4P2ZA

Structure of navms t207a/f214a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p2zA00
4G28B 2AHZA 3LDDA 3KG2A 3ASOC 1LNQA 4PDRA 2X6AA 4GX2A 5EC2C 3FB8C 2JK5C 4H33A 4X89A 1OCOC 2AHYA 2X6BA 3E8HA 3IFXA 2WLHA 4MVQA 2EILC 4X8AA 4GX0A 2QTOA 2A0LA 4MTOA 4R6ZA 3E86A 4PDMA 3TCUA 4QE9A 4XDKA 3SPCA 3T2MA 4MVZA 5EBLC 2W0FC 1JVMA 5EK0A 4LBEC 1R3KC 4X88A 2A79B 2HJFC 4MVMA 4WFEA 3FB7C 3LNMB 4JTAB 1R3JC 4MTGA 4JTDB 3BEHA 3T4DA 1ORQC 4P30A 1OCZC 4F4LA 2BOCC 1J95A 2R9RB 4QE7A 3K06A 4P9OA 3STLC 5KUMA 4WFFA 3ABMC 4MVOA 3IGAC 4QNHB 3SYPA 4OXSA 2BOBC 3R65A 2HFEC 4PA6A 3SYQA 2HVKC 3RVZA 3JYCA 1XL6A 4G27B 2DWEC 2Q6AA 3ASNC 2DWDC 4WFHA 4XDLA 3TETA 3OUFA 4MS2A 2HG5C 3E83A 3SPGA 3STZC 4H37A 3UKMA 3FB5C 4R7CA 4WFGA 5CBHA 3ZJZA 2YEVA 4P2ZA 2IH3C 4ZBMA 3E8FA 3SPJA 3K0DA 3SYAA 3ABKC 3K0GA 3LDEA 4GX5A 4MW8A 5EBWC 4MVRA 2H8PC 4J9ZB 2P7TC 4MVUA 1R3LC 2IH1C 3K03A 4MTFA 3E89A 1K4CC 2HVJC 3UM7A 1QLEC 4R50A 5B1BC 3RW0A 2NLJC 1XL4A 4GX1A 5CBFA 1M56C 3ABLC 4PA9A 2WLIB 3OUSA 4BW5A 2DYSC 3K04A 3LDCA 4HZ3A 4CBCA 4LP8A 1G4YB 2OCCC 3WG7C 2ITDC 1S5HC 2ZXWC 3AG1C 3PJSK 2Y69C 3AG4C 2X6CA 5BZBA 3T4ZA 4LCUC 4TWKA 3AG3C 4MSWC 4RUFA 3HPLC 5KUKA 4PA4A 4P9PA 4UUJC 5EBMC 2Q69A 3E8BA 4J9YB 2WLLB 5IY5C 3SPHA 3X2QC 4HYOA 5CBGA 2WLJA 3OR6C 5B1AC 4KFMA 1KKDA 4MVSA 2ZD9A 3SPIA 3AG2C 2WLIA 4RAIA 4RO2A 3ZRSA 1V55C 4I9WA 2DYRC 2WLNA 2Q67A 4MW3A 2EINC 2KB1A 4PDVA 2EIKC 2WLKA 1M57C 1R3IC 3VOUA 2ATKC 2ITCC 4XDJA 5E1AC 3SYOA 1V54C 3F5WC 3FB6C 3K08A 4DXWA 3EFFK 2EIMC 4R8CA 3SYCA 4EKWA 3OGCC 5EC1C 3T1CA 4PA7A 3RVYA 3LUTB 4JTCB 3SJQC 2WLLA 4PA3A 1P7BA 1ZWIC 4RUEA 1OCRC 3F7VC 5J9PC 2Q68A 2A9HA 4PDLA 1K4DC 2QKSA 3E8GA 3GB7C 3RBZA 3F7YC 5B3SC 1OCCC 1BL8A 3OR7C 2WLMA 2K1EA 2EIJC
chains in the Genus database with same CATH superfamily
4X66B 2Z0AA 5KA5A 4O4JB 1YDXA 3JD1A 1XNRB 5KA6A 4JI5O 5CA0B 5LOVB 3T2MA 4WBNB 1RPOA 1NT2B 2OTJV 2XT9A 2QR4A 1Y66A 2GTSA 4DV7O 2QJ1A 2IM9A 2QEXV 3R65A 1BMFG 1HNWO 1V9PA 4GKKB 4ZKIA 2GUZA 1PNMA 3ZMTA 3FB5C 4R7CA 2KKWA 4X1YA 3GWKC 2ZDIC 5J2UA 4UXNA 4JYAO 5CA3A 4DR5O 1R3LC 2XASA 4HBNA 1QLEC 2HHHO 3RYCB 5BXZA 1KYOF 4DV1O 2FTKA 1BGYH 5LGTA 4JI7B 1VQ7V 3CCUV 1K3EA 1Q90D 2CTRA 3ZMUA 4BR6A 4MSWC 1M93A 3KKYA 3JD2A 1WB8A 4J9YB 4DW0A 4FFKA 1PV0A 4DUZB 3ZRSA 4JPRA 5D5QA 5J2TB 1NR7A 2KB1A 3CCLV 1BS3A 1O9GA 1QLEB 2VRZA 3U0ZA 3F5WC 4BIOA 2CGOA 1JFFA 1WJZA 2UXDO 2UUAB 2MK3A 1N34B 5LXTA 3D36C 1WLEA 5IWAO 3RBZA 2A9HA 1AR4A 4I4TA 5JVDB 5LMUB 3B77A 3OR7C 2H3OA 4FK5C 4Z1VA 4F6RA 1BE3H 3FB8C 4H33A 4X89A 1MG1A 4GX0A 2A0LA 1IBMB 4PDMA 4X64B 1TAEA 4LF8O 4DR2O 1NU1H 1JOYA 4GKJB 4JTAB 1K92A 2Z3YA 1KU9A 4CH3A 2E5LB 2GDSA 1U96A 4FZ0A 5KUMA 3IGAC 4OXSA 4PA6A 1QBZA 2Z5UA 5LHHA 1FAFA 4GCZA 4YY3O 1CP9A 4JYYA 3E83A 2P67A 4I50A 3HKEB 2LO1A 4FFBB 2JEXA 1NZ6A 3J80N 3C3TA 4LH7A 1YSCA 2XOKG 1Q43A 4G2KA 3UO2A 5BMVB 2HJDA 5LMNO 3R66A 4B3SO 1NJIW 1RM1B 3E35A 3U11A 3OE7G 4JYAB 1TGOA 1WPXA 2X0LA 1N36B 3QO5A 3K5LA 4QJFB 4LFAO 3OT7A 2Q4PA 2PF4E 2HKOA 4B08A 2ZR2A 5CA1B 4F6EA 3E8BA 2WLLB 5CBGA 4LFBO 2WLIA 1ENVA 4TV8A 5B66Z 4LR3A 3MD0A 4WF9V 1N8RW 4CC6A 1HNZO 2Q73A 1H8HG 4JZGA 1JX9A 4QGPA 3SYCA 1ZLZA 4YJ2A 2WA3A 3CCJV 3JAMN 4DV6B 5H6QA 1TVKA 1Y76A 1N0NA 3OMAB 3CMEV 3BABA 5KAFZ 4BW5A 2A3QA 4G28B 3ASOC 3H1LH 2R72A 1TUBA 2AZ0A 2GUZB 4XDKA 4X1YB 1Q82W 4X1IA 5J2UB 5B1OA 2F66C 3LNMB 5LYJA 3AK3A 4I9QA 3BRCA 2Y0PA 4EB6A 1OCZC 3CCMV 1HP8A 2B5UA 4EFEA 2BOBC 4YIOA 5FPRA 4DR6O 2M6YA 2VQEO 1IDSA 3PN1A 5FL7G 1KMIZ 3W7SA 1K5SA 1N33B 5LP6A 3JD4A 3LDEA 5EIBC 4NVPA 3CC2V 1WB7A 1EN4A 2XAJA 2N05A 1XNQB 3ABKB 2OCHA 3VQVA 5L3GA 4R50A 1YIJV 3HKDA 5FPOA 1OCZB 4DR1O 1G4YB 4BWAA 1RFYA 2B9ZA 1MABG 2X6CA 1JFFB 3CC7V 3QF7A 5KUKA 5LXTB 1HWYA 1P84F 4DV4O 2C2AA 2B1GA 1X4TA 4I4TB 2X7RB 2GHYA 1V55C 2ZIOA 4BIUA 2EINC 2QKCA 2Q0OC 4F6RB 1GMGA 4FM1A 2DYRB 3CMAV 3FB6C 1VF6A 1FJGB 4JV5B 2DJVA 4B3TO 3CC4V 3DTUB 1H38A 4PI0A 3OM3B 4YJ3A 4NXNB 1AI7A 5KHHA 2QKSA 4IHJA 2Q8VA 4O4HA 4DV2B 4PJ0Z 1KQSU 4UCTA 3UQ8A 1XMQO 4MTOA 1I94O 1DF5A 3DGEA 5JJEB 5LBQA 4I50B 4TOIA 5H5NA 2A79B 1GN3A 2VS0A 4CC5A 4ZHQA 3BY6A 4DRXA 1G6UA 4TT3G 1CEZA 3RWRD 1HW7A 3VQXA 4J7KA 3APOA 4JI3O 3KCXA 1S76D 4H37A 3UKMA 4PD4F 2ZE6A 4KHPO 1K73W 3WB2A 4AHCA 4GX5A 3K9AA 1GAXA 4MVUA 4FLUA 3RW0A 2NLJC 3ABLC 1Q6UA 2WLIB 1A32A 4TV8B 1SESA 1FPOA 4HZ3A 3F5TA 2UXNA 2PUSA 1PNLA 2JGDA 3L70H 4HNAA 5IJ0A 5BZBA 1YTFB 2CAZC 4YJ2B 3HPLC 2PGGA 3B8NA 3AG4B 1TVKB 1JR9A 1P7GA 3X2QC 5B1AC 1Y76B 3D3QA 4NXMB 4RAIA 3P3PA 4JAVA 1YHQV 3W7UA 2N04A 1WP8A 3CXHF 2YSUB 1NQTA 3ABLB 2KG7A 1JMKC 1TUBB 5LP6C 2WPDG 4E4EA 3G67A 4DV4B 1B06A 1UJWB 2QSAA 1IURA 3RVYA 4X1IB 1OCRC 5LYJB 4FIPC 1K8AW 4JASA 3WB1A 4EB6B 2K1EA 2AHZA 3OGIB 3X2QB 3KG2A 5L3BA 1RPRA 2JK5C 4LF9B 4UVAA 1D5NA 2X6BA 4X8AA 4H13B 2RN9A 2EIJB 4MVQA 2HR3A 4LF4B 4X66O 1H8EG 5EBLC 1OCOB 1SC5B 2W0FC 1XNRO 1M5IA 1IBLB 5LP6B 2QKAA 3P3NA 4DO2A 2QWOB 2HP8A 3CWBH 2R9RB 5H9CA 3K06A 3SYQA 5KMGA 3NXSA 1Q6IA 1VF6C 3HKDB 3ZHTA 1VQOV 2LGQA 1XUQA 3K79A 3HR0A 4IT5A 3W7TA 1SQBH 2V4DA 2M7WA 3D3IA 1QLNA 4O4IA 3ZJZA 5KHKA 3ETQA 3SPJA 4GKKO 2XUMA 4J9ZB 2P7TC 1W59A 1VQ5V 1K4CC 3ZCCA 4LF6B 4PV1B 3RYHA 1COWG 3OAAG 1M56C 4XBFA 4DR7B 2ODMA 3HKCA 4EFBA 2RCVA 2YI8A 4LP8A 2OCCC 3K9SA 2Y0IA 3ZMSA 1BZKA 4WCEV 1YEWA 4JI7O 1BSMA 4X62B 3AG3C 3W7XA 2W6IG 2BTQA 2Y69B 1HDJA 2QDOA 4YJ3B 4RWUA 4IHJB 4O4HB 3AK2A 2XAFA 1XILA 3JD3A 1SS3A 1V54C 4DUZO 3EFFK 1M57B 4R8CA 1BHAA 2ZINA 1VQMV 3CE2A 3BAAA 2NNUA 4ZHQB 1GTOA 5JCOC 4DRXB 1SQVH 2UUAO 1N34O 1OCCC 3NR7A 4R6ZA 1T5EA 3RN4A 4X1KA 5LMUO 2E3CA 2P6JA 3T1HB 3LSSA 3TCUA 3SJAC 3KZIZ 3H1IH 5EK0A 1Q86W 2P4KA 3CEIA 4J42A 1PL4A 1NI8A 4JTDB 4X20B 3T4DA 4X64O 3OFNG 2PY5A 1LR1A 2EX3A 3OTOB 2Y48A 2QE7G 1AR1B 