4P2ZA

Structure of navms t207a/f214a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p2zA00
3ZJZA 2A0LA 4H37A 4GX5A 4QE9A 4H33A 4J9ZB 4LP8A 4MTOA 4X8AA 2EINC 1QLEC 2QKSA 4RUEA 4MVQA 4PDVA 1P7BA 2X6CA 3ZRSA 4P9OA 2DYRC 4PA6A 4R7CA 3EFFK 3SPGA 4RAIA 2HFEC 3F7VC 5IY5C 3E89A 2WLIA 4JTDB 4MVOA 4BW5A 5CBGA 2EIJC 2IH1C 3FB8C 2DYSC 4WFGA 1OCZC 4GX0A 1LNQA 5B3SC 3RW0A 1XL4A 3F5WC 3OR7C 5EBWC 3TCUA 3UM7A 2DWEC 2Q67A 3ABKC 2ATKC 4UUJC 2WLLB 1K4DC 5EBMC 4MVSA 4PDRA 4G27B 2AHYA 4MW3A 3RVZA 5J9PC 1KKDA 3K0GA 3HPLC 1ZWIC 2WLNA 3IFXA 2NLJC 3E83A 3TETA 1V54C 2WLHA 2H8PC 2EIKC 3E8HA 1R3KC 3FB5C 1M56C 3GB7C 3UKMA 4WFHA 3K04A 2A79B 2DWDC 4XDJA 3AG4C 4MS2A 4X88A 3RBZA 3SPJA 4OXSA 1K4CC 5CBHA 3E8FA 5EC2C 1JVMA 4MVUA 4CBCA 1R3IC 1R3LC 3LDCA 2QTOA 3BEHA 3LNMB 3SPIA 2KB1A 4PA9A 3SYPA 2HVKC 4PA7A 3OUSA 2R9RB 3ASNC 2Y69C 3VOUA 4I9WA 3AG3C 4P9PA 3K03A 3SPCA 3R65A 4JTCB 2BOBC 2Q6AA 4WFEA 5EK0A 3E8BA 1BL8A 3OR6C 3RVYA 3E86A 4EKWA 5KUMA 4HZ3A 4JTAB 4P30A 4MVMA 3SPHA 4GX2A 4DXWA 2Q69A 5EBLC 2ITDC 3K06A 4R6ZA 3T4DA 5CBFA 5B1AC 4MW8A 4ZBMA 3AG2C 4PA3A 3SYOA 2A9HA 3X2QC 2BOCC 4HYOA 4F4LA 1J95A 4PDMA 3ASOC 3PJSK 2WLIB 4G28B 4R50A 5BZBA 4P2ZA 3LDEA 3JYCA 2WLJA 2P7TC 1OCCC 3K0DA 4PDLA 4GX1A 1V55C 2EILC 4R8CA 2HG5C 2ITCC 2HJFC 4MSWC 4X89A 3STLC 1ORQC 2W0FC 3E8GA 3AG1C 2K1EA 4QNHB 3SYCA 2ZD9A 4J9YB 2X6BA 3ABMC 4RUFA 1OCRC 2HVJC 2YEVA 4PA4A 4QE7A 3KG2A 4XDLA 5E1AC 2JK5C 3ABLC 3OUFA 4MTFA 2ZXWC 4MTGA 1XL6A 1G4YB 3K08A 2WLKA 3FB7C 5KUKA 3SJQC 2IH3C 2AHZA 3SYQA 2WLMA 5EC1C 1M57C 3OGCC 4TWKA 2Q68A 4RO2A 3F7YC 1R3JC 5B1BC 3STZC 3SYAA 4XDKA 1S5HC 2EIMC 4MVRA 3T1CA 4LBEC 3FB6C 3T4ZA 3WG7C 4KFMA 4LCUC 4WFFA 2WLLA 3IGAC 3LUTB 1OCOC 4MVZA 3T2MA 2OCCC 2X6AA 3LDDA
chains in the Genus database with same CATH superfamily
2DQ3A 1PNMA 1QLEC 1L1FA 3HKEB 4LF8O 1ROPA 3N27A 4Q20A 1VMGA 1IBKO 2QWNB 5L3GA 4YJ3A 5IWAO 1WA8A 3CC4V 3CX5F 1Q6IA 2RMKB 1MZEA 4GKJO 4X1IA 5IJ9B 5JJEB 3G6EV 3UM7A 1I5YA 2DWEC 4JI7B 4DV1B 1QBZA 2ODMA 1K5SA 5JCOA 5LGNA 2CTQA 1ZWIC 2YIBD 1PD3A 5IJ0B 4QPKA 3E8HA 3K59A 3BA9A 3K04A 5KHKA 1M57B 2A7WA 4TUYB 4O4IB 1R3LC 4PA9A 2GHYA 1P7GA 2OCCB 4N21A 4BIZA 4X1KB 4I7ZB 3WB0A 3BRCA 1M5IA 3RT3C 5TISZ 1H2SB 3QO7A 4R6ZA 2EBOA 4Z1VA 3SYOA 4HYOA 1K92A 4UVBA 1DLBA 1CXZB 3IJ4A 1GMGA 4JAUA 1MSDA 3PN1A 4IHJB 3GWOA 1TVKB 2LFRA 4HBNA 1AP6A 1XHXA 2ZKOA 2KKWA 3SYCA 4LF6B 1K7DA 1YEWA 2YEVA 1HR0B 1A32A 2EJ7A 3CJHA 2ZXWC 2JGUA 2OIEA 1GN6A 1BS3A 3J7AU 2BSKA 4TWKA 4DUZO 4B3TO 2FYUH 2Y0PA 2PYLA 2V4DA 2P5OA 3CXCU 2AZ0A 2CH7A 1KBHA 2UUCB 2X6AA 1AR5A 4MTOA 2F4VB 1FFXB 1P49A 1XOUA 2IJKA 4DV6B 5LGUA 2QKCA 3JCUZ 4B3MO 2Q8VA 3QO5A 3CRMA 3OTOO 1NQTA 3ZIAG 3VQVA 2X0LA 3TCUA 3CP1A 2VQEO 1L0NH 3JARB 4ICGA 2H3OA 5JVDB 4O4HA 2A06H 3RYCA 4FVMA 4UV9A 3K57A 1GM7A 4YHHB 1IXMA 2Z5UA 1NH2B 4LF5B 2YI9A 2LW1A 4GKKB 3B8NA 2Q9LA 4W4KA 1AI5A 4WFEA 1H2LA 2Q0OC 5D5PA 2E3CA 5IYDO 5GONB 2W6IG 3OD4A 1PV0A 3T1YO 1S76D 2A9HA 2JRIA 3CEIA 1YXBA 4FLYA 1NJIW 1WN7A 4B7EA 2YXLA 1XDCA 4YJ2A 5DEDA 4B3SB 4LH7A 5IYCO 2W6JG 1TUEB 4K35A 1V55C 3JD4A 5LYJA 3BVOA 2JS5A 5CN0A 2JJ1G 4OPHA 3K5OA 4RUFA 2GSMB 3L9DA 1IURA 2UUBO 1Q6HA 2WLMA 4TUYA 4O4IA 3W7WA 1PNKA 4DR6O 1THZA 4HNAA 4ZI7B 4O2AA 3T4ZA 4LCUC 4FLZA 2HP8A 4X1KA 4LH6A 3K3WA 3WU2Z 2UXXA 2CTRA 2HKOA 2WA4A 4J7KA 2IBZH 2DYRC 2Z3YA 1YITV 4DV0B 3A0RA 4MT8A 1SQXH 3JAKB 1BQZA 4O4LB 2PF4E 4GX0A 3F5TA 4IHJA 3VBBA 2RDCA 3CCUV 1SS3A 1JOYA 1SETA 3K0GA 1WPXA 2PI4A 1NTKH 2WLNA 5B1OA 3GB7C 2EIKC 2GBOA 2QGNA 4TSFG 3L71H 2A79B 1KKCA 4KHPO 1H38A 1JMKC 2JS3A 2JIZG 3RN4A 3W7XA 3AK3A 3K79A 2QKAA 4BWAA 3JASB 1NZ6A 3CSXA 2N05A 2YUAA 1GN2A 3E8BA 4X66B 5LHHA 1FFXA 4JTAB 3SPHA 2Q69A 4U3JB 1JJ2U 5CBFA 1Z2GA 3ZMVA 1J95A 5JH7B 5EIBD 2BCCH 1YVWA 2QSAA 1IZ3A 1OCCC 4FIPC 5CB4B 1H2MA 1XHZA 3LSUA 4DRXA 2KQXA 4DV3B 4K3AA 3CRRA 2ZD9A 5E79Z 3I56V 3ABMC 1NR7A 4XDLA 3ETEA 4CS4A 1KQSU 5J2TA 1UFIA 5KUKA 2VRZA 5KAFZ 2EULA 3E35A 1R3JC 2F43G 3MAQA 1JPXA 3ETGA 2QWPB 2YIBA 5DECA 4MVZA 4DV5B 1JR9A 2A0LA 5IE9A 2B5UA 5GONA 4RUEA 3H1KH 2R72A 4NTWA 3FFQA 1N0NA 3DC5A 3L75H 3APOA 1OCCB 1VQOV 3FB8C 2XAQA 2JVDA 2LGQA 1XL4A 5CA0B 4UUJC 3ZX6A 1M9NA 4LFAO 4LFBO 2XAJA 4LF9B 2E76B 3TETA 4DK0A 2ZNJA 1WAZA 2F66C 1VQKV 3CCMV 3QVNA 1O9HA 4AHCA 3E2EA 4LF8B 1IBKB 4DYLA 1XNQB 1F23A 2OYQA 4LF5O 3CWBH 1YJ9V 2XAGA 1AROP 4GKJB 2EZPA 3N2KA 3OUSA 3JALA 3AG3C 2IM9A 3MDSA 2LQTA 2Q6AA 1YTFB 1H8EG 3OAAG 1F51A 5EZYB 2ITDC 1DK1A 1IX9A 2BOCC 5KHHA 4UCTA 2VWJA 1OJHA 4X62B 1BQ0A 2CGNA 4B3SO 1I7FA 1NU1H 5KHGA 1WB7A 5CA1B 2HLDG 4UCOA 2FKXA 4TV8B 1VQ5V 3QF7A 1GKFA 4GUNA 4I0XB 1XQ8A 1YSCA 1ZLZA 1AJNA 3JCZA 5LP6C 4J7JA 4WBNB 2L6LA 3JASA 3TK1A 1WP7A 2RCVA 1BHAA 4GX5A 3CXHF 4MVQA 3ML0A 1EZVH 1ZL8B 3W7UA 1FFTB 4DV0O 3F7VC 5IY5C 2OCHA 5EYPA 3TXSA 4IIJB 1F4MA 2CUGA 3GVMA 5EBWC 3I5DA 2DQ0A 1KUQA 2ZR3A 3RGBA 3UO3A 2YDEA 1KP2A 1L8DA 2H8PC 2LP7A 3UCSC 1CPYA 5B1AB 4PHZA 5LOVA 4I55B 5AG2A 4IL6Z 1S5LZ 4CH3A 3E8FA 5LP6B 4D6TH 1N36O 1G1XB 3HKCB 4B3MB 4NVPA 2QDOA 4UVCA 1AR4A 1NS1A 2R9RB 3HR0A 3G67A 1JFFA 2CGOA 2VQEB 4GT1A 4X66O 1VQLV 4J41A 3CCVV 4NTXA 2P6JA 4UCRA 2ZE5A 3FYIB 2Q7GA 4JAAA 4CS2A 3ASOC 1Q82W 2MW2B 2ZDIC 4CH6A 2EIMB 2WLJA 1H2NA 4JYAO 2GUZA 2ZINA 4PD4F 1PL0A 1YIJV 1SQGA 4I50B 1SZXA 4QGPA 5FNVB 3C3TA 3DGEA 3HB3B 4DV3O 5KMGB 4J9YB 4NKGB 1UJWB 2HVJC 4JI3B 1K73W 3T1YB 5L3EA 5EC1C 4B08A 1G6UA 2GV9A 2QM4A 2QA4V 3H1JH 4FLVA 4XDKA 5FPOA 3SDLA 2QJ1A 4MVRA 4JI0B 3R66A 3K9AA 4YY3B 4WFFA 1TUBA 1LUVA 4DV5O 2V1DA 3ZS8C 4H37A 3ZHTA 4QE9A 4YXWG 2UXBO 1RSOA 4FJCC 4PDVA 2X6CA 4NTYA 5IDJA 3ASOB 2NR5A 3ZCCA 1QHTA 4FFBB 2ZIMA 2Q5ZA 3RFRA 2L35A 2EIJC 1WJZA 5CA1A 4DR6B 1KMIZ 3S3XA 2H94A 4PV1B 2ZIOA 4X20B 5LA6B 5LHGA 3RVZA 1VQ4V 3H1HH 