2YXH A;  2F95 B;  5L3B A;  2WAM A;  4TUY A;  4DUZ B;  3FYI B;  4B3T B;  1L0N H;  4JYC A;  3NR7 A;  2XAG A;  4I4T A;  1DF4 A;  1GKF A;  4TQD A;  4CS2 A;  5EIB C;  2YI8 A;  4LF4 B;  2E74 B;  2HVJ C;  2BTQ A;  3CE2 A;  1BQ0 A;  4KUM A;  4YJ2 B;  2UXC O;  2F23 A;  3WB0 A;  4X1I A;  3CCE V;  3VBB A;  3ABK C;  1K3E A;  4TV8 A;  4EFE A;  2Y0P A;  1P49 A;  4JI7 B;  5LXT B;  2VQF B;  1SQB H;  1EFR G;  3ASN B;  4GYC B;  1IZ3 A;  3VOU A;  3LUT B;  4O4J B;  1MNG A;  3OTO O;  2ODM A;  2HP8 A;  4DXW A;  2QSA A;  3HB3 B;  1B04 A;  1TUB A;  3D3I A;  1NTK H;  4B3M O;  3SPG A;  1HR0 O;  4LFB B;  2ZDI A;  1ZL8 B;  2WPD G;  5JJN B;  2WLK A;  3MHS C;  1DF5 A;  4JI2 B;  4PDV A;  1I0H A;  5KHJ A;  2EIM C;  4ZKI A;  1Y76 A;  2N74 A;  1K5S A;  1Y76 B;  4JTD B;  3CCU V;  3ZMZ A;  3LSS A;  3UT5 A;  4LFA B;  2EIK C;  1I5X A;  1PNL A;  4JYA O;  2JDI G;  2FTK A;  4JI0 O;  1R6T A;  1JPX A;  5EYP B;  5CBF A;  5IDJ A;  1B06 A;  1BQZ A;  1H2L A;  2F43 G;  3UM7 A;  3CME V;  5CA1 B;  2W0X A;  2VWJ A;  1KBH A;  4WFE A;  1Q7Y W;  2OCH A;  1AR1 B;  5C8Y B;  3JD0 A;  4XDL A;  4LF9 B;  1DK1 A;  1MAB G;  1KYO F;  4GKJ B;  1TVK B;  3CCM V;  4O4I B;  2RQ6 A;  4PV1 B;  2HEP A;  4NTW A;  2O57 A;  4DW0 A;  4UVB A;  2EIJ C;  3QF7 A;  4UB8 Z;  2HG5 C;  3L74 H;  4X20 B;  2AGA A;  1PPJ H;  5LOV A;  4DR1 B;  2C2A A;  4DR5 B;  1Q6H A;  5L3D A;  1XBL A;  1YZB A;  2YC0 A;  4FLX A;  3UO2 A;  2UUC B;  1VQN V;  3SDL A;  4JI3 O;  3S3W A;  3HKB A;  1HNW B;  3K08 A;  2ADQ B;  1A32 A;  3SYA A;  3ASO C;  3HKC A;  5JCO A;  2QJ1 A;  3UKM A;  5D5Q A;  1R6K A;  1RSO A;  4GX1 A;  3LNN A;  3AG3 C;  1RSO B;  3JAL B;  4DR7 B;  1BE3 H;  4CC5 A;  1S76 D;  4L87 A;  2XTA A;  4PDM A;  3JAK B;  1BSM A;  1IXB A;  2YI9 A;  4X89 A;  1AR5 A;  4UCU A;  2Q7H A;  2RNB A;  4KHP B;  1NI8 A;  1M57 C;  1QU7 A;  3D36 C;  4FLZ A;  3CCL V;  2XHB A;  1SQF A;  1BT8 A;  4PI0 A;  3J81 N;  3CRQ A;  5J2U B;  3K5O A;  3LDC A;  2QTO A;  1XNR B;  1VQ5 V;  4GCZ A;  2CTR A;  3THO A;  4DR6 O;  4E2L A;  3RYH B;  4DUZ O;  4FZ0 A;  3UO3 A;  4ABM A;  4J7K A;  2X0L A;  5KX5 A;  2YIB A;  3JAM N;  2IW5 A;  1Y74 B;  3I5D A;  1R3K C;  4PI2 A;  3BCC H;  5E1A C;  2V4D A;  4LF4 O;  1FPO A;  