2MK3A

Solution nmr structure of gp41 ectodomain monomer on a dpc micelle
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein, chimeric construct
publication title Dissociation of the trimeric gp41 ectodomain at the lipid-water interface suggests an active role in HIV-1 Env-mediated membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 15
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2mk3A00
4FK5C 1MOFA 1MG1A 1EBOA 1K34A 3CP1A 1QR8A 4JGSA 3GWOA 4E2LA 1DF4A 3B8NA 1SZTA 2OT5A 1JPXA 2M7WA 2X7RB 3P30A 1QCEA 2EBOA 1DLBA 5H9CA 1K33A 3B8MA 3H01A 2EZOA 5HFMA 2MK3A 4N23A 5CMUA 1DF5A 1QBZA 4G2KA 5KA6A 3M99B 1I5XA 2P6JA 4FJCC 5CN0A 1ENVA 3K9AA 2EZPA 1Y66A 1JQ0A 4JF3A 1I5YA 3CYOA 3MHHC 1F23A 1QR9A 2LP7A 1Y4MA 3MHSC 4JPRA 5KA5A 5HFLA 3WFVA 3B77A 4FIPC 4N21A
chains in the Genus database with same CATH superfamily
1MMMA 1ZSPA 4DV1B 2OT5A 3KCYA 3TETA 1PL4A 1PP9H 4K0KO 5JWPA 1QQCA 1GN2A 3K06A 5CN0A 5JJJB 3H1KH 1B06A 4DR4B 1PNKA 4OPAA 2OCCC 5IYBO 3C3SA 3B4SA 4L8JA 5DN6G 1NTKH 1WPBA 3T2MA 2V4DA 2P22C 3CX5F 3N2GA 5BR8B 1HNXO 1BQZA 3Q4HA 3UQ8A 2M6YA 3JARB 1OCZB 4X66B 4JAVA 2X6BA 2IW5A 3TCUA 1F4MA 2CTPA 2ZCEA 1M5IA 1VEWA 1H2NA 4YY3O 1W0JG 3JSNA 4FK5C 4JTDB 3L73H 1IXBA 4PV1B 3VBBA 3UKMA 4LWSB 4RQFA 4YHHB 2ZIOA 3APOA 2YIBD 3E22A 3DC6A 2LGQA 2EZOA 5C8YA 5CA0A 1R3JC 2VWJA 4TV9B 1AP6A 3DXRA 1IDSA 2PUSA 3TGUH 4H33A 1R1BA 4LC1A 4KXRA 1N34O 1YHQV 4I55A 2YS8A 4JI0O 3FYEB 3ETEA 1F23A 2R9AA 2OCHA 3NR7A 4O2AB 3CCRV 5FNVB 4NR1A 1TAEA 2X6CA 3CCVV 3B8MA 3K0GA 2RJZA 3GVMA 4BIOA 2AHYA 1HNZB 4Z2WA 1DK1A 2GDSA 1I94B 3ZMZA 1YCIA 2WSSG 4HBNA 2QKAA 4UFZA 4FIPC 2R72A 1SETA 4DV1O 1OCRB 3BHPA 5FPOA 3JD1A 4JAAA 2B1GA 4EEQA 1MSWD 3RBZA 2AXTZ 1BMFG 4YXWG 2ZNIA 1D5NA 2P6JA 4O4HA 4UB8Z 1H2SB 5EIBD 3CRAA 2BE3A 2GTAA 4K3AA 1GH6A 1XDCA 4B3SB 2WLJA 4U3JB 2ZR2A 3F7YC 3S3WA 2Q7HA 2KQXA 3FB7C 3RYHB 1FJGB 1IZ3A 4JYCA 4GCZA 4X65B 2GTSA 4LH6A 3SPHA 2DWEC 1CXZB 4QPJA 4TV8A 3K5LA 5L3BA 5JVDA 1SKVA 4RUFA 1B04A 3N2KB 4X66O 2OCCB 4R8CA 4I0XB 3ZX6A 1Y76B 1TVKB 1MZFA 3GWKC 3A0BZ 1NJIW 4FFBB 2JVDA 3E86A 4HNAA 1I0HA 1GAXA 3CRCA 3KKYA 4YHHO 2R9RB 4JI3B 4FZ1A 1XI1A 2HLDG 1XOUA 4P9OA 4CZZA 3FAVA 1F4NA 2PGGA 1QNMA 5KHJA 5ITZB 4X1YA 4EKWA 3ABLC 2PY5A 4ASUG 1Q82W 2DW4A 3BY6A 2AHZA 1BHAA 4HYOA 2EJ7A 1OHHG 1YVWA 4TSFG 1N0JA 1SERA 2VS0A 1HNZO 5JJEB 4U7OA 1I94O 4UCUA 4RUEA 4X62B 2Y69B 4PA4A 4EFBA 3H1LH 1Q6HA 3CP1A 5GONA 1JCHA 4TOIA 3RYIA 3U0ZA 3OTFA 4LCUC 2L35A 4JI5B 4W4KA 4E4EA 3WG7C 3ZIAG 2GSMB 4LNUB 1J5EB 1MA1A 3B40A 1CP9A 4GT1A 2EIMC 2AGAA 1RFYA 1KP3A 2LJ2A 1BZKA 3P32A 4D6TH 5BMVB 4B3SO 1ZX3A 3F7VC 2XTAA 1KECA 1I08A 4MTOA 3U11A 1YEWA 1FJGO 2FL4A 1U97A 5H6QA 1OV9A 2EBOA 2MW2B 4UCVA 3ZRXA 1GN3A 4UCRA 1DTOA 1XREA 4FLUA 4HAMA 4KP4A 4DW1A 3ZMTA 1TGOA 1MNGA 4W4LA 5L3CA 1I5YA 3J81N 2EINC 1EN4A 5KAFZ 4PELA 3JALA 3D36C 3ZN1A 4CS3A 2PI4A 4JI3O 2GUZB 4GZRB 5IJ0A 1BS3A 1VIBA 2IH3C 2F95B 2QKSA 3CCLV 2FYUH 1RP3B 3JCZA 1M57B 5LP6C 3R65A 2YDEA 4O4JB 2UXBB 2OTJV 4A5UB 4ZOLB 2P4VA 3W7XA 3GWOA 1Z5WA 5CBHA 3LDCA 1GRJA 1K4CC 1NT2B 4I5SA 4GUNA 1BSMA 3M99B 3OGCC 4J80A 4YJ3A 4J7KA 2UXNA 2DQ3A 5CA3A 3QTCA 1K8AW 2XT9A 3KZIZ 2JK5C 3JAWB 3SJQC 3ABMC 3ZJZA 4NXMB 2ZIMA 3ABLB 1KUQA 3MDSA 4X62O 4H44B 1JVMA 2WWWA 1OCOC 2YXHA 4JI5O 3AG2B 1NVPD 1KB9F 1QLNA 5E1AC 2OTLV 5EZYB 4YJ2B 1FFXB 3CRMA 1Q6IA 1J5EO 1JX9A 2HHHB 3G6EV 3SGIA 2F66C 3ZCCA 2HP8A 1ZL8A 2E74B 2JGUA 5LOVB 2Q67A 3QG5A 2P5OA 4R6ZA 3ZRSA 1RM1B 3SDLA 1K33A 1LR1A 3E89A 1P7GA 1IXMA 2EIMB 1WP8A 4P2ZA 2BCCH 2KG7A 3K9AA 4H0LB 4D7SA 1XQ8A 5KUMA 2F43G 3SPIA 3T1CA 3CJHA 4DXWA 3MHSC 4NXNB 1VARA 3RYCB 4JASA 1SQBH 3OFNG 3AK2A 4AQYB 5EBMC 4O2BB 1S76D 2VRZA 4WFAV 1FXHA 4O4IB 1RPOA 2BOBC 3CXCU 1JJ2U 1SQVH 1BCCH 1VQLV 4BIZA 2EINB 2ZT9B 3KCXA 2UXBO 2IU0A 1L1FA 4DW0A 2IH1C 3DGEA 1XL6A 4MTFA 1XEQA 4JI1B 3RWRD 1NQTA 1OCCC 2JGDB 2Y4TA 3UT5B 5LP6B 3CCEV 4JTAB 3LDDA 3JAMN 1EN5A 4L87A 4NXMO 4D7TA 2DN9A 3JAWA 3P3PA 4B7EA 1NH2B 1D2DA 2BOCC 1D5AA 3JD4A 5BXZA 1GK9A 4LF6B 1VF6A 2CK3G 5IYZB 5CMUA 3J80N 1RSOB 1VQ8V 2HHHO 2DJVA 4X1IA 2JS5A 4LFBO 3ABMB 4WCEV 2DYSC 4J11A 1SQXH 2QTSA 1ZTEA 2WLIB 4RO2A 3OUSA 1K73W 3T4ZA 4PD4F 1OCOB 4UVBA 3VQVA 5IE9A 5IDJA 4MSWC 5H6RA 4B3MB 3ABKC 3OMAB 2MK3A 1VF5B 5K1PA 2A79B 1VF7A 1N36B 3STZC 4DR2B 2QGNA 1Y74A 2W6JG 4UCOA 3CMAV 2P7TC 2CE4A 1QVFU 4NXNO 1IX9A 1PM9A 2Q0AA 4AQYO 2JEXA 3N2GB 4KHPB 3CC4V 3Q4HB 1K9MW 3LUTB 4AHCA 1HNXB 5CB4A 3UM7A 3K08A 3G71V 4OXSA 5IYCO 1YTFB 4DV4O 3FFQA 1JQ0A 2PI5A 1VQ4V 4FLVA 5LMUO 5KHKA 4MVRA 2A3QA 4UXNA 1YIJV 2XASA 5JH7A 1HP8A 2H8PC 2P67A 3E22B 3ZHUA 2YXYA 5C8YB 5CA0B 3FB6C 4I50A 4N23A 2ZXWC 2EIKC 3DXRB 3D8CA 2C2AA 3SYQA 1R6KA 3ZS8C 3UT5A 2R70A 2QWOB 4I55B 4U7NA 2OWOA 1GO3F 4ICGA 4JPRA 2HJDA 4J7ZA 5IWAB 3OT7A 3TXQA 2KKWA 4LF6O 3E8FA 3B8NA 3CCMV 1OCCB 2OIGA 5HFMA 3RVZA 2BTQA 1KYOF 2G38A 2RNBA 4WFGA 5IYZA 4DR7B 4BW5A 3E35A 1Q6UA 2LW7A 1IBLB 1JJOA 2ATKC 2RQ6A 1Q8IA 4PDLA 2WLIA 1Q5OA 1R6TA 1K34A 4JGSA 4FM0A 1KKCA 2Y0PA 3O9OA 4GKJB 4B3MO 1FYJA 1VQMV 4JI8B 1N36O 2DYSB 4O4HB 4X8AA 5KA6A 1E1QG 4DR2O 1N33O 1US6A 1H2KA 4TQFA 2JEUA 2DMXA 5JQGA 3N27A 5D5QA 1SRYA 1URFA 1PNLA 2ZE5A 5L3FA 2X6AA 3ABKB 5LGUA 4KHPO 1GTOA 1DLBA 4TV8B 3CHXA 2Q7GA 3T1YB 1DF5A 2YC0A 3K04A 5JVDB 3RW0A 1KMIZ 4IYHA 1YDXA 3OMIB 3K9SA 5LHHA 4MW3A 1NH2D 1SQQH 4X64B 5DECA 5L3GA 5EBLC 2NR5A 4HNAB 