4P2ZA

Structure of navms t207a/f214a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p2zA00
2ITCC 2ITDC 3UKMA 4TWKA 3E86A 5EC1C 3SYQA 3IGAC 3SYAA 3ASOC 3ABLC 3OR7C 5EBLC 2ZXWC 3OUSA 3R65A 1R3JC 4MVQA 4QE7A 3T1CA 3X2QC 3LUTB 4MTFA 3K0DA 2HVKC 2DWEC 3SPCA 5EK0A 2EILC 3F7VC 2AHYA 3K08A 3E8HA 4PDVA 3K0GA 5EBMC 2WLNA 2HJFC 2YEVA 3E8BA 2Q6AA 2JK5C 4MVZA 3AG3C 4H37A 4LBEC 3F7YC 2ATKC 4UUJC 2H8PC 1M56C 5E1AC 2A0LA 3AG1C 1BL8A 2EIKC 3PJSK 4RO2A 3FB6C 3SYPA 1QLEC 4MTOA 4MTGA 3AG2C 2DYSC 3F5WC 4WFHA 4WFGA 5IY5C 4EKWA 4WFFA 3EFFK 3UM7A 4PDMA 5CBHA 4GX1A 2Q69A 4BW5A 4H33A 3JYCA 4MS2A 3BEHA 4ZBMA 2WLIA 1OCOC 4GX0A 5BZBA 4G28B 4RUFA 3OR6C 4JTCB 3RVYA 5J9PC 2A79B 3IFXA 1S5HC 1OCRC 2Q67A 1V55C 3KG2A 3OUFA 4MVMA 3LDCA 5EC2C 3SYOA 2HFEC 2Y69C 4QE9A 4QNHB 3K06A 4PA9A 1P7BA 1K4DC 4J9ZB 3E8FA 4LCUC 2DYRC 4MVUA 4G27B 4OXSA 4P9PA 4MVOA 3T4DA 2QTOA 4PA7A 4XDKA 3T4ZA 2Q68A 3RVZA 1R3KC 3K04A 3TETA 4MW3A 5CBFA 1ORQC 4P9OA 4MSWC 1OCCC 3TCUA 4HYOA 3AG4C 2EINC 2ZD9A 4R50A 2AHZA 5KUMA 2K1EA 2WLIB 5KUKA 4PDLA 4CBCA 3OGCC 3LDDA 4RAIA 3SJQC 4KFMA 3WG7C 3HPLC 2OCCC 2WLJA 3FB5C 4DXWA 4X89A 2DWDC 2R9RB 2W0FC 3ASNC 5CBGA 3E83A 1R3LC 3GB7C 4RUEA 4PA3A 1M57C 4JTAB 2KB1A 4XDLA 3FB8C 3K03A 1V54C 1OCZC 2EIJC 2IH1C 2X6AA 2EIMC 2WLLA 2BOCC 4PDRA 4MVSA 2IH3C 2BOBC 3SYCA 1JVMA 3SPHA 5B3SC 3E89A 5B1BC 2WLHA 2NLJC 4X8AA 5EBWC 3FB7C 3RW0A 3SPIA 3LNMB 2WLKA 4R7CA 2P7TC 1XL4A 1KKDA 1R3IC 4F4LA 3ABMC 4PA4A 3ZJZA 2WLMA 4J9YB 4X88A 1G4YB 4JTDB 2QKSA 3E8GA 4R6ZA 2X6BA 2HG5C 2HVJC 3ZRSA 3SPJA 3SPGA 4P30A 4R8CA 3STZC 3LDEA 4HZ3A 4MVRA 3T2MA 2WLLB 3ABKC 4MW8A 4GX5A 1ZWIC 4LP8A 1LNQA 4GX2A 3VOUA 3RBZA 1J95A 2X6CA 4PA6A 3STLC 4P2ZA 4WFEA 4XDJA 5B1AC 1K4CC 1XL6A 2A9HA 4I9WA
chains in the Genus database with same CATH superfamily
3JALA 5IJ9B 2FYUH 1TA8A 4U7OA 1E1RG 5IYCO 1XREA 4N23A 4MTFA 5KHGA 2BSKB 1FXVA 2NN4A 4BIOA 4OGQB 2QWRB 3AG3C 4H37A 1VQNV 4UUJC 3UO3A 1DK1A 2ZCEA 4GT1A 3JD1A 4H44B 2KG7B 3ZEDA 3P3NA 1XMOB 3ETQA 4NYKA 4O4JA 4O4LA 3Q4HA 5JQGA 1YDXA 4ZI7B 5KA6A 4LFAB 3SYOA 5L3FA 1GM8A 4K8XA 2LW1A 4F6RA 1GO3F 1VF6C 4BW9A 5IDJA 2ZDIC 1YVWA 5CB4A 5KHKA 3G6EV 5LHIA 2YI8A 1YTFB 5JJEB 3TGUH 1VQ5V 1Q6HA 1NVPB 4B3TO 2PI5A 5LYJA 2IW5A 2QR4A 2KB1A 3JAWA 1XNRB 1PNLA 3ZHTA 2VWJA 4X20B 1OCRB 3ASOB 3ZHUA 2PYLA 4GKJO 5EBWC 3CCUV 1PNKA 2P7TC 1JMKC 3OT7A 2ZIOA 1G4YB 2ODMA 3SPJA 3G4SV 5L3CA 2OTLV 3HKCA 3H01A 2YICA 3X2QB 4FZ1A 1Y67A 4X1IA 5BR8B 5EC1C 2WA4A 2EINB 3ASOC 4AILC 1KU9A 4I0XA 2AHYA 3HKDA 3J80N 2UXBB 3K9SA 4IT5A 1KC8W 4HNAB 2A0LA 1BZKA 2PGGA 5DEDA 4H0LB 3A2FA 4WFGA 4LWSA 3EFFK 1EN6A 2ZDIA 3KKYA 4MS2A 1DGSA 1X4TA 1TUBB 4JYAB 3RVYA 2DQ0A 4FMTA 2A79B 4DR3B 4QGPA 3CCSV 4QE9A 5IJ0B 1FXKA 4BWAA 4MVUA 4O4IB 2Y4TA 4PA7A 2Q68A 1BE3H 4X20A 2RQ6A 3ABLB 1K92A 1VIBA 5KUMA 3W7TA 4Q6GA 1K34A 3SJAC 4FM1A 5CBGA 3N2GB 2JJ2G 4JZ2A 3NXSA 1PD3A 3RGBA 3K03A 2RMKB 3K58A 1IVSA 2WSSG 2XAGA 4DYLA 2B1GA 1I0HA 3CRMA 3BPZA 3ETEA 3L73H 1MSWD 1GAXA 1WP7A 2WLMA 4J9YB 5FPRA 5H5NA 2QKSA 1COWG 2X6BA 2EIMB 4X1KA 5H2FZ 4P30A 4MVRA 2WLLB 4LF6B 4GX5A 2CGOA 3UKMA 4L8JA 4BIZA 4RQFA 1QU7A 1FFXB 4J42A 4IIJB 3ABLC 5LOVB 1VF7A 1Q5OA 3K0DA 4BAYA 2NNUA 3RYIB 5IYZA 1M56C 1F51A 3CP1A 1URFA 4B3MB 5HFLA 2P6JA 3L71H 5KHIA 3E22A 4YXWG 4BW5A 3OEEG 4ZBMA 4UVBA 3B4SA 1BQ0A 4B7KA 3JCZA 4I55A 1IURA 2ADQB 2V7QG 4L87A 1WPXA 1MABG 1GN6A 3D3QA 3ASNB 1DLBA 1K97A 4CH5A 4WFAV 2NR5A 4DR6B 5E79Z 1SETA 1Q3EA 1N33O 1ZLZA 4Z1VA 3CCMV 3BA8A 4D7TA 5L3DA 4KFMA 2LFRA 4JYYA 1QCEA 4JTAB 4WBNB 4B3RO 2Y4UA 5BY1A 1V55B 4NXNO 1XNQB 1GKFA 1VQ9V 2CTQA 2UXCB 5GTHZ 1PL4A 4FK5C 4TV8B 1JQ0A 2DMXA 3SPIA 4O2BA 3P3PA 4DR1O 5LYJB 4X88A 4JTDB 5LOVA 1H38A 2YIBA 4FLWA 2FB5A 2EZPA 1YF2A 2LGQA 4JI0B 3OMAB 2GUZA 4LF8O 1S76D 1VQOV 1Y4MA 1YXBA 2N74A 4NB5A 4WFEA 2IU0A 1HNXB 2WWWA 1K4CC 3BFRA 1OCOB 3KCXA 5IYZB 3CEIA 3SR2C 4LH6A 4JI1O 2UXDO 3UT5B 1AI6A 2QKAA 3AEIA 3SYAA 5GTIZ 5LXTB 2Q73A 3IC9A 2OYQA 2Q7HA 1UJWB 4DW0A 3QVNA 1GM7A 4JYCA 3E8HA 3OGIB 1H2GA 1Q43A 3JD0A 5BR8O 5L3EA 1D2DA 3D8CA 3CRAA 3MDSA 5H6QA 3JAMN 2ZM6B 1OCCB 4U7NA 2F4VO 4K8ZA 2XASA 4H33A 3ZHRA 4GX0A 3L9DA 4PV1B 2GTSA 3BVOA 2GHYA 4QNHB 1OCZB 3W7WA 3T1YB 5KHJA 2BE3A 1N0NA 3MHSC 4XDKA 1VQPV 5LMUO 1KD1W 5DECA 2EULA 5LGNA 4YHHB 1SESA 3LDDA 1PP9H 2KKWA 1TUEB 4JZGA 4DV3B 3E83A 5IJ0A 4FLYA 3ZMTA 2E3CA 2X6AA 2AZ2A 1FJGO 2LGWA 4LF4B 3CC2V 2WLLA 2MK3A 4QJFB 5JVDB 3E89A 3ZRVA 2LFSA 3SDLA 1Y74B 4X8AA 4QPKA 4FM2A 2V4DA 4QPJA 4F4LA 1NZ6A 4PHZA 5LP6A 4J7ZA 5LL6Y 4B3TB 3CYOA 3E8GA 4YY3O 4X62B 2HP8A 4TUYB 4IHJA 1F7YA 3BCCH 4K3AA 5K1XA 3CD6V 1H2SB 4UCVA 3TK1A 1H2MA 2Q9LA 4PA6A 1JCHA 4DRXA 4N21A 4W4KA 4UFZA 2F93B 4UXNA 3UO2A 5HFMA 4LF7O 1K9MW 1XDCA 4OPHA 4GLXA 2JGUA 2RJZA 1N0JA 1SQBH 2YEVA 2O57A 1MSDA 2VWKA 3PJSK 2DE0X 3UQ8A 5H9CA 3UCSC 2JJ1G 1B06A 5CBHA 2QM7A 3RYFA 3S3XA 3BEHA 1W0JG 4ZIBA 5A9GA 3QO5A 4FLUA 1H8HG 3NR7A 3OR6C 1OCRC 1SF9A 5TISZ 5ITZB 4U3FH 4JI5O 1YIJV 5LP6C 2XUMA 1ZAUA 2CGNA 2LQTA 2OCCB 5LA6B 1SQXH 2YXYA 3RVZA 4FZ0A 1FD9A 5CBFA 1JOYA 3DC6A 5LGTA 1Y74A 1TVKB 5D5PA 1AJNA 4LH7A 4O2BB 3OGCC 3CCEV 3HPLC 2OCCC 1FKAO 4DV5O 3TJTA 1NBMG 3WB2A 5LP6B 1N34B 2YIDA 3GB7C 1IXMA 3FB8C 1OCZC 3ML0A 1WB8A 4MVSA 4CS4A 4DR2O 1KB9F 2JGDA 5BXZA 2Q8VA 2EJRA 2YUAA 4LC1A 2WLHA 2RN9A 3W7UA 3VQWA 4FLZA 2CH7A 1FS0G 1KECA 3A0HZ 1J5EO 3B2EE 4J41A 1Q82W 1NTKH 4JI3B 3R66A 4CH3A 1GN4A 1S5LZ 2PI4A 2QGNA 2M7WA 4KUMA 3K5LA 2Q7GA 1M1KW 2F95B 4AI8A 1YCIA 3IAYA 1XI1A 2QM4A 3FAVB 2UXCO 1WJZA 3X2QC 5KMGB 1IBKB 2VQFO 4XBFA 5CA0B 3D36C 4OX9O 4DR4O 4DUZO 2WLNA 2XT9A 5E1AC 1B04A 1P49A 1YJNV 3F5WC 2HJDA 2XAFA 1M56B 3JSNA 1SERA 4X1YB 1KQSU 4G28B 1QLNA 3VQYA 4MVMA 1V55C 3CJHB 1OZ0A 3BY6A 4IYHA 3K06A 3RYHB 1Q7YW 2DYRC 