2MK3A

Solution nmr structure of gp41 ectodomain monomer on a dpc micelle
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
b'SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein, chimeric construct
publication title Dissociation of the trimeric gp41 ectodomain at the lipid-water interface suggests an active role in HIV-1 Env-mediated membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 15
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2mk3A00
4JF3A 3GWOA 1DLBA 1QR8A 2EBOA 4G2KA 1I5XA 1QR9A 1Y66A 3H01A 1QBZA 1JPXA 2M7WA 4FIPC 5CMUA 3P30A 2MK3A 3MHHC 4N23A 4E2LA 1JQ0A 3MHSC 1F23A 1I5YA 1ENVA 2OT5A 2P6JA 1MG1A 2X7RB 3B8NA 5H9CA 3B77A 5HFLA 1SZTA 3K9AA 5HFMA 1Y4MA 1MOFA 4FJCC 1DF5A 4JPRA 1EBOA 3M99B 3CYOA 4JGSA 1K34A 2EZOA 2LP7A 1DF4A 5CN0A 5KA5A 4FK5C 4N21A 1K33A 1QCEA 3B8MA 5KA6A 2EZPA 3WFVA 3CP1A
chains in the Genus database with same CATH superfamily
1PP9H 1XL6A 4Q20A 1YF2A 4TQDA 4QNHB 4B3RO 5FLXN 4PHZA 1M56C 2HLDG 1FJGB 2ODMA 5IJ9B 5LOVA 1OCRC 5EBLC 4FM1A 4FLYA 2V4DA 1BZKA 4IHJB 4JZGA 1IBMO 3K08A 5L3BA 1NS1A 1E1QG 2XAQA 1Q7YW 1F51A 4UV9A 2F43G 1P49A 3SPIA 1MG1A 1PV0A 3SYOA 2JEUA 3BA8A 4FLWA 3WG7C 3RYFB 2QJ1A 3Q4HA 1BQ0A 4I5SA 4O4IA 3UT5B 5B1BB 4DR4O 3W7XA 1H2SB 4I9WA 1VQ7V 4DR5O 1W0KG 4O4LA 3HB3B 4PDLA 3P30A 4FMTA 3F7YC 1US6A 1AB3A 3ICXA 1RM1B 3ZEDA 1ORQC 1KUQA 4LNUA 2Q6AA 1FXVA 2HHHO 4B3SO 4RQEA 2ZCEA 1L0NH 1XOUA 1GMGA 1Z5WA 2EINB 1K4DC 3MDSA 2UXDO 3ZRWB 2ADQB 2MW2B 3CRCA 3A0BZ 5JJEB 3E83A 5AG2A 1YITV 2PUSA 2HJFC 5EZYA 3HKBB 3OMNB 4EEQA 2VQFO 1YTFD 2BTOA 1Q6IA 1F7YA 2WLLB 3JSNA 3IC7A 5B1AB 2OT5A 1TVKB 3L70H 3FAVA 4UVBA 2DN9A 4GX5A 1K9MW 1LR1A 1RSOA 2OWOA 1Q6HA 3OR6C 4YIOA 4JI4O 1IBKB 5GW7A 3K03A 3ABLB 1MZEA 4P9PA 3N2KA 4JTDB 3RW0A 4CH4A 1M90W 4BWAA 2L35A 2Z0AA 1YXBA 3B2EE 3E22B 3CWBH 5CA1A 1VQPV 4GT1A 4U7NA 4J41A 3LDEA 1K7DA 3OMAB 1FXKB 1ZWIC 3N2GB 5CN0A 4IIJA 5LMNB 2BTQB 2XAJA 4PA7A 3P32A 3ZMVA 1BQZA 1M93A 1SQQH 3RT3C 3H1JH 2F4VO 4UXNA 5CMUA 3F7VC 2N05A 5A2QN 1WA8A 4TOIA 2H94A 3ASOC 3L71H 1NTZH 3K9AA 1FFXB 3JARB 5B1NA 4R50A 4MW3A 1SA0B 4WFBV 2RJZA 2DYSC 1QLEC 2EIJB 2KQXA 1X4TA 1L1FA 3CCVV 1QR8A 1YIJV 3CCQV 3H9VA 4EB6A 4TSFG 4W4KA 1XMOO 3W7WA 3MHSC 1NT2B 1W0JG 1VIBA 1DF5A 1NVPB 1OCCB 1XBLA 3AG3C 2P5OA 5IYCO 2IJJA 2UUCB 4DUYO 1GN2A 5LYJA 1NJIW 1ZX3A 1HNWB 1NH2B 4IT5A 4D7TA 1Y66A 4X64B 5D5QA 1VEWA 2IM9A 4U3JB 5LMUO 1HNZB 2QGNA 3SYAA 3D36C 4RUEA 2R9RB 3QO7A 1M1KW 2JIZG 1S77D 2RQ6A 1M56B 1V54B 1SF9A 5LBQA 3OT7A 5KHJA 3OTOO 5IYZA 4JV5O 1Q86W 4DV6B 3GVMA 4JI8O 3HKDA 2QWOB 3E89A 4LF4O 1QHTA 3AG2B 1VF6A 1MOFA 2XAGA 3SPCA 1GN6A 3W7UA 1SQPH 2ILMA 4B3TO 1OJHA 2X6CA 2HKOA 3SJBC 2AHZA 3DC6A 3GWKC 4ZOLA 1JFFB 2P22C 1HNXB 2YICA 4PA3A 1EN6A 2QTOA 1ROPA 5B1OA 4ZIBA 4JPRA 3P3PA 4K3AA 3KCXA 1YVWA 2H8PC 1Q5OA 4XDLA 3UO3A 4F4LA 4UCOA 1OV9A 5H2FZ 4OPAA 4WFFA 1MNGA 1PNLA 4NVPA 1R3JC 4DW0A 3CHXA 4MS2A 1SESA 3SJAC 4X62B 5FPRA 3S3XA 3AG1C 1UFIA 4JI3O 1TA8A 3ABMB 1PPJH 2GTSA 2OTLV 1M57C 2CTQA 4MVUA 5J2UB 1KKCA 4X9QA 2QKSA 4GKJB 1H2GA 1U97A 5KLVH 1L0LH 3OGCC 4AI8A 4ZKIA 4FFKA 1V9PA 2JRIA 1R6KA 1ZSPA 4DXWA 5JJJB 3DGEA 4PDRA 1J95A 4QE9A 5GONA 1GTOA 4LF6O 4ICGA 2YEVA 5C8YB 2LFRA 2ARHA 4OGQB 4E4EA 4KXRA 5J2TB 1SS3A 2Y69C 3IC9A 2FTKA 3OEEG 3BVOA 5IJ0A 3CMAV 1LNQA 2EIMB 4NTXA 2ZDIC 1GM7A 3BEHA 4K8ZA 5BY1A 4DK0A 1KYOF 3BHPA 3NXSA 1R3LC 3JCZA 4HBNA 5LGNA 4LF5B 1R6NA 1S5HC 1SERA 1ZUQA 5EYPB 4UFZA 4CH5A 3K0GA 1EM1A 3B8NA 1HP8A 1PKXA 4WBNB 5E79Z 1VQOV 1QQCA 5K1XA 3OFNG 2B1IA 4JI1O 4DRXA 4J9YB 2QWNB 5KX5B 3DXRB 5BXZA 2N04A 1TUEB 4B3RB 1OCOC 2E75B 5FNVB 5KUMA 2P7TC 4B7KA 3ASOB 1KP3A 5FL7G 3BPZA 2UU9B 3CE2A 4QJFB 4NXMB 4B08A 3UQ8A 1EZJA 4FLXA 2RN9A 4X89A 3JD4A 4PA4A 3LSSA 4DR3O 3E8GA 1QLEB 1BL8A 5CB4B 5JWPA 2Q4PA 1XILA 3BRCA 3ZRVA 2WPDG 3A0HZ 1H8HG 2KG7A 4CH3A 4LFCO 4DR7O 1IZ3A 3J7AU 3C3SA 1QBZA 3RFRA 2ZXWC 2DQ3A 1HR0O 4N23A 4GCZA 4NXNB 4DR1O 2CH7B 3KZIZ 3JSLA 4DV0B 3T4DA 4DR5B 1EFRG 1IURA 2ZE6A 1J5EO 5CA3A 4KHPB 2IU0A 2Q7HA 4X1YA 1JA8A 5IWAO 3K5NA 3VQXA 2IU3A 1S72V 4FVMA 2PGGA 1JCHA 3FB6C 2XAHA 4B3MB 1K73W 2K9PA 2B9ZA 3HKEA 4LH7A 3SDLA 4BIOA 5EBWC 2DYRB 2DWDC 1TUBA 4ZI7A 1GK9A 4FZ0A 4H44B 2Q7GA 4JAAA 5TISZ 5LA6B 1VQMV 1DK1A 3IFXA 4LWSB 4AQYO 2ITDC 5ITZB 1B6QA 5KMGA 2ZE8A 2IJHA 1JOYA 1JVMA 1K33A 2C2AA 1K3EA 3C90A 4O2BB 2RNBA 3ZMZA 4LFBB 4JTCB 1H2KA 5L3EA 3K58A 1VF5B 2K1EA 4TUYB 3FB7C 1VQ9V 1JPXA 2DE0X 3ZN0A 2DMXA 1NKDA 3ZHUA 3BAAA 2EIKB 2W6JG 2XASA 1P7BA 2JEXA 2QE7G 2JK5C 2CGNA 2WWWA 4RO2A 2ZM6O 3QVNA 3T1HO 1GN3A 2P90A 2Y0IA 3PN1A 5IE9A 4LF7O 4DO2A 2Q5ZA 4GKKO 4JI0O 3EFFK 1IDSA 3ABKB 1IBLB 4KP4A 3BCCH 4MTGA 2QM4A 4J10A 4CC6A 1AR4A 1I7FA 2E5LO 3JAWB 1W2BU 1AR1B 4FFBB 2YIDA 2Y4UA 3KG2A 1P84F 4DV2O 2WA4A 3L74H 4LH6A 3SJCC 4MVQA 3RWRD 5IT9N 2DWEC 4X8AA 1XNRO 5CA0B 4I55B 2VQEO 3U0ZA 4MTFA 1SETA 3ASNB 3CRAA 2F66C 3RYFA 1SZXA 4DV7B 3UT5A 2EX3A 1Q90D 1RFYA 1NR7A 4O4JB 3JYCA 2H3OA 5BR8B 3CB2A 2ITCC 3SPJA 3I5DA 3J81N 4NKGB 1YEWA 3QG5A 1Y6XA 4UB6Z 4JYAO 1XHZA 4HAMA 3GB7C 4DR6O 5FPOA 3AK2A 1M5IA 3STLC 4DV5B 2QTSA 3J80N 3DTUB 2E76B 4Z1MG 1N36O 3CJHB 3HKCB 1SQXH 2KB1A 3G80A 2QM8A 3SYQA 1I0HA 1VF6C 4DV4B 1CP9A 5H6RA 1OCOB 3VQWA 2B5UA 4JYBA 2PTMA 1V55C 2W6IG 4JF3A 3PJSK 5LGUA 1G1XB 1RPOA 4JI8B 4OX9B 5B3SB 4IYIA 3AG7A 5JQGB 3APQA 3ZCCA 3H1IH 4ZHQB 4YY3B 1H2NA 2R9AA 4DV1O 3Q4HB 1TVKA 