1EBOA 1AI4A 1AI7A 5L3DA 4FLWA 3HR0A 4B08A 4EB6B 4JI7B 3EFFK 4J9ZB 1IBMB 1PPJH 2ADPA 2XAFA 3FAVB 1EZJA 2XOKG 3T4DA 2QSAA 2O57A 4X1YB 4CH6A 4Z1VA 1XUQA 5IWAO 3ETQA 1MG1A 1ZAUA 4GKKB 3K57A 1S5JA 3CCJV 2Y69C 2ZXWB 2EIKB 3IC9A 4DR7O 4NKGB 1BHBA 3OGIB 1IBLO 4YIPA 1VQ7V 1H38A 2XUMA 4MVOA 3ZRWA 3J7AU 4QGPA 3H1HH 5GONB 3RYIB 4PDRA 2A06H 2W0XA 4E2LA 1Y67A 4GKJO 4DV6O 2M7WA 4GX0A 4HZ3A 1J95A 3U10A 2YI9A 3FB8C 3T1HB 4JI8O 4CS2A 1M9NA 3OAAG 3ZRVA 2UUAB 1N0NA 5LHGA 3IGAC 1G4YB 5EYPA 4GX1A 4C7UA 3ZN0A 2E3CA 3K5OA 4I9WA 1SF9A 4MW8A 4LH7A 4N21A 2CDYA 2NN4A 3VOUA 3W7UA 5CA1A 5BY1A 2IBZH 3T1YO 1IBKB 1QBZA 4MT8A 4Q20A 2QR4A 4DV7B 3X2QC 2FMLA 4FJCC 1ENVA 2B5UA 4OX9B 2CTWA 4LFCO 4JAUA 3K3WA 4X64O 2VQFB 1G8MA 2YEVA 4MVMA 1M57C 1WB7A 4NYKA 3JALB 5CBFA 1AJNA 4MTGA 3RVYA 3RYFA 1RPRA 4JI7O 1EM1A 2YXLA 3P30A 3CE2A 5IJ0B 1F51A 5B5EZ 1ZUQA 4EB6A 2QWPB 5LGTA 1HNWB 3CCQV 3BRCA 1YJNV 3CB2A 1IBMO 4XBFA 1XMQB 2VWKA 5KAIZ 4NTXA 3SR2C 4WFBV 2ZR3A 4DV3B 3IFXA 4AI8A 3MAQA 1QLEC 4WFHA 4GKKO 4XDJA 4B3RB 2X0LA 4NTWA 1SESA 3I56V 1VF6C 4CBCA 4DR1B 3OD4A 3AG2C 4YJ3B 3AG7A 5J2UB 5GTIZ 5EC2C 4RWUA 1AR4A 2D2CB 1JMKC 4BAYA 1VQKV 2QEXV 4JV5B 3BEHA 5EC1C 1SQPH 4XDLA 5H9CA 3T1HO 2UUAO 2KB1A 1RM1C 1SQGA 4FZ0A 2Q69A 3BCCH 4DRXB 3OE7G 2AZ0A 4LR3A 3OEHG 1XNRB 1S5LZ 3OEEG 4FLXA 1XL4A 1ZL8B 1R6NA 2ZE7A 1EZVH 1XBLA 1FXKA 3AEIA 3CCSV 1YITV 2ZKOA 1WAZA 3B09A 4FM2A 3G80A 3WB0A 1IBKO 5LGNA 3G67A 4DV7O 4BW9A 2KG7B 3JAKA 2JDIG 5A9GA 2QWRB 3CJHB 4OX9O 3ZMVA 3JD2A 2VQFO 2HJFC 2FB5A 4CS4A 3ABTA 4MVSA 2EILB 3UO3A 1K97A 2E75B 3IAYA 3LSUA 2QM8A 3SPGA 4DV5B 1HNWO 2ARHA 3X2QB 1DGSA 2AZ2A 1XMQO 4EFEA 1I5XA 4UVCA 5IT9N 4DV3O 3TJTA 1FD9A 1UJWB 3OTOB 4B7KA 5KMGA 2ODMA 2F4VB 4CH5A 4B3RO 2Y4UA 3ABUA 4DR1O 1UPGA 2ZE8A 5J2UA 1TUBA 3W7SA 3CS5A 2CGNA 2OYQA 2ZQMA 1QLEB 5FPRA 5GW7A 4JV5O 2QJ1A 4IGGA 1WB8A 4J7JA 3QO7A 2FTKA 3ZHRA 1B6QA 1Q3EA 1PL0A 5A2QN 1XHZA 4IL6Z 4QE7A 4X1IB 1JFFA 2H3OA 4OPHA 3CC7V 3F5TA 1WN7A 4LFBB 4DRXA 4DR5O 1XNRO 4K8XA 4J9YB 1L8DA 1AJPA 2P90A 2WLNA 5EBWC 3UO2A 1JA8A 4ZKIA 3SPJA 3CRRA 2NNUA 4LF7B 4X88A 1Y74B 4LF4B 2JJ2G 2Z0AA 4B3TB 1U96A 3HKEA 3OMNB 4GYCB 2Q73A 2WAMA 3VQYA 4PA6A 2V7QG 4UVAA 1FAFA 3FKSG 2Q7EA 2IJIA 4NVPA 4DV5O 3JCUZ 3H01A 2UXCO 5CB4B 5K1XA 3HPLC 5FL7G 2UXXA 4U3FH 3RFRA 3SYPA 5H5NA 1M90W 4I7ZB 3DTUB 4JZGA 4DV4B 3CYOA 5LHIA 5B66Z 5J9PC 3OTOO 4QNHB 2F4VO 5LMUB 5JH7B 3CXHF 1FKAO 2P06A 3ZBHA 4I50B 1KD1W 5JJNB 1Q86W 2Q8VA 3B2EE 1PV0A 4PA3A 1YJWV 1S3JA 1ZLZA 5IJ9B 2N05A 2A9HA 3L72H 4DUYB 1OZ0A 4AILC 2ITCC 4PHZA 2HKOA 5LXTA 4ZI7A 1QR8A 1SS3A 1IURA 4JI6B 2F1MA 2YI8A 2BTQB 3F5WC 3DSQA 4Q6GA 3ZMSA 3UCSC 4DR3O 5KUKA 4X9QA 4RAIA 2HVJC 2JIZG 3EVKA 1G6UA 2QKCA 4GLXA 1NKDA 3PJSK 3M8AA 1BT8A 2ZDIA 4CC5A 2N04A 2RMKB 2CTRA 4LF7O 2BSKA 1AVMA 4LF4O 1N33B 4B3TO 5JQGB 1AI5A 1SZXA 1GM8A 3FX7A 3CPWU 2L6LA 5HFLA 2A0LA 3BVOA 3H1IH 1KC8W 3O65A 3BA9A 3HKDB 3C3TA 4K8ZA 2RCVA 2YIAA 1W59A 2A7WA 1Z2GA 1YZBA 1M4UA 3K0DA 3L75H 5TISZ 3K59A 3ICXA 1AI6A 4JTCB 4WF9V 2WLLB 3SJAC 3AG4C 4TQDA 4FFKA 2EULA 3IJ4A 3BFRA 1GMGA 3AG3C 5F2VO 2VQEB 1HR0B 2F93B 1AB3A 4LBEC 3ZEDA 3L70H 1NR7A 1V54C 3BA8A 2JJ1G 5IJ9A 4TUYA 4IYIA 1BL8A 4R7CA 1X4TA 4DUYO 2IU3A 5LMNB 4LF9O 2QE7G 3D3QA 3VQXA 4UB6Z 3VQWA 2H94A 2PTMA 4JI6O 2RN9A 2UXDB 1AR5A 4JI2B 4WFEA 4ABMA 4LF5B 3HKCA 3PN1A 2OIEA 3K5MA 2CTQA 2GHYA 3JASA 2QDOA 2BTOA 4LF8B 3ZRWB 4K35A 1IVSA 5JCOA 3ZHQA 1WA8B 4LP8A 1P49A 2XHBA 2IM9A 4H37A 4FMTA 1FXKC 5B3SC 4DV6B 2K9PA 3MD0A 1I7FA 1Q7YW 1K3EA 3LNMB 3M7MX 3WB1A 2YIBA 1HW7A 4G27B 5EYPB 2W0FC 4DV2B 4LFAO 5LA6A 2LFSA 4GX2A 1N8RW 2UUCB 2QTOA 2LQTA 4J10A 2PZSA 1WP7A 1Z5VA 5CA1B 2ITDC 4F6RA 2WLKA 2Q9LA 2WLMA 3HKDA 2QWNB 1ZWIC 4J41A 2LFRA 3W7TA 4WBNB 3STLC 2DYRC 5KX5A 2YEVB 2JRIA 4LFCB 2DWDC 3RYFB 2Z5UA 1YSCA 3HKBA 2WLLA 3E8HA 1R3KC 2EJRA 2VQEO 5KHHA 1HR0O 3AG1C 4IIJA 1NTMH 4G2KA 3AK3A 4JZ2A 1R73A 5LMNO 3BPZA 3AG4B 3TXSA 2EX3A 3AG3B 2UXDO 5B1NA 1V55C 4JI2O 4LF5O 1SA0A 4X20A 4UUJC 1XNQO 1ORQC 4IT5A 1V54B 1TA8A 2KSDA 1THZA 3LDEA 2ZD9A 1BE3H 1FXVA 4LF8O 2Y48A 4DV0B 1HWYA 3IC7A 2ILMA 1YI2V 2PF4E 1MSDA 1EFRG 4MTXA 1WA8A 3ML0A 1HDJA 1JPXA 1WJZA 2CH7A 3BAAA 2CGOA 1YTFD 2WLHA 4BR6A 4ZHQA 3ETDA 3RN4A 3ASNB 3CD6V 5B1AC 4X1KA 4DV2O 5E79Z 3LSSA 5J2TB 3ZMUA 1QR9A 3TK1A 4IHJB 3E83A 3B77A 2UUCO 1XHXA 3OUFA 1FXKB 5B3SB 1H2LA 2EILC 3E8BA 1NTZH 4FVMA 4JYAB 3JAKB 1GM7A 3AK1A 1H2GA 3CRQA 4UV8A 4DR4O 2ZNJA 1AR1B 1JOYA 1LUWA 2GBOA 4I9QA 4MVQA 4FM1A 4X89A 4G28B 4WBNA 2E5LB 1F7YA 1GN6A 1O9HA 2K1EA 3K5NA 1S5HC 1DF4A 1O9GA 5BR8O 3A0HZ 1K5SA 1NVPB 2DYRB 2XNDG 3JARA 2GV9A 2NLJC 1T5EA 4R50A 2ZM6B 1L0NH 3SYAA 5KMGB 3CWBH 3OM3B 3W7WA 1AP5A 2WA4A 2X7RB 3AG1B 3LSQA 4LWSA 4DK1A 1N32B 5KHGA 3OR7C 1VQOV 1K4DC 4TV9A 5CBGA 1TUBB 1VQ6V 1Q81W 4DV0O 1COWG 1V55B 1QHTA 2QA4V 1M1KW 4PDMA 4O2AA 5FNVA 4P9PA 3WB2A 1NS1A 3SJCC 1YF2A 2ZDIC 1JFFB 2YUAA 3SJBC 5D5PA 4DR6B 3DC5A 3RT3C 2R9IA 4DR5B 1L0LH 4TT3G 3ZHTA 3FD9A 3L74H 1KKDA 3SYCA 5J2TA 4IHJA 2FKXA 1GM9A 1AILA 2CUGA 4MVUA 4JYAO 2ADQB 5B1AB 2E76B 3CEIA 3HKEB 2E5LO 4MS2A 5IY5C 3A8TA 4U3JA 5EK0A 3BABA 3G6BA 1NR1A 3I5DA 3RYHA 4X65O 3QF7A 1SC5B 4FLYA 2B1IA 1M93A 1E1RG 2DOSA 2UXCB 2N74A 5B1BC 2JS3A 3N2KA 3GB7C 5DM6V 2PYLA 2Z3YA 3K79A 1KU9A 4I0XA 2ZM6O 3EXAA 1AJQA 2WA3A 2DE0X 1Y76A 1TVKA 3JD0A 1CPYA 1KP2A 2LW1A 4PA7A 4FFBA 5C93A 1S77D 5B1OA 4KL1A 1M56C 1H8EG 