3JAWB 3T4DA 4OXSA 1P7GA 4DV0B 1RFYA 2P67A 1FFTB 1P84F 1I94O 3ZMVA 1HNWB 5C93A 3TXSA 1I7FA 2IJJA 2EINC 1IBLB 3CCLV 5KUKA 5JJJB 4DXWA 2DWDC 3WFVA 1OHHG 1XHXA 4JI6O 4TUYA 2CTWA 3WU2Z 1S0VA 2EIMC 5LMUB 4NTWA 4FJCC 4YIPA 2BOBC 2X0LA 1R6KA 4G2KA 1QVGU 4YJ3A 5KLVH 1SZXA 2FTKA 1XOUA 2Y48A 1SZTA 4JYAO 1MNGA 1LR1A 2CUGA 1ZSPA 2ZT9B 1K3EA 1THZA 1Z5WA 5CA1A 1F4NA 2UUBO 1HW7A 2LJ2A 4DR5B 1WB7A 3G67A 1FFXA 2ITDC 2KQXA 2BCCH 3L70H 4DV2B 5KHHA 4K0KB 5L3GA 1I5YA 2B9ZA 2ZXWC 3T1CA 4QE7A 4A5UB 2F66C 5IYDO 1IBMB 5JJNB 1JA8A 1WAZA 2D2CB 3JARB 2VQEB 1IXBA 4UCOA 5KX5A 3B40A 2X7RB 1AB3A 4TV9B 2DYSB 2N05A 4DV7O 4JAVA 4LWSB 5BZBA 2UU9B 4ICGA 4TT3G 4RUFA 2YIAA 2E5LB 4CS2A 3APOA 2Y69C 3P32A 3QTCA 1P7BA 1BT8A 4U3JA 3AG7A 4P9PA 1IBMO 3K04A 1HNZB 4ASUG 4WF9V 1WPBA 5H6RA 1H2LA 2QKCA 5FNVA 2W0XA 3EHBB 4LNUB 3MD0A 5B1AB 3ASNC 3CC4V 3QO7A 2V1DA 5AG2A 2VQFB 4HAMA 1WA8B 4UCUA 2UUBB 2AW9A 4CC5A 1NR7A 3LNMB 2GBOA 4DW1A 2DJVA 1YITV 1K5SA 2JEXA 2P22C 2CAZC 5J2UB 5GW7A 4DR7B 5CA0A 5C8YA 2Q7EA 4DK0A 1EFRG 2QWPB 2Q4PA 3JD2A 3DTUB 4GX2A 4IYIA 4JAAA 3JASB 3WB1A 3ZRWB 2QWNB 4DUZB 4JI7O 1G6UA 4TWKA 1SQVH 2IU3A 1Q90D 3EVKA 1BHAA 3SGIA 3RYCA 2VRZA 2YXLA 1BHBA 4QIWF 4J7KA 1GTOA 1YEWA 1VQKV 3J81N 2EIKC 1Y76B 5KMGA 3A0RA 2QDOA 5LMNO 3CRRA 3E22B 4B3MO 2HLDG 3IFXA 3W7XA 2WPDG 1BS3A 2PF4E 1R6TA 4PA9A 2Y69B 4DR4B 2JS3A 3TETA 1T5EA 2H3OA 1IBKO 2Z0AA 4FM0A 4X1YA 4DUYB 3H1IH 3WG7C 5EIBD 1TAEA 2M6YA 4UCSA 4GCZA 1Z2GA 4DR5O 1FXHA 3C90A 3CMAV 1RM1B 4LF7B 3GWKC 3VBBA 1SKVA 4PDRA 1GH6A 3O9OA 4UVAA 2ZE5A 1N8RW 3K59A 3I55V 4DR1B 2GDSA 2YI9A 4K35A 4OPAA 1WN7A 3ABTA 4DV5B 3JAKB 3ABMC 3ZJZA 2HEPA 4IHJB 2PYJA 4HBNA 4ABMA 4DR3O 2HG5C 2HVJC 3N2KA 4LFBO 4J10A 3RYCB 2CTRA 1Q8IA 4J11A 1VQ7V 4LFBB 4O2AB 2P06A 3L75H 4PELA 3RBZA 3U10A 1B6QA 3STLC 3VQXA 2GUZB 3JATA 2HHHB 3KCYA 5B66Z 3B09A 1E79G 5EZYB 1G1XB 2QM8A 5B3SB 4I0XB 3HKEA 3ICXA 1AJQA 4TOIA 1VEWA 1M5IA 4DV1B 2R72A 3K08A 2BSKA 4JV5B 4MVZA 2JK5C 4RWUA 4X65B 3F7YC 3ZCCA 4AQYB 2AGAA 3ZHQA 1S3JA 2UXNA 2PZSA 3Q4HB 2KG7A 4WFFA 3AK1A 4X62O 2QJ1A 4LFCO 2WAMA 2BTQA 2XAHA 1OJHA 2JVDA 5BMVB 3GVMA 4EB6B 1RPOA 2ADPA 3CB2A 4NKGB 3E8FA 1R6NA 2QTOA 1IDSA 3K79A 4NXMB 1TVKA 4TV9A 4X9QA 5KA5A 4DV0O 4KL1A 2UUCO 1Q81W 1US6A 4TSFG 1BCCH 1YJWV 4XDLA 1YJ9V 4LF6O 1V54C 4EFEA 2IH1C 3CRQA 1M93A 5C8YB 1KYOF 1QQCA 1I94B 1HNWO 1AI7A 1YI2V 1FJGB 4PI0A 4X66B 1KP2A 5B1OA 1SA0A 4JI1B 1YHQV 4E4EA 5GONB 3RW0A 3KZIZ 4DV3O 1R3IC 3P30A 4H13B 4PA4A 1QLEB 3K3WA 2A7WA 1PM9A 5JCOC 1AR5A 4R8CA 3STZC 3LDEA 2ZM6O 2JEUA 1QBZA 4CH4A 1LNQA 3D36A 4KHPB 5FL7G 2A9HA 4I9WA 3CXCU 1XUQA 2EIKB 3IGAC 2ARHA 2UU9O 3C3SA 1Z5VA 3T1HB 4E2LA 5EK0A 3ZMSA 3CC7V 2EBOA 4CH6A 2YEVB 4DV4B 3JCUZ 2HHHO 4B3SB 1LUWA 4HNAA 4FFBB 4MTGA 1GMGA 1EZVH 2QSAA 3UM7A 4LF9B 4GX1A 2AXTZ 1CPYA 5JQGB 4JTCB 5EC2C 1BQZA 1NU1H 1XMQO 4GKKB 1VARA 4NXNB 2DQ3A 5CA3A 3LNNA 3G80A 4FPPA 4P9OA 4LR3A 4IL6Z 5JWPA 2P4KA 1RSOB 4DO2A 1WP8A 1K8AW 2AZ0A 2FL4A 2FMLA 3ZRXA 2Z5UA 1VMGA 4DR6O 2A3QA 1PV0A 1Q6IA 2DW4A 4YJ2B 5B3SC 2QWQB 3SPHA 1GN2A 3SJBC 4B3RB 3CPWU 1JJ2U 1R1BA 2OIGA 5IYBO 2ZE6A 4GKJB 3BABA 1NQTA 1ZTEA 1GK9A 1SC5B 1AILA 5EYPB 3ZMUA 1KP3A 3VOUA 3H1JH 3HKCB 1D5NA 4X1IB 5L3BA 3SYQA 3RT3C 5JH7B 2XHBA 1BSMA 3HR0A 1QR9A 3FAVA 3OR7C 4I50B 4DR7O 3HKBA 3DSQA 1YSCA 3F7VC 2BTQB 3M7MX 3K0GA 3E8BA 2IJKA 1GM9A 3RYIA 5IT9N 4JI8B 2XNDG 4JI7B 1MMMA 2ATKC 3ZN0A 3H1LH 1VQ4V 2GV9A 3AG1C 1BL8A 3CXHF 4ZHQA 3FB6C 2UUCB 5LGUA 1ENVA 2QWOB 1AR1B 2P5OA 1FPOA 3FD9A 4D6TH 1M90W 3OTOO 5FLXN 1RSOA 3CCQV 3B8MA 2JIZG 2Q67A 3B8NA 3OUFA 4RQEA 2HFEC 3E35A 2N04A 2EIJB 1NTMH 5LBQA 3CSXA 5CN0A 4WFBV 4O4IA 2CE4A 2ZIMA 3OTFA 4MSWC 3TCUA 3CE2A 1ZL8A 3DGEA 4YJ3B 4PDLA 1J5EB 3QG5A 3SJQC 1W0KG 4J80A 2L35A 3PN1A 3JSLA 3JD3A 4JPRA 3FKSG 5CA1B 5JVDA 4WBNA 3U0ZA 2P90A 1XHZA 1HDJA 4BIUA 4EFBA 1AJPA 1EM1A 1UFIA 4R7CA 5D5QA 4X64B 4JI4O 3M8AA 4DV6B 5J2UA 1U96A 2E5LO 4UCTA 1AROP 4DK1A 2YC0A 1RPRA 1EZJA 3ZRSA 1XNQO 4X1KB 3RN4A 1CP9A 1VP7A 4I4TB 1CEZA 4JYBA 5DN6G 5J2TA 2PTMA 5A2QN 1RP3B 2FKXA 3L72H 4X66O 5EBLC 2CTPA 3R65A 5B1NA 1SQGA 1XNRO 2GSMB 3E2EA 1AP6A 1EN5A 4GKKO 1MA1A 2XTAA 1L1FA 2UXBO 1Y76A 3IC7A 3MHHC 1XEQA 2R9IA 2ZR2A 3FX7A 4NXMO 3T1HO 1H2KA 1ZL8B 1L0NH 2DN9A 3TXQA 4LNUA 5ITZA 1NT2B 1KMIZ 5DM6V 2ZNJA 5JCOA 4KHPO 4JF3A 3RFRA 3T4ZA 4KP4A 2IJIA 5F2VO 1R3KC 2LW7A 1HR0O 4FIPC 1MG1A 3LSSA 3H1KH 3APQA 3JD4A 2ZR3A 3AG4C 5IWAO 2K1EA 1H2NA 3CRCA 3OFNG 1SQFA 3G71V 4DV2O 3DXRA 2K9PA 3FB5C 1NVPD 2W0FC 2YSUB 1YTFD 1JFFA 3H9VA 4Z1MG 1M57C 3VQVA 2QE7G 1DF5A 1XQ8A 2JRIA 4FFKA 3CHXA 2C2AA 2ZXWB 1F23A 1JR9A 2E76B 2NLJC 2E75B 2MW2B 3JAKA 2CH7B 2IJHA 4J7JA 1HWYA 2PY5A 3OM3B 1M57B 2L6LA 2PUSA 3G6BA 3U11A 3OTOB 4HZ3A 3CX5F 1HP8A 4MW8A 2F1MA 3ABKC 4YJ2A 4AQYO 1ZWIC 4LP8A 2UXXA 3JATB 4IGGA 4JI6B 1SQPH 2Q5ZA 1K33A 2ITCC 3AG4B 4ZOLB 4ZHQB 2W6JG 4DRXB 4FLXA 3HKEB 3UT5A 1QHTA 2RCVA 4FLVA 1S5JA 4KXRA 4LF4O 1AI5A 1XMOO 2GTAA 3THOA 1XBLA 3QNEA 4NVPA 3AG3B 4PDVA 2P4VA 3ABKB 2LP7A 3N27A 2HJFC 1HNXO 1JPXA 2RNBA 1TGOA 2Z3YA 4UCRA 3OAAG 4RO2A 1S72V 5IY5B 5JH7A 4DR2B 1KBHA 4W4LA 3ZHSA 1HR0B 4UB6Z 1MOFA 3OEHG 2Q69A 1OCOC 3CJHA 2DYRB 4DV6O 3K5OA 4EB6A 1AP5A 1FXKB 2OCHA 3CWBH 1K4DC 4LCUC 1VQ6V 4F6RB 4MW3A 5LHHA 4ZKIA 4WCEV 1K5QA 1N32O 1Q6UA 4FVMA 1EN4A 4JI2O 4DUYO 4X64O 4JI4B 1R3LC 4RUEA 1I08A 1FXKC 4TQDA 2H94A 4LF5O 3AK2A 2EILB 2BOCC 3OD4A 2ZNIA 1DF4A 4K0KO 5J2TB 4DV4O 1CXZB 2IBZH 3L74H 3ABUA 1D5AA 3ZN1A 4JI5B 2ZE7A 4R6ZA 1ROPA 2R9AA 5FPOA 4UV8A 4MTXA 4LF9O 1N4CA 4YY3B 1Y66A 3BAAA 1Q86W 4O2AA 1J95A 2LO1A 4O4HB 4JI8O 4FLTA 3A8TA 4XDJA 2F23A 5B1AC 1XL6A 1E1QG 4IIJA 2ZKOA 4UV9A 2HKOA 1NI8A 1A32A 1EBOA 3SJCC 2EX3A 3LUTB 4CC6A 2HVKC 4B7EA 1YZBA 3O65A 5K1PA 1GRJA 2E74B 2UUAB 