4P2ZA

Structure of navms t207a/f214a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p2zA00
3AG4C 2HVKC 1R3JC 3ASOC 3K08A 2WLJA 3FB6C 3OGCC 2X6BA 2DWDC 3OUFA 5EC2C 5EC1C 3LUTB 3E8HA 4QNHB 3SYPA 1QLEC 2IH3C 4G27B 4P2ZA 4MW8A 4X89A 4P9PA 3X2QC 3SPCA 3STLC 3FB5C 3R65A 4MTOA 4RO2A 4DXWA 5BZBA 3STZC 4P9OA 3VOUA 2BOBC 3KG2A 5KUMA 4MVRA 3RW0A 1M57C 3WG7C 4X88A 4EKWA 3F7YC 3SPHA 3RVYA 4JTDB 2WLLA 2ZXWC 4P30A 4BW5A 4MW3A 3IFXA 5IY5C 2P7TC 5KUKA 3GB7C 5B3SC 4TWKA 1OCOC 4WFGA 3LDDA 4MSWC 4WFFA 1R3IC 2HFEC 2AHZA 4MS2A 2R9RB 3ASNC 1V54C 3SYCA 4KFMA 3AG2C 4UUJC 3E8FA 3OUSA 4OXSA 5EBWC 3K06A 1R3LC 2NLJC 1XL6A 1KKDA 3FB8C 4RUFA 4ZBMA 3F7VC 3SPJA 3TETA 5CBGA 3SYQA 3ABLC 3LNMB 3SYAA 1K4DC 4HYOA 4XDLA 1JVMA 1OCZC 2X6CA 3UKMA 2JK5C 2EIJC 4R6ZA 4GX5A 4LP8A 1J95A 2ATKC 2W0FC 2WLNA 4GX0A 4PA7A 3JYCA 2WLIA 5EBMC 3ZRSA 3ABKC 1ORQC 2EILC 3T1CA 3AG3C 2A0LA 1K4CC 2DWEC 2H8PC 4JTCB 3UM7A 3E8BA 4J9YB 3E83A 1LNQA 3E86A 3SYOA 3OR6C 3LDEA 1BL8A 4I9WA 4R7CA 5EBLC 2BOCC 4GX2A 2WLIB 3T4DA 4PDMA 1P7BA 4QE9A 4CBCA 2K1EA 4RAIA 4R50A 2A9HA 2DYSC 3IGAC 3RVZA 5CBHA 4LCUC 2WLHA 4QE7A 4X8AA 3LDCA 1S5HC 1G4YB 5E1AC 2EIMC 4MTGA 4PDLA 4XDJA 2QTOA 3FB7C 4MVUA 1M56C 1OCCC 4PA9A 4F4LA 4MVSA 5CBFA 5J9PC 4MVMA 4G28B 4HZ3A 2IH1C 4PA3A 4H37A 2OCCC 4R8CA 3SPGA 3OR7C 4J9ZB 2WLKA 3F5WC 5EK0A 2EINC 1ZWIC 3BEHA 2WLLB 1V55C 2KB1A 3SJQC 3K04A 4XDKA 1XL4A 3ABMC 5B1BC 4PA4A 4MVZA 3PJSK 3SPIA 3AG1C 4PDRA 4JTAB 2ITCC 2HG5C 3EFFK 2HVJC 3K0GA 2QKSA 3HPLC 2X6AA 2ZD9A 3E89A 4RUEA 1R3KC 3E8GA 4MTFA 3K03A 2EIKC 2Q67A 2Q6AA 5B1AC 3ZJZA 2A79B 4PA6A 2Q68A 4MVQA 4WFEA 3T4ZA 2Q69A 2AHYA 4H33A 3TCUA 2YEVA 4WFHA 4PDVA 4LBEC 4MVOA 1OCRC 4GX1A 2Y69C 3K0DA 2HJFC 2WLMA 3T2MA 2ITDC 3RBZA 2DYRC
chains in the Genus database with same CATH superfamily
1NVPD 4BIOA 5KA5A 2AXTZ 1VQMV 1WPXA 3X2QC 2E76B 2ZE7A 3SPCA 1Q81W 4JI2O 1PL4A 4WF9V 1S3JA 2WPDG 4X64B 1F4NA 2DN9A 1M57C 2HHHO 1QLEB 2H94A 5LXTB 3HKEA 4TT3G 4UV9A 3RVYA 3CCMV 1OCZB 4NKGB 4CS3A 1KP2A 1Y74B 2GUZB 3FYEB 2P6JA 3X2QB 1SF9A 3K06A 1VARA 3CJHB 2JJ2G 4GKJO 3H9VA 3W7UA 2QWPB 2JJ1G 4GX0A 4O2AB 1SESA 3HKCB 2EIMB 4J9YB 2YUAA 2QWRB 1KP3A 5KHGA 4CBCA 4D6TH 3ZRWA 4R50A 3WU2Z 5CBHA 1IVSA 4WCEV 1VF7A 3ZHVA 1MZFA 4GKKO 1NH2B 5EZYB 5EIBD 3J80N 1EN6A 1IURA 4I0XA 5EK0A 1QVGU 1KD1W 2QR4A 4QPKA 3SJQC 1XL4A 1SZXA 1WPBA 3CRMA 2ITCC 2HG5C 2GHYA 3RT3C 2OYQA 3ZHUA 3M99B 5AG2A 4DRXA 1PL0A 2ODMA 4CZZA 1XHZA 3L73H 1I5YA 4TV9B 5IWAB 4OX9B 3HKDA 3MD0A 2X6BA 4JI7O 1IZ3A 1WB7A 4DV5B 2W6JG 4UCRA 1Q7YW 5KUMA 3J7AU 3KCYA 4W4LA 3TK1A 1YVWA 3WG7C 1MA1A 2BSKA 4JZ2A 1R73A 1EBOA 4LF4B 2XAGA 4CC6A 3IFXA 4FLXA 4IL6Z 2X0LA 2F4VB 2Q0AA 4U3JB 1VMGA 1HNZO 2A3QA 4B3TO 1MABG 3ETEA 4NXNB 3FD9A 2OCHA 2CTRA 4J7JA 1EZVH 1X4TA 1VQ8V 2RMKB 3BHPA 5LHIA 4O4JA 1J95A 1S72V 4LNUA 2CUGA 2EILC 4I55B 4DV1B 3OR6C 2O57A 1BL8A 4OPHA 2ZM6B 1JFFA 3RYCA 3ZMTA 5JJJB 2DYSC 5BMVA 2UU9B 4LCUC 4QIWF 2ARHA 5E1AC 3FAVA 3CCEV 2A06H 1IBMO 1AILA 1SETA 5IYCO 5IDJA 4J80A 3ASOB 4E4EA 3SPGA 2WLLB 3ZIAG 4TOIA 3CWBH 3N2GB 3AEIA 3EHBB 3Q4HB 1AI5A 1F4MA 3SGIA 4B3SB 3CCRV 2RJZA 1NU1H 1BHAA 3W7WA 1AR1B 2BCCH 5FPRA 5IY5B 1UJWB 3AG7A 2YEVA 1VQ7V 4WFHA 3QO8A 1OCRC 3E22B 2ITDC 3JD0A 4I7ZB 1R6NA 3JALB 5JH7A 1V55B 1IBLB 4P2ZA 5IJ0A 1TVKA 1EZJA 5H9CA 4GCZA 3STZC 2DW4A 3KG2A 4UXNA 4X62O 4UCVA 3L72H 1M90W 5CMUA 3ABLB 3AG1B 5FPOA 4AQYO 4JTDB 3SJAC 3NR7A 1TUBA 2UXBO 1VQ5V 2JGDB 1QQCA 1U96A 5B66Z 4FLZA 2M6YA 3W7XA 1KB9F 1V54C 2YDEA 2LO1A 1ZTEA 1DTOA 3RWRD 3FB8C 2Y69B 4DV4O 2ZKOA 2PI4A 1NKDA 3FFQA 5B1BB 3LNMB 2X6CA 3P32A 3B40A 4LP8A 1PKXA 5IT9N 1NTKH 2A0LA 2DWEC 3IC7A 4X1KA 1LNQA 1VF6C 1K97A 3CRAA 4UVCA 3THOA 1FAFA 1KKCA 4DR3B 2B9ZA 3DSQA 1N8RW 2QTOA 3P3NA 4YXWG 1BS3A 4JAUA 4FM0A 2UXXA 3L9DA 4J41A 3K5NA 2OCCC 1IBKB 3G71V 1SA0A 1XI1A 2E5LB 1R1BA 3AG3B 2UUCO 2HJDA 3B2EE 2CK3G 3DXRA 3E8GA 1HR0O 5GONB 4U3FH 1M93A 3ZRWB 1K9MW 3ASNB 2HR3A 1OV9A 4NYKA 3K59A 3JD2A 4MVQA 1SS3A 1P49A 5JVDA 4B3MO 3UCSC 1AJNA 3H1LH 1EN5A 1W0KG 2JEUA 4FFBA 4KL1A 4P9PA 1HNXB 5BR8O 1NBMG 4BWAA 4UCTA 3UQ8A 3A2FA 2QWNB 1HP8A 3KCXA 4B3RO 4YY3O 4DW1A 1M5IA 4YJ3B 2QWQB 4QJFB 1BE3H 1QLNA 2IBZH 5B3SC 1OCOC 4KHPB 2YXHA 4UFZA 4WFFA 3QG5A 2AHZA 5L3DA 4JI3O 4UUJC 4L8JA 2QEXV 1R3LC 4PJ0Z 2A7WA 2ZR3A 1KYOF 4FLWA 5L3CA 4JI8B 3SYAA 2UUAB 1AROP 2JK5C 3SDLA 2IU0A 2GTAA 3ZRSA 4A5UB 1N34O 4GT1A 5LMUB 1XMQB 1YF2A 3CXHF 4UB6Z 4DR1B 4CH6A 2F43G 3G6BA 5A9GA 4X66B 2WLHA 1WB8A 2Z3YA 5L3FA 3OGIB 1GTOA 3C3SA 3CSXA 4DV0B 2KSDA 1Q5OA 4JASA 3JD1A 4X1KB 4J11A 1ZSPA 2PGGA 1R6KA 3ZHTA 1GM9A 5L3EA 1YIJV 1N33B 1KC8W 3OW2U 1N33O 