1SZTA 5LBQA 4PDVA 1N32O 3APQA 1YXBA 4Z1MG 5GTHZ 1W0KG 3JSLA 5ITZA 1ROPA 5LXTB 1H2MA 5H2FZ 4ZI7B 2AW9A 5JCOC 2W6IG 1GN4A 2HR3A 3CC2V 5AG2A 4DR3B 3E2EA 4DR6O 2XAQA 1XMOB 2EZPA 4CH3A 1KQSU 4UCTA 2XAHA 4JYYA 2B9ZA 3FYIB 4GX5A 3SPCA 1VQPV 3I55V 2ETNA 2XAGA 5KLVH 3P3NA 4O4LB 4KUMA 1QU7A 4ZBMA 5LYJB 2BSKB 1Q43A 3RGBA 5BZBA 4I4TB 4LNUA 5KHIA 3WU2Z 1WLEA 4JI4B 3C90A 1X59A 4DK0A 1WPXA 1KBHA 2HG5C 4JYBA 5L3EA 3WFVA 3ZHSA 4F4LA 5BMVA 3WG7B 4P30A 1R3IC 2Q4PA 1PNMA 5LL6Y 4BIUA 1Y6XA 2P4KA 1BGYH 4H13B 2ZINA 2Q68A 1AROP 3ASOC 4PA9A 2UUBB 2IJHA 2YSUB 4NTYA 2UU9B 1N4CA 1P84F 5IY5B 2WPDG 3K03A 3MHHC 3CCUV 4DO2A 1FPOA 3D3IA 2HEPA 1EN6A 3E8GA 5EIBC 2GUZA 5B1BB 3JYCA 3A2FA 2LO1A 1P7BA 1JR9A 1B3QA 3FB5C 3ZHVA 1BQ0A 1SQFA 2Q6AA 3JD3A 4TUYB 4BWAA 2EIJC 4KFMA 1NU1H 4RQEA 3JATB 3QO8A 4O4JA 1FFTB 1A32A 4LF9B 2IJJA 1M56B 4ZOLA 2F23A 3A0RA 4FPPA 4YIOA 3HKCB 1G1XB 3OW2U 3L71H 3JASB 2XAJA 1W2BU 4QJFB 4DUZB 1XMOO 2YIDA 1Y66A 3G4SV 4PI0A 4J42A 2LP7A 4WFFA 3S3XA 1K92A 3KG2A 1MOFA 2RDCA 4PJ0Z 1S72V 2D3OW 2DQ0A 3R66A 4O4LA 5EZYA 4YJ2A 1FFXA 5LYJA 3H1JH 4JI4O 4I4TA 5LA6B 1Q90D 4LFAB 3THOA 1PKXA 1K7DA 1VQNV 1WNSA 2Q0OC 3CSXA 5LOVA 2QWQB 3K58A 3H9VA 1NBMG 2QM7A 4F6RB 1MZEA 3CMEV 4DYLA 4K0KB 2UUBO 3NXSA 2HFEC 1NZ6A 2UU9O 5FLXN 1OCZC 5KX5B 4NB5A 4XDKA 4F6EA 4UCSA 1FS0G 1VQ5V 1OJHA 4UV9A 1XILA 3RYCA 2YICA 3HKBB 3EHBB 1UFIA 4O2BA 2V1DA 3ASOB 2CAZC 1VP7A 1LUVA 4IIJB 4O4IA 1VQ9V 1PD3A 3SYOA 1GKFA 2Q5ZA 4PI2A 2Y0IA 1QVGU 4YY3B 3D36A 3JATA 4OGQB 4MVZA 2QM4A 4QPKA 1NI8A 4JI1O 1V9PA 4CH4A 1SA0B 4X20B 1S0VA 1CEZA 1R3LC 1YJ9V 2PYJA 1XNQB 2EIJB 2JGDA 5LP6A 4DUZO 4CC6A 3L9DA 2IJKA 4QE9A 1N34B 4TWKA 3ASNC 4FLTA 4JI0B 3QNEA 4FLZA 1H8HG 3OR6C 2CH7B 1QCEA 2HVKC 1E79G 1K5QA 1OCRC 4ZIBA 3ETGA 4ZHQB 3LNNA 1RSOA 4QIWF 2LGWA 1VMGA 1TUEB 3QO5A 4X1KB 5IYDO 1P4RA 1LNQA 4JF3A 5DEDA 2ZE6A 1Y4MA 3QVNA 1MABG 3HB3B 5KA5A
chains in the Genus database with same CATH topology
1NH2B 2BOCC 2K1EA 3JD4A 1S5HC 1DF4A 1GK9A 2OT5A 3TETA 3ABUA 2CK3G 1K5SA 5CMUA 1NVPB 3K06A 1VQ8V 2DYRB 2XNDG 3ABMB 5CN0A 4WCEV 2DYSC 2NLJC 3W7SA 1PNKA 2WLIB 4RO2A 3OUSA 4R50A 1K73W 2OCCC 2ZQMA 1QLEB 5GW7A 3SYAA 5IYBO 3OM3B 3T4ZA 3W7WA 1OCOB 4UVBA 5IDJA 4MSWC 5DN6G 2X7RB 3AG1B 3LSQA 3QO7A 5H6RA 2FTKA 3T2MA 1B6QA 3ABKC 3OMAB 2MK3A 1PL0A 3OR7C 1VQOV 1K4DC 2A79B 4QE7A 3STZC 1OCZB 3CC7V 4JAVA 5CBGA 2W6JG 1VQ6V 2X6BA 3CMAV 2IW5A 2P7TC 1Q81W 3TCUA 1F4MA 1QVFU 1COWG 4J9YB 1V55B 1W0JG 4FK5C 4JTDB 2QA4V 1M1KW 1AJPA 4PDMA 3VBBA 2JEXA 2P90A 2WLNA 5EBWC 3UKMA 4RQFA 4ZKIA 4P9PA 3SPJA 3CC4V 2NNUA 2ZDIC 1K9MW 2EZOA 3LUTB 3UM7A 1R3JC 4X88A 3K08A 3G71V 4OXSA 5IYCO 1YTFB 4H33A 2JJ2G 4LC1A 1JQ0A 2R9IA 3OMNB 1YHQV 2PI5A 3FYEB 3ETEA 2WAMA 1VQ4V 1F23A 4TT3G 4MVRA 1KKDA 3SYCA 4UXNA 1YIJV 4PA6A 2V7QG 2XASA 3CCRV 4UVAA 3FKSG 1GM9A 2IJIA 2H8PC 2P67A 2X6CA 3CCVV 3B8MA 3FB6C 3H01A 3K0GA 4MVUA 3HPLC 4N23A 2ZXWC 2EIKC 2UXXA 5FL7G 5B1AB 3SYPA 2C2AA 3SYQA 1R6KA 1M90W 2AHYA 3DTUB 4U7NA 3CYOA 5LHIA 1GO3F 3ZMZA 5J9PC 2WSSG 4MS2A 4QNHB 4JPRA 5IY5C 4FIPC 1SETA 5EK0A 1NR1A 3E8FA 3B8NA 1OCRB 3JD1A 3CCMV 1OCCB 2B1GA 1KD1W 2B1IA 1MSWD 3RBZA 3RVZA 5HFMA 1Q86W 1E1RG 4PA3A 1YJWV 1BMFG 4YXWG 1S3JA 4WFGA 5B1BC 2P6JA 4BW5A 3GB7C 3E35A 2A9HA 5DM6V 2Z3YA 2ATKC 3K79A 1OZ0A 4PDLA 2ITCC 2WLIA 1AJQA 2WLJA 2HKOA 1CPYA 1KP2A 2ZR2A 3JD0A 3F7YC 1K34A 4PA7A 3FB7C 1QR8A 4JGSA 5C93A 1S77D 5B1OA 1M56C 1H8EG 1SZTA 5LBQA 4JYCA 4GCZA 4PDVA 3F5WC 3SPHA 3ZMSA 2DWEC 1VQMV 4QPJA 2DYSB 5L3BA 5KUKA 4X8AA 4RUFA 1E1QG 5KA6A 4RAIA 2HVJC 4Z1MG 2OCCB 1W0KG 2JEUA 4R8CA 2JIZG 1NKDA 1SRYA 1ROPA 1PNLA 3PJSK 1NJIW 3E86A 5L3FA 2X6AA 2W6IG 3ABKB 5LGUA 2R9RB 2ZDIA 1GTOA 2HR3A 1DLBA 3CC2V 2HLDG 4P9OA 1DF5A 3K04A 3RW0A 3OMIB 3E2EA 4CZZA 2XAQA 5LHHA 1F4NA 2EZPA 1AI5A 4MW3A 1NH2D 1KQSU 1GM8A 2XAHA 5L3GA 3CPWU 5HFLA 2A0LA 4EKWA 5EBLC 3FYIB 4GX5A 3SPCA 1VQPV 1EBOA 1AI4A 1AI7A 3I55V 3ABLC 5L3DA 1KC8W 4ASUG 2XAGA 1Q82W 2DW4A 4KUMA 3BY6A 2AHZA 1BHAA 4HYOA 4ZBMA 3EFFK 4J9ZB 1OHHG 4TSFG 5BZBA 2XAFA 1EZJA 2XOKG 3T4DA 1SERA 1WLEA 4U7OA 3K0DA 1WPXA 2HG5C 4JYBA 1AI6A 5L3EA 4JTCB 4RUEA 3WFVA 4WF9V 4F4LA 2WLLB 2Y69B 1MG1A 4PA4A 3CP1A 3AG4C 3WG7B 1JCHA 4P30A 1R3IC 1PNMA 4LCUC 4BIUA 3CCJV 2Y69C 2ZXWB 2EIKB 1GMGA 3WG7C 3ZIAG 3AG3C 2Q68A 2GSMB 1AROP 3ASOC 4PA9A 4LBEC 2IJHA 1BHBA 1CP9A 4GT1A 2YSUB 1NR7A 2EIMC 1VQ7V 1V54C 2JJ1G 1KP3A 4R7CA 1BL8A 5IY5B 2WPDG 3K03A 3MHHC 1H38A 2IU3A 3CCUV 3P32A 4MVOA 4DO2A 3ZRWA 2QE7G 3D3IA 3F7VC 4PDRA 1KECA 4MTOA 4E2LA 2H94A 2M7WA 3E8GA 4GX0A 4HZ3A 5H6QA 2EBOA 1J95A 4WFEA 5B1BB 3JYCA 3FB8C 3ZRXA 1P7BA 1M9NA 1DTOA 3OAAG 3ZRVA 4HAMA 3FB5C 4KP4A 5LHGA 3IGAC 2GHYA 2Q6AA 3JD3A 1G4YB 3ZMTA 2EIJC 5L3CA 4GX1A 4KFMA 1I5YA 2EINC 4RQEA 3ZRWB 3ZN0A 4I9WA 3QO8A 1FFTB 4MW8A 2IJJA 1M56B 4N21A 4LP8A 4PELA 4H37A 3ZN1A 4FMTA 1FXKC 5B3SC 2PI4A 3A0RA 4FPPA 3VOUA 3W7UA 3MD0A 1Q7YW 1K3EA 3LNMB 1QBZA 4MT8A 4Q20A 3OW2U 2IH3C 2QKSA 3X2QC 3CCLV 2XAJA 4FJCC 1W2BU 4QJFB 4G27B 1ENVA 2W0FC 3JCZA 1M57B 1Y66A 2B5UA 3R65A 3G4SV 2LFSA 4GX2A 4JAUA 3K3WA 1G8MA 2YEVA 2LP7A 4WFFA 2OTJV 4MVMA 1M57C 1N8RW 5CBFA 1K92A 1AJNA 4MTGA 3KG2A 1MOFA 3RVYA 1S72V 1RPRA 2QTOA 3W7XA 3GWOA 5CBHA 3LDCA 2D3OW 1K4CC 2DQ0A 3P30A 4I5SA 1F51A 5LGTA 2ITDC 3CCQV 2WLKA 1YJNV 2WLMA 4XBFA 3M99B 1ZWIC 3OGCC 2UXNA 2DQ3A 5CA3A 4WFBV 2LFRA 2ZR3A 3W7TA 1K8AW 3STLC 2DYRC 2JK5C 3ZJZA 3SJQC 