4TV9B 1MSWD 1BS3A 2EZOA 5A9GA 4D6TH 3RGBA 1JX9A 4CS2A 4O4LB 1JMKC 2ZXWB 3AEIA 2NNUA 2AZ0A 2AZ2A 4WFEA 1N33O 4K35A 4YJ2B 2BSKA 3MHHC 3BFRA 4J7KA 2UXBB 1AVMA 3E22A 5CBHA 4TQFA 3LSUA 1NR1A 2Q0OC 1AI6A 2GUZB 3OGIB 3B40A 5EK0A 4DK1A 1XMQB 4J42A 1FXKA 3JASA 3QNEA 3T1YO 1AJQA 3CP1A 5C93A 2W0XA 4JASA 3GWOA 5LXTA 3S3WA 1QLNA 2BTQA 2ADPA 3K06A 4O4HB 1PL0A 3T1CA 2JJ1G 3JAKA 4UB8Z 4UV8A 4YHHO 3CEIA 4JI2O 1XL4A 2ZE7A 1MZFA 3QO5A 4DV3B 3CYOA 1FFXA 1NTMH 1ZAUA 3ETDA 1AILA 3JARA 3CCSV 4BR6A 1I94B 3BA9A 1WN7A 2ZR3A 3ZS8C 4K0KB 4IYHA 1K8AW 3FAVB 2WA3A 3D8CA 1K5QA 3E35A 5DM6V 1KMIZ 5H9CA 1VQ4V 3ETGA 3E8HA 3TGUH 3O9OA 1OCZC 4JI5O 3LSQA 2YIAA 1QU7A 1MABG 3AK1A 4PA6A 2UXCB 4XDKA 3CPWU 1ZLZA 1P7GA 4G2KA 1WB7A 5E1AC 5IY5B 4E2LA 3K5LA 3B4SA 1FJGO 2D3OW 2UUAB 4LBEC 3H1LH 1ZTEA 1SC5B 3KCYA 2AXTZ 2QKCA 4K8XA 4CS4A 2XAFA 4QGPA 3WB1A 1CPYA 1Y74B 2XTAA 1Y67A 2QSAA 2EILB 1GH6A 4DR2B 3CXCU 3ZHSA 2X0LA 3DC5A 5J9PC 2WLJA 4QIWF 4BAYA 1Y4MA 4FLUA 3RN4A 3WU2Z 2HFEC 1Q3EA 5K1PA 4EB6B 3CRRA 1FS0G 3ML0A 3CRMA 4UVAA 4DR3B 2MK3A 3EXAA 1OCRB 2VWJA 4EFEA 4PI0A 1VQNV 3AG4C 1JFFA 5BZBA 3LUTB 4L87A 4LF8O 4JI7B 1NH2D 5LYJB 4RWUA 1K92A 5LP6A 2XT9A 1XNQB 1NZ6A 1ZL8B 4UCRA 1R1BA 1AR5A 2EBOA 2RMKB 4MVOA 2E74B 1K4CC 1FPOA 4R6ZA 4NR1A 4B7EA 1B3QA 1FD9A 4KFMA 3WG7B 2PYLA 3W7SA 5JH7A 2QWQB 5IYBO 2YSUB 4QPJA 2FKXA 1YHQV 1CEZA 5IYZB 2R9IA 4LP8A 4CC5A 2RCVA 1PM9A 5IYDO 4X65B 1MA1A 4IL6Z 3X2QC 4ASUG 2IJIA 4R8CA 4Z2WA 4NTWA 1K5SA 1Z2GA 2A3QA 5KHIA 2A79B 5GTHZ 3JD0A 4TV8A 3VQYA 1IBKO 4X1KA 3UCSC 1TGOA 4QPKA 3F5WC 4P9OA 3L75H 2WSSG 4L8JA 1F4NA 1I5YA 3ETQA 1R3KC 4I4TB 3ZMUA 2P67A 4BIUA 4W4LA 3TXQA 2QWRB 4LR3A 3K59A 4I50A 3ZRSA 2ZKOA 4X66B 3FB5C 5LMNO 4WCEV 1I5XA 2CTRA 2EULA 2IH3C 2Q0AA 2OIGA 4P30A 2PY5A 3C3TA 1Q43A 2L6LA 5EYPA 4F6RB 3ZJZA 4DUZB 3OUSA 2ZD9A 2ZM6B 1BCCH 4CZZA 2IH1C 2CE4A 2ZT9B 2F93B 1WJZA 5KUKA 1NI8A 3IGAC 1YZBA 1SQVH 5KX5A 3SPGA 4I7ZB 5FNVA 3RYHB 1AJPA 2F95B 1XUQA 3MAQA 3FKSG 1IX9A 4CS3A 5L3GA 1SZTA 3CX5F 3FD9A 3CRQA 3B09A 4UCVA 3P3NA 5KA5A 1K97A 3FB8C 1UJWB 4KUMA 5L3FA 5B1BC 4MW8A 2UUCO 4QE7A 1VP7A 3LDCA 2VQEB 1HNWO 3OMIB 3VQVA 3CCLV 4X64O 1Y76B 1OZ0A 4FM0A 1HNZO 1IBMB 2XNDG 1RM1C 2JJ2G 1YJNV 2DYSB 2CTPA 2JGDB 3CCMV 1VQ6V 2EZPA 3CS5A 3T2MA 3ZMSA 1KD1W 5B66Z 4FLTA 4R7CA 2NR5A 1H8EG 3SPHA 4DRXB 3AG3B 2EINC 1RPRA 4MT8A 3OR7C 2GSMB 2UUBO 1D5AA 4MTXA 4PI2A 4DR4B 1N4CA 4LCUC 4PV1B 5BMVB 2DOSA 3WFVA 1O9GA 3CSXA 1VF7A 4DW1A 1XHXA 2Y48A 3K5OA 3LNMB 4YIPA 2XUMA 4FPPA 1Q81W 2JGUA 2X7RB 3TJTA 3CCUV 4H0LB 5LA6A 1G4YB 1HNXO 1HW7A 2B1GA 3FYEB 3M8AA 4D7SA 4P2ZA 1NTKH 1PD3A 2HHHB 4B3SB 1XQ8A 1H2MA 1SQGA 1BHAA 3ABLC 1UPGA 2UXDB 3NR7A 4X1IB 4TUYA 3RYIB 4I0XA 3K79A 4WF9V 1DGSA 4DYLA 5HFMA 1B06A 1FFTB 3CC7V 1URFA 4GX2A 4FLVA 2Q9LA 3AK3A 2Q7EA 3MD0A 2VQFB 1WP8A 1FXKC 5KA6A 4Q6GA 1S76D 4YJ3B 4GLXA 1O9HA 1QNMA 3JATB 5JVDA 1JR9A 1VMGA 2WLIB 3TXSA 3CMEV 4GKJO 4WFHA 4X20A 2HP8A 3G4SV 1SQFA 1PL4A 4U3FH 5DEDA 1TAEA 4J7JA 2LW7A 4JI4B 4O2AB 1LUVA 4EKWA 3HKEB 1WPXA 4N21A 3JAWA 1IXBA 2FB5A 1TUBB 1M4UA 4JYYA 4FFBA 2LO1A 4HNAB 1PNMA 2EIJC 1S0VA 2JS3A 1VQ5V 1JQ0A 1N32O 3R66A 2IBZH 5KMGB 3AG1B 3OAAG 4FM2A 2BCCH 5CA0A 5IJ9A 1M57B 4I55A 4JI6O 3SGIA 4IHJA 3JD3A 2F4VB 3ZHVA 2VWKA 3JALB 3ABUA 4WFGA 1R73A 3HPLC 4RQFA 4GX0A 4LF5O 3K9SA 3CD6V 4KL1A 1YJ9V 2HVJC 4UCTA 3RYCB 5DECA 2PYJA 1GM9A 4GUNA 4PJ0Z 4J11A 4LFAO 5LHIA 4BW5A 1XMOB 4PA9A 2OYQA 3ZHQA 2Y69B 4CH6A 1V54C 4AHCA 2P6JA 2FYUH 3ZRXA 3OD4A 2UU9O 3CJHA 3HKCA 4NXMO 4DUYB 3AG2C 4Z1VA 3QTCA 3B8MA 4ABMA 4TT3G 2KKWA 1YDXA 3JCUZ 1KP2A 5LMUB 2OCCC 5LOVB 3ZBHA 1N34O 1COWG 1AJNA 1F23A 3A8TA 3QO8A 2Q67A 4UCSA 3B77A 5JQGA 4OPHA 4ZHQA 1IXMA 4HZ3A 4NXNO 1N0JA 2LP7A 2N74A 5LP6C 3ZRWA 4TV9A 4DV0O 3OTOB 4UVCA 4JV5B 3CXHF 2NN4A 2YS8A 1WB8A 2CAZC 2OIEA 3HKBA 2YDEA 3E8BA 4LF8B 4KHPO 4LF4B 4IGGA 3F5TA 2XOKG 2WLLA 1ENVA 4YJ2A 1SKVA 3THOA 1YTFB 5IDJA 1PNKA 2CGOA 4B3TB 5EIBD 1VQ8V 1WAZA 4O4IB 2GTAA 1GAXA 2GUZA 4B3MO 3ABMC 4JTAB 2QEXV 2LFSA 3UKMA 2M7WA 2O57A 3UM7A 1B04A 4O4HA 3ZMTA 4X88A 5L3DA 4J80A 1LUWA 4H37A 1KBHA 1GKFA 4GYCB 3G6BA 2JVDA 1BE3H 3U10A 1VARA 4LNUB 2LQTA 4FK5C 3L73H 1P4RA 1SRYA 4LF9O 1JJ2U 3N2GA 3ETEA 1SQBH 1S5LZ 5JCOA 4J9ZB 4PD4F 3ABTA 3VBBA 3CCRV 4LFBO 2IW5A 2Q73A 1FKAO 4JI3B 3RVZA 4F6EA 3JD2A 3JAMN 2QR4A 5EZYB 1FAFA 2ZE5A 2AW9A 1RP3B 2AGAA 4PDVA 4WFAV 2EIMC 5EC2C 1S3JA 3TK1A 4C7UA 2BSKB 1SA0A 2P4VA 1FXHA 1NU1H 2F23A 3E8FA 4JAVA 4JYCA 3ZHTA 3I56V 2A7WA 3T4ZA 1IBLO 3STZC 1BGYH 4XDJA 2AHYA 1RSOB 1BMFG 4LF6B 2G38A 3JASB 2WLMA 2ZQMA 5LXTB 3N2KB 4TWKA 5L3CA 2M6YA 1XEQA 2WLNA 3JAKB 3ZIAG 3OW2U 3WB0A 2HR3A 4FLZA 4GX1A 5CA1B 3WB2A 1Y74A 1NBMG 2BE3A 1R3IC 1QVFU 2ZINA 4U3JA 4IIJB 1GRJA 2YUAA 1HDJA 2ZNIA 2ZNJA 2PI4A 1KU9A 2YC0A 3E2EA 4RAIA 5LL6Y 2BOBC 4PELA 1WA8B 4DV7O 2BOCC 2DW4A 4NTYA 2A06H 2YXHA 3OM3B 5H5NA 1HWYA 4I9QA 5EBMC 4JI1B 5BR8O 1Q82W 1THZA 1FYJA 3HR0A 5LHHA 1Q6UA 4JAUA 3BABA 4MSWC 4MVZA 1ZL8A 2QDOA 1YCIA 1JJOA 4YXWG 1NVPD 4DV5O 1WPBA 4MTOA 2DJVA 3LDDA 4HYOA 2OTJV 3K5MA 3K04A 1VQKV 4LFCB 4DV4O 4DR7B 1QCEA 2XHBA 2QKAA 3IAYA 2GHYA 2OCHA 1Z5VA 1HR0B 3QF7A 1DTOA 2F1MA 2P4KA 2Q68A 1AI7A 4FIPC 2DYRC 4DR1B 4MVSA 2UUBB 2A9HA 4OX9O 4A5UB 3LNNA 5JJNB 4LC1A 4JGSA 1S5JA 4YY3O 3JD1A 1J5EB 1WLEA 2HG5C 3M7MX 1EZVH 2OCCB 5IWAB 4J7ZA 5J2UA 3EHBB 3HKDB 3CCEV 4MVMA 3A2FA 5LP6B 3G71V 3RBZA 2EIKC 4U7OA 4I4TA 2UXBO 