3L9D A;  3LSU A;  4MVQ A;  4JAV A;  5FLX N;  3ZHR A;  4BW9 A;  4KP4 A;  1J5E B;  1AP5 A;  3E22 B;  2ZM6 B;  3P30 A;  5B1N A;  2OTJ V;  2EIL C;  4J42 A;  3B40 A;  4I55 B;  2VQF O;  3OM3 B;  4J11 A;  4JGS A;  2MK3 A;  3D8C A;  3WFV A;  3JCZ A;  3A0R A;  4K0K B;  1EM1 A;  1JQ0 A;  4N23 A;  3CC2 V;  4I0X A;  4MVS A;  4I0X B;  2Q8V A;  3OEE G;  1COW G;  2H3O A;  5FL7 G;  2BOB C;  4DV6 B;  4LFB O;  1YIT V;  1ZTE A;  2UXX A;  3ZRW B;  1JX9 A;  4U3J A;  4WBN A;  2EZP A;  2QWN B;  1OCO B;  2BOC C;  1XQ8 A;  4JI2 O;  2QKS A;  4PJ0 Z;  2FB5 A;  4JI1 B;  4I7Z B;  3IAY A;  4RQE A;  3B77 A;  5DN6 G;  1MZE A;  4ZHQ B;  3Q4H A;  1S72 V;  3K0G A;  3Q4H B;  3TXS A;  4LFA O;  2DWD C;  1VQP V;  1YCI A;  2Q7G A;  3KCX A;  4NKG B;  4UXN A;  4WFA V;  5CBG A;  4P30 A;  4DUY O;  3K57 A;  4JF3 A;  5JWP A;  3JAR B;  5LMN B;  2VS0 A;  4AIL C;  5KLV H;  4BIU A;  4QGP A;  2EIN C;  1TGO A;  1VF6 C;  1P7B A;  3OGC C;  5LGU A;  4LF9 O;  3ABM B;  4GKJ O;  4DV2 B;  4FFB B;  2M6Y A;  3TET A;  5CA3 A;  2WA3 A;  1WJZ A;  3BA9 A;  1OZ0 A;  3MAQ A;  1WPB A;  4MTX A;  4PA6 A;  3MDS A;  1W59 A;  1RP3 B;  5B3S C;  1UFI A;  3ZMU A;  3K5N A;  2WLM A;  1WNS A;  4B7E A;  1N4C A;  4DR1 O;  2XUM A;  4DR5 O;  5H6Q A;  3LNM B;  4DK0 A;  2UUC O;  1M93 A;  2Q73 A;  3IFX A;  3MD0 A;  3CC7 V;  4WFB V;  5LBQ A;  1HNW O;  2ZNJ A;  3DTU B;  1SC5 B;  1R6N A;  4CS4 A;  3T4D A;  4J7Z A;  2DN9 A;  2EJR A;  4JI4 B;  4DR7 O;  1Q81 W;  1KEC A;  1O9G A;  2QWQ B;  5KHG A;  4OX9 O;  1SRY A;  3CHX A;  3H1L H;  1VF5 B;  1NT2 B;  3JAW B;  3BY6 A;  2WLJ A;  3SGI A;  4AQY O;  4XBF A;  3OGI B;  3C3T A;  3F5W C;  3R66 A;  1JMK C;  5TIS Z;  3G4S V;  5CB4 B;  5CN0 A;  2YUA A;  4H0L B;  3K0D A;  4DV4 B;  1AI7 A;  4QPJ A;  3STL C;  1RM1 B;  5B1A C;  4O4L B;  4YY3 O;  4KHP O;  1SA0 A;  5H9C A;  4IHJ A;  4YJ3 B;  1HNX O;  2A7W A;  4FLW A;  5GON A;  4H33 A;  2IJK A;  1FD9 A;  2X6C A;  1U96 A;  1T5E A;  1XNR O;  4MW8 A;  4LWS A;  1AJQ A;  3RYI A;  1LNQ A;  2WSS G;  5IY5 B;  3JD3 A;  1H8E G;  2QTS A;  3E86 A;  3ZRV A;  2AZ2 A;  4DR4 B;  2BSK A;  3L73 H;  3GVM A;  3JD1 A;  1RPR A;  2WLL B;  4QIW F;  3P3N A;  4P9O A;  5BZB A;  2FKX A;  2CE4 A;  2JK5 C;  4PDR A;  