1AP5A 1Q3EA 1VQKV 5E79Z 2QKSA 2X6AA 3K79A 3K03A 1HW7A 4JYCA 2LW1A 1SRYA 3S3WA 4O4IA 3T1HB 5CA0A 2ZDIA 1B06A 5EC1C 4DR1O 4DR5O 3E2EA 3L71H 4X89A 4H44B 3O65A 3ZHQA 1EN4A 3VQYA 1XMQO 5LMUO 2OIEA 5KHIA 5KMGA 1GK9A 3N2GA 1VP7A 3CMEV 4PD4F 2QDOA 3ABTA 1I94O 1S77D 4WFGA 2EJ7A 4JI3B 2HFEC 4TSFG 4LC1A 1RM1B 5LGNA 3CD6V 4IYIA 1B3QA 2QM4A 1W0JG 1GN4A 2EIJC 2W0FC 1AI7A 3EVKA 5LMNB 4K35A 1ORQC 5J2UB 1K3EA 5JCOC 1TAEA 4I4TA 1HNXO 2LGQA 3BRCA 3OTFA 3ETGA 3ETQA 2WLIB 5LYJB 3CMAV 1L8DA 3CX5F 4YJ2A 1RSOA 4FIPC 3K9SA 4F4LA 2XT9A 4I55A 4W4KA 4BIZA 1F51A 4IT5A 1HR0B 4GZRB 2UUCB 1H38A 1GH6A 1YEWA 5LGUA 1DLBA 5CA1A 3TXQA 1XEQA 4RQEA 2ADQB 1D2DA 3CCQV 4J7ZA 3K58A 2FKXA 2BTQA 3JARA 5JJEB 2OT5A 2ZT9B 4FPPA 2ZDIC 2Q68A 3ZMUA 2YXYA 2Q7GA 2P5OA 2P06A 4GX1A 3K0DA 1GN2A 3T2MA 3OEEG 3F5TA 3CC7V 2IJIA 2DWDC 1HNWO 3GWOA 1JX9A 4G27B 1W2BU 1YJ9V 1D5NA 2OWOA 1ZLZA 4EKWA 2Q5ZA 2VQEO 3CC4V 3UT5B 4DV4B 4DYLA 3VQXA 2XUMA 1FXVA 3SR2C 2GV9A 2DQ0A 2GSMB 1GM7A 2DYSB 3VBBA 2EULA 2P4KA 3F7VC 2EZOA 3GVMA 4AILC 4PV1B 1SQXH 4AQYB 1K4DC 4O4HB 4B7KA 4BIUA 2XTAA 3ZCCA 4X62B 1Y67A 5LHHA 3IAYA 3ABKC 4LH6A 2PTMA 3UM7A 3SYOA 2G38A 1X59A 1B04A 5H6RA 3K57A 4I9WA 2XAFA 5A2QN 1Y76A 4RWUA 3K3WA 2IU3A 2ZXWB 1S0VA 1CP9A 1FJGB 4QGPA 2EJRA 1S5HC 1IXMA 2UUBB 4X1YA 1M56C 5CBFA 1V54B 4MVSA 1GN3A 2LFSA 2PI5A 4B3SO 1O9GA 3CRQA 4Z1MG 2F95B 3RYFB 2DYRB 2JRIA 4KUMA 4PA4A 1FPOA 1K33A 5JQGA 3EFFK 1FD9A 3OEHG 1NH2D 1XNQO 2Y0PA 2YSUB 5LP6B 1K5SA 4DO2A 3PN1A 3CP1A 1K92A 2QJ1A 2UU9O 1Y66A 4K8ZA 3OMNB 1DF5A 1BHBA 2WLJA 2P67A 1M4UA 2IH3C 5J2UA 3B09A 2N04A 3DXRB 4DV1O 5LHGA 1FFXA 1YTFD 3A0BZ 3SPHA 1SQGA 3N2KB 1RSOB 2Q73A 1XDCA 2ZNJA 3FX7A 4FMTA 1NQTA 2CGNA 3Q4HA 2F4VO 5CA0B 4JYAO 3ASNC 4IYHA 4Q20A 3ZRVA 5JH7B 3JATB 2BSKB 1KKDA 2V7QG 3HKBB 3ETDA 3QF7A 1K73W 4LFBB 1JVMA 3ZX6A 2R72A 3APQA 1AR5A 4IIJB 1KU9A 3WB2A 3LSSA 2OCCB 5EBMC 3OMIB 4CS4A 5C93A 1L0LH 3R66A 1ZX3A 5EBLC 1Y74A 3BPZA 2YI8A 4JI7B 4RAIA 3EXAA 1PNKA 4LH7A 5IWAO 1VQ6V 4O4JB 1F23A 1N32O 1OCCC 4UCOA 1EFRG 3ZS8C 1MOFA 4O2BA 3KKYA 5EIBC 3BEHA 3AG4B 3ZHSA 4EEQA 5BMVB 5KX5B 4DR6B 3JARB 3MAQA 4JTAB 2XAQA 2P4VA 3CS5A 3JAKA 3H1HH 5EYPB 3HB3B 1R3KC 1HDJA 1WP7A 4MTFA 3OTOO 1BZKA 2Q6AA 2XAHA 3OTOB 4FLUA 3ZEDA 1BCCH 3ZN0A 1AJQA 4DR6O 2NN4A 3MDSA 3RBZA 3AG4C 1Z2GA 2HVKC 3OUFA 1Z5VA 1MG1A 3E8HA 2WAMA 5JWPA 4YJ2B 4BAYA 1Y76B 1N32B 4LWSB 1Q86W 1AVMA 4GUNA 4Z1VA 3DC6A 1XQ8A 4CH5A 4DRXB 4GKJB 1OCRB 3U11A 1S76D 2BTOA 1XREA 4TWKA 3DGEA 1R3IC 3B8NA 2VWJA 2OTLV 1CPYA 2NR5A 4LFBO 1MNGA 1G1XB 4YIOA 3N2KA 1PNMA 1P4RA 3OMAB 1UPGA 1KECA 3ABLC 1CXZB 4X64O 1QU7A 1Q6HA 2QM7A 5KLVH 4WBNB 4JYAB 3AG3C 4JI2B 4R7CA 4PHZA 1K34A 3S3XA 4QE9A 3FAVB 2AZ0A 5HFMA 1J5EO 1XBLA 1YCIA 1VQPV 1PP9H 1WLEA 4FLYA 1QVFU 3SJCC 2KG7B 4KXRA 3F5WC 3K5OA 2EINC 4JI4B 1QBZA 2F93B 2HLDG 3ZRXA 2EBOA 3OAAG 4MVZA 1N0JA 4FFBB 2AW9A 3HPLC 4UVAA 1XNQB 4DV7O 5IYDO 4WFBV 1S5LZ 3JSNA 1JQ0A 4PA6A 4HAMA 2DMXA 2PYJA 4B7EA 4GLXA 1SKVA 2WLMA 3D3IA 1URFA 5LA6A 4NXMB 3OD4A 4FLVA 1LUVA 1P7GA 3OM3B 4DXWA 2GDSA 1JCHA 3ML0A 5DM6V 5FNVA 2UUBO 4ICGA 5JVDB 1FJGO 3HKCA 5D5PA 1MMMA 1FXKB 2WLLA 4H0LB 2JS5A 4MT8A 2CE4A 5LGTA 4X1IA 4MSWC 3RYIA 3WFVA 4B08A 4KFMA 1MSDA 4OPAA 1JOYA 3TJTA 4DV3B 1JA8A 4Q6GA 2JEXA 5KHKA 4JAAA 3UKMA 3A0HZ 4IHJA 5LXTA 3WG7B 3E83A 4K3AA 1JMKC 2E74B 4DV2O 2VQEB 2B5UA 3LDCA 1FYJA 3D36C 5KHJA 3BY6A 3CYOA 3T1YB 2YI9A 1HNWB 1NJIW 4LF8B 2F1MA 3TGUH 2LQTA 3ABMC 3AK3A 3QO7A 4LF6O 1QHTA 2RDCA 2WA3A 1H2KA 4DUYO 3CCUV 2EILB 1JJOA 1ENVA 4HNAB 2B1GA 2A79B 2Q7HA 1PD3A 4HNAA 2ZQMA 4CC5A 1OHHG 1PV0A 4NTYA 1NI8A 1SQBH 4LF5B 3ZMZA 3C90A 4N21A 4D7TA 1E1RG 4LNUB 1QLEC 4MW8A 3LNNA 5FLXN 3FB5C 4RO2A 1Y6XA 5BZBA 3BVOA 3GWKC 2BOBC 5K1XA 2VWKA 3RW0A 1AB3A 1YZBA 4X88A 5L3BA 1PPJH 2ZR2A 2PZSA 1T5EA 3WB1A 4JI0B 1JFFB 1N0NA 2ZE8A 3D3QA 3G4SV 5LMNO 1E79G 4ZHQB 2PY5A 3P30A 4ZIBA 3JCZA 4G2KA 3L70H 4HYOA 2PYLA 5JJNB 1Q43A 2MK3A 1JR9A 5B1NA 1S5JA 3LSQA 2CTPA 1U97A 3LSUA 3LDEA 1I94B 5H5NA 3T4DA 1DK1A 4DR2O 2R70A 5LA6B 4K0KB 2Y0IA 3QVNA 1BSMA 2E3CA 3D36A 5IJ0B 2W0XA 1G4YB 3CB2A 4C7UA 5IE9A 5J9PC 4E2LA 2FTKA 3I5DA 4HZ3A 4PA3A 4H37A 5LYJA 4DR5B 4DV6O 4JAVA 4U3JA 2KB1A 5BXZA 5B1BC 3T1HO 3IJ4A 1VQLV 1BQZA 3CJHA 2YIAA 3TCUA 4EFBA 2P90A 2Q69A 3FYIB 1NZ6A 4F6EA 4I50B 3SYCA 3CHXA 1R3JC 3ASOC 5EC2C 3A8TA 1WAZA 1K7DA 3LUTB 4NR1A 1OCCB 5LOVB 4DR4O 4I4TB 3R65A 1AR4A 3U10A 4DV0O 4AHCA 2EZPA 4MVRA 3N27A 2CTWA 4TQFA 1SQVH 3W7TA 5CN0A 4X66O 3H1JH 4D7SA 4MW3A 2IM9A 1GN6A 5IY5C 2P7TC 3C3TA 5KUKA 1G8MA 2YS8A 1Q6UA 2VQFB 3CC2V 1N34B 2B1IA 4O2BB 2IJHA 2NNUA 3CRCA 4AI8A 4X20B 2UUAO 