3HPLC 1EZJA 4U3FH 1FS0G 3S3WA 2B9ZA 3TJTA 4UCSA 1XNQO 1Q5OA 5J2UB 2IJJA 4X65O 5EC2C 2AGAA 1NH2D 1XREA 1MSWD 2XTAA 4TT3G 3R65A 3SJAC 3OR6C 3GWKC 4C7UA 1GM9A 5JWPA 5CMUA 4MVMA 2IJHA 5H2FZ 3ZEDA 3RWRD 2IU0A 5BXZA 3X2QC 4JASA 5KA6A 2EIJB 4X62O 3CC2V 4KHPB 3CRQA 3ZRWB 4BIOA 1FKAO 1RP3B 1WPBA 2AZ2A 1GN4A 3HKBB 4MSWC 1MNGA 4FK5C 3ETQA 3UT5A 1QLEB 2JGDB 2W0FC 3CCLV 4Z2WA 2DOSA 3H9VA 4E2LA 4I55A 1P84F 3D3QA 2R9AA 1DF5A 1E1RG 1L0LH 3AK2A 3P3PA 4NXNB 2CE4A 2WLLA 4EB6A 3LDDA 2CTWA 4EFEA 4QJFB 1ENVA 3IC7A 3X2QB 2Q0AA 1QCEA 1I94O 3ZMTA 4IT5A 5C8YB 3E89A 1QNMA 4MVOA 3CE2A 4JI2B 3OMAB 5IYBO 3RW0A 4DV2O 2Q67A 1Q90D 1S72V 4KXRA 4HAMA 1GRJA 1FAFA 5KA5A 3H01A 3L72H 1V54C 2WLHA 1D5AA 2IU3A 3SPJA 3ABUA 1GK9A 2Q7HA 3RYIB 3UO2A 5KAIZ 3LNMB 2KB1A 2GDSA 1VF6A 2PY5A 1RM1C 2JEXA 4LFAB 4LFBB 4EEQA 5GW7A 3KCXA 4JGSA 5C93A 4HZ3A 3K9SA 2ZXWB 4J11A 4F4LA 3ZMZA 4FLTA 3OW2U 4L8JA 4FZ0A 3OE7G 3E22B 3N2GA 4DW1A 4X20A 2HG5C 2ITCC 4FLUA 1V54B 5LBQA 3O65A 3JATB 4JI3O 4PA4A 3KG2A 3HKEA 4JPRA 1TGOA 1KC8W 3FAVB 3BY6A 1I08A 4H13B 3JD2A 1Z5VA 1M4UA 3DTUB 4DV4B 1D5NA 4JI0O 5IJ9A 1VQ6V 3SJCC 4YY3O 4KFMA 1RM1B 2P90A 3D36C 4DR7B 4DR1O 4J9ZB 1ZTEA 2WPDG 1YJNV 5IJ0A 2HR3A 1FXKC 4UV8A 1KU9A 4FZ1A 5BY1A 2VQFO 1LNQA 4FFKA 2AW9A 4J42A 3OR7C 3RYHB 2ATKC 2ILMA 4MVSA 4PDRA 5J9PC 1NR1A 4DV7B 3IFXA 1B06A 2RQ6A 5FLXN 2YICA 4JI8O 1B3QA 4JI6B 1R73A 2DWDC 1S5JA 4X88A 3UQ8A 1K4CC 2A3QA 3LSQA 1JVMA 1YI2V 1Q43A 2Y4TA 3KCYA 1E79G 3LDCA 1V55B 3BEHA 1BHBA 4AQYO 5CA3A 1TVKA 3D3IA 4DR4O 1QVFU 2ADQB 3RVYA 1YTFD 1FXKB 5KUMA 1Y76B 1ZUQA 3T4DA 4MW8A 4J80A 1SQFA 5IYZB 4BIUA 3U11A 2MK3A 4R50A 1AB3A 2P22C 4EFBA 4LF7O 5D5QA 1Z5WA 1N36B 5B66Z 1GM8A 3VQWA 3ETDA 1Q6UA 3EVKA 2M7WA 2UXDO 1HNWO 3JD3A 4OPAA 1H2GA 4FLXA 2DYRB 4CC5A 5KHIA 1LR1A 4UCUA 4NXNO 5FL7G 3OTFA 1FXVA 1VF5B 2LJ2A 3FB6C 4U7OA 3HKDB 5L3BA 4JYAB 1WLEA 1OCOC 3A2FA 3JARA 2EIKB 4PI2A 1WNSA 1RPRA 4TQDA 4J10A 2ZCEA 5JVDA 1P7BA 3ZHVA 1SA0B 1MOFA 2HJDA 1AI6A 3E22A 4JI2O 2IH1C 4FM2A 4JV5B 1HP8A 2LGWA 4JYBA 1LUWA 3ABKC 1KP3A 2AHYA 4MW3A 1X4TA 4RQFA 1EN6A 2UXBB 2YIDA 1BGYH 3FAVA 1J5EO 4B7KA 4JAVA 4TV9B 5LMNB 1AVMA 4PELA 1F7YA 4U7NA 4H0LB 2B1IA 3MHHC 2E5LB 1R6NA 4K8XA 1OCOB 5LHIA 1GO3F 2YIAA 1NTZH 4WF9V 3CCEV 2XAHA 4Z1MG 3ABMB 1YHQV 3QO8A 3BHPA 2VS0A 2OTLV 2DE0X 1BE3H 2GTAA 1QU7A 3AG2C 2FB5A 4NYKA 1IDSA 3PJSK 3ZRXA 1K3EA 4X65B 2P7TC 4ZI7A 5HFMA 3SR2C 4JZGA 3RYHA 1NI8A 1YZBA 1B6QA 4OX9B 4WFAV 2ARHA 3WB1A 1VP7A 2PI5A 3WFVA 5EIBC 3OGCC 4DV4O 3JAKA 3FD9A 4O4LA 3STZC 4DR7O 2HEPA 3ZMSA 1Y74B 3ZJZA 5JCOC 3U10A 1W59A 2QR4A 4DUYB 4DR3O 1ZAUA 5BMVB 1Y76A 3I55V 3OEEG 1HWYA 1COWG 1JQ0A 2E74B 2XOKG 1WB8A 4ZHQB 3CRAA 2DN9A 2BTQB 5BR8O 2CDYA 1OCZC 3AG3B 4FLWA 4G27B 5LGTA 1KKDA 1CP9A 1HW7A 4DV7O 1P4RA 3L73H 2BE3A 5JQGB 4UFZA 4LFCO 3CMAV 3UKMA 4JI6O 2CAZC 4O2BB 2N04A 1AILA 4U3JA 4YJ3B 1WA8B 3CMEV 1I94B 2FMLA 3LSSA 1G8MA 4Q6GA 5JH7A 4X1IB 1RFYA 2IW5A 3JAMN 4CBCA 1R3IC 4X1YB 2OTJV 1BCCH 1XMOB 2HVKC 3OEHG 1ZX3A 1U96A 2WWWA 4I9WA 4DV2B 1MG1A 5CB4A 3E86A 4AI8A 4P30A 3K06A 1SA0A 3T1HO 2PTMA 4PA3A 1GN3A 1Y67A 1OCZB 1Y4MA 5LL6Y 3K0DA 1F4NA 1GH6A 1BT8A 1VQMV 2EILC 4R8CA 1YDXA 2HJFC 1UPGA 2XHBA 4B3RB 4NR1A 2RN9A 4TOIA 2HHHO 2K9PA 3AG1C 1AJQA 3VQYA 1D2DA 1M93A 1SQBH 5IY5B 5B5EZ 4TV9A 3FB7C 2AHZA 1YCIA 2Q68A 1AI4A 3F7YC 3M8AA 2XT9A 2UXCO 4UXNA 5CA0A 4FMTA 5HFLA 1JA8A 4GYCB 4H33A 5JJNB 4LP8A 3B09A 2EINC 2XUMA 2QKSA 2YEVB 3H1IH 4JF3A 3CJHB 5B1NA 1VQ9V 2WAMA 4PI0A 3SPGA 1JJOA 1N8RW 1N0JA 2HFEC 4FPPA 1S0VA 3ZHRA 4LF4O 5CBGA 1IBMO 4WCEV 4JV5O 2DYSC 2EILB 3NR7A 2RNBA 2CH7B 1K4DC 2R9IA 4NXMO 3TXQA 4IGGA 1OV9A 1Y66A 2WSSG 3FB5C 1R3KC 4DR1B 3APQA 3CB2A 1BMFG 4D7TA 1K9MW 1XMQO 5EZYA 2JEUA 5LMNO 4N23A 2UU9B 2QWQB 4MTXA 2Y48A 1SQPH 1BZKA 3B40A 3RYFB 3OMIB 2E5LO 4MVUA 2LFSA 3VOUA 2QTOA 2VQFB 4PA7A 1PM9A 1HNXO 4P9PA 4TV8A 1XILA 1Y74A 4O4HB 4I0XA 3CS5A 1XUQA 1FPOA 4A5UB 1PP9H 4JI8B 3ICXA 5JJJB 2DYSB 1GAXA 3A0BZ 4ZHQA 1RPOA 3LDEA 4ZIBA 2FL4A 3B8MA 4I9QA 4ZOLB 2YXYA 4WBNA 4GX1A 3L74H 4UB8Z 1Q8IA 2CK3G 4AQYB 3Q4HB 3ZBHA 4OX9O 3CC7V 2QM8A 5JQGA 3E8GA 4QNHB 4DR4B 2UUAB 4O2BA 1ZL8A 3ZHSA 2V7QG 2JK5C 1NBMG 2ETNA 1N33B 3ZN1A 1B04A 1XL6A 1G4YB 2DJVA 3SJQC 2IH3C 3JD1A 4AILC 4RO2A 4YJ2B 4D7SA 4IIJA 4X1YA 4LF7B 1VARA 3JSNA 4I4TB 4JI4B 2F23A 3BA8A 2ZR2A 1TA8A 4G2KA 5LYJB 1M56C 1Q3EA 5DN6G 2C2AA 4I5SA 4DUYO 2UXDB 1HNWB 5LXTB 3ZRSA 5A9GA 2ZT9B 3AK1A 5LP6A 4HNAB 1R1BA 4O2AB 3HKCA 2FTKA 4LNUB 1OHHG 1DGSA 2E75B 2EJRA 2YSUB 1ZSPA 1K8AW 1TAEA 3OMNB 2D3OW 5CBHA 1NVPB 3SJBC 3ZHQA 4UVAA 1M90W 1DF4A 1XMOO 3A0HZ 2XAFA 1K97A 2WA3A 1M56B 2F93B 1AP5A 4RWUA 3K03A 2NN4A 4I50A 2BOBC 4JTCB 5FNVA 5EK0A 4LR3A 5ITZB 5KMGA 1PL4A 4CS3A 4GX2A 2B1GA 4ZBMA 2KSDA 1J5EB 4P2ZA 3JYCA 1S3JA 2XASA 4X64B 1FD9A 1R6TA 4NB5A 1I0HA 4B3RO 1O9GA 3H1LH 1Q86W 5LMUO 3AG7A 2YC0A 4QE7A 1SZTA 2AXTZ 3OUFA 2EZOA 5DM6V 2WLKA 2ZDIA 2PYJA 4QPJA 1DTOA 4FFBA 3W7SA 3RYFA 1FJGO 2W0XA 1QVGU 1U97A 2X7RB 1HNZO 5LA6A 2QE7G 4DO2A 4DRXB 5A2QN 4X8AA 3CRCA 1AR1B 1URFA 1H2KA 4P9OA 5J2TB 3IAYA 5J2UA 1SQVH 2DW4A 2VWKA 3P30A 1K5QA 1KYOF 4ZOLA 5H6RA 4BR6A 1VQNV 3QG5A 4GCZA 1V9PA 4UB6Z 2BTOA 3Q4HA 2ZNIA 3VQXA 4TQFA 1E1QG 1NT2B 3IC9A 3P32A 4WFHA 3QTCA 4DR3B 4ZKIA 4JYYA 2YS8A 3AG4C 2UU9O 4OXSA 1K33A 3LNNA 2QM7A 3ZRWA 4CH5A 4DR2B 5BR8B 4I4TA 1Q7YW 4JI5O 3HKBA 2ADPA 1IXBA 1SESA 2JGDA 2XNDG 5LXTA 4EKWA 4LFCB 1KB9F 5K1PA 1VF7A 1N32B 2ZM6B 2R70A 3MHSC 3CCRV 3N2KB 3JALB 4K0KB 3ZHUA 4LNUA 4H44B 3CPWU 2ZQMA 2UUAO 3AG4B 4DR5B 1BSMA 1N33O 3A8TA 1SERA 3JAWB 4MTGA 3K08A 3T1HB 5C8YA 5GTHZ 4FM0A 1IVSA 1NTMH 4JI7O 4DV1O 2OWOA 3WG7C 4FM1A 2Z0AA 3G4SV 4JI4O 1EFRG 2P4KA 2UXNA 3T2MA 3LUTB 3D8CA 2PUSA 2YI8A 1XNRB 5ITZA 4UCVA 1EBOA 2HHHB 4LWSB 