1EZJA

Crystal structure of the multimerization domain of the phosphoprotein from sendai virus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
114
structure length
114
Chain Sequence
ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOCAPSID PHOSPHOPROTEIN
publication title Tetrameric coiled coil domain of Sendai virus phosphoprotein.
pubmed doi rcsb
source organism Sendai virus (strain harris)
molecule tags Viral protein, transferase
total genus 47
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.320 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA01
1.10.287.340 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ezjA02
1EZJA
chains in the Genus database with same CATH superfamily
3T1YB 1V54B 3RYCB 1TVKB 5C8YB 3GVMA 1H38A 5JH7A 4FIPC 4MTXA 2UXDO 4DV6B 1R73A 2AHYA 4DV7O 1YJNV 5B1AB 4B3TO 1AR5A 2Q0OC 4D6TH 4KUMA 4WBNB 1THZA 3ZMTA 2IM9A 1RPOA 2XAHA 1S5LZ 4UV8A 1WAZA 5KUKA 2ZE5A 4KP4A 4DRXA 4WFGA 4JV5O 1LUVA 3ZRSA 4WCEV 5LYJA 1NR7A 3ETQA 1TGOA 4DV1B 4DR5B 2PI4A 1TUBA 2W0XA 2Z5UA 3H1KH 2VS0A 5IWAO 2HVJC 2RQ6A 5EC2C 4J7JA 3HKCB 2OIGA 1Q6UA 1NT2B 5DECA 1S0VA 2E76B 4LH6A 3IGAC 2H3OA 1RSOA 4G28B 1SZXA 1H2KA 2XTAA 4DYLA 1M5IA 3TGUH 1FJGB 2EBOA 5GW7A 2P6JA 1PKXA 3QO8A 4CC5A 4DV0O 2PY5A 4GLXA 4DK0A 2ZE7A 2PZSA 2ZXWB 4DV3O 1YSCA 2NNUA 3RYIB 4U3JB 3T4DA 4UCUA 4DR7B 1WPXA 2Y0PA 1M56C 3FB5C 1P7BA 3CCEV 3CC7V 2Y4TA 1IXMA 5LMUB 5B3SC 4UCTA 5IJ0A 3CD6V 2M7WA 4TOIA 1ZX3A 2ETNA 1M56B 4NVPA 4B08A 3RW0A 1U96A 3ML0A 3ZN1A 1GTOA 5B3SB 3J7AU 3ABTA 3H1HH 5LHHA 4LF7O 4FM2A 4N21A 4YY3O 2QSAA 2P7TC 3E8GA 2A0LA 1GM8A 4ZKIA 4RQFA 2JK5C 1HWYA 1N34B 4PA3A 3ZBHA 3FB7C 4O2AB 1SQXH 5BY1A 1GRJA 1N32B 1S77D 5IYCO 1GN4A 1FAFA 4LF4B 4D7TA 5FNVA 1QR9A 2R9AA 3HKBB 1X59A 1JJ2U 2HJDA 1R1BA 1Q8IA 4I9QA 3CB2A 4BIOA 2ZIOA 5JJNB 4MVQA 3A0BZ 3O9OA 3D36A 5IJ9B 5KLVH 5LXTA 4X66B 4LF6B 1NBMG 4RUEA 2ZE6A 1ZSPA 1GMGA 3L74H 3LNMB 5A2QN 3FYEB 4DV5O 4GT1A 5LHGA 1B6QA 2D3OW 1HNZO 4FLWA 1YHQV 4JI8O 3UT5B 1Y76A 1MSDA 1R3JC 1S5HC 4R8CA 4TV8B 2OTLV 1N0JA 1RP3B 1KBHA 2ZD9A 4P30A 1Q43A 2OTJV 5KHHA 2WLLA 2EIMC 3JATB 3OR7C 3KCXA 2HFEC 2A7WA 3FKSG 4C7UA 2EIMB 3JAKA 3K58A 3RFRA 4YHHO 2H8PC 1QR8A 3EHBB 2CTPA 2YXYA 1DK1A 4YJ3A 3K59A 2CK3G 5IDJA 3T1YO 4DR2B 3AG3C 3K08A 2O57A 2CDYA 3JALA 4K0KO 4H13B 1UPGA 4JI6B 1VEWA 2BTQA 4QPKA 1I5YA 1M4UA 1K9MW 5L3BA 5B5EZ 3JSNA 2F93B 1HW7A 4NYKA 4I55B 4H0LB 2XAGA 2ITCC 3ZS8C 3OUSA 3AG4C 1EN6A 2BCCH 4NTYA 1M9NA 4X89A 1VQMV 1VQPV 2YIAA 1K92A 4DV1O 4DR5O 1QHTA 5L3EA 4H44B 1HNWB 4JF3A 2ZDIC 2E75B 4L87A 3APOA 1LUWA 3AG4B 4J7ZA 3CSXA 2PF4E 2Q73A 2Y0IA 3D3IA 5CB4B 1XOUA 3ABKC 5E79Z 2UXBB 5FL7G 5FLXN 1Q6IA 4TV9A 2PYLA 2B1GA 4PA9A 1SA0A 1XEQA 4I4TB 3SDLA 5C93A 1GKFA 5EIBC 4NKGB 1Q82W 1JPXA 2W6IG 2WPDG 5A9GA 4A5UB 1W2BU 3ABKB 1FJGO 5GONB 2RN9A 5CA0A 5IE9A 2Q69A 3KKYA 4ABMA 1JR9A 1DGSA 2UUAB 4X1IB 3T1HO 1YCIA 4O4JA 3B2EE 3PN1A 4X65O 3G67A 3VQVA 4G27B 4O2BB 4JTAB 2YDEA 5KMGA 4FZ1A 1KECA 2YI9A 2KG7A 4QJFB 3T1CA 5EK0A 1B06A 4MTGA 3CCQV 3G6EV 5GTIZ 5KAIZ 1MMMA 1VF5B 1YEWA 5LBQA 4FJCC 4JYBA 4PA4A 4UCOA 5J2UA 3M7MX 4DV4O 3VBBA 1N34O 1E1RG 4U7NA 3AG2B 4LF4O 4JI2B 2QWOB 2RCVA 1V9PA 2BOBC 2IJJA 3OTOB 4LFAB 4EB6B 4PHZA 3FYIB 1SESA 4UUJC 4RO2A 3UO3A 4QPJA 1Q6HA 2NLJC 2UXDB 4ZHQB 1QQCA 2FKXA 3CRMA 1VQ4V 3DC5A 2DJVA 1VQ7V 1W0JG 4X66O 3B09A 3SPIA 1XREA 5CN0A 3BFRA 3SJAC 1KQSU 4TT3G 3UKMA 4FPPA 3ZRWB 1ROPA 3K03A 1NTKH 2BSKB 4DV2B 5IWAB 2LW7A 3F7VC 4OPAA 3ZCCA 4JASA 1DF5A 4BW5A 3AEIA 1RFYA 3U0ZA 4JI7O 1VF7A 3H1IH 3Q4HB 1YZBA 3VQYA 1M90W 3D3QA 1AROP 2EX3A 3SYCA 5KHKA 1WLEA 4JYYA 5LGTA 4Q20A 1PNKA 3A0HZ 3OAAG 4FZ0A 4DV0B 2HVKC 4X9QA 2Y69C 5KA6A 2ZIMA 4DV3B 3CEIA 2BE3A 4IGGA 1WA8B 1MZFA 4XDLA 5J2TB 2ADPA 4FLZA 2XUMA 2Y69B 4DR2O 3GWOA 4ZI7B 3SPHA 2QTSA 4E4EA 4UCRA 4LF8B 3IC7A 1KP2A 4NXMB 1BHBA 2CH7A 3KG2A 3ZHRA 4WF9V 5LOVA 1NVPB 1K4CC 3X2QC 3JAWA 4YY3B 4FVMA 1QLEC 3QG5A 2CTRA 4OXSA 5ITZA 5EYPB 2EJRA 3K5MA 3W7TA 3VOUA 1BSMA 3SPGA 2GV9A 2UUBO 2ZKOA 1L8DA 1HNWO 3X2QB 2CGOA 4I5SA 1QLEB 1ZAUA 4ICGA 1FKAO 3ICXA 3AG7A 2UXBO 1QBZA 4K8XA 1XNQO 3ZIAG 4WFBV 2Q0AA 1R3KC 4U3FH 2VQFO 3MAQA 4YJ2B 1FFXA 3H1LH 3ETDA 4F6RB 2WLJA 4TWKA 1I5XA 3CRAA 4DUZB 2Y4UA 4GKJB 3JASA 1IDSA 4B3RB 3FAVB 1K3EA 3I55V 5JCOA 3F5WC 1NH2D 5TISZ 1EFRG 4FLXA 4AQYO 2NR5A 4JI8B 5HFLA 5IYZA 3LDCA 1E1QG 1Y74A 4JI3B 5L3GA 4RQEA 2P22C 2Q4PA 1I94O 4JAVA 2CAZC 2Q7EA 1H2GA 4F4LA 5IYDO 1KU9A 3LSSA 3K57A 3B77A 2L6LA 2IJKA 4ZOLA 4U7OA 5H2FZ 2E74B 3IJ4A 5FPOA 3CJHA 1TAEA 3K3WA 4MVUA 2VRZA 4WFEA 1GN6A 2LW1A 1XNRB 4PV1B 1OCOC 1MABG 1BQZA 2Q5ZA 3UQ8A 4JI2O 2AW9A 2WLMA 3NXSA 2QWQB 4J10A 4GCZA 2FTKA 3OTOO 4LFAO 1K5QA 4AILC 1S76D 1R3LC 2ZCEA 1OCOB 5EC1C 3R65A 4BIZA 4K35A 4K0KB 3B40A 2P90A 2ZM6B 4BAYA 3CXHF 4HNAA 1YVWA 2W0FC 2G38A 2N74A 4NB5A 1JVMA 3H9VA 4JYAB 2PYJA 2OCCC 4UB6Z 3FX7A 4DR6O 1JFFB 1FS0G 1KP3A 2YIBD 3GWKC 2WLIB 1SS3A 2OCCB 3RYHA 4DUYO 2YEVB 1I08A 4DV2O 2EIKC 1AJNA 1OCRC 3D8CA 4KFMA 3RYFB 1S5JA 3MHSC 1H8EG 4LWSA 3OMIB 5CA1B 3CC2V 3CPWU 2DN9A 3JARA 1E79G 5LA6B 1K8AW 1K7DA 2EIKB 2BTQB 2JGDA 1OCRB 4BIUA 2P06A 1AJPA 1WJZA 3K79A 4I0XB 1CEZA 4X1YB 4DXWA 5L3CA 3HKEB 3L73H 2ZNIA 3T1HB 3OGCC 4LC1A 4X65B 5HFMA 1VARA 1RM1C 5KAFZ 2R9IA 1FXKC 2WA4A 2GTAA 1PPJH 1Q7YW 1FXVA 