1EZJA

Crystal structure of the multimerization domain of the phosphoprotein from sendai virus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
114
structure length
114
Chain Sequence
b'ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOCAPSID PHOSPHOPROTEIN
molecule tags Viral protein, transferase
source organism Sendai virus (strain harris)
publication title Tetrameric coiled coil domain of Sendai virus phosphoprotein.
pubmed doi rcsb
total genus 47
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.320 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA01
1.10.287.340 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA02
1EZJA
chains in the Genus database with same CATH superfamily
3ASNB 5H2FZ 1VQ7V 4JYAB 4ZI7A 3SYQA 1AR5A 3CXCU 2E5LO 2WAMA 2UXBB 2XNDG 3G71V 2QGNA 3JAMN 3QF7A 1MNGA 3T1YO 4OX9O 1OCCB 1P4RA 3B77A 3KZIZ 3SYOA 2OYQA 1AJNA 1WJZA 1KMIZ 4X64O 4YIOA 1SZTA 1EZJA 1K34A 1GN6A 2GTSA 2X6CA 5K1PA 3QO5A 1SQQH 4FLXA 2Y4TA 1BT8A 4B3MB 3K5NA 4Q20A 4R7CA 5C8YB 3UCSC 3RBZA 2Q8VA 4R50A 1AI4A 4DV0B 1JR9A 1XNRB 4KFMA 5EBMC 1OCRB 5FPOA 4I55A 2ZM6B 2QR4A 4Z2WA 3AG1C 3BFRA 4MVQA 1T5EA 3ABLB 1YDXA 4LF8O 1K73W 4DRXB 3FB8C 1NJIW 4DR4O 1PKXA 2ZNJA 3RFRA 4DV1B 2HJFC 3HKDB 5H5NA 3K59A 4IHJA 5EYPA 2QKAA 1K3EA 3M99B 2B1IA 3O9OA 3ZHRA 2HHHB 2Z5UA 1OCCC 1RPRA 5C8YA 5LMUB 1DF4A 4PDVA 2ZXWC 4KP4A 1K5QA 4MVSA 4J10A 4CH4A 1X4TA 2A0LA 1IX9A 5J2TA 3X2QC 1XMQO 3DSQA 2OIGA 1E1RG 1YIJV 1GM7A 5GW7A 3F7YC 3LDDA 2R9IA 3AG7A 3WG7B 5IY5C 1MZEA 4K35A 3G67A 1VIBA 5CB4A 3AK1A 4DR6B 3JARA 5FL7G 3KG2A 4GKKO 4CZZA 3ZN1A 2ITCC 4LF4B 3WB2A 4FLYA 3BVOA 1VEWA 3OTOO 2OCCC 3ETQA 4LH6A 1K92A 3JSLA 3T1HO 4X65B 4KHPB 3OE7G 1IBMB 3RYIA 3UT5B 1NTMH 5IYZA 3K9AA 3VBBA 3FB5C 3D3QA 4CC6A 1Y74A 4RQFA 1KB9F 2OIEA 3LDCA 3OM3B 2HEPA 5IT9N 5BY1A 2XHBA 2IJKA 5L3CA 2PGGA 2KKWA 3OTFA 3OGIB 5KX5B 5JJEB 4X65O 4R6ZA 3ZRWA 4B3SB 1QCEA 2ZE5A 2IH1C 1L0NH 3IFXA 1Q5OA 3MDSA 1XMOB 1S5JA 4U3JB 4YIPA 2RMKB 1NQTA 4DR3B 2P6JA 1DLBA 1I94B 4I50B 1GMGA 2E3CA 1FD9A 4H44B 4AILC 2M6YA 3B09A 2LW1A 4JZ2A 2BSKA 1N0JA 1CP9A 1YHQV 1N33O 4OGQB 3LSSA 1Q6UA 1VMGA 5IYBO 3E8FA 2BTQB 4LF6B 3CRRA 1QVGU 4PHZA 4ZOLB 3ASOC 3RYHB 1F51A 3OMAB 2P67A 3N2KB 2YC0A 2FYUH 5L3GA 4YJ3A 1XDCA 1Y76A 1PNLA 3B8MA 4J7JA 3ZRXA 4DV6B 3C90A 4U3JA 1K5SA 3GVMA 4DR1O 1FFXA 3W7TA 2QWQB 4LCUC 4BR6A 1QU7A 1N32O 1KC8W 1BHBA 1PNMA 5L3EA 3K0DA 4JAVA 3K5OA 5LHIA 1BZKA 3RT3C 4EFBA 4DV5O 4MT8A 3ZHSA 4FLWA 3FYIB 3T4ZA 1BCCH 4I0XA 3U10A 2DYSC 3GWKC 2WLIA 5LMNO 4JI5O 5GONA 4FJCC 3UQ8A 3HKDA 5LP6C 4BW9A 1RSOA 1IBMO 1Q43A 1IBKO 4IL6Z 2BTOA 5KUKA 3LNMB 2VWJA 4LF6O 1EFRG 5B1BC 4MVOA 1FPOA 3T2MA 1G6UA 3JCZA 5CB4B 1Y6XA 5LBQA 1NTZH 4GKJO 5LHHA 3SDLA 4QGPA 1I94O 5C93A 3ASOB 1VQOV 3SJCC 3WB0A 4OPHA 3OEEG 1NU1H 2N05A 4NTWA 4X88A 3UM7A 1Y76B 4RWUA 3IC7A 3M8AA 4HBNA 1VF6C 5B1OA 3E22B 1YJWV 5B66Z 2EIMC 2YXHA 4DV5B 4TUYB 3E83A 3J7AU 5EYPB 1M5IA 4NYKA 2YEVA 1OJHA 4X8AA 4LFBO 1YF2A 4DV6O 3ZRWB 4F4LA 4DUZO 2RNBA 1D2DA 1MG1A 1H8EG 2JIZG 4CH3A 2WLLA 1F4NA 1E79G 2Q0AA 3K5LA 1KQSU 4J80A 1OV9A 2Q5ZA 2ZXWB 4P9OA 5IWAB 2ITDC 5LP6B 4UV9A 5KHHA 4RAIA 3JARB 2LP7A 2W0XA 4DK1A 2DYRB 1O9HA 2Y0IA 3F7VC 3FAVB 2P4KA 1M1KW 3LSUA 3EFFK 2WLIB 1GM9A 4DV2B 4LF5B 3RYHA 3CWBH 4LP8A 5IJ0B 4OXSA 2GDSA 4NXNB 2XASA 3KCXA 4K8XA 1F4MA 1TVKB 3TXQA 4RQEA 2HVKC 1IBLB 1HNXO 3N2GB 1JOYA 4JI6O 3JD1A 2OWOA 2JJ1G 1G1XB 1N0NA 4AQYO 2JRIA 3QO8A 4B3TB 4X1KB 3H1IH 2VWKA 3E2EA 3A2FA 2PTMA 1W59A 1CPYA 3APOA 4JI1O 1CEZA 4PI2A 4B3RO 1QBZA 3B4SA 1GM8A 3K06A 4JI3B 4RUFA 3WU2Z 1XQ8A 3ZX6A 4GYCB 3CCRV 2YUAA 2QE7G 2QWNB 4LFAB 3DC6A 4CC5A 4WFGA 3CP1A 1VF7A 3SGIA 2YIDA 1Q6HA 4LF7O 2UXDB 2OCHA 2NLJC 5JJNB 4JZGA 1HR0B 4IYHA 4ICGA 2CE4A 2DQ0A 2QKCA 5B5EZ 3IAYA 1OCOB 1KECA 1VQLV 3JAWB 4IGGA 2JJ2G 2ZQMA 2PZSA 1NS1A 5EC2C 3ZEDA 2ZR3A 2XT9A 2R9RB 2QKSA 2WPDG 2IM9A 5CA3A 1AP6A 4TT3G 2GSMB 4DR4B 3FD9A 4FIPC 2H8PC 1XMOO 1EBOA 2A3QA 4DR7B 2DYSB 3BEHA 3MD0A 1PV0A 2EIKC 1XNQO 2PF4E 3SR2C 3G6BA 2EULA 1AB3A 1I5YA 5ITZA 1MSWD 4LC1A 5KUMA 3SJBC 1EN5A 4X1IB 3APQA 3THOA 1J95A 1R3KC 4FFKA 1R6NA 3TJTA 4J42A 1H8HG 4QE7A 1FJGB 2Q69A 5KA5A 4JI8B 4I0XB 3BHPA 1BHAA 1XL6A 1ZAUA 1GKFA 2RN9A 4HNAA 4MTGA 1HW7A 1U96A 4TV9B 1VF5B 2P7TC 4JF3A 2GUZA 2A7WA 5H6RA 4WFFA 4DR5B 3M7MX 5JQGA 5B1AB 3CCLV 1M56C 1NTKH 3OAAG 4JAUA 1PL0A 2VQFO 2EIMB 2XUMA 4I9WA 4FLZA 5ITZB 1KKDA 4PDMA 4JI0B 3ABMC 1AR4A 1Z5WA 4TSFG 3QVNA 4XDJA 2UXDO 4DK0A 5KMGB 2QM8A 2EZPA 3TETA 2CTPA 4LR3A 3L9DA 2ADPA 1HNWO 3E35A 3OR7C 2HP8A 1NH2B 3SYAA 4TQDA 1WP8A 2W6JG 3ZS8C 1H2KA 4JTAB 1K97A 1OCZB 4B3SO 4QPKA 1Q86W 4WF9V 4QJFB 3SJQC 4ABMA 4L8JA 5LXTA 4DR1B 2LJ2A 3HKBB 3CC7V 2NN4A 1NR7A 3AK3A 1WNSA 4D6TH 3N2GA 2EIJC 1COWG 1PP9H 4LNUA 3R66A 4B7KA 3ETGA 4LF8B 2AW9A 3K03A 4NTXA 4DV1O 1XHXA 3ZRSA 1QLNA 3HKEA 2CTRA 2DOSA 4AQYB 5J2UB 2Q7EA 4PI0A 3CCSV 1GN3A 4KUMA 4GKJB 1H2LA 3HKBA 3BCCH 3P32A 3JCUZ 2CGNA 2WLNA 5B1NA 1PNKA 4JYBA 2ZE7A 3SPCA 1KP3A 1WP7A 3NXSA 2UUAO 2RJZA 1GH6A 4UVCA 1YITV 4LFAO 4X66B 5EZYB 5KHIA 3W7UA 2EINC 2ZKOA 4DV7O 1IURA 2H3OA 2MK3A 4KXRA 4I55B 1Q90D 4IIJA 1I7FA 4JYYA 2FL4A 1JJOA 4NVPA 5B1BB 5LA6B 3RW0A 4O2AA 2F4VB 4HNAB 1IZ3A 2Q7GA 3A0BZ 2CDYA 1L0LH 3CCQV 4I7ZB 4J11A 2Y69B 4PELA 5LOVA 3CCVV 4BIUA 1VQ5V 