1N4CA 5FPRA 1FYJA 4RAIA 1IBLB 1JCHA 1X59A 3CD6V 1US6A 2GTSA 3RYIA 4WFGA 2UXCB 2NNUA 1YJWV 5KX5B 1M1KW 3MD0A 3M7MX 2F1MA 2NLJC 2P06A 1SKVA 1XEQA 2Q73A 1K34A 4J7ZA 3EHBB 1MA1A 1S77D 3EXAA 3RBZA 3BFRA 1R6KA 1N34B 5EYPB 5F2VO 3FX7A 2EX3A 3WG7B 4RQEA 4LF4B 1IBMB 3SPIA 4F6RB 3ZRVA 3SPCA 3SGIA 3TGUH 4NXMB 2ZE7A 4K8ZA 4LF6O 4BW9A 1HR0O 2JDIG 3M99B 4GZRB 3JATA 5LOVB 5GTIZ 1T5EA 1XMQB 4PDMA 3JSLA 2WLIB 3L70H 4X64O 2G38A 2OT5A 2LW7A 4E4EA 3JD0A 2UUCO 1JFFB 2YXHA 1HNXB 2F4VO 2OIGA 4F6EA 1MZFA 5L3FA 4GLXA 1QQCA 4LC1A 2X6BA 2N74A 1VQPV 4DV6O 3ABLC 2O57A 3J80N 3QNEA 4IYHA 1AI7A 2CTPA 2ZE6A 1S5HC 1SRYA 1OZ0A 3ABKB 3KKYA 3T1CA 1QR9A 3G6BA 4LBEC 2GUZB 3U0ZA 4JI1B 1VIBA 4BAYA 3THOA 2QWOB 3NXSA 4YIOA 3CYOA 5L3CA 1QLNA 4YHHO 1QR8A 3OGIB 5IWAB 4BW5A 3K5LA 4GKKO 3F5WC 3D36A 3FYEB 1TUBB 5H9CA 1VQ7V 2KG7B 3B4SA 3FKSG 1W0JG 4W4LA 1GTOA 1SF9A 1RSOB 2D2CB 3ABLB 3DC6A 1FXKA 3AG2B 4O4JB 3JAWA 1PKXA 1PPJH 5IYZA 4KL1A 5KLVH 3K58A 3W7TA 4DR2O 3DXRB 2LO1A 2Y0IA 3BCCH 3K5NA 2ZE8A 3KZIZ 1BL8A 4LWSA 2QTSA 4DK1A 4JYCA 5EBLC 1N32O 5B1AC 3CCQV 3DSQA 2ZM6O 2F95B 1W2BU 2Y4UA 5BZBA 1CEZA 1JX9A 3OT7A 3BAAA 2JJ2G 2Q4PA 4K0KO 3CCJV 5IT9N 3HKDA 5KX5A 3P3NA 3STLC 1KD1W 2M6YA 1KECA 2RJZA 4DR5O 1OCRC 2P4VA 1WP8A 4MTFA 3G71V 5H6QA 3C3SA 5B1BC 4DUZB 3SYAA 3G80A 1VQ8V 4B3TB 2EIMC 1EN4A 4F6RA 5KHJA 4CH4A 1W0KG 4CC6A 3AEIA 3UT5B 1XNRO 4WFBV 4CZZA 5LMUB 4X9QA 4ASUG 1VEWA 1NKDA 1SC5B 4PA6A 1PNLA 3EFFK 4R7CA 1IBLO 2WLIA 4JTDB 2IJIA 4QIWF 1FJGB 5B3SC 3OTOB 1HDJA 1EM1A 4DW0A 4PJ0Z 2WLLB 1FXHA 4KP4A 5EBMC 1VF6C 4EB6B 1HNZB 4IYIA 1I5XA 3BPZA 1OCRB 3ABTA 3E83A 5H5NA 4XDJA 4MS2A 1N34O 5B1BB 2BSKB 4JZ2A 5K1XA 3O9OA 3SYPA 1NVPD 2Q7EA 3ASNC 3OM3B 2Y69C 2QWRB 4ABMA 1H8HG 3AG1B 1MMMA 3WB2A 4L87A 4DXWA 2PGGA 4XBFA 3CHXA 4G28B 1Y6XA 5B3SB 3J81N 3ZN0A 3CCSV 4PDLA 1AJPA 3K5MA 1Q81W 1XBLA 2KG7A 4JI5B 2PZSA 4X89A 2EINB 1ORQC 4OGQB 2DMXA 3C90A 2K1EA 2P67A 1SQQH 2QEXV 4O4JA 5BMVA 5E1AC 3RYCB 2UUBB 4YIPA 1XI1A 3SYQA 1M57C 1MABG 5L3DA 3N2GB 3DXRA 3B2EE 3ASNB 1YF2A 2BTQA 2Y69B 3OFNG 3BABA 3ZMUA 4JI1O 3IGAC 1EN5A 4LF9O 2OCCC 3B77A 4KUMA
chains in the Genus database with same CATH topology
2DQ3A 1BHAA 4GX5A 1PNMA 2EIKB 4X8AA 1QLEC 1RPRA 4MVQA 3ML0A 1L1FA 1AR1B 1P7BA 3W7UA 1FFTB 1ROPA 4P9OA 4Q20A 3TK1A 5L3GA 1MOFA 3F7VC 3CC4V 1AI6A 5IY5C 2DW4A 2IH1C 3P30A 1F4MA 1K5QA 5H6RA 1VQNV 4JYBA 5EBWC 3G6EV 3UM7A 1I5YA 2DWEC 3ABKC 4GCZA 1QBZA 1K5SA 1KP3A 2AHYA 2DQ0A 4MW3A 5LGNA 2ZR3A 1ZWIC 1E1QG 4RQFA 1PD3A 4QPKA 1KP2A 2H8PC 2LP7A 3E8HA 1CPYA 3P32A 4WFHA 5B1AB 3K04A 4ZKIA 1M57B 3AG4C 4JAVA 4OXSA 1K33A 4PELA 3E8FA 4U7NA 2QM7A 3ZRWA 2B1IA 3MHHC 1R6NA 1R3LC 4UVCA 4PA9A 1OCOB 2GHYA 2OCCB 2R9RB 1Q7YW 5LHIA 1GO3F 4N21A 4BIZA 4WF9V 4GT1A 3CCEV 1VQLV 1SESA 2XAHA 3CCVV 4Z1MG 3ABMB 1YHQV 2P6JA 2XNDG 3QO8A 4EKWA 3FYIB 3QO7A 2OTLV 4R6ZA 2EBOA 3AG2C 3SYOA 4HYOA 1K92A 4UVBA 1DLBA 3ASOC 3PJSK 3ZRXA 1Q82W 1GMGA 2ZDIC 4JAUA 3MHSC 3CCRV 1K3EA 2EIMB 2WLJA 2P7TC 5HFMA 3GWOA 1YIJV 1PL0A 2LFRA 1B6QA 3DGEA 3HB3B 3CPWU 2ZQMA 3SYCA 4J9YB 4WFAV 1UJWB 3AG4B 1K7DA 2HVJC 2YEVA 1K73W 1SERA 2PI5A 2ZXWC 4MTGA 3WFVA 3K08A 5L3EA 5EC1C 3OGCC 4TWKA 2QA4V 3STZC 4XDKA 4MVRA 3CXCU 3WG7C 3G4SV 1EFRG 3K9AA 4WFFA 2UXNA 3T2MA 3LUTB 3ZMSA 2X6AA 2V1DA 3ZJZA 4H37A 4QE9A 4MTOA 4YXWG 1EBOA 4FJCC 4PDVA 2X6CA 3I55V 5IDJA 2IJKA 3OEEG 3ASOB 1HWYA 1COWG 5LGUA 4RAIA 3ZCCA 1JCHA 1JQ0A 2XOKG 3CD6V 2EIJC 3QO5A 4WFGA 1NQTA 1OCZC 3ZIAG 2X0LA 2H94A 3AG3B 3TCUA 2NNUA 1YJWV 5LHGA 3CP1A 3RVZA 4G27B 1M1KW 1VQ4V 5LGTA 1KKDA 1CP9A 3MD0A 3HPLC 1P4RA 1EZJA 2NLJC 1FS0G 3CMAV 3UKMA 4UV9A 1K34A 3EHBB 1S77D 1GM7A 3RBZA 3CMEV 1IXMA 2Z5UA 1R6KA 2IJJA 3LSSA 1G8MA 1NH2B 5EC2C 2IW5A 3WG7B 4RQEA 4CBCA 1R3IC 2OTJV 3SPIA 1NH2D 2HVKC 3OEHG 3B8NA 1MSWD 2WWWA 4I9WA 3ZRVA 4TT3G 3SPCA 1MG1A 1AI5A 3R65A 4WFEA 3OR6C 3E86A 5IYDO 2JDIG 3M99B 1GM9A 2W6IG 4P30A 4MVMA 5CMUA 2IJHA 3K06A 2IU0A 1S76D 4PA3A 2A9HA 4JASA 3X2QC 2EIJB 5KA6A 4PDMA 1NJIW 3CC2V 2WLIB 1OCZB 3ZRWB 1Y4MA 5IYCO 2W6JG 1F4NA 3K0DA 2OT5A 1TUEB 3JD0A 1V55C 2EILC 4R8CA 1VQMV 3JD4A 2HJFC 4MSWC 4FK5C 1QLEB 2W0FC 3AG1C 5CN0A 5L3FA 2JJ1G 3CCLV 4LC1A 1AJQA 2X6BA 4RUFA 1VQPV 4E2LA 2GSMB 3ABLC 5IY5B 4DO2A 1DF5A 1E1RG 3FB7C 3QNEA 2AHZA 2WLMA 1AI7A 3W7WA 2Q68A 1AI4A 1PNKA 1THZA 3F7YC 4UXNA 1S5HC 1SRYA 1OZ0A 3ABKB 3T1CA 1QR9A 4LBEC 3T4ZA 4LCUC 2WLLA 4BAYA 4FMTA 5HFLA 3LDDA 4QJFB 1ENVA 4H33A 4LP8A 3K3WA 3IC7A 2EINC 3NXSA 2QKSA 2UXXA 2YEVB 2HKOA 3CYOA 4JF3A 5B1NA 3X2QB 5L3CA 1VQ9V 2WAMA 1QLNA 1QCEA 2DYRC 3ZMTA 1QR8A 3SPGA 2Z3YA 1YITV 1N8RW 2HFEC 4FPPA 1S0VA 3A0RA 3E89A 4MT8A 4MVOA 4BW5A 5CBGA 4WCEV 2DYSC 2EILB 3OMAB 4GX0A 5IYBO 3VBBA 3RW0A 3F5WC 3D36A 3FYEB 2Q67A 5H9CA 3CCUV 1JOYA 1K4DC 1S72V 1VQ7V 2R9IA 1SETA 3K0GA 1WPXA 4HAMA 3FKSG 1W0JG 2PI4A 2WLNA 1Y66A 1GTOA 2WSSG 5B1OA 3H01A 5KA5A 1V54C 3ABLB 2WLHA 3GB7C 2EIKC 3FB5C 1R3KC 1BMFG 1FXKA 2IU3A 4TSFG 3AG2B 2A79B 1K9MW 1PKXA 2JEUA 3SPJA 1H38A 4N23A 3ABUA 1GK9A 2JIZG 2Y48A 4MTXA 3W7XA 3K79A 3OMIB 4MVUA 3W7TA 2LFSA 3VOUA 2QTOA 3LNMB 2KB1A 4PA7A 4P9PA 1RM1C 2JEXA 3E8BA 1BL8A 5GW7A 4JGSA 5C93A 5LHHA 4HZ3A 4JTAB 2ZXWB 3SPHA 4JYCA 2Q69A 5EBLC 1JJ2U 5CBFA 5B1AC 3CCQV 4F4LA 3ZMVA 3ZMZA 3OW2U 1J95A 2DYSB 1W2BU 3OE7G 5BZBA 1RPOA 3LDEA 1CEZA 1JX9A 3B8MA 1OCCC 4FIPC 2JJ2G 4GX1A 3CCJV 2HG5C 2ITCC 2CK3G 1V54B 3STLC 5LBQA 2QM8A 3CC7V 1KD1W 3E8GA 1KECA 4QNHB 2ZD9A 3I56V 3ABMC 1OCRC 1NR7A 4PA4A 3KG2A 3ETEA 2V7QG 2JK5C 4JPRA 1NBMG 4MTFA 4XDLA 1KC8W 1KQSU 3ZN1A 3BY6A 1XL6A 1G4YB 3G71V 5H6QA 3SJQC 5KUKA 2IH3C 3JD2A 3JD1A 4RO2A 3DTUB 3E35A 1R3JC 5B1BC 3SYAA 2F43G 1VQ8V 1VQ6V 2EIMC 1JPXA 3ETGA 4KFMA 1RM1B 2P90A 1W0KG 2ZR2A 4G2KA 4MVZA 3AEIA 1M56C 4WFBV 5DN6G 2A0LA 2C2AA 