1V55B 1DF4A 2D2CB 2ZR2A 2FL4A 1XMQO 3EVKA 4ZOLB 4H13B 5C8YA 2QA4V 1MMMA 3L72H 2Q8VA 1XREA 2GBOA 3ABKC 4AQYB 5JH7B 2E3CA 5LHGA 1OHHG 4XBFA 3FFQA 2JS5A 4F6RA 3N27A 5J2TA 5EC1C 1WNSA 1KECA 1K34A 4G28B 4DV3O 2CK3G 3L9DA 1E79G 1I94O 1QR9A 3K0DA 1H38A 1L8DA 5KHHA 3RYHA 4K0KO 2CDYA 1M9NA 2R72A 3T1HB 3G67A 3IJ4A 3SYCA 4WBNA 2YXLA 4LF7B 1W59A 2HJDA 2JDIG 4GKKB 3KKYA 4TV8B 2DQ0A 5CBFA 2Z5UA 4JI0B 3ASNC 4X1KB 1N8RW 3A0RA 4NB5A 3TETA 3DXRA 1N32B 2UXCO 4NYKA 5DN6G 3UO2A 2YXYA 1AP5A 2E5LB 1AI4A 4MVRA 4JI6B 2A0LA 4I50B 5GONB 1Y76A 3OTFA 2VS0A 3M99B 4DV2B 2QM7A 2YEVB 3FYIB 1KC8W 2WLHA 3SYPA 1GM8A 4ZBMA 2UUAO 3ZN1A 2Y0PA 5CB4A 2JGDA 1XNRB 2Q69A 3OUFA 3H01A 4OXSA 5EIBC 3H1HH 5F2VO 5IJ0B 1N0NA 2GV9A 1YSCA 4DR2O 4LFAB 2LJ2A 1OCZB 5KAIZ 3RVYA 4CBCA 2ZIOA 2CTWA 2R70A 2PI5A 5KHGA 2CH7A 2X6BA 3APOA 4RUFA 2HVKC 3DSQA 3ZX6A 2QWPB 5BMVA 4UUJC 4UCUA 2IJKA 1CXZB 4AILC 4JYAB 5B3SC 1G8MA 3D36A 4DR6B 1D2DA 3VOUA 4DV6O 1XI1A 2FMLA 4H33A 4JI7O 3BY6A 1XNQO 4PDMA 1DLBA 5D5PA 1KKDA 1N34B 1N36B 3K3WA 3W7TA 3D3IA 4EFBA 2V1DA 1F4MA 1GN4A 2GDSA 4X1IA 3RYIA 4GZRB 3H1KH 1KB9F 2Y4TA 5B1AC 4LWSA 2KG7B 2PZSA 1GO3F 5ITZA 1BT8A 2NLJC 2ZIMA 1WP7A 4O2BA 3E86A 4YJ3A 1EN5A 3JATA 3R65A 3AG4B 2WLIA 3TCUA 4DV1B 1R6TA 2VRZA 4X65O 1NQTA 2YI8A 1YI2V 2UXNA 4X62O 4O2AA 3G6EV 1X59A 3O65A 1N33B 4X1YB 2ETNA 2X6AA 5JCOC 3OEHG 1VQLV 2UXXA 4HNAA 3SJQC 1QVGU 3OE7G 2YIBA 5KHKA 1IVSA 2EJ7A 2P06A 4LF9B 1BSMA 3T1YB 3CC4V 3K57A 1BHBA 3D3QA 1Q8IA 2WAMA 5CBGA 3SR2C 2KSDA 4ZI7B 3U11A 4I0XB 2LGQA 4YHHB 3FX7A 2ATKC 4X66O 3JALA 2W0FC 1E1RG 4JI2B 1D5NA 3X2QB 1EN4A 1H2LA 2WLKA 5IY5C 5GTIZ 5B5EZ 1YJWV 3CC2V 4FJCC 4DUZO 1AI5A 1EBOA 4G27B 4JZ2A 1I08A 1G6UA 2LW1A 3RYCA 5JVDB 3ZHRA 1AROP 2EJRA 1KQSU 1OCCC 4BW9A 5H6QA 5KAFZ 3I55V 4X20B 1U96A 1MSDA 2CUGA 2LGWA 1A32A 2YI9A 4O4JA 4FZ1A 2EILC 1AP6A 2Z3YA 5HFLA 4JI5B 3CCJV 1XDCA 2RDCA 2PF4E 2ZDIA 2YIBD 4BIZA 5LGTA 2V7QG 1T5EA 2HEPA
chains in the Genus database with same CATH topology
2R9IA 1XL6A 1FXHA 4LP8A 4Q20A 4QNHB 1QBZA 3E8FA 4JAVA 5IYDO 4JYCA 3I56V 2ZXWC 2DQ3A 1M56C 4N23A 2HLDG 4GCZA 3T4ZA 3STZC 4XDJA 3X2QC 2AHYA 2IJIA 4R8CA 4ASUG 1OCRC 1BMFG 5EBLC 1K5SA 2WLMA 2ZQMA 3T4DA 3K08A 4TWKA 5L3BA 5L3CA 1E1QG 1EFRG 2A79B 2XAQA 2WLNA 5CA3A 3ZIAG 3JD0A 3OW2U 1Q7YW 1F51A 2HR3A 2IU0A 4GX1A 4QPKA 3F5WC 4P9OA 4UV9A 2IU3A 2F43G 1NBMG 2WSSG 1S72V 3SPIA 1F4NA 1I5YA 1R3IC 1QVFU 1MG1A 3SYOA 1R3KC 1JCHA 3ZMUA 2JEUA 3FB6C 2P67A 4BIUA 2XAHA 3WG7C 1K73W 3ZRSA 4I5SA 5B1BB 2PI4A 3E2EA 3FB5C 4RAIA 3W7XA 2BOBC 5EBWC 4WCEV 4I9WA 4PELA 2DYRB 2DWDC 1I5XA 2IH3C 1VQ7V 1GK9A 1W0KG 4P30A 2BOCC 2DW4A 3HB3B 4PDLA 3P30A 4FMTA 3F7YC 3OM3B 1VQMV 3ZJZA 3OUSA 2ZD9A 3IFXA 1RM1B 1HWYA 5EBMC 4CZZA 2ITDC 2IH1C 1Q82W 1B6QA 1THZA 1ORQC 5LHHA 2IJHA 5KUKA 1JOYA 1JVMA 1K33A 2C2AA 1K3EA 3IGAC 3ZMZA 4JAUA 4JTCB 4MSWC 3SPGA 2Q6AA 4MVZA 5L3EA 2K1EA 1FXVA 3FB7C 4RQEA 1VQ9V 4YXWG 1AJPA 1JPXA 1GMGA 3ZN0A 1NVPD 1NKDA 2EINB 1K4DC 4MTOA 3LDDA 2EIKB 3FKSG 2W6JG 4HYOA 3ZRWB 5L3GA 1SZTA 2XASA 1P7BA 2JEXA 2QE7G 2OTJV 2JK5C 3K04A 3E83A 2WWWA 4RO2A 5KA5A 1K97A 1VQKV 1YITV 2HJFC 3FB8C 2P90A 1QCEA 1UJWB 2GHYA 4KUMA 4DO2A 3OMNB 5L3FA 5B1BC 4MW8A 1YTFD 3EFFK 3ABKB 4QE7A 2WLLB 1DTOA 2Q68A 4KP4A 1AI7A 3LDCA 4FIPC 4MTGA 2DYRC 3OMIB 4MVSA 3IC7A 3CCLV 5B1AB 2A9HA 2OT5A 4UVBA 4GX5A 1OZ0A 1K9MW 2XNDG 4LC1A 1RM1C 2JJ2G 4JGSA 1YJNV 2DYSB 3JD1A 1W2BU 1AR1B 1WLEA 3OR6C 3KG2A 2HG5C 3K03A 5GW7A 2EZPA 3ABLB 3CCMV 1VQ6V 3T2MA 4P9PA 2OCCB 4JTDB 3ZMSA 1KD1W 3RW0A 1M90W 4MVQA 2DWEC 4R7CA 3EHBB 4X8AA 3CCEV 1H8EG 4MVMA 3SPHA 4GT1A 1VQPV 4U7NA 3G71V 3RBZA 3AG3B 2EINC 1RPRA 3LDEA 1K7DA 2EIKC 1SETA 4MT8A 4MTFA 3OMAB 3OR7C 2GSMB 1FXKB 3ASNB 4U7OA 1V55B 1ZWIC 5CN0A 1DF4A 4MTXA 4LCUC 2ZR2A 2XAJA 3WFVA 4PA7A 3P32A 3ZMVA 1NR7A 2Y48A 3LNMB 3JYCA 4UXNA 5CMUA 2QA4V 3F7VC 4FPPA 1Q81W 3ABKC 2ITCC 2H94A 3SPJA 1OHHG 3ASOC 2X7RB 4XBFA 5LHGA 3CCUV 3K9AA 1G4YB 5EC1C 5B1NA 1KECA 4HAMA 3GB7C 1K34A 4R50A 4MW3A 2B1GA 3FYEB 4G28B 4WFBV 4P2ZA 1PD3A 2DYSC 1QLEC 2EIJB 2CK3G 1L1FA 3STLC 1BHAA 3CCVV 1QR8A 1YIJV 3CCQV 1E79G 3ABLC 1QR9A 3DTUB 4TSFG 3K0DA 1H38A 4Z1MG 3W7WA 3MHSC 3K79A 4WF9V 1W0JG 2KB1A 2QM8A 1M9NA 3SYQA 5HFMA 1DF5A 3SYCA 1FFTB 3CC7V 1NVPB 4GX2A 1CP9A 5H6RA 1OCOB 1OCCB 3AG3C 3MD0A 2JDIG 2B5UA 5IYCO 4JYBA 2DQ0A 5CBFA 2IJJA 2Z5UA 1FXKC 3ASNC 1V55C 1NJIW 5KA6A 1N8RW 1S76D 2W6IG 3A0RA 4JF3A 3TETA 2WLIB 3PJSK 1NH2B 5LGUA 1Y66A 5DN6G 1RPOA 5B3SB 3CMEV 4WFHA 3ZCCA 3G4SV 1AI4A 3SYAA 4MVRA 2A0LA 4RUEA 2R9RB 3QO7A 1MSWD 3M99B 1M1KW 4EKWA 2QM7A 2EZOA 2YEVB 3FYIB 1KC8W 2WLHA 3SYPA 1GM8A 1WPXA 4N21A 4ZBMA 1JX9A 3ZN1A 2JIZG 1S77D 2ZXWB 1M56B 1PNMA 3AEIA 2NNUA 1V54B 2EIJC 1S0VA 5LBQA 2Q69A 3OUFA 4WFEA 3H01A 1Q86W 4OXSA 3MHHC 5EC2C 3TK1A 1VQ5V 1JQ0A 3AG1B 3OAAG 1YSCA 5CBHA 3E89A 1OCZB 3RVYA 4CBCA 3AG2B 1MOFA 1NR1A 2XAGA 3SPCA 3W7UA 1M57B 2PI5A 1AI6A 5EK0A 2X6BA 1FXKA 3QNEA 3JD3A 4RUFA 2HVKC 1AJQA 3CP1A 5C93A 2X6CA 4JASA 3GWOA 2HKOA 1QLNA 3ABUA 4UUJC 4WFGA 3K06A 2AHZA 1PL0A 3T1CA 2IJKA 1R73A 3HPLC 2JJ1G 4RQFA 4GX0A 4UV8A 3CD6V 5B3SC 1YJ9V 1G8MA 3D36A 4PA3A 5B1OA 2QTOA 1ROPA 2HVJC 1XL4A 3VOUA 3QO5A 4JPRA 3CYOA 1GM9A 4H33A 3ETDA 3CCSV 5LHIA 2H8PC 3BY6A 4BW5A 4XDLA 4F4LA 4PDMA 1DLBA 2ZR3A 1KKDA 4PA9A 4WFFA 1K8AW 2Y69B 3K3WA 1PNLA 1V54C 1K5QA 3W7TA 3E35A 1R3JC 3D3IA 4MS2A 2V1DA 5DM6V 1SESA 2P6JA 1F4MA 5H9CA 