4GKJO 5IT9N 1Q8IA 2E5LO 3C90A 1EFRG 1OCCB 2V1DA 1I7FA 3B4SA 1QHTA 5IJ9A 3HB3B 4HNAB 4ZBMA 1B04A 5IJ0B 5EBWC 3J7AU 3J81N 1FKAO 5K1XA 2CGNA 2HLDG 4PHZA 3SGIA 5IE9A 1XBLA 4OGQB 3E2EA 2NN4A 4TSFG 3B8MA 2IU3A 3OUSA 1TA8A 5CN0A 2LQTA 2KG7B 4NR1A 3VBBA 1PM9A 2Q5ZA 4ZIBA 3JCUZ 2DMXA 3L72H 3AG1B 1E79G 4P9PA 4UUJC 1KUQA 2GTAA 1N36O 2WLJA 1PD3A 1U97A 3LSQA 4FLTA 4JYCA 1R73A 2PZSA 2YIBD 2CH7A 2ARHA 3WB0A 4JI4B 2EIMB 1UPGA 2F4VB 3RFRA 1HNXB 2H94A 4DV6O 1K5QA 3G6BA 5KMGB 2YI9A 5EC2C 3ZHRA 4NTYA 4N23A 5DN6G 4NYKA 4L87A 3I5DA 4MVZA 1AJQA 4O4IB 2GV9A 2CTQA 1DTOA 1L0LH 4DV0B 1NR1A 1WN7A 4LWSA 1Z2GA 4F4LA 1WNSA 2Q9LA 3RYHB 3CSXA 4FLYA 5JJNB 3TGUH 5K1PA 3HKCB 1OV9A 3OTFA 4WFHA 2ZE7A 2HG5C 4DR3B 4WFGA 3ZIAG 1AILA 1MSWD 3P32A 2XAHA 2BTQB 1DF4A 4OPHA 1VQNV 2IH1C 4I55A 2A7WA 2JRIA 1E1QG 4W4LA 1N33O 4C7UA 1XL4A 1RM1C 1E1RG 1XNQO 5KAIZ 4LF5B 3IC9A 4CBCA 4KL1A 2W6JG 4K8XA 3T4ZA 2F93B 5LA6A 2BTOA 3E22A 1VQ9V 4D7SA 5HFLA 2Q69A 2LFRA 1JA8A 1Q3EA 2ILMA 3B40A 2QA4V 3IJ4A 5KHJA 4X1KB 4JI1B 1IVSA 1JPXA 4CS2A 2Y4TA 5EC1C 1K34A 3WFVA 3UT5A 3OMIB 5KHIA 4K35A 2VQFB 4RUEA 5TISZ 3F7VC 3C3SA 4MT8A 2JVDA 4JV5O 1FJGO 1BQZA 2EZPA 3D8CA 4YHHB 5KX5A 4NXNO 1S77D 1IX9A 4TUYA 4JI0B 4CH6A 2IJJA 1SRYA 5JQGA 1MZEA 3K57A 4DV2O 2OT5A 2YICA 5IJ9B 3ZRVA 3M7MX 1EBOA 1R3JC 3BEHA 3CRRA 1YF2A 1I08A 2D3OW 4GYCB 4NB5A 3OUFA 1G1XB 1ZUQA 3I55V 1GN4A 3ABKC 3O9OA 1OZ0A 4MVRA 2YXHA 5DECA 4KXRA 2UXBB 2EJRA 1P4RA 1J5EB 3L9DA 4UVBA 3UM7A 5FLXN 2R9IA 1O9HA 4HAMA 4JF3A 5LGUA 1MNGA 2VWJA 1PNKA 4NTXA 3M99B 2JGUA 2CH7B 5HFMA 5LHIA 4U7OA 2E75B 4TWKA 5DM6V 1Y74A 2O57A 3RYIA 2RDCA 3DC5A 3CXCU 2DYRC 4MW3A 3T1YB 1JQ0A 2EZOA 3S3WA 4NXMO 3L71H 3BHPA 4WFAV 2RNBA 3T1CA 4X65B 4CH4A 1HR0B 4QPKA 1KB9F 1ZWIC 3IC7A 5GTHZ 4J10A 4LWSB 1BL8A 2L35A 2ETNA 1NBMG 1Z5VA 5EZYA 1N4CA 2ZM6B 1VQPV 3FD9A 1QCEA 4CS3A 4FLVA 4LF9O 1DK1A 4LF4O 3JAWA 5JJJB 4I7ZB 4I55B 1IBLO 3QG5A 1IXMA 3K5OA 3ZRXA 3ASNC 2Q6AA 3CB2A 1S3JA 2WSSG 1AR5A 1PP9H 2FL4A 1MMMA 3CS5A 3L73H 2JJ2G 1KC8W 1QR8A 2YEVA 4JI6O 1AROP 2IJKA 5C8YA 3SYAA 1QVFU 3B09A 5LA6B 4AI8A 1WPBA 2OWOA 3E22B 3L74H 2YIBA 4FLWA 4GX1A 2AXTZ 3AEIA 5L3EA 2XTAA 3JCZA 1ZX3A 3RT3C 4LF6O 2JEUA 5B5EZ 3JALA 3AG4C 1MSDA 3ASNB 1AVMA 3CD6V 4DR7O 3A0BZ 1LUVA 4D6TH 3UT5B 1BT8A 1I5YA 3SR2C 1AI5A 3SPHA 2P5OA 3JD0A 4KFMA 1XQ8A 2ZD9A 1GH6A 1EN6A 4X62O 3SPIA 3QO7A 1GN2A 3A0HZ 4RO2A 5KX5B 3Q4HA 1YITV 1R3IC 1WAZA 2CK3G 3AG2B 4TUYB 1IXBA 3OEEG 4U7NA 5JQGB 1M90W 4DK0A 2ZIMA 2MW2B 4H44B 1IBKO 1NS1A 4W4KA 4PDLA 3GB7C 1ROPA 1I5XA 3TXSA 3I56V 1N32B 1XHZA 2WLMA 2EIJC 2NR5A 1YXBA 4N21A 2UUBB 1OCOC 4DYLA 2P06A 2R9AA 5EIBD 3G4SV 1VQ4V 2BCCH 1K7DA 4DV3B 1JVMA 3T1HO 2G38A 1NTMH 3SDLA 4FLZA 2DQ3A 1NTZH 3STLC 3ZRWA 2HFEC 3K3WA 3ZS8C 1XL6A 4JAAA 3OTOO 4XDLA 1L1FA 4U3FH 2CUGA 4U3JA 1DGSA 1CPYA 3K5MA 2ADQB 1FXKA 1EZJA 4FZ1A 1AJPA 1Y74B 3FAVA 4GT1A 1SZTA 1I0HA 3RYFA 2P90A 4Z1MG 3BA8A 3K03A 4MTFA 3E89A 2HVJC 3RYIB 4CZZA 1SQQH 4BW9A 5IYZA 5B1BB 4JI6B 2IJHA 3OMNB 3N2KA 2Y69C 4TQDA 4PA4A 2ZDIA 4MVSA 1ZAUA 3UCSC 1D5AA 3N2GA 1W0JG 1Z5WA 1KBHA 4UFZA 1M57C 3ZHSA 4DV5B 4AQYB 1H2LA 3MAQA 4XDJA 5EZYB 3KCYA 3A8TA 4BIZA 1FYJA 2KSDA 1W2BU 3ZMVA 5CB4A 5GONA 1VQKV 2OIEA 3JAWB 1VF5B 1SQFA 4JI4O 3H1HH 2JJ1G 4Q20A 3LDDA 3JATA 2F4VO 2YIAA 1YJWV 1OJHA 1JJOA 3GWOA 4Q6GA 3MHSC 1HNXO 3E8HA 1XI1A 3CJHA 1CXZB 3E86A 1IBKB 3JSNA 4GUNA 1F7YA 3DSQA 2EILB 4J80A 2YEVB 2FMLA 2ZNJA 1H2MA 1B6QA 5C8YB 1SA0A 3TK1A 4JI2B 3H1JH 1ZSPA 3D36A 4J11A 1GRJA 1G8MA 4E2LA 4MVOA 5EYPA 4DV0O 1YCIA 1ZTEA 2W0XA 2R70A 3A2FA 2DWDC 2P22C 2LJ2A 4FFBA 2QM4A 4K3AA 2IU0A 4UV9A 1SQPH 4P2ZA 1EN5A 3JALB 4B3RB 1QQCA 2LW7A 2ZT9B 2UXXA 4DR3O 3TXQA 2E76B 2XNDG 3L75H 1AB3A 1VQ6V 1XMOB 3LDCA 3Q4HB 3APQA 1K33A 1RSOA 2UUCB 4IIJA 2ZXWC 3AG1C 1M4UA 1R6TA 4FJCC 1BQ0A 2F1MA 2JGDB 4LF5O 4LNUA 2BE3A 3K59A 4HYOA 2YXYA 5IYCO 1Q7YW 4KP4A 4KUMA 1KD1W 4LC1A 2EIKC 4LFCB 2ITCC 1YI2V 1FXKC 1GKFA 2F23A 3OEHG 4ICGA 2EIMC 4K8ZA 1THZA 3SJQC 4JI1O 2ZXWB 3CRMA 1K4DC 1PPJH 3JARA 4B7KA 3SJBC 3ZRWB 5L3CA 2VQFO 2RQ6A 2ZE5A 5B1NA 2AHYA 3CX5F 3IFXA 3JSLA 4YHHO 3CCRV 2ZR3A 4QE9A 4U3JB 2EIKB 1YZBA 2YDEA 3JAKA 2DW4A 1WA8A 4JI0O 2HJFC 1FXKB 3FB7C 3BFRA 2XAQA 3CRQA 3QTCA 4FM0A 4DUYO 1UFIA 3FAVB 1ORQC 2OIGA 5BR8B 4K0KB 3RYFB 1J95A 4WFFA 4QNHB 4AILC 2FKXA 4JI8B 1Y67A 2B1IA 2HVKC 3ZHUA 4BAYA 1XHXA 5IYZB 1QR9A 4ZOLA 2OTLV 4MS2A 3SPGA 3QNEA 5H2FZ 3N2KB 3FKSG 2IBZH 3DC6A 3CP1A 4TV9A 2E74B 4FVMA 3P30A 4GZRB 3ETEA 4NKGB 4UB6Z 4LF7B 5GTIZ 3H01A 2AZ2A 5LL6Y 2UXBO 3HKBA 3N2GB 1J5EO 4UCRA 1S72V 3ABUA 1XDCA 4ABMA 2WAMA 1GM7A 5H6RA 1F23A 1NKDA 4B7EA 5CB4B 2JS5A 5EBMC 3K5NA 5GONB 4DR4B 4RQFA 4O2BA 4UCSA 2WLNA 2PI5A 4B3MB 2UU9B 3RGBA 3JATB 2WLKA 3ZN0A 4YIPA 1MOFA 3K08A 2ADPA 3CJHB 4EKWA 3T1YO 4O4LA 3U10A 4PA7A 4PA3A 2OYQA 1SA0B 5J9PC 2PTMA 4UCVA 5C93A 3F7YC 4MTXA 1ZL8A 4X65O 4JI5B 1HR0O 5EYPB 4NTWA 1L0NH 1H2SB 2AW9A 5GW7A 2EJ7A 2QTOA 5IDJA 3CCSV 4FLXA 4DV7B 2AGAA 1XEQA 2DE0X 1R3KC 2ZM6O 1PKXA 2XAGA 1HNWB 3B2EE 1JJ2U 3TJTA 5FNVA 1R6KA 4OPAA 3RVZA 4G27B 2LGWA 2DWEC 1KKCA 2EULA 3STZC 1RSOB 5F2VO 4DR5B 4IIJB 4DUYB 3IAYA 3AG7A 2HHHB 1SETA 1KP3A 1YVWA 4MW8A 4LNUB 4DV1B 1RP3B 4IGGA 1AJNA 1B3QA 3BA9A 2ZCEA 3FFQA 5KLVH 4PA9A 4CH5A 2ZNIA 4UCOA 2CTWA 3EHBB 3ICXA 4J7ZA 4DW1A 1H2GA 2PYLA 3K04A 1SZXA 3SJCC 3WG7C 5DEDA 2ITDC 1W0KG 1S5HC 3THOA 2Q7GA 1MZFA 2K9PA 1H2NA 4OX9O 2IW5A 4X9QA 1KECA 2JS3A 5IY5C 3OR6C 4ZI7A 4QPJA 3CCQV 3JARB 1FXVA 4I9WA 1AI6A 2UXDB 1EM1A 3S3XA 4PDVA 2ATKC 5LHGA 5E1AC 5IWAB 5JH7A 1SKVA 1L8DA 1Q6HA 1NVPB 3UO3A 3WG7B 4DK1A 3JAKB 1WA8B 5KHGA 1S0VA 2Q68A 2JIZG 2PI4A 2YS8A 2YUAA 5B3SC 1K97A 1S5JA 1R6NA 1SF9A 4L8JA 5IY5B 4LF8B 4H0LB 4DR2B 5D5PA 4ZOLB 1N32O 2F43G 3ASOB 4QIWF 3SPCA 