1EZJA

Crystal structure of the multimerization domain of the phosphoprotein from sendai virus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
114
structure length
114
Chain Sequence
ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, transferase
molecule keywords NUCLEOCAPSID PHOSPHOPROTEIN
publication title Tetrameric coiled coil domain of Sendai virus phosphoprotein.
pubmed doi rcsb
source organism Sendai virus (strain harris)
total genus 47
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.320 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA01
1.10.287.340 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA02
1EZJA
chains in the Genus database with same CATH superfamily
4I4TA 1QR8A 2W6IG 1ZUQA 1IXBA 4ZIBA 2IM9A 2PI5A 2Q67A 3A0BZ 1HP8A 1N0NA 3ZHTA 2X6CA 1AR1B 3OUFA 1QLEC 1MZEA 1Q43A 1TGOA 1RSOA 1N36O 1AVMA 3I5DA 4TOIA 3THOA 4K35A 3OFNG 2ITCC 4H44B 1XMQB 3DC6A 5KA5A 4DR2B 4JYYA 1JVMA 2ZR2A 3ZHVA 1XHXA 5L3FA 2IW5A 4X1IA 1M93A 1KUQA 4YJ3A 3ZHUA 1PM9A 3JAWB 3Q4HA 4Z2WA 4FK5C 3ZN1A 3ZMUA 2YEVB 2DOSA 4DV6O 3HKCA 1ZWIC 3FD9A 1FKAO 1AI5A 1J5EB 5CA3A 2WPDG 1GKFA 2VWKA 2Q9LA 4JI0O 1JPXA 1TUBB 1AB3A 1RPOA 2E5LB 3OE7G 1PNMA 2HJFC 4O4HB 3L9DA 5JJJB 3ZMTA 1GH6A 4JYAO 1N0JA 2IJJA 4PA7A 4PI0A 1MABG 3KCXA 3LNNA 2JEUA 5L3GA 5LMUO 1I94B 1I08A 1Z5WA 2AGAA 2DWDC 3UCSC 4I50A 4J7KA 3LSUA 2DJVA 3JAKA 3CCMV 3IAYA 3SYPA 2P5OA 4DV5O 1F4NA 1K33A 4P9OA 1URFA 3ETEA 3MAQA 3RN4A 3OMAB 1KP2A 4MVQA 2XTAA 5DM6V 2R72A 2ZR3A 4WFHA 2QTOA 5B3SB 2QGNA 1K8AW 1E1QG 5KMGA 4K0KB 3C90A 2IU0A 4DR1B 3K0GA 2QTSA 4O2BB 1KKCA 1JMKC 3G6BA 2Q7HA 1NZ6A 1VQ6V 3L72H 4MVRA 2WLIB 2WLKA 1YI2V 3RFRA 3AK3A 5KX5A 2E74B 3FX7A 3AG7A 2UXCO 1L8DA 2C2AA 4MS2A 1VQNV 1Q6UA 3K0DA 2BSKB 4O4LB 5EC2C 1VIBA 4AILC 4FIPC 1JFFB 1QCEA 4X66O 3KCYA 5GTHZ 3RYCA 4JTAB 2G38A 3OR7C 4GCZA 1DGSA 2ILMA 3UT5B 4GT1A 3X2QB 2Q0AA 5K1PA 5EBLC 1S5HC 1FXVA 2VWJA 3ZHSA 5BR8O 2Q7EA 3F7VC 4OGQB 2CAZC 4JI3B 3OUSA 4X65O 2LJ2A 4CS4A 3T1YB 2XAHA 3JAWA 4LH7A 3RYIB 3S3WA 1H8HG 1THZA 2D3OW 3VBBA 3CCJV 2YEVA 3CS5A 1P7BA 1R3JC 4NVPA 2ATKC 4PI2A 4DXWA 4BAYA 4NKGB 3RBZA 3K04A 2IU3A 1TUBA 4I5SA 5LA6B 2ZE6A 3ZRVA 2HHHO 2YSUB 4UXNA 5B1NA 1W0JG 3H1JH 4O4HA 4DUYO 1VQ7V 1KP3A 2QKAA 1QHTA 4R7CA 3I56V 2F43G 4LF5B 1IDSA 1A32A 4DV1B 3FAVB 4J11A 2XNDG 3QTCA 1SKVA 4GKKO 1HNZO 1HW7A 4X64O 4EFBA 2KQXA 1NH2D 3GVMA 4AQYO 5BXZA 3BAAA 5CN0A 3CEIA 2Y69B 5B3SC 1IBKB 4MTFA 4P30A 3WB2A 1Q82W 2QWNB 2ZNJA 1YJ9V 2X6BA 1DK1A 3ML0A 3T1HB 5KAIZ 1GN3A 1NR1A 3C3SA 2WLHA 2X6AA 4I55B 4O2BA 5KA6A 1GN6A 4MVSA 1ZAUA 4FM1A 3E89A 4RUEA 5KUMA 1N34O 1YEWA 2E3CA 2EINB 1Q8IA 4D7TA 1JX9A 1AP6A 1Y66A 4B3TO 2P4VA 2A3QA 4NB5A 2BSKA 4O4LA 1K4DC 2EULA 4TT3G 2ZM6B 1EZJA 1MA1A 4RUFA 5H2FZ 4GKJB 1WPXA 1B6QA 4UCVA 1N33O 3X2QC 4IGGA 2JVDA 2EIMB 4GX5A 3R65A 2B1GA 2ZT9B 3UT5A 4FLUA 3BFRA 3JASB 4JAUA 4FLZA 4MTXA 5LMNO 1QU7A 4K8ZA 4DR7O 1HWYA 2YC0A 1VQ5V 1R1BA 2P90A 1KD1W 3W7XA 4J42A 1ENVA 4QPJA 1VMGA 2Z5UA 1WP7A 3KKYA 2YI9A 2JJ1G 2LW1A 3MHHC 5LA6A 4FLYA 4X9QA 3EHBB 3ZRSA 1MZFA 1B3QA 3UO2A 3ZIAG 1N32B 1XMOO 3O9OA 4I9QA 3P3PA 3OT7A 2WA3A 1PPJH 3SJQC 4ZHQB 5CA1B 3FAVA 1GMGA 4KHPO 2VQFB 3OGCC 3RVZA 2HJDA 3NXSA 3ZRXA 1I5XA 1QLNA 2HFEC 4FZ0A 1WPBA 4JI2O 1PL4A 4YY3O 2Y69C 3P3NA 3CRRA 3CD6V 5EYPB 4Z1VA 4H13B 1JJ2U 4NXNO 4NTYA 3CJHA 2JS5A 4DV3B 1G8MA 1SETA 3FB6C 3VQVA 4X62O 4JV5O 3B40A 3K5LA 4I55A 4W4KA 4LF7B 4LF8O 5H6RA 5LHGA 1G1XB 2EINC 4MVOA 3T1CA 1MSDA 4JPRA 5LXTB 3LSSA 2B9ZA 3ZEDA 2UUBO 1LR1A 1H2KA 5IYZB 5HFMA 3D3IA 1V55B 2VQEB 2QM7A 5LP6B 3ZX6A 1IURA 2RMKB 1XBLA 4DR6B 3ZMSA 3K3WA 2Q6AA 2XAFA 2WLLB 2F93B 3ZJZA 3CYOA 1AI4A 2RDCA 2EIMC 4CBCA 5LOVB 2ZD9A 1NR7A 3OR6C 3OMNB 4LF6O 2DYRB 2RNBA 4NXMO 3AG3B 1BL8A 3JASA 3K5NA 2ETNA 3JARB 4DV4B 2FB5A 3DC5A 2Y4TA 5IWAO 3U11A 4LCUC 5IYCO 4FMTA 1K97A 3IGAC 4JGSA 5KHIA 3TCUA 1ZSPA 2VS0A 2EILB 1P49A 1DF5A 3BABA 1EFRG 5GTIZ 3I55V 4W4LA 3JATB 1NI8A 1BCCH 2R9RB 5KLVH 4JI1O 1XUQA 3ZS8C 3RT3C 1QR9A 1R6TA 2OIEA 4ZHQA 5CA1A 1IBMO 3LDCA 3C3TA 2LP7A 1VQPV 3EXAA 5EBWC 5KHGA 4PELA 3TK1A 3H01A 3W7WA 3GWOA 2CUGA 1IBLO 5JQGB 1FXKA 1Q86W 2CTRA 4B3SO 3QO5A 1GN4A 2UUCO 4I50B 3JAKB 5B1OA 4PDVA 3CCLV 1BZKA 1FJGB 1L1FA 2GSMB 3HKBB 1JCHA 1AR5A 3CCUV 5JH7B 2F4VO 1HNXB 2Q73A 4TWKA 1SS3A 3B4SA 5E79Z 1Y74A 4UV8A 1RM1B 4LFCO 4DV7O 2A9HA 2AHZA 4LP8A 4MVMA 3H9VA 5LXTA 3K5MA 5KMGB 4OXSA 1V55C 4JI7B 5IYZA 5LP6C 4TQFA 5AG2A 5CBFA 5CA0B 4P9PA 4DRXB 5LP6A 1LNQA 4KXRA 1D2DA 3SR2C 1YITV 5B5EZ 3JD1A 1PD3A 2WLLA 4WFEA 5KX5B 4UCSA 5LOVA 1HNWO 2DYRC 4FFBB 1AILA 4O2AB 3AG3C 4J7JA 4L8JA 5H6QA 2GTAA 3FYEB 2MW2B 4J41A 3JARA 3RYCB 1HR0O 1BT8A 5GONB 4PA6A 4B7EA 5C8YA 1XNRO 3IFXA 5FL7G 2EILC 2V7QG 4CH5A 3R66A 4F4LA 4BWAA 4PA9A 2QKCA 1H2SB 1G6UA 2F95B 2QR4A 1MMMA 4DV5B 4JI6B 1QVFU 3A0HZ 1S72V 3JATA 4DR3B 2HEPA 4DV2O 4LFAO 1FAFA 1Q5OA 1P84F 1M56B 3G67A 1JA8A 1VARA 4UVBA 4GLXA 4I7ZB 4LR3A 1KECA 1AR4A 3ABMB 4LF4B 3F5WC 2YIAA 2QJ1A 3B8MA 4KFMA 5JQGA 4JI8B 3CC7V 4CS3A 1M4UA 4UCOA 2P4KA 5FNVB 1KQSU 1N4CA 4L87A 5L3CA 2Q8VA 4WF9V 2ZKOA 3W7SA 1OCCB 3HKBA 3BVOA 4CC6A 1R3KC 4U3JA 1KU9A 4DR2O 3SGIA 4PDMA 5JH7A 3CPWU 1D5NA 3EVKA 3LUTB 1KYOF 2KSDA 4X66B 4QNHB 5LYJB 3D36A 1RM1C 1XNQB 4PA3A 1IVSA 3BPZA 2EZPA 2EIKB 1XI1A 2PZSA 4KL1A 