2F1M A;  5LA6 B;  1V55 B;  4EB6 A;  1PM9 A;  2NN4 A;  3FKS G;  3K5L A;  5HFM A;  3RW0 A;  4Z2W A;  2R72 A;  3ETQ A;  1WB8 A;  2EJ7 A;  4HNA A;  4ZIB A;  2ZM6 O;  1N33 B;  3OUF A;  1OV9 A;  1O9H A;  2OIG A;  1QLE B;  2B1I A;  4RWU A;  1M5I A;  2WLI A;  5KA5 A;  4NTX A;  2WLI B;  2DMX A;  2PUS A;  1XL4 A;  1FKA O;  1X59 A;  4K0K O;  4TQF A;  2Z0A A;  1WP8 A;  2QWO B;  1YTF B;  1YEW A;  4IIJ A;  1VF7 A;  1ZX3 A;  1SF9 A;  1VQM V;  2RCV A;  3E8G A;  4XDJ A;  3RYC B;  3JAT B;  1SS3 A;  3O65 A;  2OCC C;  4DV6 O;  3JD4 A;  1X4T A;  3SJQ C;  1H38 A;  4JI1 O;  3SPI A;  5CA0 B;  1QLN A;  2PF4 E;  5IYD O;  3WU2 Z;  4JTC B;  1CEZ A;  2JEX A;  2Z5U A;  4QNH B;  4UVC A;  2HFE C;  5EZY A;  4WCE V;  2EX3 A;  1K73 W;  1NH2 B;  1NZ6 A;  2ZE8 A;  4IGG A;  1VQK V;  3CRM A;  5F2V O;  4UV8 A;  2LFR A;  1YTF D;  3G67 A;  3EVK A;  2DYS C;  5LMN O;  1J95 A;  2OYQ A;  3QNE A;  4KFM A;  1VQ9 V;  4CH6 A;  3WG7 C;  3G71 V;  1GM7 A;  2PZS A;  4DV2 O;  2KQX A;  3EXA A;  1GAX A;  1F51 A;  3RT3 C;  1DGS A;  1WA8 A;  4LC1 A;  1CXZ B;  4LR3 A;  2IBZ H;  4PDL A;  1NTZ H;  4LF5 B;  1K4D C;  1VQ6 V;  1VAR A;  3HKD B;  2K9P A;  1U97 A;  5BMV B;  1US6 A;  2X7R B;  5IYZ B;  4FPP A;  3BEH A;  2A79 B;  1EN6 A;  1NH2 D;  2P7T C;  1KU9 A;  2ZCE A;  1PNM A;  2VRZ A;  2H8P C;  1G8M A;  2QWR B;  2PYL A;  4U3F H;  3AK3 A;  1R1B A;  3ABL C;  3ZN0 A;  2Q5Z A;  3JAS B;  3QVN A;  2HJD A;  5KAI Z;  4G27 B;  2E3C A;  4D7S A;  4JI4 O;  5DED A;  5EK0 A;  4J80 A;  1FXK B;  3L70 H;  5LL6 Y;  3J80 N;  1VEW A;  5JH7 B;  1OCC C;  2R9R B;  3AK2 A;  3BA8 A;  4TUY B;  2ZXW C;  1E1R G;  4DV4 O;  4CBC A;  3ABT A;  4J10 A;  3K9S A;  3W7S A;  4I4T B;  4MVZ A;  1ENV A;  5H6R A;  4L8J A;  3OMI B;  3N2G A;  5KMG A;  1BHB A;  1WB7 A;  4UCS A;  2BTQ B;  4UVA A;  5LHG A;  1F7Y A;  3ZHT A;  4DO2 A;  3LDD A;  4X1I B;  3CJH A;  2CDY A;  4DR4 O;  3D3Q A;  3FX7 A;  3A0H Z;  4JAU A;  4TV8 B;  1VIB A;  3ABK B;  2K1E A;  1R3L C;  3MHH C;  2P4K A;  3BHP A;  3QO5 A;  5IWA B;  2EBO A;  3L75 H;  3RGB A;  2V1D A;  4H44 B;  1OHH G;  1TUB B;  3N27 A;  2XND G;  5J2T A;  4UCO A;  2RMK B;  3ABU A;  3N2K A;  1N33 O;  4C7U A;  4NXN B;  4JZ2 A;  1FFT B;  2UXN A;  4MTO A;  