3ZRXA 1VQ4V 3ETGA 3E8HA 3AG1C 5B1AC 3ABMB 1OCZC 3AG2C 3LSQA 1MABG 1GO3F 4PA6A 1M57C 2OTLV 3B8MA 4TT3G 4XDKA 4MVUA 3CPWU 2NLJC 2QKSA 1H2GA 4G2KA 5E1AC 1KP2A 3E86A 3OGCC 5IY5B 3R65A 3AG4B 4ZKIA 2WLIA 2OCCC 3TCUA 4E2LA 1COWG 1AJNA 1F23A 1R6KA 3QO8A 2Q67A 3B77A 4DXWA 1NQTA 2D3OW 3DGEA 4LBEC 1IXMA 4HZ3A 1J95A 4PDRA 4QE9A 2LP7A 3ZRWA 1YI2V 1GTOA 2UXNA 2YEVA 3G6EV 4UVCA 2LFRA 2XAFA 2X6AA 1CPYA 3OEHG 1VQLV 2UXXA 2EILB 3E8BA 3SJQC 1QVGU 3CXCU 2X0LA 2XOKG 3OE7G 2WLLA 2Y69C 1ENVA 2FTKA 3OEEG 1YTFB 5J9PC 5IDJA 1PNKA 2WLJA 4QIWF 4BAYA 1Y4MA 3CMAV 1LNQA 1VQ8V 2EIMB 3CC4V 1BHBA 2WAMA 5CBGA 2ZDIC 1GM7A 2HFEC 3BEHA 3ABMC 3NXSA 4JTAB 2QEXV 1R3LC 1FS0G 3JCZA 2LFSA 3ML0A 5LGNA 1R6NA 2ATKC 3UKMA 1S5HC 1SERA 2M7WA 2W0FC 1E1RG 4UVAA 2MK3A 3UM7A 3X2QB 1OCRB 3ZMTA 4X88A 2WLKA 5L3DA 5IY5C 1VQNV 3AG4C 3K0GA 3B8NA 5BZBA 1PKXA 4H37A 3LUTB 4L87A 1GKFA 1VQOV 1YJWV 4FJCC 3CC2V 1AI5A 1EBOA 4G27B 1NH2D 1K92A 3OFNG 2B1IA 4J9YB 4FK5C 1P4RA 1AROP 1SRYA 1TUEB 2EJRA 1KQSU 1JJ2U 1OCOC 1OCCC 3ETEA 5H6QA 5KUMA 3I55V 2EBOA 2P7TC 4J9ZB 4MVOA 3ABTA 3VBBA 3CCRV 3ASOB 1KP3A 1K4CC 2IW5A 4R6ZA 5FL7G 4QJFB 1EZJA 2EILC 4KFMA 2Z3YA 4X89A 5HFLA 3RVZA 3JD4A 4PA4A 3WG7B 3LSSA 3CCJV 3JD2A 3W7SA 3E8GA 1QLEB 2YSUB 5IYBO 1BL8A 4QPJA 2ZDIA 4BIZA 4PDVA 4WFAV 5LGTA 3ZRVA 2EIMC 2WPDG 2V7QG 1YHQV 1H8HG 1CEZA 1S3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF3 A;  3GWO A;  1DLB A;  1QR8 A;  2EBO A;  4G2K A;  1I5X A;  1QR9 A;  1Y66 A;  3H01 A;  1QBZ A;  1JPX A;  2M7W A;  4FIP C;  5CMU A;  3P30 A;  2MK3 A;  3MHH C;  4N23 A;  4E2L A;  1JQ0 A;  3MHS C;  1F23 A;  1I5Y A;  1ENV A;  2OT5 A;  2P6J A;  1MG1 A;  2X7R B;  3B8N A;  5H9C A;  3B77 A;  5HFL A;  1SZT A;  3K9A A;  5HFM A;  1Y4M A;  1MOF A;  4FJC C;  1DF5 A;  4JPR A;  1EBO A;  3M99 B;  3CYO A;  4JGS A;  1K34 A;  2EZO A;  2LP7 A;  1DF4 A;  5CN0 A;  5KA5 A;  4FK5 C;  4N21 A;  1K33 A;  1QCE A;  3B8M A;  5KA6 A;  2EZP A;  3WFV A;  3CP1 A; 
#chains in the Genus database with same CATH topology
 1PP9 H;  1XL6 A;  4Q20 A;  1YF2 A;  4TQD A;  4QNH B;  4B3R O;  5FLX N;  4PHZ A;  1M56 C;  2HLD G;  1FJG B;  2ODM A;  5IJ9 B;  5LOV A;  1OCR C;  5EBL C;  4FM1 A;  4FLY A;  2V4D A;  1BZK A;  4IHJ B;  4JZG A;  1IBM O;  3K08 A;  5L3B A;  1NS1 A;  1E1Q G;  2XAQ A;  1Q7Y W;  1F51 A;  4UV9 A;  2F43 G;  1P49 A;  3SPI A;  1MG1 A;  1PV0 A;  3SYO A;  2JEU A;  3BA8 A;  4FLW A;  3WG7 C;  3RYF B;  2QJ1 A;  3Q4H A;  1BQ0 A;  4I5S A;  4O4I A;  3UT5 B;  5B1B B;  4DR4 O;  3W7X A;  1H2S B;  4I9W A;  1VQ7 V;  4DR5 O;  1W0K G;  4O4L A;  3HB3 B;  4PDL A;  3P30 A;  4FMT A;  3F7Y C;  1US6 A;  1AB3 A;  3ICX A;  1RM1 B;  3ZED A;  1ORQ C;  1KUQ A;  4LNU A;  2Q6A A;  1FXV A;  2HHH O;  4B3S O;  4RQE A;  2ZCE A;  1L0N H;  1XOU A;  1GMG A;  1Z5W A;  2EIN B;  1K4D C;  3MDS A;  2UXD O;  3ZRW B;  2ADQ B;  2MW2 B;  3CRC A;  3A0B Z;  5JJE B;  3E83 A;  5AG2 A;  1YIT V;  2PUS A;  2HJF C;  5EZY A;  3HKB B;  3OMN B;  4EEQ A;  2VQF O;  1YTF D;  2BTO A;  1Q6I A;  1F7Y A;  2WLL B;  3JSN A;  3IC7 A;  5B1A B;  2OT5 A;  1TVK B;  3L70 H;  3FAV A;  4UVB A;  2DN9 A;  4GX5 A;  1K9M W;  1LR1 A;  1RSO A;  2OWO A;  1Q6H A;  3OR6 C;  4YIO A;  4JI4 O;  1IBK B;  5GW7 A;  3K03 A;  3ABL B;  1MZE A;  4P9P A;  3N2K A;  4JTD B;  3RW0 A;  4CH4 A;  1M90 W;  4BWA A;  2L35 A;  2Z0A A;  1YXB A;  3B2E E;  3E22 B;  3CWB H;  5CA1 A;  1VQP V;  4GT1 A;  4U7N A;  4J41 A;  3LDE A;  1K7D A;  3OMA B;  1FXK B;  1ZWI C;  3N2G B;  5CN0 A;  4IIJ A;  5LMN B;  2BTQ B;  2XAJ A;  4PA7 A;  3P32 A;  3ZMV A;  1BQZ A;  1M93 A;  1SQQ H;  3RT3 C;  3H1J H;  2F4V O;  4UXN A;  5CMU A;  3F7V C;  2N05 A;  5A2Q N;  1WA8 A;  4TOI A;  2H94 A;  3ASO C;  3L71 H;  1NTZ H;  3K9A A;  1FFX B;  3JAR B;  5B1N A;  4R50 A;  4MW3 A;  1SA0 B;  4WFB V;  2RJZ A;  2DYS C;  1QLE C;  2EIJ B;  2KQX A;  1X4T A;  1L1F A;  3CCV V;  1QR8 A;  1YIJ V;  3CCQ V;  3H9V A;  4EB6 A;  4TSF G;  4W4K A;  1XMO O;  3W7W A;  3MHS C;  1NT2 B;  1W0J G;  1VIB A;  1DF5 A;  1NVP B;  1OCC B;  1XBL A;  3AG3 C;  2P5O A;  5IYC O;  2IJJ A;  2UUC B;  4DUY O;  1GN2 A;  5LYJ A;  1NJI W;  1ZX3 A;  1HNW B;  1NH2 B;  4IT5 A;  4D7T A;  1Y66 A;  4X64 B;  5D5Q A;  1VEW A;  2IM9 A;  4U3J B;  5LMU O;  1HNZ B;  2QGN A;  3SYA A;  3D36 C;  4RUE A;  2R9R B;  3QO7 A;  1M1K W;  2JIZ G;  1S77 D;  2RQ6 A;  1M56 B;  1V54 B;  1SF9 A;  5LBQ A;  3OT7 A;  5KHJ A;  3OTO O;  5IYZ A;  4JV5 O;  1Q86 W;  4DV6 B;  3GVM A;  4JI8 O;  3HKD A;  2QWO B;  3E89 A;  4LF4 O;  1QHT A;  3AG2 B;  1VF6 A;  1MOF A;  2XAG A;  3SPC A;  1GN6 A;  3W7U A;  1SQP H;  2ILM A;  4B3T O;  1OJH A;  2X6C A;  2HKO A;  3SJB C;  2AHZ A;  3DC6 A;  3GWK C;  4ZOL A;  1JFF B;  2P22 C;  1HNX B;  2YIC A;  4PA3 A;  1EN6 A;  2QTO A;  1ROP A;  5B1O A;  4ZIB A;  4JPR A;  3P3P A;  4K3A A;  3KCX A;  1YVW A;  2H8P C;  1Q5O A;  4XDL A;  3UO3 A;  4F4L A;  4UCO A;  1OV9 A;  5H2F Z;  4OPA A;  4WFF A;  1MNG A;  1PNL A;  4NVP A;  1R3J C;  4DW0 A;  3CHX A;  4MS2 A;  1SES A;  3SJA C;  4X62 B;  5FPR A;  3S3X A;  3AG1 C;  1UFI A;  4JI3 O;  1TA8 A;  3ABM B;  1PPJ H;  2GTS A;  2OTL V;  1M57 C;  2CTQ A;  4MVU A;  5J2U B;  1KKC A;  4X9Q A;  2QKS A;  4GKJ B;  1H2G A;  1U97 A;  5KLV H;  1L0L H;  3OGC C;  4AI8 A;  4ZKI A;  4FFK A;  1V9P A;  2JRI A;  1R6K A;  1ZSP A;  4DXW A;  5JJJ B;  3DGE A;  4PDR