2EJRA 4H37A 2PYJA 2ITDC 1XDCA 2YUAA 4ABMA 1J5EO 1MOFA 3UQ8A 1VF7A 5IT9N 2YICA 5CA0A 4DRXA 1XOUA 2B1IA 2PI4A 2E5LO 4DR5B 4F6EA 1VP7A 4UCUA 4EFEA 4DW0A 5H5NA 3L70H 1NTZH 5BY1A 4AI8A 4FFBA 4O2AA 4U3FH 1XEQA 1I94O 2XAQA 3AEIA 2EIJB 1NKDA 2LGQA 3ZMVA 1FFTB 2UXNA 3SPGA 5GONA 5EIBD 2JEXA 1H2NA 1SQBH 2XAJA 4H33A 2IJIA 4Q20A 5C93A 2JIZG 2D2CB 2E76B 4K3AA 4GUNA 2XHBA 1BMFG 4CZZA 4X1YB 1K3EA 1KBHA 4UCTA 1M56C 1M57B 5D5QA 1Y6XA 4DR1O 4IT5A 5IY5B 4EEQA 2A06H 1BGYH 3ABMC 2H8PC 4E2LA 3UKMA 1NT2B 2F1MA 5TISZ 2P22C 1FD9A 3L75H 1Y67A 4U7OA 4YIOA 1R6KA 2ADQB 3BA9A 4HNAB 1N8RW 1M5IA 3FFQA 1MNGA 1OCCC 5FNVA 1ZLZA 3HR0A 1SQFA 4XDLA 3ZHRA 1IXMA 2YXHA 3VOUA 1WN7A 1XHZA 4TQDA 2W0FC 4JI3O 3BRCA 5LYJA 3T1YO 2EIKC 4PD4F 1QBZA 3K06A 4R8CA 3HPLC 1XQ8A 3G4SV 4IYIA 5IYBO 5CMUA 4DUZB 4UB8Z 3CJHB 3JCUZ 5JCOC 4BIOA 2P67A 1GM7A 1H2MA 5JCOA 2FL4A 3K08A 2EZOA 2VRZA 1NQTA 3G71V 5F2VO 3A2FA 2HVJC 1KMIZ 2DMXA 4JTDB 5IJ9A 3LNMB 4LF5O 2K9PA 1ZTEA 5LHIA 4DV1O 4LFBB 2GHYA 2EIJC 4Q6GA 4LC1A 3B8NA 1SQXH 5J2TB 2QWQB 1X4TA 3H1IH 2LW7A 2N05A 1GM8A 1S5JA 2ZIMA 1UFIA 2ZCEA 4KUMA 4WFGA 4P2ZA 2X7RB 4E4EA 1L0NH 5IYDO 3K57A 5H9CA 2Z3YA 3K9SA 5CBGA 2H94A 4WFAV 3QO8A 2YDEA 3OTOB 1K92A 3H1HH 5L3BA 2OTLV 4JI5B 4G27B 4X1YA 4J9YB 1IBKO 1SERA 5KHJA 1SRYA 2RN9A 1M57C 1SF9A 4TV9B 3VQWA 2OTJV 2ZXWB 2HKOA 4GX1A 3P30A 2YXLA 5IY5C 3T1HO 4RQEA 4FFKA 3ZMZA 2WAMA 1S0VA 5LL6Y 3FYIB 1OCZB 3D3QA 3SYQA 4Z1MG 2RQ6A 2XUMA 1MSWD 2YS8A 1ZL8A 1WNSA 3CRCA 3SDLA 3HKEA 1YF2A 1NBMG 2AW9A 5FPRA 2GV9A 4R6ZA 5DEDA 2QKSA 2UXDB 2DYSB 2N74A 1PNLA 3B2EE 4HNAA 3CX5F 4JI4B 2CGNA 1EN6A 2ZM6O 3E8GA 1VQMV 3H1KH 3ABLB 1X59A 4GKJO 1SESA 3SPCA 1WP8A 1EM1A 1L0LH 3E35A 3QG5A 5KHHA 1FXKB 1LUVA 4GX0A 4BW9A 2CK3G 1F23A 3SJAC 4O4IB 1AJQA 4A5UB 2YI8A 2WSSG 4QJFB 3OM3B 3ETQA 4LWSB 3RGBA 4BIZA 3DSQA 3J80N 2N04A 4ZI7A 1YXBA 3E8FA 1XL4A 3G6EV 3QF7A 3K58A 4X1KA 3QNEA 4GZRB 1CP9A 3ZCCA 1E1RG 1F7YA 2NNUA 3BY6A 3ASOB 1NS1A 4WFFA 2ZE5A 2B5UA 3E22A 4YHHB 2UUAB 3J81N 2DQ3A 1D5AA 1Y74B 4PV1B 5LGNA 2ZE7A 2R70A 1RFYA 3IJ4A 2JK5C 3SPIA 3OAAG 2GDSA 4FLXA 4OX9B 2QDOA 2IH1C 1KKDA 3APQA 4CC5A 3J7AU 1N32O 2NLJC 4QE9A 2GTSA 4J10A 4WCEV 1M90W 5J2TA 2DE0X 4DK1A 3PN1A 3ABTA 1GTOA 4JZ2A 2CDYA 3M7MX 1F4MA 3K9AA 1OZ0A 1S3JA 4B7KA 4DR4B 1B04A 3STLC 2Z0AA 2OIGA 3T4ZA 4B3MB 1K4CC 3A0RA 2OYQA 1B06A 3T4DA 1WB8A 2UXBB 2ZXWC 4QE7A 5C8YB 2E75B 4B3RB 4TV9A 2UXXA 5LBQA 2PGGA 1WAZA 4UCRA 1I5YA 4DV3O 5JVDA 1JQ0A 5FPOA 1OCZC 2LO1A 2R9IA 1BHBA 2OWOA 3GWKC 1XREA 4LF7O 3JD3A 3JD0A 1YVWA 1WB7A 2Q5ZA 2CE4A 5J9PC 2DYSC 3OEEG 3N2GB 5EIBC 5JWPA 1KC8W 1J95A 1Q6HA 2Q7GA 3ABKB 1K5QA 2VQEO 3ABLC 4QPKA 1RPRA 4LF9B 1K9MW 2QA4V 4DR6O 5LHHA 1FXKC 1FYJA 3RYFB 2YXYA 1FFXA 2PYLA 3CCEV 2K1EA 5A9GA 4DO2A 1JJOA 4NR1A 1Y76B 4FLTA 4O4IA 5KAFZ 3BHPA 3W7TA 3E8HA 5EK0A 1MG1A 4JYCA 1PP9H 4DV0O 4LWSA 5EZYA 3VQYA 3VQXA 3EFFK 4U3JB 2DW4A 3ASOC 3W7UA 5D5PA 3CC4V 1G4YB 4FPPA 4UV9A 1N36B 2KG7B 1HDJA 2ZQMA 3F7YC 4EB6A 2ZDIC 1ZX3A 2Y0IA 4MTOA 1SA0B 4FVMA 1H2GA 1YTFD 2ZNIA 2RCVA 2ZDIA 4MSWC 3CMEV 4EKWA 2IJHA 1VQ9V 2R9AA 3ZN0A 4LNUB 3SJBC 3FB5C 3FB7C 1YJWV 2ZINA 1I0HA 1AJNA 4XDKA 2A79B 3AK1A 4JF3A 4JYBA 3RW0A 2Q68A 4QIWF 3K59A 4DV6B 3CB2A 5BMVB 4DV2B 5A2QN 4MW3A 5B1BB 4ZOLB 4JI0B 1NTMH 2UU9O 2BTOA 2GBOA 3BEHA 5KHKA 3CCRV 3IC9A 1FXHA 4XDJA 2L35A 1VQLV 1CPYA 2M6YA 2W6JG 4IL6Z 4JYAB 2CH7A 1FJGO 4NTXA 5JJEB 5LMUB 2CTPA 3RWRD 4TUYA 4PDRA 4UB6Z 4HZ3A 2IJKA 1HNXO 1SZTA 3L71H 2KB1A 3L73H 1RP3B 3SPHA 1ORQC 1WJZA 3U10A 1V54B 1FS0G 3IC7A 1U97A 2JJ2G 2LQTA 1VF5B 1QVGU 3ABKC 2NR5A 4JI7O 3N2GA 3JALB 1GO3F 2QWOB 4TSFG 3N27A 2JDIG 4J7ZA 3FB8C 3JD4A 3K03A 2JGDB 1YDXA 3K79A 3RYFA 4K8XA 1Q7YW 4CS2A 5IJ0A 1XILA 1PKXA 1Y76A 4OPHA 2A0LA 4YXWG 4RQFA 2JRIA 3CWBH 1YJNV 1TA8A 5L3EA 1SQVH 2FTKA 3OMIB 4DYLA 2UXCB 2W0XA 1R3IC 1XMQO 4I0XA 2BOCC 3TXSA 3D36C 5LGTA 1GN2A 1VQOV 1DTOA 2PY5A 2KG7A 3ETDA 1NTKH 2YIDA 4UVCA 3ZRWA 3ZBHA 2ZE8A 1ROPA 2Y4UA 1SA0A 3CE2A 3MD0A 3STZC 3N2KB 1QNMA 4JI6O 2FKXA 4R50A 3UM7A 4DR3O 1O9GA 2OCHA 5BR8B 1SQGA 1JOYA 1FPOA 4LNUA 1Q3EA 1Q90D 1VQ8V 4X65B 1AI6A 1EBOA 4QGPA 3MDSA 4X88A 1EN4A 4LF4O 4DW1A 1WLEA 5IJ9B 3OEHG 2BCCH 3CHXA 5EC1C 5B1BC 5BMVA 2P06A 2ARHA 1R73A 2KKWA 2XOKG 5KUKA 2AZ0A 1BE3H 1S5LZ 1VF6C 2X0LA 4RAIA 1OCOB 4JI8O 3P32A 4ZOLA 2DWEC 1OJHA 1VF6A 2HHHB 4JZGA 2QE7G 2V4DA 2L6LA 4DUYB 3OD4A 5J2UB 2H3OA 3TETA 4D7SA 1YTFB 3WG7B 2Q69A 3DTUB 1Q6IA 1EZVH 4GKKB 1HNZB 2HR3A 2WWWA 2HG5C 1OHHG 1V54C 4ICGA 4FLVA 4X64B 5ITZB 1XNQO 3CRQA 1H2LA 4YIPA 4PA4A 3LSQA 1W59A 4AQYB 4BIUA 5IDJA 4K0KO 5GW7A 3JALA 1VEWA 1YHQV 4JASA 3AK2A 4MT8A 1DLBA 1E79G 1PNKA 3L74H 4DR5O 2JGDA 1ZL8B 4WBNB 3HKEB 4X8AA 2YIBA 1YSCA 2LFRA 1NVPD 2F23A 1AJPA 3K5OA 3OW2U 3AG2B 1BHAA 4JAAA 2ODMA 2XASA 2A7WA 5IE9A 4MTGA 1N34B 1H38A 1T5EA 3H1LH 1AP5A 3JCZA 2Y48A 4TV8B 1PV0A 3RVYA 2AZ2A 3O65A 4B3TB 4WFBV 3S3XA 5LGUA 2AXTZ 5DECA 4NYKA 1WA8B 4ZKIA 4G28B 4FM2A 5CB4B 2LGWA 3TXQA 1M9NA 4F6RB 5FLXN 3E83A 3JSNA 4ZI7B 2BE3A 1N33B 4X89A 4ASUG 3U0ZA 3N2KA 4PJ0Z 4IHJB 2Q0OC 2WA4A 4X1KB 1YZBA 2WLJA 2QSAA 5BZBA 1VQ4V 2RJZA 5LMNB 4MW8A 3CSXA 4O4JB 3E22B 4D6TH 2ZIOA 2Y0PA 2MK3A 3ICXA 4DR7B 4UVAA 3DGEA 1BQZA 1BQ0A 3PJSK 1OCOC 3CCVV 2IH3C 4UUJC 3OGIB 4YJ2B 4AHCA 1I7FA 5HFLA 3CXHF 3GB7C 1M1KW 2HLDG 2WLIA 