3ABMC 2YEVB 2DWDC 3ABLB 3IFXA 1PKXA 2Z5UA 1YSCA 1K7DA 1VQNV 1QLEC 4WFHA 1JVMA 2WWWA 1OCOC 2WLLA 4XDJA 3E8HA 3AG2B 1R3KC 1NVPD 1NBMG 2X0LA 2EJRA 2QM7A 3I56V 1SESA 5E1AC 3CMEV 2OTLV 1QLNA 3AG1C 4CBCA 3AG2C 1JX9A 4G2KA 3NXSA 2HFEC 3G6EV 5EC2C 1OCZC 1R73A 3ZCCA 4XDKA 4BAYA 1VQKV 3AG4B 1FS0G 1VQ5V 2QEXV 4UV9A 3EHBB 3BEHA 5EC1C 2Q67A 3AG3B 4R6ZA 5B1NA 1V55C 2V1DA 3ZRSA 3ASOB 1RM1B 4XDLA 5H9CA 1K33A 3E89A 4UUJC 1ORQC 1IXMA 2EIMB 2KB1A 1V54B 1RM1C 2Q69A 4P2ZA 1VQ9V 1PD3A 3SYOA 1GKFA 1THZA 3K9AA 3OE7G 5KUMA 3T1CA 2F43G 3LDEA 3SPIA 3OEHG 2ZD9A 1FXVA 2Y48A 4DXWA 3OEEG 1XL4A 1HWYA 3IC7A 3MHSC 1R6NA 1YI2V 4JASA 1QVGU 3D36A 3OFNG 1EFRG 1FXKA 3AEIA 5EBMC 4MTXA 4MVZA 3ML0A 4QPKA 3CCSV 1YITV 1JPXA 1S76D 4WFAV 1FXHA 1YTFD 1S0VA 1RPOA 2WLHA 5LGNA 1CEZA 2BOBC 3CXCU 1R3LC 1YJ9V 2JDIG 2EIJB 3ETDA 1JJ2U 3ASNB 3CD6V 1VQLV 4BIZA 2EINB 5B1AC 2IJKA 4QE9A 3ZMVA 3JD2A 3LSSA 2HJFC 3ASNC 4TWKA 3ZMUA 1QR9A 3ABTA 4MVSA 1L1FA 2EILB 2IU0A 3TK1A 3E83A 3B77A 3QNEA 1K97A 3OUFA 1FXKB 5B3SB 1H8HG 2EILC 2IH1C 2QM8A 3DGEA 3E8BA 1XL6A 3OR6C 4MTFA 3SPGA 1QCEA 2HVKC 1E79G 1K5QA 3X2QB 1OCRC 3ETGA 1NQTA 1OCCC 3CCEV 1GM7A 1H2GA 1I5XA 4QIWF 4JTAB 1TUEB 3QO5A 4UV8A 4UVCA 1AR1B 3LDDA 1JOYA 5IYDO 4L87A 1P4RA 1LNQA 4JF3A 4MVQA 4X89A 4G28B 1UJWB 1Y4MA 1MABG 3HB3B 5KA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 C;  1MOF A;  1MG1 A;  1EBO A;  1K34 A;  3CP1 A;  1QR8 A;  4JGS A;  3GWO A;  4E2L A;  1DF4 A;  3B8N A;  1SZT A;  2OT5 A;  1JPX A;  2M7W A;  2X7R B;  3P30 A;  1QCE A;  2EBO A;  1DLB A;  5H9C A;  1K33 A;  3B8M A;  3H01 A;  2EZO A;  5HFM A;  2MK3 A;  4N23 A;  5CMU A;  1DF5 A;  1QBZ A;  4G2K A;  5KA6 A;  3M99 B;  1I5X A;  2P6J A;  4FJC C;  5CN0 A;  1ENV A;  3K9A A;  2EZP A;  1Y66 A;  1JQ0 A;  4JF3 A;  1I5Y A;  3CYO A;  3MHH C;  1F23 A;  1QR9 A;  2LP7 A;  1Y4M A;  3MHS C;  4JPR A;  5KA5 A;  5HFL A;  3WFV A;  3B77 A;  4FIP C;  4N21 A; 
#chains in the Genus database with same CATH topology
 1MMM A;  1ZSP A;  4DV1 B;  2OT5 A;  3KCY A;  3TET A;  1PL4 A;  1PP9 H;  4K0K O;  5JWP A;  1QQC A;  1GN2 A;  3K06 A;  5CN0 A;  5JJJ B;  3H1K H;  1B06 A;  4DR4 B;  1PNK A;  4OPA A;  2OCC C;  5IYB O;  3C3S A;  3B4S A;  4L8J A;  5DN6 G;  1NTK H;  1WPB A;  3T2M A;  2V4D A;  2P22 C;  3CX5 F;  3N2G A;  5BR8 B;  1HNX O;  1BQZ A;  3Q4H A;  3UQ8 A;  2M6Y A;  3JAR B;  1OCZ B;  4X66 B;  4JAV A;  2X6B A;  2IW5 A;  3TCU A;  1F4M A;  2CTP A;  2ZCE A;  1M5I A;  1VEW A;  1H2N A;  4YY3 O;  1W0J G;  3JSN A;  4FK5 C;  4JTD B;  3L73 H;  1IXB A;  4PV1 B;  3VBB A;  3UKM A;  4LWS B;  4RQF A;  4YHH B;  2ZIO A;  3APO A;  2YIB D;  3E22 A;  3DC6 A;  2LGQ A;  2EZO A;  5C8Y A;  5CA0 A;  1R3J C;  2VWJ A;  4TV9 B;  1AP6 A;  3DXR A;  1IDS A;  2PUS A;  3TGU H;  4H33 A;  1R1B A;  4LC1 A;  4KXR A;  1N34 O;  1YHQ V;  4I55 A;  2YS8 A;  4JI0 O;  3FYE B;  3ETE A;  1F23 A;  2R9A A;  2OCH A;  3NR7 A;  4O2A B;  3CCR V;  5FNV B;  4NR1 A;  1TAE A;  2X6C A;  3CCV V;  3B8M A;  3K0G A;  2RJZ A;  3GVM A;  4BIO A;  2AHY A;  1HNZ B;  4Z2W A;  1DK1 A;  2GDS A;  1I94 B;  3ZMZ A;  1YCI A;  2WSS G;  4HBN A;  2QKA A;  4UFZ A;  4FIP C;  2R72 A;  1SET A;  4DV1 O;  1OCR B;  3BHP A;  5FPO A;  3JD1 A;  4JAA A;  2B1G A;  4EEQ A;  1MSW D;  3RBZ A;  2AXT Z;  1BMF G;  4YXW G;  2ZNI A;  1D5N A;  2P6J A;  4O4H A;  4UB8 Z;  1H2S B;  5EIB D;  3CRA A;  2BE3 A;  2GTA A;  4K3A A;  1GH6 A;  1XDC A;  4B3S B;  2WLJ A;  4U3J B;  2ZR2 A;  3F7Y C;  3S3W A;  2Q7H A;  2KQX A;  3FB7 C;  3RYH B;  1FJG B;  1IZ3 A;  4JYC A;  4GCZ A;  4X65 B;  2GTS A;  4LH6 A;  3SPH A;  2DWE C;  1CXZ B;  4QPJ A;  4TV8 A;  3K5L A;  5L3B A;  5JVD A;  1SKV A;  4RUF A;  1B04 A;  3N2K B;  4X66 O;  2OCC B;  4R8C A;  4I0X B;  3ZX6 A;  1Y76 B;  1TVK B;  1MZF A;  3GWK C;  3A0B Z;  1NJI W;  4FFB B;  2JVD A;  3E86 A;  4HNA A;  1I0H A;  1GAX A;  3CRC A;  3KKY A;  4YHH O;  2R9R B;  4JI3 B;  4FZ1 A;  1XI1 A;  2HLD G;  1XOU A;  4P9O A;  4CZZ A;  3FAV A;  1F4N A;  2PGG A;  1QNM A;  5KHJ A;  5ITZ B;  4X1Y A;  4EKW A;  3ABL C;  2PY5 A;  4ASU G;  1Q82 W;  2DW4 A;  3BY6 A;  2AHZ A;  1BHA A;  4HYO A;  2EJ7 A;  1OHH G;  1YVW A;  4TSF G;  1N0J A;  1SER A;  2VS0 A;  1HNZ O;  5JJE B;  4U7O A;  1I94 O;  4UCU A;  4RUE A;  4X62 B;  2Y69 B;  4PA4 A;  4EFB A;  3H1L H;  1Q6H A;  3CP1 A;  5GON A;  1JCH A;  4TOI A;  3RYI A;  3U0Z A;  3OTF A;  4LCU C;  2L35 A;  4JI5 B;  4W4K A;  4E4E A;  3WG7 C;  3ZIA G;  2GSM B;  4LNU B;  1J5E B;  1MA1 A;  3B40 A;  1CP9 A;  4GT1 A;  2EIM C;  2AGA A;  1RFY A;  1KP3 A;  2LJ2 A;  1BZK A;  3P32 A;  4D6T H;  5BMV B;  4B3S O;  1ZX3 A;  3F7V C;  2XTA A;  1KEC A;  1I08 A;  4MTO A;  3U11 A;  1YEW A;  1FJG O;  2FL4 A;  1U97 A;  5H6Q A;  1OV9 A;  2EBO A;  2MW2 B;  4UCV A;  3ZRX A;  1GN3 A;  4UCR A;  1DTO A;  1XRE A;  4FLU A;  4HAM A;  4KP4 A;  4DW1 A;  3ZMT A;  1TGO A;  1MNG A;  4W4L A;  5L3C A;  1I5Y A;  3J81 N;  2EIN C;  1EN4 A;  5KAF Z;  4PEL A;  3JAL A;  3D36 C;  3ZN1 A;  4CS3 A;  2PI4 A;  4JI3 O;  2GUZ B;  4GZR B;  5IJ0 A;  1BS3 A;  1VIB A;  2IH3 C;  2F95 B;  2QKS A;  3CCL V;  2FYU H;  1RP3 B;  3JCZ A;  1M57 B;  5LP6 C;  3R65 A;  2YDE A;  4O4J B;  2UXB B;  2OTJ V;  4A5U B;  4ZOL B;  2P4V A;  3W7X A;  3GWO A;  1Z5W A;  5CBH A;  3LDC A;  1GRJ A;  1K4C C;  1NT2 B;  4I5S A;  4GUN A;  1BSM A;  3M99 B;  3OGC C;  