2ZKOA 1VQLV 3JASA 2UUBO 4MVMA 2QWPB 4MTGA 3K58A 2QM7A 1NTKH 4TV9B 1VF7A 4YXWG 2BOCC 4DV3O 4IYIA 4YY3B 3ABMC 1F4MA 1N0JA 1M1KW 3CRAA 5E79Z 4FPPA 3OD4A 1R1BA 1NH2B 3HKBB 5B3SB 5CMUA 2Y4UA 2QWQB 3ZX6A 4RQEA 2QGNA 5LMNB 3E8FA 1H2KA 3K0GA 4B3SB 1VMGA 3G6EV 3CCEV 3DXRA 2WA4A 1F51A 1YJNV 3W7WA 4O2BB 1VQ8V 4LFAB 4EEQA 1Y6XA 1FFTB 4I5SA 2DYSC 3ABMB 1SQXH 4J7JA 2GBOA 3CCVV 4LFBB 3ZMZA 4UB8Z 1XOUA 4O4LB 1TUEB 2KQXA 2IJIA 1KKDA 3MDSA 2DQ0A 1GO3F 1HNZB 4JAUA 1AP6A 1F4NA 3AG2C 3ZHVA 1ZL8B 1NVPD 2Q67A 2ZQMA 2WWWA 2F95B 3ETGA 4OX9B 3VOUA 2BSKA 4O2AA 1V55B 2P4VA 4DXWA 2EINB 2CDYA 2YIDA 2DYSB 4DV5O 4AQYO 1GN6A 3OW2U 3WU2Z 4JTCB 5ITZA 1BCCH 3BPZA 3E8GA 4Z2WA 1WP7A 2GSMB 5FNVB 2X6AA 1XREA 2WLHA 4I0XA 2Q7HA 2HEPA 4PI2A 2Q7EA 2YXLA 3QVNA 1DLBA 2CE4A 2PYJA 4X88A 3M8AA 4WFEA 4X20A 3ZEDA 1NH2D 3ML0A 1QVGU 5L3DA 1FFXA 5LGNA 4DR6B 4P30A 4WFBV 5JWPA 4TQFA 1SERA 1AP5A 4QE7A 1S5LZ 2D2CB 5JCOA 2VQEB 3SYPA 4O4JA 2QTSA 4JI2O 1Q81W 3CPWU 1SQGA 2UXCO 3G80A 5CA0A 5LOVA 4WBNA 3ZBHA 3FYIB 2DOSA 1AI4A 3ETDA 3VQWA 2RJZA 2L6LA 1X59A 3K0DA 1KP2A 3CRCA 2H8PC 1YJ9V 4DR1B 3GVMA 3FX7A 5B1BC 4B3RO 4ZI7B 3ABTA 4JZ2A 1US6A 3AK1A 3A0RA 5L3FA 1GK9A 2YC0A 3CHXA 4UCUA 5JH7B 4A5UB 5IYBO 1XMOO 4D7TA 2FB5A 3MHHC 4RUFA 2FYUH 2QWRB 2JDIG 2UUCO 1FXHA 3RYCA 3CYOA 2DN9A 1FD9A 5A2QN 1EZVH 5B1AB 4B3TB 1QNMA 1MA1A 1Q5OA 1JCHA 1IZ3A 4LFCO 3JASB 1P7BA 4LH6A 2N74A 4JYBA 2EBOA 1XMQB 1OCRB 4UV8A 5J2TA 1I94B 1LNQA 4PDRA 4GX2A 4PELA 4GLXA 1D2DA 2EILC 1URFA 2QWNB 3QO8A 3H9VA 5IYDO 2RMKB 1FS0G 4LBEC 4UVCA 1OHHG 5JVDA 4JI3B 1VP7A 3DXRB 4P9OA 4J41A 1YTFD 4JGSA 3ZN1A 4FM2A 3JYCA 5A9GA 4KHPB 5BR8O 4K0KO 3TETA 2LP7A 4IYHA 2LFSA 3FYEB 5CBHA 4JI8O 2IH3C 1K9MW 2VWKA 3VQYA 2V7QG 2UXCB 2A06H 5CBFA 4FMTA 3ZHQA 1M9NA 3BCCH 1M56B 2BSKB 3H1KH 4O2AB 4LF7O 3HKEA 3PJSK 3O65A 2OCCB 2ZE8A 4LCUC 1PL0A 5BMVA 2CTPA 5ITZB 3AG3B 1GM8A 1LUWA 1BHBA 2XHBA 3EVKA 1P49A 4ASUG 1QU7A 4IL6Z 4DR4O 3EXAA 3BVOA 3LSUA 3SYOA 2LW1A 4I0XB 5AG2A 2QM8A 1VIBA 3OGCC 2UU9O 4B3MO 5CA1A 4CS4A 1V54B 3LUTB 2WLLA 1Y4MA 1IBMO 1VEWA 1GM9A 3N27A 1FFXB 5BY1A 3LNNA 2Q0AA 1VARA 3G71V
chains in the Genus database with same CATH topology
1NBMG 2AHZA 5KA5A 3X2QB 3KG2A 5L3BA 1RPRA 2JK5C 3JD1A 4UVAA 5GW7A 2X6BA 4X8AA 1VQPV 4MVQA 5KA6A 2EIJB 2HR3A 1QCEA 2QTOA 5IDJA 3CCSV 3T2MA 1H8EG 5EBLC 1OCOB 2W0FC 1RPOA 1R3KC 1PKXA 2OTJV 2XAGA 1Y66A 4DO2A 2R9RB 5H9CA 3K06A 2QEXV 3SYQA 3R65A 1JJ2U 1BMFG 1R6KA 3NXSA 1IXMA 3RVZA 4G27B 3ZRXA 1VQOV 4ZKIA 2DWEC 2Q6AA 3ASNC 1PNMA 3K79A 3W7TA 1S3JA 3ZMTA 2WSSG 3STZC 2M7WA 3D3IA 2JJ2G 3FB5C 4R7CA 1QLNA 1KC8W 1QR8A 3ZJZA 2YEVA 1SETA 1KP3A 2ZDIC 1AROP 2IJKA 3SPJA 4UXNA 3SYAA 4MW8A 1QVFU 5CA3A 4J9ZB 2P7TC 1VQ5V 1R3LC 1AJNA 2XASA 1K4CC 3ZCCA 1QLEC 1COWG 4GX1A 3OAAG 1M56C 3AEIA 4PA9A 4XBFA 5L3EA 3EHBB 2FTKA 5LGTA 1H2GA 3JCZA 3K04A 4LP8A 2OCCC 3WG7C 1VQ7V 3CCUV 1K3EA 2ITDC 1W0KG 1S5HC 2JEUA 3ZMSA 3ZMUA 3AG4C 4WCEV 2IW5A 3ASNB 3CD6V 3AG3C 4MSWC 3W7XA 2W6IG 2Y69B 1KECA 1I5YA 3JD2A 1AI5A 4J9YB 5IY5C 3SPHA 3JD0A 3OR6C 4KFMA 4QPJA 3CCQV 2ZD9A 3SPIA 3QO7A 4RO2A 3ZRSA 1FXVA 4I9WA 4JPRA 1AI6A 1NR7A 2KB1A 4PDVA 3CCLV 1QLEB 1YITV 1R3IC 2CK3G 2XAFA 2ATKC 3AG2B 3JD3A 5LHGA 5E1AC 1V54C 3F5WC 3EFFK 3OEEG 4U7NA 1M57B 4R8CA 1BHAA 1M90W 1VQMV 1NVPB 2MK3A 3WG7B 1WLEA 2NNUA 1S0VA 1GTOA 2Q68A 2A9HA 2JIZG 4PDLA 3GB7C 3RBZA 2PI4A 1ROPA 5B3SC 1I5XA 3I56V 3B77A 1OCCC 4R6ZA 3OR7C 2WLMA 2EIJC 1K97A 4FK5C 1R6NA 5IY5B 4N21A 3FB8C 4H33A 4X89A 1OCOC 1MG1A 2P6JA 4GX0A 3G4SV 1VQ4V 2F43G 3LSSA 2A0LA 3ASOB 4QIWF 4PDMA 3TCUA 3SPCA 1K7DA 1VQLV 1JVMA 5EK0A 1Q86W 4MVMA 1JOYA 4JTAB 1K92A 2Z3YA 4MTGA 4JTDB 2QM7A 3T4DA 2DQ3A 3OFNG 4YXWG 2BOCC 3STLC 3ZRWA 2Y48A 5KUMA 3ABMC 1F4MA 3IGAC 2QE7G 4OXSA 1AR1B 1M1KW 2HFEC 3K3WA 4PA6A 4FPPA 1QBZA 1NH2B 2Z5UA 1XL6A 1EFRG 5B3SB 5LHHA 1OCCB 2V1DA 4XDLA 4GCZA 1CP9A 1L1FA 3E83A 5CMUA 1CPYA 2P67A 3HB3B 4RQEA 2JEXA 4ZBMA 3E8FA 1FXKA 1EZJA 3K0GA 5EBWC 1AJPA 1YSCA 3G6EV 2XOKG 4G2KA 4GT1A 1SZTA 3CCEV 2HLDG 2P90A 3K03A 4Z1MG 1F51A 3E89A 2HVJC 4MTFA 1YJNV 3E2EA 4CZZA 3W7WA 4TSFG 3B8MA 2IU3A 1VQ8V 3OUSA 1NJIW 4I5SA 1FFTB 5B1BB 5CN0A 2DYSC 1RM1B 3ABMB 3E35A 3OE7G 2IJHA 1WPXA 2X0LA 3QO5A 4QJFB 3OMNB 2Y69C 3VBBA 3CCVV 3ZMZA 2HKOA 2ZR2A 3AG1B 1TUEB 1E79G 4PA4A 2ZDIA 4P9PA 4UUJC 3E8BA 2WLLB 2IJIA 5CBGA 2WLJA 1KKDA 2DQ0A 1PD3A 4MVSA 1GO3F 4JAUA 1F4NA 3LSQA 3AG2C 2WLIA 1ENVA 4JYCA 1R73A 1NVPD 2Q67A 2ZQMA 1W0JG 2WWWA 3ETGA 3MD0A 1M57C 4WF9V 3VOUA 1N8RW 1V55B 4XDJA 1H8HG 4DXWA 2EINB 4BIZA 1JX9A 3SYCA 1W2BU 2DYSB 3ZMVA 3CCJV 5H6QA 3OW2U 4JTCB 2EIMB 1VQKV 3E8GA 3OMAB 2H94A 1K5QA 3CMEV 2JJ1G 4Q20A 4BW5A 4G28B 3LDDA 2GSMB 3ASOC 5EC2C 2X6AA 3GWOA 1YJWV 3MHSC 3E8HA 2WLHA 4N23A 5DN6G 4L87A 3E86A 4XDKA 4MVZA 1DLBA 1AJQA 2EILB 2YEVB 4X88A 1Q82W 1DTOA 4WFEA 5B1OA 1B6QA 1NH2D 3LNMB 3ML0A 1QVGU 5L3DA 3TK1A 1NR1A 5LGNA 4P30A 3D36A 1OCZC 4WFBV 4F4LA 3CCMV 1SERA 4QE7A 1G8MA 4E2LA 4MVOA 2B5UA 3SYPA 2BOBC 1Q81W 3CPWU 2DWDC 4WFHA 2HG5C 3FYIB 4WFGA 5FL7G 3W7SA 2IU0A 4P2ZA 1AI4A 3ETDA 4UV9A 3ZIAG 1K5SA 1MSWD 3K0DA 3JD4A 3LDEA 1KP2A 3P32A 3CC2V 2XAJA 2UXXA 2H8PC 2XAHA 1YJ9V 1DF4A 1VQNV 2IH1C 3ABKB 5L3GA 1E1QG 2XNDG 4R50A 5B1BC 1XL4A 3ABTA 1YIJV 1RM1C 1OCZB 1E1RG 1VQ6V 3LDCA 4CBCA 1G4YB 1K33A 2ZXWC 3A0RA 3AG1C 5L3FA 4FJCC 1GK9A 1MABG 2W6JG 2X6CA 3T4ZA 5IYBO 3MHHC 4RUFA 1VQ9V 3CC7V 5KUKA 5HFLA 2JDIG 2Q69A 1HWYA 1FXHA 2C2AA 2LFRA 4HYOA 2B1GA 5IYCO 1Q7YW 3CYOA 4KP4A 2X7RB 2GHYA 4KUMA 1KD1W 1V55C 5B1AB 4LC1A 4BIUA 2EINC 2QA4V 2EIKC 1GMGA 2ITCC 2DYRB 3CMAV 1FXKC 3FB6C 1GKFA 1YI2V 1JPXA 1JCHA 3OEHG 2EIMC 5EC1C 1K34A 3CC4V 3DTUB 1THZA 3WFVA 1H38A 3OMIB 3OM3B 3SJQC 2ZXWB 1P7BA 4RUEA 1AI7A 3F7VC 4MT8A 1K4DC 2QKSA 4JYBA 2EBOA 2EZPA 