5J9P C;  3CXC U;  3FB6 C;  3RYF A;  5EIB D;  3RYF B;  1H2N A;  1GH6 A;  1K34 A;  4OPH A;  4F4L A;  4JTA B;  2Q68 A;  1ROP A;  2QDO A;  1I7F A;  3SR2 C;  4PA9 A;  5FNV A;  3SJC C;  2RDC A;  3UT5 B;  1KB9 F;  3NXS A;  2EIK B;  2Q69 A;  2JGD A;  1IBM B;  1GMG A;  2JGD B;  1SER A;  4CZZ A;  4DUY B;  4QJF B;  4UUJ C;  1IDS A;  1GN4 A;  1ZWI C;  1FJG B;  1DLB A;  2QEX V;  3ETE A;  3CXH F;  4OPA A;  1EZV H;  3DC6 A;  3A8T A;  1G4Y B;  1QR9 A;  4JI5 B;  2IH3 C;  3PJS K;  1NQT A;  2CK3 G;  3ZHV A;  2YDE A;  4DV3 B;  4LCU C;  2XAH A;  2EIJ B;  2OT5 A;  2D3O W;  2YEV A;  1BCC H;  4LF6 B;  2DOS A;  1G6U A;  4DK1 A;  1N8R W;  5LOV B;  4MVU A;  2R9A A;  4LF8 B;  1QNM A;  1M1K W;  3ZRS A;  2QM8 A;  3ZHQ A;  1N0J A;  1LUV A;  3CMA V;  2YID A;  1B6Q A;  1SQP H;  5LYJ A;  3HKB B;  4FLT A;  3ZMT A;  2E76 B;  2RJZ A;  4LNU A;  3HKC B;  3I56 V;  3ASO B;  2CUG A;  4OXS A;  2PI5 A;  4LF5 O;  4LF7 B;  4J9Z B;  2LP7 A;  4GX2 A;  2DYR C;  3AG3 B;  4OX9 B;  1YF2 A;  3OAA G;  4X9Q A;  5IE9 A;  1TA8 A;  4AQY B;  3AG4 C;  1AJN A;  1AIL A;  1SQG A;  1HP8 A;  4MVO A;  1QVF U;  2LGW A;  2JRI A;  3X2Q C;  1PD3 A;  3E8B A;  3CCJ V;  1AB3 A;  5IJ9 A;  5GTH Z;  4YY3 B;  5IJ9 B;  1YI2 V;  2YIC A;  1HNX B;  3D36 A;  4X1K A;  1M57 B;  1RPO A;  3ZCC A;  3ZS8 C;  2P4V A;  2FYU H;  3ZRX A;  2CGN A;  2NNU A;  5L3C A;  4RQF A;  1YVW A;  4FJC C;  2ZD9 A;  2CH7 A;  2CH7 B;  2W6I G;  2ZE6 A;  1GK9 A;  5KX5 B;  3CP1 A;  3K04 A;  1H2K A;  3APQ A;  5FPO A;  1YJW V;  4WFH A;  1P4R A;  1B3Q A;  2X6B A;  1QHT A;  2ILM A;  4PA7 A;  2YIA A;  3CWB H;  2Y4U A;  4ZI7 A;  4ZI7 B;  1QVG U;  1SET A;  3P3P A;  1S5H C;  2HLD G;  3AG1 B;  5K1X A;  2EIL B;  3CYO A;  3CC4 V;  3ICX A;  2Q7E A;  3L71 H;  2ZIM A;  5IWA O;  2E5L B;  3GWK C;  2Y69 C;  4O2B A;  2CTQ A;  5D5P A;  1IX9 A;  2Q4P A;  5KHH A;  3CRC A;  2YIB D;  4LH7 A;  4NXN O;  3HPL C;  3VQW A;  2ZE5 A;  4G2K A;  4U3J B;  4WBN B;  1S3J A;  3EFF K;  2DWE C;  1GM9 A;  3PN1 A;  4DV1 B;  3QG5 A;  4TV9 A;  3FYE B;  5H2F Z;  1KQS U;  3FD9 A;  1THZ A;  2NR5 A;  5C93 A;  5L3E A;  1OCO C;  2OTL V;  1IBM O;  2EZO A;  2NLJ C;  2DQ0 A;  3I55 V;  3H01 A;  3SPH A;  2IJJ A;  3H9V A;  4H37 A;  1FJG O;  