4J80 A;  4YJ3 A;  4J7K A;  2UXN A;  2DQ3 A;  5CA3 A;  3QTC A;  1K8A W;  2XT9 A;  3KZI Z;  2JK5 C;  3JAW B;  3SJQ C;  3ABM C;  3ZJZ A;  4NXM B;  2ZIM A;  3ABL B;  1KUQ A;  3MDS A;  4X62 O;  4H44 B;  1JVM A;  2WWW A;  1OCO C;  2YXH A;  4JI5 O;  3AG2 B;  1NVP D;  1KB9 F;  1QLN A;  5E1A C;  2OTL V;  5EZY B;  4YJ2 B;  1FFX B;  3CRM A;  1Q6I A;  1J5E O;  1JX9 A;  2HHH B;  3G6E V;  3SGI A;  2F66 C;  3ZCC A;  2HP8 A;  1ZL8 A;  2E74 B;  2JGU A;  5LOV B;  2Q67 A;  3QG5 A;  2P5O A;  4R6Z A;  3ZRS A;  1RM1 B;  3SDL A;  1K33 A;  1LR1 A;  3E89 A;  1P7G A;  1IXM A;  2EIM B;  1WP8 A;  4P2Z A;  2BCC H;  2KG7 A;  3K9A A;  4H0L B;  4D7S A;  1XQ8 A;  5KUM A;  2F43 G;  3SPI A;  3T1C A;  3CJH A;  4DXW A;  3MHS C;  4NXN B;  1VAR A;  3RYC B;  4JAS A;  1SQB H;  3OFN G;  3AK2 A;  4AQY B;  5EBM C;  4O2B B;  1S76 D;  2VRZ A;  4WFA V;  1FXH A;  4O4I B;  1RPO A;  2BOB C;  3CXC U;  1JJ2 U;  1SQV H;  1BCC H;  1VQL V;  4BIZ A;  2EIN B;  2ZT9 B;  3KCX A;  2UXB O;  2IU0 A;  1L1F A;  4DW0 A;  2IH1 C;  3DGE A;  1XL6 A;  4MTF A;  1XEQ A;  4JI1 B;  3RWR D;  1NQT A;  1OCC C;  2JGD B;  2Y4T A;  3UT5 B;  5LP6 B;  3CCE V;  4JTA B;  3LDD A;  3JAM N;  1EN5 A;  4L87 A;  4NXM O;  4D7T A;  2DN9 A;  3JAW A;  3P3P A;  4B7E A;  1NH2 B;  1D2D A;  2BOC C;  1D5A A;  3JD4 A;  5BXZ A;  1GK9 A;  4LF6 B;  1VF6 A;  2CK3 G;  5IYZ B;  5CMU A;  3J80 N;  1RSO B;  1VQ8 V;  2HHH O;  2DJV A;  4X1I A;  2JS5 A;  4LFB O;  3ABM B;  4WCE V;  2DYS C;  4J11 A;  1SQX H;  2QTS A;  1ZTE A;  2WLI B;  4RO2 A;  3OUS A;  1K73 W;  3T4Z A;  4PD4 F;  1OCO B;  4UVB A;  3VQV A;  5IE9 A;  5IDJ A;  4MSW C;  5H6R A;  4B3M B;  3ABK C;  3OMA B;  2MK3 A;  1VF5 B;  5K1P A;  2A79 B;  1VF7 A;  1N36 B;  3STZ C;  4DR2 B;  2QGN A;  1Y74 A;  2W6J G;  4UCO A;  3CMA V;  2P7T C;  2CE4 A;  1QVF U;  4NXN O;  1IX9 A;  1PM9 A;  2Q0A A;  4AQY O;  2JEX A;  3N2G B;  4KHP B;  3CC4 V;  3Q4H B;  1K9M W;  3LUT B;  4AHC A;  1HNX B;  5CB4 A;  3UM7 A;  3K08 A;  3G71 V;  4OXS A;  5IYC O;  1YTF B;  4DV4 O;  3FFQ A;  1JQ0 A;  2PI5 A;  1VQ4 V;  4FLV A;  5LMU O;  5KHK A;  4MVR A;  2A3Q A;  4UXN A;  1YIJ V;  2XAS A;  5JH7 A;  1HP8 A;  2H8P C;  2P67 A;  3E22 B;  3ZHU A;  2YXY A;  5C8Y B;  5CA0 B;  3FB6 C;  4I50 A;  4N23 A;  2ZXW C;  2EIK C;  3DXR B;  3D8C A;  2C2A A;  3SYQ A;  1R6K A;  3ZS8 C;  3UT5 A;  2R70 A;  2QWO B;  4I55 B;  4U7N A;  2OWO A;  1GO3 F;  4ICG A;  4JPR A;  2HJD A;  4J7Z A;  5IWA B;  3OT7 A;  3TXQ A;  2KKW A;  4LF6 O;  3E8F A;  3B8N A;  3CCM V;  1OCC B;  2OIG A;  5HFM A;  3RVZ A;  2BTQ A;  1KYO F;  2G38 A;  2RNB A;  4WFG A;  5IYZ A;  4DR7 B;  4BW5 A;  3E35 A;  1Q6U A;  2LW7 A;  1IBL B;  1JJO A;  2ATK C;  2RQ6 A;  1Q8I A;  4PDL A;  2WLI A;  1Q5O A;  1R6T A;  1K34 A;  4JGS A;  4FM0 A;  1KKC A;  2Y0P A;  3O9O A;  4GKJ B;  4B3M O;  1FYJ A;  1VQM V;  4JI8 B;  1N36 O;  2DYS B;  4O4H B;  4X8A A;  5KA6 A;  1E1Q G;  4DR2 O;  1N33 O;  1US6 A;  1H2K A;  4TQF A;  2JEU A;  2DMX A;  5JQG A;  3N27 A;  5D5Q A;  1SRY A;  1URF A;  1PNL A;  2ZE5 A;  5L3F A;  2X6A A;  3ABK B;  5LGU A;  4KHP O;  1GTO A;  1DLB A;  4TV8 B;  3CHX A;  2Q7G A;  3T1Y B;  1DF5 A;  2YC0 A;  3K04 A;  5JVD B;  3RW0 A;  1KMI Z;  4IYH A;  1YDX A;  3OMI B;  3K9S A;  5LHH A;  4MW3 A;  1NH2 D;  1SQQ H;  4X64 B;  5DEC A;  5L3G A;  5EBL C;  2NR5 A;  4HNA B;  1EBO A;  1AI4 A;  1AI7 A;  5L3D A;  4FLW A;  3HR0 A;  4B08 A;  4EB6 B;  4JI7 B;  3EFF K;  4J9Z B;  1IBM B;  1PPJ H;  2ADP A;  2XAF A;  3FAV B;  1EZJ A;  2XOK G;  3T4D A;  2QSA A;  2O57 A;  4X1Y B;  4CH6 A;  4Z1V A;  1XUQ A;  5IWA O;  3ETQ A;  1MG1 A;  1ZAU A;  4GKK B;  3K57 A;  1S5J A;  3CCJ V;  2Y69 C;  2ZXW B;  2EIK B;  3IC9 A;  4DR7 O;  4NKG B;  1BHB A;  3OGI B;  1IBL O;  4YIP A;  1VQ7 V;  1H38 A;  2XUM A;  4MVO A;  3ZRW A;  3J7A U;  4QGP A;  3H1H H;  5GON B;  3RYI B;  4PDR A;  2A06 H;  2W0X A;  4E2L A;  1Y67 A;  4GKJ O;  4DV6 O;  2M7W A;  4GX0 A;  4HZ3 A;  1J95 A;  3U10 A;  2YI9 A;  3FB8 C;  3T1H B;  4JI8 O;  4CS2 A;  1M9N A;  3OAA G;  3ZRV A;  2UUA B;  1N0N A;  5LHG A;  3IGA C;  1G4Y B;  5EYP A;  4GX1 A;  4C7U A;  3ZN0 A;  2E3C A;  3K5O A;  4I9W A;  1SF9 A;  4MW8 A;  4LH7 A;  4N21 A;  2CDY A;  2NN4 A;  3VOU A;  3W7U A;  5CA1 A;  5BY1 A;  2IBZ H;  3T1Y O;  1IBK B;  1QBZ A;  4MT8 A;  4Q20 A;  2QR4 A;  4DV7 B;  3X2Q C;  2FML A;  4FJC C;  1ENV A;  2B5U A;  4OX9 B;  2CTW A;  4LFC O;  4JAU A;  3K3W A;  4X64 O;  2VQF B;  1G8M A;  2YEV A;  4MVM A;  1M57 C;  1WB7 A;  4NYK A;  3JAL B;  5CBF A;  1AJN A;  4MTG A;  3RVY A;  3RYF A;  1RPR A;  4JI7 O;  1EM1 A;  2YXL A;  3P30 A;  3CE2 A;  5IJ0 B;  1F51 A;  5B5E Z;  1ZUQ A;  4EB6 A;  2QWP B;  5LGT A;  1HNW B;  3CCQ V;  3BRC A;  1YJN V;  3CB2 A;  1IBM O;  4XBF A;  1XMQ B;  2VWK A;  5KAI Z;  4NTX A;  3SR2 C;  4WFB V;  2ZR3 A;  4DV3 B;  3IFX A;  4AI8 A;  3MAQ A;  1QLE C;  4WFH A;  4GKK O;  4XDJ A;  4B3R B;  2X0L A;  4NTW A;  1SES A;  3I56 V;  1VF6 C;  4CBC A;  4DR1 B;  3OD4 A;  3AG2 C;  4YJ3 B;  3AG7 A;  5J2U B;  5GTI Z;  5EC2 C;  4RWU A;  1AR4 A;  2D2C B;  1JMK C;  4BAY A;  1VQK V;  2QEX V;  4JV5 B;  3BEH A;  5EC1 C;  1SQP H;  4XDL A;  5H9C A;  3T1H O;  2UUA O;  2KB1 A;  1RM1 C;  1SQG A;  4FZ0 A;  2Q69 A;  3BCC H;  4DRX B;  3OE7 G;  2AZ0 A;  4LR3 A;  3OEH G;  1XNR B;  1S5L Z;  3OEE G;  4FLX A;  1XL4 A;  1ZL8 