4H0LB 2BTQB 1XL6A 1IX9A 3E2EA 1XMOB 3E8BA 5J2UA 3WG7C 2QM4A 4KHPB 1GM9A 2V1DA 4PHZA 1CEZA 1K7DA 1JFFA 4N23A 4RWUA 5ITZA 4N21A 1P7GA 5K1XA 3RYHB 2EJ7A 1NU1H 4DUZO 3QO7A 3TJTA 2OT5A 4OPAA 5JVDB 2XT9A 3SPJA 3JAMN 5B66Z 4JI2B 3AG4B 4YY3B 4G2KA 2ADPA 4FLWA 4X20B 1JR9A 1TVKB 1K34A 4MVUA 1SZXA 1TAEA 1EN5A 2GUZB 1P4RA 4NXNB 3RYIA 1CXZB 2CGOA 4WBNA 2CTQA 3HB3B 3AG2C 4X62B 3CP1A 1PL0A 4LFBO 4JV5B 2PF4E 4LF8B 4BR6A 3AG1B 2HVKC 2PUSA 1U96A 3CRAA 3JD2A 3B09A 2DQ0A 3WB1A 2UUBB 4TV8A 1FFXB 1SQQH 3D8CA 1BS3A 3CMAV 2WLMA 3ZHQA 4CH4A 2QEXV 3CRMA 1WA8A 4J9ZB 3LDDA 2HP8A 5CB4A 3OTOO 2M7WA 3CCSV 3SYCA 2P6JA 4JI5O 3BA8A 3CXCU 3T2MA 4F6RA 5EZYB 1LUWA 2LFSA 1NJIW 4IHJA 1R3LC 4LF6B 3MHSC 1YIJV 3HKDB 4NXMB 2FMLA 3FKSG 1F51A 1OCRB 1H8EG 5B1AB 4KP4A 5E1AC 4EB6B 4O4JA 1NVPB 2WLNA 5IWAB 3G80A 3SJCC 3ASNB 1SQPH 1K5SA 4GX2A 1KB9F 1OV9A 4FZ1A 3WU2Z 1W0KG 4YJ2A 5CBHA 3JSLA 1TUEB 1V9PA 4JAVA 2JS3A 4IYHA 2UXDO 4NTWA 2VQFO 2OCCB 5L3DA 4JI4O 4CH3A 3WFVA 2BTQA 3DXRB 4HYOA 4IIJB 4JTCB 4JI1B 4LH6A 1BSMA 1IBMB 4I4TB 3JYCA 2EBOA 1NH2B 2YIBD 4J80A 1AI7A 4PDLA 2CH7B 4CH6A 2FYUH 2AHYA 3APOA 3NR7A 2QM8A 1IBLB 3F5TA 3RYHA 3AG4C 4B3SB 5EBMC 4FM0A 2O57A 4TUYB 4MVZA 1YCIA 2UUCB 1RSOB 3SYAA 4X20A 1QLEB 4XBFA 1TVKA 2IBZH 4DV0B 1W2BU 4YHHO 2UUAO 1S77D 1O9HA 2GUZA 4OX9O 1UPGA 4GYCB 2F4VB 3ABUA 2QWRB 4BW5A 3AG1C 1Y4MA 4X1IB 4YJ3B 1S76D 4B08A 3Q4HB 3BCCH 1Z2GA 3CCQV 2QWPB 4LFCB 1K73W 4DV7B 1GAXA 3HKCB 2Q4PA 2BOBC 1QQCA 3B77A 4HBNA 1SC5B 5JJNB 4DK0A 5IJ0B 1R6NA 2DN9A 2F66C 3E86A 4DR4O 1COWG 1UJWB 4U7NA 3KG2A 2EX3A 1AROP 4B3MO 4DV4O 1GK9A 2UXBO 3M8AA 3WB0A 4ZBMA 1HNWB 1Z5VA 4HAMA 4I0XB 4B3RO 1OCRC 2JGUA 2PTMA 2NN4A 5B1AC 3HKDA 2UU9B 4I9WA 1VQKV 2CTWA 3KZIZ 3ASNC 3ZRWB 1HR0B 4LBEC 5EYPA 4C7UA 3A8TA 3OTFA 3M99B 3TGUH 1DF4A 5DN6G 3CC2V 1GRJA 1XNRB 4FJCC 3UO3A 4UFZA 1Q81W 2XAGA 3ETGA 2OCCC 3QVNA 2P7TC 4LF9O 3SYOA 1IZ3A 3DXRA 4IIJA 1US6A 4LFAB 4RO2A 3LDEA
chains in the Genus database with same CATH topology
3P32A 1V55B 1QR8A 2DWEC 2W6IG 2QM7A 1GM8A 2QE7G 2PI5A 2Q67A 3ZMSA 3K3WA 2Q6AA 2XAFA 2WLLB 3ZJZA 3CYOA 1AI4A 4KUMA 4WFGA 4P2ZA 2EIMC 4CBCA 2X7RB 2ZD9A 1NR7A 2X6CA 3OR6C 1AR1B 5IYDO 3OMNB 5H9CA 2Z3YA 3OUFA 3TETA 1YTFB 2DYRB 3WG7B 1QLEC 5CBGA 2H94A 2Q69A 3AG3B 3DTUB 1BL8A 4WFAV 3QO8A 2HR3A 1K92A 5L3BA 2WWWA 2OTLV 2HG5C 4G27B 1OHHG 1V54C 4LCUC 4J9YB 5IYCO 1SERA 4FMTA 1K97A 1SRYA 1M57C 3OFNG 4PA4A 2ITCC 3IGAC 3LSQA 4JGSA 2OTJV 2ZXWB 2HKOA 4BIUA 5KA5A 4GX1A 3P30A 5IY5C 1JVMA 3TCUA 2ZR2A 5IDJA 4RQEA 3ZMZA 2WAMA 1S0VA 5GW7A 5L3FA 2EILB 1YHQV 3FYIB 4JASA 1OCZB 1DF5A 2IW5A 4MT8A 1EFRG 3I55V 1DLBA 3SYQA 4Z1MG 1E79G 1PNKA 4FK5C 3ZN1A 1MSWD 3ZMUA 2YEVB 4X8AA 1ZWIC 1YSCA 2LFRA 2R9RB 1NVPD 1NBMG 1AJPA 1AI5A 4R6ZA 1QR9A 5CA3A 2WPDG 1GKFA 3OW2U 3AG2B 3LDCA 2QKSA 2DYSB 2LP7A 1BHAA 1JPXA 1PNLA 2XASA 1RPOA 1VQPV 3OE7G 4MTGA 5EBWC 1H38A 1PNMA 3E8GA 1VQMV 4PELA 2HJFC 3ABLB 3JCZA 2Y48A 3TK1A 1SESA 3ZMTA 3SPCA 3H01A 3RVYA 3W7WA 3E35A 2IJJA 3GWOA 4PA7A 1FXKB 1MABG 4WFBV 1FXKA 5LGUA 1Q86W 2JEUA 5L3GA 4GX0A 3QO5A 2CK3G 1F23A 2DWDC 1AJQA 4ZKIA 2WSSG 4G28B 4QJFB 3OM3B 5B1OA 1M9NA 4PDVA 3CCLV 3E83A 3CCMV 4BIZA 4X89A 3SYPA 4ASUG 3E8FA 1L1FA 2GSMB 1XL4A 1F4NA 1K33A 3G6EV 4P9OA 1JCHA 3CCUV 3QNEA 3ETEA 2WLJA 1VQ4V 5BZBA 1CP9A 3ZCCA 1E1RG 2NNUA 4MW8A 3BY6A 3ASOB 3OMAB 1KP2A 4WFFA 4MVQA 2B5UA 4TWKA 2DQ3A 5DM6V 2MK3A 2ZR3A 5LGNA 2JK5C 2QTOA 4WFHA 4UV8A 3SPIA 5B3SB 3OAAG 1RM1B 4UVAA 3DGEA 2A9HA 2AHZA 4LP8A 4MVMA 2IH1C 3PJSK 1KKDA 1OCOC 4OXSA 3CCVV 1K8AW 1E1QG 1V55C 2IH3C 4UUJC 2NLJC 2IU0A 4QE9A 3K0GA 4WCEV 1M90W 5HFLA 5CBFA 1VQ6V 3GB7C 4P9PA 1LNQA 4MVRA 2WLIB 1M1KW 2HLDG 1YITV 2WLKA 2WLIA 3JD1A 1PD3A 1YI2V 2WLLA 1XL6A 4WFEA 3ABTA 3E2EA 1GTOA 3E8BA 2DYRC 3WG7C 1F4MA 2C2AA 3K9AA 3AG3C 1OZ0A 4MS2A 1VQNV 3K0DA 1S3JA 5H6QA 3STLC 3FYEB 1GM9A 2V1DA 5EC2C 1CEZA 1K7DA 4FIPC 3T4ZA 1QCEA 1K4CC 3A0RA 3T4DA 4N23A 2ZXWC 4N21A 4QE7A 4JTAB 4PA6A 3OR7C 5LBQA 2UXXA 4GCZA 3QO7A 3X2QB 2OT5A 3IFXA 4GT1A 5FL7G 5EBLC 1S5HC 1FXVA 1I5YA 3SPJA 2EILC 2V7QG 3AG4B 1JQ0A 4G2KA 1OCZC 4F4LA 2R9IA 3F7VC 3OUSA 4PA9A 1BHBA 1K34A 3JD3A 4MVUA 2XAHA 3JD0A 1P4RA 1QVFU 1H8HG 1THZA 2D3OW 3VBBA 1S72V 3CCJV 2YEVA 3HB3B 1P7BA 1R3JC 3AG2C 5J9PC 2DYSC 1M56B 2ATKC 3CP1A 3OEEG 1PL0A 1KC8W 4DXWA 4BAYA 1J95A 3ABKB 3RBZA 4UVBA 3K04A 1K5QA 3AG1B 2HVKC 2IU3A 4I5SA 3ABLC 4QPKA 1KECA 3JD2A 3ZRVA 1RPRA 2YSUB 4UXNA 1K9MW 5B1NA 2DQ0A 3ABMB 1W0JG 2QA4V 5LHHA 3F5WC 1FXKC 1VQ7V 1KP3A 4R7CA 3I56V 2F43G 3CMAV 3CCEV 2K1EA 3B8MA 2WLMA 4KFMA 2QEXV 3CC7V 4DO2A 2XNDG 3W7TA 4J9ZB 3E8HA 5EK0A 1MG1A 3LDDA 4JYCA 2M7WA 3CCSV 3SYCA 2P6JA 3CXCU 3T2MA 1KQSU 4L87A 5L3CA 2LFSA 4WF9V 1NJIW 1R3LC 3MHSC 1NH2D 3W7SA 3EFFK 1OCCB 1YIJV 1R3KC 2DW4A 3ASOC 3FKSG 3W7UA 4PDMA 1F51A 1OCRB 1G4YB 3CC4V 4FPPA 3CPWU 1H8EG 4UV9A 5B1AB 3LUTB 4KP4A 5E1AC 2ZQMA 5CN0A 3F7YC 1NVPB 2WLNA 2ZDIC 4QNHB 3D36A 2Y69B 5B3SC 1RM1C 4MTOA 3ASNB 4MTFA 4P30A 1Q82W 1H2GA 4PA3A 1YTFD 2EZPA 1YJ9V 2ZDIA 2X6BA 1K5SA 2EIKB 4GX2A 4MSWC 3ML0A 3CMEV 4EKWA 2IJHA 1VQ9V 2EJRA 1W0KG 4H37A 2ITDC 3ZN0A 3FB5C 3FB7C 1NR1A 5CBHA 2WLHA 2X6AA 1TUEB 1YJWV 1MOFA 4JAVA 1AJNA 4XDKA 2A79B 5KA6A 4JF3A 4MVSA 2OCCB 2B1IA 4JYBA 5L3DA 2PI4A 3RW0A 2Q68A 3E89A 4RUEA 5KUMA 4QIWF 2EINB 3WFVA 4HYOA 4JTCB 1JX9A 