1OCRB 4UV8A 3ZRWB 5L3CA 1LNQA 4PDRA 1S77D 4GX2A 4PELA 5B1NA 1KQSU 2AHYA 3IFXA 2EILC 2IJJA 3CCRV 3QO8A 1SRYA 4MTOA 2ZR3A 4QE9A 1DF5A 3DGEA 5IYDO 2EIKB 2OT5A 1FS0G 5LBQA 2DW4A 3ZRVA 4LBEC 2A79B 2HJFC 1FXKB 1EBOA 3FB7C 2XAQA 3BY6A 4UVCA 1OHHG 1R3JC 3BEHA 1ORQC 4TT3G 1CEZA 1J95A 4P9OA 4WFFA 4QNHB 1YTFD 4JGSA 3ZN1A 2B1IA 2D3OW 2HVKC 3JYCA 4BAYA 1QR9A 3TETA 2OTLV 2LP7A 3OUFA 4MS2A 1S76D 3SPGA 4H37A 3UKMA 2LFSA 3QNEA 3FYEB 5CBHA 2IH3C 1K73W 3FKSG 3I55V 1K9MW 3ABKC 4GX5A 1OZ0A 3K9AA 3CP1A 4MVRA 2EJRA 4MVUA 2V7QG 1P4RA 3P30A 3ETEA 4UVBA 3UM7A 3RW0A 2NLJC 5CBFA 3ABLC 3H01A 2R9IA 4FMTA 2WLIB 4HAMA 4JF3A 5LGUA 1S72V 1M9NA 1SESA 3ABUA 4HZ3A 1M56B 1PNKA 2UXNA 2WAMA 1GM7A 3M99B 1PNLA 3PJSK 5H6RA 5HFMA 1F23A 2OCCB 5LHIA 4U7OA 5BZBA 4LCUC 1YTFB 1NKDA 4TWKA 5DM6V 1PL0A 3HPLC 3B8NA 5EBMC 3AG4B 3X2QC 5B1AC 3AG3B 1GM8A 4RQFA 1BHBA 4RAIA 3CXCU 2DYRC 2WLNA 4ASUG 4MW3A 2PI5A 4JAVA 1YHQV 1JQ0A 2EZOA 3W7UA 2WLKA 2YSUB 1NQTA 3ZN0A 3ABLB 3SYOA 1MOFA 3K08A 2WPDG 2QM8A 4EKWA 3OGCC 4WFAV 1UJWB 3T1CA 1V54B 4PA7A 3RVYA 3LUTB 4QPKA 2WLLA 1Y4MA 4PA3A 1ZWIC 1OCRC 3IC7A 1GM9A 5J9PC 4FIPC 1K8AW 4JASA 5C93A 3F7YC 4MTXA 1BL8A 3G71V 2K1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G28 B;  2AHZ A;  3LDD A;  3KG2 A;  3ASO C;  1LNQ A;  4PDR A;  2X6A A;  4GX2 A;  5EC2 C;  3FB8 C;  2JK5 C;  4H33 A;  4X89 A;  1OCO C;  2AHY A;  2X6B A;  3E8H A;  3IFX A;  2WLH A;  4MVQ A;  2EIL C;  4X8A A;  4GX0 A;  2QTO A;  2A0L A;  4MTO A;  4R6Z A;  3E86 A;  4PDM A;  3TCU A;  4QE9 A;  4XDK A;  3SPC A;  3T2M A;  4MVZ A;  5EBL C;  2W0F C;  1JVM A;  5EK0 A;  4LBE C;  1R3K C;  4X88 A;  2A79 B;  2HJF C;  4MVM A;  4WFE A;  3FB7 C;  3LNM B;  4JTA B;  1R3J C;  4MTG A;  4JTD B;  3BEH A;  3T4D A;  1ORQ C;  4P30 A;  1OCZ C;  4F4L A;  2BOC C;  1J95 A;  2R9R B;  4QE7 A;  3K06 A;  4P9O A;  3STL C;  5KUM A;  4WFF A;  3ABM C;  4MVO A;  3IGA C;  4QNH B;  3SYP A;  4OXS A;  2BOB C;  3R65 A;  2HFE C;  4PA6 A;  3SYQ A;  2HVK C;  3RVZ A;  3JYC A;  1XL6 A;  4G27 B;  2DWE C;  2Q6A A;  3ASN C;  2DWD C;  4WFH A;  4XDL A;  3TET A;  3OUF A;  4MS2 A;  2HG5 C;  3E83 A;  3SPG A;  3STZ C;  4H37 A;  3UKM A;  3FB5 C;  4R7C A;  4WFG A;  5CBH A;  3ZJZ A;  2YEV A;  4P2Z A;  2IH3 C;  4ZBM A;  3E8F A;  3SPJ A;  3K0D A;  3SYA A;  3ABK C;  3K0G A;  3LDE A;  4GX5 A;  4MW8 A;  5EBW C;  4MVR A;  2H8P C;  4J9Z B;  2P7T C;  4MVU A;  1R3L C;  2IH1 C;  3K03 A;  4MTF A;  3E89 A;  1K4C C;  2HVJ C;  3UM7 A;  1QLE C;  4R50 A;  5B1B C;  3RW0 A;  2NLJ C;  1XL4 A;  4GX1 A;  5CBF A;  1M56 C;  3ABL C;  4PA9 A;  2WLI B;  3OUS A;  4BW5 A;  2DYS C;  3K04 A;  3LDC A;  4HZ3 A;  4CBC A;  4LP8 A;  1G4Y B;  2OCC C;  3WG7 C;  2ITD C;  1S5H C;  2ZXW C;  3AG1 C;  3PJS K;  2Y69 C;  3AG4 C;  2X6C A;  5BZB A;  3T4Z A;  4LCU C;  4TWK A;  3AG3 C;  4MSW C;  4RUF A;  3HPL C;  5KUK A;  4PA4 A;  4P9P A;  4UUJ C;  5EBM C;  2Q69 A;  3E8B A;  4J9Y B;  2WLL B;  5IY5 C;  3SPH A;  3X2Q C;  4HYO A;  5CBG A;  2WLJ A;  3OR6 C;  5B1A C;  4KFM A;  1KKD A;  4MVS A;  2ZD9 A;  3SPI A;  3AG2 C;  2WLI A;  4RAI A;  4RO2 A;  3ZRS A;  1V55 C;  4I9W A;  2DYR C;  2WLN A;  2Q67 A;  4MW3 A;  2EIN C;  2KB1 A;  4PDV A;  2EIK C;  2WLK A;  1M57 C;  1R3I C;  3VOU A;  2ATK C;  2ITC C;  4XDJ A;  5E1A C;  3SYO A;  1V54 C;  3F5W C;  3FB6 C;  3K08 A;  4DXW A;  3EFF K;  2EIM C;  4R8C A;  3SYC A;  4EKW A;  3OGC C;  5EC1 C;  3T1C A;  4PA7 A;  3RVY A;  3LUT B;  4JTC B;  3SJQ C;  2WLL A;  4PA3 A;  1P7B A;  1ZWI C;  4RUE A;  1OCR C;  3F7V C;  5J9P C;  2Q68 A;  2A9H A;  4PDL A;  1K4D C;  2QKS A;  3E8G A;  3GB7 C;  3RBZ A;  3F7Y C;  5B3S C;  1OCC C;  1BL8 A;  3OR7 C;  2WLM A;  2K1E A;  2EIJ C; 
#chains in the Genus database with same CATH topology
 4X66 B;  2Z0A A;  5KA5 A;  4O4J B;  1YDX A;  3JD1 A;  1XNR B;  5KA6 A;  4JI5 O;  5CA0 B;  5LOV B;  3T2M A;  4WBN B;  1RPO A;  1NT2 B;  2OTJ V;  2XT9 A;  2QR4 A;  1Y66 A;  2GTS A;  4DV7 O;  2QJ1 A;  2IM9 A;  2QEX V;  3R65 A;  1BMF G;  1HNW O;  1V9P A;  4GKK B;  4ZKI A;  2GUZ A;  1PNM A;  3ZMT A;  3FB5 C;  4R7C A;  2KKW A;  4X1Y A;  3GWK C;  2ZDI C;  5J2U A;  4UXN A;  4JYA O;  5CA3 A;  4DR5 O;  1R3L C;  2XAS A;  4HBN A;  1QLE C;  2HHH O;  3RYC B;  5BXZ A;  1KYO F;  4DV1 O;  2FTK A;  1BGY H;  5LGT A;  4JI7 B;  1VQ7 V;  3CCU V;  1K3E A;  1Q90 D;  2CTR A;  3ZMU A;  4BR6 A;  4MSW C;  1M93 A;  3KKY A;  3JD2 A;  1WB8 A;  4J9Y B;  4DW0 A;  4FFK A;  1PV0 A;  4DUZ B;  3ZRS A;  4JPR A;  5D5Q A;  5J2T B;  1NR7 A;  2KB1 A;  3CCL V;  1BS3 A;  1O9G A;  1QLE B;  2VRZ A;  3U0Z A;  3F5W C;  4BIO A;  2CGO A;  1JFF A;  1WJZ A;  2UXD O;  2UUA B;  2MK3 A;  1N34 B;  5LXT A;  3D36 C;  1WLE A;  5IWA O;  3RBZ A;  2A9H A;  1AR4 A;  4I4T A;  5JVD B;  5LMU B;  3B77 A;  3OR7 C;  2H3O A;  4FK5 C;  4Z1V A;  4F6R A;  1BE3 H;  3FB8 C;  4H33 A;  4X89 A;  1MG1 A;  4GX0 A;  2A0L A;  1IBM B;  4PDM A;  4X64 B;  1TAE A;  4LF8 O;  4DR2 O;  1NU1 H;  1JOY A;  4GKJ B;  4JTA B;  1K92 A;  2Z3Y A;  1KU9 A;  4CH3 A;  2E5L B;  2GDS A;  1U96 A;  4FZ0 A;  5KUM A;  3IGA C;  4OXS A;  4PA6 A;  1QBZ A;  2Z5U A;  5LHH A;  1FAF A;  4GCZ A;  4YY3 O;  1CP9 A;  4JYY A;  3E83 A;  2P67 A;  4I50 A;  3HKE B;  2LO1 A;  4FFB B;  2JEX A;  1NZ6 A;  3J80 N;  3C3T A;  4LH7 A;  1YSC A;  2XOK G;  1Q43 A;  4G2K A;  3UO2 A;  5BMV B;  2HJD A;  5LMN O;  3R66 A;  4B3S O;  1NJI W;  1RM1 B;  3E35 A;  3U11 A;  3OE7 G;  4JYA B;  1TGO A;  1WPX A;  2X0L A;  1N36 B;  3QO5 A;  3K5L A;  4QJF B;  4LFA O;  3OT7 A;  2Q4P A;  2PF4 E;  2HKO A;  4B08 A;  2ZR2 A;  5CA1 B;  4F6E A;  3E8B A;  2WLL B;  5CBG A;  4LFB O;  2WLI A;  1ENV A;  4TV8 A;  5B66 Z;  4LR3 A;  3MD0 A;  4WF9 V;  1N8R W;  