B;  1R6N A;  2ZE7 A;  1EZV H;  1XBL A;  1FXK A;  3AEI A;  3CCS V;  1YIT V;  2ZKO A;  1WAZ A;  3B09 A;  4FM2 A;  3G80 A;  3WB0 A;  1IBK O;  5LGN A;  3G67 A;  4DV7 O;  4BW9 A;  2KG7 B;  3JAK A;  2JDI G;  5A9G A;  2QWR B;  3CJH B;  4OX9 O;  3ZMV A;  3JD2 A;  2VQF O;  2HJF C;  2FB5 A;  4CS4 A;  3ABT A;  4MVS A;  2EIL B;  3UO3 A;  1K97 A;  2E75 B;  3IAY A;  3LSU A;  2QM8 A;  3SPG A;  4DV5 B;  1HNW O;  2ARH A;  3X2Q B;  1DGS A;  2AZ2 A;  1XMQ O;  4EFE A;  1I5X A;  4UVC A;  5IT9 N;  4DV3 O;  3TJT A;  1FD9 A;  1UJW B;  3OTO B;  4B7K A;  5KMG A;  2ODM A;  2F4V B;  4CH5 A;  4B3R O;  2Y4U A;  3ABU A;  4DR1 O;  1UPG A;  2ZE8 A;  5J2U A;  1TUB A;  3W7S A;  3CS5 A;  2CGN A;  2OYQ A;  2ZQM A;  1QLE B;  5FPR A;  5GW7 A;  4JV5 O;  2QJ1 A;  4IGG A;  1WB8 A;  4J7J A;  3QO7 A;  2FTK A;  3ZHR A;  1B6Q A;  1Q3E A;  1PL0 A;  5A2Q N;  1XHZ A;  4IL6 Z;  4QE7 A;  4X1I B;  1JFF A;  2H3O A;  4OPH A;  3CC7 V;  3F5T A;  1WN7 A;  4LFB B;  4DRX A;  4DR5 O;  1XNR O;  4K8X A;  4J9Y B;  1L8D A;  1AJP A;  2P90 A;  2WLN A;  5EBW C;  3UO2 A;  1JA8 A;  4ZKI A;  3SPJ A;  3CRR A;  2NNU A;  4LF7 B;  4X88 A;  1Y74 B;  4LF4 B;  2JJ2 G;  2Z0A A;  4B3T B;  1U96 A;  3HKE A;  3OMN B;  4GYC B;  2Q73 A;  2WAM A;  3VQY A;  4PA6 A;  2V7Q G;  4UVA A;  1FAF A;  3FKS G;  2Q7E A;  2IJI A;  4NVP A;  4DV5 O;  3JCU Z;  3H01 A;  2UXC O;  5CB4 B;  5K1X A;  3HPL C;  5FL7 G;  2UXX A;  4U3F H;  3RFR A;  3SYP A;  5H5N A;  1M90 W;  4I7Z B;  3DTU B;  4JZG A;  4DV4 B;  3CYO A;  5LHI A;  5B66 Z;  5J9P C;  3OTO O;  4QNH B;  2F4V O;  5LMU B;  5JH7 B;  3CXH F;  1FKA O;  2P06 A;  3ZBH A;  4I50 B;  1KD1 W;  5JJN B;  1Q86 W;  2Q8V A;  3B2E E;  1PV0 A;  4PA3 A;  1YJW V;  1S3J A;  1ZLZ A;  5IJ9 B;  2N05 A;  2A9H A;  3L72 H;  4DUY B;  1OZ0 A;  4AIL C;  2ITC C;  4PHZ A;  2HKO A;  5LXT A;  4ZI7 A;  1QR8 A;  1SS3 A;  1IUR A;  4JI6 B;  2F1M A;  2YI8 A;  2BTQ B;  3F5W C;  3DSQ A;  4Q6G A;  3ZMS A;  3UCS C;  4DR3 O;  5KUK A;  4X9Q A;  4RAI A;  2HVJ C;  2JIZ G;  3EVK A;  1G6U A;  2QKC A;  4GLX A;  1NKD A;  3PJS K;  3M8A A;  1BT8 A;  2ZDI A;  4CC5 A;  2N04 A;  2RMK B;  2CTR A;  4LF7 O;  2BSK A;  1AVM A;  4LF4 O;  1N33 B;  4B3T O;  5JQG B;  1AI5 A;  1SZX A;  1GM8 A;  3FX7 A;  3CPW U;  2L6L A;  5HFL A;  2A0L A;  3BVO A;  3H1I H;  1KC8 W;  3O65 A;  3BA9 A;  3HKD B;  3C3T A;  4K8Z A;  2RCV A;  2YIA A;  1W59 A;  2A7W A;  1Z2G A;  1YZB A;  1M4U A;  3K0D A;  3L75 H;  5TIS Z;  3K59 A;  3ICX A;  1AI6 A;  4JTC B;  4WF9 V;  2WLL B;  3SJA C;  3AG4 C;  4TQD A;  4FFK A;  2EUL A;  3IJ4 A;  3BFR A;  1GMG A;  3AG3 C;  5F2V O;  2VQE B;  1HR0 B;  2F93 B;  1AB3 A;  4LBE C;  3ZED A;  3L70 H;  1NR7 A;  1V54 C;  3BA8 A;  2JJ1 G;  5IJ9 A;  4TUY A;  4IYI A;  1BL8 A;  4R7C A;  1X4T A;  4DUY O;  2IU3 A;  5LMN B;  4LF9 O;  2QE7 G;  3D3Q A;  3VQX A;  4UB6 Z;  3VQW A;  2H94 A;  2PTM A;  4JI6 O;  2RN9 A;  2UXD B;  1AR5 A;  4JI2 B;  4WFE A;  4ABM A;  4LF5 B;  3HKC A;  3PN1 A;  2OIE A;  3K5M A;  2CTQ A;  2GHY A;  3JAS A;  2QDO A;  2BTO A;  4LF8 B;  3ZRW B;  4K35 A;  1IVS A;  5JCO A;  3ZHQ A;  1WA8 B;  4LP8 A;  1P49 A;  2XHB A;  2IM9 A;  4H37 A;  4FMT A;  1FXK C;  5B3S C;  4DV6 B;  2K9P A;  3MD0 A;  1I7F A;  1Q7Y W;  1K3E A;  3LNM B;  3M7M X;  3WB1 A;  2YIB A;  1HW7 A;  4G27 B;  5EYP B;  2W0F C;  4DV2 B;  4LFA O;  5LA6 A;  2LFS A;  4GX2 A;  1N8R W;  2UUC B;  2QTO A;  2LQT A;  4J10 A;  2PZS A;  1WP7 A;  1Z5V A;  5CA1 B;  2ITD C;  4F6R A;  2WLK A;  2Q9L A;  2WLM A;  3HKD A;  2QWN B;  1ZWI C;  4J41 A;  2LFR A;  3W7T A;  4WBN B;  3STL C;  2DYR C;  5KX5 A;  2YEV B;  2JRI A;  4LFC B;  2DWD C;  3RYF B;  2Z5U A;  1YSC A;  3HKB A;  2WLL A;  3E8H A;  1R3K C;  2EJR A;  2VQE O;  5KHH A;  1HR0 O;  3AG1 C;  4IIJ A;  1NTM H;  4G2K A;  3AK3 A;  4JZ2 A;  1R73 A;  5LMN O;  3BPZ A;  3AG4 B;  3TXS A;  2EX3 A;  3AG3 B;  2UXD O;  5B1N A;  1V55 C;  4JI2 O;  4LF5 O;  1SA0 A;  4X20 A;  4UUJ C;  1XNQ O;  1ORQ C;  4IT5 A;  1V54 B;  1TA8 A;  2KSD A;  1THZ A;  3LDE A;  2ZD9 A;  1BE3 H;  1FXV A;  4LF8 O;  2Y48 A;  4DV0 B;  1HWY A;  3IC7 A;  2ILM A;  1YI2 V;  2PF4 E;  1MSD A;  1EFR G;  4MTX A;  1WA8 A;  3ML0 A;  1HDJ A;  1JPX A;  1WJZ A;  2CH7 A;  3BAA A;  2CGO A;  1YTF D;  2WLH A;  4BR6 A;  4ZHQ A;  3ETD A;  3RN4 A;  3ASN B;  3CD6 V;  5B1A C;  4X1K A;  4DV2 O;  5E79 Z;  3LSS A;  5J2T B;  3ZMU A;  1QR9 A;  3TK1 A;  4IHJ B;  3E83 A;  3B77 A;  2UUC O;  1XHX A;  3OUF A;  1FXK B;  5B3S B;  1H2L A;  2EIL C;  3E8B A;  1NTZ H;  4FVM A;  4JYA B;  3JAK B;  1GM7 A;  3AK1 A;  1H2G A;  3CRQ A;  4UV8 A;  4DR4 O;  2ZNJ A;  1AR1 B;  1JOY A;  1LUW A;  2GBO A;  4I9Q A;  4MVQ A;  4FM1 A;  4X89 A;  4G28 B;  4WBN A;  2E5L B;  1F7Y A;  1GN6 A;  1O9H A;  2K1E A;  3K5N A;  1S5H C;  1DF4 A;  1O9G A;  5BR8 O;  3A0H Z;  1K5S A;  1NVP B;  2DYR B;  2XND G;  3JAR A;  2GV9 A;  2NLJ C;  1T5E A;  4R50 A;  2ZM6 B;  1L0N H;  3SYA A;  5KMG B;  3CWB H;  3OM3 B;  3W7W A;  1AP5 A;  2WA4 A;  2X7R B;  3AG1 B;  3LSQ A;  4LWS A;  4DK1 A;  1N32 B;  5KHG A;  3OR7 C;  1VQO V;  1K4D C;  4TV9 A;  5CBG A;  1TUB B;  1VQ6 V;  1Q81 W;  4DV0 O;  1COW G;  1V55 B;  1QHT A;  2QA4 V;  1M1K W;  4PDM A;  4O2A A;  5FNV A;  4P9P A;  3WB2 A;  1NS1 A;  3SJC C;  1YF2 A;  2ZDI C;  1JFF B;  2YUA A;  3SJB C;  5D5P A;  4DR6 B;  3DC5 A;  3RT3 C;  2R9I A;  4DR5 