4F6RA 1ZAUA 5DEDA 5CA1B 4JI8O 1ROPA 3QNEA 3TETA 4O4LB 5ITZA 4NTWA 4XBFA 2PF4E 1TUBB 4KHPO 3E8BA 1VQ9V 1AP6A 4PDMA 2K1EA 3VQVA 4DW0A 1WN7A 2UXDB 3IGAC 3K9AA 1I5XA 4YY3B 3J81N 4B3RB 4LFCO 1XUQA 1YDXA 1L1FA 2KQXA 1Z5WA 5KHHA 1YJWV 5BR8B 4FZ1A 3DC5A 1P84F 5IJ9A 1VQ4V 4J9ZB 5H2FZ 2YEVB 4UCUA 1NR1A 4KP4A 1O9HA 1WA8B 2FMLA 5LP6C 1RPRA 4EB6B 4B3MB 3AG1C 4PDRA 2QKCA 2HVJC 3CPWU 1IDSA 1OZ0A 5IYZA 2Z5UA 1SQQH 2ZNIA 1FFXB 1K8AW 4TUYA 3JSLA 3QO5A 2QSAA 2Y69C 2ZIMA 3CCJV 2E5LO 3B4SA 2Y4UA 3ABMB 2QGNA 3RYHA 1KQSU 1WNSA 4CH4A 1IBKO 4MTOA 2ILMA 1WA8A 5LP6A 3JD3A 4DR3O 5CA3A 4JV5B 4FVMA 4O4IB 4X9QA 1Q82W 2P22C 2QA4V 2VS0A 4BW5A 1VIBA 4YIPA 2XOKG 1M9NA 1RP3B 1M57B 5EYPA 2FL4A 3AG2C 4DUZB 3ABKB 4OXSA 5IYZB 2JDIG 4FLTA 2V1DA 5KAIZ 4ZBMA 5J2TB 1XNRO 4LFAB 2HEPA 3AK2A 4XDLA 5C8YA 2GUZA 3BAAA 4GX5A 4DK1A 2CTQA 1N36B 5GW7A 2BOCC 4I9QA 4X65O 5H6QA 1H2NA 2GBOA 2UXBB 1FXKC 4YHHO 4TQDA 3RVZA 2CH7A 2JVDA 2RNBA 4QE7A 5B1OA 1BMFG 2EIMC 4XDJA 1XMOO 2YIBD 3FB7C 4PA9A 5FNVB 2EIKB 2PUSA 5J2TA 4G28B 4U7OA 2VRZA 1I0HA 1ZL8B 3ZN1A 1IBLO 3OR7C 2ZCEA 2WLKA 2DQ3A 2AZ2A 4XDKA 2RQ6A 2XAJA 4X1IB 1HWYA 1D5AA 2RCVA 3UO3A 4RUEA 4O4HA 2QTSA 1FXKA 1N4CA 1YHQV 3ICXA 5B3SB 1QNMA 3ZJZA 1VF6A 3T4ZA 1XMOB 2AHYA 3ZHRA 2YICA 3M8AA 1PM9A 4MVOA 2HJFC 2XASA 1H8HG 1I08A 1QCEA 2DYRC 4YHHB 4N23A 4UVBA 4X65B 4EFEA 3ABUA 2KKWA 3APOA 1YXBA 1N36O 2N05A 1IBMB 1XHXA 5DN6G 4IHJB 4DK0A 3JCUZ 3RFRA 1MZEA 1E1QG 4LFAO 1XNRB 2ZM6O 1NTZH 4NB5A 4DUZO 4ABMA 1G6UA 4HBNA 3RN4A 3MHSC 3AK1A 4WBNA 3H01A 1GM8A 1K5QA 3VQWA 4TV8B 3BABA 5EZYA 4O4LA 4UCSA 3L75H 4QPJA 4K8XA 4NXNO 3JAWA 3UT5A 4B3TB 3SYQA 1HNZB 4NTXA 2BTQB 3CCVV 1YITV 4JV5O 1OCZC 5KA6A 1YSCA 2LW7A 1GAXA 2WLIA 1YJNV 2DOSA 2Q7EA 3MHHC 1BT8A 1COWG 4O2AA 2XNDG 2IJJA 1H2MA 4H13B 4LF4O 3BA9A 3OT7A 4JZGA 4X8AA 2ETNA 2R9AA 4PI2A 1M1KW 5JQGB 2H3OA 2JS3A 3H1KH 2D2CB 1JJ2U 2CAZC 1SA0B 3BFRA 3HR0A 4DV5O 1Y4MA 1WP8A 1V55C 3OE7G 4YJ3A 5IJ9B 2CH7B 4JPRA 4OX9O 2HP8A 3ZMSA 1KMIZ 1RFYA 2ZD9A 4U7NA 1GO3F 1XILA 3I55V 4TV9A 1SC5B 4WFEA 4UV8A 3CEIA 4PDVA 4LFCB 2UXDO 4FK5C 3OGCC 2Y48A 3O9OA 4QNHB 3SYPA 1M56B 4JGSA 1H2LA 3STLC 3RYIB 2D3OW 1OCOB 4P9OA 2EIJB 1ZUQA 5DECA 4GKKB 1VF5B 4RQFA 4F6RB 1THZA 3E22A 1BQ0A 2QE7G 3SJBC 2DE0X 4ZI7B 4WFAV 2LFRA 4IIJA 4MS2A 1TUEB 2VQFO 4RUFA 3ZMVA 2WSSG 5CBGA 2OTJV 3RYFA 4NVPA 3CE2A 4PA7A 2M7WA 1KUQA 2H8PC 5LBQA 1OJHA 4DR4B 4CH3A 3JASB 1P7BA 4ZI7A 4OGQB 2V4DA 2Z0AA 1NS1A 2A9HA 1YI2V 1US6A 5GTIZ 2HHHB 1BGYH 1Q8IA 4GYCB 3L74H 1TVKB 4PDLA 5B1AB 3TXSA 5GTHZ 3OFNG 2CDYA 3JALA 1IX9A 2X7RB 4BR6A 4R8CA 4FJCC 4TUYB 1IXBA 3K04A 5KMGB 4BW9A 3PJSK 1R6TA 3K0GA 4DV6B 5FL7G 2JIZG 2Q8VA 2GTSA 4CS2A 3E89A 5L3GA 3RYCB 2EIKC 1W59A 1JPXA 1UFIA 5B5EZ 3HKBA 1NR7A 2EINB 5BY1A 4LF9O 2K9PA 2F23A 1LUWA 3K08A 2N74A 3H1IH 1XOUA 4K0KO 4X20A 4DR2B 5LL6Y 1Q90D 4LF7O 1F7YA 2Q0OC 4X1YB 2R9IA 3HKEB 3VOUA 1GRJA 4JF3A 1KBHA 3HKDB 1SZTA 2MW2B 4J7KA 1FXHA 3U0ZA 2ZXWC 2JGUA 1DF4A 1H2GA 2ADPA 5C8YB 1FFTB 1SERA 4J10A 3JATA 2R9RB 2L6LA 2Q9LA 3E8FA 3BCCH 1GKFA 4JI0O 2NLJC 3E35A 4LR3A 1NT2B 2LJ2A 1SQPH 1TGOA 1LR1A 4JI1O 3SPJA 3K5MA 3G67A 4I50A 4MTXA 4I0XB 4FZ0A 5GONA 2XHBA 3ZBHA 3JYCA 1EM1A 3T1CA 2ZE5A 3CCLV 2JGDA 3E86A 4JI6B 5F2VO 1ZL8A 1AI4A 2UXCB 5CB4A 2LGWA 4LF5O 3KZIZ 5JCOA 2IH1C 3JAWB 2LP7A 2HKOA 4DUYB 1QR8A 1ZWIC 2ZIOA 4TV8A 3NXSA 4LF6B 1NVPB 4J42A 3JAKB 5HFLA 3P3PA 2IJKA 3SPIA 4DR7B 4LF8O 2YIBA 4JI5B 4FM1A 3RGBA 5KX5A 3T1YO 3M7MX 2AGAA 4EB6A 4PELA 5KAFZ 5LOVA 2WWWA 2UXNA 5B1AC 2CGOA 4ZKIA 2YXLA 1V9PA 4JI5O 2ZINA 4H33A 3RYHB 1GMGA 4DR7O 4LBEC 2QWOB 4DV2B 3FB6C 1PNLA 3AG2B 1FS0G 2YIDA 2WA4A 2Y4TA 3JASA 3BA8A 3WB0A 2BE3A 3JAMN 3F7YC 1YTFB 3CXCU 4ASUG 4DV3O 1VEWA 4P30A 2UXCO 1CEZA 5ITZB 3GB7C 4JI6O 3CCSV 4ZOLA 3LDDA 3I56V 3OUSA 4ZOLB 5EBWC 3DTUB 1XL6A 2L35A 2IW5A 4ZHQA 2FYUH 2W6IG 1H8EG 4JI1B 1Q6IA 1RM1C 2DJVA 4R6ZA 1TA8A 2OIGA 2ATKC 2WLNA 1FKAO 2C2AA 4L87A 5D5QA 1K4CC 4JTCB 1RPOA 2Q4PA 2QKAA 4I5SA 4JYBA 1NTMH 3D8CA 3JD4A 4GX2A 1DGSA 4NXMO 2YC0A 3IC9A 1AJPA 4FM2A 1WJZA 4MTGA 2FB5A 5TISZ 4MVUA 5K1PA 3W7SA 4UB8Z 4MVMA 1H2SB 1VQOV 3QTCA 4LF7B 4Z2WA 1MSWD 4DV7B 3CRRA 5CB4B 3FKSG 3B8MA 3UO2A 2KG7A 2ZE6A 1AI6A 4LF9B 4JI4O 1QR9A 1B6QA 2F66C 4PI0A 2E75B 3G6EV 3K5LA 2Q67A 3B77A 4IGGA 1I7FA 2RN9A 1A32A 4JYYA 4LWSA 3G80A 1L0NH 1J5EB 1VQNV 1SQFA 5IYBO 4FFKA 3A0RA 2EX3A 2QM8A
chains in the Genus database with same CATH topology