1Y66A 4MW3A 5B1BB 3JYCA 3BEHA 2XAQA 2EBOA 3AEIA 2EIJB 1K4DC 1NKDA 3CCRV 1NH2B 4TT3G 3ZMVA 1FXHA 4XDJA 1EZJA 1AI7A 4RUFA 1VQLV 1CPYA 2W6JG 1FFTB 4PDLA 2UXNA 1WPXA 1B6QA 2AHYA 3SPGA 3X2QC 2QM8A 2JEXA 3AG4C 2XAJA 2EIMB 4GX5A 3R65A 4H33A 5EBMC 2B1GA 4MVZA 2IJIA 4Q20A 4JAUA 3SYAA 5C93A 4PDRA 4MTXA 1QLEB 2JIZG 4XBFA 4HZ3A 2IJKA 1BMFG 1SZTA 4CZZA 1W2BU 2KB1A 3SPHA 1ORQC 1S77D 1K3EA 5HFMA 1V54B 1FS0G 3IC7A 1HWYA 1M56C 1VQ5V 2P90A 1M57B 1KD1W 2JJ2G 3ABUA 3W7XA 3ABKC 1QVGU 4BW5A 1ENVA 3AG1C 4QPJA 2Z5UA 1Y4MA 5IY5B 1GO3F 4TSFG 3ABMC 2JDIG 2H8PC 2JJ1G 1S76D 3FB8C 3MHHC 3JD4A 3K03A 4E2LA 3CCQV 3EHBB 3ZRSA 3UKMA 1K73W 3K79A 3ZIAG 2BOBC 3B77A 3SJQC 1Q7YW 4U7OA 1R6KA 1R6NA 1GMGA 3E86A 1PKXA 1COWG 2A0LA 1N8RW 1UJWB 4YXWG 4RQFA 4U7NA 3KG2A 1AROP 3OGCC 3RVZA 3NXSA 1GK9A 1YJNV 3ZRXA 5L3EA 1I5XA 1OCCC 4ZBMA 2FTKA 4HAMA 3OMIB 1QLNA 1R3IC 1OCRC 2HFEC 4XDLA 2BOCC 5B1AC 1IXMA 4I9WA 3VOUA 5LGTA 2Y69C 1VQKV 1VQOV 1DTOA 3ASNC 2W0FC 3ZRWB 3ETDA 4UVCA 3CD6V 3ZRWA 4LBEC 2EIKC 1ROPA 1QBZA 3K06A 4R8CA 3MD0A 3HPLC 3STZC 3G4SV 5IYBO 3M99B 5CMUA 1JJ2U 1DF4A 5DN6G 3CC2V 4LC1A 4FJCC 4R50A 3UM7A 1G8MA 1SETA 2P67A 1Q81W 2XAGA 3ETGA 3FB6C 1JOYA 1GM7A 1VQ8V 2OCCC 3K08A 1AI6A 1EBOA 5H6RA 2EZOA 5LHGA 1NQTA 3G71V 2P7TC 2EINC 4MVOA 4X88A 2HVJC 3T1CA 3SYOA 1WLEA 3OEHG 4JTDB 4JPRA 3LSSA 5EC1C 5B1BC 3LNMB 2XOKG 1R73A 5KUKA 4RO2A 3LDEA 5LHIA 2X0LA 4RAIA 2GHYA 2EIJC 1OCOB 3D3IA 3B8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZJ A; 
#chains in the Genus database with same CATH topology
 4I4T A;  1QR8 A;  2W6I G;  1ZUQ A;  1IXB A;  4ZIB A;  2IM9 A;  2PI5 A;  2Q67 A;  3A0B Z;  1HP8 A;  1N0N A;  3ZHT A;  2X6C A;  1AR1 B;  3OUF A;  1QLE C;  1MZE A;  1Q43 A;  1TGO A;  1RSO A;  1N36 O;  1AVM A;  3I5D A;  4TOI A;  3THO A;  4K35 A;  3OFN G;  2ITC C;  4H44 B;  1XMQ B;  3DC6 A;  5KA5 A;  4DR2 B;  4JYY A;  1JVM A;  2ZR2 A;  3ZHV A;  1XHX A;  5L3F A;  2IW5 A;  4X1I A;  1M93 A;  1KUQ A;  4YJ3 A;  3ZHU A;  1PM9 A;  3JAW B;  3Q4H A;  4Z2W A;  4FK5 C;  3ZN1 A;  3ZMU A;  2YEV B;  2DOS A;  4DV6 O;  3HKC A;  1ZWI C;  3FD9 A;  1FKA O;  1AI5 A;  1J5E B;  5CA3 A;  2WPD G;  1GKF A;  2VWK A;  2Q9L A;  4JI0 O;  1JPX A;  1TUB B;  1AB3 A;  1RPO A;  2E5L B;  3OE7 G;  1PNM A;  2HJF C;  4O4H B;  3L9D A;  5JJJ B;  3ZMT A;  1GH6 A;  4JYA O;  1N0J A;  2IJJ A;  4PA7 A;  4PI0 A;  1MAB G;  3KCX A;  3LNN A;  2JEU A;  5L3G A;  5LMU O;  1I94 B;  1I08 A;  1Z5W A;  2AGA A;  2DWD C;  3UCS C;  4I50 A;  4J7K A;  3LSU A;  2DJV A;  3JAK A;  3CCM V;  3IAY A;  3SYP A;  2P5O A;  4DV5 O;  1F4N A;  1K33 A;  4P9O A;  1URF A;  3ETE A;  3MAQ A;  3RN4 A;  3OMA B;  1KP2 A;  4MVQ A;  2XTA A;  5DM6 V;  2R72 A;  2ZR3 A;  4WFH A;  2QTO A;  5B3S B;  2QGN A;  1K8A W;  1E1Q G;  5KMG A;  4K0K B;  3C90 A;  2IU0 A;  4DR1 B;  3K0G A;  2QTS A;  4O2B B;  1KKC A;  1JMK C;  3G6B A;  2Q7H A;  1NZ6 A;  1VQ6 V;  3L72 H;  4MVR A;  2WLI B;  2WLK A;  1YI2 V;  3RFR A;  3AK3 A;  5KX5 A;  2E74 B;  3FX7 A;  3AG7 A;  2UXC O;  1L8D A;  2C2A A;  4MS2 A;  1VQN V;  1Q6U A;  3K0D A;  2BSK B;  4O4L B;  5EC2 C;  1VIB A;  4AIL C;  4FIP C;  1JFF B;  1QCE A;  4X66 O;  3KCY A;  5GTH Z;  3RYC A;  4JTA B;  2G38 A;  3OR7 C;  4GCZ A;  1DGS A;  2ILM A;  3UT5 B;  4GT1 A;  3X2Q B;  2Q0A A;  5K1P A;  5EBL C;  1S5H C;  1FXV A;  2VWJ A;  3ZHS A;  5BR8 O;  2Q7E A;  3F7V C;  4OGQ B;  2CAZ C;  4JI3 B;  3OUS A;  4X65 O;  2LJ2 A;  4CS4 A;  3T1Y B;  2XAH A;  3JAW A;  4LH7 A;  3RYI B;  3S3W A;  1H8H G;  1THZ A;  2D3O W;  3VBB A;  3CCJ V;  2YEV A;  3CS5 A;  1P7B A;  1R3J C;  4NVP A;  2ATK C;  4PI2 A;  4DXW A;  4BAY A;  4NKG B;  3RBZ A;  3K04 A;  2IU3 A;  1TUB A;  4I5S A;  5LA6 B;  2ZE6 A;  3ZRV A;  2HHH O;  2YSU B;  4UXN A;  5B1N A;  1W0J G;  3H1J H;  4O4H A;  4DUY O;  1VQ7 V;  1KP3 A;  2QKA A;  1QHT A;  4R7C A;  3I56 V;  2F43 G;  4LF5 B;  1IDS A;  1A32 A;  4DV1 B;  3FAV B;  4J11 A;  2XND G;  3QTC A;  1SKV A;  4GKK O;  1HNZ O;  1HW7 A;  4X64 O;  4EFB A;  2KQX A;  1NH2 D;  3GVM A;  4AQY O;  5BXZ A;  3BAA A;  5CN0 A;  3CEI A;  2Y69 B;  5B3S C;  1IBK B;  4MTF A;  4P30 A;  3WB2 A;  1Q82 W;  2QWN B;  2ZNJ A;  1YJ9 V;  2X6B A;  1DK1 A;  3ML0 A;  3T1H B;  5KAI Z;  1GN3 A;  1NR1 A;  3C3S A;  2WLH A;  2X6A A;  4I55 B;  4O2B A;  5KA6 A;  1GN6 A;  4MVS A;  1ZAU A;  4FM1 A;  3E89 A;  4RUE A;  5KUM A;  1N34 O;  1YEW A;  2E3C A;  2EIN B;  1Q8I A;  4D7T A;  1JX9 A;  1AP6 A;  1Y66 A;  4B3T O;  2P4V A;  2A3Q A;  4NB5 A;  2BSK A;  4O4L A;  1K4D C;  2EUL A;  4TT3 G;  2ZM6 B;  1EZJ A;  1MA1 A;  4RUF A;  5H2F Z;  4GKJ B;  1WPX A;  1B6Q A;  4UCV A;  1N33 O;  3X2Q C;  4IGG A;  2JVD A;  2EIM B;  4GX5 A;  3R65 A;  2B1G A;  2ZT9 B;  3UT5 A;  4FLU A;  3BFR A;  3JAS B;  4JAU A;  4FLZ A;  4MTX A;  5LMN O;  1QU7 A;  4K8Z A;  4DR7 O;  1HWY A;  2YC0 A;  1VQ5 V;  1R1B A;  2P90 A;  1KD1 W;  3W7X A;  4J42 A;  1ENV A;  4QPJ A;  1VMG A;  2Z5U A;  1WP7 A;  3KKY A;  2YI9 A;  2JJ1 G;  2LW1 A;  3MHH C;  5LA6 A;  4FLY A;  4X9Q A;  3EHB B;  3ZRS A;  1MZF A;  1B3Q A;  3UO2 A;  3ZIA G;  1N32 B;  1XMO O;  3O9O A;  4I9Q A;  3P3P A;  3OT7 A;  2WA3 A;  1PPJ H;  3SJQ C;  4ZHQ B;  5CA1 B;  3FAV A;  1GMG A;  4KHP O;  2VQF B;  3OGC C;  3RVZ A;  2HJD A;  3NXS A;  