4I5SA 2B5UA 4J9ZB 4CZZA 2WPDG 4RUEA 1YJNV 2HR3A 4ASUG 3ZRSA 1NKDA 4PA6A 4R7CA 1PNLA 3EFFK 1FXKC 4UV8A 2WLIA 4JTDB 1OCCB 1VQOV 2IJIA 2XAQA 3FB8C 4QIWF 1LNQA 5B3SC 1XL4A 3OR7C 4UUJC 2ATKC 2WLLB 1FXHA 4KP4A 5EBMC 4MVSA 4PDRA 2FTKA 1M9NA 5J9PC 1OHHG 1NR1A 1I5XA 2XAJA 3IFXA 1OCRB 3ABTA 3E83A 3TETA 2EJRA 2YSUB 1VQKV 1K8AW 3CCMV 1R73A 2DWDC 4XDJA 3E2EA 4MS2A 3OMNB 4X88A 2D3OW 1K4CC 5CBHA 1F23A 3LSQA 5B1BB 1NVPB 1YJ9V 2XAGA 1JVMA 1AROP 4UVAA 1YI2V 1M90W 1DF4A 1E79G 3LDCA 2EZPA 1V55B 2XAFA 3BEHA 3SYPA 1NVPD 1K97A 3OUSA 1M56B 3ASNC 1BHBA 3OM3B 2Y69C 5CA3A 3AG3C 3K03A 3D3IA 1H8HG 4JTCB 2BOBC 2Q6AA 3AG1B 5EK0A 1YTFB 1QVFU 1H8EG 3RVYA 3OAAG 4L87A 1F51A 1YTFD 1FXKB 5KUMA 4DXWA 4GX2A 2ITDC 2B1GA 3T4DA 4XBFA 4MW8A 4ZBMA 2BOCC 4BIUA 2MK3A 4G28B 4R50A 4P2ZA 5B3SB 3JYCA 3ZN0A 1S3JA 3CCSV 2XASA 1GM8A 4PDLA 1AJPA 2HLDG 3ETDA 1Q81W 1VQ5V 2M7WA 1Q86W 4X89A 2EINB 1ORQC 1GKFA 3JD3A 2K1EA 2P67A 1H2GA 2QEXV 2DYRB 4QE7A 1SZTA 5E1AC 3OUFA 1YSCA 2EZOA 5DM6V 1AJNA 2WLKA 2ZDIA 4QPJA 3SYQA 1DTOA 1M57C 3W7SA 1MABG 5L3DA 1QVGU 3ASNB 3JCZA 2X7RB 2Y69B 5FL7G 3OFNG 1FXVA 3FB6C 3ZMUA 4U7OA 5L3BA 1WLEA 3IGAC 1OCOC 2OCCC 3B77A 4KUMA 2QE7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJZ A;  2A0L A;  4H37 A;  4GX5 A;  4QE9 A;  4H33 A;  4J9Z B;  4LP8 A;  4MTO A;  4X8A A;  2EIN C;  1QLE C;  2QKS A;  4RUE A;  4MVQ A;  4PDV A;  1P7B A;  2X6C A;  3ZRS A;  4P9O A;  2DYR C;  4PA6 A;  4R7C A;  3EFF K;  3SPG A;  4RAI A;  2HFE C;  3F7V C;  5IY5 C;  3E89 A;  2WLI A;  4JTD B;  4MVO A;  4BW5 A;  5CBG A;  2EIJ C;  2IH1 C;  3FB8 C;  2DYS C;  4WFG A;  1OCZ C;  4GX0 A;  1LNQ A;  5B3S C;  3RW0 A;  1XL4 A;  3F5W C;  3OR7 C;  5EBW C;  3TCU A;  3UM7 A;  2DWE C;  2Q67 A;  3ABK C;  2ATK C;  4UUJ C;  2WLL B;  1K4D C;  5EBM C;  4MVS A;  4PDR A;  4G27 B;  2AHY A;  4MW3 A;  3RVZ A;  5J9P C;  1KKD A;  3K0G A;  3HPL C;  1ZWI C;  2WLN A;  3IFX A;  2NLJ C;  3E83 A;  3TET A;  1V54 C;  2WLH A;  2H8P C;  2EIK C;  3E8H A;  1R3K C;  3FB5 C;  1M56 C;  3GB7 C;  3UKM A;  4WFH A;  3K04 A;  2A79 B;  2DWD C;  4XDJ A;  3AG4 C;  4MS2 A;  4X88 A;  3RBZ A;  3SPJ A;  4OXS A;  1K4C C;  5CBH A;  3E8F A;  5EC2 C;  1JVM A;  4MVU A;  4CBC A;  1R3I C;  1R3L C;  3LDC A;  2QTO A;  3BEH A;  3LNM B;  3SPI A;  2KB1 A;  4PA9 A;  3SYP A;  2HVK C;  4PA7 A;  3OUS A;  2R9R B;  3ASN C;  2Y69 C;  3VOU A;  4I9W A;  3AG3 C;  4P9P A;  3K03 A;  3SPC A;  3R65 A;  4JTC B;  2BOB C;  2Q6A A;  4WFE A;  5EK0 A;  3E8B A;  1BL8 A;  3OR6 C;  3RVY A;  3E86 A;  4EKW A;  5KUM A;  4HZ3 A;  4JTA B;  4P30 A;  4MVM A;  3SPH A;  4GX2 A;  4DXW A;  2Q69 A;  5EBL C;  2ITD C;  3K06 A;  4R6Z A;  3T4D A;  5CBF A;  5B1A C;  4MW8 A;  4ZBM A;  3AG2 C;  4PA3 A;  3SYO A;  2A9H A;  3X2Q C;  2BOC C;  4HYO A;  4F4L A;  1J95 A;  4PDM A;  3ASO C;  3PJS K;  2WLI B;  4G28 B;  4R50 A;  5BZB A;  4P2Z A;  3LDE A;  3JYC A;  2WLJ A;  2P7T C;  1OCC C;  3K0D A;  4PDL A;  4GX1 A;  1V55 C;  2EIL C;  4R8C A;  2HG5 C;  2ITC C;  2HJF C;  4MSW C;  4X89 A;  3STL C;  1ORQ C;  2W0F C;  3E8G A;  3AG1 C;  2K1E A;  4QNH B;  3SYC A;  2ZD9 A;  4J9Y B;  2X6B A;  3ABM C;  4RUF A;  1OCR C;  2HVJ C;  2YEV A;  4PA4 A;  4QE7 A;  3KG2 A;  4XDL A;  5E1A C;  2JK5 C;  3ABL C;  3OUF A;  4MTF A;  2ZXW C;  4MTG A;  1XL6 A;  1G4Y B;  3K08 A;  2WLK A;  3FB7 C;  5KUK A;  3SJQ C;  2IH3 C;  2AHZ A;  3SYQ A;  2WLM A;  5EC1 C;  1M57 C;  3OGC C;  4TWK A;  2Q68 A;  4RO2 A;  3F7Y C;  1R3J C;  5B1B C;  3STZ C;  3SYA A;  4XDK A;  1S5H C;  2EIM C;  4MVR A;  3T1C A;  4LBE C;  3FB6 C;  3T4Z A;  3WG7 C;  4KFM A;  4LCU C;  4WFF A;  2WLL A;  3IGA C;  3LUT B;  1OCO C;  4MVZ A;  3T2M A;  2OCC C;  2X6A A;  3LDD A; 
#chains in the Genus database with same CATH topology
 2DQ3 A;  1PNM A;  1QLE C;  1L1F A;  3HKE B;  4LF8 O;  1ROP A;  3N27 A;  4Q20 A;  1VMG A;  1IBK O;  2QWN B;  5L3G A;  4YJ3 A;  5IWA O;  1WA8 A;  3CC4 V;  3CX5 F;  1Q6I A;  2RMK B;  1MZE A;  4GKJ O;  4X1I A;  5IJ9 B;  5JJE B;  3G6E V;  3UM7 A;  1I5Y A;  2DWE C;  4JI7 B;  4DV1 B;  1QBZ A;  2ODM A;  1K5S A;  5JCO A;  5LGN A;  2CTQ A;  1ZWI C;  2YIB D;  1PD3 A;  5IJ0 B;  4QPK A;  3E8H A;  3K59 A;  3BA9 A;  3K04 A;  5KHK A;  1M57 B;  2A7W A;  4TUY B;  4O4I B;  1R3L C;  4PA9 A;  2GHY A;  1P7G A;  2OCC B;  4N21 A;  4BIZ A;  4X1K B;  4I7Z B;  3WB0 A;  3BRC A;  1M5I A;  3RT3 C;  5TIS Z;  1H2S B;  3QO7 A;  4R6Z A;  2EBO A;  4Z1V A;  3SYO A;  4HYO A;  1K92 A;  4UVB A;  1DLB A;  1CXZ B;  3IJ4 A;  1GMG A;  4JAU A;  1MSD A;  3PN1 A;  4IHJ B;  3GWO A;  1TVK B;  2LFR A;  4HBN A;  1AP6 A;  1XHX A;  2ZKO A;  2KKW A;  3SYC A;  4LF6 B;  1K7D A;  1YEW A;  2YEV A;  1HR0 B;  1A32 A;  2EJ7 A;  3CJH A;  2ZXW C;  2JGU A;  2OIE A;  1GN6 A;  1BS3 A;  3J7A U;  2BSK A;  4TWK A;  4DUZ O;  4B3T O;  2FYU H;  2Y0P A;  2PYL A;  2V4D A;  2P5O A;  3CXC U;  2AZ0 A;  2CH7 A;  1KBH A;  2UUC B;  2X6A A;  1AR5 A;  4MTO A;  2F4V B;  1FFX B;  1P49 A;  1XOU A;  2IJK A;  4DV6 B;  5LGU A;  2QKC A;  3JCU Z;  4B3M O;  2Q8V A;  3QO5 A;  3CRM A;  3OTO O;  1NQT A;  3ZIA G;  3VQV A;  2X0L A;  3TCU A;  3CP1 A;  2VQE O;  1L0N H;  3JAR B;  4ICG A;  2H3O A;  5JVD B;  4O4H A;  2A06 H;  3RYC A;  4FVM A;  4UV9 A;  3K57 A;  1GM7 A;  4YHH B;  1IXM A;  2Z5U A;  1NH2 B;  4LF5 B;  2YI9 A;  2LW1 A;  4GKK B;  3B8N A;  2Q9L A;  4W4K A;  1AI5 A;  4WFE A;  1H2L A;  2Q0O C;  5D5P A;  2E3C A;  5IYD O;  5GON B;  2W6I G;  3OD4 A;  1PV0 A;  3T1Y O;  1S76 D;  2A9H A;  2JRI A;  3CEI A;  1YXB A;  4FLY A;  1NJI W;  1WN7 A;  4B7E A;  2YXL A;  1XDC A;  4YJ2 A;  5DED A;  4B3S B;  4LH7 A;  5IYC O;  2W6J G;  1TUE B;  4K35 A;  1V55 C;  3JD4 A;  5LYJ A;  3BVO A;  2JS5 A;  5CN0 A;  2JJ1 