1W0JG 1S0VA 1V54B 2CAZC 2Y4UA 2CH7B 4EB6A 2QEXV 1FXKA 4QNHB 4X1KA 3CRAA 2QM7A 1SESA 3P30A 3CHXA 3JALA 3ABLC 3L75H 1J5EB 3AG1B 1AI5A 4X89A 1YZBA 3LNNA 1SC5B 3HKCA 2CGOA 1Q8IA 5LGTA 1QQCA 3OEHG 4LF9O 1SQBH 1EM1A 2YICA 1W2BU 3CPWU 2WLJA 3JD0A 3FAVA 3JATA 4HZ3A 3FYEB 5LMNB 5KHJA 1BL8A 1SQXH 1AJQA 2XTAA 2IJHA 2XAHA 4YJ3B 1JX9A 2Y0PA 2F95B 4DV3O 4D7TA 1FXKB 4D7SA 1N33B 4MVZA 3B8NA 4JGSA 4ZBMA 3CS5A 1AILA 3AG4B 3BA8A 4B3MO 2A79B 1LUWA 4LFCB 4O4LA 4Q6GA 3DXRB 1YJNV 2K1EA 4PV1B 2W0FC 1MA1A 3BA9A 3FX7A 2UXCB 1YJ9V 5JQGB 4CS3A 2YS8A 2Z3YA 2G38A 1GN4A 4QE9A 4AHCA 3CXHF 1YTFD 1SQFA 1WN7A 4Z1VA 4WFBV 4TV9A 1THZA 2ZDIC 5AG2A 1AP5A 5FLXN 4JV5B 4F6RA 4U3FH 4U7NA 1YSCA 4YHHO 3CB2A 4FZ1A 1GTOA 2UUCO 4DYLA 5CN0A 2YSUB 1RSOB 1WB7A 3ZMVA 4DV4O 3D36C 2RCVA 1SQVH 2B5UA 4NXMO 4O4IA 2WWWA 4TWKA 4J7KA 5LYJB 5JWPA 4DR5O 4JV5O 4ZHQB 3CEIA 4JTDB 3K57A 3H1HH 3OTOB 2HR3A 1K9MW 1LUVA 1IBKB 2EIKB 1FXHA 2GHYA 2KG7B 5D5PA 1H2SB 3QNEA 1R1BA 2KQXA 4HAMA 1NVPD 1FFXB 1KU9A 2AXTZ 3RWRD 1NI8A 2IJJA 2VQEO 4O4JA 2DW4A 3PN1A 1BSMA 5JVDB 1P7BA 4O2AB 1RM1B 3UKMA 1S76D 4MW3A 4XDLA 4MVUA 1JFFA 1GRJA 2OTLV 4MTFA 3CCJV 3N2KA 1SA0A 1IXBA 4DV3B 5JH7B 2PI4A 2EILB 2EINB 5CA0A 4PA3A 1KUQA 5EIBD 4FK5C 1YVWA 5B3SC 2BSKB 2XOKG 2P5OA 1FAFA 2E74B 1NKDA 1S77D 4JI5B 2VQEB 5J9PC 1PM9A 2XAFA 4PA9A 1FJGO 3WB1A 3W7XA 3D36A 2EJRA 2JGDB 1EN6A 1WAZA 1XMQB 2UUAB 2F23A 4UCRA 1QVFU 4DR3O 3JATB 2IBZH 4DW1A 4TQFA 2V4DA 2P22C 3JASB 2V1DA 5EC1C 1IBLO 1OCOC 4QIWF 2JS3A 3BY6A 2UXBO 4NXMB 1ZLZA 4X1IA 4X1YA 4AI8A 5JH7A 4JI2B 4DV4B 1Q82W 4MS2A 2ZT9B 2CK3G 3QG5A 1MSDA 4ZKIA 4B3RB 1SERA 2Q0OC 4FFBB 2AZ0A 4W4LA 1V9PA 1VQMV 4UV8A 3KCYA 5A2QN 1XUQA 1VQPV 4B7EA 2JGDA 4JI6B 2D2CB 5LYJA 1ROPA 2OT5A 1RP3B 3IGAC 1VP7A 1FYJA 4JI4O 2ZR2A 3HR0A 4DUYB 2ZNIA 1BS3A 2A06H 2JGUA 3D3IA 3DXRA 4GT1A 2ZCEA 2PUSA 2IU3A 2N04A 3C3SA 1UPGA 2X0LA 1G4YB 5TISZ 1URFA 2AHZA 2V7QG 4DV0O 5E1AC 3BRCA 4X9QA 4ZI7B 2L6LA 2UUBB 1VQ9V 1N4CA 5BXZA 1H2NA 2JEXA 1ZTEA 4I9QA 4FFBA 4XBFA 1CXZB 3K9SA 3H9VA 4FLUA 1AJPA 4ASUG 1L1FA 3E89A 4G27B 2IJIA 1SA0B 3OMNB 2VRZA 2JVDA 1B6QA 1MZFA 4CBCA 3JD3A 4DO2A 4H0LB 4WFEA 3R65A 3SPJA 2YIBA 1DK1A 1JJ2U 4JASA 2EBOA 1F23A 4P9PA 3K3WA 2WLHA 5J2UA 1K4DC 3QTCA 5IYZB 1NBMG 3OR6C 2B9ZA 1E1QG 1SQPH 1XNQB 4H37A 1XILA 4DR7O 1WA8B 1DF5A 4BAYA 3ZJZA 1GK9A 2ADQB 1R6TA 1HDJA 2LQTA 4EFEA 3OUSA 1WB8A 3K79A 3W7WA 4GKKB 1L8DA 2ODMA 3CC4V 1TUBB 4F6RB 1LNQA 3HKEB 2ZE8A 1D5AA 3AG2B 1BE3H 3ABMB 3STLC 1QR8A 1VARA 1SQGA 4WFHA 3EHBB 2QM4A 3OFNG 4O2BA 3ZCCA 4W4KA 4UFZA 4FM0A 3I55V 3OW2U 3ZHTA 2PYLA 3CD6V 4GX5A 4MTXA 1VQ8V 4DR2O 2PY5A 2ATKC 3QO7A 3U0ZA 4K0KB 2GBOA 2Q4PA 1Q81W 5IJ9B 4JI0O 1QLEB 1WPBA 5HFMA 4DW0A 5JCOC 4FM2A 2R70A 3FKSG 4WBNA 3G6EV 3O65A 3CE2A 4I4TB 1PPJH 4FZ0A 1Q6IA 4ZOLA 3CC2V 1KKCA 3K0GA 4O4LB 2ZIOA 4BIOA 2QTSA 1H2GA 1UFIA 1FS0G 4MVRA 1B04A 3JALB 5LGUA 2QA4V 4CS2A 3P3PA 1KBHA 3E8GA 4E2LA 2A9HA 4PD4F 3RYFA 3TGUH 3T1CA 2BE3A 4NXNO 1ENVA 4LBEC 2VQFB 4LFCO 1V54C 4GUNA 4B08A 4UVAA 4FLTA 2UU9B 4LH7A 4IHJB 2D3OW 4MSWC 2L35A 2QWOB 1XL4A 4MVMA 5KAFZ 2NR5A 1IDSA 2WLMA 2W6IG 3JSNA 3CRMA 3HKCB 4GZRB 5FPRA 2UXNA 2YIAA 1QLEC 5IYCO 1TVKA 1R3LC 1OCZC 1OHHG 3N27A 5IDJA 2DWDC 1IXMA 3FFQA 5DN6G 3K5MA 4TV8B 5B3SB 4R8CA 4TUYA 4LF9B 3WFVA 2LW7A 3BPZA 4Z1MG 4H33A 3MHHC 5JCOA 3A0RA 4HYOA 4JPRA 2GUZB 1ZL8A 4RUEA 4YY3O 2FMLA 3ZRVA 5BMVA 2IU0A 4G28B 1ZWIC 5EK0A 1K7DA 4FLVA 5JVDA 5L3DA 3I5DA 1K4CC 1RPOA 1Y66A 4O4HB 1H2MA 1FFTB 2Q67A 3CCEV 1M56B 1SKVA 5B1AC 1P7GA 1KYOF 3EVKA 4X20A 1PL4A 4CH5A 1YTFB 2LFRA 5J2TB 4LWSB 1ZX3A 5H9CA 3ZBHA 4PA4A 3IJ4A 3CMEV 1BQ0A 4DR2B 1JPXA 1Y4MA 1N34O 1QR9A 1A32A 1LR1A 5IWAO 3CYOA 3STZC 3X2QB 2YDEA 1QNMA 4C7UA 3H1LH 5FNVB 3NR7A 5BMVB 2O57A 2DYRC 1YI2V 2F43G 4JYCA 4JAAA 3FB6C 4JI7B 1GAXA 4WFAV 4NKGB 2KG7A 5GTIZ 2ZDIA 2E76B 1N36B 1H38A 2P90A 1S3JA 1P84F 3CSXA 2YXLA 3VQWA 1DGSA 3GWOA 3K04A 1WA8A 2X7RB 4IT5A 5FNVA 4O4HA 2QSAA 4UCOA 3RYCA 1GN2A 4YHHB 3RVYA 4I5SA 1BMFG 5LP6A 1JMKC 4LFBB 2H94A 3CJHB 3JD2A 4JI7O 5LXTB 2AHYA 1MOFA 3L71H 2JEUA 1AVMA 1NT2B 1US6A 3ABKB 4RO2A 3T1HB 4UB6Z 5LMUO 5F2VO 1B3QA 5GTHZ 2F4VO 3LDEA 2AZ2A 3MAQA 2HFEC 4L87A 3DC5A 2ARHA 3P3NA 4A5UB 2JDIG 3VOUA 3UO2A 3OGCC 4J9YB 1S5LZ 1YEWA 4BIZA 3AG4C 3ZHVA 4J9ZB 1R3IC 2GV9A 4UCUA 3G80A 4P2ZA 4DXWA 2DJVA 3KKYA 1FXKC 1HNZB 1M57C 4IIJB 1K33A 3CRQA 3IC9A 3SPIA 1HR0O 4TV8A 3ML0A 4EEQA 3C3TA 1TUBA 1NZ6A 2ZIMA 2EX3A 3J81N 2C2AA 4O2BB 3B2EE 3AG2C 1VQNV 3L70H 5KLVH 2VS0A 1M9NA 5DECA 5L3BA 4DV2O 3RYFB 2CUGA 1HP8A 2X6BA 1RM1C 2QTOA 1G8MA 3ABKC 1XI1A 3E86A 5LL6Y 3ABUA 1Y67A 3ZIAG 4J7ZA 5DM6V 1AR1B 3A0HZ 4MTOA 3JD4A 4X62B 2HKOA 2Q73A 3S3WA 3JYCA 1TA8A 1SF9A 1S72V 1ZSPA 5CMUA 4LNUB 4GX1A 2F93B 1VQ6V 2FTKA 2WLLB 3JASA 2WSSG 4GX0A 3DTUB 3ZHUA 2Z0AA 4UVBA 1XOUA 2BCCH 3JAKA 2Q9LA 4DUZB 3LSQA 1BQZA 3E22A 3AK2A 1U97A 3ETDA 3F5TA 4PA6A 4UXNA 2WA3A 4ZIBA 3VQVA 4B3TO 1AI7A 5IJ0A 2F66C 3K58A 4OPAA 3JAWA 3Q4HA 5CA1B 2CTQA 4ZHQA 3F5WC 5A9GA 1XNRO 1B06A 1F7YA 4KHPO 5EZYA 2ZM6O 1MABG 1Z2GA 2HVJC 5CA0B 3H1JH 4FVMA 1M4UA 1TUEB 5KHKA 5IY5B 4UUJC 1N34B 1IVSA 5BZBA 1O9GA 4J41A 2DWEC 2F1MA 4X1YB 3ZMUA 2WA4A 3BABA 3W7SA 3E8BA 1NR1A 3D8CA 4UB8Z 2X6AA 5EBLC 1EN4A 4DUYO 1M93A 4JI1B 1WPXA 5LHGA 1N36O 3JAKB 5L3FA 4JI3O 3L73H 4PJ0Z 2YXYA 