3D3IA 4N23A 4UVBA 5EC1C 1NVPD 3E2EA 3ABUA 5KA5A 3OM3B 4X89A 1WPXA 1VQMV 3X2QC 3SPCA 1Q81W 4DXWA 1GK9A 1JCHA 3ML0A 5DM6V 4WF9V 1S3JA 2WPDG 1F4NA 5DN6G 1M57C 1QLEB 2H94A 4TT3G 4UV9A 3RVYA 3CMEV 3CCMV 1E1QG 1FXKB 1OCZB 2WLLA 4MT8A 1KP2A 3ABTA 1S77D 5LGTA 4WFGA 4MSWC 2HFEC 3FYEB 3MHSC 4TSFG 4LC1A 3WFVA 3H01A 1RM1B 4KFMA 2P6JA 3X2QB 1GM8A 1K5QA 5LGNA 3K06A 2JJ2G 3CD6V 4QPJA 1JOYA 3W7UA 3SYQA 2JEXA 1W0JG 3CCVV 1YITV 1OCZC 5KA6A 1YSCA 3UKMA 2EIJC 2JJ1G 2W0FC 1AI7A 4GX0A 1SESA 3WG7B 2WLIA 1YJNV 1ORQC 1K3EA 2EIMB 4J9YB 3E83A 3MHHC 1COWG 3ETGA 2WLIB 2XNDG 1KP3A 3CMAV 4CBCA 2IJJA 3ZRWA 4R50A 2B5UA 5CBHA 4WCEV 4X8AA 3LDCA 1M1KW 4FIPC 1NH2B 4F4LA 1JJ2U 4BIZA 1F51A 3BY6A 3CYOA 1H38A 1Y4MA 5EK0A 1QVGU 1NJIW 1V55C 1KD1W 4QPKA 3OE7G 3SJQC 5LGUA 1XL4A 3ABMC 4JPRA 1DLBA 3QO7A 4RQEA 3ZMSA 2ITCC 2HG5C 2GHYA 3CCQV 4U7NA 2ZD9A 1GO3F 3CCUV 3M99B 2EILB 3I55V 1ENVA 1PL0A 2OT5A 4CZZA 2B1GA 2A79B 4FPPA 2ZDIC 2Q68A 4WFEA 3ZMUA 4UV8A 1PD3A 1I5YA 4PDVA 4GX1A 2ZQMA 3K0DA 3T2MA 1OHHG 3MD0A 3OEEG 4FK5C 3OGCC 2IJIA 2X6BA 2DWDC 2Y48A 3ZMZA 3CC7V 4N21A 4QNHB 1E1RG 2W6JG 1JX9A 1QLEC 3GWOA 4G27B 3SYPA 4MW8A 1M56B 4JGSA 3STLC 3FB5C 4RO2A 5BZBA 2D3OW 1OCOB 1W2BU 1YJ9V 1Q7YW 4P9OA 2EIJB 2BOBC 5KUMA 3RW0A 3TK1A 3WG7C 4RQFA 4X88A 4EKWA 5L3BA 1THZA 1R73A 1EBOA 2WLMA 2XAGA 3CC4V 2ZR2A 3IFXA 2QE7G 1FXVA 4WFAV 2LFRA 2X0LA 4MS2A 2DQ0A 3G4SV 1E79G 1TUEB 3P30A 2GSMB 1GM7A 3JCZA 2DYSB 4RUFA 2DYRC 3VBBA 1MABG 3F7VC 3ZMVA 2EZOA 3ETEA 2WSSG 5CBGA 4G2KA 1VQ8V 1K4DC 4HYOA 2OTJV 4BIUA 3ZCCA 5LHIA 1J95A 1S72V 5LHHA 4PA7A 2MK3A 2M7WA 3ABKC 5B1NA 2EILC 3UM7A 2H8PC 3LSQA 5LBQA 3SYOA 3OR6C 3LDEA 5H6RA 1BL8A 4I9WA 2XAFA 3T4DA 1P7BA 3K3WA 2IU3A 2ZXWB 3ZMTA 1S0VA 1CP9A 2A9HA 2DYSC 1YI2V 4LCUC 4QIWF 3D36A 2EJRA 1S5HC 1G4YB 5E1AC 1IXMA 4PDLA 5B1AB 3CCEV 5J9PC 1M56C 1SETA 5CBFA 1V54B 4MVSA 4E2LA 5IYCO 2LFSA 2PI5A 2FTKA 3OFNG 5IDJA 4HZ3A 4PA3A 4Z1MG 3ASOB 4H37A 2X7RB 4R8CA 4FJCC 3SPGA 4JAVA 2WLLB 3ZIAG 2KB1A 3K04A 2DYRB 2HJFC 5B1BC 4KUMA 4PA4A 3PJSK 1K33A 3AEIA 3EHBB 3EFFK 3K0GA 1AI5A 1VQLV 1F4MA 2JIZG 5FL7G 3E89A 5L3GA 2EIKC 3OEHG 3CCRV 1NH2D 1JPXA 1BHAA 2YSUB 3W7WA 1AR1B 1K5SA 4DO2A 1UJWB 3TCUA 5IY5B 3CP1A 2P90A 2Q69A 3FYIB 2YEVA 1VQ7V 4WFHA 1K92A 3QO8A 1NR7A 2EINB 1OCRC 1Y66A 2ITDC 3SYCA 3OMNB 3K08A 1DF5A 1R3JC 1R6NA 3ASOC 2WLJA 2P67A 3JD0A 5EC2C 1V55B 1BHBA 1K7DA 3LUTB 2IH3C 4P2ZA 1OCCB 5LHGA 3R65A 1EZJA 5H9CA 4GCZA 3STZC 2DW4A 2R9IA 3VOUA 3KG2A 4UXNA 2EZPA 4MVRA 1YTFD 1M90W 5CMUA 3ABLB 3AG1B 4JF3A 3SPHA 3W7TA 1SZTA 5CN0A 4JTDB 1FXHA 2ZXWC 1VQ5V 4MW3A 1DF4A 5IY5C 2P7TC 1H2GA 5KUKA 1G8MA 4FMTA 3W7XA 1NQTA 1FFTB 1SERA 3CC2V 2B1IA 2R9RB 3ASNC 1V54C 4Q20A 2IJHA 3E8FA 2NNUA 3ZRVA 1GKFA 3E35A 2NLJC 1KKDA 1DTOA 3FB8C 2Y69B 2V7QG 1ROPA 3QNEA 3ETDA 2PI4A 1NKDA 3SPJA 3TETA 5B1BB 1K73W 3LNMB 4MTXA 1JVMA 2X6CA 3P32A 4LP8A 1PKXA 3LSSA 2OCCB 3JYCA 5EBMC 4XBFA 3OMIB 3T1CA 2A0LA 2DWEC 3CCLV 5C93A 3E8BA 3IC7A 1LNQA 3E86A 1VQ9V 5EBLC 1AI4A 1K97A 4PDMA 4UVCA 2K1EA 4RAIA 1PNKA 3IGAC 3K9AA 1I5XA 1VQ6V 1L1FA 1N8RW 1F23A 2QTOA 4YXWG 4JAUA 1OCCC 1YJWV 2UXXA 1EFRG 2IH1C 2OCCC 1MOFA 2LP7A 3G71V 2HKOA 4J9ZB 1VQ4V 1QR8A 3BEHA 1ZWIC 2YEVB 3AG4B 3NXSA 1NR1A 4KP4A 1NVPB 5HFLA 2IJKA 1RPRA 3SPIA 3AG1C 4PDRA 4JTAB 2HVJC 3AG3B 2XAQA 3CPWU 3HB3B 1R3KC 4PELA 2CK3G 3E8GA 4MTFA 2XAHA 1OZ0A 2Q6AA 2UXNA 2WWWA 5B1AC 3ZRWB 1K9MW 2Z5UA 3ASNB 4ZKIA 2HR3A 3JD2A 4MVQA 1K8AW 4H33A 3ZN0A 1GMGA 1AJNA 3QO5A 4LBEC 1AJQA 2Y69C 3CCJV 3RBZA 3ABMB 3AG4C 2HVKC 3OUFA 1W0KG 2JEUA 3FB6C 1MG1A 1KQSU 3E8HA 1PNLA 2WAMA 3AG2B 4P9PA 1FS0G 1NBMG 4MTOA 4BAYA 3JD3A 1Q86W 5CA3A 1Q82W 3F7YC 1YTFB 3CXCU 4ASUG 2QA4V 4P30A 4BW5A 4QJFB 2XOKG 1OCRB 1CEZA 1QLNA 3GB7C 5B3SC 4TWKA 3CCSV 1M9NA 1OCOC 1S76D 1M57B 3DGEA 3LDDA 3I56V 4WFFA 1R3IC 2AHZA 3B8NA 5L3DA 3AG2C 2OTLV 4UUJC 1CPYA 3OUSA 3ABKB 4OXSA 2QEXV 5EBWC 2JDIG 1R3LC 3DTUB 2V1DA 1XL6A 2IW5A 1PNMA 2ZR3A 4ZBMA 1P4RA 2W6IG 1H8EG 3OMAB 5L3CA 1KECA 3ABLC 3SYAA 1RM1C 4XDLA 1AROP 2JK5C 4R6ZA 4GX5A 2IU0A 2ATKC 2WLNA 2QM7A 3ZRSA 2C2AA 4GT1A 3AG3C 4L87A 1K4CC 4JTCB 1RPOA 5GW7A 4I5SA 4R7CA 4JYBA 2BOCC 3JD4A 4GX2A 1K34A 5H6QA 2F43G 1FXKC 4QE9A 3RVZA 2WLHA 4QE7A 1AJPA 5B1OA 1BMFG 2Z3YA 5HFMA 5L3FA 2EIMC 4MTGA 4XDJA 1GTOA 3FB7C 4MVUA 4PA9A 3W7SA 1VQPV 2EIKB 4MVMA 1VQOV 4G28B 4JASA 1WLEA 4U7OA 1MSWD 3JD1A 1QVFU 3ZN1A 3OR7C 2WLKA 3F5WC 3FKSG 1R6KA 3B8MA 2EINC 1GM9A 2DQ3A 5L3EA 1YIJV 1QBZA 4XDKA 2HLDG 3ZRXA 2EBOA 1AI6A 3OW2U 2XAJA 3OAAG 4MVZA 1KC8W 1HWYA 1VQKV 2QKSA 1QR9A 3HPLC 2X6AA 4UVAA 3K79A 4RUEA 1B6QA 1FXKA 3K03A 3G6EV 1YHQV 2Q67A 5IYDO 3B77A 4JYCA 5B3SB 4WFBV 3ZJZA 1JQ0A 4PA6A 4HAMA 3T4ZA 2AHYA 1SRYA 1VQNV 4MVOA 5IYBO 2ZDIA 2XASA 3A0RA 1H8HG 1QCEA 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 C;  2HVK C;  1R3J