G;  4OPH A;  3K5O A;  4RUF A;  2GSM B;  3L9D A;  1IUR A;  2UUB O;  1Q6H A;  2WLM A;  4TUY A;  4O4I A;  3W7W A;  1PNK A;  4DR6 O;  1THZ A;  4HNA A;  4ZI7 B;  4O2A A;  3T4Z A;  4LCU C;  4FLZ A;  2HP8 A;  4X1K A;  4LH6 A;  3K3W A;  3WU2 Z;  2UXX A;  2CTR A;  2HKO A;  2WA4 A;  4J7K A;  2IBZ H;  2DYR C;  2Z3Y A;  1YIT V;  4DV0 B;  3A0R A;  4MT8 A;  1SQX H;  3JAK B;  1BQZ A;  4O4L B;  2PF4 E;  4GX0 A;  3F5T A;  4IHJ A;  3VBB A;  2RDC A;  3CCU V;  1SS3 A;  1JOY A;  1SET A;  3K0G A;  1WPX A;  2PI4 A;  1NTK H;  2WLN A;  5B1O A;  3GB7 C;  2EIK C;  2GBO A;  2QGN A;  4TSF G;  3L71 H;  2A79 B;  1KKC A;  4KHP O;  1H38 A;  1JMK C;  2JS3 A;  2JIZ G;  3RN4 A;  3W7X A;  3AK3 A;  3K79 A;  2QKA A;  4BWA A;  3JAS B;  1NZ6 A;  3CSX A;  2N05 A;  2YUA A;  1GN2 A;  3E8B A;  4X66 B;  5LHH A;  1FFX A;  4JTA B;  3SPH A;  2Q69 A;  4U3J B;  1JJ2 U;  5CBF A;  1Z2G A;  3ZMV A;  1J95 A;  5JH7 B;  5EIB D;  2BCC H;  1YVW A;  2QSA A;  1IZ3 A;  1OCC C;  4FIP C;  5CB4 B;  1H2M A;  1XHZ A;  3LSU A;  4DRX A;  2KQX A;  4DV3 B;  4K3A A;  3CRR A;  2ZD9 A;  5E79 Z;  3I56 V;  3ABM C;  1NR7 A;  4XDL A;  3ETE A;  4CS4 A;  1KQS U;  5J2T A;  1UFI A;  5KUK A;  2VRZ A;  5KAF Z;  2EUL A;  3E35 A;  1R3J C;  2F43 G;  3MAQ A;  1JPX A;  3ETG A;  2QWP B;  2YIB A;  5DEC A;  4MVZ A;  4DV5 B;  1JR9 A;  2A0L A;  5IE9 A;  2B5U A;  5GON A;  4RUE A;  3H1K H;  2R72 A;  4NTW A;  3FFQ A;  1N0N A;  3DC5 A;  3L75 H;  3APO A;  1OCC B;  1VQO V;  3FB8 C;  2XAQ A;  2JVD A;  2LGQ A;  1XL4 A;  5CA0 B;  4UUJ C;  3ZX6 A;  1M9N A;  4LFA O;  4LFB O;  2XAJ A;  4LF9 B;  2E76 B;  3TET A;  4DK0 A;  2ZNJ A;  1WAZ A;  2F66 C;  1VQK V;  3CCM V;  3QVN A;  1O9H A;  4AHC A;  3E2E A;  4LF8 B;  1IBK B;  4DYL A;  1XNQ B;  1F23 A;  2OYQ A;  4LF5 O;  3CWB H;  1YJ9 V;  2XAG A;  1ARO P;  4GKJ B;  2EZP A;  3N2K A;  3OUS A;  3JAL A;  3AG3 C;  2IM9 A;  3MDS A;  2LQT A;  2Q6A A;  1YTF B;  1H8E G;  3OAA G;  1F51 A;  5EZY B;  2ITD C;  1DK1 A;  1IX9 A;  2BOC C;  5KHH A;  4UCT A;  2VWJ A;  1OJH A;  4X62 B;  1BQ0 A;  2CGN A;  4B3S O;  1I7F A;  1NU1 H;  5KHG A;  1WB7 A;  5CA1 B;  2HLD G;  4UCO A;  2FKX A;  4TV8 B;  1VQ5 V;  3QF7 A;  1GKF A;  4GUN A;  4I0X B;  1XQ8 A;  1YSC A;  1ZLZ A;  1AJN A;  3JCZ A;  5LP6 C;  4J7J A;  4WBN B;  2L6L A;  3JAS A;  3TK1 A;  1WP7 A;  2RCV A;  1BHA A;  4GX5 A;  3CXH F;  4MVQ A;  3ML0 A;  1EZV H;  1ZL8 B;  3W7U A;  1FFT B;  4DV0 O;  3F7V C;  5IY5 C;  2OCH A;  5EYP A;  3TXS A;  4IIJ B;  1F4M A;  2CUG A;  3GVM A;  5EBW C;  3I5D A;  2DQ0 A;  1KUQ A;  2ZR3 A;  3RGB A;  3UO3 A;  2YDE A;  1KP2 A;  1L8D A;  2H8P C;  2LP7 A;  3UCS C;  1CPY A;  5B1A B;  4PHZ A;  5LOV A;  4I55 B;  5AG2 A;  4IL6 Z;  1S5L Z;  4CH3 A;  3E8F A;  5LP6 B;  4D6T H;  1N36 O;  1G1X B;  3HKC B;  4B3M B;  4NVP A;  2QDO A;  4UVC A;  1AR4 A;  1NS1 A;  2R9R B;  3HR0 A;  3G67 A;  1JFF A;  2CGO A;  2VQE B;  4GT1 A;  4X66 O;  1VQL V;  4J41 A;  3CCV V;  4NTX A;  2P6J A;  4UCR A;  2ZE5 A;  3FYI B;  2Q7G A;  4JAA A;  4CS2 A;  3ASO C;  1Q82 W;  2MW2 B;  2ZDI C;  4CH6 A;  2EIM B;  2WLJ A;  1H2N A;  4JYA O;  2GUZ A;  2ZIN A;  4PD4 F;  1PL0 A;  1YIJ V;  1SQG A;  4I50 B;  1SZX A;  4QGP A;  5FNV B;  3C3T A;  3DGE A;  3HB3 B;  4DV3 O;  5KMG B;  4J9Y B;  4NKG B;  1UJW B;  2HVJ C;  4JI3 B;  1K73 W;  3T1Y B;  5L3E A;  5EC1 C;  4B08 A;  1G6U A;  2GV9 A;  2QM4 A;  2QA4 V;  3H1J H;  4FLV A;  4XDK A;  5FPO A;  3SDL A;  2QJ1 A;  4MVR A;  4JI0 B;  3R66 A;  3K9A A;  4YY3 B;  4WFF A;  1TUB A;  1LUV A;  4DV5 O;  2V1D A;  3ZS8 C;  4H37 A;  3ZHT A;  4QE9 A;  4YXW G;  2UXB O;  1RSO A;  4FJC C;  4PDV A;  2X6C A;  4NTY A;  5IDJ A;  3ASO B;  2NR5 A;  3ZCC A;  1QHT A;  4FFB B;  2ZIM A;  2Q5Z A;  3RFR A;  2L35 A;  2EIJ C;  1WJZ A;  5CA1 A;  4DR6 B;  1KMI Z;  3S3X A;  2H94 A;  4PV1 B;  2ZIO A;  4X20 B;  5LA6 B;  5LHG A;  3RVZ A;  1VQ4 V;  3H1H H;  3HPL C;  1EZJ A;  4U3F H;  1FS0 G;  3S3W A;  2B9Z A;  3TJT A;  4UCS A;  1XNQ O;  1Q5O A;  5J2U B;  2IJJ A;  4X65 O;  5EC2 C;  2AGA A;  1NH2 D;  1XRE A;  1MSW D;  2XTA A;  4TT3 G;  3R65 A;  3SJA C;  3OR6 C;  3GWK C;  4C7U A;  1GM9 A;  5JWP A;  5CMU A;  4MVM A;  2IJH A;  5H2F Z;  3ZED A;  3RWR D;  2IU0 A;  5BXZ A;  3X2Q C;  4JAS A;  5KA6 A;  2EIJ B;  4X62 O;  3CC2 V;  4KHP B;  3CRQ A;  3ZRW B;  4BIO A;  1FKA O;  1RP3 B;  1WPB A;  2AZ2 A;  1GN4 A;  3HKB B;  4MSW C;  1MNG A;  4FK5 C;  3ETQ A;  3UT5 A;  1QLE B;  2JGD B;  2W0F C;  3CCL V;  4Z2W A;  2DOS A;  3H9V A;  4E2L A;  4I55 A;  1P84 F;  3D3Q A;  2R9A A;  1DF5 A;  1E1R G;  1L0L H;  3AK2 A;  3P3P A;  4NXN B;  2CE4 A;  2WLL A;  4EB6 A;  3LDD A;  2CTW A;  4EFE A;  4QJF B;  1ENV A;  3IC7 A;  3X2Q B;  2Q0A A;  1QCE A;  1I94 O;  3ZMT A;  4IT5 A;  5C8Y B;  3E89 A;  1QNM A;  4MVO A;  3CE2 A;  4JI2 B;  3OMA B;  5IYB O;  3RW0 A;  4DV2 O;  2Q67 A;  1Q90 D;  1S72 V;  4KXR A;  4HAM A;  1GRJ A;  1FAF A;  5KA5 A;  3H01 A;  3L72 H;  1V54 C;  2WLH A;  1D5A A;  2IU3 A;  3SPJ A;  3ABU A;  1GK9 A;  2Q7H A;  3RYI B;  3UO2 A;  5KAI Z;  3LNM B;  2KB1 A;  2GDS A;  1VF6 A;  2PY5 A;  1RM1 C;  2JEX A;  4LFA B;  4LFB B;  4EEQ A;  5GW7 A;  3KCX A;  4JGS A;  5C93 A;  4HZ3 A;  3K9S A;  2ZXW B;  4J11 A;  4F4L A;  3ZMZ A;  4FLT A;  3OW2 U;  4L8J A;  4FZ0 A;  3OE7 G;  3E22 B;  3N2G A;  4DW1 A;  4X20 A;  2HG5 C;  2ITC C;  4FLU A;  1V54 B;  5LBQ A;  3O65 A;  3JAT B;  4JI3 O;  4PA4 A;  3KG2 A;  3HKE A;  4JPR A;  1TGO A;  1KC8 W;  3FAV B;  3BY6 A;  1I08 A;  4H13 B;  3JD2 A;  1Z5V A;  1M4U A;  3DTU B;  4DV4 B;  1D5N A;  4JI0 O;  5IJ9 A;  1VQ6 V;  3SJC C;  4YY3 O;  4KFM A;  1RM1 B;  2P90 A;  3D36 C;  4DR7 B;  4DR1 O;  4J9Z B;  1ZTE A;  2WPD G;  1YJN V;  5IJ0 A;  