3ZRX A;  1I5X A;  1QLN A;  2HFE C;  4FZ0 A;  1WPB A;  4JI2 O;  1PL4 A;  4YY3 O;  2Y69 C;  3P3N A;  3CRR A;  3CD6 V;  5EYP B;  4Z1V A;  4H13 B;  1JJ2 U;  4NXN O;  4NTY A;  3CJH A;  2JS5 A;  4DV3 B;  1G8M A;  1SET A;  3FB6 C;  3VQV A;  4X62 O;  4JV5 O;  3B40 A;  3K5L A;  4I55 A;  4W4K A;  4LF7 B;  4LF8 O;  5H6R A;  5LHG A;  1G1X B;  2EIN C;  4MVO A;  3T1C A;  1MSD A;  4JPR A;  5LXT B;  3LSS A;  2B9Z A;  3ZED A;  2UUB O;  1LR1 A;  1H2K A;  5IYZ B;  5HFM A;  3D3I A;  1V55 B;  2VQE B;  2QM7 A;  5LP6 B;  3ZX6 A;  1IUR A;  2RMK B;  1XBL A;  4DR6 B;  3ZMS A;  3K3W A;  2Q6A A;  2XAF A;  2WLL B;  2F93 B;  3ZJZ A;  3CYO A;  1AI4 A;  2RDC A;  2EIM C;  4CBC A;  5LOV B;  2ZD9 A;  1NR7 A;  3OR6 C;  3OMN B;  4LF6 O;  2DYR B;  2RNB A;  4NXM O;  3AG3 B;  1BL8 A;  3JAS A;  3K5N A;  2ETN A;  3JAR B;  4DV4 B;  2FB5 A;  3DC5 A;  2Y4T A;  5IWA O;  3U11 A;  4LCU C;  5IYC O;  4FMT A;  1K97 A;  3IGA C;  4JGS A;  5KHI A;  3TCU A;  1ZSP A;  2VS0 A;  2EIL B;  1P49 A;  1DF5 A;  3BAB A;  1EFR G;  5GTI Z;  3I55 V;  4W4L A;  3JAT B;  1NI8 A;  1BCC H;  2R9R B;  5KLV H;  4JI1 O;  1XUQ A;  3ZS8 C;  3RT3 C;  1QR9 A;  1R6T A;  2OIE A;  4ZHQ A;  5CA1 A;  1IBM O;  3LDC A;  3C3T A;  2LP7 A;  1VQP V;  3EXA A;  5EBW C;  5KHG A;  4PEL A;  3TK1 A;  3H01 A;  3W7W A;  3GWO A;  2CUG A;  1IBL O;  5JQG B;  1FXK A;  1Q86 W;  2CTR A;  4B3S O;  3QO5 A;  1GN4 A;  2UUC O;  4I50 B;  3JAK B;  5B1O A;  4PDV A;  3CCL V;  1BZK A;  1FJG B;  1L1F A;  2GSM B;  3HKB B;  1JCH A;  1AR5 A;  3CCU V;  5JH7 B;  2F4V O;  1HNX B;  2Q73 A;  4TWK A;  1SS3 A;  3B4S A;  5E79 Z;  1Y74 A;  4UV8 A;  1RM1 B;  4LFC O;  4DV7 O;  2A9H A;  2AHZ A;  4LP8 A;  4MVM A;  3H9V A;  5LXT A;  3K5M A;  5KMG B;  4OXS A;  1V55 C;  4JI7 B;  5IYZ A;  5LP6 C;  4TQF A;  5AG2 A;  5CBF A;  5CA0 B;  4P9P A;  4DRX B;  5LP6 A;  1LNQ A;  4KXR A;  1D2D A;  3SR2 C;  1YIT V;  5B5E Z;  3JD1 A;  1PD3 A;  2WLL A;  4WFE A;  5KX5 B;  4UCS A;  5LOV A;  1HNW O;  2DYR C;  4FFB B;  1AIL A;  4O2A B;  3AG3 C;  4J7J A;  4L8J A;  5H6Q A;  2GTA A;  3FYE B;  2MW2 B;  4J41 A;  3JAR A;  3RYC B;  1HR0 O;  1BT8 A;  5GON B;  4PA6 A;  4B7E A;  5C8Y A;  1XNR O;  3IFX A;  5FL7 G;  2EIL C;  2V7Q G;  4CH5 A;  3R66 A;  4F4L A;  4BWA A;  4PA9 A;  2QKC A;  1H2S B;  1G6U A;  2F95 B;  2QR4 A;  1MMM A;  4DV5 B;  4JI6 B;  1QVF U;  3A0H Z;  1S72 V;  3JAT A;  4DR3 B;  2HEP A;  4DV2 O;  4LFA O;  1FAF A;  1Q5O A;  1P84 F;  1M56 B;  3G67 A;  1JA8 A;  1VAR A;  4UVB A;  4GLX A;  4I7Z B;  4LR3 A;  1KEC A;  1AR4 A;  3ABM B;  4LF4 B;  3F5W C;  2YIA A;  2QJ1 A;  3B8M A;  4KFM A;  5JQG A;  4JI8 B;  3CC7 V;  4CS3 A;  1M4U A;  4UCO A;  2P4K A;  5FNV B;  1KQS U;  1N4C A;  4L87 A;  5L3C A;  2Q8V A;  4WF9 V;  2ZKO A;  3W7S A;  1OCC B;  3HKB A;  3BVO A;  4CC6 A;  1R3K C;  4U3J A;  1KU9 A;  4DR2 O;  3SGI A;  4PDM A;  5JH7 A;  3CPW U;  1D5N A;  3EVK A;  3LUT B;  1KYO F;  2KSD A;  4X66 B;  4QNH B;  5LYJ B;  3D36 A;  1RM1 C;  1XNQ B;  4PA3 A;  1IVS A;  3BPZ A;  2EZP A;  2EIK B;  1XI1 A;  2PZS A;  4KL1 A;  2EJR A;  4H37 A;  2PYJ A;  2ITD C;  1XDC A;  2YUA A;  4ABM A;  1J5E O;  1MOF A;  3UQ8 A;  1VF7 A;  5IT9 N;  2YIC A;  5CA0 A;  4DRX A;  1XOU A;  2B1I A;  2PI4 A;  2E5L O;  4DR5 B;  4F6E A;  1VP7 A;  4UCU A;  4EFE A;  4DW0 A;  5H5N A;  3L70 H;  1NTZ H;  5BY1 A;  4AI8 A;  4FFB A;  4O2A A;  4U3F H;  1XEQ A;  1I94 O;  2XAQ A;  3AEI A;  2EIJ B;  1NKD A;  2LGQ A;  3ZMV A;  1FFT B;  2UXN A;  3SPG A;  5GON A;  5EIB D;  2JEX A;  1H2N A;  1SQB H;  2XAJ A;  4H33 A;  2IJI A;  4Q20 A;  5C93 A;  2JIZ G;  2D2C B;  2E76 B;  4K3A A;  4GUN A;  2XHB A;  1BMF G;  4CZZ A;  4X1Y B;  1K3E A;  1KBH A;  4UCT A;  1M56 C;  1M57 B;  5D5Q A;  1Y6X A;  4DR1 O;  4IT5 A;  5IY5 B;  4EEQ A;  2A06 H;  1BGY H;  3ABM C;  2H8P C;  4E2L A;  3UKM A;  1NT2 B;  2F1M A;  5TIS Z;  2P22 C;  1FD9 A;  3L75 H;  1Y67 A;  4U7O A;  4YIO A;  1R6K A;  2ADQ B;  3BA9 A;  4HNA B;  1N8R W;  1M5I A;  3FFQ A;  1MNG A;  1OCC C;  5FNV A;  1ZLZ A;  3HR0 A;  1SQF A;  4XDL A;  3ZHR A;  1IXM A;  2YXH A;  3VOU A;  1WN7 A;  1XHZ A;  4TQD A;  2W0F C;  4JI3 O;  3BRC A;  5LYJ A;  3T1Y O;  2EIK C;  4PD4 F;  1QBZ A;  3K06 A;  4R8C A;  3HPL C;  1XQ8 A;  3G4S V;  4IYI A;  5IYB O;  5CMU A;  4DUZ B;  4UB8 Z;  3CJH B;  3JCU Z;  5JCO C;  4BIO A;  2P67 A;  1GM7 A;  1H2M A;  5JCO A;  2FL4 A;  3K08 A;  2EZO A;  2VRZ A;  1NQT A;  3G71 V;  5F2V O;  3A2F A;  2HVJ C;  1KMI Z;  2DMX A;  4JTD B;  5IJ9 A;  3LNM B;  4LF5 O;  2K9P A;  1ZTE A;  5LHI A;  4DV1 O;  4LFB B;  2GHY A;  2EIJ C;  4Q6G A;  4LC1 A;  3B8N A;  1SQX H;  5J2T B;  2QWQ B;  1X4T A;  3H1I H;  2LW7 A;  2N05 A;  1GM8 A;  1S5J A;  2ZIM A;  1UFI A;  2ZCE A;  4KUM A;  4WFG A;  4P2Z A;  2X7R B;  4E4E A;  1L0N H;  5IYD O;  3K57 A;  5H9C A;  2Z3Y A;  3K9S A;  5CBG A;  2H94 A;  4WFA V;  3QO8 A;  2YDE A;  3OTO B;  1K92 A;  3H1H H;  5L3B A;  2OTL V;  4JI5 B;  4G27 B;  4X1Y A;  4J9Y B;  1IBK O;  1SER A;  5KHJ A;  1SRY A;  2RN9 A;  1M57 C;  1SF9 A;  4TV9 B;  3VQW A;  2OTJ V;  2ZXW B;  2HKO A;  4GX1 A;  3P30 A;  2YXL A;  5IY5 C;  3T1H O;  4RQE A;  4FFK A;  3ZMZ A;  2WAM A;  1S0V A;  5LL6 Y;  3FYI B;  1OCZ B;  3D3Q A;  3SYQ A;  4Z1M G;  2RQ6 A;  2XUM A;  1MSW D;  2YS8 A;  1ZL8 A;  1WNS A;  3CRC A;  3SDL A;  3HKE A;  1YF2 A;  1NBM G;  2AW9 A;  5FPR A;  2GV9 A;  4R6Z A;  5DED A;  2QKS A;  2UXD B;  2DYS B;  2N74 A;  1PNL A;  3B2E E;  4HNA A;  3CX5 F;  4JI4 B;  2CGN A;  1EN6 A;  2ZM6 O;  3E8G A;  1VQM V;  3H1K H;  3ABL B;  1X59 A;  4GKJ O;  1SES A;  3SPC A;  1WP8 A;  1EM1 A;  1L0L H;  3E35 A;  3QG5 A;  5KHH A;  1FXK B;  1LUV A;  4GX0 A;  4BW9 A;  2CK3 G;  1F23 A;  3SJA C;  4O4I B;  1AJQ A;  4A5U B;  2YI8 A;  2WSS G;  4QJF B;  3OM3 B;  3ETQ A;  4LWS B;  3RGB A;  4BIZ A;  3DSQ A;  3J80 N;  2N04 A;  4ZI7 A;  1YXB A;  3E8F A;  1XL4 A;  3G6E V;  3QF7 A;  3K58 A;  4X1K A;  3QNE A;  4GZR B;  1CP9 A;  3ZCC A;  1E1R G;  1F7Y A;  2NNU A;  3BY6 A;  3ASO B;  1NS1 A;  4WFF A;  2ZE5 A;  2B5U A;  3E22 A;  4YHH B;  2UUA B;  3J81 N;  2DQ3 A;  1D5A A;  1Y74 B;  4PV1 B;  5LGN A;  2ZE7 A;  2R70 A;  1RFY A;  3IJ4 A;  2JK5 C;  3SPI A;  3OAA G;  2GDS A;  4FLX A;  4OX9 B;  2QDO A;  2IH1 C;  1KKD A;  3APQ A;  4CC5 A;  3J7A U;  1N32 O;  2NLJ C;  4QE9 A;  2GTS A;  4J10 A;  4WCE V;  1M90 W;  5J2T A;  2DE0 X;  4DK1 A;  3PN1 A;  3ABT A;  1GTO A;  4JZ2 A;  2CDY A;  3M7M X;  1F4M A;  3K9A A;  1OZ0 A;  1S3J A;  4B7K A;  4DR4 B;  1B04 A;  3STL C;  2Z0A A;  2OIG A;  3T4Z A;  4B3M B;  1K4C C;  3A0R A;  2OYQ A;  1B06 A;  3T4D A;  1WB8 A;  2UXB B;  2ZXW C;  4QE7 A;  5C8Y B;  2E75 B;  4B3R B;  4TV9 A;  2UXX A;  5LBQ A;  2PGG A;  1WAZ A;  4UCR A;  1I5Y A;  4DV3 O;  5JVD A;  1JQ0 A;  5FPO A;  1OCZ C;  2LO1 A;  2R9I A;  1BHB A;  2OWO A;  3GWK C;  1XRE A;  4LF7 O;  3JD3 A;  3JD0 A;  1YVW A;  1WB7 A;  2Q5Z A;  2CE4 A;  5J9P C;  2DYS C;  3OEE G;  3N2G B;  5EIB C;  5JWP A;  1KC8 W;  1J95 A;  1Q6H A;  2Q7G A;  3ABK B;  1K5Q A;  2VQE O;  3ABL C;  4QPK A;  1RPR A;  4LF9 B;  1K9M W;  2QA4 V;  4DR6 O;  5LHH A;  1FXK C;  1FYJ A;  3RYF B;  2YXY A;  1FFX A;  2PYL A;  3CCE V;  2K1E A;  5A9G A;  4DO2 A;  1JJO A;  4NR1 A;  1Y76 B;  4FLT A;  4O4I A;  5KAF Z;  3BHP A;  3W7T A;  3E8H A;  5EK0 A;  1MG1 A;  4JYC A;  1PP9 H;  4DV0 O;  4LWS A;  5EZY A;  3VQY A;  3VQX A;  3EFF K;  4U3J B;  2DW4 A;  3ASO C;  3W7U A;  5D5P A;  3CC4 V;  1G4Y B;  4FPP A;  4UV9 A;  1N36 B;  2KG7 B;  1HDJ A;  2ZQM A;  3F7Y C;  4EB6 A;  2ZDI C;  1ZX3 A;  2Y0I A;  4MTO A;  1SA0 B;  4FVM A;  1H2G A;  1YTF D;  2ZNI A;  2RCV A;  2ZDI A;  4MSW C;  3CME V;  4EKW A;  2IJH A;  1VQ9 V;  2R9A A;  3ZN0 A;  4LNU B;  3SJB C;  3FB5 C;  3FB7 C;  1YJW V;  2ZIN A;  1I0H A;  1AJN A;  4XDK A;  2A79 B;  3AK1 A;  4JF3 A;  4JYB A;  3RW0 A;  2Q68 A;  4QIW F;  3K59 A;  4DV6 B;  3CB2 A;  5BMV B;  4DV2 B;  5A2Q N;  4MW3 A;  5B1B B;  4ZOL B;  4JI0 B;  1NTM H;  2UU9 O;  2BTO A;  2GBO A;  3BEH A;  5KHK A;  3CCR V;  3IC9 A;  1FXH A;  4XDJ A;  2L35 A;  1VQL V;  1CPY A;  2M6Y A;  2W6J G;  4IL6 Z;  4JYA B;  2CH7 A;  1FJG O;  4NTX A;  5JJE B;  5LMU B;  2CTP A;  3RWR D;  4TUY A;  4PDR A;  4UB6 Z;  4HZ3 A;  2IJK A;  1HNX O;  1SZT A;  3L71 H;  2KB1 A;  3L73 H;  1RP3 B;  3SPH A;  1ORQ C;  1WJZ A;  3U10 A;  1V54 B;  1FS0 G;  3IC7 A;  1U97 A;  2JJ2 G;  2LQT A;  1VF5 B;  1QVG U;  3ABK C;  2NR5 A;  4JI7 O;  3N2G A;  3JAL B;  1GO3 F;  2QWO B;  4TSF G;  3N27 A;  2JDI G;  4J7Z A;  3FB8 C;  3JD4 A;  3K03 A;  2JGD B;  1YDX A;  3K79 A;  3RYF A;  4K8X A;  1Q7Y W;  4CS2 A;  5IJ0 A;  1XIL A;  1PKX A;  1Y76 A;  4OPH A;  2A0L A;  4YXW G;  4RQF A;  2JRI A;  3CWB H;  1YJN V;  1TA8 A;  5L3E A;  1SQV H;  2FTK A;  3OMI B;  4DYL A;  2UXC B;  2W0X A;  1R3I C;  1XMQ O;  4I0X A;  2BOC C;  3TXS A;  3D36 C;  5LGT A;  1GN2 A;  1VQO V;  1DTO A;  2PY5 A;  2KG7 A;  3ETD A;  1NTK H;  2YID A;  4UVC A;  3ZRW A;  3ZBH A;  2ZE8 A;  1ROP A;  2Y4U A;  1SA0 A;  3CE2 A;  3MD0 A;  3STZ C;  3N2K B;  1QNM A;  4JI6 O;  2FKX A;  4R50 A;  3UM7 A;  4DR3 O;  1O9G A;  2OCH A;  5BR8 B;  1SQG A;  1JOY A;  1FPO A;  4LNU A;  1Q3E A;  1Q90 D;  1VQ8 V;  4X65 B;  1AI6 A;  1EBO A;  4QGP A;  3MDS A;  4X88 A;  1EN4 A;  4LF4 O;  4DW1 A;  1WLE A;  5IJ9 B;  3OEH G;  2BCC H;  3CHX A;  5EC1 C;  5B1B C;  5BMV A;  2P06 A;  2ARH A;  1R73 A;  2KKW A;  2XOK G;  5KUK A;  2AZ0 A;  1BE3 H;  1S5L Z;  1VF6 C;  2X0L A;  4RAI A;  1OCO B;  4JI8 O;  3P32 A;  4ZOL A;  2DWE C;  1OJH A;  1VF6 A;  2HHH B;  4JZG A;  2QE7 G;  2V4D A;  2L6L A;  4DUY B;  3OD4 A;  5J2U B;  2H3O A;  3TET A;  4D7S A;  1YTF B;  3WG7 B;  2Q69 A;  3DTU B;  1Q6I A;  1EZV H;  4GKK B;  1HNZ B;  2HR3 A;  2WWW A;  2HG5 C;  1OHH G;  1V54 C;  4ICG A;  4FLV A;  4X64 B;  5ITZ B;  1XNQ O;  3CRQ A;  1H2L A;  4YIP A;  4PA4 A;  3LSQ A;  1W59 A;  4AQY B;  4BIU A;  5IDJ A;  4K0K O;  5GW7 A;  3JAL A;  1VEW A;  1YHQ V;  4JAS A;  3AK2 A;  4MT8 A;  1DLB A;  1E79 G;  1PNK A;  3L74 H;  4DR5 O;  2JGD A;  1ZL8 B;  4WBN B;  3HKE B;  4X8A A;  2YIB A;  1YSC A;  2LFR A;  1NVP D;  2F23 A;  1AJP A;  3K5O A;  3OW2 U;  3AG2 B;  1BHA A;  4JAA A;  2ODM A;  2XAS A;  2A7W A;  5IE9 A;  4MTG A;  1N34 B;  1H38 A;  1T5E A;  3H1L H;  1AP5 A;  3JCZ A;  2Y48 A;  4TV8 B;  1PV0 A;  3RVY A;  2AZ2 A;  3O65 A;  4B3T B;  4WFB V;  3S3X A;  5LGU A;  2AXT Z;  5DEC A;  4NYK A;  1WA8 B;  4ZKI A;  4G28 B;  4FM2 A;  5CB4 B;  2LGW A;  3TXQ A;  1M9N A;  4F6R B;  5FLX N;  3E83 A;  3JSN A;  4ZI7 B;  2BE3 A;  1N33 