4CC6 A;  1HNZ O;  2Q73 A;  1H8H G;  4JZG A;  1JX9 A;  4QGP A;  3SYC A;  1ZLZ A;  4YJ2 A;  2WA3 A;  3CCJ V;  3JAM N;  4DV6 B;  5H6Q A;  1TVK A;  1Y76 A;  1N0N A;  3OMA B;  3CME V;  3BAB A;  5KAF Z;  4BW5 A;  2A3Q A;  4G28 B;  3ASO C;  3H1L H;  2R72 A;  1TUB A;  2AZ0 A;  2GUZ B;  4XDK A;  4X1Y B;  1Q82 W;  4X1I A;  5J2U B;  5B1O A;  2F66 C;  3LNM B;  5LYJ A;  3AK3 A;  4I9Q A;  3BRC A;  2Y0P A;  4EB6 A;  1OCZ C;  3CCM V;  1HP8 A;  2B5U A;  4EFE A;  2BOB C;  4YIO A;  5FPR A;  4DR6 O;  2M6Y A;  2VQE O;  1IDS A;  3PN1 A;  5FL7 G;  1KMI Z;  3W7S A;  1K5S A;  1N33 B;  5LP6 A;  3JD4 A;  3LDE A;  5EIB C;  4NVP A;  3CC2 V;  1WB7 A;  1EN4 A;  2XAJ A;  2N05 A;  1XNQ B;  3ABK B;  2OCH A;  3VQV A;  5L3G A;  4R50 A;  1YIJ V;  3HKD A;  5FPO A;  1OCZ B;  4DR1 O;  1G4Y B;  4BWA A;  1RFY A;  2B9Z A;  1MAB G;  2X6C A;  1JFF B;  3CC7 V;  3QF7 A;  5KUK A;  5LXT B;  1HWY A;  1P84 F;  4DV4 O;  2C2A A;  2B1G A;  1X4T A;  4I4T B;  2X7R B;  2GHY A;  1V55 C;  2ZIO A;  4BIU A;  2EIN C;  2QKC A;  2Q0O C;  4F6R B;  1GMG A;  4FM1 A;  2DYR B;  3CMA V;  3FB6 C;  1VF6 A;  1FJG B;  4JV5 B;  2DJV A;  4B3T O;  3CC4 V;  3DTU B;  1H38 A;  4PI0 A;  3OM3 B;  4YJ3 A;  4NXN B;  1AI7 A;  5KHH A;  2QKS A;  4IHJ A;  2Q8V A;  4O4H A;  4DV2 B;  4PJ0 Z;  1KQS U;  4UCT A;  3UQ8 A;  1XMQ O;  4MTO A;  1I94 O;  1DF5 A;  3DGE A;  5JJE B;  5LBQ A;  4I50 B;  4TOI A;  5H5N A;  2A79 B;  1GN3 A;  2VS0 A;  4CC5 A;  4ZHQ A;  3BY6 A;  4DRX A;  1G6U A;  4TT3 G;  1CEZ A;  3RWR D;  1HW7 A;  3VQX A;  4J7K A;  3APO A;  4JI3 O;  3KCX A;  1S76 D;  4H37 A;  3UKM A;  4PD4 F;  2ZE6 A;  4KHP O;  1K73 W;  3WB2 A;  4AHC A;  4GX5 A;  3K9A A;  1GAX A;  4MVU A;  4FLU A;  3RW0 A;  2NLJ C;  3ABL C;  1Q6U A;  2WLI B;  1A32 A;  4TV8 B;  1SES A;  1FPO A;  4HZ3 A;  3F5T A;  2UXN A;  2PUS A;  1PNL A;  2JGD A;  3L70 H;  4HNA A;  5IJ0 A;  5BZB A;  1YTF B;  2CAZ C;  4YJ2 B;  3HPL C;  2PGG A;  3B8N A;  3AG4 B;  1TVK B;  1JR9 A;  1P7G A;  3X2Q C;  5B1A C;  1Y76 B;  3D3Q A;  4NXM B;  4RAI A;  3P3P A;  4JAV A;  1YHQ V;  3W7U A;  2N04 A;  1WP8 A;  3CXH F;  2YSU B;  1NQT A;  3ABL B;  2KG7 A;  1JMK C;  1TUB B;  5LP6 C;  2WPD G;  4E4E A;  3G67 A;  4DV4 B;  1B06 A;  1UJW B;  2QSA A;  1IUR A;  3RVY A;  4X1I B;  1OCR C;  5LYJ B;  4FIP C;  1K8A W;  4JAS A;  3WB1 A;  4EB6 B;  2K1E A;  2AHZ A;  3OGI B;  3X2Q B;  3KG2 A;  5L3B A;  1RPR A;  2JK5 C;  4LF9 B;  4UVA A;  1D5N A;  2X6B A;  4X8A A;  4H13 B;  2RN9 A;  2EIJ B;  4MVQ A;  2HR3 A;  4LF4 B;  4X66 O;  1H8E G;  5EBL C;  1OCO B;  1SC5 B;  2W0F C;  1XNR O;  1M5I A;  1IBL B;  5LP6 B;  2QKA A;  3P3N A;  4DO2 A;  2QWO B;  2HP8 A;  3CWB H;  2R9R B;  5H9C A;  3K06 A;  3SYQ A;  5KMG A;  3NXS A;  1Q6I A;  1VF6 C;  3HKD B;  3ZHT A;  1VQO V;  2LGQ A;  1XUQ A;  3K79 A;  3HR0 A;  4IT5 A;  3W7T A;  1SQB H;  2V4D A;  2M7W A;  3D3I A;  1QLN A;  4O4I A;  3ZJZ A;  5KHK A;  3ETQ A;  3SPJ A;  4GKK O;  2XUM A;  4J9Z B;  2P7T C;  1W59 A;  1VQ5 V;  1K4C C;  3ZCC A;  4LF6 B;  4PV1 B;  3RYH A;  1COW G;  3OAA G;  1M56 C;  4XBF A;  4DR7 B;  2ODM A;  3HKC A;  4EFB A;  2RCV A;  2YI8 A;  4LP8 A;  2OCC C;  3K9S A;  2Y0I A;  3ZMS A;  1BZK A;  4WCE V;  1YEW A;  4JI7 O;  1BSM A;  4X62 B;  3AG3 C;  3W7X A;  2W6I G;  2BTQ A;  2Y69 B;  1HDJ A;  2QDO A;  4YJ3 B;  4RWU A;  4IHJ B;  4O4H B;  3AK2 A;  2XAF A;  1XIL A;  3JD3 A;  1SS3 A;  1V54 C;  4DUZ O;  3EFF K;  1M57 B;  4R8C A;  1BHA A;  2ZIN A;  1VQM V;  3CE2 A;  3BAA A;  2NNU A;  4ZHQ B;  1GTO A;  5JCO C;  4DRX B;  1SQV H;  2UUA O;  1N34 O;  1OCC C;  3NR7 A;  4R6Z A;  1T5E A;  3RN4 A;  4X1K A;  5LMU O;  2E3C A;  2P6J A;  3T1H B;  3LSS A;  3TCU A;  3SJA C;  3KZI Z;  3H1I H;  5EK0 A;  1Q86 W;  2P4K A;  3CEI A;  4J42 A;  1PL4 A;  1NI8 A;  4JTD B;  4X20 B;  3T4D A;  4X64 O;  3OFN G;  2PY5 A;  1LR1 A;  2EX3 A;  3OTO B;  2Y48 A;  2QE7 G;  1AR1 B;  4GKJ O;  5IT9 N;  1Q8I A;  2E5L O;  3C90 A;  1EFR G;  1OCC B;  2V1D A;  1I7F A;  3B4S A;  1QHT A;  5IJ9 A;  3HB3 B;  4HNA B;  4ZBM A;  1B04 A;  5IJ0 B;  5EBW C;  3J7A U;  3J81 N;  1FKA O;  5K1X A;  2CGN A;  2HLD G;  4PHZ A;  3SGI A;  5IE9 A;  1XBL A;  4OGQ B;  3E2E A;  2NN4 A;  4TSF G;  3B8M A;  2IU3 A;  3OUS A;  1TA8 A;  5CN0 A;  2LQT A;  2KG7 B;  4NR1 A;  3VBB A;  1PM9 A;  2Q5Z A;  4ZIB A;  3JCU Z;  2DMX A;  3L72 H;  3AG1 B;  1E79 G;  4P9P A;  4UUJ C;  1KUQ A;  2GTA A;  1N36 O;  2WLJ A;  1PD3 A;  1U97 A;  3LSQ A;  4FLT A;  4JYC A;  1R73 A;  2PZS A;  2YIB D;  2CH7 A;  2ARH A;  3WB0 A;  4JI4 B;  2EIM B;  1UPG A;  2F4V B;  3RFR A;  1HNX B;  2H94 A;  4DV6 O;  1K5Q A;  3G6B A;  5KMG B;  2YI9 A;  5EC2 C;  3ZHR A;  4NTY A;  4N23 A;  5DN6 G;  4NYK A;  4L87 A;  3I5D A;  4MVZ A;  1AJQ A;  4O4I B;  2GV9 A;  2CTQ A;  1DTO A;  1L0L H;  4DV0 B;  1NR1 A;  1WN7 A;  4LWS A;  1Z2G A;  4F4L A;  1WNS A;  2Q9L A;  3RYH B;  3CSX A;  4FLY A;  5JJN B;  3TGU H;  5K1P A;  3HKC B;  1OV9 A;  3OTF A;  4WFH A;  2ZE7 A;  2HG5 C;  4DR3 B;  4WFG A;  3ZIA G;  1AIL A;  1MSW D;  3P32 A;  2XAH A;  2BTQ B;  1DF4 A;  4OPH A;  1VQN V;  2IH1 C;  4I55 A;  2A7W A;  2JRI A;  1E1Q G;  4W4L A;  1N33 O;  4C7U A;  1XL4 A;  1RM1 C;  1E1R G;  1XNQ O;  5KAI Z;  4LF5 B;  3IC9 A;  4CBC A;  4KL1 A;  2W6J G;  4K8X A;  3T4Z A;  2F93 B;  5LA6 A;  2BTO A;  3E22 A;  1VQ9 V;  4D7S A;  5HFL A;  2Q69 A;  2LFR A;  1JA8 A;  1Q3E A;  2ILM A;  3B40 A;  2QA4 V;  3IJ4 A;  5KHJ A;  4X1K B;  4JI1 B;  1IVS A;  1JPX A;  4CS2 A;  2Y4T A;  5EC1 C;  1K34 A;  3WFV A;  3UT5 A;  3OMI B;  5KHI A;  4K35 A;  2VQF B;  4RUE A;  5TIS Z;  3F7V C;  3C3S A;  4MT8 A;  2JVD A;  4JV5 O;  1FJG O;  1BQZ A;  2EZP A;  3D8C A;  4YHH B;  5KX5 A;  4NXN O;  1S77 D;  