2HR3 A;  1FXK C;  4UV8 A;  1KU9 A;  4FZ1 A;  5BY1 A;  2VQF O;  1LNQ A;  4FFK A;  2AW9 A;  4J42 A;  3OR7 C;  3RYH B;  2ATK C;  2ILM A;  4MVS A;  4PDR A;  5J9P C;  1NR1 A;  4DV7 B;  3IFX A;  1B06 A;  2RQ6 A;  5FLX N;  2YIC A;  4JI8 O;  1B3Q A;  4JI6 B;  1R73 A;  2DWD C;  1S5J A;  4X88 A;  3UQ8 A;  1K4C C;  2A3Q A;  3LSQ A;  1JVM A;  1YI2 V;  1Q43 A;  2Y4T A;  3KCY A;  1E79 G;  3LDC A;  1V55 B;  3BEH A;  1BHB A;  4AQY O;  5CA3 A;  1TVK A;  3D3I A;  4DR4 O;  1QVF U;  2ADQ B;  3RVY A;  1YTF D;  1FXK B;  5KUM A;  1Y76 B;  1ZUQ A;  3T4D A;  4MW8 A;  4J80 A;  1SQF A;  5IYZ B;  4BIU A;  3U11 A;  2MK3 A;  4R50 A;  1AB3 A;  2P22 C;  4EFB A;  4LF7 O;  5D5Q A;  1Z5W A;  1N36 B;  5B66 Z;  1GM8 A;  3VQW A;  3ETD A;  1Q6U A;  3EVK A;  2M7W A;  2UXD O;  1HNW O;  3JD3 A;  4OPA A;  1H2G A;  4FLX A;  2DYR B;  4CC5 A;  5KHI A;  1LR1 A;  4UCU A;  4NXN O;  5FL7 G;  3OTF A;  1FXV A;  1VF5 B;  2LJ2 A;  3FB6 C;  4U7O A;  3HKD B;  5L3B A;  4JYA B;  1WLE A;  1OCO C;  3A2F A;  3JAR A;  2EIK B;  4PI2 A;  1WNS A;  1RPR A;  4TQD A;  4J10 A;  2ZCE A;  5JVD A;  1P7B A;  3ZHV A;  1SA0 B;  1MOF A;  2HJD A;  1AI6 A;  3E22 A;  4JI2 O;  2IH1 C;  4FM2 A;  4JV5 B;  1HP8 A;  2LGW A;  4JYB A;  1LUW A;  3ABK C;  1KP3 A;  2AHY A;  4MW3 A;  1X4T A;  4RQF A;  1EN6 A;  2UXB B;  2YID A;  1BGY H;  3FAV A;  1J5E O;  4B7K A;  4JAV A;  4TV9 B;  5LMN B;  1AVM A;  4PEL A;  1F7Y A;  4U7N A;  4H0L B;  2B1I A;  3MHH C;  2E5L B;  1R6N A;  4K8X A;  1OCO B;  5LHI A;  1GO3 F;  2YIA A;  1NTZ H;  4WF9 V;  3CCE V;  2XAH A;  4Z1M G;  3ABM B;  1YHQ V;  3QO8 A;  3BHP A;  2VS0 A;  2OTL V;  2DE0 X;  1BE3 H;  2GTA A;  1QU7 A;  3AG2 C;  2FB5 A;  4NYK A;  1IDS A;  3PJS K;  3ZRX A;  1K3E A;  4X65 B;  2P7T C;  4ZI7 A;  5HFM A;  3SR2 C;  4JZG A;  3RYH A;  1NI8 A;  1YZB A;  1B6Q A;  4OX9 B;  4WFA V;  2ARH A;  3WB1 A;  1VP7 A;  2PI5 A;  3WFV A;  5EIB C;  3OGC C;  4DV4 O;  3JAK A;  3FD9 A;  4O4L A;  3STZ C;  4DR7 O;  2HEP A;  3ZMS A;  1Y74 B;  3ZJZ A;  5JCO C;  3U10 A;  1W59 A;  2QR4 A;  4DUY B;  4DR3 O;  1ZAU A;  5BMV B;  1Y76 A;  3I55 V;  3OEE G;  1HWY A;  1COW G;  1JQ0 A;  2E74 B;  2XOK G;  1WB8 A;  4ZHQ B;  3CRA A;  2DN9 A;  2BTQ B;  5BR8 O;  2CDY A;  1OCZ C;  3AG3 B;  4FLW A;  4G27 B;  5LGT A;  1KKD A;  1CP9 A;  1HW7 A;  4DV7 O;  1P4R A;  3L73 H;  2BE3 A;  5JQG B;  4UFZ A;  4LFC O;  3CMA V;  3UKM A;  4JI6 O;  2CAZ C;  4O2B B;  2N04 A;  1AIL A;  4U3J A;  4YJ3 B;  1WA8 B;  3CME V;  1I94 B;  2FML A;  3LSS A;  1G8M A;  4Q6G A;  5JH7 A;  4X1I B;  1RFY A;  2IW5 A;  3JAM N;  4CBC A;  1R3I C;  4X1Y B;  2OTJ V;  1BCC H;  1XMO B;  2HVK C;  3OEH G;  1ZX3 A;  1U96 A;  2WWW A;  4I9W A;  4DV2 B;  1MG1 A;  5CB4 A;  3E86 A;  4AI8 A;  4P30 A;  3K06 A;  1SA0 A;  3T1H O;  2PTM A;  4PA3 A;  1GN3 A;  1Y67 A;  1OCZ B;  1Y4M A;  5LL6 Y;  3K0D A;  1F4N A;  1GH6 A;  1BT8 A;  1VQM V;  2EIL C;  4R8C A;  1YDX A;  2HJF C;  1UPG A;  2XHB A;  4B3R B;  4NR1 A;  2RN9 A;  4TOI A;  2HHH O;  2K9P A;  3AG1 C;  1AJQ A;  3VQY A;  1D2D A;  1M93 A;  1SQB H;  5IY5 B;  5B5E Z;  4TV9 A;  3FB7 C;  2AHZ A;  1YCI A;  2Q68 A;  1AI4 A;  3F7Y C;  3M8A A;  2XT9 A;  2UXC O;  4UXN A;  5CA0 A;  4FMT A;  5HFL A;  1JA8 A;  4GYC B;  4H33 A;  5JJN B;  4LP8 A;  3B09 A;  2EIN C;  2XUM A;  2QKS A;  2YEV B;  3H1I H;  4JF3 A;  3CJH B;  5B1N A;  1VQ9 V;  2WAM A;  4PI0 A;  3SPG A;  1JJO A;  1N8R W;  1N0J A;  2HFE C;  4FPP A;  1S0V A;  3ZHR A;  4LF4 O;  5CBG A;  1IBM O;  4WCE V;  4JV5 O;  2DYS C;  2EIL B;  3NR7 A;  2RNB A;  2CH7 B;  1K4D C;  2R9I A;  4NXM O;  3TXQ A;  4IGG A;  1OV9 A;  1Y66 A;  2WSS G;  3FB5 C;  1R3K C;  4DR1 B;  3APQ A;  3CB2 A;  1BMF G;  4D7T A;  1K9M W;  1XMQ O;  5EZY A;  2JEU A;  5LMN O;  4N23 A;  2UU9 B;  2QWQ B;  4MTX A;  2Y48 A;  1SQP H;  1BZK A;  3B40 A;  3RYF B;  3OMI B;  2E5L O;  4MVU A;  2LFS A;  3VOU A;  2QTO A;  2VQF B;  4PA7 A;  1PM9 A;  1HNX O;  4P9P A;  4TV8 A;  1XIL A;  1Y74 A;  4O4H B;  4I0X A;  3CS5 A;  1XUQ A;  1FPO A;  4A5U B;  1PP9 H;  4JI8 B;  3ICX A;  5JJJ B;  2DYS B;  1GAX A;  3A0B Z;  4ZHQ A;  1RPO A;  3LDE A;  4ZIB A;  2FL4 A;  3B8M A;  4I9Q A;  4ZOL B;  2YXY A;  4WBN A;  4GX1 A;  3L74 H;  4UB8 Z;  1Q8I A;  2CK3 G;  4AQY B;  3Q4H B;  3ZBH A;  4OX9 O;  3CC7 V;  2QM8 A;  5JQG A;  3E8G A;  4QNH B;  4DR4 B;  2UUA B;  4O2B A;  1ZL8 A;  3ZHS A;  2V7Q G;  2JK5 C;  1NBM G;  2ETN A;  1N33 B;  3ZN1 A;  1B04 A;  1XL6 A;  1G4Y B;  2DJV A;  3SJQ C;  2IH3 C;  3JD1 A;  4AIL C;  4RO2 A;  4YJ2 B;  4D7S A;  4IIJ A;  4X1Y A;  4LF7 B;  1VAR A;  3JSN A;  4I4T B;  4JI4 B;  2F23 A;  3BA8 A;  2ZR2 A;  1TA8 A;  4G2K A;  5LYJ B;  1M56 C;  1Q3E A;  5DN6 G;  2C2A A;  4I5S A;  4DUY O;  2UXD B;  1HNW B;  5LXT B;  3ZRS A;  5A9G A;  2ZT9 B;  3AK1 A;  5LP6 A;  4HNA B;  1R1B A;  4O2A B;  3HKC A;  2FTK A;  4LNU B;  1OHH G;  1DGS A;  2E75 B;  2EJR A;  2YSU B;  1ZSP A;  1K8A W;  1TAE A;  3OMN B;  2D3O W;  5CBH A;  1NVP B;  3SJB C;  3ZHQ A;  4UVA A;  1M90 W;  1DF4 A;  1XMO O;  3A0H Z;  2XAF A;  1K97 A;  2WA3 A;  1M56 B;  2F93 B;  1AP5 A;  4RWU A;  3K03 A;  2NN4 A;  4I50 A;  2BOB C;  4JTC B;  5FNV A;  5EK0 A;  4LR3 A;  5ITZ B;  5KMG A;  1PL4 A;  4CS3 A;  4GX2 A;  2B1G A;  4ZBM A;  2KSD A;  1J5E B;  4P2Z A;  3JYC A;  1S3J A;  2XAS A;  4X64 B;  1FD9 A;  1R6T A;  4NB5 A;  1I0H A;  4B3R O;  1O9G A;  3H1L H;  1Q86 W;  5LMU O;  3AG7 A;  2YC0 A;  4QE7 A;  1SZT A;  2AXT Z;  3OUF A;  2EZO A;  5DM6 V;  2WLK A;  2ZDI A;  2PYJ A;  4QPJ A;  1DTO A;  4FFB A;  3W7S A;  3RYF A;  1FJG O;  2W0X A;  1QVG U;  1U97 A;  2X7R B;  1HNZ O;  5LA6 A;  2QE7 G;  4DO2 A;  4DRX B;  5A2Q N;  4X8A A;  3CRC A;  1AR1 B;  1URF A;  1H2K