1FAFA 4Q20A 5EIBC 3B77A 3OMIB 3JARA 3HKDB 4I4TA 4LFAO 4UB8Z 2QEXV 1PKXA 2H8PC 4YHHO 2W6IG 1N36B 3SYPA 4LFCB 1NKDA 2DYSC 1N33B 3FFQA 4GZRB 1HNZO 2OT5A 3AK3A 1NS1A 2XAJA 1M4UA 3JYCA 1I5XA 4JASA 3BA9A 3RYFB 3W7SA 5J9PC 1K73W 1QVFU 4Z2WA 2Q0AA 3OW2U 3LDCA 4X65O 3ETDA 1GN3A 4J9ZB 3RYHA 2RDCA 2YIBD 1SA0B 1QR8A 2ZD9A 1N36O 2OIEA 2WLIB 1NR1A 4CBCA 3FYIB 3A0BZ 2YS8A 4TQFA 4PA3A 2Y0IA 3LSUA 2EIJC 4UVCA 3CCJV 3S3WA 3C3TA 5KAIZ 1SQQH 3SYCA 2IH3C 2JGDB 3FB7C 4F6EA 2WLKA 3QO8A 3BHPA 3K5MA 2QA4V 2G38A 1LUVA 4DV1O 1JFFB 3AG1B 1L0LH 1IZ3A 4B08A 3ETGA 3ZX6A 1V54B 3JASA 2X6CA 4GUNA 4TV8A 3RWRD 4LF8B 3AG2B 1W2BU 1VF5B 1L8DA 1JJOA 4AHCA 2Q0OC 1N32B 2CDYA 2B1IA 2R70A 3OUSA 2ZE8A 2A06H 1SS3A 4YIOA 3SPCA 2EILC 3DC5A 1QNMA 4D7SA 4PD4F 5EBMC 1N34O 5KX5B 1K7DA 4JI2B 2VQEO 1H8EG 1W59A 4ZOLA 4PI2A 3JALB 5IJ9A 5LMNB 3ZBHA 3D3IA 3BRCA 4WFHA 3IJ4A 4FFBA 5IY5C 4EKWA 1ZX3A 3CCRV 4I9QA 2F4VB 2WLIA 1KKCA 1M9NA 4NTYA 4CS3A 1R73A 3CMEV 1XMQB 1FYJA 1RM1C 3H1HH 4I55B 3K57A 1NH2D 3ZIAG 4JAUA 1MZEA 4G27B 3QF7A 4U3JB 1ORQC 2KSDA 1OCCC 4HYOA 4O4JB 4O4LB 4R50A 5FNVB 5B1BB 2XOKG 1VQMV 2UXDB 4RAIA 1DTOA 2WLJA 4ZI7A 1B3QA 2R9RB 1IBLO 2F43G 4OX9B 3WB0A 4JI0O 1WA8A 2OWOA 2HR3A 1PL0A 3K9AA 5B1BC 1V9PA 4O4HA 1BMFG 4GYCB 3ABMB 2DOSA 1XL4A 1KKDA 4CZZA 3K5NA 1P4RA 1MZFA 1NTZH 1U97A 4JI3O 3ZMZA 3T2MA 2ZINA 2Y0PA 1PNMA 1ZUQA 2BTOA 5EYPA 1AVMA 5B5EZ 4JV5O 2D3OW 3E86A 5EZYA 4I7ZB 1IX9A 5IWAB 4NTXA 4MVQA 1R3JC 2WA3A 1TUBA 2DWEC 4MT8A 5LXTA 3CS5A 4I50A 4BR6A 1VF6A 3GWOA 3HKBB 3M99B 1VQ8V 3T1YO 1OV9A 1NJIW 2Q6AA 4LBEC 4PJ0Z 3ZHVA 2ILMA 3FYEB 1QLEC 4MTOA 4DV7B 3AG2C 5CMUA 1F4MA 2B5UA 1VQLV 3I56V 4PDMA 1WLEA 2ZQMA 5LHGA 2YDEA 4I5SA 5BMVA 1AR4A 1G8MA 1S5HC 1UPGA 3KG2A 1Y6XA 3N2GA 1AI4A 1WNSA 2QTSA 2OTJV 4NR1A 1NH2B 3F5TA 3OE7G 4MVOA 2UUAO 5KAFZ 3CCVV 2CK3G 1PPJH 4LF5B 3HB3B 2XAQA 1S77D 4C7UA 4JGSA 2AHZA 3DXRB 4B3SO 3I5DA 3J7AU 2ETNA 4X89A 2JDIG 3EXAA 2IM9A 5LA6A 1XILA 5CB4B 1JVMA 1O9GA 3LSQA 1KUQA 1SRYA 5GONA 1JX9A 4EEQA 1BGYH 5IE9A 2YXHA 3OMNB 3MAQA 2EJ7A 3SPGA 1X59A 3N2KB 2VS0A 2JS5A 3WG7B 3ZS8C 4P2ZA 1O9HA 2EZOA 3ZRWA
chains in the Genus database with same CATH topology
2ITCC 3AG4B 4N21A 2W6JG 4UXNA 4U7OA 1E79G 5HFMA 1E1RG 2QM8A 5B3SB 5IYCO 4N23A 4MTFA 1AJQA 1AI5A 3QNEA 1K9MW 3K08A 3AG3B 1FXVA 4PDVA 3ABKB 2LP7A 2HJFC 2YEVA 1JPXA 4MVZA 2JK5C 3AG3C 4H37A 2Z3YA 3F7YC 3ZCCA 4UUJC 1VQNV 3OAAG 3PJSK 4RO2A 5IY5B 1S72V 4GT1A 3JD1A 1S3JA 2UXNA 5H9CA 2JJ1G 5CBHA 2QM7A 4WFFA 1MOFA 3OEHG 2Q69A 3BEHA 1W0JG 1OCOC 3QO5A 2DYRB 1H8HG 2WAMA 3OR6C 2XAHA 1OCRC 5KA6A 3SYOA 5L3FA 1FXKB 1RPOA 1GM8A 1YIJV 1K4DC 3E8FA 4LCUC 1GO3F 5IDJA 2OCCB 1VQ6V 1R6NA 2QTOA 3K79A 3RVZA 2ZDIC 4MW3A 5LHHA 5CBFA 4ZKIA 4WCEV 1K5QA 3G6EV 5LHIA 1YTFB 1JOYA 5KA5A 5LGTA 1VQ5V 1AJNA 3OGCC 3CCEV 1NVPB 3HPLC 2OCCC 1NBMG 2PI5A 1Q81W 1R3LC 3GB7C 4RUEA 4TSFG 1FXKC 1IXMA 2IW5A 1YJWV 2KB1A 4XDLA 1YJ9V 3FB8C 1V54C 1OCZC 2H94A 2IH1C 3ML0A 1PNLA 2EILB 2BOCC 4MVSA 1OCRB 3ASOB 1AI7A 1YI2V 1KP2A 5B1OA 1DF4A 2EJRA 4LC1A 2WLHA 3W7UA 5EBWC 1YHQV 3RW0A 3CCUV 1PNKA 2P7TC 1R3IC 3ABUA 3ZN1A 3P30A 4PA4A 1FS0G 1QLEB 3K3WA 1KECA 1G4YB 4R6ZA 1Q82W 3SPJA 1ROPA 3G4SV 4R8CA 4UV8A 4MTXA 3STZC 3LDEA 5L3CA 2OTLV 2PI4A 2JEUA 3H01A 1QBZA 1Y66A 1LNQA 2M7WA 3D36A 4KUMA 3X2QB 1Q86W 1J95A 5FL7G 4XDJA 5B1AC 1XL6A 2A9HA 1E1QG 4I9WA 3CXCU 1M1KW 5EC1C 4UV9A 2HKOA 2EIKB 2EINB 3IGAC 3ASOC 1EBOA 3X2QC 3LUTB 4XBFA 2HVKC 4E2LA 5EK0A 3ZMSA 2AHYA 3CC7V 4Q20A 3B77A 2EBOA 3OMIB 2WLNA 2YEVB 2QEXV 1PKXA 2H8PC 5E1AC 1KC8W 2A0LA 2W6IG 3SYPA 4MTGA 1GMGA 1YJNV 1NKDA 2DYSC 3F5WC 4WFGA 2OT5A 3EFFK 3UM7A 2XAFA 2XAJA 1M56B 4GX1A 2ZDIA 1SERA 4MS2A 3JYCA 1I5XA 4JASA 1KQSU 1CPYA 4G28B 3W7SA 1QLNA 4JTCB 3RVYA 2DQ0A 4FMTA 2A79B 4MVMA 5J9PC 1K73W 1QVFU 1V55C 5EC2C 3CCSV 3LDCA 1OZ0A 3OW2U 3BY6A 3ETDA 4QE9A 3K06A 1FXKA 4J9ZB 1Q7YW 2DYRC 4MVUA 3T4DA 4OXSA 2DQ3A 4PA7A 5CA3A 2Q68A 2P67A 1FFTB 4FPPA 3ZMVA 5C93A 4P9OA 3ABLB 2IJJA 1K92A 1QR8A 2EINC 2ZD9A 5KUMA 3W7TA 2WLIB 4DO2A 1NR1A 4CBCA 5KUKA 3CCLV 1K34A 1K8AW 3FYIB 4DXWA 2DWDC 5CBGA 3ZRXA 3WFVA 1OHHG 2JJ2G 4PA3A 3NXSA 1PD3A 2Z5UA 1S0VA 3K03A 2EIJC 4UVCA 3CCJV 2EIMC 2WSSG 2XAGA 2B1GA 2DW4A 4FJCC 3SYCA 2IH3C 2BOBC 5B3SC 3SPHA 2X0LA 1R6KA 4G2KA 1QVGU 3CPWU 1JJ2U 3FB7C 2WLKA 2FTKA 3ETEA 5IYBO 2Y48A 3QO8A 1SZTA 2QA4V 1MSWD 2WLMA 4J9YB 2QKSA 1COWG 3AG1B 2X6BA 2EIMB 1NQTA 1GK9A 1K3EA 1THZA 4P30A 1F4NA 3ETGA 4MVRA 1V54B 2WLLB 4GX5A 3ZMUA 1KP3A 3VOUA 2X6CA 2ITDC 3UKMA 4BIZA 3AG2B 1W2BU 4RQFA 5L3BA 3SYQA 5L3GA 1QR9A 1I5YA 2B1IA 3ABLC 3OR7C 2ZXWC 3OUSA 3T1CA 4QE7A 3K0DA 3SPCA 4BAYA 5IYDO 1YSCA 2EILC 3F7VC 2NNUA 3K0GA 5EBMC 3E8BA 2IJKA 1GM9A 1K7DA 2XNDG 2ATKC 3ZN0A 1H8EG 1VQ4V 2X7RB 1M56C 1F51A 3AG1C 1BL8A 3CP1A 3FB6C 5LGUA 1ENVA 3D3IA 5HFLA 2P6JA 1AR1B 4WFHA 5IY5C 4EKWA 1M90W 2DYSB 4YXWG 4BW5A 3OEEG 4JAVA 4UVBA 2WLIA 4ZBMA 5BZBA 1M9NA 3CCQV 3CCRV 4TT3G 4RUFA 3JCZA 3CMEV 1R73A 3B8MA 2JIZG 2Q67A 3B8NA 3OUFA 4RQEA 1RM1C 2V7QG 1NH2D 4L87A 2HFEC 1WPXA 2Y69C 3P32A 4JAUA 3E35A 3ZIAG 1MABG 2EIJB 1P7BA 3ASNB 1DLBA 5LBQA 1K97A 4G27B 4P9PA 4WFAV 5CN0A 3K04A 4WFBV 4ASUG 4WF9V 1SETA 1ORQC 5H6RA 4MSWC 1OCCC 3TCUA 4HYOA 3DGEA 4R50A 3CCMV 5B1BB 2XOKG 4PDLA 1VQMV 3EHBB 4RAIA 1DTOA 5L3DA 4KFMA 3SJQC 2LFRA 2WLJA 1W0KG 3MD0A 5B1AB 2R9RB 3ASNC 3CC4V 3QO7A 1QCEA 2F43G 3JD3A 2V1DA 4JTAB 4JPRA 3FKSG 2HR3A 4HAMA 2P90A 1PL0A 1V55B 1NR7A 1GKFA 1VQ9V 3K9AA 4BIUA 1AJPA 5B1BC 1BMFG 4FK5C 1JQ0A 3ABMB 3LNMB 4R7CA 3SPIA 1XL4A 1KKDA 4CZZA 1YITV 1K5SA 2JEXA 4X88A 1P4RA 4JTDB 1AROP 1H38A 3ZRSA 1RPRA 1EZJA 5GW7A 2EZPA 3ZMZA 3T2MA 1PNMA 1EFRG 3JD2A 3DTUB 3OMAB 4GX2A 1S76D 1CP9A 1VQOV 1Y4MA 3ZRWB 2IU0A 4WFEA 4JYBA 5DN6G 1CEZA 2WWWA 1K4CC 2D3OW 