1IX9 A;  4TUY A;  4JI0 B;  4CH6 A;  2IJJ A;  1SRY A;  5JQG A;  1MZE A;  3K57 A;  4DV2 O;  2OT5 A;  2YIC A;  5IJ9 B;  3ZRV A;  3M7M X;  1EBO A;  1R3J C;  3BEH A;  3CRR A;  1YF2 A;  1I08 A;  2D3O W;  4GYC B;  4NB5 A;  3OUF A;  1G1X B;  1ZUQ A;  3I55 V;  1GN4 A;  3ABK C;  3O9O A;  1OZ0 A;  4MVR A;  2YXH A;  5DEC A;  4KXR A;  2UXB B;  2EJR A;  1P4R A;  1J5E B;  3L9D A;  4UVB A;  3UM7 A;  5FLX N;  2R9I A;  1O9H A;  4HAM A;  4JF3 A;  5LGU A;  1MNG A;  2VWJ A;  1PNK A;  4NTX A;  3M99 B;  2JGU A;  2CH7 B;  5HFM A;  5LHI A;  4U7O A;  2E75 B;  4TWK A;  5DM6 V;  1Y74 A;  2O57 A;  3RYI A;  2RDC A;  3DC5 A;  3CXC U;  2DYR C;  4MW3 A;  3T1Y B;  1JQ0 A;  2EZO A;  3S3W A;  4NXM O;  3L71 H;  3BHP A;  4WFA V;  2RNB A;  3T1C A;  4X65 B;  4CH4 A;  1HR0 B;  4QPK A;  1KB9 F;  1ZWI C;  3IC7 A;  5GTH Z;  4J10 A;  4LWS B;  1BL8 A;  2L35 A;  2ETN A;  1NBM G;  1Z5V A;  5EZY A;  1N4C A;  2ZM6 B;  1VQP V;  3FD9 A;  1QCE A;  4CS3 A;  4FLV A;  4LF9 O;  1DK1 A;  4LF4 O;  3JAW A;  5JJJ B;  4I7Z B;  4I55 B;  1IBL O;  3QG5 A;  1IXM A;  3K5O A;  3ZRX A;  3ASN C;  2Q6A A;  3CB2 A;  1S3J A;  2WSS G;  1AR5 A;  1PP9 H;  2FL4 A;  1MMM A;  3CS5 A;  3L73 H;  2JJ2 G;  1KC8 W;  1QR8 A;  2YEV A;  4JI6 O;  1ARO P;  2IJK A;  5C8Y A;  3SYA A;  1QVF U;  3B09 A;  5LA6 B;  4AI8 A;  1WPB A;  2OWO A;  3E22 B;  3L74 H;  2YIB A;  4FLW A;  4GX1 A;  2AXT Z;  3AEI A;  5L3E A;  2XTA A;  3JCZ A;  1ZX3 A;  3RT3 C;  4LF6 O;  2JEU A;  5B5E Z;  3JAL A;  3AG4 C;  1MSD A;  3ASN B;  1AVM A;  3CD6 V;  4DR7 O;  3A0B Z;  1LUV A;  4D6T H;  3UT5 B;  1BT8 A;  1I5Y A;  3SR2 C;  1AI5 A;  3SPH A;  2P5O A;  3JD0 A;  4KFM A;  1XQ8 A;  2ZD9 A;  1GH6 A;  1EN6 A;  4X62 O;  3SPI A;  3QO7 A;  1GN2 A;  3A0H Z;  4RO2 A;  5KX5 B;  3Q4H A;  1YIT V;  1R3I C;  1WAZ A;  2CK3 G;  3AG2 B;  4TUY B;  1IXB A;  3OEE G;  4U7N A;  5JQG B;  1M90 W;  4DK0 A;  2ZIM A;  2MW2 B;  4H44 B;  1IBK O;  1NS1 A;  4W4K A;  4PDL A;  3GB7 C;  1ROP A;  1I5X A;  3TXS A;  3I56 V;  1N32 B;  1XHZ A;  2WLM A;  2EIJ C;  2NR5 A;  1YXB A;  4N21 A;  2UUB B;  1OCO C;  4DYL A;  2P06 A;  2R9A A;  5EIB D;  3G4S V;  1VQ4 V;  2BCC H;  1K7D A;  4DV3 B;  1JVM A;  3T1H O;  2G38 A;  1NTM H;  3SDL A;  4FLZ A;  2DQ3 A;  1NTZ H;  3STL C;  3ZRW A;  2HFE C;  3K3W A;  3ZS8 C;  1XL6 A;  4JAA A;  3OTO O;  4XDL A;  1L1F A;  4U3F H;  2CUG A;  4U3J A;  1DGS A;  1CPY A;  3K5M A;  2ADQ B;  1FXK A;  1EZJ A;  4FZ1 A;  1AJP A;  1Y74 B;  3FAV A;  4GT1 A;  1SZT A;  1I0H A;  3RYF A;  2P90 A;  4Z1M G;  3BA8 A;  3K03 A;  4MTF A;  3E89 A;  2HVJ C;  3RYI B;  4CZZ A;  1SQQ H;  4BW9 A;  5IYZ A;  5B1B B;  4JI6 B;  2IJH A;  3OMN B;  3N2K A;  2Y69 C;  4TQD A;  4PA4 A;  2ZDI A;  4MVS A;  1ZAU A;  3UCS C;  1D5A A;  3N2G A;  1W0J G;  1Z5W A;  1KBH A;  4UFZ A;  1M57 C;  3ZHS A;  4DV5 B;  4AQY B;  1H2L A;  3MAQ A;  4XDJ A;  5EZY B;  3KCY A;  3A8T A;  4BIZ A;  1FYJ A;  2KSD A;  1W2B U;  3ZMV A;  5CB4 A;  5GON A;  1VQK V;  2OIE A;  3JAW B;  1VF5 B;  1SQF A;  4JI4 O;  3H1H H;  2JJ1 G;  4Q20 A;  3LDD A;  3JAT A;  2F4V O;  2YIA A;  1YJW V;  1OJH A;  1JJO A;  3GWO A;  4Q6G A;  3MHS C;  1HNX O;  3E8H A;  1XI1 A;  3CJH A;  1CXZ B;  3E86 A;  1IBK B;  3JSN A;  4GUN A;  1F7Y A;  3DSQ A;  2EIL B;  4J80 A;  2YEV B;  2FML A;  2ZNJ A;  1H2M A;  1B6Q A;  5C8Y B;  1SA0 A;  3TK1 A;  4JI2 B;  3H1J H;  1ZSP A;  3D36 A;  4J11 A;  1GRJ A;  1G8M A;  4E2L A;  4MVO A;  5EYP A;  4DV0 O;  1YCI A;  1ZTE A;  2W0X A;  2R70 A;  3A2F A;  2DWD C;  2P22 C;  2LJ2 A;  4FFB A;  2QM4 A;  4K3A A;  2IU0 A;  4UV9 A;  1SQP H;  4P2Z A;  1EN5 A;  3JAL B;  4B3R B;  1QQC A;  2LW7 A;  2ZT9 B;  2UXX A;  4DR3 O;  3TXQ A;  2E76 B;  2XND G;  3L75 H;  1AB3 A;  1VQ6 V;  1XMO B;  3LDC A;  3Q4H B;  3APQ A;  1K33 A;  1RSO A;  2UUC B;  4IIJ A;  2ZXW C;  3AG1 C;  1M4U A;  1R6T A;  4FJC C;  1BQ0 A;  2F1M A;  2JGD B;  4LF5 O;  4LNU A;  2BE3 A;  3K59 A;  4HYO A;  2YXY A;  5IYC O;  1Q7Y W;  4KP4 A;  4KUM A;  1KD1 W;  4LC1 A;  2EIK C;  4LFC B;  2ITC C;  1YI2 V;  1FXK C;  1GKF A;  2F23 A;  3OEH G;  4ICG A;  2EIM C;  4K8Z A;  1THZ A;  3SJQ C;  4JI1 O;  2ZXW B;  3CRM A;  1K4D C;  1PPJ H;  3JAR A;  4B7K A;  3SJB C;  3ZRW B;  5L3C A;  2VQF O;  2RQ6 A;  2ZE5 A;  5B1N A;  2AHY A;  3CX5 F;  3IFX A;  3JSL A;  4YHH O;  3CCR V;  2ZR3 A;  4QE9 A;  4U3J B;  2EIK B;  1YZB A;  2YDE A;  3JAK A;  2DW4 A;  1WA8 A;  4JI0 O;  2HJF C;  1FXK B;  3FB7 C;  3BFR A;  2XAQ A;  3CRQ A;  3QTC A;  4FM0 A;  4DUY O;  1UFI A;  3FAV B;  1ORQ C;  2OIG A;  5BR8 B;  4K0K B;  3RYF B;  1J95 A;  4WFF A;  4QNH B;  4AIL C;  2FKX A;  4JI8 B;  1Y67 A;  2B1I A;  2HVK C;  3ZHU A;  4BAY A;  1XHX A;  5IYZ B;  1QR9 A;  4ZOL A;  2OTL V;  4MS2 A;  3SPG A;  3QNE A;  5H2F Z;  3N2K B;  3FKS G;  2IBZ H;  3DC6 A;  3CP1 A;  4TV9 A;  2E74 B;  4FVM A;  3P30 A;  4GZR B;  3ETE A;  4NKG B;  4UB6 Z;  4LF7 B;  5GTI Z;  3H01 A;  2AZ2 A;  5LL6 Y;  2UXB O;  3HKB A;  3N2G B;  1J5E O;  4UCR A;  1S72 V;  3ABU A;  1XDC A;  4ABM A;  2WAM A;  1GM7 A;  5H6R A;  1F23 A;  1NKD A;  4B7E A;  5CB4 B;  2JS5 A;  5EBM C;  3K5N A;  5GON B;  4DR4 B;  4RQF A;  4O2B A;  4UCS A;  2WLN A;  2PI5 A;  4B3M B;  2UU9 B;  3RGB A;  3JAT B;  2WLK A;  3ZN0 A;  4YIP A;  1MOF A;  3K08 A;  2ADP A;  3CJH B;  4EKW A;  3T1Y O;  4O4L A;  3U10 A;  4PA7 A;  4PA3 A;  2OYQ A;  1SA0 B;  5J9P C;  2PTM A;  4UCV A;  5C93 A;  3F7Y C;  4MTX A;  1ZL8 A;  4X65 O;  4JI5 B;  1HR0 O;  5EYP B;  4NTW A;  1L0N H;  1H2S B;  2AW9 A;  5GW7 A;  2EJ7 A;  2QTO A;  5IDJ A;  3CCS V;  4FLX A;  4DV7 B;  2AGA A;  1XEQ A;  2DE0 X;  1R3K C;  2ZM6 O;  1PKX A;  2XAG A;  1HNW B;  3B2E E;  1JJ2 U;  3TJT A;  5FNV A;  1R6K A;  4OPA