5JVDA 1F7YA 4JPRA 1IBLO 4FLUA 1MG1A 3K5NA 2ARHA 3PJSK 4KXRA 4LF8O 2RDCA 4NXMO 4GYCB 1FXKB 1YJWV 3E86A 1AP6A 2R9RB 2WLKA 2YIBA 1VQ6V 3BVOA 2DE0X 3SYPA 3I5DA 4NTXA 4I50B 2OT5A 4J42A 4DV4B 2IW5A 2UUCO 5L3FA 5BMVB 3U11A 1AI6A 2DOSA 2X6AA 4JI1B 1SQFA 2DQ0A 2QKSA 4FFBB 4BR6A 1YJ9V 2V4DA 3BY6A 4MW3A 3NR7A 3CCLV 3J81N 2A06H 2P4VA 2N05A 4N23A 3HB3B 4IIJB 1COWG 5KMGB 4X20B 4CS4A 3BA8A 3THOA 2AXTZ 3BCCH 3OD4A 1U97A 2VWJA 4PDMA 1P4RA 1A32A 4P9PA 4EKWA 2Z3YA 2ZNJA 3LDDA 2JGUA 1R6KA 5JQGB 2GUZB 3CE2A 4UVAA 4CS3A 4DUZO 4RUFA 2X6BA 1R6TA 2BOCC 1MA1A 4GKJO 5J2UB 1YXBA 4B3RO 2CTQA 4CH6A 1CXZB 1ENVA 3TJTA 2Q7HA 3DXRB 4H37A 1M1KW 5JJEB 2DYSC 3HKDA 2FYUH 4MT8A 1Z2GA 1PNLA 4JI3O 4O4HA 1XDCA 1I0HA 3E89A 2GHYA 2QA4V 1Z5WA 1XMQO 2QR4A 4JI7B 4DR4O 2DYSB 1GO3F 4J7KA 2B5UA 3L9DA 2R70A 2ZQMA 1TVKA 3RYCA 5C8YA 1BL8A 4JTCB 3E22B 4MW8A 1N36O 1S72V 4MS2A 3S3WA 4MTFA 1HP8A 2KKWA 3BPZA 1XNRO 5H5NA 3ZHVA 1KUQA 4B7EA 4WBNA 2GTSA 1G8MA 1N4CA 3JD1A 4XDKA 3R66A 1JQ0A 1OCCC 2RNBA 3RWRD 4PELA 1GM9A 2JRIA 1AP5A 4LFCB 1YDXA 2ZM6O 5EBWC 3ABMC 2ZT9B 4X62B 1UJWB 3AK1A 4JYAO 3AG3B 1FFTB 4HZ3A 4F6EA 1LR1A 4P9OA 3HKCA 1URFA 3M99B 3N2GA 1J5EO 4UVCA 4EEQA 1H2MA 3ABMB 1GM7A 4QNHB 2XT9A 4R7CA 2UUBB 1NQTA 4L8JA 2JJ1G 4CH5A 1RPRA 4BW9A 4D7SA 1AB3A 1IBKB 1X4TA 2WSSG 3QF7A 3RBZA 2X6CA 2HR3A 4LF5O 5B1BC 1K5SA 3G71V 1XNQB 1BHAA 3RYIA 4U3JA 2IH3C 1KYOF 5BR8O 1US6A 1V55C 4DW0A 4JZ2A 2VQFB 1R3IC 4KL1A 3K06A 4TQDA 1WB7A 3OMNB 4LCUC 5KX5B 5B1BB 4FM0A 1BGYH 1D2DA 3CCRV 5K1PA 2Q7GA 3JAWB 1Z5VA 4LF9O 4LBEC 1MOFA 2IJIA 1L0LH 1V55B 2YUAA 2LQTA 1SQGA 3K04A 2ADQB 3MHHC 2RMKB 4R6ZA 4AQYB 3OM3B 2H94A 4XDJA 2ITDC 1AI7A 2DWDC 4O4LB 2IU0A 1I94B 2PUSA 4WFAV 2DMXA 4O2AA 3OEHG 3W7XA 4J80A 3N2KB 1YTFB 1WNSA 1FPOA 3A0RA 3ZHQA 3HKBA 1AI5A 1VQ8V 5JJJB 3ZMVA 5EBMC 5EZYB 3RT3C 2YC0A 1F4MA 4TQFA 4RAIA 5IJ9A 1Q81W 4W4KA 4IYIA 4JI1O 1AI4A 1VF6A 1WN7A 4IHJB 5LMNB 2ZR2A 3U10A 3AK3A 3AG1C 3OMAB 1L1FA 3SPJA 4AI8A 3UCSC 4TSFG 1ZL8A 2ILMA 3JAMN 5DM6V 5AG2A 4QE9A 2OCHA 3UT5A 2F23A 4TV8A 1ZLZA 1FYJA 2PTMA 1AJQA 4LNUB 1AVMA 1OJHA 1BT8A 4DR6B 3RVZA 3E8FA 4Z1VA 1G4YB 4O4IB 3JATA 3LNNA 1EZVH 4H33A 3OFNG 4LFBO 1QLNA 5LP6A 4DUYB 3TXQA 1Q86W 4KHPB 1P49A 4I9WA 3SYAA 3B4SA 1IXBA 3FD9A 3ZMUA 1W0KG 4X88A 5JH7B 2E5LO 2F66C 4HNAB 5EIBD 1JOYA 4CS2A 1G1XB 3SGIA 3S3XA 4FLTA 5EBLC 1VIBA 2CTWA 4P2ZA 1NR1A 3C90A 3OTFA 4K3AA 2ZR3A 4DRXB 5LHIA 5LYJB 3G6BA 3RYHB 1SC5B 1TUBB 1QVGU 4I55A 1CP9A 1K97A 4W4LA 1VQLV 1P84F 2CUGA 2Y48A 1KKDA 1VQ5V 1IBLB 2PGGA 4GX1A 4LFCO 2GSMB 2QM8A 1O9HA 2AGAA 2UXXA 4X62O 1H8HG 3OEEG 2BTOA 4CH4A 4B3MO 1K34A 1S3JA 3O65A 3SYQA 1RSOB 3W7SA 4PI2A 1Q5OA 3ZJZA 2ZDIA 3ZHUA 5GTHZ 2QWPB 4I4TA 1JJOA 1DLBA 4FFKA 2UUCB 4UVBA 1N8RW 5DN6G 2YICA 1R6NA 5E1AC 1IBKO 5GONA 2QM4A 2KSDA 1Y66A 4OX9O 4GKKB 4X1KA 2D2CB 5KUMA 4X1IA 3WFVA 5IJ0B 3H01A 4JAAA 1XILA 1BZKA 2K9PA 2Q9LA 1HNXO 2F43G 4O2BA 1JX9A 4JI0B 4DR1O 2WWWA 2ODMA 2GDSA 3E35A 3P3PA 3SJCC 1K33A 3C3SA 1BMFG 1SETA 2IJHA 4MVMA 3K5OA 3CCJV 1P7GA 4NTWA 3LSUA 1XHXA 4DR3B 2QM7A 2EZOA 2W6JG 1BE3H 5FNVB 3D36C 4OPHA 3E8HA 1I7FA 3SPCA 5KHJA 1PNMA 2QKAA 1XMQB 4DR4B 1SKVA 2MK3A 5CBFA 4B3SO 3L72H 5DEDA 1IBMB 4EB6A 3W7WA 1W59A 3KZIZ 1N36B 2JDIG 5LXTB 5LGNA 1PV0A 2MW2B 2E3CA 4ZHQA 1KKCA 4HAMA 3JD0A 1ZUQA 4YIOA 3WB0A 1AR1B 2LFSA 4Q6GA 4CH3A 1HR0B 3TETA 5LMNO 1Y76B 3H1JH 4TUYA 1O9GA 1MSWD 1NVPD 2WAMA 3ZRWA 2WLLB 1JA8A 1IZ3A 3UO2A 4PD4F 3SYOA 4J11A 3G80A 5B1AC 5B1OA 3HR0A 1J5EB 3JAKB 3Q4HA 4PJ0Z 4PA7A 3SR2C 4JI5O 3JSLA 3T4ZA 4G2KA 1B04A 2UU9B 4KHPO 4YJ3B 2LGWA 4J41A 3RGBA 3RN4A 2WA3A 1TA8A 3TK1A 4QGPA 4FK5C 4R50A 4LF5B 3IC9A 3JALB 1WA8A 5J2TA 5BR8B 2B1IA 2F4VO 3ZX6A 2UXCB 2DWEC 4ZI7A 5KA5A 1VQKV 1KC8W 3BAAA 1BCCH 4LF9B 2JS3A 4MVSA 3N2GB 3ASOC 1ZWIC 4QE7A 2M6YA 3K0GA 2ZXWC 3CYOA 3BRCA 3B8MA 2Q8VA 4MTOA 3KCYA 3W7UA 3ASOB 1VMGA 1SQBH 3J80N 1F4NA 2FMLA 5EYPA 4MVRA 1RM1B 4TV9B 2OIEA 3WU2Z 2HEPA 1CPYA 3BHPA 1SA0B 2EULA 2HJFC 2XHBA 4Z1MG 4NXNB 5CBHA 1PL4A 4FLVA 4IYHA 2EINC 5H9CA 4K8ZA 2HHHO 3A2FA 5L3DA 1EN4A 5CA0B 3OT7A 2EJ7A 2A3QA 2JJ2G 4JAUA 1TUEB 1XBLA 2LGQA 3RVYA 4O4JB 4YJ2A 3JD4A 1OHHG 1G6UA 2EINB 4F6RA 3OUFA 2Q67A 2V1DA 4GKKO 1BQ0A 4UXNA 4EFEA 3QO7A 3LUTB 3IAYA 5BZBA 3FAVA 3ASNC 2P5OA 2KG7B 4PDLA 3F7YC 4JI0O 1BS3A 2KQXA 5LGUA 3ABUA 1QNMA 2JS5A 1SERA 1M93A 1FXHA 2DYRC 3BABA 3ZRXA 3ASNB 3P32A 1VF6C 3A8TA 3CMAV 4MSWC 2HG5C 2QTOA 4PA6A 1YITV 2DW4A 3I56V 4LFBB 4FMTA 1B3QA 2DYRB 4UCVA 4HBNA 4DR3O 3QNEA 3OGIB 2Q68A 3B8NA 3ETGA 3EXAA 2P4KA 1XL4A 4CBCA 3VQXA 5J9PC 2HKOA 4UCSA 5FPRA 4ZBMA 3WG7C 4E2LA 1K73W 2AZ2A 3E8BA 1ORQC 1DTOA 5CMUA 1F51A 1ZL8B 1XI1A 3ZHTA 1SQPH 2E5LB 1GH6A 1GK9A 1N33O 2YI8A 4HYOA 1IBMO 3WG7B 2YSUB 5LP6C 1D5AA 4GUNA 2XASA 3QVNA 1KMIZ 2VQEO 1YIJV 3ZRVA 2N04A 3JD2A 5LL6Y 1PL0A 5LP6B 1UFIA 3JYCA 1Y4MA 3QTCA 4LP8A 1HR0O 5H6RA 4DO2A 3FB6C 2QJ1A 2JVDA 1JFFA 1NKDA 4LR3A 4JI4O 2ZE8A 2WLIA 3HPLC 3CCSV 1AILA 1OZ0A 2YEVA 3N27A 3MD0A 1OCCB 1XHZA 4B3MB 3RYFA 2IU3A 5B1NA 1OV9A 3STZC 5CA1A 2VWKA 5LA6A 5F2VO 1QU7A 3TXSA 4LH7A 2C2AA 4UFZA 2QWNB 5H6QA 5KHIA 1QVFU 4DV6O 3L70H 1LNQA 1L0NH 1WP8A 2DQ3A 1NJIW 3FFQA 5KHGA 2UU9O 4I0XA 4JTDB 1VP7A 1GN3A 2XNDG 4X1YA 1IURA 4OX9B 3HKEA 1EM1A 1XMOB 1VQNV 1PM9A 1HNXB 2EIJC 1XQ8A 2UXCO 3WB1A 5IT9N 4DR1B 3T2MA 