A;  1J95 A;  4QE9 A;  5GON A;  1GTO A;  4LF6 O;  4ICG A;  2YEV A;  5C8Y B;  2LFR A;  2ARH A;  4OGQ B;  4E4E A;  4KXR A;  5J2T B;  1SS3 A;  2Y69 C;  3IC9 A;  2FTK A;  3OEE G;  3BVO A;  5IJ0 A;  3CMA V;  1LNQ A;  2EIM B;  4NTX A;  2ZDI C;  1GM7 A;  3BEH A;  4K8Z A;  5BY1 A;  4DK0 A;  1KYO F;  3BHP A;  3NXS A;  1R3L C;  3JCZ A;  4HBN A;  5LGN A;  4LF5 B;  1R6N A;  1S5H C;  1SER A;  1ZUQ A;  5EYP B;  4UFZ A;  4CH5 A;  3K0G A;  1EM1 A;  3B8N A;  1HP8 A;  1PKX A;  4WBN B;  5E79 Z;  1VQO V;  1QQC A;  5K1X A;  3OFN G;  2B1I A;  4JI1 O;  4DRX A;  4J9Y B;  2QWN B;  5KX5 B;  3DXR B;  5BXZ A;  2N04 A;  1TUE B;  4B3R B;  1OCO C;  2E75 B;  5FNV B;  5KUM A;  2P7T C;  4B7K A;  3ASO B;  1KP3 A;  5FL7 G;  3BPZ A;  2UU9 B;  3CE2 A;  4QJF B;  4NXM B;  4B08 A;  3UQ8 A;  1EZJ A;  4FLX A;  2RN9 A;  4X89 A;  3JD4 A;  4PA4 A;  3LSS A;  4DR3 O;  3E8G A;  1QLE B;  1BL8 A;  5CB4 B;  5JWP A;  2Q4P A;  1XIL A;  3BRC A;  3ZRV A;  2WPD G;  3A0H Z;  1H8H G;  2KG7 A;  4CH3 A;  4LFC O;  4DR7 O;  1IZ3 A;  3J7A U;  3C3S A;  1QBZ A;  3RFR A;  2ZXW C;  2DQ3 A;  1HR0 O;  4N23 A;  4GCZ A;  4NXN B;  4DR1 O;  2CH7 B;  3KZI Z;  3JSL A;  4DV0 B;  3T4D A;  4DR5 B;  1EFR G;  1IUR A;  2ZE6 A;  1J5E O;  5CA3 A;  4KHP B;  2IU0 A;  2Q7H A;  4X1Y A;  1JA8 A;  5IWA O;  3K5N A;  3VQX A;  2IU3 A;  1S72 V;  4FVM A;  2PGG A;  1JCH A;  3FB6 C;  2XAH A;  4B3M B;  1K73 W;  2K9P A;  2B9Z A;  3HKE A;  4LH7 A;  3SDL A;  4BIO A;  5EBW C;  2DYR B;  2DWD C;  1TUB A;  4ZI7 A;  1GK9 A;  4FZ0 A;  4H44 B;  2Q7G A;  4JAA A;  5TIS Z;  5LA6 B;  1VQM V;  1DK1 A;  3IFX A;  4LWS B;  4AQY O;  2ITD C;  5ITZ B;  1B6Q A;  5KMG A;  2ZE8 A;  2IJH A;  1JOY A;  1JVM A;  1K33 A;  2C2A A;  1K3E A;  3C90 A;  4O2B B;  2RNB A;  3ZMZ A;  4LFB B;  4JTC B;  1H2K A;  5L3E A;  3K58 A;  1VF5 B;  2K1E A;  4TUY B;  3FB7 C;  1VQ9 V;  1JPX A;  2DE0 X;  3ZN0 A;  2DMX A;  1NKD A;  3ZHU A;  3BAA A;  2EIK B;  2W6J G;  2XAS A;  1P7B A;  2JEX A;  2QE7 G;  2JK5 C;  2CGN A;  2WWW A;  4RO2 A;  2ZM6 O;  3QVN A;  3T1H O;  1GN3 A;  2P90 A;  2Y0I A;  3PN1 A;  5IE9 A;  4LF7 O;  4DO2 A;  2Q5Z A;  4GKK O;  4JI0 O;  3EFF K;  1IDS A;  3ABK B;  1IBL B;  4KP4 A;  3BCC H;  4MTG A;  2QM4 A;  4J10 A;  4CC6 A;  1AR4 A;  1I7F A;  2E5L O;  3JAW B;  1W2B U;  1AR1 B;  4FFB B;  2YID A;  2Y4U A;  3KG2 A;  1P84 F;  4DV2 O;  2WA4 A;  3L74 H;  4LH6 A;  3SJC C;  4MVQ A;  3RWR D;  5IT9 N;  2DWE C;  4X8A A;  1XNR O;  5CA0 B;  4I55 B;  2VQE O;  3U0Z A;  4MTF A;  1SET A;  3ASN B;  3CRA A;  2F66 C;  3RYF A;  1SZX A;  4DV7 B;  3UT5 A;  2EX3 A;  1Q90 D;  1RFY A;  1NR7 A;  4O4J B;  3JYC A;  2H3O A;  5BR8 B;  3CB2 A;  2ITC C;  3SPJ A;  3I5D A;  3J81 N;  4NKG B;  1YEW A;  3QG5 A;  1Y6X A;  4UB6 Z;  4JYA O;  1XHZ A;  4HAM A;  3GB7 C;  4DR6 O;  5FPO A;  3AK2 A;  1M5I A;  3STL C;  4DV5 B;  2QTS A;  3J80 N;  3DTU B;  2E76 B;  4Z1M G;  1N36 O;  3CJH B;  3HKC B;  1SQX H;  2KB1 A;  3G80 A;  2QM8 A;  3SYQ A;  1I0H A;  1VF6 C;  4DV4 B;  1CP9 A;  5H6R A;  1OCO B;  3VQW A;  2B5U A;  4JYB A;  2PTM A;  1V55 C;  2W6I G;  4JF3 A;  3PJS K;  5LGU A;  1G1X B;  1RPO A;  4JI8 B;  4OX9 B;  5B3S B;  4IYI A;  3AG7 A;  5JQG B;  3APQ A;  3ZCC A;  3H1I H;  4ZHQ B;  4YY3 B;  1H2N A;  2R9A A;  4DV1 O;  3Q4H B;  1TVK A;  4TV9 B;  1MSW D;  1BS3 A;  2EZO A;  5A9G A;  4D6T H;  3RGB A;  1JX9 A;  4CS2 A;  4O4L B;  1JMK C;  2ZXW B;  3AEI A;  2NNU A;  2AZ0 A;  2AZ2 A;  4WFE A;  1N33 O;  4K35 A;  4YJ2 B;  2BSK A;  3MHH C;  3BFR A;  4J7K A;  2UXB B;  1AVM A;  3E22 A;  5CBH A;  4TQF A;  3LSU A;  1NR1 A;  2Q0O C;  1AI6 A;  2GUZ B;  3OGI B;  3B40 A;  5EK0 A;  4DK1 A;  1XMQ B;  4J42 A;  1FXK A;  3JAS A;  3QNE A;  3T1Y O;  1AJQ A;  3CP1 A;  5C93 A;  2W0X A;  4JAS A;  3GWO A;  5LXT A;  3S3W A;  1QLN A;  2BTQ A;  2ADP A;  3K06 A;  4O4H B;  1PL0 A;  3T1C A;  2JJ1 G;  3JAK A;  4UB8 Z;  4UV8 A;  4YHH O;  3CEI A;  4JI2 O;  1XL4 A;  2ZE7 A;  1MZF A;  3QO5 A;  4DV3 B;  3CYO A;  1FFX A;  1NTM H;  1ZAU A;  3ETD A;  1AIL A;  3JAR A;  3CCS V;  4BR6 A;  1I94 B;  3BA9 A;  1WN7 A;  2ZR3 A;  3ZS8 C;  4K0K B;  4IYH A;  1K8A W;  3FAV B;  2WA3 A;  3D8C A;  1K5Q A;  3E35 A;  5DM6 V;  1KMI Z;  5H9C A;  1VQ4 V;  3ETG A;  3E8H A;  3TGU H;  3O9O A;  1OCZ C;  4JI5 O;  3LSQ A;  2YIA A;  1QU7 A;  1MAB G;  3AK1 A;  4PA6 A;  2UXC B;  4XDK A;  3CPW U;  1ZLZ A;  1P7G A;  4G2K A;  1WB7 A;  5E1A C;  5IY5 B;  4E2L A;  3K5L A;  3B4S A;  1FJG O;  2D3O W;  2UUA B;  4LBE C;  3H1L H;  1ZTE A;  1SC5 B;  3KCY A;  2AXT Z;  2QKC A;  4K8X A;  4CS4 A;  2XAF A;  4QGP A;  3WB1 A;  1CPY A;  1Y74 B;  2XTA A;  1Y67 A;  2QSA A;  2EIL B;  1GH6 A;  4DR2 B;  3CXC U;  3ZHS A;  2X0L A;  3DC5 A;  5J9P C;  2WLJ A;  4QIW F;  4BAY A;  1Y4M A;  4FLU A;  3RN4 A;  3WU2 Z;  2HFE C;  1Q3E A;  5K1P A;  4EB6 B;  3CRR A;  1FS0 G;  3ML0 A;  3CRM A;  4UVA A;  4DR3 B;  2MK3 A;  3EXA A;  1OCR B;  2VWJ A;  4EFE A;  4PI0 A;  1VQN V;  3AG4 C;  1JFF A;  5BZB A;  3LUT B;  4L87 A;  4LF8 O;  4JI7 B;  1NH2 D;  5LYJ B;  4RWU A;  1K92 A;  5LP6 A;  2XT9 A;  1XNQ B;  1NZ6 A;  1ZL8 B;  4UCR A;  1R1B A;  1AR5 A;  2EBO A;  2RMK B;  4MVO A;  2E74 B;  1K4C C;  1FPO A;  4R6Z A;  4NR1 A;  4B7E A;  1B3Q A;  1FD9 A;  4KFM A;  3WG7 B;  2PYL A;  3W7S A;  5JH7 A;  2QWQ B;  5IYB O;  2YSU B;  4QPJ A;  2FKX A;  1YHQ V;  1CEZ A;  