1OCOB 4TWKA 3E86A 1AI6A 2IU3A 3AEIA 3SYAA 5EBLC 4MVQA 3R65A 1R3JC 1BHAA 5B1NA 1UJWB 4MT8A 2DWEC 2GSMB 1GM7A 4JYCA 1BHBA 3E2EA 3GWOA 3M99B 1VQ8V 4QIWF 3E8HA 1H2GA 3JD0A 5L3EA 1NJIW 2Q6AA 1GTOA 4LBEC 1L1FA 5H6QA 1VQKV 2EIKC 3IC7A 3MHHC 2R9IA 3FYEB 1QLEC 4MTOA 2ZR2A 1OCCB 3AG2C 4U7NA 5CMUA 1F4MA 2B5UA 1VQLV 3I56V 4PDMA 1WLEA 2XASA 4H33A 3A0RA 4GX0A 2ZQMA 5LHGA 2HLDG 4I5SA 3IFXA 1G8MA 1S5HC 3KG2A 2GHYA 3W7XA 2WPDG 5DM6V 1AI4A 2OTJV 4QNHB 1OCZB 4PA9A 3W7WA 2Y69B 1NH2B 3OE7G 4JF3A 4MVOA 3CCVV 4XDKA 3MHSC 2CK3G 4KP4A 2IJIA 3T4ZA 1R3KC 3HB3B 3TETA 1VQPV 4FIPC 2XAQA 1S77D 1MG1A 3LSSA 3JD4A 1KD1W 2ZR3A 3AG4C 4JGSA 2AHZA 2K1EA 5LGNA 1SESA 3OFNG 3G71V 3LDDA 3WG7C 1NVPD 3FB5C 4X89A 1TUEB 2W0FC 2YSUB 3E83A 1YTFD 4GCZA 4Z1MG 2JDIG 1FXHA 1M57C 3ZMTA 2QE7G 1DF5A 3CMAV 1RM1B 2X6AA 3VBBA 3CC2V 2WLLA 4PDRA 2C2AA 2MK3A 2ZXWB 4UVAA 1JVMA 4QJFB 3E89A 3LSQA 3ZRVA 1F23A 1SRYA 2LFSA 1JX9A 1N8RW 3I55V 2NLJC 4X8AA 4QPKA 4QPJA 3ABTA 4F4LA 2IJHA 3ABMC 3ZJZA 1HWYA 3OMNB 3CYOA 3E8GA 2HG5C 2HVJC 3OM3B 3SPGA 1M57B 1VQ7V 4HZ3A 4MW8A 3ABKC 3CD6V 1ZWIC 4LP8A 4PELA 3TK1A 2UXXA 3RBZA 3WG7B 1B6QA 4PA6A 3STLC 4P2ZA 1JCHA 1K33A 2EZOA 3ZRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITC C;  2ITD C;  3UKM A;  4TWK A;  3E86 A;  5EC1 C;  3SYQ A;  3IGA C;  3SYA A;  3ASO C;  3ABL C;  3OR7 C;  5EBL C;  2ZXW C;  3OUS A;  3R65 A;  1R3J C;  4MVQ A;  4QE7 A;  3T1C A;  3X2Q C;  3LUT B;  4MTF A;  3K0D A;  2HVK C;  2DWE C;  3SPC A;  5EK0 A;  2EIL C;  3F7V C;  2AHY A;  3K08 A;  3E8H A;  4PDV A;  3K0G A;  5EBM C;  2WLN A;  2HJF C;  2YEV A;  3E8B A;  2Q6A A;  2JK5 C;  4MVZ A;  3AG3 C;  4H37 A;  4LBE C;  3F7Y C;  2ATK C;  4UUJ C;  2H8P C;  1M56 C;  5E1A C;  2A0L A;  3AG1 C;  1BL8 A;  2EIK C;  3PJS K;  4RO2 A;  3FB6 C;  3SYP A;  1QLE C;  4MTO A;  4MTG A;  3AG2 C;  2DYS C;  3F5W C;  4WFH A;  4WFG A;  5IY5 C;  4EKW A;  4WFF A;  3EFF K;  3UM7 A;  4PDM A;  5CBH A;  4GX1 A;  2Q69 A;  4BW5 A;  4H33 A;  3JYC A;  4MS2 A;  3BEH A;  4ZBM A;  2WLI A;  1OCO C;  4GX0 A;  5BZB A;  4G28 B;  4RUF A;  3OR6 C;  4JTC B;  3RVY A;  5J9P C;  2A79 B;  3IFX A;  1S5H C;  1OCR C;  2Q67 A;  1V55 C;  3KG2 A;  3OUF A;  4MVM A;  3LDC A;  5EC2 C;  3SYO A;  2HFE C;  2Y69 C;  4QE9 A;  4QNH B;  3K06 A;  4PA9 A;  1P7B A;  1K4D C;  4J9Z B;  3E8F A;  4LCU C;  2DYR C;  4MVU A;  4G27 B;  4OXS A;  4P9P A;  4MVO A;  3T4D A;  2QTO A;  4PA7 A;  4XDK A;  3T4Z A;  2Q68 A;  3RVZ A;  1R3K C;  3K04 A;  3TET A;  4MW3 A;  5CBF A;  1ORQ C;  4P9O A;  4MSW C;  1OCC C;  3TCU A;  4HYO A;  3AG4 C;  2EIN C;  2ZD9 A;  4R50 A;  2AHZ A;  5KUM A;  2K1E A;  2WLI B;  5KUK A;  4PDL A;  4CBC A;  3OGC C;  3LDD A;  4RAI A;  3SJQ C;  4KFM A;  3WG7 C;  3HPL C;  2OCC C;  2WLJ A;  3FB5 C;  4DXW A;  4X89 A;  2DWD C;  2R9R B;  2W0F C;  3ASN C;  5CBG A;  3E83 A;  1R3L C;  3GB7 C;  4RUE A;  4PA3 A;  1M57 C;  4JTA B;  2KB1 A;  4XDL A;  3FB8 C;  3K03 A;  1V54 C;  1OCZ C;  2EIJ C;  2IH1 C;  2X6A A;  2EIM C;  2WLL A;  2BOC C;  4PDR A;  4MVS A;  2IH3 C;  2BOB C;  3SYC A;  1JVM A;  3SPH A;  5B3S C;  3E89 A;  5B1B C;  2WLH A;  2NLJ C;  4X8A A;  5EBW C;  3FB7 C;  3RW0 A;  3SPI A;  3LNM B;  2WLK A;  4R7C A;  2P7T C;  1XL4 A;  1KKD A;  1R3I C;  4F4L A;  3ABM C;  4PA4 A;  3ZJZ A;  2WLM A;  4J9Y B;  4X88 A;  1G4Y B;  4JTD B;  2QKS A;  3E8G A;  4R6Z A;  2X6B A;  2HG5 C;  2HVJ C;  3ZRS A;  3SPJ A;  3SPG A;  4P30 A;  4R8C A;  3STZ C;  3LDE A;  4HZ3 A;  4MVR A;  3T2M A;  2WLL B;  3ABK C;  4MW8 A;  4GX5 A;  1ZWI C;  4LP8 A;  1LNQ A;  4GX2 A;  3VOU A;  3RBZ A;  1J95 A;  2X6C A;  4PA6 A;  3STL C;  4P2Z A;  4WFE A;  4XDJ A;  5B1A C;  1K4C C;  1XL6 A;  2A9H A;  4I9W A; 
#chains in the Genus database with same CATH topology
 3JAL A;  5IJ9 B;  2FYU H;  1TA8 A;  4U7O A;  1E1R G;  5IYC O;  1XRE A;  4N23 A;  4MTF A;  5KHG A;  2BSK B;  1FXV A;  2NN4 A;  4BIO A;  4OGQ B;  2QWR B;  3AG3 C;  4H37 A;  1VQN V;  4UUJ C;  3UO3 A;  1DK1 A;  2ZCE A;  4GT1 A;  3JD1 A;  4H44 B;  2KG7 B;  3ZED A;  3P3N A;  1XMO B;  3ETQ A;  4NYK A;  4O4J A;  4O4L A;  3Q4H A;  5JQG A;  1YDX A;  4ZI7 B;  5KA6 A;  4LFA B;  3SYO A;  5L3F A;  1GM8 A;  4K8X A;  2LW1 A;  4F6R A;  1GO3 F;  1VF6 C;  4BW9 A;  5IDJ A;  2ZDI C;  1YVW A;  5CB4 A;  5KHK A;  3G6E V;  5LHI A;  2YI8 A;  1YTF B;  5JJE B;  3TGU H;  1VQ5 V;  1Q6H A;  1NVP B;  4B3T O;  2PI5 A;  5LYJ A;  2IW5 A;  2QR4 A;  2KB1 A;  3JAW A;  1XNR B;  1PNL A;  3ZHT A;  2VWJ A;  4X20 B;  1OCR B;  3ASO B;  3ZHU A;  2PYL A;  4GKJ O;  5EBW C;  3CCU V;  1PNK A;  2P7T C;  1JMK C;  3OT7 A;  2ZIO A;  1G4Y B;  2ODM A;  3SPJ A;  3G4S V;  5L3C A;  2OTL V;  3HKC A;  3H01 A;  2YIC A;  3X2Q B;  4FZ1 A;  1Y67 A;  4X1I A;  5BR8 B;  5EC1 C;  2WA4 A;  2EIN B;  3ASO C;  4AIL C;  1KU9 A;  4I0X A;  2AHY A;  3HKD A;  3J80 N;  2UXB B;  3K9S A;  4IT5 A;  1KC8 W;  4HNA B;  2A0L A;  1BZK A;  2PGG A;  5DED A;  4H0L B;  3A2F A;  4WFG A;  4LWS A;  3EFF K;  1EN6 A;  2ZDI A;  3KKY A;  4MS2 A;  1DGS A;  1X4T A;  1TUB B;  4JYA B;  3RVY A;  2DQ0 A;  4FMT A;  2A79 B;  4DR3 B;  4QGP A;  3CCS V;  4QE9 A;  5IJ0 B;  1FXK A;  4BWA A;  4MVU A;  4O4I B;  2Y4T A;  4PA7 A;  2Q68 A;  1BE3 H;  4X20 A;  2RQ6 A;  3ABL B;  1K92 A;  1VIB A;  5KUM A;  3W7T A;  4Q6G A;  1K34 A;  3SJA C;  4FM1 A;  5CBG A;  3N2G B;  2JJ2 G;  4JZ2 A;  3NXS A;  1PD3 A;  3RGB A;  3K03 A;  2RMK B;  3K58 A;  1IVS A;  2WSS G;  2XAG A;  4DYL A;  2B1G A;  1I0H A;  3CRM A;  3BPZ A;  3ETE A;  3L73 H;  1MSW D;  1GAX A;  1WP7 A;  2WLM A;  4J9Y B;  5FPR A;  5H5N A;  2QKS A;  1COW G;  2X6B A;  2EIM B;  4X1K A;  5H2F Z;  4P30 A;  4MVR A;  2WLL B;  4LF6 B;  4GX5 A;  2CGO A;  3UKM A;  4L8J A;  