1IUR A;  1XDC A;  5E79 Z;  1F4N A;  3ZMV A;  1VF6 A;  2EIN B;  2OWO A;  2ITC C;  5FPR A;  4JI5 O;  1M4U A;  4DYL A;  4HZ3 A;  1Q6U A;  5EBM C;  4DV3 O;  4RO2 A;  4H13 B;  4FM0 A;  4PA3 A;  1OCZ B;  2HHH B;  3ABM C;  4LF6 O;  2R70 A;  3DSQ A;  4B3R O;  1EZJ A;  4DRX A;  4LF8 O;  5ITZ A;  1URF A;  2JEU A;  5KHI A;  1K8A W;  3DGE A;  1XNQ B;  4F6R A;  2VQE B;  1Z5V A;  3T1C A;  3H1J H;  4LF7 O;  2QM7 A;  2ZIO A;  5KAF Z;  2Q9L A;  1MSW D;  1N0N A;  3OW2 U;  2UU9 B;  2GTS A;  1MG1 A;  3WB2 A;  1TUE B;  4MVR A;  2ARH A;  3AEI A;  4E4E A;  4YIO A;  2JIZ G;  5B1B C;  2LW7 A;  2FML A;  1BZK A;  1GTO A;  4JI8 B;  3HKE A;  1SA0 B;  4IHJ B;  1EN4 A;  2A3Q A;  5GON B;  1NJI W;  2YXL A;  1Q90 D;  1Q3E A;  4BAY A;  4LWS B;  3RYI B;  3U0Z A;  3GWO A;  1PL4 A;  3CRA A;  2Q0O C;  4I50 A;  4X1Y A;  2BSK B;  4MTG A;  4X1Y B;  2AHY A;  5DM6 V;  2EUL A;  3ZHU A;  1OCR C;  3LSQ A;  3W7U A;  3OT7 A;  4PEL A;  4YHH B;  4JAA A;  3C90 A;  1M56 B;  3K06 A;  4FLY A;  4IYI A;  4EB6 B;  4HBN A;  5BR8 B;  5LGN A;  1EBO A;  4HNA B;  1XHX A;  2V7Q G;  5LMU O;  1I5Y A;  3TK1 A;  2IM9 A;  4DV0 B;  3K5M A;  1FXV A;  1SQX H;  3K03 A;  3OR6 C;  3RWR D;  3OR7 C;  1V54 C;  2P22 C;  2UUA O;  4CH3 A;  5JVD A;  2IJI A;  1AI4 A;  1Y6X A;  2E5L O;  1AR4 A;  1K33 A;  2FL4 A;  1VP7 A;  3A2F A;  4IIJ B;  4XDK A;  2ETN A;  4NB5 A;  4UCV A;  1NVP D;  3K79 A;  3SYC A;  2ZQM A;  3CCQ V;  5JJE B;  2OIE A;  2OCC B;  5B1O A;  1XMQ B;  2YXY A;  1QR8 A;  1Y4M A;  5CBH A;  3K58 A;  1K4C C;  3SJB C;  4UCT A;  4DV1 O;  3ZMS A;  4GUN A;  3W7X A;  4MVM A;  5EZY B;  1FFX A;  2LGQ A;  4BIO A;  1FFX B;  1NS1 A;  4YXW G;  1YDX A;  1FYJ A;  3BAB A;  2E75 B;  5BXZ A;  4X65 B;  2ZR3 A;  1NBM G;  4JAS A;  5K1P A;  4D7T A;  5DEC A; 
#chains in the Genus database with same CATH homology
 1UJW B;  1FFT B;  1R73 A;  1PL0 A;  2UXN A;  4MTO A;  5J9P C;  2M7W A;  2X0L A;  3FB6 C;  3CXC U;  4ZBM A;  4QE9 A;  2IW5 A;  5GW7 A;  1K34 A;  1QBZ A;  2DYS B;  2Q68 A;  4JTA B;  1R3K C;  4MTF A;  4F4L A;  1ROP A;  5E1A C;  1VQ8 V;  1SES A;  4X8A A;  2GHY A;  3OUS A;  4J9Y B;  4EKW A;  4PA9 A;  2Q67 A;  3CCS V;  1JJ2 U;  2A0L A;  5B1B B;  3WG7 B;  4MVQ A;  2XAJ A;  4JAV A;  1MOF A;  2WLN A;  3ML0 A;  2IU3 A;  3OFN G;  4KP4 A;  3NXS A;  3OE7 G;  5B1A B;  3SYQ A;  2EIK B;  4TSF G;  2Q69 A;  4MSW C;  4R50 A;  5IYC O;  1GMG A;  3P30 A;  2WLH A;  1SER A;  3SPJ A;  4CZZ A;  1KP2 A;  4QJF B;  1ARO P;  5B1N A;  2OTJ V;  1CP9 A;  2EIL C;  4UUJ C;  1E79 G;  1ZWI C;  3R65 A;  3OM3 B;  1RM1 C;  4JGS A;  1DLB A;  2MK3 A;  4LBE C;  3WFV A;  2QEX V;  4GT1 A;  3JCZ A;  3JYC A;  1S0V A;  3A0R A;  3ETE A;  2R9I A;  3TCU A;  1JQ0 A;  4N23 A;  4PA4 A;  1NVP B;  2ATK C;  1G4Y B;  4N21 A;  3CC2 V;  1DTO A;  1QR9 A;  4MVS A;  2IH3 C;  1OCR B;  4R7C A;  5IY5 C;  3PJS K;  3G6E V;  1NQT A;  3OEE G;  3ABL B;  1COW G;  1JOY A;  1YJN V;  2CK3 G;  4HAM A;  5FL7 G;  3F7Y C;  2BOB C;  2XAH A;  4LCU C;  4MT8 A;  3E35 A;  2EIJ B;  1Q82 W;  2OT5 A;  4GX0 A;  2XAF A;  2Z3Y A;  1YIT V;  2UXX A;  2D3O W;  2YEV A;  3ZRW B;  1JX9 A;  2WLL A;  2A9H A;  3E89 A;  2EZP A;  2LFS A;  4I5S A;  1OCO B;  2BOC C;  5LGT A;  3KG2 A;  1N8R W;  2QKS A;  2ZR2 A;  1K9M W;  4FIP C;  3AG2 C;  1K92 A;  4RQE A;  4MVU A;  3QO7 A;  1VQL V;  1M1K W;  1OCC B;  3B77 A;  3ZRS A;  5DN6 G;  2JJ1 G;  4FMT A;  3F7V C;  4JYB A;  1YIJ V;  1M56 C;  2QM8 A;  3CMA V;  1V55 C;  2ZXW B;  1S72 V;  1B6Q A;  4BW5 A;  3K0G A;  1KD1 W;  1FXK C;  1V54 B;  2DWD C;  1VQP V;  2XOK G;  5EC1 C;  3ZMT A;  4LP8 A;  1KKD A;  3IGA C;  3I56 V;  3ASO B;  4X88 A;  4UXN A;  4I9W A;  4OXS A;  2GSM B;  3ZIA G;  4WFA V;  5CBG A;  4P30 A;  2PI5 A;  4J9Z B;  4JF3 A;  1QLE C;  2LP7 A;  2DYR C;  3AG3 B;  4GX2 A;  3OAA G;  3AG4 C;  3JD2 A;  1AJN A;  3CCV V;  2P67 A;  4P9P A;  1GO3 F;  2KB1 A;  2Y48 A;  1L1F A;  3K9A A;  4MVO A;  1PKX A;  4BIU A;  1QVF U;  2EIN C;  1P7B A;  4G28 B;  3OGC C;  4Q20 A;  5LGU A;  3ABM B;  4TT3 G;  2X6A A;  3X2Q C;  1PD3 A;  3E8B A;  3CCJ V;  3TET A;  1YI2 V;  1H8H G;  4RUE A;  4RUF A;  5CA3 A;  3D36 A;  1M57 B;  1RPO A;  1WLE A;  1OZ0 A;  3ZCC A;  1SZT A;  4MTX A;  3ZRX A;  4PA6 A;  1WPX A;  2NNU A;  3OMA B;  5B3S C;  5L3C A;  3ZMU A;  4RQF A;  3ASN C;  2WLM A;  1NKD A;  4FK5 C;  4FJC C;  1ORQ C;  5H6Q A;  5L3F A;  5KUK A;  2ZD9 A;  1PNK A;  3LNM B;  3QO8 A;  3EHB B;  4UV9 A;  3MD0 A;  5HFL A;  3IFX A;  3CC7 