5IYZ B;  2R9I A;  4LP8 A;  4CC5 A;  2RCV A;  1PM9 A;  5IYD O;  4X65 B;  1MA1 A;  4IL6 Z;  3X2Q C;  4ASU G;  2IJI A;  4R8C A;  4Z2W A;  4NTW A;  1K5S A;  1Z2G A;  2A3Q A;  5KHI A;  2A79 B;  5GTH Z;  3JD0 A;  4TV8 A;  3VQY A;  1IBK O;  4X1K A;  3UCS C;  1TGO A;  4QPK A;  3F5W C;  4P9O A;  3L75 H;  2WSS G;  4L8J A;  1F4N A;  1I5Y A;  3ETQ A;  1R3K C;  4I4T B;  3ZMU A;  2P67 A;  4BIU A;  4W4L A;  3TXQ A;  2QWR B;  4LR3 A;  3K59 A;  4I50 A;  3ZRS A;  2ZKO A;  4X66 B;  3FB5 C;  5LMN O;  4WCE V;  1I5X A;  2CTR A;  2EUL A;  2IH3 C;  2Q0A A;  2OIG A;  4P30 A;  2PY5 A;  3C3T A;  1Q43 A;  2L6L A;  5EYP A;  4F6R B;  3ZJZ A;  4DUZ B;  3OUS A;  2ZD9 A;  2ZM6 B;  1BCC H;  4CZZ A;  2IH1 C;  2CE4 A;  2ZT9 B;  2F93 B;  1WJZ A;  5KUK A;  1NI8 A;  3IGA C;  1YZB A;  1SQV H;  5KX5 A;  3SPG A;  4I7Z B;  5FNV A;  3RYH B;  1AJP A;  2F95 B;  1XUQ A;  3MAQ A;  3FKS G;  1IX9 A;  4CS3 A;  5L3G A;  1SZT A;  3CX5 F;  3FD9 A;  3CRQ A;  3B09 A;  4UCV A;  3P3N A;  5KA5 A;  1K97 A;  3FB8 C;  1UJW B;  4KUM A;  5L3F A;  5B1B C;  4MW8 A;  2UUC O;  4QE7 A;  1VP7 A;  3LDC A;  2VQE B;  1HNW O;  3OMI B;  3VQV A;  3CCL V;  4X64 O;  1Y76 B;  1OZ0 A;  4FM0 A;  1HNZ O;  1IBM B;  2XND G;  1RM1 C;  2JJ2 G;  1YJN V;  2DYS B;  2CTP A;  2JGD B;  3CCM V;  1VQ6 V;  2EZP A;  3CS5 A;  3T2M A;  3ZMS A;  1KD1 W;  5B66 Z;  4FLT A;  4R7C A;  2NR5 A;  1H8E G;  3SPH A;  4DRX B;  3AG3 B;  2EIN C;  1RPR A;  4MT8 A;  3OR7 C;  2GSM B;  2UUB O;  1D5A A;  4MTX A;  4PI2 A;  4DR4 B;  1N4C A;  4LCU C;  4PV1 B;  5BMV B;  2DOS A;  3WFV A;  1O9G A;  3CSX A;  1VF7 A;  4DW1 A;  1XHX A;  2Y48 A;  3K5O A;  3LNM B;  4YIP A;  2XUM A;  4FPP A;  1Q81 W;  2JGU A;  2X7R B;  3TJT A;  3CCU V;  4H0L B;  5LA6 A;  1G4Y B;  1HNX O;  1HW7 A;  2B1G A;  3FYE B;  3M8A A;  4D7S A;  4P2Z A;  1NTK H;  1PD3 A;  2HHH B;  4B3S B;  1XQ8 A;  1H2M A;  1SQG A;  1BHA A;  3ABL C;  1UPG A;  2UXD B;  3NR7 A;  4X1I B;  4TUY A;  3RYI B;  4I0X A;  3K79 A;  4WF9 V;  1DGS A;  4DYL A;  5HFM A;  1B06 A;  1FFT B;  3CC7 V;  1URF A;  4GX2 A;  4FLV A;  2Q9L A;  3AK3 A;  2Q7E A;  3MD0 A;  2VQF B;  1WP8 A;  1FXK C;  5KA6 A;  4Q6G A;  1S76 D;  4YJ3 B;  4GLX A;  1O9H A;  1QNM A;  3JAT B;  5JVD A;  1JR9 A;  1VMG A;  2WLI B;  3TXS A;  3CME V;  4GKJ O;  4WFH A;  4X20 A;  2HP8 A;  3G4S V;  1SQF A;  1PL4 A;  4U3F H;  5DED A;  1TAE A;  4J7J A;  2LW7 A;  4JI4 B;  4O2A B;  1LUV A;  4EKW A;  3HKE B;  1WPX A;  4N21 A;  3JAW A;  1IXB A;  2FB5 A;  1TUB B;  1M4U A;  4JYY A;  4FFB A;  2LO1 A;  4HNA B;  1PNM A;  2EIJ C;  1S0V A;  2JS3 A;  1VQ5 V;  1JQ0 A;  1N32 O;  3R66 A;  2IBZ H;  5KMG B;  3AG1 B;  3OAA G;  4FM2 A;  2BCC H;  5CA0 A;  5IJ9 A;  1M57 B;  4I55 A;  4JI6 O;  3SGI A;  4IHJ A;  3JD3 A;  2F4V B;  3ZHV A;  2VWK A;  3JAL B;  3ABU A;  4WFG A;  1R73 A;  3HPL C;  4RQF A;  4GX0 A;  4LF5 O;  3K9S A;  3CD6 V;  4KL1 A;  1YJ9 V;  2HVJ C;  4UCT A;  3RYC B;  5DEC A;  2PYJ A;  1GM9 A;  4GUN A;  4PJ0 Z;  4J11 A;  4LFA O;  5LHI A;  4BW5 A;  1XMO B;  4PA9 A;  2OYQ A;  3ZHQ A;  2Y69 B;  4CH6 A;  1V54 C;  4AHC A;  2P6J A;  2FYU H;  3ZRX A;  3OD4 A;  2UU9 O;  3CJH A;  3HKC A;  4NXM O;  4DUY B;  3AG2 C;  4Z1V A;  3QTC A;  3B8M A;  4ABM A;  4TT3 G;  2KKW A;  1YDX A;  3JCU Z;  1KP2 A;  5LMU B;  2OCC C;  5LOV B;  3ZBH A;  1N34 O;  1COW G;  1AJN A;  1F23 A;  3A8T A;  3QO8 A;  2Q67 A;  4UCS A;  3B77 A;  5JQG A;  4OPH A;  4ZHQ A;  1IXM A;  4HZ3 A;  4NXN O;  1N0J A;  2LP7 A;  2N74 A;  5LP6 C;  3ZRW A;  4TV9 A;  4DV0 O;  3OTO B;  4UVC A;  4JV5 B;  3CXH F;  2NN4 A;  2YS8 A;  1WB8 A;  2CAZ C;  2OIE A;  3HKB A;  2YDE A;  3E8B A;  4LF8 B;  4KHP O;  4LF4 B;  4IGG A;  3F5T A;  2XOK G;  2WLL A;  1ENV A;  4YJ2 A;  1SKV A;  3THO A;  1YTF B;  5IDJ A;  1PNK A;  2CGO A;  4B3T B;  5EIB D;  1VQ8 V;  1WAZ A;  4O4I B;  2GTA A;  1GAX A;  2GUZ A;  4B3M O;  3ABM C;  4JTA B;  2QEX V;  2LFS A;  3UKM A;  2M7W A;  2O57 A;  3UM7 A;  1B04 A;  4O4H A;  3ZMT A;  4X88 A;  5L3D A;  4J80 A;  1LUW A;  4H37 A;  1KBH A;  1GKF A;  4GYC B;  3G6B A;  2JVD A;  1BE3 H;  3U10 A;  1VAR A;  4LNU B;  2LQT A;  4FK5 C;  3L73 H;  1P4R A;  1SRY A;  4LF9 O;  1JJ2 U;  3N2G A;  3ETE A;  1SQB H;  1S5L Z;  5JCO A;  4J9Z B;  4PD4 F;  3ABT A;  3VBB A;  3CCR V;  4LFB O;  2IW5 A;  2Q73 A;  1FKA O;  4JI3 B;  3RVZ A;  4F6E A;  3JD2 A;  3JAM N;  2QR4 A;  5EZY B;  1FAF A;  2ZE5 A;  2AW9 A;  1RP3 B;  2AGA A;  4PDV A;  4WFA V;  2EIM C;  5EC2 C;  1S3J A;  3TK1 A;  4C7U A;  2BSK B;  1SA0 A;  2P4V A;  1FXH A;  1NU1 H;  2F23 A;  3E8F A;  4JAV A;  4JYC A;  3ZHT A;  3I56 V;  2A7W A;  3T4Z A;  1IBL O;  3STZ C;  1BGY H;  4XDJ A;  2AHY A;  1RSO B;  1BMF G;  4LF6 B;  2G38 A;  3JAS B;  2WLM A;  2ZQM A;  5LXT B;  3N2K B;  4TWK A;  5L3C A;  2M6Y A;  1XEQ A;  2WLN A;  3JAK B;  3ZIA G;  3OW2 U;  3WB0 A;  2HR3 A;  4FLZ A;  4GX1 A;  5CA1 B;  3WB2 A;  1Y74 A;  1NBM G;  2BE3 A;  1R3I C;  1QVF U;  2ZIN A;  4U3J A;  4IIJ B;  1GRJ A;  2YUA A;  1HDJ A;  2ZNI A;  2ZNJ A;  2PI4 A;  1KU9 A;  2YC0 A;  3E2E A;  4RAI A;  5LL6 Y;  2BOB C;  4PEL A;  1WA8 B;  4DV7 O;  2BOC C;  2DW4 A;  4NTY A;  2A06 H;  2YXH A;  3OM3 B;  5H5N A;  1HWY A;  4I9Q A;  5EBM C;  4JI1 B;  5BR8 O;  1Q82 W;  1THZ A;  1FYJ A;  3HR0 A;  5LHH A;  1Q6U A;  4JAU A;  3BAB A;  4MSW C;  4MVZ A;  1ZL8 A;  2QDO A;  1YCI A;  1JJO