4BIZ A;  4RQF A;  1QU7 A;  1FFX B;  4J42 A;  4IIJ B;  3ABL C;  5LOV B;  1VF7 A;  1Q5O A;  3K0D A;  4BAY A;  2NNU A;  3RYI B;  5IYZ A;  1M56 C;  1F51 A;  3CP1 A;  1URF A;  4B3M B;  5HFL A;  2P6J A;  3L71 H;  5KHI A;  3E22 A;  4YXW G;  4BW5 A;  3OEE G;  4ZBM A;  4UVB A;  3B4S A;  1BQ0 A;  4B7K A;  3JCZ A;  4I55 A;  1IUR A;  2ADQ B;  2V7Q G;  4L87 A;  1WPX A;  1MAB G;  1GN6 A;  3D3Q A;  3ASN B;  1DLB A;  1K97 A;  4CH5 A;  4WFA V;  2NR5 A;  4DR6 B;  5E79 Z;  1SET A;  1Q3E A;  1N33 O;  1ZLZ A;  4Z1V A;  3CCM V;  3BA8 A;  4D7T A;  5L3D A;  4KFM A;  2LFR A;  4JYY A;  1QCE A;  4JTA B;  4WBN B;  4B3R O;  2Y4U A;  5BY1 A;  1V55 B;  4NXN O;  1XNQ B;  1GKF A;  1VQ9 V;  2CTQ A;  2UXC B;  5GTH Z;  1PL4 A;  4FK5 C;  4TV8 B;  1JQ0 A;  2DMX A;  3SPI A;  4O2B A;  3P3P A;  4DR1 O;  5LYJ B;  4X88 A;  4JTD B;  5LOV A;  1H38 A;  2YIB A;  4FLW A;  2FB5 A;  2EZP A;  1YF2 A;  2LGQ A;  4JI0 B;  3OMA B;  2GUZ A;  4LF8 O;  1S76 D;  1VQO V;  1Y4M A;  1YXB A;  2N74 A;  4NB5 A;  4WFE A;  2IU0 A;  1HNX B;  2WWW A;  1K4C C;  3BFR A;  1OCO B;  3KCX A;  5IYZ B;  3CEI A;  3SR2 C;  4LH6 A;  4JI1 O;  2UXD O;  3UT5 B;  1AI6 A;  2QKA A;  3AEI A;  3SYA A;  5GTI Z;  5LXT B;  2Q73 A;  3IC9 A;  2OYQ A;  2Q7H A;  1UJW B;  4DW0 A;  3QVN A;  1GM7 A;  4JYC A;  3E8H A;  3OGI B;  1H2G A;  1Q43 A;  3JD0 A;  5BR8 O;  5L3E A;  1D2D A;  3D8C A;  3CRA A;  3MDS A;  5H6Q A;  3JAM N;  2ZM6 B;  1OCC B;  4U7N A;  2F4V O;  4K8Z A;  2XAS A;  4H33 A;  3ZHR A;  4GX0 A;  3L9D A;  4PV1 B;  2GTS A;  3BVO A;  2GHY A;  4QNH B;  1OCZ B;  3W7W A;  3T1Y B;  5KHJ A;  2BE3 A;  1N0N A;  3MHS C;  4XDK A;  1VQP V;  5LMU O;  1KD1 W;  5DEC A;  2EUL A;  5LGN A;  4YHH B;  1SES A;  3LDD A;  1PP9 H;  2KKW A;  1TUE B;  4JZG A;  4DV3 B;  3E83 A;  5IJ0 A;  4FLY A;  3ZMT A;  2E3C A;  2X6A A;  2AZ2 A;  1FJG O;  2LGW A;  4LF4 B;  3CC2 V;  2WLL A;  2MK3 A;  4QJF B;  5JVD B;  3E89 A;  3ZRV A;  2LFS A;  3SDL A;  1Y74 B;  4X8A A;  4QPK A;  4FM2 A;  2V4D A;  4QPJ A;  4F4L A;  1NZ6 A;  4PHZ A;  5LP6 A;  4J7Z A;  5LL6 Y;  4B3T B;  3CYO A;  3E8G A;  4YY3 O;  4X62 B;  2HP8 A;  4TUY B;  4IHJ A;  1F7Y A;  3BCC H;  4K3A A;  5K1X A;  3CD6 V;  1H2S B;  4UCV A;  3TK1 A;  1H2M A;  2Q9L A;  4PA6 A;  1JCH A;  4DRX A;  4N21 A;  4W4K A;  4UFZ A;  2F93 B;  4UXN A;  3UO2 A;  5HFM A;  4LF7 O;  1K9M W;  1XDC A;  4OPH A;  4GLX A;  2JGU A;  2RJZ A;  1N0J A;  1SQB H;  2YEV A;  2O57 A;  1MSD A;  2VWK A;  3PJS K;  2DE0 X;  3UQ8 A;  5H9C A;  3UCS C;  2JJ1 G;  1B06 A;  5CBH A;  2QM7 A;  3RYF A;  3S3X A;  3BEH A;  1W0J G;  4ZIB A;  5A9G A;  3QO5 A;  4FLU A;  1H8H G;  3NR7 A;  3OR6 C;  1OCR C;  1SF9 A;  5TIS Z;  5ITZ B;  4U3F H;  4JI5 O;  1YIJ V;  5LP6 C;  2XUM A;  1ZAU A;  2CGN A;  2LQT A;  2OCC B;  5LA6 B;  1SQX H;  2YXY A;  3RVZ A;  4FZ0 A;  1FD9 A;  5CBF A;  1JOY A;  3DC6 A;  5LGT A;  1Y74 A;  1TVK B;  5D5P A;  1AJN A;  4LH7 A;  4O2B B;  3OGC C;  3CCE V;  3HPL C;  2OCC C;  1FKA O;  4DV5 O;  3TJT A;  1NBM G;  3WB2 A;  5LP6 B;  1N34 B;  2YID A;  3GB7 C;  1IXM A;  3FB8 C;  1OCZ C;  3ML0 A;  1WB8 A;  4MVS A;  4CS4 A;  4DR2 O;  1KB9 F;  2JGD A;  5BXZ A;  2Q8V A;  2EJR A;  2YUA A;  4LC1 A;  2WLH A;  2RN9 A;  3W7U A;  3VQW A;  4FLZ A;  2CH7 A;  1FS0 G;  1KEC A;  3A0H Z;  1J5E O;  3B2E E;  4J41 A;  1Q82 W;  1NTK H;  4JI3 B;  3R66 A;  4CH3 A;  1GN4 A;  1S5L Z;  2PI4 A;  2QGN A;  2M7W A;  4KUM A;  3K5L A;  2Q7G A;  1M1K W;  2F95 B;  4AI8 A;  1YCI A;  3IAY A;  1XI1 A;  2QM4 A;  3FAV B;  2UXC O;  1WJZ A;  3X2Q C;  5KMG B;  1IBK B;  2VQF O;  4XBF A;  5CA0 B;  3D36 C;  4OX9 O;  4DR4 O;  4DUZ O;  2WLN A;  2XT9 A;  5E1A C;  1B04 A;  1P49 A;  1YJN V;  3F5W C;  2HJD A;  2XAF A;  1M56 B;  3JSN A;  1SER A;  4X1Y B;  1KQS U;  4G28 B;  1QLN A;  3VQY A;  4MVM A;  1V55 C;  3CJH B;  1OZ0 A;  3BY6 A;  4IYH A;  3K06 A;  3RYH B;  1Q7Y W;  2DYR C;  3JAW B;  3T4D A;  4OXS A;  1P7G A;  4DV0 B;  1RFY A;  2P67 A;  1FFT B;  1P84 F;  1I94 O;  3ZMV A;  1HNW B;  5C93 A;  3TXS A;  1I7F A;  2IJJ A;  2EIN C;  1IBL B;  3CCL V;  5KUK A;  5JJJ B;  4DXW A;  2DWD C;  3WFV A;  1OHH G;  1XHX A;  4JI6 O;  4TUY A;  2CTW A;  3WU2 Z;  1S0V A;  2EIM C;  5LMU B;  4NTW A;  4FJC C;  4YIP A;  2BOB C;  2X0L A;  1R6K A;  4G2K A;  1QVG U;  4YJ3 A;  5KLV H;  1SZX A;  2FTK A;  1XOU A;  2Y48 A;  1SZT A;  4JYA O;  1MNG A;  1LR1 A;  2CUG A;  1ZSP A;  2ZT9 B;  1K3E A;  1THZ A;  1Z5W A;  5CA1 A;  1F4N A;  2UUB O;  1HW7 A;  2LJ2 A;  4DR5 B;  1WB7 A;  3G67 A;  1FFX A;  2ITD C;  2KQX A;  2BCC H;  3L70 H;  4DV2 B;  5KHH A;  4K0K B;  5L3G A;  1I5Y A;  2B9Z A;  2ZXW C;  3T1C A;  4QE7 A;  4A5U B;  2F66 C;  5IYD O;  1IBM B;  5JJN B;  1JA8 A;  1WAZ A;  2D2C B;  3JAR B;  2VQE B;  1IXB A;  4UCO A;  5KX5 A;  3B40 A;  2X7R B;  1AB3 A;  4TV9 B;  2DYS B;  2N05 A;  4DV7 O;  4JAV A;  4LWS B;  5BZB A;  2UU9 B;  4ICG A;  4TT3 G;  4RUF A;  2YIA A;  2E5L B;  4CS2 A;  3APO A;  2Y69 C;  3P32 A;  3QTC A;  1P7B A;  1BT8 A;  4U3J A;  3AG7 A;  4P9P A;  1IBM O;  3K04 A;  1HNZ B;  4ASU G;  4WF9 V;  1WPB A;  5H6R A;  1H2L A;  2QKC A;  5FNV A;  2W0X A;  3EHB B;  4LNU B;  3MD0 A;  5B1A B;  3ASN C;  3CC4 V;  3QO7 A;  2V1D A;  5AG2 A;  2VQF B;  4HAM A;  1WA8 B;  4UCU A;  2UUB B;  2AW9 A;  4CC5 A;  1NR7 A;  3LNM B;  2GBO A;  4DW1 A;  2DJV A;  1YIT V;  1K5S A;  2JEX A;  2P22 C;  2CAZ C;  5J2U B;  5GW7 A;  4DR7 B;  5CA0 A;  5C8Y A;  2Q7E A;  4DK0 A;  1EFR G;  2QWP B;  2Q4P A;  3JD2 A;  3DTU B;  4GX2 A;  4IYI A;  4JAA A;  3JAS B;  3WB1 A;  3ZRW B;  2QWN B;  4DUZ B;  4JI7 O;  1G6U A;  4TWK A;  1SQV H;  2IU3 A;  1Q90 D;  3EVK A;  1BHA A;  3SGI A;  3RYC A;  2VRZ A;  2YXL A;  1BHB A;  4QIW F;  