A;  3RVZ A;  4G27 B;  2LGW A;  2DWE C;  1KKC A;  2EUL A;  3STZ C;  1RSO B;  5F2V O;  4DR5 B;  4IIJ B;  4DUY B;  3IAY A;  3AG7 A;  2HHH B;  1SET A;  1KP3 A;  1YVW A;  4MW8 A;  4LNU B;  4DV1 B;  1RP3 B;  4IGG A;  1AJN A;  1B3Q A;  3BA9 A;  2ZCE A;  3FFQ A;  5KLV H;  4PA9 A;  4CH5 A;  2ZNI A;  4UCO A;  2CTW A;  3EHB B;  3ICX A;  4J7Z A;  4DW1 A;  1H2G A;  2PYL A;  3K04 A;  1SZX A;  3SJC C;  3WG7 C;  5DED A;  2ITD C;  1W0K G;  1S5H C;  3THO A;  2Q7G A;  1MZF A;  2K9P A;  1H2N A;  4OX9 O;  2IW5 A;  4X9Q A;  1KEC A;  2JS3 A;  5IY5 C;  3OR6 C;  4ZI7 A;  4QPJ A;  3CCQ V;  3JAR B;  1FXV A;  4I9W A;  1AI6 A;  2UXD B;  1EM1 A;  3S3X A;  4PDV A;  2ATK C;  5LHG A;  5E1A C;  5IWA B;  5JH7 A;  1SKV A;  1L8D A;  1Q6H A;  1NVP B;  3UO3 A;  3WG7 B;  4DK1 A;  3JAK B;  1WA8 B;  5KHG A;  1S0V A;  2Q68 A;  2JIZ G;  2PI4 A;  2YS8 A;  2YUA A;  5B3S C;  1K97 A;  1S5J A;  1R6N A;  1SF9 A;  4L8J A;  5IY5 B;  4LF8 B;  4H0L B;  4DR2 B;  5D5P A;  4ZOL B;  1N32 O;  2F43 G;  3ASO B;  4QIW F;  3SPC A;  2ZKO A;  1VQL V;  3JAS A;  2UUB O;  4MVM A;  2QWP B;  4MTG A;  3K58 A;  2QM7 A;  1NTK H;  4TV9 B;  1VF7 A;  4YXW G;  2BOC C;  4DV3 O;  4IYI A;  4YY3 B;  3ABM C;  1F4M A;  1N0J A;  1M1K W;  3CRA A;  5E79 Z;  4FPP A;  3OD4 A;  1R1B A;  1NH2 B;  3HKB B;  5B3S B;  5CMU A;  2Y4U A;  2QWQ B;  3ZX6 A;  4RQE A;  2QGN A;  5LMN B;  3E8F A;  1H2K A;  3K0G A;  4B3S B;  1VMG A;  3G6E V;  3CCE V;  3DXR A;  2WA4 A;  1F51 A;  1YJN V;  3W7W A;  4O2B B;  1VQ8 V;  4LFA B;  4EEQ A;  1Y6X A;  1FFT B;  4I5S A;  2DYS C;  3ABM B;  1SQX H;  4J7J A;  2GBO A;  3CCV V;  4LFB B;  3ZMZ A;  4UB8 Z;  1XOU A;  4O4L B;  1TUE B;  2KQX A;  2IJI A;  1KKD A;  3MDS A;  2DQ0 A;  1GO3 F;  1HNZ B;  4JAU A;  1AP6 A;  1F4N A;  3AG2 C;  3ZHV A;  1ZL8 B;  1NVP D;  2Q67 A;  2ZQM A;  2WWW A;  2F95 B;  3ETG A;  4OX9 B;  3VOU A;  2BSK A;  4O2A A;  1V55 B;  2P4V A;  4DXW A;  2EIN B;  2CDY A;  2YID A;  2DYS B;  4DV5 O;  4AQY O;  1GN6 A;  3OW2 U;  3WU2 Z;  4JTC B;  5ITZ A;  1BCC H;  3BPZ A;  3E8G A;  4Z2W A;  1WP7 A;  2GSM B;  5FNV B;  2X6A A;  1XRE A;  2WLH A;  4I0X A;  2Q7H A;  2HEP A;  4PI2 A;  2Q7E A;  2YXL A;  3QVN A;  1DLB A;  2CE4 A;  2PYJ A;  4X88 A;  3M8A A;  4WFE A;  4X20 A;  3ZED A;  1NH2 D;  3ML0 A;  1QVG U;  5L3D A;  1FFX A;  5LGN A;  4DR6 B;  4P30 A;  4WFB V;  5JWP A;  4TQF A;  1SER A;  1AP5 A;  4QE7 A;  1S5L Z;  2D2C B;  5JCO A;  2VQE B;  3SYP A;  4O4J A;  2QTS A;  4JI2 O;  1Q81 W;  3CPW U;  1SQG A;  2UXC O;  3G80 A;  5CA0 A;  5LOV A;  4WBN A;  3ZBH A;  3FYI B;  2DOS A;  1AI4 A;  3ETD A;  3VQW A;  2RJZ A;  2L6L A;  1X59 A;  3K0D A;  1KP2 A;  3CRC A;  2H8P C;  1YJ9 V;  4DR1 B;  3GVM A;  3FX7 A;  5B1B C;  4B3R O;  4ZI7 B;  3ABT A;  4JZ2 A;  1US6 A;  3AK1 A;  3A0R A;  5L3F A;  1GK9 A;  2YC0 A;  3CHX A;  4UCU A;  5JH7 B;  4A5U B;  5IYB O;  1XMO O;  4D7T A;  2FB5 A;  3MHH C;  4RUF A;  2FYU H;  2QWR B;  2JDI G;  2UUC O;  1FXH A;  3RYC A;  3CYO A;  2DN9 A;  1FD9 A;  5A2Q N;  1EZV H;  5B1A B;  4B3T B;  1QNM A;  1MA1 A;  1Q5O A;  1JCH A;  1IZ3 A;  4LFC O;  3JAS B;  1P7B A;  4LH6 A;  2N74 A;  4JYB A;  2EBO A;  1XMQ B;  1OCR B;  4UV8 A;  5J2T A;  1I94 B;  1LNQ A;  4PDR A;  4GX2 A;  4PEL A;  4GLX A;  1D2D A;  2EIL C;  1URF A;  2QWN B;  3QO8 A;  3H9V A;  5IYD O;  2RMK B;  1FS0 G;  4LBE C;  4UVC A;  1OHH G;  5JVD A;  4JI3 B;  1VP7 A;  3DXR B;  4P9O A;  4J41 A;  1YTF D;  4JGS A;  3ZN1 A;  4FM2 A;  3JYC A;  5A9G A;  4KHP B;  5BR8 O;  4K0K O;  3TET A;  2LP7 A;  4IYH A;  2LFS A;  3FYE B;  5CBH A;  4JI8 O;  2IH3 C;  1K9M W;  2VWK A;  3VQY A;  2V7Q G;  2UXC B;  2A06 H;  5CBF A;  4FMT A;  3ZHQ A;  1M9N A;  3BCC H;  1M56 B;  2BSK B;  3H1K H;  4O2A B;  4LF7 O;  3HKE A;  3PJS K;  3O65 A;  2OCC B;  2ZE8 A;  4LCU C;  1PL0 A;  5BMV A;  2CTP A;  5ITZ B;  3AG3 B;  1GM8 A;  1LUW A;  1BHB A;  2XHB A;  3EVK A;  1P49 A;  4ASU G;  1QU7 A;  4IL6 Z;  4DR4 O;  3EXA A;  3BVO A;  3LSU A;  3SYO A;  2LW1 A;  4I0X B;  5AG2 A;  2QM8 A;  1VIB A;  3OGC C;  2UU9 O;  4B3M O;  5CA1 A;  4CS4 A;  1V54 B;  3LUT B;  2WLL A;  1Y4M A;  1IBM O;  1VEW A;  1GM9 A;  3N27 A;  1FFX B;  5BY1 A;  3LNN A;  2Q0A A;  1VAR A;  3G71 V; 
#chains in the Genus database with same CATH homology
 1NBM G;  2AHZ A;  5KA5 A;  3X2Q B;  3KG2 A;  5L3B A;  1RPR A;  2JK5 C;  3JD1 A;  4UVA A;  5GW7 A;  2X6B A;  4X8A A;  1VQP V;  4MVQ A;  5KA6 A;  2EIJ B;  2HR3 A;  1QCE A;  2QTO A;  5IDJ A;  3CCS V;  3T2M A;  1H8E G;  5EBL C;  1OCO B;  2W0F C;  1RPO A;  1R3K C;  1PKX A;  2OTJ V;  2XAG A;  1Y66 A;  4DO2 A;  2R9R B;  5H9C A;  3K06 A;  2QEX V;  3SYQ A;  3R65 A;  1JJ2 U;  1BMF G;  1R6K A;  3NXS A;  1IXM A;  3RVZ A;  4G27 B;  3ZRX A;  1VQO V;  4ZKI A;  2DWE C;  2Q6A A;  3ASN C;  1PNM A;  3K79 A;  3W7T A;  1S3J A;  3ZMT A;  2WSS G;  3STZ C;  2M7W A;  3D3I A;  2JJ2 G;  3FB5 C;  4R7C A;  1QLN A;  1KC8 W;  1QR8 A;  3ZJZ A;  2YEV A;  1SET A;  1KP3 A;  2ZDI C;  1ARO P;  2IJK A;  3SPJ A;  4UXN A;  3SYA A;  4MW8 A;  1QVF U;  5CA3 A;  4J9Z B;  2P7T C;  1VQ5 V;  1R3L C;  1AJN A;  2XAS A;  1K4C C;  3ZCC A;  1QLE C;  1COW G;  4GX1 A;  3OAA G;  1M56 C;  3AEI A;  4PA9 A;  4XBF A;  5L3E A;  3EHB B;  2FTK A;  5LGT A;  1H2G A;  3JCZ A;  3K04 A;  4LP8 A;  2OCC C;  3WG7 C;  1VQ7 V;  3CCU V;  1K3E A;  2ITD C;  1W0K G;  1S5H C;  2JEU A;  3ZMS A;  3ZMU A;  3AG4 C;  4WCE V;  2IW5 A;  3ASN B;  3CD6 V;  3AG3 C;  4MSW C;  3W7X A;  2W6I G;  2Y69 B;  1KEC A;  1I5Y A;  3JD2 A;  1AI5 A;  4J9Y B;  5IY5 C;  3SPH A;  3JD0 A;  3OR6 C;  4KFM A;  4QPJ A;  3CCQ V;  2ZD9 A;  3SPI A;  3QO7 A;  4RO2 A;  3ZRS A;  1FXV A;  4I9W A;  4JPR A;  1AI6 A;  1NR7 A;  2KB1 A;  