3T4DA 1M90W 1TAEA 1X59A 1V55B 2YI9A 3U11A 3T1YB 5CBHA 4OX9B 3PJSK 3ETEA 4KL1A 1NVPB 3ZHQA 3SJAC 1EZVH 2UXCO 4EKWA 2UU9O 1HNWB 5JJJB 1JFFB 3FB7C 1ZUQA 3L74H 1HNXB 3OMIB 3G4SV 1WLEA 2Y48A 3SPHA 3RVZA 4F6EA 5EBWC 3MHSC 4FPPA 1JQ0A 1QHTA 5GONB 2DN9A 5KX5A 1S5HC 2EZOA 1DTOA 3SPGA 5EIBC 4YXWG 2PI5A 3ABTA 4NTYA 2UUBO 1J5EO 2LGWA 4MW8A 4H13B 2JS5A 2YEVB 1SRYA 4DV7B 1XREA 4YJ2B 3HPLC 5IE9A 5H6QA 2ZINA 2KSDA 2ZE6A 3TCUA 3RYCB 2DQ3A 4U7OA 3WG7C 3ICXA 1VQ4V 2BOBC 3HB3B 1ORQC 4BWAA 2BTQA 2UUCB 1ZL8B 2N74A 3ASNC 2LFSA 3AG3C 4O4JB 4EB6B 1JA8A 1I08A 1Z5VA 3E8HA 3K08A 2OTJV 4N23A 3Q4HB 1R6KA 4PDRA 5CA1A 4NR1A 3S3XA 2HHHO 1P49A 1AI6A 2RQ6A 2Q7HA 3TK1A 4N21A 2QWRB 4GCZA 4QPJA 3TXSA 4CH6A 1K8AW 4JI2O 1HWYA 4UCVA 2FKXA 2BOCC 2Q6AA 2Q68A 1JVMA 3LUTB 2QDOA 2NNUA 3BAAA 2QJ1A 1XBLA 1JCHA 1OZ0A 3AEIA 2P4VA 5BR8B 3ZN0A 2ETNA 2DMXA 2HJDA 1YXBA 2EJ7A 5IYDO 4I50A 4DR6O 4BW5A 2Y69C 3ZMSA 4X66O 3RYIB 3UT5A 3VQXA 3ZMTA 1FXVA 2R9AA 3SYPA 1KP2A 3VQYA 5CBFA 4TOIA 3AG3B 2RDCA 1NH2D 4K0KO 4FMTA 2ILMA 1N8RW 2M7WA 2B1GA 5CBGA 2CH7A 1R73A 5KAIZ 1MMMA 3CMAV 3CCMV 3UO3A 1D5NA 3RN4A 4PA7A 4LF7B 1M57B 2QWPB 1V55C 2KB1A 4JYAO 1BGYH 1RFYA 1TGOA 2EILC 5K1XA 2E5LB 1HNZO 5HFLA 1KD1W 4GLXA 2XAQA 3B40A 4G2KA 5DEDA 3OT7A 2HLDG 3CRCA 1I0HA 4X64B 2HG5C 1AROP 2OCCB 1SS3A 3I56V 3GB7C 1Q3EA 2YIBD 2GTAA 1SETA 4JTCB 3RGBA 4GX2A 2IW5A 4LWSA 1YCIA 1PD3A 2AGAA 2YI8A 5KMGA 2E75B 2XAGA 2P06A 4X62O 3EXAA 4NB5A 4CS4A 5LGNA 1Y74B 2EIJB 3DGEA 2JK5C 2WLKA 4O4IB 1VF6A 4UCSA 4XDKA 1UJWB 2FB5A 3CCUV 4YY3B 4WCEV 4LF4O 4PDLA 2XAJA 3L72H 3H01A 2ZD9A 3SYCA 5LOVB 4LF5O 4P30A 2R72A 1R3JC 3A8TA 4E4EA 3CX5F 2MW2B 1XHZA 2K9PA 2DE0X 5KHGA 4I4TA 1I5XA 3OUFA 1GO3F 3OD4A 4K3AA 3H1KH 4JI4B 5D5QA 2UXXA 4DRXA 5IJ9A 1XEQA 5BR8O 5KA6A 4IYIA 1VQKV 1Q7YW 2LGQA 1SZXA 1W0KG 2LO1A 5E79Z 3J80N 1FKAO 1N32B 1OCRC 2PYJA 4WBNB 4JI8O 2IH3C 4FM1A 4X20B 5LA6A 2CTWA 4UCTA 4K8ZA 3ZMZA 3CJHA 4YJ2A
chains in the Genus database with same CATH topology
1CPYA 3ASNB 2HFEC 4L87A 1VQ7V 2OTLV 4MTFA 3CCJV 1CEZA 3SYQA 1QBZA 1GM8A 2JDIG 3VOUA 3CXCU 2WAMA 3K06A 4RUFA 3OGCC 4J9YB 2XNDG 3G71V 2PI4A 4BIZA 2EILB 3AG4C 4J9ZB 2EINB 1R3IC 1OCCB 1P4RA 4PA3A 4P2ZA 4DXWA 4FK5C 3B77A 3CCRV 3SYOA 1FXKC 1M57C 5B3SC 1K33A 2XOKG 2QE7G 1NKDA 3SPIA 1AJNA 4WFGA 3CP1A 1S77D 3ML0A 1SZTA 5J9PC 1EZJA 1K34A 2XAFA 2C2AA 2X6CA 2NLJC 3QO5A 3AG2C 4PA9A 1VQNV 3W7XA 4Q20A 4R7CA 3D36A 2EJRA 1M9NA 2DQ0A 5L3BA 1OCOB 1KECA 1VQLV 3RBZA 2JJ2G 2ZQMA 1QVFU 2X6BA 5EC2C 1RM1C 3ABKC 2QTOA 2ZR3A 1G8MA 3E86A 3ABUA 4R50A 2R9RB 2QKSA 1AI4A 2WPDG 4KFMA 5EBMC 3ZIAG 5CA3A 1OCRB 4TT3G 2GSMB 2V1DA 5DM6V 1AR1B 4FIPC 4MTOA 5EC1C 2H8PC 1OCOC 4QIWF 3JD4A 3BY6A 1EBOA 3AG1C 4MVQA 2HKOA 3ABLB 2DYSB 3BEHA 3MD0A 1K73W 2EIKC 3FB8C 3JYCA 1NJIW 1S72V 1PKXA 4MS2A 1Q82W 5CMUA 2CK3G 4GX1A 1VQ6V 1I5YA 2FTKA 2HJFC 2WLLB 4ZKIA 2WSSG 1SERA 4GX0A 1MSWD 3DTUB 1VQMV 4LC1A 5KUMA 1K3EA 3M99B 4UV8A 2B1IA 4UVBA 1J95A 1VQPV 2Z5UA 1OCCC 1R3KC 1RPRA 1R6NA 1DF4A 4PDVA 3LSQA 1H8HG 4QE7A 2ZXWC 2Q69A 4KP4A 5KA5A 1K5QA 3ETDA 4MVSA 1BHAA 1ROPA 1XL6A 2OT5A 4PA6A 4UXNA 3IGAC 2A0LA 1GKFA 3ZMZA 3X2QC 1AI7A 2ZR2A 1E1RG 4MTGA 1YIJV 3F5WC 3D3IA 1GM7A 4GT1A 3F7YC 3LDDA 5GW7A 2R9IA 2P7TC 3WG7B 1MABG 4JF3A 2HVJC 5IY5C 2IU3A 2X0LA 5H6RA 4WFFA 1TUEB 5IY5B 5FL7G 3KG2A 1G4YB 5B1AB 4CZZA 4UUJC 3CCLV 2AHZA 3ZN1A 2ITCC 1M56C 2V7QG 3OAAG 5E1AC 4JAUA 5BZBA 1PL0A 2DWEC 3ZMUA 2EIMB 2OCCC 3W7SA 4I9WA 1K92A 1VQ9V 3E8BA 1NR1A 5EBLC 1KKDA 2X6AA 2JEXA 4PDMA 4XBFA 3ABMC 4TSFG 1AJPA 4ASUG 1L1FA 1WPXA 5LHGA 3OE7G 4XDJA 3E89A 4G27B 2IJIA 5L3FA 3OMNB 3K9AA 3VBBA 1B6QA 2QM8A 2EZPA 3FB5C 3TETA 4CBCA 3T4DA 3JD3A 4DO2A 4RQFA 1M90W 3LDCA 4WFEA 1V55B 3OM3B 3R65A 3E35A 3SPJA 3OR7C 1NH2B 3SYAA 5CBHA 3PJSK 1JJ2U 3ETEA 2W6JG 4JASA 2EBOA 2IJKA 4JTAB 5L3CA 1F23A 1NVPB 1K97A 4P9PA 1OCZB 3K3WA 4QPKA 1Q86W 2WLHA 4EKWA 4WF9V 4QJFB 3SJQC 3FB7C 1K4DC 3OMIB 4R6ZA 3G4SV 1NBMG 1WLEA 3OR6C 2Y48A 3CC7V 3ZRWA 1E1QG 1NR7A 2EIJC 4H37A 1COWG 1QCEA 3SPHA 2IH1C 3ETGA 3RVZA 3IFXA 3K03A 5EBWC 1DF5A 3ZRSA 1QLNA 3MHSC 4FPPA 1JQ0A 1S5HC 3CCSV 1NQTA 4BAYA 3ZJZA 2EZOA 1DTOA 4KUMA 1GK9A 2P6JA 3SPGA 1DLBA 3OUSA 4YXWG 3K79A 3W7WA 3P32A 3CC4V 1GMGA 2PI5A 1LNQA 2WLNA 5B1NA 3AG2B 3ABTA 1PNKA 4JYBA 3ABMB 3SPCA 1KP3A 3STLC 1QR8A 3NXSA 1CP9A 4MW8A 1YHQV 2YEVB 1SRYA 3LSSA 4WFHA 3EHBB 4UVCA 1YITV 3HPLC 3OFNG 5H6QA 3ZCCA 5IYBO 3E8FA 3TCUA 1QVGU 3W7UA 3OW2U 3I55V 2EINC 3ASOC 1F51A 2MK3A 3OMAB 2P67A 4GX5A 4MTXA 3CD6V 1VQ8V 2DQ3A 4U7OA 2ATKC 3QO7A 3WG7C 1VQ4V 2BOBC 3HB3B 5L3GA 1Q81W 1ORQC 1PNLA 1QLEB 5HFMA 3B8MA 3ZRXA 3ASNC 2LFSA 5B1BB 3AG3C 3RW0A 3FKSG 3E8HA 3G6EV 3K08A 2OTJV 4N23A 1R6KA 4PDRA 3CC2V 1K5SA 1AI6A 3K0GA 3W7TA 3TK1A 4LCUC 4N21A 3CCQV 2Y69B 4PELA 3CCVV 1H2GA 4GCZA 4BIUA 4QPJA 1KC8W 1W0JG 1VQ5V 1S0VA 1BHBA 1FS0G 4MVRA 1K8AW 1PNMA 5L3EA 3K0DA 1HWYA 4JAVA 1V54B 5LGUA 2QEXV 2BOCC 5LHIA 2QA4V 1FXKA 4QNHB 4MT8A 2Q6AA 2Q68A 3E8GA 4E2LA 1JVMA 2A9HA 3LUTB 2QM7A 1SESA 3FYIB 2NNUA 3T4ZA 3P30A 3T1CA 1JCHA 1OZ0A 1ENVA 4LBEC 2DYSC 3ABLC 3AEIA 2WLIA 3AG1B 1AI5A 1V54C 3ZN0A 4X89A 4UVAA 5IYDO 4FJCC 4BW5A 2Y69C 3ZMSA 5LGTA 2D3OW 4MSWC 3ZMTA 1FXVA 3OEHG 1XL4A 4MVMA 5KUKA 3SYPA 1KP2A 3LNMB 5CBFA 1W2BU 3CPWU 2WLJA 2WLMA 3JD0A 1EFRG 2W6IG 3AG3B 5B1BC 