C;  3ASO C;  3K08 A;  2WLJ A;  3FB6 C;  3OGC C;  2X6B A;  2DWD C;  3OUF A;  5EC2 C;  5EC1 C;  3LUT B;  3E8H A;  4QNH B;  3SYP A;  1QLE C;  2IH3 C;  4G27 B;  4P2Z A;  4MW8 A;  4X89 A;  4P9P A;  3X2Q C;  3SPC A;  3STL C;  3FB5 C;  3R65 A;  4MTO A;  4RO2 A;  4DXW A;  5BZB A;  3STZ C;  4P9O A;  3VOU A;  2BOB C;  3KG2 A;  5KUM A;  4MVR A;  3RW0 A;  1M57 C;  3WG7 C;  4X88 A;  4EKW A;  3F7Y C;  3SPH A;  3RVY A;  4JTD B;  2WLL A;  2ZXW C;  4P30 A;  4BW5 A;  4MW3 A;  3IFX A;  5IY5 C;  2P7T C;  5KUK A;  3GB7 C;  5B3S C;  4TWK A;  1OCO C;  4WFG A;  3LDD A;  4MSW C;  4WFF A;  1R3I C;  2HFE C;  2AHZ A;  4MS2 A;  2R9R B;  3ASN C;  1V54 C;  3SYC A;  4KFM A;  3AG2 C;  4UUJ C;  3E8F A;  3OUS A;  4OXS A;  5EBW C;  3K06 A;  1R3L C;  2NLJ C;  1XL6 A;  1KKD A;  3FB8 C;  4RUF A;  4ZBM A;  3F7V C;  3SPJ A;  3TET A;  5CBG A;  3SYQ A;  3ABL C;  3LNM B;  3SYA A;  1K4D C;  4HYO A;  4XDL A;  1JVM A;  1OCZ C;  2X6C A;  3UKM A;  2JK5 C;  2EIJ C;  4R6Z A;  4GX5 A;  4LP8 A;  1J95 A;  2ATK C;  2W0F C;  2WLN A;  4GX0 A;  4PA7 A;  3JYC A;  2WLI A;  5EBM C;  3ZRS A;  3ABK C;  1ORQ C;  2EIL C;  3T1C A;  3AG3 C;  2A0L A;  1K4C C;  2DWE C;  2H8P C;  4JTC B;  3UM7 A;  3E8B A;  4J9Y B;  3E83 A;  1LNQ A;  3E86 A;  3SYO A;  3OR6 C;  3LDE A;  1BL8 A;  4I9W A;  4R7C A;  5EBL C;  2BOC C;  4GX2 A;  2WLI B;  3T4D A;  4PDM A;  1P7B A;  4QE9 A;  4CBC A;  2K1E A;  4RAI A;  4R50 A;  2A9H A;  2DYS C;  3IGA C;  3RVZ A;  5CBH A;  4LCU C;  2WLH A;  4QE7 A;  4X8A A;  3LDC A;  1S5H C;  1G4Y B;  5E1A C;  2EIM C;  4MTG A;  4PDL A;  4XDJ A;  2QTO A;  3FB7 C;  4MVU A;  1M56 C;  1OCC C;  4PA9 A;  4F4L A;  4MVS A;  5CBF A;  5J9P C;  4MVM A;  4G28 B;  4HZ3 A;  2IH1 C;  4PA3 A;  4H37 A;  2OCC C;  4R8C A;  3SPG A;  3OR7 C;  4J9Z B;  2WLK A;  3F5W C;  5EK0 A;  2EIN C;  1ZWI C;  3BEH A;  2WLL B;  1V55 C;  2KB1 A;  3SJQ C;  3K04 A;  4XDK A;  1XL4 A;  3ABM C;  5B1B C;  4PA4 A;  4MVZ A;  3PJS K;  3SPI A;  3AG1 C;  4PDR A;  4JTA B;  2ITC C;  2HG5 C;  3EFF K;  2HVJ C;  3K0G A;  2QKS A;  3HPL C;  2X6A A;  2ZD9 A;  3E89 A;  4RUE A;  1R3K C;  3E8G A;  4MTF A;  3K03 A;  2EIK C;  2Q67 A;  2Q6A A;  5B1A C;  3ZJZ A;  2A79 B;  4PA6 A;  2Q68 A;  4MVQ A;  4WFE A;  3T4Z A;  2Q69 A;  2AHY A;  4H33 A;  3TCU A;  2YEV A;  4WFH A;  4PDV A;  4LBE C;  4MVO A;  1OCR C;  4GX1 A;  2Y69 C;  3K0D A;  2HJF C;  2WLM A;  3T2M A;  2ITD C;  3RBZ A;  2DYR C; 
#chains in the Genus database with same CATH topology
 1NVP D;  4BIO A;  5KA5 A;  2AXT Z;  1VQM V;  1WPX A;  3X2Q C;  2E76 B;  2ZE7 A;  3SPC A;  1Q81 W;  4JI2 O;  1PL4 A;  4WF9 V;  1S3J A;  2WPD G;  4X64 B;  1F4N A;  2DN9 A;  1M57 C;  2HHH O;  1QLE B;  2H94 A;  5LXT B;  3HKE A;  4TT3 G;  4UV9 A;  3RVY A;  3CCM V;  1OCZ B;  4NKG B;  4CS3 A;  1KP2 A;  1Y74 B;  2GUZ B;  3FYE B;  2P6J A;  3X2Q B;  1SF9 A;  3K06 A;  1VAR A;  3CJH B;  2JJ2 G;  4GKJ O;  3H9V A;  3W7U A;  2QWP B;  2JJ1 G;  4GX0 A;  4O2A B;  1SES A;  3HKC B;  2EIM B;  4J9Y B;  2YUA A;  2QWR B;  1KP3 A;  5KHG A;  4CBC A;  4D6T H;  3ZRW A;  4R50 A;  3WU2 Z;  5CBH A;  1IVS A;  4WCE V;  1VF7 A;  3ZHV A;  1MZF A;  4GKK O;  1NH2 B;  5EZY B;  5EIB D;  3J80 N;  1EN6 A;  1IUR A;  4I0X A;  5EK0 A;  1QVG U;  1KD1 W;  2QR4 A;  4QPK A;  3SJQ C;  1XL4 A;  1SZX A;  1WPB A;  3CRM A;  2ITC C;  2HG5 C;  2GHY A;  3RT3 C;  2OYQ A;  3ZHU A;  3M99 B;  5AG2 A;  4DRX A;  1PL0 A;  2ODM A;  4CZZ A;  1XHZ A;  3L73 H;  1I5Y A;  4TV9 B;  5IWA B;  4OX9 B;  3HKD A;  3MD0 A;  2X6B A;  4JI7 O;  1IZ3 A;  1WB7 A;  4DV5 B;  2W6J G;  4UCR A;  1Q7Y W;  5KUM A;  3J7A U;  3KCY A;  4W4L A;  3TK1 A;  1YVW A;  3WG7 C;  1MA1 A;  2BSK A;  4JZ2 A;  1R73 A;  1EBO A;  4LF4 B;  2XAG A;  4CC6 A;  3IFX A;  4FLX A;  4IL6 Z;  2X0L A;  2F4V B;  2Q0A A;  4U3J B;  1VMG A;  1HNZ O;  2A3Q A;  4B3T O;  1MAB G;  3ETE A;  4NXN B;  3FD9 A;  2OCH A;  2CTR A;  4J7J A;  1EZV H;  1X4T A;  1VQ8 V;  2RMK B;  3BHP A;  5LHI A;  4O4J A;  1J95 A;  1S72 V;  4LNU A;  2CUG A;  2EIL C;  4I55 B;  4DV1 B;  3OR6 C;  2O57 A;  1BL8 A;  4OPH A;  2ZM6 B;  1JFF A;  3RYC A;  3ZMT A;  5JJJ B;  2DYS C;  5BMV A;  2UU9 B;  4LCU C;  4QIW F;  2ARH A;  5E1A C;  3FAV A;  3CCE V;  2A06 H;  1IBM O;  1AIL A;  1SET A;  5IYC O;  5IDJ A;  4J80 A;  3ASO B;  4E4E A;  3SPG A;  2WLL B;  3ZIA G;  4TOI A;  3CWB H;  3N2G B;  3AEI A;  3EHB B;  3Q4H B;  1AI5 A;  1F4M A;  3SGI A;  4B3S B;  3CCR V;  2RJZ A;  1NU1 H;  1BHA A;  3W7W A;  1AR1 B;  2BCC H;  5FPR A;  5IY5 B;  1UJW B;  3AG7 A;  2YEV A;  1VQ7 V;  4WFH A;  3QO8 A;  1OCR C;  3E22 