A;  4YXW G;  1NVP D;  4DV5 O;  1WPB A;  4MTO A;  2DJV A;  3LDD A;  4HYO A;  2OTJ V;  3K5M A;  3K04 A;  1VQK V;  4LFC B;  4DV4 O;  4DR7 B;  1QCE A;  2XHB A;  2QKA A;  3IAY A;  2GHY A;  2OCH A;  1Z5V A;  1HR0 B;  3QF7 A;  1DTO A;  2F1M A;  2P4K A;  2Q68 A;  1AI7 A;  4FIP C;  2DYR C;  4DR1 B;  4MVS A;  2UUB B;  2A9H A;  4OX9 O;  4A5U B;  3LNN A;  5JJN B;  4LC1 A;  4JGS A;  1S5J A;  4YY3 O;  3JD1 A;  1J5E B;  1WLE A;  2HG5 C;  3M7M X;  1EZV H;  2OCC B;  5IWA B;  4J7Z A;  5J2U A;  3EHB B;  3HKD B;  3CCE V;  4MVM A;  3A2F A;  5LP6 B;  3G71 V;  3RBZ A;  2EIK C;  4U7O A;  4I4T A;  2UXB O;  1V55 B;  1DF4 A;  2D2C B;  2ZR2 A;  2FL4 A;  1XMQ O;  3EVK A;  4ZOL B;  4H13 B;  5C8Y A;  2QA4 V;  1MMM A;  3L72 H;  2Q8V A;  1XRE A;  2GBO A;  3ABK C;  4AQY B;  5JH7 B;  2E3C A;  5LHG A;  1OHH G;  4XBF A;  3FFQ A;  2JS5 A;  4F6R A;  3N27 A;  5J2T A;  5EC1 C;  1WNS A;  1KEC A;  1K34 A;  4G28 B;  4DV3 O;  2CK3 G;  3L9D A;  1E79 G;  1I94 O;  1QR9 A;  3K0D A;  1H38 A;  1L8D A;  5KHH A;  3RYH A;  4K0K O;  2CDY A;  1M9N A;  2R72 A;  3T1H B;  3G67 A;  3IJ4 A;  3SYC A;  4WBN A;  2YXL A;  4LF7 B;  1W59 A;  2HJD A;  2JDI G;  4GKK B;  3KKY A;  4TV8 B;  2DQ0 A;  5CBF A;  2Z5U A;  4JI0 B;  3ASN C;  4X1K B;  1N8R W;  3A0R A;  4NB5 A;  3TET A;  3DXR A;  1N32 B;  2UXC O;  4NYK A;  5DN6 G;  3UO2 A;  2YXY A;  1AP5 A;  2E5L B;  1AI4 A;  4MVR A;  4JI6 B;  2A0L A;  4I50 B;  5GON B;  1Y76 A;  3OTF A;  2VS0 A;  3M99 B;  4DV2 B;  2QM7 A;  2YEV B;  3FYI B;  1KC8 W;  2WLH A;  3SYP A;  1GM8 A;  4ZBM A;  2UUA O;  3ZN1 A;  2Y0P A;  5CB4 A;  2JGD A;  1XNR B;  2Q69 A;  3OUF A;  3H01 A;  4OXS A;  5EIB C;  3H1H H;  5F2V O;  5IJ0 B;  1N0N A;  2GV9 A;  1YSC A;  4DR2 O;  4LFA B;  2LJ2 A;  1OCZ B;  5KAI Z;  3RVY A;  4CBC A;  2ZIO A;  2CTW A;  2R70 A;  2PI5 A;  5KHG A;  2CH7 A;  2X6B A;  3APO A;  4RUF A;  2HVK C;  3DSQ A;  3ZX6 A;  2QWP B;  5BMV A;  4UUJ C;  4UCU A;  2IJK A;  1CXZ B;  4AIL C;  4JYA B;  5B3S C;  1G8M A;  3D36 A;  4DR6 B;  1D2D A;  3VOU A;  4DV6 O;  1XI1 A;  2FML A;  4H33 A;  4JI7 O;  3BY6 A;  1XNQ O;  4PDM A;  1DLB A;  5D5P A;  1KKD A;  1N34 B;  1N36 B;  3K3W A;  3W7T A;  3D3I A;  4EFB A;  2V1D A;  1F4M A;  1GN4 A;  2GDS A;  4X1I A;  3RYI A;  4GZR B;  3H1K H;  1KB9 F;  2Y4T A;  5B1A C;  4LWS A;  2KG7 B;  2PZS A;  1GO3 F;  5ITZ A;  1BT8 A;  2NLJ C;  2ZIM A;  1WP7 A;  4O2B A;  3E86 A;  4YJ3 A;  1EN5 A;  3JAT A;  3R65 A;  3AG4 B;  2WLI A;  3TCU A;  4DV1 B;  1R6T A;  2VRZ A;  4X65 O;  1NQT A;  2YI8 A;  1YI2 V;  2UXN A;  4X62 O;  4O2A A;  3G6E V;  1X59 A;  3O65 A;  1N33 B;  4X1Y B;  2ETN A;  2X6A A;  5JCO C;  3OEH G;  1VQL V;  2UXX A;  4HNA A;  3SJQ C;  1QVG U;  3OE7 G;  2YIB A;  5KHK A;  1IVS A;  2EJ7 A;  2P06 A;  4LF9 B;  1BSM A;  3T1Y B;  3CC4 V;  3K57 A;  1BHB A;  3D3Q A;  1Q8I A;  2WAM A;  5CBG A;  3SR2 C;  2KSD A;  4ZI7 B;  3U11 A;  4I0X B;  2LGQ A;  4YHH B;  3FX7 A;  2ATK C;  4X66 O;  3JAL A;  2W0F C;  1E1R G;  4JI2 B;  1D5N A;  3X2Q B;  1EN4 A;  1H2L A;  2WLK A;  5IY5 C;  5GTI Z;  5B5E Z;  1YJW V;  3CC2 V;  4FJC C;  4DUZ O;  1AI5 A;  1EBO A;  4G27 B;  4JZ2 A;  1I08 A;  1G6U A;  2LW1 A;  3RYC A;  5JVD B;  3ZHR A;  1ARO P;  2EJR A;  1KQS U;  1OCC C;  4BW9 A;  5H6Q A;  5KAF Z;  3I55 V;  4X20 B;  1U96 A;  1MSD A;  2CUG A;  2LGW A;  1A32 A;  2YI9 A;  4O4J A;  4FZ1 A;  2EIL C;  1AP6 A;  2Z3Y A;  5HFL A;  4JI5 B;  3CCJ V;  1XDC A;  2RDC A;  2PF4 E;  2ZDI A;  2YIB D;  4BIZ A;  5LGT A;  2V7Q G;  1T5E A;  2HEP A; 
#chains in the Genus database with same CATH homology
 2R9I A;  1XL6 A;  1FXH A;  4LP8 A;  4Q20 A;  4QNH B;  1QBZ A;  3E8F A;  4JAV A;  5IYD O;  4JYC A;  3I56 V;  2ZXW C;  2DQ3 A;  1M56 C;  4N23 A;  2HLD G;  4GCZ A;  3T4Z A;  3STZ C;  4XDJ A;  3X2Q C;  2AHY A;  2IJI A;  4R8C A;  4ASU G;  1OCR C;  1BMF G;  5EBL C;  1K5S A;  2WLM A;  2ZQM A;  3T4D A;  3K08 A;  4TWK A;  5L3B A;  5L3C A;  1E1Q G;  1EFR G;  2A79 B;  2XAQ A;  2WLN A;  5CA3 A;  3ZIA G;  3JD0 A;  3OW2 U;  1Q7Y W;  1F51 A;  2HR3 A;  2IU0 A;  4GX1 A;  4QPK A;  3F5W C;  4P9O A;  4UV9 A;  2IU3 A;  2F43 G;  1NBM G;  2WSS G;  1S72 V;  3SPI A;  1F4N A;  1I5Y A;  1R3I C;  1QVF U;  1MG1 A;  3SYO A;  1R3K C;  1JCH A;  3ZMU A;  2JEU A;  3FB6 C;  2P67 A;  4BIU A;  2XAH A;  3WG7 C;  1K73 W;  3ZRS A;  4I5S A;  5B1B B;  2PI4 A;  3E2E A;  3FB5 C;  4RAI A;  3W7X A;  2BOB C;  5EBW C;  4WCE V;  4I9W A;  4PEL A;  2DYR B;  2DWD C;  1I5X A;  2IH3 C;  1VQ7 V;  1GK9 A;  1W0K G;  4P30 A;  2BOC C;  2DW4 A;  3HB3 B;  4PDL A;  3P30 A;  4FMT A;  3F7Y C;  3OM3 B;  1VQM V;  3ZJZ A;  3OUS A;  2ZD9 A;  3IFX A;  1RM1 B;  1HWY A;  5EBM C;  4CZZ A;  2ITD C;  2IH1 C;  1Q82 W;  1B6Q A;  1THZ A;  1ORQ C;  5LHH A;  2IJH A;  5KUK A;  1JOY A;  1JVM A;  1K33 A;  2C2A A;  1K3E A;  3IGA C;  3ZMZ A;  4JAU A;  4JTC B;  4MSW C;  3SPG A;  2Q6A A;  4MVZ A;  5L3E A;  2K1E A;  1FXV A;  3FB7 C;  4RQE A;  1VQ9 V;  4YXW G;  1AJP A;  1JPX A;  1GMG A;  3ZN0 A;  1NVP D;  1NKD A;  2EIN B;  1K4D C;  4MTO A;  3LDD A;  2EIK B;  3FKS G;  2W6J G;  4HYO A;  3ZRW B;  5L3G A;  1SZT A;  2XAS A;  1P7B A;  2JEX A;  2QE7 G;  2OTJ V;  2JK5 C;  3K04 A;  3E83 A;  2WWW A;  4RO2 A;  5KA5 A;  1K97 A;  1VQK V;  1YIT V;  2HJF C;  3FB8 C;  2P90 A;  1QCE A;  1UJW B;  2GHY A;  4KUM A;  4DO2 A;  3OMN B;  5L3F A;  