4MVOA 1NH2D 3T2MA 2UXNA 4FMTA 4HZ3A 1N8RW 2M7WA 2B1GA 1QLEC 3JCZA 5CBGA 1R73A 5LBQA 3FYEB 5LHHA 3CMAV 1BL8A 5IYCO 3CCMV 1R3LC 1OCZC 5C93A 1OHHG 1AJQA 3ASOB 2DWDC 2IJHA 2XAHA 1IXMA 5IDJA 1JX9A 1VQOV 5DN6G 4PA7A 3OEEG 1M57B 4R8CA 5B3SB 1FXKB 1V55C 3WFVA 2KB1A 4MVZA 3B8NA 4JGSA 4ZBMA 4Z1MG 4H33A 3MHHC 3A0RA 3AG4B 2EILC 4HYOA 4JPRA 4X88A 3UM7A 5HFLA 4RUEA 1KD1W 2XAQA 2A79B 3ZRVA 1YJNV 2IU0A 2K1EA 4G28B 1ZWIC 5EK0A 1K7DA 3IC7A 4G2KA 2W0FC 2HLDG 5B1OA 1YJWV 2HG5C 5L3DA 1AROP 2EIMC 2OCCB 1K4CC 1RPOA 1YJ9V 1Y66A 3I56V 3GB7C 3E83A 1FFTB 2Z3YA 1SETA 4JTCB 2Q67A 3CCEV 1M56B 4GX2A 2IW5A 4QE9A 5B1AC 1PD3A 1YTFD 2YEVA 4WFBV 4X8AA 2XAGA 3ZRWB 1THZA 4F4LA 5LGNA 2EIJB 2ZDIC 2JK5C 2WLKA 3DGEA 1MG1A 4XDKA 1YTFB 2LFRA 1H8EG 2JIZG 4U7NA 5H9CA 1UJWB 1YSCA 4PA4A 3CMEV 2WLLA 3CCUV 1JPXA 1GTOA 1Y4MA 4WCEV 1QR9A 4PDLA 5CN0A 1F4NA 2YSUB 3CYOA 2XAJA 3STZC 3X2QB 1E79G 3H01A 2ZD9A 3SYCA 4P30A 1KQSU 3ZMVA 1R3JC 2DYRC 1YI2V 2F43G 4JYCA 2ZXWB 4P9OA 3FB6C 3E2EA 2B5UA 2ITDC 2WWWA 4TWKA 4UV9A 4WFAV 4RAIA 1I5XA 2ZDIA 1H38A 2P90A 1S3JA 3OUFA 2LP7A 1GO3F 2DYRB 4JTDB 3F7VC 2UXXA 3GWOA 3K04A 1M1KW 2X7RB 2HR3A 3EFFK 5KA6A 1K9MW 1VQKV 2WLIB 2EIKB 1GM9A 1FXHA 2GHYA 1Q7YW 3RVYA 3QNEA 1W0KG 4I5SA 1BMFG 4LP8A 4OXSA 4HAMA 1NVPD 2H94A 2XASA 3JD2A 1F4MA 1OCRC 2AHYA 1MOFA 2IJJA 2JEUA 4RQEA 2HVKC 2IH3C 2DW4A 3ABKB 4RO2A 1JOYA 1RM1B 3UKMA 1S76D 4MW3A 3JD1A 2JJ1G 3LDEA 3QO8A 4XDLA 1P7BA 4MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZJ A; 
#chains in the Genus database with same CATH topology
 3ASN B;  5H2F Z;  1VQ7 V;  4JYA B;  4ZI7 A;  3SYQ A;  1AR5 A;  3CXC U;  2E5L O;  2WAM A;  2UXB B;  2XND G;  3G71 V;  2QGN A;  3JAM N;  3QF7 A;  1MNG A;  3T1Y O;  4OX9 O;  1OCC B;  1P4R A;  3B77 A;  3KZI Z;  3SYO A;  2OYQ A;  1AJN A;  1WJZ A;  1KMI Z;  4X64 O;  4YIO A;  1SZT A;  1EZJ A;  1K34 A;  1GN6 A;  2GTS A;  2X6C A;  5K1P A;  3QO5 A;  1SQQ H;  4FLX A;  2Y4T A;  1BT8 A;  4B3M B;  3K5N A;  4Q20 A;  4R7C A;  5C8Y B;  3UCS C;  3RBZ A;  2Q8V A;  4R50 A;  1AI4 A;  4DV0 B;  1JR9 A;  1XNR B;  4KFM A;  5EBM C;  1OCR B;  5FPO A;  4I55 A;  2ZM6 B;  2QR4 A;  4Z2W A;  3AG1 C;  3BFR A;  4MVQ A;  1T5E A;  3ABL B;  1YDX A;  4LF8 O;  1K73 W;  4DRX B;  3FB8 C;  1NJI W;  4DR4 O;  1PKX A;  2ZNJ A;  3RFR A;  4DV1 B;  2HJF C;  3HKD B;  5H5N A;  3K59 A;  4IHJ A;  5EYP A;  2QKA A;  1K3E A;  3M99 B;  2B1I A;  3O9O A;  3ZHR A;  2HHH B;  2Z5U A;  1OCC C;  1RPR A;  5C8Y A;  5LMU B;  1DF4 A;  4PDV A;  2ZXW C;  4KP4 A;  1K5Q A;  4MVS A;  4J10 A;  4CH4 A;  1X4T A;  2A0L A;  1IX9 A;  5J2T A;  3X2Q C;  1XMQ O;  3DSQ A;  2OIG A;  1E1R G;  1YIJ V;  1GM7 A;  5GW7 A;  3F7Y C;  3LDD A;  2R9I A;  3AG7 A;  3WG7 B;  5IY5 C;  1MZE A;  4K35 A;  3G67 A;  1VIB A;  5CB4 A;  3AK1 A;  4DR6 B;  3JAR A;  5FL7 G;  3KG2 A;  4GKK O;  4CZZ A;  3ZN1 A;  2ITC C;  4LF4 B;  3WB2 A;  4FLY A;  3BVO A;  1VEW A;  3OTO O;  2OCC C;  3ETQ A;  4LH6 A;  1K92 A;  3JSL A;  3T1H O;  4X65 B;  4KHP B;  3OE7 G;  1IBM B;  3RYI A;  3UT5 B;  1NTM H;  5IYZ A;  3K9A A;  3VBB A;  3FB5 C;  3D3Q A;  4CC6 A;  1Y74 A;  4RQF A;  1KB9 F;  2OIE A;  3LDC A;  3OM3 B;  2HEP A;  5IT9 N;  5BY1 A;  2XHB A;  2IJK A;  5L3C A;  2PGG A;  2KKW A;  3OTF A;  3OGI B;  5KX5 B;  5JJE B;  4X65 O;  4R6Z A;  3ZRW A;  4B3S B;  1QCE A;  2ZE5 A;  2IH1 C;  1L0N H;  3IFX A;  1Q5O A;  3MDS A;  1XMO B;  1S5J A;  4U3J B;  4YIP A;  2RMK B;  1NQT A;  4DR3 B;  2P6J A;  1DLB A;  1I94 B;  4I50 B;  1GMG A;  2E3C A;  1FD9 A;  4H44 B;  4AIL C;  2M6Y A;  3B09 A;  2LW1 A;  4JZ2 A;  2BSK A;  1N0J A;  1CP9 A;  1YHQ V;  1N33 O;  4OGQ B;  3LSS A;  1Q6U A;  1VMG A;  5IYB O;  3E8F A;  2BTQ B;  4LF6 B;  3CRR A;  1QVG U;  4PHZ A;  4ZOL B;  3ASO C;  3RYH B;  1F51 A;  3OMA B;  2P67 A;  3N2K B;  2YC0 A;  2FYU H;  5L3G A;  4YJ3 A;  1XDC A;  1Y76 A;  1PNL A;  3B8M A;  4J7J A;  3ZRX A;  4DV6 B;  3C90 A;  4U3J A;  1K5S A;  3GVM A;  4DR1 O;  1FFX A;  3W7T A;  2QWQ B;  4LCU C;  4BR6 A;  1QU7 A;  1N32 O;  1KC8 W;  1BHB A;  1PNM A;  5L3E A;  3K0D A;  4JAV A;  3K5O A;  5LHI A;  1BZK A;  3RT3 C;  4EFB A;  4DV5 O;  4MT8 A;  3ZHS A;  4FLW A;  3FYI B;  3T4Z A;  1BCC H;  4I0X A;  3U10 A;  2DYS C;  3GWK C;  2WLI A;  5LMN O;  4JI5 O;  5GON A;  4FJC C;  3UQ8 A;  3HKD A;  5LP6 C;  4BW9 A;  1RSO A;  1IBM O;  1Q43 A;  1IBK O;  4IL6 Z;  2BTO A;  5KUK A;  3LNM B;  2VWJ A;  4LF6 O;  1EFR G;  5B1B C;  4MVO A;  1FPO A;  3T2M A;  1G6U A;  3JCZ A;  5CB4 B;  1Y6X A;  5LBQ A;  1NTZ H;  4GKJ O;  5LHH A;  3SDL A;  4QGP A;  1I94 O;  5C93 A;  3ASO B;  1VQO V;  3SJC C;  3WB0 A;  4OPH A;  3OEE G;  1NU1 H;  2N05 A;  4NTW A;  4X88 A;  3UM7 A;  1Y76 B;  4RWU A;  3IC7 A;  3M8A A;  4HBN A;  1VF6 C;  5B1O A;  3E22 B;  1YJW V;  5B66 Z;  2EIM C;  2YXH A;  4DV5 B;  4TUY B;  3E83 A;  3J7A U;  5EYP B;  1M5I A;  4NYK A;  2YEV A;  1OJH A;  4X8A A;  4LFB O;  1YF2 A;  4DV6 O;  3ZRW B;  4F4L A;  4DUZ O;  2RNB A;  1D2D A;  1MG1 A;  1H8E G;  2JIZ G;  4CH3 A;  2WLL A;  1F4N A;  1E79 G;  2Q0A A;  3K5L A;  1KQS U;  4J80 A;  1OV9 A;  2Q5Z A;  2ZXW B;  4P9O A;  5IWA B;  2ITD C;  5LP6 B;  4UV9 A;  5KHH A;  4RAI A;  3JAR B;  2LP7 A;  2W0X A;  4DK1 A;  2DYR B;  1O9H A;  2Y0I A;  3F7V C;  3FAV B;  2P4K A;  