B;  4X89 A;  4ASU G;  3U0Z A;  3N2K A;  4PJ0 Z;  4IHJ B;  2Q0O C;  2WA4 A;  4X1K B;  1YZB A;  2WLJ A;  2QSA A;  5BZB A;  1VQ4 V;  2RJZ A;  5LMN B;  4MW8 A;  3CSX A;  4O4J B;  3E22 B;  4D6T H;  2ZIO A;  2Y0P A;  2MK3 A;  3ICX A;  4DR7 B;  4UVA A;  3DGE A;  1BQZ A;  1BQ0 A;  3PJS K;  1OCO C;  3CCV V;  2IH3 C;  4UUJ C;  3OGI B;  4YJ2 B;  4AHC A;  1I7F A;  5HFL A;  3CXH F;  3GB7 C;  1M1K W;  2HLD G;  2WLI A;  4H0L B;  2BTQ B;  1XL6 A;  1IX9 A;  3E2E A;  1XMO B;  3E8B A;  5J2U A;  3WG7 C;  2QM4 A;  4KHP B;  1GM9 A;  2V1D A;  4PHZ A;  1CEZ A;  1K7D A;  1JFF A;  4N23 A;  4RWU A;  5ITZ A;  4N21 A;  1P7G A;  5K1X A;  3RYH B;  2EJ7 A;  1NU1 H;  4DUZ O;  3QO7 A;  3TJT A;  2OT5 A;  4OPA A;  5JVD B;  2XT9 A;  3SPJ A;  3JAM N;  5B66 Z;  4JI2 B;  3AG4 B;  4YY3 B;  4G2K A;  2ADP A;  4FLW A;  4X20 B;  1JR9 A;  1TVK B;  1K34 A;  4MVU A;  1SZX A;  1TAE A;  1EN5 A;  2GUZ B;  1P4R A;  4NXN B;  3RYI A;  1CXZ B;  2CGO A;  4WBN A;  2CTQ A;  3HB3 B;  3AG2 C;  4X62 B;  3CP1 A;  1PL0 A;  4LFB O;  4JV5 B;  2PF4 E;  4LF8 B;  4BR6 A;  3AG1 B;  2HVK C;  2PUS A;  1U96 A;  3CRA A;  3JD2 A;  3B09 A;  2DQ0 A;  3WB1 A;  2UUB B;  4TV8 A;  1FFX B;  1SQQ H;  3D8C A;  1BS3 A;  3CMA V;  2WLM A;  3ZHQ A;  4CH4 A;  2QEX V;  3CRM A;  1WA8 A;  4J9Z B;  3LDD A;  2HP8 A;  5CB4 A;  3OTO O;  2M7W A;  3CCS V;  3SYC A;  2P6J A;  4JI5 O;  3BA8 A;  3CXC U;  3T2M A;  4F6R A;  5EZY B;  1LUW A;  2LFS A;  1NJI W;  4IHJ A;  1R3L C;  4LF6 B;  3MHS C;  1YIJ V;  3HKD B;  4NXM B;  2FML A;  3FKS G;  1F51 A;  1OCR B;  1H8E G;  5B1A B;  4KP4 A;  5E1A C;  4EB6 B;  4O4J A;  1NVP B;  2WLN A;  5IWA B;  3G80 A;  3SJC C;  3ASN B;  1SQP H;  1K5S A;  4GX2 A;  1KB9 F;  1OV9 A;  4FZ1 A;  3WU2 Z;  1W0K G;  4YJ2 A;  5CBH A;  3JSL A;  1TUE B;  1V9P A;  4JAV A;  2JS3 A;  4IYH A;  2UXD O;  4NTW A;  2VQF O;  2OCC B;  5L3D A;  4JI4 O;  4CH3 A;  3WFV A;  2BTQ A;  3DXR B;  4HYO A;  4IIJ B;  4JTC B;  4JI1 B;  4LH6 A;  1BSM A;  1IBM B;  4I4T B;  3JYC A;  2EBO A;  1NH2 B;  2YIB D;  4J80 A;  1AI7 A;  4PDL A;  2CH7 B;  4CH6 A;  2FYU H;  2AHY A;  3APO A;  3NR7 A;  2QM8 A;  1IBL B;  3F5T A;  3RYH A;  3AG4 C;  4B3S B;  5EBM C;  4FM0 A;  2O57 A;  4TUY B;  4MVZ A;  1YCI A;  2UUC B;  1RSO B;  3SYA A;  4X20 A;  1QLE B;  4XBF A;  1TVK A;  2IBZ H;  4DV0 B;  1W2B U;  4YHH O;  2UUA O;  1S77 D;  1O9H A;  2GUZ A;  4OX9 O;  1UPG A;  4GYC B;  2F4V B;  3ABU A;  2QWR B;  4BW5 A;  3AG1 C;  1Y4M A;  4X1I B;  4YJ3 B;  1S76 D;  4B08 A;  3Q4H B;  3BCC H;  1Z2G A;  3CCQ V;  2QWP B;  4LFC B;  1K73 W;  4DV7 B;  1GAX A;  3HKC B;  2Q4P A;  2BOB C;  1QQC A;  3B77 A;  4HBN A;  1SC5 B;  5JJN B;  4DK0 A;  5IJ0 B;  1R6N A;  2DN9 A;  2F66 C;  3E86 A;  4DR4 O;  1COW G;  1UJW B;  4U7N A;  3KG2 A;  2EX3 A;  1ARO P;  4B3M O;  4DV4 O;  1GK9 A;  2UXB O;  3M8A A;  3WB0 A;  4ZBM A;  1HNW B;  1Z5V A;  4HAM A;  4I0X B;  4B3R O;  1OCR C;  2JGU A;  2PTM A;  2NN4 A;  5B1A C;  3HKD A;  2UU9 B;  4I9W A;  1VQK V;  2CTW A;  3KZI Z;  3ASN C;  3ZRW B;  1HR0 B;  4LBE C;  5EYP A;  4C7U A;  3A8T A;  3OTF A;  3M99 B;  3TGU H;  1DF4 A;  5DN6 G;  3CC2 V;  1GRJ A;  1XNR B;  4FJC C;  3UO3 A;  4UFZ A;  1Q81 W;  2XAG A;  3ETG A;  2OCC C;  3QVN A;  2P7T C;  4LF9 O;  3SYO A;  1IZ3 A;  3DXR A;  4IIJ A;  1US6 A;  4LFA B;  4RO2 A;  3LDE A; 
#chains in the Genus database with same CATH homology
 3P32 A;  1V55 B;  1QR8 A;  2DWE C;  2W6I G;  2QM7 A;  1GM8 A;  2QE7 G;  2PI5 A;  2Q67 A;  3ZMS A;  3K3W A;  2Q6A A;  2XAF A;  2WLL B;  3ZJZ A;  3CYO A;  1AI4 A;  4KUM A;  4WFG A;  4P2Z A;  2EIM C;  4CBC A;  2X7R B;  2ZD9 A;  1NR7 A;  2X6C A;  3OR6 C;  1AR1 B;  5IYD O;  3OMN B;  5H9C A;  2Z3Y A;  3OUF A;  3TET A;  1YTF B;  2DYR B;  3WG7 B;  1QLE C;  5CBG A;  2H94 A;  2Q69 A;  3AG3 B;  3DTU B;  1BL8 A;  4WFA V;  3QO8 A;  2HR3 A;  1K92 A;  5L3B A;  2WWW A;  2OTL V;  2HG5 C;  4G27 B;  1OHH G;  1V54 C;  4LCU C;  4J9Y B;  5IYC O;  1SER A;  4FMT A;  1K97 A;  1SRY A;  1M57 C;  3OFN G;  4PA4 A;  2ITC C;  3IGA C;  3LSQ A;  4JGS A;  2OTJ V;  2ZXW B;  2HKO A;  4BIU A;  5KA5 A;  4GX1 A;  3P30 A;  5IY5 C;  1JVM A;  3TCU A;  2ZR2 A;  5IDJ A;  4RQE A;  3ZMZ A;  2WAM A;  1S0V A;  5GW7 A;  5L3F A;  2EIL B;  1YHQ V;  3FYI B;  4JAS A;  1OCZ B;  1DF5 A;  2IW5 A;  4MT8 A;  1EFR G;  3I55 V;  1DLB A;  3SYQ A;  4Z1M G;  1E79 G;  1PNK A;  4FK5 C;  3ZN1 A;  1MSW D;  3ZMU A;  2YEV B;  4X8A A;  1ZWI C;  1YSC A;  2LFR A;  2R9R B;  1NVP D;  1NBM G;  1AJP A;  1AI5 A;  4R6Z A;  1QR9 A;  5CA3 A;  2WPD G;  1GKF A;  3OW2 U;  3AG2 B;  3LDC A;  2QKS A;  2DYS B;  2LP7 A;  1BHA A;  1JPX A;  1PNL A;  2XAS A;  1RPO A;  1VQP V;  3OE7 G;  4MTG A;  5EBW C;  1H38 A;  1PNM A;  3E8G A;  1VQM V;  4PEL A;  2HJF C;  3ABL B;  3JCZ A;  2Y48 A;  3TK1 A;  1SES A;  3ZMT A;  3SPC A;  3H01 A;  3RVY A;  3W7W A;  3E35 A;  2IJJ A;  3GWO A;  4PA7 A;  1FXK B;  1MAB G;  4WFB V;  1FXK A;  5LGU A;  1Q86 W;  2JEU A;  5L3G A;  4GX0 A;  3QO5 A;  2CK3 G;  1F23 A;  2DWD C;  1AJQ A;  4ZKI A;  2WSS G;  4G28 B;  4QJF B;  3OM3 B;  5B1O A;  1M9N A;  4PDV A;  3CCL V;  3E83 A;  3CCM V;  4BIZ A;  4X89 A;  3SYP A;  4ASU G;  3E8F A;  1L1F A;  2GSM B;  1XL4 A;  1F4N A;  1K33 A;  3G6E V;  4P9O A;  1JCH A;  