2CH7B 5LOVB 2EIJB 3LSQA 4EFBA 3DGEA 1FXKA 5ITZB 4J9YB 1EN5A 3SJBC 4JGSA 3JCUZ 1PP9H 3DTUB 4X64B 1PD3A 1MZEA 3OR6C 4WFFA 4I50A 1SZTA 2RJZA 4X1KB 5BMVA 3ZEDA 4BWAA 2F1MA 2AHZA 2F95B 4FFBA 4DR7O 2FB5A 4YIPA 4B3SB 4NXNO 5LMUO 4UB8Z 1FFXB 3C3TA 4IIJA 3ZMZA 1D5NA 1NZ6A 4OGQB 5JCOC 4X20A 2CGNA 4NR1A 4MVZA 2YIDA 1QCEA 1JMKC 3P30A 3JASB 5CBGA 1H2SB 2XAJA 5JQGA 1T5EA 3CCUV 3DSQA 4ZIBA 2GUZA 3AG2C 3ZN0A 3L75H 5IYZB 5K1XA 2YXHA 1Y74B 3OW2U 1KB9F 1DF4A 2QKCA 3DXRA 3ZMSA 1VQ9V 2ZINA 1K4DC 1NU1H 2NN4A 1N32O 2XAQA 4UV9A 3P3NA 2R72A 3AG1B 4B7KA 4ZOLB 1IVSA 3AK2A 3CJHB 1WP7A 5D5QA 2XAFA 3K0DA 4JI5B 4X8AA 3CWBH 4ASUG 4DV7B 4B3TB 4WFHA 3EVKA 3E22A 3JCZA 2OYQA 2Z0AA 4LF6O 3L71H 5CA3A 4PDVA 3G4SV 2XOKG 4TUYB 3WB2A 4JV5B 4QIWF 2F4VB 3E2EA 2LO1A 1XL6A 3IFXA 2IBZH 2GBOA 3CRCA 3K9SA 5IY5C 3CCVV 2WLNA 2LFRA 1SQVH 1NH2B 5B66Z 4I7ZB 2OWOA 1YI2V 2V7QG 3ETEA 1EZJA 5IY5B 2L35A 1NTZH 2CE4A 3BA9A 2QGNA 2JIZG 2X0LA 2LP7A 1H2NA 1YTFD 1IX9A 4GX2A 2X7RB 1Y67A 4LWSB 3GB7C 3TCUA 1AR4A 1J95A 3JARB 5D5PA 4FLYA 3ABLC 3QO5A 1WB8A 2JGDB 2QEXV 3CP1A 5CB4A 4J9ZB 2HHHB 4CZZA 2PI5A 1SQQH 3VQWA 3ABLB 4JI6O 3CX5F 1MNGA 5JWPA 4AHCA 2WLHA 3K9AA 5KX5A 1F23A 3CC4V 3EFFK 4GX5A 4PDRA 2JEUA 4LF7B 2JEXA 2QWRB 1NTMH 2IH1C 5JVDB 1KD1W 1XMOO 2AZ0A 2K1EA 2LJ2A 1N0NA 1NI8A 2EZPA 2A79B 1FD9A 3CHXA 4O4LA 3APQA 3M8AA 4IL6Z 1Y6XA 2FL4A 4PI0A 2ATKC 3N2KA 4YXWG 3DC6A 1SRYA 3STLC 1JCHA 2KB1A 4X64O 1WPBA 4IT5A 3CRQA 3SJQC 5EZYA 3LDEA 4JYCA 3CRRA 1M57C 2UUAO 1H2LA 1Q90D 3ZHSA 5BXZA 2HLDG 1YF2A 4DV5B 2A9HA 3F5TA 4IHJA 3CMEV 4FM1A 1HDJA 1HNZB 1N33B 2HP8A 2P67A 3JD3A 1GN2A 1M57B 2QE7G 3CS5A 3K5LA 4CC6A 3UM7A 2YS8A 4DK1A 1SF9A 2B9ZA 2EILC 4GX0A 4MVOA 2VQEB 2QDOA 3BEHA 4JZGA 4GZRB 5IYBO 1Q3EA 1OCZC 4XBFA 1ZTEA 1VQOV 4LNUA 2UXNA 3HKDB 2EILB 1EBOA 4O4IA 3CCMV 4DW1A 4Z2WA 4O4HB 4JI4B 1XUQA 1V54C 2Q6AA 4YHHB 1OCZB 1GAXA 3FB8C 4RWUA 1NS1A 2YXLA 3OE7G 2BSKA 3MDSA 3CXCU 3E83A
chains in the Genus database with same CATH topology
1V55B 3P32A 4XDLA 3K04A 3CMAV 1V54B 4MSWC 2HG5C 2QTOA 4PA6A 3MHHC 1YITV 1H38A 2Y69B 4R6ZA 2DW4A 3I56V 3GWOA 3SPHA 4FMTA 3OM3B 2H94A 4FIPC 4MTXA 4XDJA 2DYRB 2ITDC 1AI7A 1R73A 3QNEA 2AHYA 2Q68A 2DWDC 1YJNV 5B1AB 3B8NA 3ETGA 3IC7A 1KP2A 4KUMA 2IU0A 4WFAV 1XL4A 4CBCA 1BHBA 1THZA 5J9PC 2HKOA 4ZBMA 3WG7C 4E2LA 3KG2A 3ZMTA 4WF9V 1K73W 3OEHG 1RPOA 3W7XA 3E8BA 1ORQC 1DTOA 1K4CC 1NVPB 2XAHA 4UV8A 3X2QC 1YTFB 5CMUA 5KUKA 1F51A 4KP4A 1QLEC 3A0RA 4WFGA 1GK9A 1AI5A 3ZRSA 4WCEV 1VQ8V 1NR7A 4OXSA 3ZMVA 5EBMC 4HYOA 3WG7B 2EJRA 2YSUB 2PI4A 2Z5UA 3W7TA 3VOUA 3SPGA 1F4MA 2HVJC 3X2QB 2XASA 4I5SA 5EC2C 1QLEB 4RAIA 1YIJV 3ZRVA 1Q81W 1AI4A 3JD2A 1QBZA 1PL0A 1S0VA 2ZR2A 3IGAC 3ZIAG 3JYCA 4WFBV 1Y4MA 4LP8A 3AG1C 3OMAB 5H6RA 1L1FA 4DO2A 3FB6C 4G28B 3SPJA 1NKDA 4TSFG 1R3KC 5DM6V 2EBOA 2WLIA 5GW7A 2P6JA 4QE9A 1PKXA 3QO8A 3HPLC 3ETDA 3CCSV 2YEVA 1OZ0A 2WLJA 4TWKA 2ZXWB 1I5XA 3MD0A 1OCCB 1YSCA 2NNUA 3T4DA 1AJQA 1WPXA 2IU3A 3FB5C 1M56C 5B1NA 3E8FA 3RVZA 1P7BA 1G4YB 3STZC 1K3EA 3CCEV 3I55V 3CC7V 1IXMA 3F5WC 3ZRXA 1NH2D 4H33A 2C2AA 1EFRG 3OFNG 5B3SC 1QLNA 3CD6V 5H6QA 5HFLA 2M7WA 1QVFU 3LDCA 1E1QG 1LNQA 5L3GA 1M56B 1Q86W 4RQEA 2DQ3A 1NJIW 4JAVA 4I9WA 3RW0A 3SYAA 4JTDB 1H2GA 4F4LA 5IYDO 3ML0A 3ZN1A 1GTOA 5B3SB 2XNDG 3ABTA 3LSSA 3B77A 3ZMUA 5LHHA 1W0KG 4N21A 2IJKA 4X88A 2P7TC 3E8GA 4U7OA 2A0LA 1VQNV 1GM8A 4ZKIA 4RQFA 2EIJC 1JOYA 2JK5C 3K3WA 4MVUA 4WFEA 1HWYA 4PA3A 5EBLC 3FB7C 3T2MA 4P2ZA 1NR1A 1S77D 5IYCO 1OCOC 1MABG 1QR9A 2EIJB 3LSQA 2WLMA 2ZR3A 3NXSA 4GCZA 1JJ2U 2FTKA 3DGEA 5LHIA 1FXKA 4J9YB 1S76D 1K5QA 1R3LC 1QVGU 1CP9A 4MVQA 4JGSA 1OCOB 5EC1C 1K97A 3R65A 4BIZA 1VQLV 2Y48A 2P90A 3DTUB 3D36A 4BAYA 1VQ5V 1KKDA 4GX1A 1PD3A 3OR6C 2W0FC 2GSMB 2QM8A 4WFFA 1JVMA 3E83A 1SZTA 2OCCC 2UXXA 1NBMG 1H8HG 4RUEA 3OEEG 2AHZA 1K34A 1S3JA 3SYQA 1GMGA 3LNMB 3FYEB 1FS0G 1KP3A 4GT1A 5LHGA 3W7SA 1B6QA 2D3OW 2WLIB 3ZJZA 3ZMZA 2OCCB 2ZDIA 1YHQV 1DLBA 2YEVB 4MVZA 1R3JC 1S5HC 4UVBA 4R8CA 2OTLV 1N8RW 2EIKC 1QCEA 5DN6G 2ZD9A 4P30A 1AJNA 1OCRC 4KFMA 1R6NA 3P30A 5E1AC 3MHSC 2OTJV 5CBGA 2WLLA 2EIMC 1H8EG 3OMIB 3OR7C 3CC2V 2XAJA 1Y66A 3CPWU 3CCUV 1E79G 2HFEC 3FKSG 3WFVA 5KUMA 3AG2C 3ZN0A 3H01A 1K8AW 1FXHA 1K7DA 2EIKB 1OCRB 4BIUA 3OW2U 2F43G 2EIMB 1DF4A 1JX9A 2WWWA 1AJPA 3E35A 3K79A 3ZMSA 1VQ9V 1CEZA 1K4DC 2H8PC 1K33A 4DXWA 1QR8A 2XAQA 5L3CA 4UV9A 3EHBB 3AG1B 1BMFG 3OGCC 1SETA 4LC1A 2IJHA 4MVMA 5HFMA 1RM1C 2CK3G 5IDJA 3CCJV 3AG3C 2R9IA 3K08A 1FXKC 2XAFA 3K0DA 1Q7YW 1FXVA 4JPRA 2QM7A 4X8AA 2EZOA 4ASUG 1MG1A 2W6JG 4QPKA 1I5YA 3PJSK 4WFHA 1K9MW 5L3BA 3JCZA 3E8HA 1FXKB 5CA3A 3E86A 1YJWV 4PDVA 3SPCA 1PNMA 2R9RB 2WLKA 3G4SV 2XOKG 1VQ6V 2MK3A 2XAGA 2ITCC 3OUSA 3AG4C 5CBFA 3SYPA 4QIWF 3E2EA 1M9NA 4X89A 1XL6A 3W7WA 1VQMV 1VQPV 3IFXA 1K92A 2JDIG 2OT5A 5L3EA 2IW5A 5LGNA 5IY5C 4JF3A 5L3FA 2ZDIC 3CCVV 4L87A 1AI6A 2X6AA 3AG4B 2WLNA 2DQ0A 2LFRA 2QKSA 3D3IA 3JD0A 4HAMA 1YJ9V 4MW3A 3BY6A 1NH2B 3CCLV 3ABKC 4N23A 5FL7G 3HB3B 1AR1B 1YI2V 2B1GA 2LFSA 2V7QG 3ETEA 4PA9A 1EZJA 5IY5B 3TETA 1COWG 5C93A 1GKFA 2JIZG 1Q82W 1JPXA 1MSWD 2W6IG 2WPDG 2X0LA 4PDMA 1NVPD 1W2BU 2LP7A 3ABKB 1P4RA 1YTFD 2WAMA 4GX2A 2X7RB 4P9PA 3ZRWA 4EKWA 2WLLB 2Z3YA 3LDDA 3GB7C 1R6KA 2Q69A 3TCUA 1J95A 3SYOA 4UVAA 3ABLC 3QO5A 4RUFA 2X6BA 5B1AC 