1M1K W;  3LSU A;  3EFF K;  2WLI B;  1GM9 A;  4DV2 B;  4LF5 B;  3RYH A;  3CWB H;  4LP8 A;  5IJ0 B;  4OXS A;  2GDS A;  4NXN B;  2XAS A;  3KCX A;  4K8X A;  1F4M A;  1TVK B;  3TXQ A;  4RQE A;  2HVK C;  1IBL B;  1HNX O;  3N2G B;  1JOY A;  4JI6 O;  3JD1 A;  2OWO A;  2JJ1 G;  1G1X B;  1N0N A;  4AQY O;  2JRI A;  3QO8 A;  4B3T B;  4X1K B;  3H1I H;  2VWK A;  3E2E A;  3A2F A;  2PTM A;  1W59 A;  1CPY A;  3APO A;  4JI1 O;  1CEZ A;  4PI2 A;  4B3R O;  1QBZ A;  3B4S A;  1GM8 A;  3K06 A;  4JI3 B;  4RUF A;  3WU2 Z;  1XQ8 A;  3ZX6 A;  4GYC B;  3CCR V;  2YUA A;  2QE7 G;  2QWN B;  4LFA B;  3DC6 A;  4CC5 A;  4WFG A;  3CP1 A;  1VF7 A;  3SGI A;  2YID A;  1Q6H A;  4LF7 O;  2UXD B;  2OCH A;  2NLJ C;  5JJN B;  4JZG A;  1HR0 B;  4IYH A;  4ICG A;  2CE4 A;  2DQ0 A;  2QKC A;  5B5E Z;  3IAY A;  1OCO B;  1KEC A;  1VQL V;  3JAW B;  4IGG A;  2JJ2 G;  2ZQM A;  2PZS A;  1NS1 A;  5EC2 C;  3ZED A;  2ZR3 A;  2XT9 A;  2R9R B;  2QKS A;  2WPD G;  2IM9 A;  5CA3 A;  1AP6 A;  4TT3 G;  2GSM B;  4DR4 B;  3FD9 A;  4FIP C;  2H8P C;  1XMO O;  1EBO A;  2A3Q A;  4DR7 B;  2DYS B;  3BEH A;  3MD0 A;  1PV0 A;  2EIK C;  1XNQ O;  2PF4 E;  3SR2 C;  3G6B A;  2EUL A;  1AB3 A;  1I5Y A;  5ITZ A;  1MSW D;  4LC1 A;  5KUM A;  3SJB C;  1EN5 A;  4X1I B;  3APQ A;  3THO A;  1J95 A;  1R3K C;  4FFK A;  1R6N A;  3TJT A;  4J42 A;  1H8H G;  4QE7 A;  1FJG B;  2Q69 A;  5KA5 A;  4JI8 B;  4I0X B;  3BHP A;  1BHA A;  1XL6 A;  1ZAU A;  1GKF A;  2RN9 A;  4HNA A;  4MTG A;  1HW7 A;  1U96 A;  4TV9 B;  1VF5 B;  2P7T C;  4JF3 A;  2GUZ A;  2A7W A;  5H6R A;  4WFF A;  4DR5 B;  3M7M X;  5JQG A;  5B1A B;  3CCL V;  1M56 C;  1NTK H;  3OAA G;  4JAU A;  1PL0 A;  2VQF O;  2EIM B;  2XUM A;  4I9W A;  4FLZ A;  5ITZ B;  1KKD A;  4PDM A;  4JI0 B;  3ABM C;  1AR4 A;  1Z5W A;  4TSF G;  3QVN A;  4XDJ A;  2UXD O;  4DK0 A;  5KMG B;  2QM8 A;  2EZP A;  3TET A;  2CTP A;  4LR3 A;  3L9D A;  2ADP A;  1HNW O;  3E35 A;  3OR7 C;  2HP8 A;  1NH2 B;  3SYA A;  4TQD A;  1WP8 A;  2W6J G;  3ZS8 C;  1H2K A;  4JTA B;  1K97 A;  1OCZ B;  4B3S O;  4QPK A;  1Q86 W;  4WF9 V;  4QJF B;  3SJQ C;  4ABM A;  4L8J A;  5LXT A;  4DR1 B;  2LJ2 A;  3HKB B;  3CC7 V;  2NN4 A;  1NR7 A;  3AK3 A;  1WNS A;  4D6T H;  3N2G A;  2EIJ C;  1COW G;  1PP9 H;  4LNU A;  3R66 A;  4B7K A;  3ETG A;  4LF8 B;  2AW9 A;  3K03 A;  4NTX A;  4DV1 O;  1XHX A;  3ZRS A;  1QLN A;  3HKE A;  2CTR A;  2DOS A;  4AQY B;  5J2U B;  2Q7E A;  4PI0 A;  3CCS V;  1GN3 A;  4KUM A;  4GKJ B;  1H2L A;  3HKB A;  3BCC H;  3P32 A;  3JCU Z;  2CGN A;  2WLN A;  5B1N A;  1PNK A;  4JYB A;  2ZE7 A;  3SPC A;  1KP3 A;  1WP7 A;  3NXS A;  2UUA O;  2RJZ A;  1GH6 A;  4UVC A;  1YIT V;  4LFA O;  4X66 B;  5EZY B;  5KHI A;  3W7U A;  2EIN C;  2ZKO A;  4DV7 O;  1IUR A;  2H3O A;  2MK3 A;  4KXR A;  4I55 B;  1Q90 D;  4IIJ A;  1I7F A;  4JYY A;  2FL4 A;  1JJO A;  4NVP A;  5B1B B;  5LA6 B;  3RW0 A;  4O2A A;  2F4V B;  4HNA B;  1IZ3 A;  2Q7G A;  3A0B Z;  2CDY A;  1L0L H;  3CCQ V;  4I7Z B;  4J11 A;  2Y69 B;  4PEL A;  5LOV A;  3CCV V;  4BIU A;  1VQ5 V;  1W0J G;  1S0V A;  1V54 B;  2CAZ C;  2Y4U A;  2CH7 B;  4EB6 A;  2QEX V;  1FXK A;  4QNH B;  4X1K A;  3CRA A;  2QM7 A;  1SES A;  3P30 A;  3CHX A;  3JAL A;  3ABL C;  3L75 H;  1J5E B;  3AG1 B;  1AI5 A;  4X89 A;  1YZB A;  3LNN A;  1SC5 B;  3HKC A;  2CGO A;  1Q8I A;  5LGT A;  1QQC A;  3OEH G;  4LF9 O;  1SQB H;  1EM1 A;  2YIC A;  1W2B U;  3CPW U;  2WLJ A;  3JD0 A;  3FAV A;  3JAT A;  4HZ3 A;  3FYE B;  5LMN B;  5KHJ A;  1BL8 A;  1SQX H;  1AJQ A;  2XTA A;  2IJH A;  2XAH A;  4YJ3 B;  1JX9 A;  2Y0P A;  2F95 B;  4DV3 O;  4D7T A;  1FXK B;  4D7S A;  1N33 B;  4MVZ A;  3B8N A;  4JGS A;  4ZBM A;  3CS5 A;  1AIL A;  3AG4 B;  3BA8 A;  4B3M O;  2A79 B;  1LUW A;  4LFC B;  4O4L A;  4Q6G A;  3DXR B;  1YJN V;  2K1E A;  4PV1 B;  2W0F C;  1MA1 A;  3BA9 A;  3FX7 A;  2UXC B;  1YJ9 V;  5JQG B;  4CS3 A;  2YS8 A;  2Z3Y A;  2G38 A;  1GN4 A;  4QE9 A;  4AHC A;  3CXH F;  1YTF D;  1SQF A;  1WN7 A;  4Z1V A;  4WFB V;  4TV9 A;  1THZ A;  2ZDI C;  5AG2 A;  1AP5 A;  5FLX N;  4JV5 B;  4F6R A;  4U3F H;  4U7N A;  1YSC A;  4YHH O;  3CB2 A;  4FZ1 A;  1GTO A;  2UUC O;  4DYL A;  5CN0 A;  2YSU B;  1RSO B;  1WB7 A;  3ZMV A;  4DV4 O;  3D36 C;  2RCV A;  1SQV H;  2B5U A;  4NXM O;  4O4I A;  2WWW A;  4TWK A;  4J7K A;  5LYJ B;  5JWP A;  4DR5 O;  4JV5 O;  4ZHQ B;  3CEI A;  4JTD B;  3K57 A;  3H1H H;  3OTO B;  2HR3 A;  1K9M W;  1LUV A;  1IBK B;  2EIK B;  1FXH A;  2GHY A;  2KG7 B;  5D5P A;  1H2S B;  3QNE A;  1R1B A;  2KQX A;  4HAM A;  1NVP D;  1FFX B;  1KU9 A;  2AXT Z;  3RWR D;  1NI8 A;  2IJJ A;  2VQE O;  4O4J A;  2DW4 A;  3PN1 A;  1BSM A;  5JVD B;  1P7B A;  4O2A B;  1RM1 B;  3UKM A;  1S76 D;  4MW3 A;  4XDL A;  4MVU A;  1JFF A;  1GRJ A;  2OTL V;  4MTF A;  3CCJ V;  3N2K A;  1SA0 A;  1IXB A;  4DV3 B;  5JH7 B;  2PI4 A;  2EIL B;  2EIN B;  5CA0 A;  4PA3 A;  1KUQ A;  5EIB D;  4FK5 C;  1YVW A;  5B3S C;  2BSK B;  2XOK G;  2P5O A;  1FAF A;  2E74 B;  1NKD A;  1S77 D;  4JI5 B;  2VQE B;  5J9P C;  1PM9 A;  2XAF A;  4PA9 A;  1FJG O;  3WB1 A;  3W7X A;  3D36 A;  2EJR A;  2JGD B;  1EN6 A;  1WAZ A;  1XMQ B;  2UUA B;  2F23 A;  4UCR A;  1QVF U;  4DR3 O;  3JAT B;  2IBZ H;  4DW1 A;  4TQF A;  2V4D A;  2P22 C;  3JAS