B;  2ITD C;  3JD0 A;  4I7Z B;  1R6N A;  3JAL B;  5JH7 A;  1V55 B;  1IBL B;  4P2Z A;  5IJ0 A;  1TVK A;  1EZJ A;  5H9C A;  4GCZ A;  3STZ C;  2DW4 A;  3KG2 A;  4UXN A;  4X62 O;  4UCV A;  3L72 H;  1M90 W;  5CMU A;  3ABL B;  3AG1 B;  5FPO A;  4AQY O;  4JTD B;  3SJA C;  3NR7 A;  1TUB A;  2UXB O;  1VQ5 V;  2JGD B;  1QQC A;  1U96 A;  5B66 Z;  4FLZ A;  2M6Y A;  3W7X A;  1KB9 F;  1V54 C;  2YDE A;  2LO1 A;  1ZTE A;  1DTO A;  3RWR D;  3FB8 C;  2Y69 B;  4DV4 O;  2ZKO A;  2PI4 A;  1NKD A;  3FFQ A;  5B1B B;  3LNM B;  2X6C A;  3P32 A;  3B40 A;  4LP8 A;  1PKX A;  5IT9 N;  1NTK H;  2A0L A;  2DWE C;  3IC7 A;  4X1K A;  1LNQ A;  1VF6 C;  1K97 A;  3CRA A;  4UVC A;  3THO A;  1FAF A;  1KKC A;  4DR3 B;  2B9Z A;  3DSQ A;  1N8R W;  2QTO A;  3P3N A;  4YXW G;  1BS3 A;  4JAU A;  4FM0 A;  2UXX A;  3L9D A;  4J41 A;  3K5N A;  2OCC C;  1IBK B;  3G71 V;  1SA0 A;  1XI1 A;  2E5L B;  1R1B A;  3AG3 B;  2UUC O;  2HJD A;  3B2E E;  2CK3 G;  3DXR A;  3E8G A;  1HR0 O;  5GON B;  4U3F H;  1M93 A;  3ZRW B;  1K9M W;  3ASN B;  2HR3 A;  1OV9 A;  4NYK A;  3K59 A;  3JD2 A;  4MVQ A;  1SS3 A;  1P49 A;  5JVD A;  4B3M O;  3UCS C;  1AJN A;  3H1L H;  1EN5 A;  1W0K G;  2JEU A;  4FFB A;  4KL1 A;  4P9P A;  1HNX B;  5BR8 O;  1NBM G;  4BWA A;  4UCT A;  3UQ8 A;  3A2F A;  2QWN B;  1HP8 A;  3KCX A;  4B3R O;  4YY3 O;  4DW1 A;  1M5I A;  4YJ3 B;  2QWQ B;  4QJF B;  1BE3 H;  1QLN A;  2IBZ H;  5B3S C;  1OCO C;  4KHP B;  2YXH A;  4UFZ A;  4WFF A;  3QG5 A;  2AHZ A;  5L3D A;  4JI3 O;  4UUJ C;  4L8J A;  2QEX V;  1R3L C;  4PJ0 Z;  2A7W A;  2ZR3 A;  1KYO F;  4FLW A;  5L3C A;  4JI8 B;  3SYA A;  2UUA B;  1ARO P;  2JK5 C;  3SDL A;  2IU0 A;  2GTA A;  3ZRS A;  4A5U B;  1N34 O;  4GT1 A;  5LMU B;  1XMQ B;  1YF2 A;  3CXH F;  4UB6 Z;  4DR1 B;  4CH6 A;  2F43 G;  3G6B A;  5A9G A;  4X66 B;  2WLH A;  1WB8 A;  2Z3Y A;  5L3F A;  3OGI B;  1GTO A;  3C3S A;  3CSX A;  4DV0 B;  2KSD A;  1Q5O A;  4JAS A;  3JD1 A;  4X1K B;  4J11 A;  1ZSP A;  2PGG A;  1R6K A;  3ZHT A;  1GM9 A;  5L3E A;  1YIJ V;  1N33 B;  1KC8 W;  3OW2 U;  1N33 O;  1AP5 A;  1Q3E A;  1VQK V;  5E79 Z;  2QKS A;  2X6A A;  3K79 A;  3K03 A;  1HW7 A;  4JYC A;  2LW1 A;  1SRY A;  3S3W A;  4O4I A;  3T1H B;  5CA0 A;  2ZDI A;  1B06 A;  5EC1 C;  4DR1 O;  4DR5 O;  3E2E A;  3L71 H;  4X89 A;  4H44 B;  3O65 A;  3ZHQ A;  1EN4 A;  3VQY A;  1XMQ O;  5LMU O;  2OIE A;  5KHI A;  5KMG A;  1GK9 A;  3N2G A;  1VP7 A;  3CME V;  4PD4 F;  2QDO A;  3ABT A;  1I94 O;  1S77 D;  4WFG A;  2EJ7 A;  4JI3 B;  2HFE C;  4TSF G;  4LC1 A;  1RM1 B;  5LGN A;  3CD6 V;  4IYI A;  1B3Q A;  2QM4 A;  1W0J G;  1GN4 A;  2EIJ C;  2W0F C;  1AI7 A;  3EVK A;  5LMN B;  4K35 A;  1ORQ C;  5J2U B;  1K3E A;  5JCO C;  1TAE A;  4I4T A;  1HNX O;  2LGQ A;  3BRC A;  3OTF A;  3ETG A;  3ETQ A;  2WLI B;  5LYJ B;  3CMA V;  1L8D A;  3CX5 F;  4YJ2 A;  1RSO A;  4FIP C;  3K9S A;  4F4L A;  2XT9 A;  4I55 A;  4W4K A;  4BIZ A;  1F51 A;  4IT5 A;  1HR0 B;  4GZR B;  2UUC B;  1H38 A;  1GH6 A;  1YEW A;  5LGU A;  1DLB A;  5CA1 A;  3TXQ A;  1XEQ A;  4RQE A;  2ADQ B;  1D2D A;  3CCQ V;  4J7Z A;  3K58 A;  2FKX A;  2BTQ A;  3JAR A;  5JJE B;  2OT5 A;  2ZT9 B;  4FPP A;  2ZDI C;  2Q68 A;  3ZMU A;  2YXY A;  2Q7G A;  2P5O A;  2P06 A;  4GX1 A;  3K0D A;  1GN2 A;  3T2M A;  3OEE G;  3F5T A;  3CC7 V;  2IJI A;  2DWD C;  1HNW O;  3GWO A;  1JX9 A;  4G27 B;  1W2B U;  1YJ9 V;  1D5N A;  2OWO A;  1ZLZ A;  4EKW A;  2Q5Z A;  2VQE O;  3CC4 V;  3UT5 B;  4DV4 B;  4DYL A;  3VQX A;  2XUM A;  1FXV A;  3SR2 C;  2GV9 A;  2DQ0 A;  2GSM B;  1GM7 A;  2DYS B;  3VBB A;  2EUL A;  2P4K A;  3F7V C;  2EZO A;  3GVM A;  4AIL C;  4PV1 B;  1SQX H;  4AQY B;  1K4D C;  4O4H B;  4B7K A;  4BIU A;  2XTA A;  3ZCC A;  4X62 B;  1Y67 A;  5LHH A;  3IAY A;  3ABK C;  4LH6 A;  2PTM A;  3UM7 A;  3SYO A;  2G38 A;  1X59 A;  1B04 A;  5H6R A;  3K57 A;  4I9W A;  2XAF A;  5A2Q N;  1Y76 A;  4RWU A;  3K3W A;  2IU3 A;  2ZXW B;  1S0V A;  1CP9 A;  1FJG B;  4QGP A;  2EJR A;  1S5H C;  1IXM A;  2UUB B;  4X1Y A;  1M56 C;  5CBF A;  1V54 B;  4MVS A;  1GN3 A;  2LFS A;  2PI5 A;  4B3S O;  1O9G A;  3CRQ A;  4Z1M G;  2F95 B;  3RYF B;  2DYR B;  2JRI A;  4KUM A;  4PA4 A;  1FPO A;  1K33 A;  5JQG A;  3EFF K;  1FD9 A;  3OEH G;  1NH2 D;  1XNQ O;  2Y0P A;  2YSU B;  5LP6 B;  1K5S A;  4DO2 A;  3PN1 A;  3CP1 A;  1K92 A;  2QJ1 A;  2UU9 O;  1Y66 A;  4K8Z A;  3OMN B;  1DF5 A;  1BHB A;  2WLJ A;  2P67 A;  1M4U A;  2IH3 C;  5J2U A;  3B09 A;  2N04 A;  3DXR B;  4DV1 O;  5LHG A;  1FFX A;  1YTF D;  3A0B Z;  3SPH A;  1SQG A;  3N2K B;  1RSO B;  2Q73 A;  1XDC