B;  1L0L H;  4TT3 G;  3ZHT A;  3FD9 A;  3L74 H;  1KKD A;  3SYC A;  5J2T A;  4IHJ A;  2FKX A;  1GM9 A;  1AIL A;  2CUG A;  4MVU A;  4JYA O;  2ADQ B;  5B1A B;  2E76 B;  3CEI A;  3HKE B;  2E5L O;  4MS2 A;  5IY5 C;  3A8T A;  4U3J A;  5EK0 A;  3BAB A;  3G6B A;  1NR1 A;  3I5D A;  3RYH A;  4X65 O;  3QF7 A;  1SC5 B;  4FLY A;  2B1I A;  1M93 A;  1E1R G;  2DOS A;  2UXC B;  2N74 A;  5B1B C;  2JS3 A;  3N2K A;  3GB7 C;  5DM6 V;  2PYL A;  2Z3Y A;  3K79 A;  1KU9 A;  4I0X A;  2ZM6 O;  3EXA A;  1AJQ A;  2WA3 A;  2DE0 X;  1Y76 A;  1TVK A;  3JD0 A;  1CPY A;  1KP2 A;  2LW1 A;  4PA7 A;  4FFB A;  5C93 A;  1S77 D;  5B1O A;  4KL1 A;  1M56 C;  1H8E G;  1SZT A;  5LBQ A;  4PDV A;  1N32 O;  3APQ A;  1YXB A;  4Z1M G;  5GTH Z;  1W0K G;  3JSL A;  5ITZ A;  1ROP A;  5LXT B;  1H2M A;  5H2F Z;  4ZI7 B;  2AW9 A;  5JCO C;  2W6I G;  1GN4 A;  2HR3 A;  3CC2 V;  5AG2 A;  4DR3 B;  3E2E A;  4DR6 O;  2XAQ A;  1XMO B;  2EZP A;  4CH3 A;  1KQS U;  4UCT A;  2XAH A;  4JYY A;  2B9Z A;  3FYI B;  4GX5 A;  3SPC A;  1VQP V;  3I55 V;  2ETN A;  2XAG A;  5KLV H;  3P3N A;  4O4L B;  4KUM A;  1QU7 A;  4ZBM A;  5LYJ B;  2BSK B;  1Q43 A;  3RGB A;  5BZB A;  4I4T B;  4LNU A;  5KHI A;  3WU2 Z;  1WLE A;  4JI4 B;  3C90 A;  1X59 A;  4DK0 A;  1WPX A;  1KBH A;  2HG5 C;  4JYB A;  5L3E A;  3WFV A;  3ZHS A;  4F4L A;  5BMV A;  3WG7 B;  4P30 A;  1R3I C;  2Q4P A;  1PNM A;  5LL6 Y;  4BIU A;  1Y6X A;  2P4K A;  1BGY H;  4H13 B;  2ZIN A;  2Q68 A;  1ARO P;  3ASO C;  4PA9 A;  2UUB B;  2IJH A;  2YSU B;  4NTY A;  2UU9 B;  1N4C A;  1P84 F;  5IY5 B;  2WPD G;  3K03 A;  3MHH C;  3CCU V;  4DO2 A;  1FPO A;  3D3I A;  2HEP A;  1EN6 A;  3E8G A;  5EIB C;  2GUZ A;  5B1B B;  3JYC A;  3A2F A;  2LO1 A;  1P7B A;  1JR9 A;  1B3Q A;  3FB5 C;  3ZHV A;  1BQ0 A;  1SQF A;  2Q6A A;  3JD3 A;  4TUY B;  4BWA A;  2EIJ C;  4KFM A;  1NU1 H;  4RQE A;  3JAT B;  3QO8 A;  4O4J A;  1FFT B;  1A32 A;  4LF9 B;  2IJJ A;  1M56 B;  4ZOL A;  2F23 A;  3A0R A;  4FPP A;  4YIO A;  3HKC B;  1G1X B;  3OW2 U;  3L71 H;  3JAS B;  2XAJ A;  1W2B U;  4QJF B;  4DUZ B;  1XMO O;  2YID A;  1Y66 A;  3G4S V;  4PI0 A;  4J42 A;  2LP7 A;  4WFF A;  3S3X A;  1K92 A;  3KG2 A;  1MOF A;  2RDC A;  4PJ0 Z;  1S72 V;  2D3O W;  2DQ0 A;  3R66 A;  4O4L A;  5EZY A;  4YJ2 A;  1FFX A;  5LYJ A;  3H1J H;  4JI4 O;  4I4T A;  5LA6 B;  1Q90 D;  4LFA B;  3THO A;  1PKX A;  1K7D A;  1VQN V;  1WNS A;  2Q0O C;  3CSX A;  5LOV A;  2QWQ B;  3K58 A;  3H9V A;  1NBM G;  2QM7 A;  4F6R B;  1MZE A;  3CME V;  4DYL A;  4K0K B;  2UUB O;  3NXS A;  2HFE C;  1NZ6 A;  2UU9 O;  5FLX N;  1OCZ C;  5KX5 B;  4NB5 A;  4XDK A;  4F6E A;  4UCS A;  1FS0 G;  1VQ5 V;  1OJH A;  4UV9 A;  1XIL A;  3RYC A;  2YIC A;  3HKB B;  3EHB B;  1UFI A;  4O2B A;  2V1D A;  3ASO B;  2CAZ C;  1VP7 A;  1LUV A;  4IIJ B;  4O4I A;  1VQ9 V;  1PD3 A;  3SYO A;  1GKF A;  2Q5Z A;  4PI2 A;  2Y0I A;  1QVG U;  4YY3 B;  3D36 A;  3JAT A;  4OGQ B;  4MVZ A;  2QM4 A;  4QPK A;  1NI8 A;  4JI1 O;  1V9P A;  4CH4 A;  1SA0 B;  4X20 B;  1S0V A;  1CEZ A;  1R3L C;  1YJ9 V;  2PYJ A;  1XNQ B;  2EIJ B;  2JGD A;  5LP6 A;  4DUZ O;  4CC6 A;  3L9D A;  2IJK A;  4QE9 A;  1N34 B;  4TWK A;  3ASN C;  4FLT A;  4JI0 B;  3QNE A;  4FLZ A;  1H8H G;  3OR6 C;  2CH7 B;  1QCE A;  2HVK C;  1E79 G;  1K5Q A;  1OCR C;  4ZIB A;  3ETG A;  4ZHQ B;  3LNN A;  1RSO A;  4QIW F;  2LGW A;  1VMG A;  1TUE B;  3QO5 A;  4X1K B;  5IYD O;  1P4R A;  1LNQ A;  4JF3 A;  5DED A;  2ZE6 A;  1Y4M A;  3QVN A;  1MAB G;  3HB3 B;  5KA5 A; 
#chains in the Genus database with same CATH homology
 1NH2 B;  2BOC C;  2K1E A;  3JD4 A;  1S5H C;  1DF4 A;  1GK9 A;  2OT5 A;  3TET A;  3ABU A;  2CK3 G;  1K5S A;  5CMU A;  1NVP B;  3K06 A;  1VQ8 V;  2DYR B;  2XND G;  3ABM B;  5CN0 A;  4WCE V;  2DYS C;  2NLJ C;  3W7S A;  1PNK A;  2WLI B;  4RO2 A;  3OUS A;  4R50 A;  1K73 W;  2OCC C;  2ZQM A;  1QLE B;  5GW7 A;  3SYA A;  5IYB O;  3OM3 B;  3T4Z A;  3W7W A;  1OCO B;  4UVB A;  5IDJ A;  4MSW C;  5DN6 G;  2X7R B;  3AG1 B;  3LSQ A;  3QO7 A;  5H6R A;  2FTK A;  3T2M A;  1B6Q A;  3ABK C;  3OMA B;  2MK3 A;  1PL0 A;  3OR7 C;  1VQO V;  1K4D C;  2A79 B;  4QE7 A;  3STZ C;  1OCZ B;  3CC7 V;  4JAV A;  5CBG A;  2W6J G;  1VQ6 V;  2X6B A;  3CMA V;  2IW5 A;  2P7T C;  1Q81 W;  3TCU A;  1F4M A;  1QVF U;  1COW G;  4J9Y B;  1V55 B;  1W0J G;  4FK5 C;  4JTD B;  2QA4 V;  1M1K W;  1AJP A;  4PDM A;  3VBB A;  2JEX A;  2P90 A;  2WLN A;  5EBW C;  3UKM A;  4RQF A;  4ZKI A;  4P9P A;  3SPJ A;  3CC4 V;  2NNU A;  2ZDI C;  1K9M W;  2EZO A;  3LUT B;  3UM7 A;  1R3J C;  4X88 A;  3K08 A;  3G71 V;  4OXS A;  5IYC O;  1YTF B;  4H33 A;  2JJ2 G;  4LC1 A;  1JQ0 A;  2R9I A;  3OMN B;  1YHQ V;  2PI5 A;  3FYE B;  3ETE A;  2WAM A;  1VQ4 V;  1F23 A;  4TT3 G;  4MVR A;  1KKD A;  3SYC A;  4UXN A;  1YIJ V;  4PA6 A;  2V7Q G;  2XAS A;  3CCR V;  4UVA A;  3FKS G;  1GM9 A;  2IJI A;  2H8P C;  2P67 A;  2X6C A;  3CCV V;  3B8M A;  3FB6 C;  3H01 A;  3K0G A;  4MVU A;  3HPL C;  4N23 A;  2ZXW C;  2EIK C;  2UXX A;  5FL7 G;  5B1A B;  3SYP A;  2C2A A;  3SYQ A;  1R6K A;  1M90 W;  2AHY A;  3DTU B;  4U7N A;  3CYO A;  5LHI A;  1GO3 F;  3ZMZ A;  5J9P C;  2WSS G;  4MS2 A;  4QNH B;  4JPR A;  5IY5 C;  4FIP C;  1SET A;  5EK0 A;  1NR1 A;  3E8F A;  3B8N A;  1OCR B;  3JD1 A;  3CCM V;  1OCC B;  2B1G A;  1KD1 W;  2B1I A;  1MSW D;  3RBZ A;  