4J7K A;  1GTO A;  1YEW A;  1VQK V;  3J81 N;  2EIK C;  1Y76 B;  5KMG A;  3A0R A;  2QDO A;  5LMN O;  3CRR A;  3E22 B;  4B3M O;  2HLD G;  3IFX A;  3W7X A;  2WPD G;  1BS3 A;  2PF4 E;  1R6T A;  4PA9 A;  2Y69 B;  4DR4 B;  2JS3 A;  3TET A;  1T5E A;  2H3O A;  1IBK O;  2Z0A A;  4FM0 A;  4X1Y A;  4DUY B;  3H1I H;  3WG7 C;  5EIB D;  1TAE A;  2M6Y A;  4UCS A;  4GCZ A;  1Z2G A;  4DR5 O;  1FXH A;  3C90 A;  3CMA V;  1RM1 B;  4LF7 B;  3GWK C;  3VBB A;  1SKV A;  4PDR A;  1GH6 A;  3O9O A;  4UVA A;  2ZE5 A;  1N8R W;  3K59 A;  3I55 V;  4DR1 B;  2GDS A;  2YI9 A;  4K35 A;  4OPA A;  1WN7 A;  3ABT A;  4DV5 B;  3JAK B;  3ABM C;  3ZJZ A;  2HEP A;  4IHJ B;  2PYJ A;  4HBN A;  4ABM A;  4DR3 O;  2HG5 C;  2HVJ C;  3N2K A;  4LFB O;  4J10 A;  3RYC B;  2CTR A;  1Q8I A;  4J11 A;  1VQ7 V;  4LFB B;  4O2A B;  2P06 A;  3L75 H;  4PEL A;  3RBZ A;  3U10 A;  1B6Q A;  3STL C;  3VQX A;  2GUZ B;  3JAT A;  2HHH B;  3KCY A;  5B66 Z;  3B09 A;  1E79 G;  5EZY B;  1G1X B;  2QM8 A;  5B3S B;  4I0X B;  3HKE A;  3ICX A;  1AJQ A;  4TOI A;  1VEW A;  1M5I A;  4DV1 B;  2R72 A;  3K08 A;  2BSK A;  4JV5 B;  4MVZ A;  2JK5 C;  4RWU A;  4X65 B;  3F7Y C;  3ZCC A;  4AQY B;  2AGA A;  3ZHQ A;  1S3J A;  2UXN A;  2PZS A;  3Q4H B;  2KG7 A;  4WFF A;  3AK1 A;  4X62 O;  2QJ1 A;  4LFC O;  2WAM A;  2BTQ A;  2XAH A;  1OJH A;  2JVD A;  5BMV B;  3GVM A;  4EB6 B;  1RPO A;  2ADP A;  3CB2 A;  4NKG B;  3E8F A;  1R6N A;  2QTO A;  1IDS A;  3K79 A;  4NXM B;  1TVK A;  4TV9 A;  4X9Q A;  5KA5 A;  4DV0 O;  4KL1 A;  2UUC O;  1Q81 W;  1US6 A;  4TSF G;  1BCC H;  1YJW V;  4XDL A;  1YJ9 V;  4LF6 O;  1V54 C;  4EFE A;  2IH1 C;  3CRQ A;  1M93 A;  5C8Y B;  1KYO F;  1QQC A;  1I94 B;  1HNW O;  1AI7 A;  1YI2 V;  1FJG B;  4PI0 A;  4X66 B;  1KP2 A;  5B1O A;  1SA0 A;  4JI1 B;  1YHQ V;  4E4E A;  5GON B;  3RW0 A;  3KZI Z;  4DV3 O;  1R3I C;  3P30 A;  4H13 B;  4PA4 A;  1QLE B;  3K3W A;  2A7W A;  1PM9 A;  5JCO C;  1AR5 A;  4R8C A;  3STZ C;  3LDE A;  2ZM6 O;  2JEU A;  1QBZ A;  4CH4 A;  1LNQ A;  3D36 A;  4KHP B;  5FL7 G;  2A9H A;  4I9W A;  3CXC U;  1XUQ A;  2EIK B;  3IGA C;  2ARH A;  2UU9 O;  3C3S A;  1Z5V A;  3T1H B;  4E2L A;  5EK0 A;  3ZMS A;  3CC7 V;  2EBO A;  4CH6 A;  2YEV B;  4DV4 B;  3JCU Z;  2HHH O;  4B3S B;  1LUW A;  4HNA A;  4FFB B;  4MTG A;  1GMG A;  1EZV H;  2QSA A;  3UM7 A;  4LF9 B;  4GX1 A;  2AXT Z;  1CPY A;  5JQG B;  4JTC B;  5EC2 C;  1BQZ A;  1NU1 H;  1XMQ O;  4GKK B;  1VAR A;  4NXN B;  2DQ3 A;  5CA3 A;  3LNN A;  3G80 A;  4FPP A;  4P9O A;  4LR3 A;  4IL6 Z;  5JWP A;  2P4K A;  1RSO B;  4DO2 A;  1WP8 A;  1K8A W;  2AZ0 A;  2FL4 A;  2FML A;  3ZRX A;  2Z5U A;  1VMG A;  4DR6 O;  2A3Q A;  1PV0 A;  1Q6I A;  2DW4 A;  4YJ2 B;  5B3S C;  2QWQ B;  3SPH A;  1GN2 A;  3SJB C;  4B3R B;  3CPW U;  1JJ2 U;  1R1B A;  2OIG A;  5IYB O;  2ZE6 A;  4GKJ B;  3BAB A;  1NQT A;  1ZTE A;  1GK9 A;  1SC5 B;  1AIL A;  5EYP B;  3ZMU A;  1KP3 A;  3VOU A;  3H1J H;  3HKC B;  1D5N A;  4X1I B;  5L3B A;  3SYQ A;  3RT3 C;  5JH7 B;  2XHB A;  1BSM A;  3HR0 A;  1QR9 A;  3FAV A;  3OR7 C;  4I50 B;  4DR7 O;  3HKB A;  3DSQ A;  1YSC A;  3F7V C;  2BTQ B;  3M7M X;  3K0G A;  3E8B A;  2IJK A;  1GM9 A;  3RYI A;  5IT9 N;  4JI8 B;  2XND G;  4JI7 B;  1MMM A;  2ATK C;  3ZN0 A;  3H1L H;  1VQ4 V;  2GV9 A;  3AG1 C;  1BL8 A;  3CXH F;  4ZHQ A;  3FB6 C;  2UUC B;  5LGU A;  1ENV A;  2QWO B;  1AR1 B;  2P5O A;  1FPO A;  3FD9 A;  4D6T H;  1M90 W;  3OTO O;  5FLX N;  1RSO A;  3CCQ V;  3B8M A;  2JIZ G;  2Q67 A;  3B8N A;  3OUF A;  4RQE A;  2HFE C;  3E35 A;  2N04 A;  2EIJ B;  1NTM H;  5LBQ A;  3CSX A;  5CN0 A;  4WFB V;  4O4I A;  2CE4 A;  2ZIM A;  3OTF A;  4MSW C;  3TCU A;  3CE2 A;  1ZL8 A;  3DGE A;  4YJ3 B;  4PDL A;  1J5E B;  3QG5 A;  3SJQ C;  1W0K G;  4J80 A;  2L35 A;  3PN1 A;  3JSL A;  3JD3 A;  4JPR A;  3FKS G;  5CA1 B;  5JVD A;  4WBN A;  3U0Z A;  2P90 A;  1XHZ A;  1HDJ A;  4BIU A;  4EFB A;  1AJP A;  1EM1 A;  1UFI A;  4R7C A;  5D5Q A;  4X64 B;  4JI4 O;  3M8A A;  4DV6 B;  5J2U A;  1U96 A;  2E5L O;  4UCT A;  1ARO P;  4DK1 A;  2YC0 A;  1RPR A;  1EZJ A;  3ZRS A;  1XNQ O;  4X1K B;  3RN4 A;  1CP9 A;  1VP7 A;  4I4T B;  1CEZ A;  4JYB A;  5DN6 G;  5J2T A;  2PTM A;  5A2Q N;  1RP3 B;  2FKX A;  3L72 H;  4X66 O;  5EBL C;  2CTP A;  3R65 A;  5B1N A;  1SQG A;  1XNR O;  2GSM B;  3E2E A;  1AP6 A;  1EN5 A;  4GKK O;  1MA1 A;  2XTA A;  1L1F A;  2UXB O;  1Y76 A;  3IC7 A;  3MHH C;  1XEQ A;  2R9I A;  2ZR2 A;  3FX7 A;  4NXM O;  3T1H O;  1H2K A;  1ZL8 B;  1L0N H;  2DN9 A;  3TXQ A;  4LNU A;  5ITZ A;  1NT2 B;  1KMI Z;  5DM6 V;  2ZNJ A;  5JCO A;  4KHP O;  4JF3 A;  3RFR A;  3T4Z A;  4KP4 A;  2IJI A;  5F2V O;  1R3K C;  2LW7 A;  1HR0 O;  4FIP C;  1MG1 A;  3LSS A;  3H1K H;  3APQ A;  3JD4 A;  2ZR3 A;  3AG4 C;  5IWA O;  2K1E A;  1H2N A;  3CRC A;  3OFN G;  1SQF A;  3G71 V;  4DV2 O;  3DXR A;  2K9P A;  3FB5 C;  1NVP D;  2W0F C;  2YSU B;  1YTF D;  1JFF A;  3H9V A;  4Z1M G;  1M57 C;  3VQV A;  2QE7 G;  1DF5 A;  1XQ8 A;  2JRI A;  4FFK A;  3CHX A;  2C2A A;  2ZXW B;  1F23 A;  1JR9 A;  2E76 B;  2NLJ C;  2E75 B;  2MW2 B;  3JAK A;  2CH7 B;  2IJH A;  4J7J A;  1HWY A;  2PY5 A;  3OM3 B;  1M57 B;  2L6L A;  2PUS A;  3G6B A;  3U11 A;  3OTO B;  4HZ3 A;  3CX5 F;  1HP8 A;  4MW8 A;  2F1M A;  3ABK C;  4YJ2 A;  4AQY O;  1ZWI C;  4LP8 A;  2UXX A;  3JAT B;  4IGG A;  4JI6 B;  1SQP H;  2Q5Z A;  1K33 A;  2ITC C;  3AG4 B;  4ZOL B;  4ZHQ B;  2W6J G;  4DRX B;  4FLX A;  3HKE B;  3UT5 A;  1QHT A;  2RCV A;  4FLV A;  1S5J A;  4KXR A;  4LF4 O;  1AI5 A;  1XMO O;  2GTA A;  3THO A;  1XBL A;  3QNE A;  4NVP A;  3AG3 B;  4PDV A;  2P4V A;  3ABK B;  2LP7 A;  3N27 A;  2HJF C;  1HNX O;  1JPX A;  2RNB A;  1TGO A;  2Z3Y