A;  2ZNJ A;  3FX7 A;  4FMT A;  1NQT A;  2CGN A;  3Q4H A;  2F4V O;  5CA0 B;  4JYA O;  3ASN C;  4IYH A;  4Q20 A;  3ZRV A;  5JH7 B;  3JAT B;  2BSK B;  1KKD A;  2V7Q G;  3HKB B;  3ETD A;  3QF7 A;  1K73 W;  4LFB B;  1JVM A;  3ZX6 A;  2R72 A;  3APQ A;  1AR5 A;  4IIJ B;  1KU9 A;  3WB2 A;  3LSS A;  2OCC B;  5EBM C;  3OMI B;  4CS4 A;  5C93 A;  1L0L H;  3R66 A;  1ZX3 A;  5EBL C;  1Y74 A;  3BPZ A;  2YI8 A;  4JI7 B;  4RAI A;  3EXA A;  1PNK A;  4LH7 A;  5IWA O;  1VQ6 V;  4O4J B;  1F23 A;  1N32 O;  1OCC C;  4UCO A;  1EFR G;  3ZS8 C;  1MOF A;  4O2B A;  3KKY A;  5EIB C;  3BEH A;  3AG4 B;  3ZHS A;  4EEQ A;  5BMV B;  5KX5 B;  4DR6 B;  3JAR B;  3MAQ A;  4JTA B;  2XAQ A;  2P4V A;  3CS5 A;  3JAK A;  3H1H H;  5EYP B;  3HB3 B;  1R3K C;  1HDJ A;  1WP7 A;  4MTF A;  3OTO O;  1BZK A;  2Q6A A;  2XAH A;  3OTO B;  4FLU A;  3ZED A;  1BCC H;  3ZN0 A;  1AJQ A;  4DR6 O;  2NN4 A;  3MDS A;  3RBZ A;  3AG4 C;  1Z2G A;  2HVK C;  3OUF A;  1Z5V A;  1MG1 A;  3E8H A;  2WAM A;  5JWP A;  4YJ2 B;  4BAY A;  1Y76 B;  1N32 B;  4LWS B;  1Q86 W;  1AVM A;  4GUN A;  4Z1V A;  3DC6 A;  1XQ8 A;  4CH5 A;  4DRX B;  4GKJ B;  1OCR B;  3U11 A;  1S76 D;  2BTO A;  1XRE A;  4TWK A;  3DGE A;  1R3I C;  3B8N A;  2VWJ A;  2OTL V;  1CPY A;  2NR5 A;  4LFB O;  1MNG A;  1G1X B;  4YIO A;  3N2K A;  1PNM A;  1P4R A;  3OMA B;  1UPG A;  1KEC A;  3ABL C;  1CXZ B;  4X64 O;  1QU7 A;  1Q6H A;  2QM7 A;  5KLV H;  4WBN B;  4JYA B;  3AG3 C;  4JI2 B;  4R7C A;  4PHZ A;  1K34 A;  3S3X A;  4QE9 A;  3FAV B;  2AZ0 A;  5HFM A;  1J5E O;  1XBL A;  1YCI A;  1VQP V;  1PP9 H;  1WLE A;  4FLY A;  1QVF U;  3SJC C;  2KG7 B;  4KXR A;  3F5W C;  3K5O A;  2EIN C;  4JI4 B;  1QBZ A;  2F93 B;  2HLD G;  3ZRX A;  2EBO A;  3OAA G;  4MVZ A;  1N0J A;  4FFB B;  2AW9 A;  3HPL C;  4UVA A;  1XNQ B;  4DV7 O;  5IYD O;  4WFB V;  1S5L Z;  3JSN A;  1JQ0 A;  4PA6 A;  4HAM A;  2DMX A;  2PYJ A;  4B7E A;  4GLX A;  1SKV A;  2WLM A;  3D3I A;  1URF A;  5LA6 A;  4NXM B;  3OD4 A;  4FLV A;  1LUV A;  1P7G A;  3OM3 B;  4DXW A;  2GDS A;  1JCH A;  3ML0 A;  5DM6 V;  5FNV A;  2UUB O;  4ICG A;  5JVD B;  1FJG O;  3HKC A;  5D5P A;  1MMM A;  1FXK B;  2WLL A;  4H0L B;  2JS5 A;  4MT8 A;  2CE4 A;  5LGT A;  4X1I A;  4MSW C;  3RYI A;  3WFV A;  4B08 A;  4KFM A;  1MSD A;  4OPA A;  1JOY A;  3TJT A;  4DV3 B;  1JA8 A;  4Q6G A;  2JEX A;  5KHK A;  4JAA A;  3UKM A;  3A0H Z;  4IHJ A;  5LXT A;  3WG7 B;  3E83 A;  4K3A A;  1JMK C;  2E74 B;  4DV2 O;  2VQE B;  2B5U A;  3LDC A;  1FYJ A;  3D36 C;  5KHJ A;  3BY6 A;  3CYO A;  3T1Y B;  2YI9 A;  1HNW B;  1NJI W;  4LF8 B;  2F1M A;  3TGU H;  2LQT A;  3ABM C;  3AK3 A;  3QO7 A;  4LF6 O;  1QHT A;  2RDC A;  2WA3 A;  1H2K A;  4DUY O;  3CCU V;  2EIL B;  1JJO A;  1ENV A;  4HNA B;  2B1G A;  2A79 B;  2Q7H A;  1PD3 A;  4HNA A;  2ZQM A;  4CC5 A;  1OHH G;  1PV0 A;  4NTY A;  1NI8 A;  1SQB H;  4LF5 B;  3ZMZ A;  3C90 A;  4N21 A;  4D7T A;  1E1R G;  4LNU B;  1QLE C;  4MW8 A;  3LNN A;  5FLX N;  3FB5 C;  4RO2 A;  1Y6X A;  5BZB A;  3BVO A;  3GWK C;  2BOB C;  5K1X A;  2VWK A;  3RW0 A;  1AB3 A;  1YZB A;  4X88 A;  5L3B A;  1PPJ H;  2ZR2 A;  2PZS A;  1T5E A;  3WB1 A;  4JI0 B;  1JFF B;  1N0N A;  2ZE8 A;  3D3Q A;  3G4S V;  5LMN O;  1E79 G;  4ZHQ B;  2PY5 A;  3P30 A;  4ZIB A;  3JCZ A;  4G2K A;  3L70 H;  4HYO A;  2PYL A;  5JJN B;  1Q43 A;  2MK3 A;  1JR9 A;  5B1N A;  1S5J A;  3LSQ A;  2CTP A;  1U97 A;  3LSU A;  3LDE A;  1I94 B;  5H5N A;  3T4D A;  1DK1 A;  4DR2 O;  2R70 A;  5LA6 B;  4K0K B;  2Y0I A;  3QVN A;  1BSM A;  2E3C A;  3D36 A;  5IJ0 B;  2W0X A;  1G4Y B;  3CB2 A;  4C7U A;  5IE9 A;  5J9P C;  4E2L A;  2FTK A;  3I5D A;  4HZ3 A;  4PA3 A;  4H37 A;  5LYJ A;  4DR5 B;  4DV6 O;  4JAV A;  4U3J A;  2KB1 A;  5BXZ A;  5B1B C;  3T1H O;  3IJ4 A;  1VQL V;  1BQZ A;  3CJH A;  2YIA A;  3TCU A;  4EFB A;  2P90 A;  2Q69 A;  3FYI B;  1NZ6 A;  4F6E A;  4I50 B;  3SYC A;  3CHX A;  1R3J C;  3ASO C;  5EC2 C;  3A8T A;  1WAZ A;  1K7D A;  3LUT B;  4NR1 A;  1OCC B;  5LOV B;  4DR4 O;  4I4T B;  3R65 A;  1AR4 A;  3U10 A;  4DV0 O;  4AHC A;  2EZP A;  4MVR A;  3N27 A;  2CTW A;  4TQF A;  1SQV H;  3W7T A;  5CN0 A;  4X66 O;  3H1J H;  4D7S A;  4MW3 A;  2IM9 A;  1GN6 A;  5IY5 C;  2P7T C;  3C3T A;  5KUK A;  1G8M A;  2YS8 A;  1Q6U A;  2VQF B;  3CC2 V;  1N34 B;  2B1I A;  4O2B B;  2IJH A;  2NNU A;  3CRC A;  4AI8 A;  4X20 B;  2UUA O;  4F6R A;  1ZAU A;  5DED A;  5CA1 B;  4JI8 O;  1ROP A;  3QNE A;  3TET A;  4O4L B;  5ITZ A;  4NTW A;  4XBF A;  2PF4 E;  1TUB B;  4KHP O;  3E8B A;  1VQ9 V;  1AP6 A;  4PDM A;  2K1E A;  3VQV A;  4DW0 A;  