A;  4P9O A;  5J2T B;  3IAY A;  5J2U A;  1SQV H;  2DW4 A;  2VWK A;  3P30 A;  1K5Q A;  1KYO F;  4ZOL A;  5H6R A;  4BR6 A;  1VQN V;  3QG5 A;  4GCZ A;  1V9P A;  4UB6 Z;  2BTO A;  3Q4H A;  2ZNI A;  3VQX A;  4TQF A;  1E1Q G;  1NT2 B;  3IC9 A;  3P32 A;  4WFH A;  3QTC A;  4DR3 B;  4ZKI A;  4JYY A;  2YS8 A;  3AG4 C;  2UU9 O;  4OXS A;  1K33 A;  3LNN A;  2QM7 A;  3ZRW A;  4CH5 A;  4DR2 B;  5BR8 B;  4I4T A;  1Q7Y W;  4JI5 O;  3HKB A;  2ADP A;  1IXB A;  1SES A;  2JGD A;  2XND G;  5LXT A;  4EKW A;  4LFC B;  1KB9 F;  5K1P A;  1VF7 A;  1N32 B;  2ZM6 B;  2R70 A;  3MHS C;  3CCR V;  3N2K B;  3JAL B;  4K0K B;  3ZHU A;  4LNU A;  4H44 B;  3CPW U;  2ZQM A;  2UUA O;  3AG4 B;  4DR5 B;  1BSM A;  1N33 O;  3A8T A;  1SER A;  3JAW B;  4MTG A;  3K08 A;  3T1H B;  5C8Y A;  5GTH Z;  4FM0 A;  1IVS A;  1NTM H;  4JI7 O;  4DV1 O;  2OWO A;  3WG7 C;  4FM1 A;  2Z0A A;  3G4S V;  4JI4 O;  1EFR G;  2P4K A;  2UXN A;  3T2M A;  3LUT B;  3D8C A;  2PUS A;  2YI8 A;  1XNR B;  5ITZ A;  4UCV A;  1EBO A;  2HHH B;  4LWS B;  1N4C A;  5FPR A;  1FYJ A;  4RAI A;  1IBL B;  1JCH A;  1X59 A;  3CD6 V;  1US6 A;  2GTS A;  3RYI A;  4WFG A;  2UXC B;  2NNU A;  1YJW V;  5KX5 B;  1M1K W;  3MD0 A;  3M7M X;  2F1M A;  2NLJ C;  2P06 A;  1SKV A;  1XEQ A;  2Q73 A;  1K34 A;  4J7Z A;  3EHB B;  1MA1 A;  1S77 D;  3EXA A;  3RBZ A;  3BFR A;  1R6K A;  1N34 B;  5EYP B;  5F2V O;  3FX7 A;  2EX3 A;  3WG7 B;  4RQE A;  4LF4 B;  1IBM B;  3SPI A;  4F6R B;  3ZRV A;  3SPC A;  3SGI A;  3TGU H;  4NXM B;  2ZE7 A;  4K8Z A;  4LF6 O;  4BW9 A;  1HR0 O;  2JDI G;  3M99 B;  4GZR B;  3JAT A;  5LOV B;  5GTI Z;  1T5E A;  1XMQ B;  4PDM A;  3JSL A;  2WLI B;  3L70 H;  4X64 O;  2G38 A;  2OT5 A;  2LW7 A;  4E4E A;  3JD0 A;  2UUC O;  1JFF B;  2YXH A;  1HNX B;  2F4V O;  2OIG A;  4F6E A;  1MZF A;  5L3F A;  4GLX A;  1QQC A;  4LC1 A;  2X6B A;  2N74 A;  1VQP V;  4DV6 O;  3ABL C;  2O57 A;  3J80 N;  3QNE A;  4IYH A;  1AI7 A;  2CTP A;  2ZE6 A;  1S5H C;  1SRY A;  1OZ0 A;  3ABK B;  3KKY A;  3T1C A;  1QR9 A;  3G6B A;  4LBE C;  2GUZ B;  3U0Z A;  4JI1 B;  1VIB A;  4BAY A;  3THO A;  2QWO B;  3NXS A;  4YIO A;  3CYO A;  5L3C A;  1QLN A;  4YHH O;  1QR8 A;  3OGI B;  5IWA B;  4BW5 A;  3K5L A;  4GKK O;  3F5W C;  3D36 A;  3FYE B;  1TUB B;  5H9C A;  1VQ7 V;  2KG7 B;  3B4S A;  3FKS G;  1W0J G;  4W4L A;  1GTO A;  1SF9 A;  1RSO B;  2D2C B;  3ABL B;  3DC6 A;  1FXK A;  3AG2 B;  4O4J B;  3JAW A;  1PKX A;  1PPJ H;  5IYZ A;  4KL1 A;  5KLV H;  3K58 A;  3W7T A;  4DR2 O;  3DXR B;  2LO1 A;  2Y0I A;  3BCC H;  3K5N A;  2ZE8 A;  3KZI Z;  1BL8 A;  4LWS A;  2QTS A;  4DK1 A;  4JYC A;  5EBL C;  1N32 O;  5B1A C;  3CCQ V;  3DSQ A;  2ZM6 O;  2F95 B;  1W2B U;  2Y4U A;  5BZB A;  1CEZ A;  1JX9 A;  3OT7 A;  3BAA A;  2JJ2 G;  2Q4P A;  4K0K O;  3CCJ V;  5IT9 N;  3HKD A;  5KX5 A;  3P3N A;  3STL C;  1KD1 W;  2M6Y A;  1KEC A;  2RJZ A;  4DR5 O;  1OCR C;  2P4V A;  1WP8 A;  4MTF A;  3G71 V;  5H6Q A;  3C3S A;  5B1B C;  4DUZ B;  3SYA A;  3G80 A;  1VQ8 V;  4B3T B;  2EIM C;  1EN4 A;  4F6R A;  5KHJ A;  4CH4 A;  1W0K G;  4CC6 A;  3AEI A;  3UT5 B;  1XNR O;  4WFB V;  4CZZ A;  5LMU B;  4X9Q A;  4ASU G;  1VEW A;  1NKD A;  1SC5 B;  4PA6 A;  1PNL A;  3EFF K;  4R7C A;  1IBL O;  2WLI A;  4JTD B;  2IJI A;  4QIW F;  1FJG B;  5B3S C;  3OTO B;  1HDJ A;  1EM1 A;  4DW0 A;  4PJ0 Z;  2WLL B;  1FXH A;  4KP4 A;  5EBM C;  1VF6 C;  4EB6 B;  1HNZ B;  4IYI A;  1I5X A;  3BPZ A;  1OCR B;  3ABT A;  3E83 A;  5H5N A;  4XDJ A;  4MS2 A;  1N34 O;  5B1B B;  2BSK B;  4JZ2 A;  5K1X A;  3O9O A;  3SYP A;  1NVP D;  2Q7E A;  3ASN C;  3OM3 B;  2Y69 C;  2QWR B;  4ABM A;  1H8H G;  3AG1 B;  1MMM A;  3WB2 A;  4L87 A;  4DXW A;  2PGG A;  4XBF A;  3CHX A;  4G28 B;  1Y6X A;  5B3S B;  3J81 N;  3ZN0 A;  3CCS V;  4PDL A;  1AJP A;  3K5M A;  1Q81 W;  1XBL A;  2KG7 A;  4JI5 B;  2PZS A;  4X89 A;  2EIN B;  1ORQ C;  4OGQ B;  2DMX A;  3C90 A;  2K1E A;  2P67 A;  1SQQ H;  2QEX V;  4O4J A;  5BMV A;  5E1A C;  3RYC B;  2UUB B;  4YIP A;  1XI1 A;  3SYQ A;  1M57 C;  1MAB G;  5L3D A;  3N2G B;  3DXR A;  3B2E E;  3ASN B;  1YF2 A;  2BTQ A;  2Y69 B;  3OFN G;  3BAB A;  3ZMU A;  4JI1 O;  3IGA C;  1EN5 A;  4LF9 O;  2OCC C;  3B77 A;  4KUM A; 
#chains in the Genus database with same CATH homology
 2DQ3 A;  1BHA A;  4GX5 A;  1PNM A;  2EIK B;  4X8A A;  1QLE C;  1RPR A;  4MVQ A;  3ML0 A;  1L1F A;  1AR1 B;  1P7B A;  3W7U A;  1FFT B;  1ROP A;  4P9O A;  4Q20 A;  3TK1 A;  5L3G A;  1MOF A;  3F7V C;  3CC4 V;  1AI6 A;  5IY5 C;  2DW4 A;  2IH1 C;  3P30 A;  1F4M A;  1K5Q A;  5H6R A;  1VQN V;  4JYB A;  5EBW C;  3G6E V;  3UM7 A;  1I5Y A;  2DWE C;  3ABK C;  4GCZ A;  1QBZ A;  1K5S A;  1KP3 A;  2AHY A;  2DQ0 A;  4MW3 A;  5LGN A;  2ZR3 A;  1ZWI C;  1E1Q G;  4RQF A;  1PD3 A;  4QPK A;  1KP2 A;  2H8P C;  2LP7 A;  3E8H A;  1CPY A;  3P32 A;  4WFH A;  5B1A B;  3K04 A;  4ZKI A;  1M57 B;  3AG4 C;  4JAV A;  4OXS A;  1K33 A;  4PEL A;  3E8F A;  4U7N A;  2QM7 A;  3ZRW A;  2B1I A;  3MHH C;  1R6N A;  1R3L C;  4UVC A;  4PA9 A;  1OCO B;  2GHY A;  2OCC B;  2R9R B;  1Q7Y W;  5LHI A;  1GO3 F;  4N21 A;  4BIZ A;  4WF9 V;  4GT1 A;  3CCE V;  1VQL V;  1SES A;  2XAH A;  3CCV V;  4Z1M G;  3ABM B;  1YHQ V;  2P6J A;  2XND G;  3QO8 A;  4EKW A;  3FYI B;  3QO7 A;  2OTL V;  4R6Z A;  2EBO A;  3AG2 C;  3SYO A;  4HYO A;  1K92 A;  4UVB A;  1DLB A;  3ASO C;  3PJS K;  3ZRX A;  1Q82 W;  1GMG A;  2ZDI C;  4JAU A;  3MHS C;  3CCR V;  1K3E A;  2EIM B;  2WLJ A;  2P7T C;  5HFM A;  3GWO A;  1YIJ V;  1PL0 A;  2LFR A;  1B6Q A;  3DGE A;  3HB3 B;  3CPW U;  2ZQM A;  3SYC A;  4J9Y B;  4WFA V;  1UJW B;  3AG4 B;  1K7D A;  2HVJ C;  2YEV A;  1K73 W;  1SER A;  2PI5 A;  2ZXW C;  4MTG A;  