2QEXV 2BOCC 5B1OA 3CP1A 4J9ZB 4G27B 4JTAB 1ENVA 4CZZA 2PI5A 4H37A 4PA7A 1M1KW 3T4ZA 4G2KA 3ABLB 2DYSC 4MT8A 1PNLA 1KECA 2WLHA 3K9AA 4QJFB 1F23A 3CC4V 3EFFK 3E89A 5EK0A 2GHYA 3T1CA 4MTGA 3TK1A 3CCQV 2QA4V 4GX5A 4FK5C 4PDRA 4R50A 3G6EV 2JEUA 2JEXA 2DYSB 1GO3F 2IH1C 5LBQA 2B5UA 4FJCC 4JYBA 2B1IA 4PA4A 1KD1W 2ZQMA 2DWEC 1BL8A 2K1EA 4JTCB 4MW8A 1S72V 4MS2A 3VBBA 4MTFA 2EZPA 5KA5A 2A79B 1E1RG 1VQKV 4U7NA 1KC8W 3AG2B 4MVSA 3ASOC 2BOBC 1G8MA 2IJJA 1ZWIC 3JD1A 4QE7A 4XDKA 2ATKC 1JQ0A 3K0GA 2ZXWC 3CYOA 3FYIB 1SESA 4UUJC 4RO2A 1OCCC 3B8MA 4YXWG 4QPJA 2NLJC 4MTOA 4PELA 1SRYA 1GM9A 3W7UA 3STLC 3ASOB 1JCHA 2KB1A 1F4NA 5EBWC 1VQ4V 4MVRA 3SJQC 1VQ7V 3LDEA 3ABMC 1RM1B 1W0JG 4JYCA 1UJWB 1M57C 1CPYA 3AG3B 1FFTB 4HZ3A 4P9OA 2HJFC 3SPIA 5CN0A 2HLDG 2A9HA 4Z1MG 3M99B 3CMEV 5CBHA 1KQSU 4TT3G 4UVCA 3UKMA 3ABMB 2EINC 2P67A 5H9CA 4FPPA 1GM7A 3ZRWB 5L3DA 1ROPA 3JD3A 1M57B 2QE7G 3K03A 4QNHB 4R7CA 1NQTA 2JJ2G 2JJ1G 3F7VC 3UM7A 1RPRA 4JAUA 1TUEB 3RVYA 2WSSG 2EILC 4GX0A 3JD4A 1OHHG 4JASA 4MVOA 1DF5A 3ZCCA 4BW5A 2EINB 3RBZA 3BEHA 3AEIA 2X6CA 2HR3A 3OUFA 5IYBO 5B1BC 1K5SA 1OCZC 3G71V 2Q67A 4XBFA 2V1DA 1BHAA 1VQOV 4UXNA 1M90W 2IH3C 2UXNA 3QO7A 1AROP 3LUTB 2EILB 1EBOA 3SYCA 1WLEA 5BZBA 3CCMV 3ASNC 1V55C 5LGTA 1R3IC 3F7YC 4PDLA 4Q20A 1V54C 2Q6AA 3K06A 3OMNB 1PNKA 4LCUC 5B1BB 3OAAG 1OCZB 5LGUA 3CCRV 2HVKC 3FB8C 3ABUA 2Y69C 5KA6A 3OE7G 1SERA 3CXCU 4LBEC 1MOFA 2DYRC 2IJIA 3ASNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZJ A; 
#chains in the Genus database with same CATH topology
 3T1Y B;  1V54 B;  3RYC B;  1TVK B;  5C8Y B;  3GVM A;  1H38 A;  5JH7 A;  4FIP C;  4MTX A;  2UXD O;  4DV6 B;  1R73 A;  2AHY A;  4DV7 O;  1YJN V;  5B1A B;  4B3T O;  1AR5 A;  2Q0O C;  4D6T H;  4KUM A;  4WBN B;  1THZ A;  3ZMT A;  2IM9 A;  1RPO A;  2XAH A;  1S5L Z;  4UV8 A;  1WAZ A;  5KUK A;  2ZE5 A;  4KP4 A;  4DRX A;  4WFG A;  4JV5 O;  1LUV A;  3ZRS A;  4WCE V;  5LYJ A;  1NR7 A;  3ETQ A;  1TGO A;  4DV1 B;  4DR5 B;  2PI4 A;  1TUB A;  2W0X A;  2Z5U A;  3H1K H;  2VS0 A;  5IWA O;  2HVJ C;  2RQ6 A;  5EC2 C;  4J7J A;  3HKC B;  2OIG A;  1Q6U A;  1NT2 B;  5DEC A;  1S0V A;  2E76 B;  4LH6 A;  3IGA C;  2H3O A;  1RSO A;  4G28 B;  1SZX A;  1H2K A;  2XTA A;  4DYL A;  1M5I A;  3TGU H;  1FJG B;  2EBO A;  5GW7 A;  2P6J A;  1PKX A;  3QO8 A;  4CC5 A;  4DV0 O;  2PY5 A;  4GLX A;  4DK0 A;  2ZE7 A;  2PZS A;  2ZXW B;  4DV3 O;  1YSC A;  2NNU A;  3RYI B;  4U3J B;  3T4D A;  4UCU A;  4DR7 B;  1WPX A;  2Y0P A;  1M56 C;  3FB5 C;  1P7B A;  3CCE V;  3CC7 V;  2Y4T A;  1IXM A;  5LMU B;  5B3S C;  4UCT A;  5IJ0 A;  3CD6 V;  2M7W A;  4TOI A;  1ZX3 A;  2ETN A;  1M56 B;  4NVP A;  4B08 A;  3RW0 A;  1U96 A;  3ML0 A;  3ZN1 A;  1GTO A;  5B3S B;  3J7A U;  3ABT A;  3H1H H;  5LHH A;  4LF7 O;  4FM2 A;  4N21 A;  4YY3 O;  2QSA A;  2P7T C;  3E8G A;  2A0L A;  1GM8 A;  4ZKI A;  4RQF A;  2JK5 C;  1HWY A;  1N34 B;  4PA3 A;  3ZBH A;  3FB7 C;  4O2A B;  1SQX H;  5BY1 A;  1GRJ A;  1N32 B;  1S77 D;  5IYC O;  1GN4 A;  1FAF A;  4LF4 B;  4D7T A;  5FNV A;  1QR9 A;  2R9A A;  3HKB B;  1X59 A;  1JJ2 U;  2HJD A;  1R1B A;  1Q8I A;  4I9Q A;  3CB2 A;  4BIO A;  2ZIO A;  5JJN B;  4MVQ A;  3A0B Z;  3O9O A;  3D36 A;  5IJ9 B;  5KLV H;  5LXT A;  4X66 B;  4LF6 B;  1NBM G;  4RUE A;  2ZE6 A;  1ZSP A;  1GMG A;  3L74 H;  3LNM B;  5A2Q N;  3FYE B;  4DV5 O;  4GT1 A;  5LHG A;  1B6Q A;  2D3O W;  1HNZ O;  4FLW A;  1YHQ V;  4JI8 O;  3UT5 B;  1Y76 A;  1MSD A;  1R3J C;  1S5H C;  4R8C A;  4TV8 B;  2OTL V;  1N0J A;  1RP3 B;  1KBH A;  2ZD9 A;  4P30 A;  1Q43 A;  2OTJ V;  5KHH A;  2WLL A;  2EIM C;  3JAT B;  3OR7 C;  3KCX A;  2HFE C;  2A7W A;  3FKS G;  4C7U A;  2EIM B;  3JAK A;  3K58 A;  3RFR A;  4YHH O;  2H8P C;  1QR8 A;  3EHB B;  2CTP A;  2YXY A;  1DK1 A;  4YJ3 A;  3K59 A;  2CK3 G;  5IDJ A;  3T1Y O;  4DR2 B;  3AG3 C;  3K08 A;  2O57 A;  2CDY A;  3JAL A;  4K0K O;  4H13 B;  1UPG A;  4JI6 B;  1VEW A;  2BTQ A;  4QPK A;  1I5Y A;  1M4U A;  1K9M W;  5L3B A;  5B5E Z;  3JSN A;  2F93 B;  1HW7 A;  4NYK A;  4I55 B;  4H0L B;  2XAG A;  2ITC C;  3ZS8 C;  3OUS A;  3AG4 C;  1EN6 A;  2BCC H;  4NTY A;  1M9N A;  4X89 A;  1VQM V;  1VQP V;  2YIA A;  1K92 A;  4DV1 O;  4DR5 O;  1QHT A;  5L3E A;  4H44 B;  1HNW B;  4JF3 A;  2ZDI C;  2E75 B;  4L87 A;  3APO A;  1LUW A;  3AG4 B;  4J7Z A;  3CSX A;  2PF4 E;  2Q73 A;  2Y0I A;  3D3I A;  5CB4 B;  1XOU A;  3ABK C;  5E79 Z;  2UXB B;  5FL7 G;  5FLX N;  1Q6I A;  4TV9 A;  2PYL A;  2B1G A;  4PA9 A;  1SA0 A;  1XEQ A;  4I4T B;  3SDL A;  5C93 A;  1GKF A;  5EIB C;  4NKG B;  1Q82 W;  1JPX A;  2W6I G;  2WPD G;  5A9G A;  4A5U B;  1W2B U;  3ABK B;  1FJG O;  5GON B;  2RN9 A;  5CA0 A;  5IE9 A;  2Q69 A;  3KKY A;  4ABM A;  1JR9 A;  1DGS A;  2UUA B;  4X1I B;  3T1H O;  1YCI A;  4O4J A;  3B2E E;  3PN1 A;  4X65 O;  3G67 A;  3VQV A;  4G27 B;  4O2B B;  4JTA B;  2YDE A;  5KMG A;  4FZ1 A;  1KEC A;  2YI9 A;  2KG7 A;  4QJF B;  3T1C A;  5EK0 A;  1B06 A;  4MTG A;  3CCQ V;  3G6E V;  5GTI Z;  5KAI Z;  1MMM A;  1VF5 B;  1YEW A;  5LBQ A;  4FJC C;  4JYB A;  4PA4 A;  4UCO A;  5J2U A;  3M7M X;  4DV4 O;  3VBB A;  1N34 O;  1E1R G;  4U7N A;  3AG2 B;  4LF4 O;  4JI2 B;  2QWO B;  2RCV A;  1V9P A;  2BOB C;  2IJJ A;  3OTO B;  4LFA B;  4EB6 B;  