A;  4UCR A;  3OAA G;  4RO2 A;  1S72 V;  5IY5 B;  5JH7 A;  4DR2 B;  1KBH A;  4W4L A;  3ZHS A;  1HR0 B;  4UB6 Z;  1MOF A;  3OEH G;  2Q69 A;  1OCO C;  3CJH A;  2DYR B;  4DV6 O;  3K5O A;  4EB6 A;  1AP5 A;  1FXK B;  2OCH A;  3CWB H;  1K4D C;  4LCU C;  1VQ6 V;  4F6R B;  4MW3 A;  5LHH A;  4ZKI A;  4WCE V;  1K5Q A;  1N32 O;  1Q6U A;  4FVM A;  1EN4 A;  4JI2 O;  4DUY O;  4X64 O;  4JI4 B;  1R3L C;  4RUE A;  1I08 A;  1FXK C;  4TQD A;  2H94 A;  4LF5 O;  3AK2 A;  2EIL B;  2BOC C;  3OD4 A;  2ZNI A;  1DF4 A;  4K0K O;  5J2T B;  4DV4 O;  1CXZ B;  2IBZ H;  3L74 H;  3ABU A;  1D5A A;  3ZN1 A;  4JI5 B;  2ZE7 A;  4R6Z A;  1ROP A;  2R9A A;  5FPO A;  4UV8 A;  4MTX A;  4LF9 O;  1N4C A;  4YY3 B;  1Y66 A;  3BAA A;  1Q86 W;  4O2A A;  1J95 A;  2LO1 A;  4O4H B;  4JI8 O;  4FLT A;  3A8T A;  4XDJ A;  2F23 A;  5B1A C;  1XL6 A;  1E1Q G;  4IIJ A;  2ZKO A;  4UV9 A;  2HKO A;  1NI8 A;  1A32 A;  1EBO A;  3SJC C;  2EX3 A;  3LUT B;  4CC6 A;  2HVK C;  4B7E A;  1YZB A;  3O65 A;  5K1P A;  1GRJ A;  2E74 B;  2UUA B;  1FAF A;  4Q20 A;  5EIB C;  3B77 A;  3OMI B;  3JAR A;  3HKD B;  4I4T A;  4LFA O;  4UB8 Z;  2QEX V;  1PKX A;  2H8P C;  4YHH O;  2W6I G;  1N36 B;  3SYP A;  4LFC B;  1NKD A;  2DYS C;  1N33 B;  3FFQ A;  4GZR B;  1HNZ O;  2OT5 A;  3AK3 A;  1NS1 A;  2XAJ A;  1M4U A;  3JYC A;  1I5X A;  4JAS A;  3BA9 A;  3RYF B;  3W7S A;  5J9P C;  1K73 W;  1QVF U;  4Z2W A;  2Q0A A;  3OW2 U;  3LDC A;  4X65 O;  3ETD A;  1GN3 A;  4J9Z B;  3RYH A;  2RDC A;  2YIB D;  1SA0 B;  1QR8 A;  2ZD9 A;  1N36 O;  2OIE A;  2WLI B;  1NR1 A;  4CBC A;  3FYI B;  3A0B Z;  2YS8 A;  4TQF A;  4PA3 A;  2Y0I A;  3LSU A;  2EIJ C;  4UVC A;  3CCJ V;  3S3W A;  3C3T A;  5KAI Z;  1SQQ H;  3SYC A;  2IH3 C;  2JGD B;  3FB7 C;  4F6E A;  2WLK A;  3QO8 A;  3BHP A;  3K5M A;  2QA4 V;  2G38 A;  1LUV A;  4DV1 O;  1JFF B;  3AG1 B;  1L0L H;  1IZ3 A;  4B08 A;  3ETG A;  3ZX6 A;  1V54 B;  3JAS A;  2X6C A;  4GUN A;  4TV8 A;  3RWR D;  4LF8 B;  3AG2 B;  1W2B U;  1VF5 B;  1L8D A;  1JJO A;  4AHC A;  2Q0O C;  1N32 B;  2CDY A;  2B1I A;  2R70 A;  3OUS A;  2ZE8 A;  2A06 H;  1SS3 A;  4YIO A;  3SPC A;  2EIL C;  3DC5 A;  1QNM A;  4D7S A;  4PD4 F;  5EBM C;  1N34 O;  5KX5 B;  1K7D A;  4JI2 B;  2VQE O;  1H8E G;  1W59 A;  4ZOL A;  4PI2 A;  3JAL B;  5IJ9 A;  5LMN B;  3ZBH A;  3D3I A;  3BRC A;  4WFH A;  3IJ4 A;  4FFB A;  5IY5 C;  4EKW A;  1ZX3 A;  3CCR V;  4I9Q A;  2F4V B;  2WLI A;  1KKC A;  1M9N A;  4NTY A;  4CS3 A;  1R73 A;  3CME V;  1XMQ B;  1FYJ A;  1RM1 C;  3H1H H;  4I55 B;  3K57 A;  1NH2 D;  3ZIA G;  4JAU A;  1MZE A;  4G27 B;  3QF7 A;  4U3J B;  1ORQ C;  2KSD A;  1OCC C;  4HYO A;  4O4J B;  4O4L B;  4R50 A;  5FNV B;  5B1B B;  2XOK G;  1VQM V;  2UXD B;  4RAI A;  1DTO A;  2WLJ A;  4ZI7 A;  1B3Q A;  2R9R B;  1IBL O;  2F43 G;  4OX9 B;  3WB0 A;  4JI0 O;  1WA8 A;  2OWO A;  2HR3 A;  1PL0 A;  3K9A A;  5B1B C;  1V9P A;  4O4H A;  1BMF G;  4GYC B;  3ABM B;  2DOS A;  1XL4 A;  1KKD A;  4CZZ A;  3K5N A;  1P4R A;  1MZF A;  1NTZ H;  1U97 A;  4JI3 O;  3ZMZ A;  3T2M A;  2ZIN A;  2Y0P A;  1PNM A;  1ZUQ A;  2BTO A;  5EYP A;  1AVM A;  5B5E Z;  4JV5 O;  2D3O W;  3E86 A;  5EZY A;  4I7Z B;  1IX9 A;  5IWA B;  4NTX A;  4MVQ A;  1R3J C;  2WA3 A;  1TUB A;  2DWE C;  4MT8 A;  5LXT A;  3CS5 A;  4I50 A;  4BR6 A;  1VF6 A;  3GWO A;  3HKB B;  3M99 B;  1VQ8 V;  3T1Y O;  1OV9 A;  1NJI W;  2Q6A A;  4LBE C;  4PJ0 Z;  3ZHV A;  2ILM A;  3FYE B;  1QLE C;  4MTO A;  4DV7 B;  3AG2 C;  5CMU A;  1F4M A;  2B5U A;  1VQL V;  3I56 V;  4PDM A;  1WLE A;  2ZQM A;  5LHG A;  2YDE A;  4I5S A;  5BMV A;  1AR4 A;  1G8M A;  1S5H C;  1UPG A;  3KG2 A;  1Y6X A;  3N2G A;  1AI4 A;  1WNS A;  2QTS A;  2OTJ V;  4NR1 A;  1NH2 B;  3F5T A;  3OE7 G;  4MVO A;  2UUA O;  5KAF Z;  3CCV V;  2CK3 G;  1PPJ H;  4LF5 B;  3HB3 B;  2XAQ A;  1S77 D;  4C7U A;  4JGS A;  2AHZ A;  3DXR B;  4B3S O;  3I5D A;  3J7A U;  2ETN A;  4X89 A;  2JDI G;  3EXA A;  2IM9 A;  5LA6 A;  1XIL A;  5CB4 B;  1JVM A;  1O9G A;  3LSQ A;  1KUQ A;  1SRY A;  5GON A;  1JX9 A;  4EEQ A;  1BGY H;  5IE9 A;  2YXH A;  3OMN B;  3MAQ A;  2EJ7 A;  3SPG A;  1X59 A;  3N2K B;  2VS0 A;  2JS5 A;  3WG7 B;  3ZS8 C;  4P2Z A;  1O9H A;  2EZO A;  3ZRW A; 
#chains in the Genus database with same CATH homology
 2ITC C;  3AG4 B;  4N21 A;  2W6J G;  4UXN A;  4U7O A;  1E79 G;  5HFM A;  1E1R G;  2QM8 A;  5B3S B;  5IYC O;  4N23 A;  4MTF A;  1AJQ A;  1AI5 A;  3QNE A;  1K9M W;  3K08 A;  3AG3 B;  1FXV A;  4PDV A;  3ABK B;  2LP7 A;  2HJF C;  2YEV A;  1JPX A;  4MVZ A;  2JK5 C;  3AG3 C;  4H37 A;  2Z3Y A;  3F7Y C;  3ZCC A;  4UUJ C;  1VQN V;  3OAA G;  3PJS K;  4RO2 A;  5IY5 B;  1S72 V;  4GT1 A;  3JD1 A;  1S3J A;  2UXN A;  5H9C A;  2JJ1 G;  5CBH A;  2QM7 A;  4WFF A;  1MOF A;  3OEH G;  2Q69 A;  3BEH A;  1W0J G;  1OCO C;  3QO5 A;  2DYR B;  1H8H G;  2WAM A;  3OR6 C;  2XAH A;  1OCR C;  5KA6 A;  3SYO A;  5L3F A;  1FXK B;  1RPO A;  1GM8 A;  1YIJ V;  1K4D C;  3E8F A;  4LCU C;  1GO3 F;  5IDJ A;  2OCC B;  1VQ6 V;  1R6N A;  2QTO A;  3K79 A;  3RVZ A;  2ZDI C;  4MW3 A;  5LHH A;  5CBF A;  4ZKI A;  4WCE V;  1K5Q A;  3G6E V;  5LHI A;  1YTF B;  1JOY A;  5KA5 A;  5LGT A;  1VQ5 V;  1AJN A;  3OGC C;  3CCE V;  1NVP B;  3HPL C;  2OCC C;  1NBM G;  2PI5 A;  1Q81 W;  1R3L C;  3GB7 C;  4RUE A;  4TSF G;  1FXK C;  1IXM A;  2IW5 A;  1YJW V;  2KB1 A;  4XDL A;  1YJ9 V;  3FB8 C;  1V54 C;  1OCZ C;  2H94 A;  2IH1 C;  3ML0 A;  1PNL A;  2EIL B;  2BOC C;  4MVS A;  1OCR B;  3ASO B;  1AI7 A;  1YI2 V;  1KP2 A;  5B1O A;  1DF4 A;  2EJR A;  4LC1 A;  2WLH A;  3W7U A;  5EBW C;  1YHQ V;  3RW0 A;  3CCU V;  1PNK A;  2P7T C;  1R3I C;  3ABU A;  3ZN1 A;  3P30 A;  4PA4 A;  1FS0 G;  1QLE B;  