V;  4WFF A;  1VQ4 V;  2W6I G;  3SPC A;  4WFB V;  1GK9 A;  2XAS A;  5LBQ A;  3IC7 A;  3STZ C;  1K97 A;  3CP1 A;  2EIM B;  3DTU B;  3K04 A;  1R6N A;  1F23 A;  1YJW V;  2P90 A;  3T4D A;  2ITD C;  2EJR A;  4WFH A;  2ZDI C;  4WF9 V;  1VQ7 V;  1KEC A;  3SYO A;  1Q81 W;  1P4R A;  2X6B A;  2H94 A;  1R3I C;  1YHQ V;  1BL8 A;  2W0F C;  1K5Q A;  1SRY A;  4PA7 A;  1VQO V;  3BY6 A;  2WLJ A;  4XBF A;  3E2E A;  3F5W C;  1QVG U;  3P32 A;  1SET A;  1S5H C;  3G4S V;  2HLD G;  5CN0 A;  3SYP A;  3AG1 B;  2EIL B;  3K0D A;  1S77 D;  2HJF C;  1AI7 A;  2AHZ A;  3CYO A;  3CD6 V;  4Z1M G;  4QPJ A;  4WFG A;  3STL C;  5B1A C;  1RM1 B;  1W0J G;  3CC4 V;  5H9C A;  2XAQ A;  2Y69 C;  4H33 A;  3E83 A;  3M99 B;  4P2Z A;  3CCR V;  3OMN B;  2IJK A;  2Q6A A;  2X6C A;  4MW8 A;  4QPK A;  3LDE A;  1AJQ A;  3FB5 C;  1LNQ A;  2WSS G;  2IU0 A;  3JD3 A;  5IY5 B;  4R6Z A;  1H8E G;  1NR7 A;  3E86 A;  3ZRV A;  1E1Q G;  4U7O A;  2HR3 A;  2P6J A;  3RVZ A;  2B5U A;  1GM8 A;  3HPL C;  2YEV B;  4G2K A;  3JD1 A;  1RPR A;  2WLL B;  4QIW F;  1S3J A;  4P9O A;  5BZB A;  1KC8 W;  3EFF K;  1CPY A;  2DWE C;  2JK5 C;  1GM9 A;  3AG2 B;  3B8N A;  3CPW U;  4PDR A;  3FYE B;  1KQS U;  4RAI A;  1THZ A;  4ASU G;  5EBW C;  5C93 A;  1K7D A;  1V55 B;  3FKS G;  1FXK A;  5L3E A;  1HWY A;  1OCO C;  3RW0 A;  5HFM A;  4BIZ A;  2OTL V;  1BMF G;  3OUF A;  2EZO A;  2NLJ C;  2DQ0 A;  5KUM A;  5L3B A;  2WAM A;  3H01 A;  2HKO A;  3FYI B;  3SPH A;  3I55 V;  1YJ9 V;  2IJJ A;  1QLE B;  2DYR B;  2B1I A;  4JYC A;  4H37 A;  3RVY A;  2XAG A;  1F4M A;  2WLI A;  1DF4 A;  1GKF A;  1R3J C;  2WLI B;  3AG4 B;  5KA5 A;  1M90 W;  1XL4 A;  2JJ2 G;  1F4N A;  5KA6 A;  1QCE A;  3ZMV A;  1FXH A;  2EIN B;  1Q86 W;  1YTF B;  2ITC C;  2HVJ C;  1VQM V;  4KUM A;  3X2Q B;  1KP3 A;  3E8G A;  4XDJ A;  4HZ3 A;  1BHA A;  3ETG A;  3CCE V;  3ETD A;  5EBM C;  4RO2 A;  3VBB A;  2OCC C;  3ABK C;  4PA3 A;  3JD4 A;  1K3E A;  1OCZ B;  3SJQ C;  3ABM C;  3K3W A;  4GX5 A;  1EFR G;  1H38 A;  1AJP A;  3ASN B;  3SPI A;  1EZJ A;  1QLN A;  3VOU A;  5IYD O;  5IYB O;  4JTC B;  3LUT B;  1CEZ A;  2JEX A;  2YSU B;  2Z5U A;  4QNH B;  4UVC A;  2HFE C;  4WCE V;  4DXW A;  3HB3 B;  3W7T A;  2JEU A;  3D3I A;  1K73 