4PHZ A;  3FYI B;  1SES A;  4UUJ C;  4RO2 A;  3UO3 A;  4QPJ A;  1Q6H A;  2NLJ C;  2UXD B;  4ZHQ B;  1QQC A;  2FKX A;  3CRM A;  1VQ4 V;  3DC5 A;  2DJV A;  1VQ7 V;  1W0J G;  4X66 O;  3B09 A;  3SPI A;  1XRE A;  5CN0 A;  3BFR A;  3SJA C;  1KQS U;  4TT3 G;  3UKM A;  4FPP A;  3ZRW B;  1ROP A;  3K03 A;  1NTK H;  2BSK B;  4DV2 B;  5IWA B;  2LW7 A;  3F7V C;  4OPA A;  3ZCC A;  4JAS A;  1DF5 A;  4BW5 A;  3AEI A;  1RFY A;  3U0Z A;  4JI7 O;  1VF7 A;  3H1I H;  3Q4H B;  1YZB A;  3VQY A;  1M90 W;  3D3Q A;  1ARO P;  2EX3 A;  3SYC A;  5KHK A;  1WLE A;  4JYY A;  5LGT A;  4Q20 A;  1PNK A;  3A0H Z;  3OAA G;  4FZ0 A;  4DV0 B;  2HVK C;  4X9Q A;  2Y69 C;  5KA6 A;  2ZIM A;  4DV3 B;  3CEI A;  2BE3 A;  4IGG A;  1WA8 B;  1MZF A;  4XDL A;  5J2T B;  2ADP A;  4FLZ A;  2XUM A;  2Y69 B;  4DR2 O;  3GWO A;  4ZI7 B;  3SPH A;  2QTS A;  4E4E A;  4UCR A;  4LF8 B;  3IC7 A;  1KP2 A;  4NXM B;  1BHB A;  2CH7 A;  3KG2 A;  3ZHR A;  4WF9 V;  5LOV A;  1NVP B;  1K4C C;  3X2Q C;  3JAW A;  4YY3 B;  4FVM A;  1QLE C;  3QG5 A;  2CTR A;  4OXS A;  5ITZ A;  5EYP B;  2EJR A;  3K5M A;  3W7T A;  3VOU A;  1BSM A;  3SPG A;  2GV9 A;  2UUB O;  2ZKO A;  1L8D A;  1HNW O;  3X2Q B;  2CGO A;  4I5S A;  1QLE B;  1ZAU A;  4ICG A;  1FKA O;  3ICX A;  3AG7 A;  2UXB O;  1QBZ A;  4K8X A;  1XNQ O;  3ZIA G;  4WFB V;  2Q0A A;  1R3K C;  4U3F H;  2VQF O;  3MAQ A;  4YJ2 B;  1FFX A;  3H1L H;  3ETD A;  4F6R B;  2WLJ A;  4TWK A;  1I5X A;  3CRA A;  4DUZ B;  2Y4U A;  4GKJ B;  3JAS A;  1IDS A;  4B3R B;  3FAV B;  1K3E A;  3I55 V;  5JCO A;  3F5W C;  1NH2 D;  5TIS Z;  1EFR G;  4FLX A;  4AQY O;  2NR5 A;  4JI8 B;  5HFL A;  5IYZ A;  3LDC A;  1E1Q G;  1Y74 A;  4JI3 B;  5L3G A;  4RQE A;  2P22 C;  2Q4P A;  1I94 O;  4JAV A;  2CAZ C;  2Q7E A;  1H2G A;  4F4L A;  5IYD O;  1KU9 A;  3LSS A;  3K57 A;  3B77 A;  2L6L A;  2IJK A;  4ZOL A;  4U7O A;  5H2F Z;  2E74 B;  3IJ4 A;  5FPO A;  3CJH A;  1TAE A;  3K3W A;  4MVU A;  2VRZ A;  4WFE A;  1GN6 A;  2LW1 A;  1XNR B;  4PV1 B;  1OCO C;  1MAB G;  1BQZ A;  2Q5Z A;  3UQ8 A;  4JI2 O;  2AW9 A;  2WLM A;  3NXS A;  2QWQ B;  4J10 A;  4GCZ A;  2FTK A;  3OTO O;  4LFA O;  1K5Q A;  4AIL C;  1S76 D;  1R3L C;  2ZCE A;  1OCO B;  5EC1 C;  3R65 A;  4BIZ A;  4K35 A;  4K0K B;  3B40 A;  2P90 A;  2ZM6 B;  4BAY A;  3CXH F;  4HNA A;  1YVW A;  2W0F C;  2G38 A;  2N74 A;  4NB5 A;  1JVM A;  3H9V A;  4JYA B;  2PYJ A;  2OCC C;  4UB6 Z;  3FX7 A;  4DR6 O;  1JFF B;  1FS0 G;  1KP3 A;  2YIB D;  3GWK C;  2WLI B;  1SS3 A;  2OCC B;  3RYH A;  4DUY O;  2YEV B;  1I08 A;  4DV2 O;  2EIK C;  1AJN A;  1OCR C;  3D8C A;  4KFM A;  3RYF B;  1S5J A;  3MHS C;  1H8E G;  4LWS A;  3OMI B;  5CA1 B;  3CC2 V;  3CPW U;  2DN9 A;  3JAR A;  1E79 G;  5LA6 B;  1K8A W;  1K7D A;  2EIK B;  2BTQ B;  2JGD A;  1OCR B;  4BIU A;  2P06 A;  1AJP A;  1WJZ A;  3K79 A;  4I0X B;  1CEZ A;  4X1Y B;  4DXW A;  5L3C A;  3HKE B;  3L73 H;  2ZNI A;  3T1H B;  3OGC C;  4LC1 A;  4X65 B;  5HFM A;  1VAR A;  1RM1 C;  5KAF Z;  2R9I A;  1FXK C;  2WA4 A;  2GTA A;  1PPJ H;  1Q7Y W;  1FXV A;  5JVD A;  1F7Y A;  4JPR A;  1IBL O;  4FLU A;  1MG1 A;  3K5N A;  2ARH A;  3PJS K;  4KXR A;  4LF8 O;  2RDC A;  4NXM O;  4GYC B;  1FXK B;  1YJW V;  3E86 A;  1AP6 A;  2R9R B;  2WLK A;  2YIB A;  1VQ6 V;  3BVO A;  2DE0 X;  3SYP A;  3I5D A;  4NTX A;  4I50 B;  2OT5 A;  4J42 A;  4DV4 B;  2IW5 A;  2UUC O;  5L3F A;  5BMV B;  3U11 A;  1AI6 A;  2DOS A;  2X6A A;  4JI1 B;  1SQF A;  2DQ0 A;  2QKS A;  4FFB B;  4BR6 A;  1YJ9 V;  2V4D A;  3BY6 A;  4MW3 A;  3NR7 A;  3CCL V;  3J81 N;  2A06 H;  2P4V A;  2N05 A;  4N23 A;  3HB3 B;  4IIJ B;  1COW G;  5KMG B;  4X20 B;  4CS4 A;  3BA8 A;  3THO A;  2AXT Z;  3BCC H;  3OD4 A;  1U97 A;  2VWJ A;  4PDM A;  1P4R A;  1A32 A;  4P9P A;  4EKW A;  2Z3Y A;  2ZNJ A;  3LDD A;  2JGU A;  1R6K A;  5JQG B;  2GUZ B;  3CE2 A;  4UVA A;  4CS3 A;  4DUZ O;  4RUF A;  2X6B A;  1R6T A;  2BOC C;  1MA1 A;  4GKJ O;  5J2U B;  1YXB A;  4B3R O;  2CTQ A;  4CH6 A;  1CXZ B;  1ENV A;  3TJT A;  2Q7H A;  3DXR B;  4H37 A;  1M1K W;  5JJE B;  2DYS C;  3HKD A;  2FYU H;  4MT8 A;  1Z2G A;  1PNL A;  4JI3 O;  4O4H A;  1XDC A;  1I0H A;  3E89 A;  2GHY A;  2QA4 V;  1Z5W A;  1XMQ O;  2QR4 A;  4JI7 B;  4DR4 O;  2DYS B;  1GO3 F;  4J7K A;  2B5U A;  3L9D A;  2R70 A;  2ZQM A;  1TVK A;  3RYC A;  5C8Y A;  1BL8 A;  4JTC B;  3E22 B;  4MW8 A;  1N36 O;  1S72 V;  4MS2 A;  3S3W A;  4MTF A;  1HP8 A;  2KKW A;  3BPZ A;  1XNR O;  5H5N A;  3ZHV A;  1KUQ A;  4B7E A;  4WBN A;  2GTS A;  1G8M A;  1N4C A;  3JD1 A;  4XDK A;  3R66 A;  1JQ0 A;  1OCC C;  2RNB A;  3RWR D;  4PEL A;  1GM9 A;  2JRI A;  1AP5 A;  4LFC B;  1YDX A;  2ZM6 O;  5EBW C;  3ABM C;  2ZT9 B;  4X62 B;  1UJW B;  3AK1 A;  4JYA O;  3AG3 B;  1FFT B;  4HZ3 A;  4F6E A;  1LR1 A;  4P9O A;  3HKC A;  1URF A;  3M99 B;  3N2G A;  1J5E O;  4UVC A;  4EEQ A;  1H2M A;  3ABM B;  1GM7 A;  4QNH B;  2XT9 A;  4R7C A;  2UUB B;  1NQT A;  4L8J A;  2JJ1 G;  4CH5 A;  1RPR A;  4BW9 A;  4D7S A;  1AB3 A;  1IBK B;  1X4T A;  2WSS G;  3QF7 A;  3RBZ A;  2X6C A;  2HR3 A;  4LF5 O;  5B1B C;  1K5S A;  3G71 V;  1XNQ B;  1BHA A;  3RYI A;  4U3J A;  2IH3 C;  1KYO F;  5BR8 O;  1US6 A;  1V55 C;  4DW0 A;  4JZ2 A;  2VQF B;  1R3I C;  4KL1 A;  3K06 A;  4TQD A;  1WB7 