B;  2V1D A;  5EC1 C;  1IBL O;  1OCO C;  4QIW F;  2JS3 A;  3BY6 A;  2UXB O;  4NXM B;  1ZLZ A;  4X1I A;  4X1Y A;  4AI8 A;  5JH7 A;  4JI2 B;  4DV4 B;  1Q82 W;  4MS2 A;  2ZT9 B;  2CK3 G;  3QG5 A;  1MSD A;  4ZKI A;  4B3R B;  1SER A;  2Q0O C;  4FFB B;  2AZ0 A;  4W4L A;  1V9P A;  1VQM V;  4UV8 A;  3KCY A;  5A2Q N;  1XUQ A;  1VQP V;  4B7E A;  2JGD A;  4JI6 B;  2D2C B;  5LYJ A;  1ROP A;  2OT5 A;  1RP3 B;  3IGA C;  1VP7 A;  1FYJ A;  4JI4 O;  2ZR2 A;  3HR0 A;  4DUY B;  2ZNI A;  1BS3 A;  2A06 H;  2JGU A;  3D3I A;  3DXR A;  4GT1 A;  2ZCE A;  2PUS A;  2IU3 A;  2N04 A;  3C3S A;  1UPG A;  2X0L A;  1G4Y B;  5TIS Z;  1URF A;  2AHZ A;  2V7Q G;  4DV0 O;  5E1A C;  3BRC A;  4X9Q A;  4ZI7 B;  2L6L A;  2UUB B;  1VQ9 V;  1N4C A;  5BXZ A;  1H2N A;  2JEX A;  1ZTE A;  4I9Q A;  4FFB A;  4XBF A;  1CXZ B;  3K9S A;  3H9V A;  4FLU A;  1AJP A;  4ASU G;  1L1F A;  3E89 A;  4G27 B;  2IJI A;  1SA0 B;  3OMN B;  2VRZ A;  2JVD A;  1B6Q A;  1MZF A;  4CBC A;  3JD3 A;  4DO2 A;  4H0L B;  4WFE A;  3R65 A;  3SPJ A;  2YIB A;  1DK1 A;  1JJ2 U;  4JAS A;  2EBO A;  1F23 A;  4P9P A;  3K3W A;  2WLH A;  5J2U A;  1K4D C;  3QTC A;  5IYZ B;  1NBM G;  3OR6 C;  2B9Z A;  1E1Q G;  1SQP H;  1XNQ B;  4H37 A;  1XIL A;  4DR7 O;  1WA8 B;  1DF5 A;  4BAY A;  3ZJZ A;  1GK9 A;  2ADQ B;  1R6T A;  1HDJ A;  2LQT A;  4EFE A;  3OUS A;  1WB8 A;  3K79 A;  3W7W A;  4GKK B;  1L8D A;  2ODM A;  3CC4 V;  1TUB B;  4F6R B;  1LNQ A;  3HKE B;  2ZE8 A;  1D5A A;  3AG2 B;  1BE3 H;  3ABM B;  3STL C;  1QR8 A;  1VAR A;  1SQG A;  4WFH A;  3EHB B;  2QM4 A;  3OFN G;  4O2B A;  3ZCC A;  4W4K A;  4UFZ A;  4FM0 A;  3I55 V;  3OW2 U;  3ZHT A;  2PYL A;  3CD6 V;  4GX5 A;  4MTX A;  1VQ8 V;  4DR2 O;  2PY5 A;  2ATK C;  3QO7 A;  3U0Z A;  4K0K B;  2GBO A;  2Q4P A;  1Q81 W;  5IJ9 B;  4JI0 O;  1QLE B;  1WPB A;  5HFM A;  4DW0 A;  5JCO C;  4FM2 A;  2R70 A;  3FKS G;  4WBN A;  3G6E V;  3O65 A;  3CE2 A;  4I4T B;  1PPJ H;  4FZ0 A;  1Q6I A;  4ZOL A;  3CC2 V;  1KKC A;  3K0G A;  4O4L B;  2ZIO A;  4BIO A;  2QTS A;  1H2G A;  1UFI A;  1FS0 G;  4MVR A;  1B04 A;  3JAL B;  5LGU A;  2QA4 V;  4CS2 A;  3P3P A;  1KBH A;  3E8G A;  4E2L A;  2A9H A;  4PD4 F;  3RYF A;  3TGU H;  3T1C A;  2BE3 A;  4NXN O;  1ENV A;  4LBE C;  2VQF B;  4LFC O;  1V54 C;  4GUN A;  4B08 A;  4UVA A;  4FLT A;  2UU9 B;  4LH7 A;  4IHJ B;  2D3O W;  4MSW C;  2L35 A;  2QWO B;  1XL4 A;  4MVM A;  5KAF Z;  2NR5 A;  1IDS A;  2WLM A;  2W6I G;  3JSN A;  3CRM A;  3HKC B;  4GZR B;  5FPR A;  2UXN A;  2YIA A;  1QLE C;  5IYC O;  1TVK A;  1R3L C;  1OCZ C;  1OHH G;  3N27 A;  5IDJ A;  2DWD C;  1IXM A;  3FFQ A;  5DN6 G;  3K5M A;  4TV8 B;  5B3S B;  4R8C A;  4TUY A;  4LF9 B;  3WFV A;  2LW7 A;  3BPZ A;  4Z1M G;  4H33 A;  3MHH C;  5JCO A;  3A0R A;  4HYO A;  4JPR A;  2GUZ B;  1ZL8 A;  4RUE A;  4YY3 O;  2FML A;  3ZRV A;  5BMV A;  2IU0 A;  4G28 B;  1ZWI C;  5EK0 A;  1K7D A;  4FLV A;  5JVD A;  5L3D A;  3I5D A;  1K4C C;  1RPO A;  1Y66 A;  4O4H B;  1H2M A;  1FFT B;  2Q67 A;  3CCE V;  1M56 B;  1SKV A;  5B1A C;  1P7G A;  1KYO F;  3EVK A;  4X20 A;  1PL4 A;  4CH5 A;  1YTF B;  2LFR A;  5J2T B;  4LWS B;  1ZX3 A;  5H9C A;  3ZBH A;  4PA4 A;  3IJ4 A;  3CME V;  1BQ0 A;  4DR2 B;  1JPX A;  1Y4M A;  1N34 O;  1QR9 A;  1A32 A;  1LR1 A;  5IWA O;  3CYO A;  3STZ C;  3X2Q B;  2YDE A;  1QNM A;  4C7U A;  3H1L H;  5FNV B;  3NR7 A;  5BMV B;  2O57 A;  2DYR C;  1YI2 V;  2F43 G;  4JYC A;  4JAA A;  3FB6 C;  4JI7 B;  1GAX A;  4WFA V;  4NKG B;  2KG7 A;  5GTI Z;  2ZDI A;  2E76 B;  1N36 B;  1H38 A;  2P90 A;  1S3J A;  1P84 F;  3CSX A;  2YXL A;  3VQW A;  1DGS A;  3GWO A;  3K04 A;  1WA8 A;  2X7R B;  4IT5 A;  5FNV A;  4O4H A;  2QSA A;  4UCO A;  3RYC A;  1GN2 A;  4YHH B;  3RVY A;  4I5S A;  1BMF G;  5LP6 A;  1JMK C;  4LFB B;  2H94 A;  3CJH B;  3JD2 A;  4JI7 O;  5LXT B;  2AHY A;  1MOF A;  3L71 H;  2JEU A;  1AVM A;  1NT2 B;  1US6 A;  3ABK B;  4RO2 A;  3T1H B;  4UB6 Z;  5LMU O;  5F2V O;  1B3Q A;  5GTH Z;  2F4V O;  3LDE A;  2AZ2 A;  3MAQ A;  2HFE C;  4L87 A;  3DC5 A;  2ARH A;  3P3N A;  4A5U B;  2JDI G;  3VOU A;  3UO2 A;  3OGC C;  4J9Y B;  1S5L Z;  1YEW A;  4BIZ A;  3AG4 C;  3ZHV A;  4J9Z B;  1R3I C;  2GV9 A;  4UCU A;  3G80 A;  4P2Z A;  4DXW A;  2DJV A;  3KKY A;  1FXK C;  1HNZ B;  1M57 C;  4IIJ B;  1K33 A;  3CRQ A;  3IC9 A;  3SPI A;  1HR0 O;  4TV8 A;  3ML0 A;  4EEQ A;  3C3T A;  1TUB A;  1NZ6 A;  2ZIM A;  2EX3 A;  3J81 N;  2C2A A;  4O2B B;  3B2E E;  3AG2 C;  1VQN V;  3L70 H;  5KLV H;  2VS0 A;  1M9N A;  5DEC A;  5L3B A;  4DV2 O;  3RYF B;  2CUG A;  1HP8 A;  2X6B A;  1RM1 C;  2QTO A;  1G8M A;  3ABK C;  1XI1 A;  3E86 A;  5LL6 Y;  3ABU A;  1Y67 A;  3ZIA G;  4J7Z A;  5DM6 V;  1AR1 B;  3A0H Z;  4MTO A;  3JD4 A;  4X62 B;  2HKO A;  2Q73 A;  3S3W A;  3JYC A;  1TA8 A;  1SF9 A;  1S72 V;  1ZSP A;  5CMU A;  4LNU B;  4GX1 A;  2F93 B;  1VQ6 V;  2FTK A;  2WLL B;  3JAS A;  2WSS G;  4GX0 A;  3DTU B;  3ZHU A;  2Z0A A;  4UVB A;  1XOU A;  2BCC H;  3JAK A;  2Q9L A;  4DUZ B;  3LSQ A;  1BQZ A;  3E22 A;  3AK2 A;  1U97 A;  3ETD A;  3F5T A;  4PA6 A;  4UXN A;  2WA3 A;  4ZIB A;  3VQV A;  4B3T O;  1AI7 A;  5IJ0 A;  2F66 C;  3K58 A;  4OPA A;  3JAW A;  3Q4H A;  5CA1 B;  2CTQ A;  4ZHQ A;  3F5W C;  5A9G A;  1XNR O;  1B06 A;  