3CCU V;  3QNE A;  3ETE A;  2WLJ A;  1VQ4 V;  5BZB A;  1CP9 A;  3ZCC A;  1E1R G;  2NNU A;  4MW8 A;  3BY6 A;  3ASO B;  3OMA B;  1KP2 A;  4WFF A;  4MVQ A;  2B5U A;  4TWK A;  2DQ3 A;  5DM6 V;  2MK3 A;  2ZR3 A;  5LGN A;  2JK5 C;  2QTO A;  4WFH A;  4UV8 A;  3SPI A;  5B3S B;  3OAA G;  1RM1 B;  4UVA A;  3DGE A;  2A9H A;  2AHZ A;  4LP8 A;  4MVM A;  2IH1 C;  3PJS K;  1KKD A;  1OCO C;  4OXS A;  3CCV V;  1K8A W;  1E1Q G;  1V55 C;  2IH3 C;  4UUJ C;  2NLJ C;  2IU0 A;  4QE9 A;  3K0G A;  4WCE V;  1M90 W;  5HFL A;  5CBF A;  1VQ6 V;  3GB7 C;  4P9P A;  1LNQ A;  4MVR A;  2WLI B;  1M1K W;  2HLD G;  1YIT V;  2WLK A;  2WLI A;  3JD1 A;  1PD3 A;  1YI2 V;  2WLL A;  1XL6 A;  4WFE A;  3ABT A;  3E2E A;  1GTO A;  3E8B A;  2DYR C;  3WG7 C;  1F4M A;  2C2A A;  3K9A A;  3AG3 C;  1OZ0 A;  4MS2 A;  1VQN V;  3K0D A;  1S3J A;  5H6Q A;  3STL C;  3FYE B;  1GM9 A;  2V1D A;  5EC2 C;  1CEZ A;  1K7D A;  4FIP C;  3T4Z A;  1QCE A;  1K4C C;  3A0R A;  3T4D A;  4N23 A;  2ZXW C;  4N21 A;  4QE7 A;  4JTA B;  4PA6 A;  3OR7 C;  5LBQ A;  2UXX A;  4GCZ A;  3QO7 A;  3X2Q B;  2OT5 A;  3IFX A;  4GT1 A;  5FL7 G;  5EBL C;  1S5H C;  1FXV A;  1I5Y A;  3SPJ A;  2EIL C;  2V7Q G;  3AG4 B;  1JQ0 A;  4G2K A;  1OCZ C;  4F4L A;  2R9I A;  3F7V C;  3OUS A;  4PA9 A;  1BHB A;  1K34 A;  3JD3 A;  4MVU A;  2XAH A;  3JD0 A;  1P4R A;  1QVF U;  1H8H G;  1THZ A;  2D3O W;  3VBB A;  1S72 V;  3CCJ V;  2YEV A;  3HB3 B;  1P7B A;  1R3J C;  3AG2 C;  5J9P C;  2DYS C;  1M56 B;  2ATK C;  3CP1 A;  3OEE G;  1PL0 A;  1KC8 W;  4DXW A;  4BAY A;  1J95 A;  3ABK B;  3RBZ A;  4UVB A;  3K04 A;  1K5Q A;  3AG1 B;  2HVK C;  2IU3 A;  4I5S A;  3ABL C;  4QPK A;  1KEC A;  3JD2 A;  3ZRV A;  1RPR A;  2YSU B;  4UXN A;  1K9M W;  5B1N A;  2DQ0 A;  3ABM B;  1W0J G;  2QA4 V;  5LHH A;  3F5W C;  1FXK C;  1VQ7 V;  1KP3 A;  4R7C A;  3I56 V;  2F43 G;  3CMA V;  3CCE V;  2K1E A;  3B8M A;  2WLM A;  4KFM A;  2QEX V;  3CC7 V;  4DO2 A;  2XND G;  3W7T A;  4J9Z B;  3E8H A;  5EK0 A;  1MG1 A;  3LDD A;  4JYC A;  2M7W A;  3CCS V;  3SYC A;  2P6J A;  3CXC U;  3T2M A;  1KQS U;  4L87 A;  5L3C A;  2LFS A;  4WF9 V;  1NJI W;  1R3L C;  3MHS C;  1NH2 D;  3W7S A;  3EFF K;  1OCC B;  1YIJ V;  1R3K C;  2DW4 A;  3ASO C;  3FKS G;  3W7U A;  4PDM A;  1F51 A;  1OCR B;  1G4Y B;  3CC4 V;  4FPP A;  3CPW U;  1H8E G;  4UV9 A;  5B1A B;  3LUT B;  4KP4 A;  5E1A C;  2ZQM A;  5CN0 A;  3F7Y C;  1NVP B;  2WLN A;  2ZDI C;  4QNH B;  3D36 A;  2Y69 B;  5B3S C;  1RM1 C;  4MTO A;  3ASN B;  4MTF A;  4P30 A;  1Q82 W;  1H2G A;  4PA3 A;  1YTF D;  2EZP A;  1YJ9 V;  2ZDI A;  2X6B A;  1K5S A;  2EIK B;  4GX2 A;  4MSW C;  3ML0 A;  3CME V;  4EKW A;  2IJH A;  1VQ9 V;  2EJR A;  1W0K G;  4H37 A;  2ITD C;  3ZN0 A;  3FB5 C;  3FB7 C;  1NR1 A;  5CBH A;  2WLH A;  2X6A A;  1TUE B;  1YJW V;  1MOF A;  4JAV A;  1AJN A;  4XDK A;  2A79 B;  5KA6 A;  4JF3 A;  4MVS A;  2OCC B;  2B1I A;  4JYB A;  5L3D A;  2PI4 A;  3RW0 A;  2Q68 A;  3E89 A;  4RUE A;  5KUM A;  4QIW F;  2EIN B;  3WFV A;  4HYO A;  4JTC B;  1JX9 A;  1Y66 A;  4MW3 A;  5B1B B;  3JYC A;  3BEH A;  2XAQ A;  2EBO A;  3AEI A;  2EIJ B;  1K4D C;  1NKD A;  3CCR V;  1NH2 B;  4TT3 G;  3ZMV A;  1FXH A;  4XDJ A;  1EZJ A;  1AI7 A;  4RUF A;  1VQL V;  1CPY A;  2W6J G;  1FFT B;  4PDL A;  2UXN A;  1WPX A;  1B6Q A;  2AHY A;  3SPG A;  3X2Q C;  2QM8 A;  2JEX A;  3AG4 C;  2XAJ A;  2EIM B;  4GX5 A;  3R65 A;  4H33 A;  5EBM C;  2B1G A;  4MVZ A;  2IJI A;  4Q20 A;  4JAU A;  3SYA A;  5C93 A;  4PDR A;  4MTX A;  1QLE B;  2JIZ G;  4XBF A;  4HZ3 A;  2IJK A;  1BMF G;  1SZT A;  4CZZ A;  1W2B U;  2KB1 A;  3SPH A;  1ORQ C;  1S77 D;  1K3E A;  5HFM A;  1V54 B;  1FS0 G;  3IC7 A;  1HWY A;  1M56 C;  1VQ5 V;  2P90 A;  1M57 B;  1KD1 W;  2JJ2 G;  3ABU A;  3W7X A;  3ABK C;  1QVG U;  4BW5 A;  1ENV A;  3AG1 C;  4QPJ A;  2Z5U A;  1Y4M A;  5IY5 B;  1GO3 F;  4TSF G;  3ABM C;  2JDI G;  2H8P C;  2JJ1 G;  1S76 D;  3FB8 C;  3MHH C;  3JD4 A;  3K03 A;  4E2L A;  3CCQ V;  3EHB B;  3ZRS A;  3UKM A;  1K73 W;  3K79 A;  3ZIA G;  2BOB C;  3B77 A;  3SJQ C;  1Q7Y W;  4U7O A;  1R6K A;  1R6N A;  1GMG A;  3E86 A;  1PKX A;  1COW G;  2A0L A;  1N8R W;  1UJW B;  4YXW G;  4RQF A;  4U7N A;  3KG2 A;  1ARO P;  3OGC C;  3RVZ A;  3NXS A;  1GK9 A;  1YJN V;  3ZRX A;  5L3E A;  1I5X A;  1OCC C;  4ZBM A;  2FTK A;  4HAM A;  3OMI B;  1QLN A;  1R3I C;  1OCR C;  2HFE C;  4XDL A;  2BOC C;  5B1A C;  1IXM A;  4I9W A;  3VOU A;  5LGT A;  2Y69 C;  1VQK V;  1VQO V;  1DTO A;  3ASN C;  2W0F C;  3ZRW B;  3ETD A;  4UVC A;  3CD6 V;  3ZRW A;  4LBE C;  2EIK C;  1ROP A;  1QBZ A;  3K06 A;  4R8C A;  3MD0 A;  3HPL C;  3STZ C;  3G4S V;  5IYB O;  3M99 B;  5CMU A;  1JJ2 U;  1DF4 A;  5DN6 G;  3CC2 V;  4LC1 A;  4FJC C;  4R50 A;  3UM7 A;  1G8M A;  1SET A;  2P67 A;  1Q81 W;  2XAG A;  3ETG A;  3FB6 C;  1JOY A;  1GM7 A;  1VQ8 V;  2OCC C;  3K08 A;  1AI6 A;  1EBO A;  5H6R A;  2EZO A;  5LHG A;  1NQT A;  3G71 V;  2P7T C;  2EIN C;  4MVO A;  4X88 A;  2HVJ C;  3T1C A;  3SYO A;  1WLE A;  3OEH G;  4JTD B;  4JPR A;  3LSS A;  5EC1 C;  5B1B C;  3LNM B;  2XOK G;  1R73 A;  5KUK A;  4RO2 A;  3LDE A;  5LHI A;  2X0L A;  4RAI A;  2GHY A;  2EIJ C;  1OCO B;  3D3I A;  3B8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...