A;  3OMN B;  4LCU C;  5KX5 B;  5B1B B;  4FM0 A;  1BGY H;  1D2D A;  3CCR V;  5K1P A;  2Q7G A;  3JAW B;  1Z5V A;  4LF9 O;  4LBE C;  1MOF A;  2IJI A;  1L0L H;  1V55 B;  2YUA A;  2LQT A;  1SQG A;  3K04 A;  2ADQ B;  3MHH C;  2RMK B;  4R6Z A;  4AQY B;  3OM3 B;  2H94 A;  4XDJ A;  2ITD C;  1AI7 A;  2DWD C;  4O4L B;  2IU0 A;  1I94 B;  2PUS A;  4WFA V;  2DMX A;  4O2A A;  3OEH G;  3W7X A;  4J80 A;  3N2K B;  1YTF B;  1WNS A;  1FPO A;  3A0R A;  3ZHQ A;  3HKB A;  1AI5 A;  1VQ8 V;  5JJJ B;  3ZMV A;  5EBM C;  5EZY B;  3RT3 C;  2YC0 A;  1F4M A;  4TQF A;  4RAI A;  5IJ9 A;  1Q81 W;  4W4K A;  4IYI A;  4JI1 O;  1AI4 A;  1VF6 A;  1WN7 A;  4IHJ B;  5LMN B;  2ZR2 A;  3U10 A;  3AK3 A;  3AG1 C;  3OMA B;  1L1F A;  3SPJ A;  4AI8 A;  3UCS C;  4TSF G;  1ZL8 A;  2ILM A;  3JAM N;  5DM6 V;  5AG2 A;  4QE9 A;  2OCH A;  3UT5 A;  2F23 A;  4TV8 A;  1ZLZ A;  1FYJ A;  2PTM A;  1AJQ A;  4LNU B;  1AVM A;  1OJH A;  1BT8 A;  4DR6 B;  3RVZ A;  3E8F A;  4Z1V A;  1G4Y B;  4O4I B;  3JAT A;  3LNN A;  1EZV H;  4H33 A;  3OFN G;  4LFB O;  1QLN A;  5LP6 A;  4DUY B;  3TXQ A;  1Q86 W;  4KHP B;  1P49 A;  4I9W A;  3SYA A;  3B4S A;  1IXB A;  3FD9 A;  3ZMU A;  1W0K G;  4X88 A;  5JH7 B;  2E5L O;  2F66 C;  4HNA B;  5EIB D;  1JOY A;  4CS2 A;  1G1X B;  3SGI A;  3S3X A;  4FLT A;  5EBL C;  1VIB A;  2CTW A;  4P2Z A;  1NR1 A;  3C90 A;  3OTF A;  4K3A A;  2ZR3 A;  4DRX B;  5LHI A;  5LYJ B;  3G6B A;  3RYH B;  1SC5 B;  1TUB B;  1QVG U;  4I55 A;  1CP9 A;  1K97 A;  4W4L A;  1VQL V;  1P84 F;  2CUG A;  2Y48 A;  1KKD A;  1VQ5 V;  1IBL B;  2PGG A;  4GX1 A;  4LFC O;  2GSM B;  2QM8 A;  1O9H A;  2AGA A;  2UXX A;  4X62 O;  1H8H G;  3OEE G;  2BTO A;  4CH4 A;  4B3M O;  1K34 A;  1S3J A;  3O65 A;  3SYQ A;  1RSO B;  3W7S A;  4PI2 A;  1Q5O A;  3ZJZ A;  2ZDI A;  3ZHU A;  5GTH Z;  2QWP B;  4I4T A;  1JJO A;  1DLB A;  4FFK A;  2UUC B;  4UVB A;  1N8R W;  5DN6 G;  2YIC A;  1R6N A;  5E1A C;  1IBK O;  5GON A;  2QM4 A;  2KSD A;  1Y66 A;  4OX9 O;  4GKK B;  4X1K A;  2D2C B;  5KUM A;  4X1I A;  3WFV A;  5IJ0 B;  3H01 A;  4JAA A;  1XIL A;  1BZK A;  2K9P A;  2Q9L A;  1HNX O;  2F43 G;  4O2B A;  1JX9 A;  4JI0 B;  4DR1 O;  2WWW A;  2ODM A;  2GDS A;  3E35 A;  3P3P A;  3SJC C;  1K33 A;  3C3S A;  1BMF G;  1SET A;  2IJH A;  4MVM A;  3K5O A;  3CCJ V;  1P7G A;  4NTW A;  3LSU A;  1XHX A;  4DR3 B;  2QM7 A;  2EZO A;  2W6J G;  1BE3 H;  5FNV B;  3D36 C;  4OPH A;  3E8H A;  1I7F A;  3SPC A;  5KHJ A;  1PNM A;  2QKA A;  1XMQ B;  4DR4 B;  1SKV A;  2MK3 A;  5CBF A;  4B3S O;  3L72 H;  5DED A;  1IBM B;  4EB6 A;  3W7W A;  1W59 A;  3KZI Z;  1N36 B;  2JDI G;  5LXT B;  5LGN A;  1PV0 A;  2MW2 B;  2E3C A;  4ZHQ A;  1KKC A;  4HAM A;  3JD0 A;  1ZUQ A;  4YIO A;  3WB0 A;  1AR1 B;  2LFS A;  4Q6G A;  4CH3 A;  1HR0 B;  3TET A;  5LMN O;  1Y76 B;  3H1J H;  4TUY A;  1O9G A;  1MSW D;  1NVP D;  2WAM A;  3ZRW A;  2WLL B;  1JA8 A;  1IZ3 A;  3UO2 A;  4PD4 F;  3SYO A;  4J11 A;  3G80 A;  5B1A C;  5B1O A;  3HR0 A;  1J5E B;  3JAK B;  3Q4H A;  4PJ0 Z;  4PA7 A;  3SR2 C;  4JI5 O;  3JSL A;  3T4Z A;  4G2K A;  1B04 A;  2UU9 B;  4KHP O;  4YJ3 B;  2LGW A;  4J41 A;  3RGB A;  3RN4 A;  2WA3 A;  1TA8 A;  3TK1 A;  4QGP A;  4FK5 C;  4R50 A;  4LF5 B;  3IC9 A;  3JAL B;  1WA8 A;  5J2T A;  5BR8 B;  2B1I A;  2F4V O;  3ZX6 A;  2UXC B;  2DWE C;  4ZI7 A;  5KA5 A;  1VQK V;  1KC8 W;  3BAA A;  1BCC H;  4LF9 B;  2JS3 A;  4MVS A;  3N2G B;  3ASO C;  1ZWI C;  4QE7 A;  2M6Y A;  3K0G A;  2ZXW C;  3CYO A;  3BRC A;  3B8M A;  2Q8V A;  4MTO A;  3KCY A;  3W7U A;  3ASO B;  1VMG A;  1SQB H;  3J80 N;  1F4N A;  2FML A;  5EYP A;  4MVR A;  1RM1 B;  4TV9 B;  2OIE A;  3WU2 Z;  2HEP A;  1CPY A;  3BHP A;  1SA0 B;  2EUL A;  2HJF C;  2XHB A;  4Z1M G;  4NXN B;  5CBH A;  1PL4 A;  4FLV A;  4IYH A;  2EIN C;  5H9C A;  4K8Z A;  2HHH O;  3A2F A;  5L3D A;  1EN4 A;  5CA0 B;  3OT7 A;  2EJ7 A;  2A3Q A;  2JJ2 G;  4JAU A;  1TUE B;  1XBL A;  2LGQ A;  3RVY A;  4O4J B;  4YJ2 A;  3JD4 A;  1OHH G;  1G6U A;  2EIN B;  4F6R A;  3OUF A;  2Q67 A;  2V1D A;  4GKK O;  1BQ0 A;  4UXN A;  4EFE A;  3QO7 A;  3LUT B;  3IAY A;  5BZB A;  3FAV A;  3ASN C;  2P5O A;  2KG7 B;  4PDL A;  3F7Y C;  4JI0 O;  1BS3 A;  2KQX A;  5LGU A;  3ABU A;  1QNM A;  2JS5 A;  1SER A;  1M93 A;  1FXH A;  2DYR C;  3BAB A;  3ZRX A;  3ASN B;  3P32 A;  1VF6 C;  3A8T A;  3CMA V;  4MSW C;  2HG5 C;  2QTO A;  4PA6 A;  1YIT V;  2DW4 A;  3I56 V;  4LFB B;  4FMT A;  1B3Q A;  2DYR B;  4UCV A;  4HBN A;  4DR3 O;  3QNE A;  3OGI B;  2Q68 A;  3B8N A;  3ETG A;  3EXA A;  2P4K A;  1XL4 A;  4CBC A;  3VQX A;  5J9P C;  2HKO A;  4UCS A;  5FPR A;  4ZBM A;  3WG7 C;  4E2L A;  1K73 W;  2AZ2 A;  3E8B A;  1ORQ C;  1DTO A;  5CMU A;  1F51 A;  1ZL8 B;  1XI1 A;  3ZHT A;  1SQP H;  2E5L B;  1GH6 A;  1GK9 A;  1N33 O;  2YI8 A;  4HYO A;  1IBM O;  3WG7 B;  2YSU B;  5LP6 C;  1D5A A;  4GUN A;  2XAS A;  3QVN A;  1KMI Z;  2VQE O;  1YIJ V;  3ZRV A;  2N04 A;  3JD2 A;  5LL6 Y;  1PL0 A;  5LP6 B;  1UFI A;  3JYC A;  1Y4M A;  3QTC A;  4LP8 A;  1HR0 O;  5H6R A;  4DO2 A;  3FB6 C;  2QJ1 A;  2JVD A;  1JFF A;  1NKD A;  4LR3 A;  4JI4 O;  2ZE8 A;  2WLI A;  3HPL C;  3CCS V;  1AIL A;  1OZ0 A;  2YEV A;  3N27 A;  3MD0 A;  1OCC B;  1XHZ A;  4B3M B;  3RYF A;  2IU3 A;  5B1N A;  1OV9 