3WFV A;  3K08 A;  5L3E A;  5EC1 C;  3OGC C;  4TWK A;  2QA4 V;  3STZ C;  4XDK A;  4MVR A;  3CXC U;  3WG7 C;  3G4S V;  1EFR G;  3K9A A;  4WFF A;  2UXN A;  3T2M A;  3LUT B;  3ZMS A;  2X6A A;  2V1D A;  3ZJZ A;  4H37 A;  4QE9 A;  4MTO A;  4YXW G;  1EBO A;  4FJC C;  4PDV A;  2X6C A;  3I55 V;  5IDJ A;  2IJK A;  3OEE G;  3ASO B;  1HWY A;  1COW G;  5LGU A;  4RAI A;  3ZCC A;  1JCH A;  1JQ0 A;  2XOK G;  3CD6 V;  2EIJ C;  3QO5 A;  4WFG A;  1NQT A;  1OCZ C;  3ZIA G;  2X0L A;  2H94 A;  3AG3 B;  3TCU A;  2NNU A;  1YJW V;  5LHG A;  3CP1 A;  3RVZ A;  4G27 B;  1M1K W;  1VQ4 V;  5LGT A;  1KKD A;  1CP9 A;  3MD0 A;  3HPL C;  1P4R A;  1EZJ A;  2NLJ C;  1FS0 G;  3CMA V;  3UKM A;  4UV9 A;  1K34 A;  3EHB B;  1S77 D;  1GM7 A;  3RBZ A;  3CME V;  1IXM A;  2Z5U A;  1R6K A;  2IJJ A;  3LSS A;  1G8M A;  1NH2 B;  5EC2 C;  2IW5 A;  3WG7 B;  4RQE A;  4CBC A;  1R3I C;  2OTJ V;  3SPI A;  1NH2 D;  2HVK C;  3OEH G;  3B8N A;  1MSW D;  2WWW A;  4I9W A;  3ZRV A;  4TT3 G;  3SPC A;  1MG1 A;  1AI5 A;  3R65 A;  4WFE A;  3OR6 C;  3E86 A;  5IYD O;  2JDI G;  3M99 B;  1GM9 A;  2W6I G;  4P30 A;  4MVM A;  5CMU A;  2IJH A;  3K06 A;  2IU0 A;  1S76 D;  4PA3 A;  2A9H A;  4JAS A;  3X2Q C;  2EIJ B;  5KA6 A;  4PDM A;  1NJI W;  3CC2 V;  2WLI B;  1OCZ B;  3ZRW B;  1Y4M A;  5IYC O;  2W6J G;  1F4N A;  3K0D A;  2OT5 A;  1TUE B;  3JD0 A;  1V55 C;  2EIL C;  4R8C A;  1VQM V;  3JD4 A;  2HJF C;  4MSW C;  4FK5 C;  1QLE B;  2W0F C;  3AG1 C;  5CN0 A;  5L3F A;  2JJ1 G;  3CCL V;  4LC1 A;  1AJQ A;  2X6B A;  4RUF A;  1VQP V;  4E2L A;  2GSM B;  3ABL C;  5IY5 B;  4DO2 A;  1DF5 A;  1E1R G;  3FB7 C;  3QNE A;  2AHZ A;  2WLM A;  1AI7 A;  3W7W A;  2Q68 A;  1AI4 A;  1PNK A;  1THZ A;  3F7Y C;  4UXN A;  1S5H C;  1SRY A;  1OZ0 A;  3ABK B;  3T1C A;  1QR9 A;  4LBE C;  3T4Z A;  4LCU C;  2WLL A;  4BAY A;  4FMT A;  5HFL A;  3LDD A;  4QJF B;  1ENV A;  4H33 A;  4LP8 A;  3K3W A;  3IC7 A;  2EIN C;  3NXS A;  2QKS A;  2UXX A;  2YEV B;  2HKO A;  3CYO A;  4JF3 A;  5B1N A;  3X2Q B;  5L3C A;  1VQ9 V;  2WAM A;  1QLN A;  1QCE A;  2DYR C;  3ZMT A;  1QR8 A;  3SPG A;  2Z3Y A;  1YIT V;  1N8R W;  2HFE C;  4FPP A;  1S0V A;  3A0R A;  3E89 A;  4MT8 A;  4MVO A;  4BW5 A;  5CBG A;  4WCE V;  2DYS C;  2EIL B;  3OMA B;  4GX0 A;  5IYB O;  3VBB A;  3RW0 A;  3F5W C;  3D36 A;  3FYE B;  2Q67 A;  5H9C A;  3CCU V;  1JOY A;  1K4D C;  1S72 V;  1VQ7 V;  2R9I A;  1SET A;  3K0G A;  1WPX A;  4HAM A;  3FKS G;  1W0J G;  2PI4 A;  2WLN A;  1Y66 A;  1GTO A;  2WSS G;  5B1O A;  3H01 A;  5KA5 A;  1V54 C;  3ABL B;  2WLH A;  3GB7 C;  2EIK C;  3FB5 C;  1R3K C;  1BMF G;  1FXK A;  2IU3 A;  4TSF G;  3AG2 B;  2A79 B;  1K9M W;  1PKX A;  2JEU A;  3SPJ A;  1H38 A;  4N23 A;  3ABU A;  1GK9 A;  2JIZ G;  2Y48 A;  4MTX A;  3W7X A;  3K79 A;  3OMI B;  4MVU A;  3W7T A;  2LFS A;  3VOU A;  2QTO A;  3LNM B;  2KB1 A;  4PA7 A;  4P9P A;  1RM1 C;  2JEX A;  3E8B A;  1BL8 A;  5GW7 A;  4JGS A;  5C93 A;  5LHH A;  4HZ3 A;  4JTA B;  2ZXW B;  3SPH A;  4JYC A;  2Q69 A;  5EBL C;  1JJ2 U;  5CBF A;  5B1A C;  3CCQ V;  4F4L A;  3ZMV A;  3ZMZ A;  3OW2 U;  1J95 A;  2DYS B;  1W2B U;  3OE7 G;  5BZB A;  1RPO A;  3LDE A;  1CEZ A;  1JX9 A;  3B8M A;  1OCC C;  4FIP C;  2JJ2 G;  4GX1 A;  3CCJ V;  2HG5 C;  2ITC C;  2CK3 G;  1V54 B;  3STL C;  5LBQ A;  2QM8 A;  3CC7 V;  1KD1 W;  3E8G A;  1KEC A;  4QNH B;  2ZD9 A;  3I56 V;  3ABM C;  1OCR C;  1NR7 A;  4PA4 A;  3KG2 A;  3ETE A;  2V7Q G;  2JK5 C;  4JPR A;  1NBM G;  4MTF A;  4XDL A;  1KC8 W;  1KQS U;  3ZN1 A;  3BY6 A;  1XL6 A;  1G4Y B;  3G71 V;  5H6Q A;  3SJQ C;  5KUK A;  2IH3 C;  3JD2 A;  3JD1 A;  4RO2 A;  3DTU B;  3E35 A;  1R3J C;  5B1B C;  3SYA A;  2F43 G;  1VQ8 V;  1VQ6 V;  2EIM C;  1JPX A;  3ETG A;  4KFM A;  1RM1 B;  2P90 A;  1W0K G;  2ZR2 A;  4G2K A;  4MVZ A;  3AEI A;  1M56 C;  4WFB V;  5DN6 G;  2A0L A;  2C2A A;  4I5S A;  2B5U A;  4J9Z B;  4CZZ A;  2WPD G;  4RUE A;  1YJN V;  2HR3 A;  4ASU G;  3ZRS A;  1NKD A;  4PA6 A;  4R7C A;  1PNL A;  3EFF K;  1FXK C;  4UV8 A;  2WLI A;  4JTD B;  1OCC B;  1VQO V;  2IJI A;  2XAQ A;  3FB8 C;  4QIW F;  1LNQ A;  5B3S C;  1XL4 A;  3OR7 C;  4UUJ C;  2ATK C;  2WLL B;  1FXH A;  4KP4 A;  5EBM C;  4MVS A;  4PDR A;  2FTK A;  1M9N A;  5J9P C;  1OHH G;  1NR1 A;  1I5X A;  2XAJ A;  3IFX A;  1OCR B;  3ABT A;  3E83 A;  3TET A;  2EJR A;  2YSU B;  1VQK V;  1K8A W;  3CCM V;  1R73 A;  2DWD C;  4XDJ A;  3E2E A;  4MS2 A;  3OMN B;  4X88 A;  2D3O W;  1K4C C;  5CBH A;  1F23 A;  3LSQ A;  5B1B B;  1NVP B;  1YJ9 V;  2XAG A;  1JVM A;  1ARO P;  4UVA A;  1YI2 V;  1M90 W;  1DF4 A;  1E79 G;  3LDC A;  2EZP A;  1V55 B;  2XAF A;  3BEH A;  3SYP A;  1NVP D;  1K97 A;  3OUS A;  1M56 B;  3ASN C;  1BHB A;  3OM3 B;  2Y69 C;  5CA3 A;  3AG3 C;  3K03 A;  3D3I A;  1H8H G;  4JTC B;  2BOB C;  2Q6A A;  3AG1 B;  5EK0 A;  1YTF B;  1QVF U;  1H8E G;  3RVY A;  3OAA G;  4L87 A;  1F51 A;  1YTF D;  1FXK B;  5KUM A;  4DXW A;  4GX2 A;  2ITD C;  2B1G A;  3T4D A;  4XBF A;  4MW8 A;  4ZBM A;  2BOC C;  4BIU A;  2MK3 A;  4G28 B;  4R50 A;  4P2Z A;  5B3S B;  3JYC A;  3ZN0 A;  1S3J A;  3CCS V;  2XAS A;  1GM8 A;  4PDL A;  1AJP A;  2HLD G;  3ETD A;  1Q81 W;  1VQ5 V;  2M7W A;  1Q86 W;  4X89 A;  2EIN B;  1ORQ C;  1GKF A;  3JD3 A;  2K1E A;  2P67 A;  1H2G A;  2QEX V;  2DYR B;  4QE7 A;  1SZT A;  5E1A C;  3OUF A;  1YSC A;  2EZO A;  5DM6 V;  1AJN A;  2WLK A;  2ZDI A;  4QPJ A;  3SYQ A;  1DTO A;  1M57 C;  3W7S A;  1MAB G;  5L3D A;  1QVG U;  3ASN B;  3JCZ A;  2X7R B;  2Y69 B;  5FL7 G;  3OFN G;  1FXV A;  3FB6 C;  3ZMU A;  4U7O A;  5L3B A;  1WLE A;  3IGA C;  1OCO C;  2OCC C;  3B77 A;  4KUM A;  2QE7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...