4PDV A;  3CCL V;  1QLE B;  1YIT V;  1R3I C;  2CK3 G;  2XAF A;  2ATK C;  3AG2 B;  3JD3 A;  5LHG A;  5E1A C;  1V54 C;  3F5W C;  3EFF K;  3OEE G;  4U7N A;  1M57 B;  4R8C A;  1BHA A;  1M90 W;  1VQM V;  1NVP B;  2MK3 A;  3WG7 B;  1WLE A;  2NNU A;  1S0V A;  1GTO A;  2Q68 A;  2A9H A;  2JIZ G;  4PDL A;  3GB7 C;  3RBZ A;  2PI4 A;  1ROP A;  5B3S C;  1I5X A;  3I56 V;  3B77 A;  1OCC C;  4R6Z A;  3OR7 C;  2WLM A;  2EIJ C;  1K97 A;  4FK5 C;  1R6N A;  5IY5 B;  4N21 A;  3FB8 C;  4H33 A;  4X89 A;  1OCO C;  1MG1 A;  2P6J A;  4GX0 A;  3G4S V;  1VQ4 V;  2F43 G;  3LSS A;  2A0L A;  3ASO B;  4QIW F;  4PDM A;  3TCU A;  3SPC A;  1K7D A;  1VQL V;  1JVM A;  5EK0 A;  1Q86 W;  4MVM A;  1JOY A;  4JTA B;  1K92 A;  2Z3Y A;  4MTG A;  4JTD B;  2QM7 A;  3T4D A;  2DQ3 A;  3OFN G;  4YXW G;  2BOC C;  3STL C;  3ZRW A;  2Y48 A;  5KUM A;  3ABM C;  1F4M A;  3IGA C;  2QE7 G;  4OXS A;  1AR1 B;  1M1K W;  2HFE C;  3K3W A;  4PA6 A;  4FPP A;  1QBZ A;  1NH2 B;  2Z5U A;  1XL6 A;  1EFR G;  5B3S B;  5LHH A;  1OCC B;  2V1D A;  4XDL A;  4GCZ A;  1CP9 A;  1L1F A;  3E83 A;  5CMU A;  1CPY A;  2P67 A;  3HB3 B;  4RQE A;  2JEX A;  4ZBM A;  3E8F A;  1FXK A;  1EZJ A;  3K0G A;  5EBW C;  1AJP A;  1YSC A;  3G6E V;  2XOK G;  4G2K A;  4GT1 A;  1SZT A;  3CCE V;  2HLD G;  2P90 A;  3K03 A;  4Z1M G;  1F51 A;  3E89 A;  2HVJ C;  4MTF A;  1YJN V;  3E2E A;  4CZZ A;  3W7W A;  4TSF G;  3B8M A;  2IU3 A;  1VQ8 V;  3OUS A;  1NJI W;  4I5S A;  1FFT B;  5B1B B;  5CN0 A;  2DYS C;  1RM1 B;  3ABM B;  3E35 A;  3OE7 G;  2IJH A;  1WPX A;  2X0L A;  3QO5 A;  4QJF B;  3OMN B;  2Y69 C;  3VBB A;  3CCV V;  3ZMZ A;  2HKO A;  2ZR2 A;  3AG1 B;  1TUE B;  1E79 G;  4PA4 A;  2ZDI A;  4P9P A;  4UUJ C;  3E8B A;  2WLL B;  2IJI A;  5CBG A;  2WLJ A;  1KKD A;  2DQ0 A;  1PD3 A;  4MVS A;  1GO3 F;  4JAU A;  1F4N A;  3LSQ A;  3AG2 C;  2WLI A;  1ENV A;  4JYC A;  1R73 A;  1NVP D;  2Q67 A;  2ZQM A;  1W0J G;  2WWW A;  3ETG A;  3MD0 A;  1M57 C;  4WF9 V;  3VOU A;  1N8R W;  1V55 B;  4XDJ A;  1H8H G;  4DXW A;  2EIN B;  4BIZ A;  1JX9 A;  3SYC A;  1W2B U;  2DYS B;  3ZMV A;  3CCJ V;  5H6Q A;  3OW2 U;  4JTC B;  2EIM B;  1VQK V;  3E8G A;  3OMA B;  2H94 A;  1K5Q A;  3CME V;  2JJ1 G;  4Q20 A;  4BW5 A;  4G28 B;  3LDD A;  2GSM B;  3ASO C;  5EC2 C;  2X6A A;  3GWO A;  1YJW V;  3MHS C;  3E8H A;  2WLH A;  4N23 A;  5DN6 G;  4L87 A;  3E86 A;  4XDK A;  4MVZ A;  1DLB A;  1AJQ A;  2EIL B;  2YEV B;  4X88 A;  1Q82 W;  1DTO A;  4WFE A;  5B1O A;  1B6Q A;  1NH2 D;  3LNM B;  3ML0 A;  1QVG U;  5L3D A;  3TK1 A;  1NR1 A;  5LGN A;  4P30 A;  3D36 A;  1OCZ C;  4WFB V;  4F4L A;  3CCM V;  1SER A;  4QE7 A;  1G8M A;  4E2L A;  4MVO A;  2B5U A;  3SYP A;  2BOB C;  1Q81 W;  3CPW U;  2DWD C;  4WFH A;  2HG5 C;  3FYI B;  4WFG A;  5FL7 G;  3W7S A;  2IU0 A;  4P2Z A;  1AI4 A;  3ETD A;  4UV9 A;  3ZIA G;  1K5S A;  1MSW D;  3K0D A;  3JD4 A;  3LDE A;  1KP2 A;  3P32 A;  3CC2 V;  2XAJ A;  2UXX A;  2H8P C;  2XAH A;  1YJ9 V;  1DF4 A;  1VQN V;  2IH1 C;  3ABK B;  5L3G A;  1E1Q G;  2XND G;  4R50 A;  5B1B C;  1XL4 A;  3ABT A;  1YIJ V;  1RM1 C;  1OCZ B;  1E1R G;  1VQ6 V;  3LDC A;  4CBC A;  1G4Y B;  1K33 A;  2ZXW C;  3A0R A;  3AG1 C;  5L3F A;  4FJC C;  1GK9 A;  1MAB G;  2W6J G;  2X6C A;  3T4Z A;  5IYB O;  3MHH C;  4RUF A;  1VQ9 V;  3CC7 V;  5KUK A;  5HFL A;  2JDI G;  2Q69 A;  1HWY A;  1FXH A;  2C2A A;  2LFR A;  4HYO A;  2B1G A;  5IYC O;  1Q7Y W;  3CYO A;  4KP4 A;  2X7R B;  2GHY A;  4KUM A;  1KD1 W;  1V55 C;  5B1A B;  4LC1 A;  4BIU A;  2EIN C;  2QA4 V;  2EIK C;  1GMG A;  2ITC C;  2DYR B;  3CMA V;  1FXK C;  3FB6 C;  1GKF A;  1YI2 V;  1JPX A;  1JCH A;  3OEH G;  2EIM C;  5EC1 C;  1K34 A;  3CC4 V;  3DTU B;  1THZ A;  3WFV A;  1H38 A;  3OMI B;  3OM3 B;  3SJQ C;  2ZXW B;  1P7B A;  4RUE A;  1AI7 A;  3F7V C;  4MT8 A;  1K4D C;  2QKS A;  4JYB A;  2EBO A;  2EZP A;  1OCR B;  4UV8 A;  3ZRW B;  5L3C A;  1LNQ A;  4PDR A;  1S77 D;  4GX2 A;  4PEL A;  5B1N A;  1KQS U;  2AHY A;  3IFX A;  2EIL C;  2IJJ A;  3CCR V;  3QO8 A;  1SRY A;  4MTO A;  2ZR3 A;  4QE9 A;  1DF5 A;  3DGE A;  5IYD O;  2EIK B;  2OT5 A;  1FS0 G;  5LBQ A;  2DW4 A;  3ZRV A;  4LBE C;  2A79 B;  2HJF C;  1FXK B;  1EBO A;  3FB7 C;  2XAQ A;  3BY6 A;  4UVC A;  1OHH G;  1R3J C;  3BEH A;  1ORQ C;  4TT3 G;  1CEZ A;  1J95 A;  4P9O A;  4WFF A;  4QNH B;  1YTF D;  4JGS A;  3ZN1 A;  2B1I A;  2D3O W;  2HVK C;  3JYC A;  4BAY A;  1QR9 A;  3TET A;  2OTL V;  2LP7 A;  3OUF A;  4MS2 A;  1S76 D;  3SPG A;  4H37 A;  3UKM A;  2LFS A;  3QNE A;  3FYE B;  5CBH A;  2IH3 C;  1K73 W;  3FKS G;  3I55 V;  1K9M W;  3ABK C;  4GX5 A;  1OZ0 A;  3K9A A;  3CP1 A;  4MVR A;  2EJR A;  4MVU A;  2V7Q G;  1P4R A;  3P30 A;  3ETE A;  4UVB A;  3UM7 A;  3RW0 A;  2NLJ C;  5CBF A;  3ABL C;  3H01 A;  2R9I A;  4FMT A;  2WLI B;  4HAM A;  4JF3 A;  5LGU A;  1S72 V;  1M9N A;  1SES A;  3ABU A;  4HZ3 A;  1M56 B;  1PNK A;  2UXN A;  2WAM A;  1GM7 A;  3M99 B;  1PNL A;  3PJS K;  5H6R A;  5HFM A;  1F23 A;  2OCC B;  5LHI A;  4U7O A;  5BZB A;  4LCU C;  1YTF B;  1NKD A;  4TWK A;  5DM6 V;  1PL0 A;  3HPL C;  3B8N A;  5EBM C;  3AG4 B;  3X2Q C;  5B1A C;  3AG3 B;  1GM8 A;  4RQF A;  1BHB A;  4RAI A;  3CXC U;  2DYR C;  2WLN A;  4ASU G;  4MW3 A;  2PI5 A;  4JAV A;  1YHQ V;  1JQ0 A;  2EZO A;  3W7U A;  2WLK A;  2YSU B;  1NQT A;  3ZN0 A;  3ABL B;  3SYO A;  1MOF A;  3K08 A;  2WPD G;  2QM8 A;  4EKW A;  3OGC C;  4WFA V;  1UJW B;  3T1C A;  1V54 B;  4PA7 A;  3RVY A;  3LUT B;  4QPK A;  2WLL A;  1Y4M A;  4PA3 A;  1ZWI C;  1OCR C;  3IC7 A;  1GM9 A;  5J9P C;  4FIP C;  1K8A W;  4JAS A;  5C93 A;  3F7Y C;  4MTX A;  1BL8 A;  3G71 V;  2K1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...