A;  3STZ C;  5CA1 A;  2VWK A;  5LA6 A;  5F2V O;  1QU7 A;  3TXS A;  4LH7 A;  2C2A A;  4UFZ A;  2QWN B;  5H6Q A;  5KHI A;  1QVF U;  4DV6 O;  3L70 H;  1LNQ A;  1L0N H;  1WP8 A;  2DQ3 A;  1NJI W;  3FFQ A;  5KHG A;  2UU9 O;  4I0X A;  4JTD B;  1VP7 A;  1GN3 A;  2XND G;  4X1Y A;  1IUR A;  4OX9 B;  3HKE A;  1EM1 A;  1XMO B;  1VQN V;  1PM9 A;  1HNX B;  2EIJ C;  1XQ8 A;  2UXC O;  3WB1 A;  5IT9 N;  4DR1 B;  3T2M A;  2CH7 B;  5LOV B;  2EIJ B;  3LSQ A;  4EFB A;  3DGE A;  1FXK A;  5ITZ B;  4J9Y B;  1EN5 A;  3SJB C;  4JGS A;  3JCU Z;  1PP9 H;  3DTU B;  4X64 B;  1PD3 A;  1MZE A;  3OR6 C;  4WFF A;  4I50 A;  1SZT A;  2RJZ A;  4X1K B;  5BMV A;  3ZED A;  4BWA A;  2F1M A;  2AHZ A;  2F95 B;  4FFB A;  4DR7 O;  2FB5 A;  4YIP A;  4B3S B;  4NXN O;  5LMU O;  4UB8 Z;  1FFX B;  3C3T A;  4IIJ A;  3ZMZ A;  1D5N A;  1NZ6 A;  4OGQ B;  5JCO C;  4X20 A;  2CGN A;  4NR1 A;  4MVZ A;  2YID A;  1QCE A;  1JMK C;  3P30 A;  3JAS B;  5CBG A;  1H2S B;  2XAJ A;  5JQG A;  1T5E A;  3CCU V;  3DSQ A;  4ZIB A;  2GUZ A;  3AG2 C;  3ZN0 A;  3L75 H;  5IYZ B;  5K1X A;  2YXH A;  1Y74 B;  3OW2 U;  1KB9 F;  1DF4 A;  2QKC A;  3DXR A;  3ZMS A;  1VQ9 V;  2ZIN A;  1K4D C;  1NU1 H;  2NN4 A;  1N32 O;  2XAQ A;  4UV9 A;  3P3N A;  2R72 A;  3AG1 B;  4B7K A;  4ZOL B;  1IVS A;  3AK2 A;  3CJH B;  1WP7 A;  5D5Q A;  2XAF A;  3K0D A;  4JI5 B;  4X8A A;  3CWB H;  4ASU G;  4DV7 B;  4B3T B;  4WFH A;  3EVK A;  3E22 A;  3JCZ A;  2OYQ A;  2Z0A A;  4LF6 O;  3L71 H;  5CA3 A;  4PDV A;  3G4S V;  2XOK G;  4TUY B;  3WB2 A;  4JV5 B;  4QIW F;  2F4V B;  3E2E A;  2LO1 A;  1XL6 A;  3IFX A;  2IBZ H;  2GBO A;  3CRC A;  3K9S A;  5IY5 C;  3CCV V;  2WLN A;  2LFR A;  1SQV H;  1NH2 B;  5B66 Z;  4I7Z B;  2OWO A;  1YI2 V;  2V7Q G;  3ETE A;  1EZJ A;  5IY5 B;  2L35 A;  1NTZ H;  2CE4 A;  3BA9 A;  2QGN A;  2JIZ G;  2X0L A;  2LP7 A;  1H2N A;  1YTF D;  1IX9 A;  4GX2 A;  2X7R B;  1Y67 A;  4LWS B;  3GB7 C;  3TCU A;  1AR4 A;  1J95 A;  3JAR B;  5D5P A;  4FLY A;  3ABL C;  3QO5 A;  1WB8 A;  2JGD B;  2QEX V;  3CP1 A;  5CB4 A;  4J9Z B;  2HHH B;  4CZZ A;  2PI5 A;  1SQQ H;  3VQW A;  3ABL B;  4JI6 O;  3CX5 F;  1MNG A;  5JWP A;  4AHC A;  2WLH A;  3K9A A;  5KX5 A;  1F23 A;  3CC4 V;  3EFF K;  4GX5 A;  4PDR A;  2JEU A;  4LF7 B;  2JEX A;  2QWR B;  1NTM H;  2IH1 C;  5JVD B;  1KD1 W;  1XMO O;  2AZ0 A;  2K1E A;  2LJ2 A;  1N0N A;  1NI8 A;  2EZP A;  2A79 B;  1FD9 A;  3CHX A;  4O4L A;  3APQ A;  3M8A A;  4IL6 Z;  1Y6X A;  2FL4 A;  4PI0 A;  2ATK C;  3N2K A;  4YXW G;  3DC6 A;  1SRY A;  3STL C;  1JCH A;  2KB1 A;  4X64 O;  1WPB A;  4IT5 A;  3CRQ A;  3SJQ C;  5EZY A;  3LDE A;  4JYC A;  3CRR A;  1M57 C;  2UUA O;  1H2L A;  1Q90 D;  3ZHS A;  5BXZ A;  2HLD G;  1YF2 A;  4DV5 B;  2A9H A;  3F5T A;  4IHJ A;  3CME V;  4FM1 A;  1HDJ A;  1HNZ B;  1N33 B;  2HP8 A;  2P67 A;  3JD3 A;  1GN2 A;  1M57 B;  2QE7 G;  3CS5 A;  3K5L A;  4CC6 A;  3UM7 A;  2YS8 A;  4DK1 A;  1SF9 A;  2B9Z A;  2EIL C;  4GX0 A;  4MVO A;  2VQE B;  2QDO A;  3BEH A;  4JZG A;  4GZR B;  5IYB O;  1Q3E A;  1OCZ C;  4XBF A;  1ZTE A;  1VQO V;  4LNU A;  2UXN A;  3HKD B;  2EIL B;  1EBO A;  4O4I A;  3CCM V;  4DW1 A;  4Z2W A;  4O4H B;  4JI4 B;  1XUQ A;  1V54 C;  2Q6A A;  4YHH B;  1OCZ B;  1GAX A;  3FB8 C;  4RWU A;  1NS1 A;  2YXL A;  3OE7 G;  2BSK A;  3MDS A;  3CXC U;  3E83 A; 
#chains in the Genus database with same CATH homology
 1V55 B;  3P32 A;  4XDL A;  3K04 A;  3CMA V;  1V54 B;  4MSW C;  2HG5 C;  2QTO A;  4PA6 A;  3MHH C;  1YIT V;  1H38 A;  2Y69 B;  4R6Z A;  2DW4 A;  3I56 V;  3GWO A;  3SPH A;  4FMT A;  3OM3 B;  2H94 A;  4FIP C;  4MTX A;  4XDJ A;  2DYR B;  2ITD C;  1AI7 A;  1R73 A;  3QNE A;  2AHY A;  2Q68 A;  2DWD C;  1YJN V;  5B1A B;  3B8N A;  3ETG A;  3IC7 A;  1KP2 A;  4KUM A;  2IU0 A;  4WFA V;  1XL4 A;  4CBC A;  1BHB A;  1THZ A;  5J9P C;  2HKO A;  4ZBM A;  3WG7 C;  4E2L A;  3KG2 A;  3ZMT A;  4WF9 V;  1K73 W;  3OEH G;  1RPO A;  3W7X A;  3E8B A;  1ORQ C;  1DTO A;  1K4C C;  1NVP B;  2XAH A;  4UV8 A;  3X2Q C;  1YTF B;  5CMU A;  5KUK A;  1F51 A;  4KP4 A;  1QLE C;  3A0R A;  4WFG A;  1GK9 A;  1AI5 A;  3ZRS A;  4WCE V;  1VQ8 V;  1NR7 A;  4OXS A;  3ZMV A;  5EBM C;  4HYO A;  3WG7 B;  2EJR A;  2YSU B;  2PI4 A;  2Z5U A;  3W7T A;  3VOU A;  3SPG A;  1F4M A;  2HVJ C;  3X2Q B;  2XAS A;  4I5S A;  5EC2 C;  1QLE B;  4RAI A;  1YIJ V;  3ZRV A;  1Q81 W;  1AI4 A;  3JD2 A;  1QBZ A;  1PL0 A;  1S0V A;  2ZR2 A;  3IGA C;  3ZIA G;  3JYC A;  4WFB V;  1Y4M A;  4LP8 A;  3AG1 C;  3OMA B;  5H6R A;  1L1F A;  4DO2 A;  3FB6 C;  4G28 B;  3SPJ A;  1NKD A;  4TSF G;  1R3K C;  5DM6 V;  2EBO A;  2WLI A;  5GW7 A;  2P6J A;  4QE9 A;  1PKX A;  3QO8 A;  3HPL C;  3ETD A;  3CCS V;  2YEV A;  1OZ0 A;  2WLJ A;  4TWK A;  2ZXW B;  1I5X A;  3MD0 A;  1OCC B;  1YSC A;  2NNU A;  3T4D A;  1AJQ A;  1WPX A;  2IU3 A;  3FB5 C;  1M56 C;  5B1N A;  3E8F A;  3RVZ A;  1P7B A;  1G4Y B;  3STZ C;  1K3E A;  3CCE V;  3I55 V;  3CC7 V;  1IXM A;  3F5W C;  3ZRX A;  1NH2 D;  4H33 A;  2C2A A;  1EFR G;  3OFN G;  5B3S C;  1QLN A;  3CD6 V;  5H6Q A;  5HFL A;  2M7W A;  1QVF U;  3LDC A;  1E1Q G;  1LNQ A;  5L3G A;  1M56 B;  1Q86 W;  4RQE A;  2DQ3 A;  1NJI W;  4JAV A;  4I9W A;  3RW0 A;  3SYA A;  4JTD B;  1H2G A;  4F4L A;  5IYD O;  