5B1B C;  4MW8 A;  1YTF D;  3EFF K;  3ABK B;  4QE7 A;  2WLL B;  1DTO A;  2Q68 A;  4KP4 A;  1AI7 A;  3LDC A;  4FIP C;  4MTG A;  2DYR C;  3OMI B;  4MVS A;  3IC7 A;  3CCL V;  5B1A B;  2A9H A;  2OT5 A;  4UVB A;  4GX5 A;  1OZ0 A;  1K9M W;  2XND G;  4LC1 A;  1RM1 C;  2JJ2 G;  4JGS A;  1YJN V;  2DYS B;  3JD1 A;  1W2B U;  1AR1 B;  1WLE A;  3OR6 C;  3KG2 A;  2HG5 C;  3K03 A;  5GW7 A;  2EZP A;  3ABL B;  3CCM V;  1VQ6 V;  3T2M A;  4P9P A;  2OCC B;  4JTD B;  3ZMS A;  1KD1 W;  3RW0 A;  1M90 W;  4MVQ A;  2DWE C;  4R7C A;  3EHB B;  4X8A A;  3CCE V;  1H8E G;  4MVM A;  3SPH A;  4GT1 A;  1VQP V;  4U7N A;  3G71 V;  3RBZ A;  3AG3 B;  2EIN C;  1RPR A;  3LDE A;  1K7D A;  2EIK C;  1SET A;  4MT8 A;  4MTF A;  3OMA B;  3OR7 C;  2GSM B;  1FXK B;  3ASN B;  4U7O A;  1V55 B;  1ZWI C;  5CN0 A;  1DF4 A;  4MTX A;  4LCU C;  2ZR2 A;  2XAJ A;  3WFV A;  4PA7 A;  3P32 A;  3ZMV A;  1NR7 A;  2Y48 A;  3LNM B;  3JYC A;  4UXN A;  5CMU A;  2QA4 V;  3F7V C;  4FPP A;  1Q81 W;  3ABK C;  2ITC C;  2H94 A;  3SPJ A;  1OHH G;  3ASO C;  2X7R B;  4XBF A;  5LHG A;  3CCU V;  3K9A A;  1G4Y B;  5EC1 C;  5B1N A;  1KEC A;  4HAM A;  3GB7 C;  1K34 A;  4R50 A;  4MW3 A;  2B1G A;  3FYE B;  4G28 B;  4WFB V;  4P2Z A;  1PD3 A;  2DYS C;  1QLE C;  2EIJ B;  2CK3 G;  1L1F A;  3STL C;  1BHA A;  3CCV V;  1QR8 A;  1YIJ V;  3CCQ V;  1E79 G;  3ABL C;  1QR9 A;  3DTU B;  4TSF G;  3K0D A;  1H38 A;  4Z1M G;  3W7W A;  3MHS C;  3K79 A;  4WF9 V;  1W0J G;  2KB1 A;  2QM8 A;  1M9N A;  3SYQ A;  5HFM A;  1DF5 A;  3SYC A;  1FFT B;  3CC7 V;  1NVP B;  4GX2 A;  1CP9 A;  5H6R A;  1OCO B;  1OCC B;  3AG3 C;  3MD0 A;  2JDI G;  2B5U A;  5IYC O;  4JYB A;  2DQ0 A;  5CBF A;  2IJJ A;  2Z5U A;  1FXK C;  3ASN C;  1V55 C;  1NJI W;  5KA6 A;  1N8R W;  1S76 D;  2W6I G;  3A0R A;  4JF3 A;  3TET A;  2WLI B;  3PJS K;  1NH2 B;  5LGU A;  1Y66 A;  5DN6 G;  1RPO A;  5B3S B;  3CME V;  4WFH A;  3ZCC A;  3G4S V;  1AI4 A;  3SYA A;  4MVR A;  2A0L A;  4RUE A;  2R9R B;  3QO7 A;  1MSW D;  3M99 B;  1M1K W;  4EKW A;  2QM7 A;  2EZO A;  2YEV B;  3FYI B;  1KC8 W;  2WLH A;  3SYP A;  1GM8 A;  1WPX A;  4N21 A;  4ZBM A;  1JX9 A;  3ZN1 A;  2JIZ G;  1S77 D;  2ZXW B;  1M56 B;  1PNM A;  3AEI A;  2NNU A;  1V54 B;  2EIJ C;  1S0V A;  5LBQ A;  2Q69 A;  3OUF A;  4WFE A;  3H01 A;  1Q86 W;  4OXS A;  3MHH C;  5EC2 C;  3TK1 A;  1VQ5 V;  1JQ0 A;  3AG1 B;  3OAA G;  1YSC A;  5CBH A;  3E89 A;  1OCZ B;  3RVY A;  4CBC A;  3AG2 B;  1MOF A;  1NR1 A;  2XAG A;  3SPC A;  3W7U A;  1M57 B;  2PI5 A;  1AI6 A;  5EK0 A;  2X6B A;  1FXK A;  3QNE A;  3JD3 A;  4RUF A;  2HVK C;  1AJQ A;  3CP1 A;  5C93 A;  2X6C A;  4JAS A;  3GWO A;  2HKO A;  1QLN A;  3ABU A;  4UUJ C;  4WFG A;  3K06 A;  2AHZ A;  1PL0 A;  3T1C A;  2IJK A;  1R73 A;  3HPL C;  2JJ1 G;  4RQF A;  4GX0 A;  4UV8 A;  3CD6 V;  5B3S C;  1YJ9 V;  1G8M A;  3D36 A;  4PA3 A;  5B1O A;  2QTO A;  1ROP A;  2HVJ C;  1XL4 A;  3VOU A;  3QO5 A;  4JPR A;  3CYO A;  1GM9 A;  4H33 A;  3ETD A;  3CCS V;  5LHI A;  2H8P C;  3BY6 A;  4BW5 A;  4XDL A;  4F4L A;  4PDM A;  1DLB A;  2ZR3 A;  1KKD A;  4PA9 A;  4WFF A;  1K8A W;  2Y69 B;  3K3W A;  1PNL A;  1V54 C;  1K5Q A;  3W7T A;  3E35 A;  1R3J C;  3D3I A;  4MS2 A;  2V1D A;  5DM6 V;  1SES A;  2P6J A;  1F4M A;  5H9C A;  3ZRX A;  1VQ4 V;  3ETG A;  3E8H A;  3AG1 C;  5B1A C;  3ABM B;  1OCZ C;  3AG2 C;  3LSQ A;  1MAB G;  1GO3 F;  4PA6 A;  1M57 C;  2OTL V;  3B8M A;  4TT3 G;  4XDK A;  4MVU A;  3CPW U;  2NLJ C;  2QKS A;  1H2G A;  4G2K A;  5E1A C;  1KP2 A;  3E86 A;  3OGC C;  5IY5 B;  3R65 A;  3AG4 B;  4ZKI A;  2WLI A;  2OCC C;  3TCU A;  4E2L A;  1COW G;  1AJN A;  1F23 A;  1R6K A;  3QO8 A;  2Q67 A;  3B77 A;  4DXW A;  1NQT A;  2D3O W;  3DGE A;  4LBE C;  1IXM A;  4HZ3 A;  1J95 A;  4PDR A;  4QE9 A;  2LP7 A;  3ZRW A;  1YI2 V;  1GTO A;  2UXN A;  2YEV A;  3G6E V;  4UVC A;  2LFR A;  2XAF A;  2X6A A;  1CPY A;  3OEH G;  1VQL V;  2UXX A;  2EIL B;  3E8B A;  3SJQ C;  1QVG U;  3CXC U;  2X0L A;  2XOK G;  3OE7 G;  2WLL A;  2Y69 C;  1ENV A;  2FTK A;  3OEE G;  1YTF B;  5J9P C;  5IDJ A;  1PNK A;  2WLJ A;  4QIW F;  4BAY A;  1Y4M A;  3CMA V;  1LNQ A;  1VQ8 V;  2EIM B;  3CC4 V;  1BHB A;  2WAM A;  5CBG A;  2ZDI C;  1GM7 A;  2HFE C;  3BEH A;  3ABM C;  3NXS A;  4JTA B;  2QEX V;  1R3L C;  1FS0 G;  3JCZ A;  2LFS A;  3ML0 A;  5LGN A;  1R6N A;  2ATK C;  3UKM A;  1S5H C;  1SER A;  2M7W A;  2W0F C;  1E1R G;  4UVA A;  2MK3 A;  3UM7 A;  3X2Q B;  1OCR B;  3ZMT A;  4X88 A;  2WLK A;  5L3D A;  5IY5 C;  1VQN V;  3AG4 C;  3K0G A;  3B8N A;  5BZB A;  1PKX A;  4H37 A;  3LUT B;  4L87 A;  1GKF A;  1VQO V;  1YJW V;  4FJC C;  3CC2 V;  1AI5 A;  1EBO A;  4G27 B;  1NH2 D;  1K92 A;  3OFN G;  2B1I A;  4J9Y B;  4FK5 C;  1P4R A;  1ARO P;  1SRY A;  1TUE B;  2EJR A;  1KQS U;  1JJ2 U;  1OCO C;  1OCC C;  3ETE A;  5H6Q A;  5KUM A;  3I55 V;  2EBO A;  2P7T C;  4J9Z B;  4MVO A;  3ABT A;  3VBB A;  3CCR V;  3ASO B;  1KP3 A;  1K4C C;  2IW5 A;  4R6Z A;  5FL7 G;  4QJF B;  1EZJ A;  2EIL C;  4KFM A;  2Z3Y A;  4X89 A;  5HFL A;  3RVZ A;  3JD4 A;  4PA4 A;  3WG7 B;  3LSS A;  3CCJ V;  3JD2 A;  3W7S A;  3E8G A;  1QLE B;  2YSU B;  5IYB O;  1BL8 A;  4QPJ A;  2ZDI A;  4BIZ A;  4PDV A;  4WFA V;  5LGT A;  3ZRV A;  2EIM C;  2WPD G;  2V7Q G;  1YHQ V;  1H8H G;  1CEZ A;  1S3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...