1F7Y A;  4KHP O;  5EZY A;  2ZM6 O;  1MAB G;  1Z2G A;  2HVJ C;  5CA0 B;  3H1J H;  4FVM A;  1M4U A;  1TUE B;  5KHK A;  5IY5 B;  4UUJ C;  1N34 B;  1IVS A;  5BZB A;  1O9G A;  4J41 A;  2DWE C;  2F1M A;  4X1Y B;  3ZMU A;  2WA4 A;  3BAB A;  3W7S A;  3E8B A;  1NR1 A;  3D8C A;  4UB8 Z;  2X6A A;  5EBL C;  1EN4 A;  4DUY O;  1M93 A;  4JI1 B;  1WPX A;  5LHG A;  1N36 O;  3JAK B;  5L3F A;  4JI3 O;  3L73 H;  4PJ0 Z;  2YXY A;  3T4D A;  1M90 W;  1TAE A;  1X59 A;  1V55 B;  2YI9 A;  3U11 A;  3T1Y B;  5CBH A;  4OX9 B;  3PJS K;  3ETE A;  4KL1 A;  1NVP B;  3ZHQ A;  3SJA C;  1EZV H;  2UXC O;  4EKW A;  2UU9 O;  1HNW B;  5JJJ B;  1JFF B;  3FB7 C;  1ZUQ A;  3L74 H;  1HNX B;  3OMI B;  3G4S V;  1WLE A;  2Y48 A;  3SPH A;  3RVZ A;  4F6E A;  5EBW C;  3MHS C;  4FPP A;  1JQ0 A;  1QHT A;  5GON B;  2DN9 A;  5KX5 A;  1S5H C;  2EZO A;  1DTO A;  3SPG A;  5EIB C;  4YXW G;  2PI5 A;  3ABT A;  4NTY A;  2UUB O;  1J5E O;  2LGW A;  4MW8 A;  4H13 B;  2JS5 A;  2YEV B;  1SRY A;  4DV7 B;  1XRE A;  4YJ2 B;  3HPL C;  5IE9 A;  5H6Q A;  2ZIN A;  2KSD A;  2ZE6 A;  3TCU A;  3RYC B;  2DQ3 A;  4U7O A;  3WG7 C;  3ICX A;  1VQ4 V;  2BOB C;  3HB3 B;  1ORQ C;  4BWA A;  2BTQ A;  2UUC B;  1ZL8 B;  2N74 A;  3ASN C;  2LFS A;  3AG3 C;  4O4J B;  4EB6 B;  1JA8 A;  1I08 A;  1Z5V A;  3E8H A;  3K08 A;  2OTJ V;  4N23 A;  3Q4H B;  1R6K A;  4PDR A;  5CA1 A;  4NR1 A;  3S3X A;  2HHH O;  1P49 A;  1AI6 A;  2RQ6 A;  2Q7H A;  3TK1 A;  4N21 A;  2QWR B;  4GCZ A;  4QPJ A;  3TXS A;  4CH6 A;  1K8A W;  4JI2 O;  1HWY A;  4UCV A;  2FKX A;  2BOC C;  2Q6A A;  2Q68 A;  1JVM A;  3LUT B;  2QDO A;  2NNU A;  3BAA A;  2QJ1 A;  1XBL A;  1JCH A;  1OZ0 A;  3AEI A;  2P4V A;  5BR8 B;  3ZN0 A;  2ETN A;  2DMX A;  2HJD A;  1YXB A;  2EJ7 A;  5IYD O;  4I50 A;  4DR6 O;  4BW5 A;  2Y69 C;  3ZMS A;  4X66 O;  3RYI B;  3UT5 A;  3VQX A;  3ZMT A;  1FXV A;  2R9A A;  3SYP A;  1KP2 A;  3VQY A;  5CBF A;  4TOI A;  3AG3 B;  2RDC A;  1NH2 D;  4K0K O;  4FMT A;  2ILM A;  1N8R W;  2M7W A;  2B1G A;  5CBG A;  2CH7 A;  1R73 A;  5KAI Z;  1MMM A;  3CMA V;  3CCM V;  3UO3 A;  1D5N A;  3RN4 A;  4PA7 A;  4LF7 B;  1M57 B;  2QWP B;  1V55 C;  2KB1 A;  4JYA O;  1BGY H;  1RFY A;  1TGO A;  2EIL C;  5K1X A;  2E5L B;  1HNZ O;  5HFL A;  1KD1 W;  4GLX A;  2XAQ A;  3B40 A;  4G2K A;  5DED A;  3OT7 A;  2HLD G;  3CRC A;  1I0H A;  4X64 B;  2HG5 C;  1ARO P;  2OCC B;  1SS3 A;  3I56 V;  3GB7 C;  1Q3E A;  2YIB D;  2GTA A;  1SET A;  4JTC B;  3RGB A;  4GX2 A;  2IW5 A;  4LWS A;  1YCI A;  1PD3 A;  2AGA A;  2YI8 A;  5KMG A;  2E75 B;  2XAG A;  2P06 A;  4X62 O;  3EXA A;  4NB5 A;  4CS4 A;  5LGN A;  1Y74 B;  2EIJ B;  3DGE A;  2JK5 C;  2WLK A;  4O4I B;  1VF6 A;  4UCS A;  4XDK A;  1UJW B;  2FB5 A;  3CCU V;  4YY3 B;  4WCE V;  4LF4 O;  4PDL A;  2XAJ A;  3L72 H;  3H01 A;  2ZD9 A;  3SYC A;  5LOV B;  4LF5 O;  4P30 A;  2R72 A;  1R3J C;  3A8T A;  4E4E A;  3CX5 F;  2MW2 B;  1XHZ A;  2K9P A;  2DE0 X;  5KHG A;  4I4T A;  1I5X A;  3OUF A;  1GO3 F;  3OD4 A;  4K3A A;  3H1K H;  4JI4 B;  5D5Q A;  2UXX A;  4DRX A;  5IJ9 A;  1XEQ A;  5BR8 O;  5KA6 A;  4IYI A;  1VQK V;  1Q7Y W;  2LGQ A;  1SZX A;  1W0K G;  2LO1 A;  5E79 Z;  3J80 N;  1FKA O;  1N32 B;  1OCR C;  2PYJ A;  4WBN B;  4JI8 O;  2IH3 C;  4FM1 A;  4X20 B;  5LA6 A;  2CTW A;  4UCT A;  4K8Z A;  3ZMZ A;  3CJH A;  4YJ2 A; 
#chains in the Genus database with same CATH homology
 1CPY A;  3ASN B;  2HFE C;  4L87 A;  1VQ7 V;  2OTL V;  4MTF A;  3CCJ V;  1CEZ A;  3SYQ A;  1QBZ A;  1GM8 A;  2JDI G;  3VOU A;  3CXC U;  2WAM A;  3K06 A;  4RUF A;  3OGC C;  4J9Y B;  2XND G;  3G71 V;  2PI4 A;  4BIZ A;  2EIL B;  3AG4 C;  4J9Z B;  2EIN B;  1R3I C;  1OCC B;  1P4R A;  4PA3 A;  4P2Z A;  4DXW A;  4FK5 C;  3B77 A;  3CCR V;  3SYO A;  1FXK C;  1M57 C;  5B3S C;  1K33 A;  2XOK G;  2QE7 G;  1NKD A;  3SPI A;  1AJN A;  4WFG A;  3CP1 A;  1S77 D;  3ML0 A;  1SZT A;  5J9P C;  1EZJ A;  1K34 A;  2XAF A;  2C2A A;  2X6C A;  2NLJ C;  3QO5 A;  3AG2 C;  4PA9 A;  1VQN V;  3W7X A;  4Q20 A;  4R7C A;  3D36 A;  2EJR A;  1M9N A;  2DQ0 A;  5L3B A;  1OCO B;  1KEC A;  1VQL V;  3RBZ A;  2JJ2 G;  2ZQM A;  1QVF U;  2X6B A;  5EC2 C;  1RM1 C;  3ABK C;  2QTO A;  2ZR3 A;  1G8M A;  3E86 A;  3ABU A;  4R50 A;  2R9R B;  2QKS A;  1AI4 A;  2WPD G;  4KFM A;  5EBM C;  3ZIA G;  5CA3 A;  1OCR B;  4TT3 G;  2GSM B;  2V1D A;  5DM6 V;  1AR1 B;  4FIP C;  4MTO A;  5EC1 C;  2H8P C;  1OCO C;  4QIW F;  3JD4 A;  3BY6 A;  1EBO A;  3AG1 C;  4MVQ A;  2HKO A;  3ABL B;  2DYS B;  3BEH A;  3MD0 A;  1K73 W;  2EIK C;  3FB8 C;  3JYC A;  1NJI W;  1S72 V;  1PKX A;  4MS2 A;  1Q82 W;  5CMU A;  2CK3 G;  4GX1 A;  1VQ6 V;  1I5Y A;  2FTK A;  2HJF C;  2WLL B;  4ZKI A;  2WSS G;  1SER A;  4GX0 A;  1MSW D;  3DTU B;  1VQM V;  4LC1 A;  5KUM A;  1K3E A;  3M99 B;  4UV8 A;  2B1I A;  4UVB A;  1J95 A;  1VQP V;  2Z5U A;  1OCC C;  1R3K C;  1RPR A;  1R6N A;  1DF4 A;  4PDV A;  3LSQ A;  1H8H G;  4QE7 A;  2ZXW C;  2Q69 A;  4KP4 A;  5KA5 A;  1K5Q A;  3ETD A;  4MVS A;  1BHA A;  1ROP A;  1XL6 A;  2OT5 A;  4PA6 A;  4UXN A;  3IGA C;  2A0L A;  1GKF A;  3ZMZ A;  3X2Q C;  1AI7 A;  2ZR2 A;  1E1R G;  4MTG A;  1YIJ V;  3F5W C;  3D3I A;  1GM7 A;  4GT1 A;  3F7Y C;  3LDD A;  5GW7 A;  2R9I A;  2P7T C;  3WG7 B;  1MAB