W;  1NH2 B;  1K8A W;  3E8H A;  3DGE A;  3SPG A;  1W2B U;  4R8C A;  1VQK V;  3T1C A;  2ZDI A;  1W0K G;  2WPD G;  2QM7 A;  2WLK A;  4UV8 A;  3RBZ A;  1MSW D;  2LFR A;  3OW2 U;  3MHS C;  5LHI A;  1YTF D;  1DF5 A;  1MG1 A;  2PI4 A;  4PDV A;  2DYS C;  1TUE B;  4MVR A;  3AEI A;  2EIM C;  4ZKI A;  5EBL C;  1J95 A;  1K5S A;  2W6J G;  4JTD B;  1H2G A;  5CMU A;  3QNE A;  3CCU V;  4KFM A;  2JIZ G;  1VQ9 V;  5B1B C;  3WG7 C;  3G71 V;  1GM7 A;  3ZMZ A;  3LSS A;  1GTO A;  1F51 A;  2EIK C;  1I5X A;  1PNL A;  4LC1 A;  4QE7 A;  1M9N A;  2JDI G;  2FTK A;  5EC2 C;  1NJI W;  1JPX A;  2B1G A;  4JPR A;  2Y69 B;  4PDL A;  5CBF A;  5IDJ A;  1K4D C;  1FS0 G;  1VQ6 V;  2F43 G;  3UM7 A;  3CME V;  3AG1 C;  4MS2 A;  4BAY A;  2DW4 A;  3GWO A;  2X7R B;  1IXM A;  4FPP A;  4MTG A;  3BEH A;  4MW3 A;  2A79 B;  4WFE A;  3OEH G;  1Q7Y W;  1NH2 D;  2AHY A;  5DM6 V;  1AR1 B;  2P7T C;  1PNM A;  3JD0 A;  4XDL A;  3T4Z A;  3E8F A;  1MAB G;  1OCR C;  1G8M A;  2H8P C;  3CCM V;  3ABL C;  4U7N A;  1XL6 A;  3LSQ A;  3ZN0 A;  3W7U A;  4PEL A;  4UVB A;  2EIJ C;  4G27 B;  1JVM A;  1M56 B;  3K06 A;  2QA4 V;  5LHH A;  5EK0 A;  3ZRW A;  1FXK B;  3ZN1 A;  1YSC A;  2HG5 C;  1EBO A;  5LGN A;  2C2A A;  2V7Q G;  5L3D A;  1I5Y A;  4HYO A;  3TK1 A;  1OCC C;  2R9R B;  1AI5 A;  1FXV A;  1VQN V;  2ZXW C;  2HVK C;  1E1R G;  3K03 A;  3OR6 C;  4CBC A;  3OR7 C;  1V54 C;  3ABT A;  2QE7 G;  3W7S A;  4MVZ A;  3K08 A;  1ENV A;  5H6R A;  2IJI A;  3GB7 C;  3OMI B;  1AI4 A;  3ASO C;  3SYA A;  1Y66 A;  3UKM A;  1BHB A;  1K33 A;  1R6K A;  4GX1 A;  3AG3 C;  1S76 D;  4L87 A;  3FB8 C;  4UVA A;  4XDK A;  5LHG A;  4DO2 A;  4PDM A;  1JCH A;  2WWW A;  3LDD A;  1NVP D;  3K79 A;  3W7W A;  3SYC A;  2ZQM A;  3CCQ V;  3ZJZ A;  1NR1 A;  5L3G A;  4JAU A;  1AI6 A;  2OCC B;  5B1O A;  4X89 A;  2IH1 C;  3ABK B;  1QR8 A;  4TWK A;  2K1E A;  2DQ3 A;  5B3S B;  3FB7 C;  1Y4M A;  1R3L C;  3MHH C;  5CBH A;  3QO5 A;  1K4C C;  1M57 C;  2EBO A;  3ZMS A;  3CCL V;  3W7X A;  4MVM A;  2V1D A;  1OCZ C;  1OHH G;  3B8M A;  3LDC A;  2XND G;  3T2M A;  2QTO A;  4YXW G;  1VQ5 V;  4GCZ A;  2IJH A;  3ABU A;  2ZR3 A;  1NBM G;  4JAS A;  4E2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...