3K3W A;  1KEC A;  1G4Y B;  4R6Z A;  1Q82 W;  3SPJ A;  1ROP A;  3G4S V;  4R8C A;  4UV8 A;  4MTX A;  3STZ C;  3LDE A;  5L3C A;  2OTL V;  2PI4 A;  2JEU A;  3H01 A;  1QBZ A;  1Y66 A;  1LNQ A;  2M7W A;  3D36 A;  4KUM A;  3X2Q B;  1Q86 W;  1J95 A;  5FL7 G;  4XDJ A;  5B1A C;  1XL6 A;  2A9H A;  1E1Q G;  4I9W A;  3CXC U;  1M1K W;  5EC1 C;  4UV9 A;  2HKO A;  2EIK B;  2EIN B;  3IGA C;  3ASO C;  1EBO A;  3X2Q C;  3LUT B;  4XBF A;  2HVK C;  4E2L A;  5EK0 A;  3ZMS A;  2AHY A;  3CC7 V;  4Q20 A;  3B77 A;  2EBO A;  3OMI B;  2WLN A;  2YEV B;  2QEX V;  1PKX A;  2H8P C;  5E1A C;  1KC8 W;  2A0L A;  2W6I G;  3SYP A;  4MTG A;  1GMG A;  1YJN V;  1NKD A;  2DYS C;  3F5W C;  4WFG A;  2OT5 A;  3EFF K;  3UM7 A;  2XAF A;  2XAJ A;  1M56 B;  4GX1 A;  2ZDI A;  1SER A;  4MS2 A;  3JYC A;  1I5X A;  4JAS A;  1KQS U;  1CPY A;  4G28 B;  3W7S A;  1QLN A;  4JTC B;  3RVY A;  2DQ0 A;  4FMT A;  2A79 B;  4MVM A;  5J9P C;  1K73 W;  1QVF U;  1V55 C;  5EC2 C;  3CCS V;  3LDC A;  1OZ0 A;  3OW2 U;  3BY6 A;  3ETD A;  4QE9 A;  3K06 A;  1FXK A;  4J9Z B;  1Q7Y W;  2DYR C;  4MVU A;  3T4D A;  4OXS A;  2DQ3 A;  4PA7 A;  5CA3 A;  2Q68 A;  2P67 A;  1FFT B;  4FPP A;  3ZMV A;  5C93 A;  4P9O A;  3ABL B;  2IJJ A;  1K92 A;  1QR8 A;  2EIN C;  2ZD9 A;  5KUM A;  3W7T A;  2WLI B;  4DO2 A;  1NR1 A;  4CBC A;  5KUK A;  3CCL V;  1K34 A;  1K8A W;  3FYI B;  4DXW A;  2DWD C;  5CBG A;  3ZRX A;  3WFV A;  1OHH G;  2JJ2 G;  4PA3 A;  3NXS A;  1PD3 A;  2Z5U A;  1S0V A;  3K03 A;  2EIJ C;  4UVC A;  3CCJ V;  2EIM C;  2WSS G;  2XAG A;  2B1G A;  2DW4 A;  4FJC C;  3SYC A;  2IH3 C;  2BOB C;  5B3S C;  3SPH A;  2X0L A;  1R6K A;  4G2K A;  1QVG U;  3CPW U;  1JJ2 U;  3FB7 C;  2WLK A;  2FTK A;  3ETE A;  5IYB O;  2Y48 A;  3QO8 A;  1SZT A;  2QA4 V;  1MSW D;  2WLM A;  4J9Y B;  2QKS A;  1COW G;  3AG1 B;  2X6B A;  2EIM B;  1NQT A;  1GK9 A;  1K3E A;  1THZ A;  4P30 A;  1F4N A;  3ETG A;  4MVR A;  1V54 B;  2WLL B;  4GX5 A;  3ZMU A;  1KP3 A;  3VOU A;  2X6C A;  2ITD C;  3UKM A;  4BIZ A;  3AG2 B;  1W2B U;  4RQF A;  5L3B A;  3SYQ A;  5L3G A;  1QR9 A;  1I5Y A;  2B1I A;  3ABL C;  3OR7 C;  2ZXW C;  3OUS A;  3T1C A;  4QE7 A;  3K0D A;  3SPC A;  4BAY A;  5IYD O;  1YSC A;  2EIL C;  3F7V C;  2NNU A;  3K0G A;  5EBM C;  3E8B A;  2IJK A;  1GM9 A;  1K7D A;  2XND G;  2ATK C;  3ZN0 A;  1H8E G;  1VQ4 V;  2X7R B;  1M56 C;  1F51 A;  3AG1 C;  1BL8 A;  3CP1 A;  3FB6 C;  5LGU A;  1ENV A;  3D3I A;  5HFL A;  2P6J A;  1AR1 B;  4WFH A;  5IY5 C;  4EKW A;  1M90 W;  2DYS B;  4YXW G;  4BW5 A;  3OEE G;  4JAV A;  4UVB A;  2WLI A;  4ZBM A;  5BZB A;  1M9N A;  3CCQ V;  3CCR V;  4TT3 G;  4RUF A;  3JCZ A;  3CME V;  1R73 A;  3B8M A;  2JIZ G;  2Q67 A;  3B8N A;  3OUF A;  4RQE A;  1RM1 C;  2V7Q G;  1NH2 D;  4L87 A;  2HFE C;  1WPX A;  2Y69 C;  3P32 A;  4JAU A;  3E35 A;  3ZIA G;  1MAB G;  2EIJ B;  1P7B A;  3ASN B;  1DLB A;  5LBQ A;  1K97 A;  4G27 B;  4P9P A;  4WFA V;  5CN0 A;  3K04 A;  4WFB V;  4ASU G;  4WF9 V;  1SET A;  1ORQ C;  5H6R A;  4MSW C;  1OCC C;  3TCU A;  4HYO A;  3DGE A;  4R50 A;  3CCM V;  5B1B B;  2XOK G;  4PDL A;  1VQM V;  3EHB B;  4RAI A;  1DTO A;  5L3D A;  4KFM A;  3SJQ C;  2LFR A;  2WLJ A;  1W0K G;  3MD0 A;  5B1A B;  2R9R B;  3ASN C;  3CC4 V;  3QO7 A;  1QCE A;  2F43 G;  3JD3 A;  2V1D A;  4JTA B;  4JPR A;  3FKS G;  2HR3 A;  4HAM A;  2P90 A;  1PL0 A;  1V55 B;  1NR7 A;  1GKF A;  1VQ9 V;  3K9A A;  4BIU A;  1AJP A;  5B1B C;  1BMF G;  4FK5 C;  1JQ0 A;  3ABM B;  3LNM B;  4R7C A;  3SPI A;  1XL4 A;  1KKD A;  4CZZ A;  1YIT V;  1K5S A;  2JEX A;  4X88 A;  1P4R A;  4JTD B;  1ARO P;  1H38 A;  3ZRS A;  1RPR A;  1EZJ A;  5GW7 A;  2EZP A;  3ZMZ A;  3T2M A;  1PNM A;  1EFR G;  3JD2 A;  3DTU B;  3OMA B;  4GX2 A;  1S76 D;  1CP9 A;  1VQO V;  1Y4M A;  3ZRW B;  2IU0 A;  4WFE A;  4JYB A;  5DN6 G;  1CEZ A;  2WWW A;  1K4C C;  2D3O W;  1OCO B;  4TWK A;  3E86 A;  1AI6 A;  2IU3 A;  3AEI A;  3SYA A;  5EBL C;  4MVQ A;  3R65 A;  1R3J C;  1BHA A;  5B1N A;  1UJW B;  4MT8 A;  2DWE C;  2GSM B;  1GM7 A;  4JYC A;  1BHB A;  3E2E A;  3GWO A;  3M99 B;  1VQ8 V;  4QIW F;  3E8H A;  1H2G A;  3JD0 A;  5L3E A;  1NJI W;  2Q6A A;  1GTO A;  4LBE C;  1L1F A;  5H6Q A;  1VQK V;  2EIK C;  3IC7 A;  3MHH C;  2R9I A;  3FYE B;  1QLE C;  4MTO A;  2ZR2 A;  1OCC B;  3AG2 C;  4U7N A;  5CMU A;  1F4M A;  2B5U A;  1VQL V;  3I56 V;  4PDM A;  1WLE A;  2XAS A;  4H33 A;  3A0R A;  4GX0 A;  2ZQM A;  5LHG A;  2HLD G;  4I5S A;  3IFX A;  1G8M A;  1S5H C;  3KG2 A;  2GHY A;  3W7X A;  2WPD G;  5DM6 V;  1AI4 A;  2OTJ V;  4QNH B;  1OCZ B;  4PA9 A;  3W7W A;  2Y69 B;  1NH2 B;  3OE7 G;  4JF3 A;  4MVO A;  3CCV V;  4XDK A;  3MHS C;  2CK3 G;  4KP4 A;  2IJI A;  3T4Z A;  1R3K C;  3HB3 B;  3TET A;  1VQP V;  4FIP C;  2XAQ A;  1S77 D;  1MG1 A;  3LSS A;  3JD4 A;  1KD1 W;  2ZR3 A;  3AG4 C;  4JGS A;  2AHZ A;  2K1E A;  5LGN A;  1SES A;  3OFN G;  3G71 V;  3LDD A;  3WG7 C;  1NVP D;  3FB5 C;  4X89 A;  1TUE B;  2W0F C;  2YSU B;  3E83 A;  1YTF D;  4GCZ A;  4Z1M G;  2JDI G;  1FXH A;  1M57 C;  3ZMT A;  2QE7 G;  1DF5 A;  3CMA V;  1RM1 B;  2X6A A;  3VBB A;  3CC2 V;  2WLL A;  4PDR A;  2C2A A;  2MK3 A;  2ZXW B;  4UVA A;  1JVM A;  4QJF B;  3E89 A;  3LSQ A;  3ZRV A;  1F23 A;  1SRY A;  2LFS A;  1JX9 A;  1N8R W;  3I55 V;  2NLJ C;  4X8A A;  4QPK A;  4QPJ A;  3ABT A;  4F4L A;  2IJH A;  3ABM C;  3ZJZ A;  1HWY A;  3OMN B;  3CYO A;  3E8G A;  2HG5 C;  2HVJ C;  3OM3 B;  3SPG A;  1M57 B;  1VQ7 V;  4HZ3 A;  4MW8 A;  3ABK C;  3CD6 V;  1ZWI C;  4LP8 A;  4PEL A;  3TK1 A;  2UXX A;  3RBZ A;  3WG7 B;  1B6Q A;  4PA6 A;  3STL C;  4P2Z A;  1JCH A;  1K33 A;  2EZO A;  3ZRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...