G;  4JF3 A;  2HVJ C;  5IY5 C;  2IU3 A;  2X0L A;  5H6R A;  4WFF A;  1TUE B;  5IY5 B;  5FL7 G;  3KG2 A;  1G4Y B;  5B1A B;  4CZZ A;  4UUJ C;  3CCL V;  2AHZ A;  3ZN1 A;  2ITC C;  1M56 C;  2V7Q G;  3OAA G;  5E1A C;  4JAU A;  5BZB A;  1PL0 A;  2DWE C;  3ZMU A;  2EIM B;  2OCC C;  3W7S A;  4I9W A;  1K92 A;  1VQ9 V;  3E8B A;  1NR1 A;  5EBL C;  1KKD A;  2X6A A;  2JEX A;  4PDM A;  4XBF A;  3ABM C;  4TSF G;  1AJP A;  4ASU G;  1L1F A;  1WPX A;  5LHG A;  3OE7 G;  4XDJ A;  3E89 A;  4G27 B;  2IJI A;  5L3F A;  3OMN B;  3K9A A;  3VBB A;  1B6Q A;  2QM8 A;  2EZP A;  3FB5 C;  3TET A;  4CBC A;  3T4D A;  3JD3 A;  4DO2 A;  4RQF A;  1M90 W;  3LDC A;  4WFE A;  1V55 B;  3OM3 B;  3R65 A;  3E35 A;  3SPJ A;  3OR7 C;  1NH2 B;  3SYA A;  5CBH A;  3PJS K;  1JJ2 U;  3ETE A;  2W6J G;  4JAS A;  2EBO A;  2IJK A;  4JTA B;  5L3C A;  1F23 A;  1NVP B;  1K97 A;  4P9P A;  1OCZ B;  3K3W A;  4QPK A;  1Q86 W;  2WLH A;  4EKW A;  4WF9 V;  4QJF B;  3SJQ C;  3FB7 C;  1K4D C;  3OMI B;  4R6Z A;  3G4S V;  1NBM G;  1WLE A;  3OR6 C;  2Y48 A;  3CC7 V;  3ZRW A;  1E1Q G;  1NR7 A;  2EIJ C;  4H37 A;  1COW G;  1QCE A;  3SPH A;  2IH1 C;  3ETG A;  3RVZ A;  3IFX A;  3K03 A;  5EBW C;  1DF5 A;  3ZRS A;  1QLN A;  3MHS C;  4FPP A;  1JQ0 A;  1S5H C;  3CCS V;  1NQT A;  4BAY A;  3ZJZ A;  2EZO A;  1DTO A;  4KUM A;  1GK9 A;  2P6J A;  3SPG A;  1DLB A;  3OUS A;  4YXW G;  3K79 A;  3W7W A;  3P32 A;  3CC4 V;  1GMG A;  2PI5 A;  1LNQ A;  2WLN A;  5B1N A;  3AG2 B;  3ABT A;  1PNK A;  4JYB A;  3ABM B;  3SPC A;  1KP3 A;  3STL C;  1QR8 A;  3NXS A;  1CP9 A;  4MW8 A;  1YHQ V;  2YEV B;  1SRY A;  3LSS A;  4WFH A;  3EHB B;  4UVC A;  1YIT V;  3HPL C;  3OFN G;  5H6Q A;  3ZCC A;  5IYB O;  3E8F A;  3TCU A;  1QVG U;  3W7U A;  3OW2 U;  3I55 V;  2EIN C;  3ASO C;  1F51 A;  2MK3 A;  3OMA B;  2P67 A;  4GX5 A;  4MTX A;  3CD6 V;  1VQ8 V;  2DQ3 A;  4U7O A;  2ATK C;  3QO7 A;  3WG7 C;  1VQ4 V;  2BOB C;  3HB3 B;  5L3G A;  1Q81 W;  1ORQ C;  1PNL A;  1QLE B;  5HFM A;  3B8M A;  3ZRX A;  3ASN C;  2LFS A;  5B1B B;  3AG3 C;  3RW0 A;  3FKS G;  3E8H A;  3G6E V;  3K08 A;  2OTJ V;  4N23 A;  1R6K A;  4PDR A;  3CC2 V;  1K5S A;  1AI6 A;  3K0G A;  3W7T A;  3TK1 A;  4LCU C;  4N21 A;  3CCQ V;  2Y69 B;  4PEL A;  3CCV V;  1H2G A;  4GCZ A;  4BIU A;  4QPJ A;  1KC8 W;  1W0J G;  1VQ5 V;  1S0V A;  1BHB A;  1FS0 G;  4MVR A;  1K8A W;  1PNM A;  5L3E A;  3K0D A;  1HWY A;  4JAV A;  1V54 B;  5LGU A;  2QEX V;  2BOC C;  5LHI A;  2QA4 V;  1FXK A;  4QNH B;  4MT8 A;  2Q6A A;  2Q68 A;  3E8G A;  4E2L A;  1JVM A;  2A9H A;  3LUT B;  2QM7 A;  1SES A;  3FYI B;  2NNU A;  3T4Z A;  3P30 A;  3T1C A;  1JCH A;  1OZ0 A;  1ENV A;  4LBE C;  2DYS C;  3ABL C;  3AEI A;  2WLI A;  3AG1 B;  1AI5 A;  1V54 C;  3ZN0 A;  4X89 A;  4UVA A;  5IYD O;  4FJC C;  4BW5 A;  2Y69 C;  3ZMS A;  5LGT A;  2D3O W;  4MSW C;  3ZMT A;  1FXV A;  3OEH G;  1XL4 A;  4MVM A;  5KUK A;  3SYP A;  1KP2 A;  3LNM B;  5CBF A;  1W2B U;  3CPW U;  2WLJ A;  2WLM A;  3JD0 A;  1EFR G;  2W6I G;  3AG3 B;  5B1B C;  4MVO A;  1NH2 D;  3T2M A;  2UXN A;  4FMT A;  4HZ3 A;  1N8R W;  2M7W A;  2B1G A;  1QLE C;  3JCZ A;  5CBG A;  1R73 A;  5LBQ A;  3FYE B;  5LHH A;  3CMA V;  1BL8 A;  5IYC O;  3CCM V;  1R3L C;  1OCZ C;  5C93 A;  1OHH G;  1AJQ A;  3ASO B;  2DWD C;  2IJH A;  2XAH A;  1IXM A;  5IDJ A;  1JX9 A;  1VQO V;  5DN6 G;  4PA7 A;  3OEE G;  1M57 B;  4R8C A;  5B3S B;  1FXK B;  1V55 C;  3WFV A;  2KB1 A;  4MVZ A;  3B8N A;  4JGS A;  4ZBM A;  4Z1M G;  4H33 A;  3MHH C;  3A0R A;  3AG4 B;  2EIL C;  4HYO A;  4JPR A;  4X88 A;  3UM7 A;  5HFL A;  4RUE A;  1KD1 W;  2XAQ A;  2A79 B;  3ZRV A;  1YJN V;  2IU0 A;  2K1E A;  4G28 B;  1ZWI C;  5EK0 A;  1K7D A;  3IC7 A;  4G2K A;  2W0F C;  2HLD G;  5B1O A;  1YJW V;  2HG5 C;  5L3D A;  1ARO P;  2EIM C;  2OCC B;  1K4C C;  1RPO A;  1YJ9 V;  1Y66 A;  3I56 V;  3GB7 C;  3E83 A;  1FFT B;  2Z3Y A;  1SET A;  4JTC B;  2Q67 A;  3CCE V;  1M56 B;  4GX2 A;  2IW5 A;  4QE9 A;  5B1A C;  1PD3 A;  1YTF D;  2YEV A;  4WFB V;  4X8A A;  2XAG A;  3ZRW B;  1THZ A;  4F4L A;  5LGN A;  2EIJ B;  2ZDI C;  2JK5 C;  2WLK A;  3DGE A;  1MG1 A;  4XDK A;  1YTF B;  2LFR A;  1H8E G;  2JIZ G;  4U7N A;  5H9C A;  1UJW B;  1YSC A;  4PA4 A;  3CME V;  2WLL A;  3CCU V;  1JPX A;  1GTO A;  1Y4M A;  4WCE V;  1QR9 A;  4PDL A;  5CN0 A;  1F4N A;  2YSU B;  3CYO A;  2XAJ A;  3STZ C;  3X2Q B;  1E79 G;  3H01 A;  2ZD9 A;  3SYC A;  4P30 A;  1KQS U;  3ZMV A;  1R3J C;  2DYR C;  1YI2 V;  2F43 G;  4JYC A;  2ZXW B;  4P9O A;  3FB6 C;  3E2E A;  2B5U A;  2ITD C;  2WWW A;  4TWK A;  4UV9 A;  4WFA V;  4RAI A;  1I5X A;  2ZDI A;  1H38 A;  2P90 A;  1S3J A;  3OUF A;  2LP7 A;  1GO3 F;  2DYR B;  4JTD B;  3F7V C;  2UXX A;  3GWO A;  3K04 A;  1M1K W;  2X7R B;  2HR3 A;  3EFF K;  5KA6 A;  1K9M W;  1VQK V;  2WLI B;  2EIK B;  1GM9 A;  1FXH A;  2GHY A;  1Q7Y W;  3RVY A;  3QNE A;  1W0K G;  4I5S A;  1BMF G;  4LP8 A;  4OXS A;  4HAM A;  1NVP D;  2H94 A;  2XAS A;  3JD2 A;  1F4M A;  1OCR C;  2AHY A;  1MOF A;  2IJJ A;  2JEU A;  4RQE A;  2HVK C;  2IH3 C;  2DW4 A;  3ABK B;  4RO2 A;  1JOY A;  1RM1 B;  3UKM A;  1S76 D;  4MW3 A;  3JD1 A;  2JJ1 G;  3LDE A;  3QO8 A;  4XDL A;  1P7B A;  4MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...