3RVZ A;  5HFM A;  1Q86 W;  1E1R G;  4PA3 A;  1YJW V;  1BMF G;  4YXW G;  1S3J A;  4WFG A;  5B1B C;  2P6J A;  4BW5 A;  3GB7 C;  3E35 A;  2A9H A;  5DM6 V;  2Z3Y A;  2ATK C;  3K79 A;  1OZ0 A;  4PDL A;  2ITC C;  2WLI A;  1AJQ A;  2WLJ A;  2HKO A;  1CPY A;  1KP2 A;  2ZR2 A;  3JD0 A;  3F7Y C;  1K34 A;  4PA7 A;  3FB7 C;  1QR8 A;  4JGS A;  5C93 A;  1S77 D;  5B1O A;  1M56 C;  1H8E G;  1SZT A;  5LBQ A;  4JYC A;  4GCZ A;  4PDV A;  3F5W C;  3SPH A;  3ZMS A;  2DWE C;  1VQM V;  4QPJ A;  2DYS B;  5L3B A;  5KUK A;  4X8A A;  4RUF A;  1E1Q G;  5KA6 A;  4RAI A;  2HVJ C;  4Z1M G;  2OCC B;  1W0K G;  2JEU A;  4R8C A;  2JIZ G;  1NKD A;  1SRY A;  1ROP A;  1PNL A;  3PJS K;  1NJI W;  3E86 A;  5L3F A;  2X6A A;  2W6I G;  3ABK B;  5LGU A;  2R9R B;  2ZDI A;  1GTO A;  2HR3 A;  1DLB A;  3CC2 V;  2HLD G;  4P9O A;  1DF5 A;  3K04 A;  3RW0 A;  3OMI B;  3E2E A;  4CZZ A;  2XAQ A;  5LHH A;  1F4N A;  2EZP A;  1AI5 A;  4MW3 A;  1NH2 D;  1KQS U;  1GM8 A;  2XAH A;  5L3G A;  3CPW U;  5HFL A;  2A0L A;  4EKW A;  5EBL C;  3FYI B;  4GX5 A;  3SPC A;  1VQP V;  1EBO A;  1AI4 A;  1AI7 A;  3I55 V;  3ABL C;  5L3D A;  1KC8 W;  4ASU G;  2XAG A;  1Q82 W;  2DW4 A;  4KUM A;  3BY6 A;  2AHZ A;  1BHA A;  4HYO A;  4ZBM A;  3EFF K;  4J9Z B;  1OHH G;  4TSF G;  5BZB A;  2XAF A;  1EZJ A;  2XOK G;  3T4D A;  1SER A;  1WLE A;  4U7O A;  3K0D A;  1WPX A;  2HG5 C;  4JYB A;  1AI6 A;  5L3E A;  4JTC B;  4RUE A;  3WFV A;  4WF9 V;  4F4L A;  2WLL B;  2Y69 B;  1MG1 A;  4PA4 A;  3CP1 A;  3AG4 C;  3WG7 B;  1JCH A;  4P30 A;  1R3I C;  1PNM A;  4LCU C;  4BIU A;  3CCJ V;  2Y69 C;  2ZXW B;  2EIK B;  1GMG A;  3WG7 C;  3ZIA G;  3AG3 C;  2Q68 A;  2GSM B;  1ARO P;  3ASO C;  4PA9 A;  4LBE C;  2IJH A;  1BHB A;  1CP9 A;  4GT1 A;  2YSU B;  1NR7 A;  2EIM C;  1VQ7 V;  1V54 C;  2JJ1 G;  1KP3 A;  4R7C A;  1BL8 A;  5IY5 B;  2WPD G;  3K03 A;  3MHH C;  1H38 A;  2IU3 A;  3CCU V;  3P32 A;  4MVO A;  4DO2 A;  3ZRW A;  2QE7 G;  3D3I A;  3F7V C;  4PDR A;  1KEC A;  4MTO A;  4E2L A;  2H94 A;  2M7W A;  3E8G A;  4GX0 A;  4HZ3 A;  5H6Q A;  2EBO A;  1J95 A;  4WFE A;  5B1B B;  3JYC A;  3FB8 C;  3ZRX A;  1P7B A;  1M9N A;  1DTO A;  3OAA G;  3ZRV A;  4HAM A;  3FB5 C;  4KP4 A;  5LHG A;  3IGA C;  2GHY A;  2Q6A A;  3JD3 A;  1G4Y B;  3ZMT A;  2EIJ C;  5L3C A;  4GX1 A;  4KFM A;  1I5Y A;  2EIN C;  4RQE A;  3ZRW B;  3ZN0 A;  4I9W A;  3QO8 A;  1FFT B;  4MW8 A;  2IJJ A;  1M56 B;  4N21 A;  4LP8 A;  4PEL A;  4H37 A;  3ZN1 A;  4FMT A;  1FXK C;  5B3S C;  2PI4 A;  3A0R A;  4FPP A;  3VOU A;  3W7U A;  3MD0 A;  1Q7Y W;  1K3E A;  3LNM B;  1QBZ A;  4MT8 A;  4Q20 A;  3OW2 U;  2IH3 C;  2QKS A;  3X2Q C;  3CCL V;  2XAJ A;  4FJC C;  1W2B U;  4QJF B;  4G27 B;  1ENV A;  2W0F C;  3JCZ A;  1M57 B;  1Y66 A;  2B5U A;  3R65 A;  3G4S V;  2LFS A;  4GX2 A;  4JAU A;  3K3W A;  1G8M A;  2YEV A;  2LP7 A;  4WFF A;  2OTJ V;  4MVM A;  1M57 C;  1N8R W;  5CBF A;  1K92 A;  1AJN A;  4MTG A;  3KG2 A;  1MOF A;  3RVY A;  1S72 V;  1RPR A;  2QTO A;  3W7X A;  3GWO A;  5CBH A;  3LDC A;  2D3O W;  1K4C C;  2DQ0 A;  3P30 A;  4I5S A;  1F51 A;  5LGT A;  2ITD C;  3CCQ V;  2WLK A;  1YJN V;  2WLM A;  4XBF A;  3M99 B;  1ZWI C;  3OGC C;  2UXN A;  2DQ3 A;  5CA3 A;  4WFB V;  2LFR A;  2ZR3 A;  3W7T A;  1K8A W;  3STL C;  2DYR C;  2JK5 C;  3ZJZ A;  3SJQ C;  3ABM C;  2YEV B;  2DWD C;  3ABL B;  3IFX A;  1PKX A;  2Z5U A;  1YSC A;  1K7D A;  1VQN V;  1QLE C;  4WFH A;  1JVM A;  2WWW A;  1OCO C;  2WLL A;  4XDJ A;  3E8H A;  3AG2 B;  1R3K C;  1NVP D;  1NBM G;  2X0L A;  2EJR A;  2QM7 A;  3I56 V;  1SES A;  5E1A C;  3CME V;  2OTL V;  1QLN A;  3AG1 C;  4CBC A;  3AG2 C;  1JX9 A;  4G2K A;  3NXS A;  2HFE C;  3G6E V;  5EC2 C;  1OCZ C;  1R73 A;  3ZCC A;  4XDK A;  4BAY A;  1VQK V;  3AG4 B;  1FS0 G;  1VQ5 V;  2QEX V;  4UV9 A;  3EHB B;  3BEH A;  5EC1 C;  2Q67 A;  3AG3 B;  4R6Z A;  5B1N A;  1V55 C;  2V1D A;  3ZRS A;  3ASO B;  1RM1 B;  4XDL A;  5H9C A;  1K33 A;  3E89 A;  4UUJ C;  1ORQ C;  1IXM A;  2EIM B;  2KB1 A;  1V54 B;  1RM1 C;  2Q69 A;  4P2Z A;  1VQ9 V;  1PD3 A;  3SYO A;  1GKF A;  1THZ A;  3K9A A;  3OE7 G;  5KUM A;  3T1C A;  2F43 G;  3LDE A;  3SPI A;  3OEH G;  2ZD9 A;  1FXV A;  2Y48 A;  4DXW A;  3OEE G;  1XL4 A;  1HWY A;  3IC7 A;  3MHS C;  1R6N A;  1YI2 V;  4JAS A;  1QVG U;  3D36 A;  3OFN G;  1EFR G;  1FXK A;  3AEI A;  5EBM C;  4MTX A;  4MVZ A;  3ML0 A;  4QPK A;  3CCS V;  1YIT V;  1JPX A;  1S76 D;  4WFA V;  1FXH A;  1YTF D;  1S0V A;  1RPO A;  2WLH A;  5LGN A;  1CEZ A;  2BOB C;  3CXC U;  1R3L C;  1YJ9 V;  2JDI G;  2EIJ B;  3ETD A;  1JJ2 U;  3ASN B;  3CD6 V;  1VQL V;  4BIZ A;  2EIN B;  5B1A C;  2IJK A;  4QE9 A;  3ZMV A;  3JD2 A;  3LSS A;  2HJF C;  3ASN C;  4TWK A;  3ZMU A;  1QR9 A;  3ABT A;  4MVS A;  1L1F A;  2EIL B;  2IU0 A;  3TK1 A;  3E83 A;  3B77 A;  3QNE A;  1K97 A;  3OUF A;  1FXK B;  5B3S B;  1H8H G;  2EIL C;  2IH1 C;  2QM8 A;  3DGE A;  3E8B A;  1XL6 A;  3OR6 C;  4MTF A;  3SPG A;  1QCE A;  2HVK C;  1E79 G;  1K5Q A;  3X2Q B;  1OCR C;  3ETG A;  1NQT A;  1OCC C;  3CCE V;  1GM7 A;  1H2G A;  1I5X A;  4QIW F;  4JTA B;  1TUE B;  3QO5 A;  4UV8 A;  4UVC A;  1AR1 B;  3LDD A;  1JOY A;  5IYD O;  4L87 A;  1P4R A;  1LNQ A;  4JF3 A;  4MVQ A;  4X89 A;  4G28 B;  1UJW B;  1Y4M A;  1MAB G;  3HB3 B;  5KA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...