3ML0 A;  3ZN1 A;  1GTO A;  5B3S B;  2XND G;  3ABT A;  3LSS A;  3B77 A;  3ZMU A;  5LHH A;  1W0K G;  4N21 A;  2IJK A;  4X88 A;  2P7T C;  3E8G A;  4U7O A;  2A0L A;  1VQN V;  1GM8 A;  4ZKI A;  4RQF A;  2EIJ C;  1JOY A;  2JK5 C;  3K3W A;  4MVU A;  4WFE A;  1HWY A;  4PA3 A;  5EBL C;  3FB7 C;  3T2M A;  4P2Z A;  1NR1 A;  1S77 D;  5IYC O;  1OCO C;  1MAB G;  1QR9 A;  2EIJ B;  3LSQ A;  2WLM A;  2ZR3 A;  3NXS A;  4GCZ A;  1JJ2 U;  2FTK A;  3DGE A;  5LHI A;  1FXK A;  4J9Y B;  1S76 D;  1K5Q A;  1R3L C;  1QVG U;  1CP9 A;  4MVQ A;  4JGS A;  1OCO B;  5EC1 C;  1K97 A;  3R65 A;  4BIZ A;  1VQL V;  2Y48 A;  2P90 A;  3DTU B;  3D36 A;  4BAY A;  1VQ5 V;  1KKD A;  4GX1 A;  1PD3 A;  3OR6 C;  2W0F C;  2GSM B;  2QM8 A;  4WFF A;  1JVM A;  3E83 A;  1SZT A;  2OCC C;  2UXX A;  1NBM G;  1H8H G;  4RUE A;  3OEE G;  2AHZ A;  1K34 A;  1S3J A;  3SYQ A;  1GMG A;  3LNM B;  3FYE B;  1FS0 G;  1KP3 A;  4GT1 A;  5LHG A;  3W7S A;  1B6Q A;  2D3O W;  2WLI B;  3ZJZ A;  3ZMZ A;  2OCC B;  2ZDI A;  1YHQ V;  1DLB A;  2YEV B;  4MVZ A;  1R3J C;  1S5H C;  4UVB A;  4R8C A;  2OTL V;  1N8R W;  2EIK C;  1QCE A;  5DN6 G;  2ZD9 A;  4P30 A;  1AJN A;  1OCR C;  4KFM A;  1R6N A;  3P30 A;  5E1A C;  3MHS C;  2OTJ V;  5CBG A;  2WLL A;  2EIM C;  1H8E G;  3OMI B;  3OR7 C;  3CC2 V;  2XAJ A;  1Y66 A;  3CPW U;  3CCU V;  1E79 G;  2HFE C;  3FKS G;  3WFV A;  5KUM A;  3AG2 C;  3ZN0 A;  3H01 A;  1K8A W;  1FXH A;  1K7D A;  2EIK B;  1OCR B;  4BIU A;  3OW2 U;  2F43 G;  2EIM B;  1DF4 A;  1JX9 A;  2WWW A;  1AJP A;  3E35 A;  3K79 A;  3ZMS A;  1VQ9 V;  1CEZ A;  1K4D C;  2H8P C;  1K33 A;  4DXW A;  1QR8 A;  2XAQ A;  5L3C A;  4UV9 A;  3EHB B;  3AG1 B;  1BMF G;  3OGC C;  1SET A;  4LC1 A;  2IJH A;  4MVM A;  5HFM A;  1RM1 C;  2CK3 G;  5IDJ A;  3CCJ V;  3AG3 C;  2R9I A;  3K08 A;  1FXK C;  2XAF A;  3K0D A;  1Q7Y W;  1FXV A;  4JPR A;  2QM7 A;  4X8A A;  2EZO A;  4ASU G;  1MG1 A;  2W6J G;  4QPK A;  1I5Y A;  3PJS K;  4WFH A;  1K9M W;  5L3B A;  3JCZ A;  3E8H A;  1FXK B;  5CA3 A;  3E86 A;  1YJW V;  4PDV A;  3SPC A;  1PNM A;  2R9R B;  2WLK A;  3G4S V;  2XOK G;  1VQ6 V;  2MK3 A;  2XAG A;  2ITC C;  3OUS A;  3AG4 C;  5CBF A;  3SYP A;  4QIW F;  3E2E A;  1M9N A;  4X89 A;  1XL6 A;  3W7W A;  1VQM V;  1VQP V;  3IFX A;  1K92 A;  2JDI G;  2OT5 A;  5L3E A;  2IW5 A;  5LGN A;  5IY5 C;  4JF3 A;  5L3F A;  2ZDI C;  3CCV V;  4L87 A;  1AI6 A;  2X6A A;  3AG4 B;  2WLN A;  2DQ0 A;  2LFR A;  2QKS A;  3D3I A;  3JD0 A;  4HAM A;  1YJ9 V;  4MW3 A;  3BY6 A;  1NH2 B;  3CCL V;  3ABK C;  4N23 A;  5FL7 G;  3HB3 B;  1AR1 B;  1YI2 V;  2B1G A;  2LFS A;  2V7Q G;  3ETE A;  4PA9 A;  1EZJ A;  5IY5 B;  3TET A;  1COW G;  5C93 A;  1GKF A;  2JIZ G;  1Q82 W;  1JPX A;  1MSW D;  2W6I G;  2WPD G;  2X0L A;  4PDM A;  1NVP D;  1W2B U;  2LP7 A;  3ABK B;  1P4R A;  1YTF D;  2WAM A;  4GX2 A;  2X7R B;  4P9P A;  3ZRW A;  4EKW A;  2WLL B;  2Z3Y A;  3LDD A;  3GB7 C;  1R6K A;  2Q69 A;  3TCU A;  1J95 A;  3SYO A;  4UVA A;  3ABL C;  3QO5 A;  4RUF A;  2X6B A;  5B1A C;  2QEX V;  2BOC C;  5B1O A;  3CP1 A;  4J9Z B;  4G27 B;  4JTA B;  1ENV A;  4CZZ A;  2PI5 A;  4H37 A;  4PA7 A;  1M1K W;  3T4Z A;  4G2K A;  3ABL B;  2DYS C;  4MT8 A;  1PNL A;  1KEC A;  2WLH A;  3K9A A;  4QJF B;  1F23 A;  3CC4 V;  3EFF K;  3E89 A;  5EK0 A;  2GHY A;  3T1C A;  4MTG A;  3TK1 A;  3CCQ V;  2QA4 V;  4GX5 A;  4FK5 C;  4PDR A;  4R50 A;  3G6E V;  2JEU A;  2JEX A;  2DYS B;  1GO3 F;  2IH1 C;  5LBQ A;  2B5U A;  4FJC C;  4JYB A;  2B1I A;  4PA4 A;  1KD1 W;  2ZQM A;  2DWE C;  1BL8 A;  2K1E A;  4JTC B;  4MW8 A;  1S72 V;  4MS2 A;  3VBB A;  4MTF A;  2EZP A;  5KA5 A;  2A79 B;  1E1R G;  1VQK V;  4U7N A;  1KC8 W;  3AG2 B;  4MVS A;  3ASO C;  2BOB C;  1G8M A;  2IJJ A;  1ZWI C;  3JD1 A;  4QE7 A;  4XDK A;  2ATK C;  1JQ0 A;  3K0G A;  2ZXW C;  3CYO A;  3FYI B;  1SES A;  4UUJ C;  4RO2 A;  1OCC C;  3B8M A;  4YXW G;  4QPJ A;  2NLJ C;  4MTO A;  4PEL A;  1SRY A;  1GM9 A;  3W7U A;  3STL C;  3ASO B;  1JCH A;  2KB1 A;  1F4N A;  5EBW C;  1VQ4 V;  4MVR A;  3SJQ C;  1VQ7 V;  3LDE A;  3ABM C;  1RM1 B;  1W0J G;  4JYC A;  1UJW B;  1M57 C;  1CPY A;  3AG3 B;  1FFT B;  4HZ3 A;  4P9O A;  2HJF C;  3SPI A;  5CN0 A;  2HLD G;  2A9H A;  4Z1M G;  3M99 B;  3CME V;  5CBH A;  1KQS U;  4TT3 G;  4UVC A;  3UKM A;  3ABM B;  2EIN C;  2P67 A;  5H9C A;  4FPP A;  1GM7 A;  3ZRW B;  5L3D A;  1ROP A;  3JD3 A;  1M57 B;  2QE7 G;  3K03 A;  4QNH B;  4R7C A;  1NQT A;  2JJ2 G;  2JJ1 G;  3F7V C;  3UM7 A;  1RPR A;  4JAU A;  1TUE B;  3RVY A;  2WSS G;  2EIL C;  4GX0 A;  3JD4 A;  1OHH G;  4JAS A;  4MVO A;  1DF5 A;  3ZCC A;  4BW5 A;  2EIN B;  3RBZ A;  3BEH A;  3AEI A;  2X6C A;  2HR3 A;  3OUF A;  5IYB O;  5B1B C;  1K5S A;  1OCZ C;  3G71 V;  2Q67 A;  4XBF A;  2V1D A;  1BHA A;  1VQO V;  4UXN A;  1M90 W;  2IH3 C;  2UXN A;  3QO7 A;  1ARO P;  3LUT B;  2EIL B;  1EBO A;  3SYC A;  1WLE A;  5BZB A;  3CCM V;  3ASN C;  1V55 C;  5LGT A;  1R3I C;  3F7Y C;  4PDL A;  4Q20 A;  1V54 C;  2Q6A A;  3K06 A;  3OMN B;  1PNK A;  4LCU C;  5B1B B;  3OAA G;  1OCZ B;  5LGU A;  3CCR V;  2HVK C;  3FB8 C;  3ABU A;  2Y69 C;  5KA6 A;  3OE7 G;  1SER A;  3CXC U;  4LBE C;  1MOF A;  2DYR C;  2IJI A;  3ASN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...