1WN7 A;  2UXD B;  3IGA C;  3K9A A;  1I5X A;  4YY3 B;  3J81 N;  4B3R B;  4LFC O;  1XUQ A;  1YDX A;  1L1F A;  2KQX A;  1Z5W A;  5KHH A;  1YJW V;  5BR8 B;  4FZ1 A;  3DC5 A;  1P84 F;  5IJ9 A;  1VQ4 V;  4J9Z B;  5H2F Z;  2YEV B;  4UCU A;  1NR1 A;  4KP4 A;  1O9H A;  1WA8 B;  2FML A;  5LP6 C;  1RPR A;  4EB6 B;  4B3M B;  3AG1 C;  4PDR A;  2QKC A;  2HVJ C;  3CPW U;  1IDS A;  1OZ0 A;  5IYZ A;  2Z5U A;  1SQQ H;  2ZNI A;  1FFX B;  1K8A W;  4TUY A;  3JSL A;  3QO5 A;  2QSA A;  2Y69 C;  2ZIM A;  3CCJ V;  2E5L O;  3B4S A;  2Y4U A;  3ABM B;  2QGN A;  3RYH A;  1KQS U;  1WNS A;  4CH4 A;  1IBK O;  4MTO A;  2ILM A;  1WA8 A;  5LP6 A;  3JD3 A;  4DR3 O;  5CA3 A;  4JV5 B;  4FVM A;  4O4I B;  4X9Q A;  1Q82 W;  2P22 C;  2QA4 V;  2VS0 A;  4BW5 A;  1VIB A;  4YIP A;  2XOK G;  1M9N A;  1RP3 B;  1M57 B;  5EYP A;  2FL4 A;  3AG2 C;  4DUZ B;  3ABK B;  4OXS A;  5IYZ B;  2JDI G;  4FLT A;  2V1D A;  5KAI Z;  4ZBM A;  5J2T B;  1XNR O;  4LFA B;  2HEP A;  3AK2 A;  4XDL A;  5C8Y A;  2GUZ A;  3BAA A;  4GX5 A;  4DK1 A;  2CTQ A;  1N36 B;  5GW7 A;  2BOC C;  4I9Q A;  4X65 O;  5H6Q A;  1H2N A;  2GBO A;  2UXB B;  1FXK C;  4YHH O;  4TQD A;  3RVZ A;  2CH7 A;  2JVD A;  2RNB A;  4QE7 A;  5B1O A;  1BMF G;  2EIM C;  4XDJ A;  1XMO O;  2YIB D;  3FB7 C;  4PA9 A;  5FNV B;  2EIK B;  2PUS A;  5J2T A;  4G28 B;  4U7O A;  2VRZ A;  1I0H A;  1ZL8 B;  3ZN1 A;  1IBL O;  3OR7 C;  2ZCE A;  2WLK A;  2DQ3 A;  2AZ2 A;  4XDK A;  2RQ6 A;  2XAJ A;  4X1I B;  1HWY A;  1D5A A;  2RCV A;  3UO3 A;  4RUE A;  4O4H A;  2QTS A;  1FXK A;  1N4C A;  1YHQ V;  3ICX A;  5B3S B;  1QNM A;  3ZJZ A;  1VF6 A;  3T4Z A;  1XMO B;  2AHY A;  3ZHR A;  2YIC A;  3M8A A;  1PM9 A;  4MVO A;  2HJF C;  2XAS A;  1H8H G;  1I08 A;  1QCE A;  2DYR C;  4YHH B;  4N23 A;  4UVB A;  4X65 B;  4EFE A;  3ABU A;  2KKW A;  3APO A;  1YXB A;  1N36 O;  2N05 A;  1IBM B;  1XHX A;  5DN6 G;  4IHJ B;  4DK0 A;  3JCU Z;  3RFR A;  1MZE A;  1E1Q G;  4LFA O;  1XNR B;  2ZM6 O;  1NTZ H;  4NB5 A;  4DUZ O;  4ABM A;  1G6U A;  4HBN A;  3RN4 A;  3MHS C;  3AK1 A;  4WBN A;  3H01 A;  1GM8 A;  1K5Q A;  3VQW A;  4TV8 B;  3BAB A;  5EZY A;  4O4L A;  4UCS A;  3L75 H;  4QPJ A;  4K8X A;  4NXN O;  3JAW A;  3UT5 A;  4B3T B;  3SYQ A;  1HNZ B;  4NTX A;  2BTQ B;  3CCV V;  1YIT V;  4JV5 O;  1OCZ C;  5KA6 A;  1YSC A;  2LW7 A;  1GAX A;  2WLI A;  1YJN V;  2DOS A;  2Q7E A;  3MHH C;  1BT8 A;  1COW G;  4O2A A;  2XND G;  2IJJ A;  1H2M A;  4H13 B;  4LF4 O;  3BA9 A;  3OT7 A;  4JZG A;  4X8A A;  2ETN A;  2R9A A;  4PI2 A;  1M1K W;  5JQG B;  2H3O A;  2JS3 A;  3H1K H;  2D2C B;  1JJ2 U;  2CAZ C;  1SA0 B;  3BFR A;  3HR0 A;  4DV5 O;  1Y4M A;  1WP8 A;  1V55 C;  3OE7 G;  4YJ3 A;  5IJ9 B;  2CH7 B;  4JPR A;  4OX9 O;  2HP8 A;  3ZMS A;  1KMI Z;  1RFY A;  2ZD9 A;  4U7N A;  1GO3 F;  1XIL A;  3I55 V;  4TV9 A;  1SC5 B;  4WFE A;  4UV8 A;  3CEI A;  4PDV A;  4LFC B;  2UXD O;  4FK5 C;  3OGC C;  2Y48 A;  3O9O A;  4QNH B;  3SYP A;  1M56 B;  4JGS A;  1H2L A;  3STL C;  3RYI B;  2D3O W;  1OCO B;  4P9O A;  2EIJ B;  1ZUQ A;  5DEC A;  4GKK B;  1VF5 B;  4RQF A;  4F6R B;  1THZ A;  3E22 A;  1BQ0 A;  2QE7 G;  3SJB C;  2DE0 X;  4ZI7 B;  4WFA V;  2LFR A;  4IIJ A;  4MS2 A;  1TUE B;  2VQF O;  4RUF A;  3ZMV A;  2WSS G;  5CBG A;  2OTJ V;  3RYF A;  4NVP A;  3CE2 A;  4PA7 A;  2M7W A;  1KUQ A;  2H8P C;  5LBQ A;  1OJH A;  4DR4 B;  4CH3 A;  3JAS B;  1P7B A;  4ZI7 A;  4OGQ B;  2V4D A;  2Z0A A;  1NS1 A;  2A9H A;  1YI2 V;  1US6 A;  5GTI Z;  2HHH B;  1BGY H;  1Q8I A;  4GYC B;  3L74 H;  1TVK B;  4PDL A;  5B1A B;  3TXS A;  5GTH Z;  3OFN G;  2CDY A;  3JAL A;  1IX9 A;  2X7R B;  4BR6 A;  4R8C A;  4FJC C;  4TUY B;  1IXB A;  3K04 A;  5KMG B;  4BW9 A;  3PJS K;  1R6T A;  3K0G A;  4DV6 B;  5FL7 G;  2JIZ G;  2Q8V A;  2GTS A;  4CS2 A;  3E89 A;  5L3G A;  3RYC B;  2EIK C;  1W59 A;  1JPX A;  1UFI A;  5B5E Z;  3HKB A;  1NR7 A;  2EIN B;  5BY1 A;  4LF9 O;  2K9P A;  2F23 A;  1LUW A;  3K08 A;  2N74 A;  3H1I H;  1XOU A;  4K0K O;  4X20 A;  4DR2 B;  5LL6 Y;  1Q90 D;  4LF7 O;  1F7Y A;  2Q0O C;  4X1Y B;  2R9I A;  3HKE B;  3VOU A;  1GRJ A;  4JF3 A;  1KBH A;  3HKD B;  1SZT A;  2MW2 B;  4J7K A;  1FXH A;  3U0Z A;  2ZXW C;  2JGU A;  1DF4 A;  1H2G A;  2ADP A;  5C8Y B;  1FFT B;  1SER A;  4J10 A;  3JAT A;  2R9R B;  2L6L A;  2Q9L A;  3E8F A;  3BCC H;  1GKF A;  4JI0 O;  2NLJ C;  3E35 A;  4LR3 A;  1NT2 B;  2LJ2 A;  1SQP H;  1TGO A;  1LR1 A;  4JI1 O;  3SPJ A;  3K5M A;  3G67 A;  4I50 A;  4MTX A;  4I0X B;  4FZ0 A;  5GON A;  2XHB A;  3ZBH A;  3JYC A;  1EM1 A;  3T1C A;  2ZE5 A;  3CCL V;  2JGD A;  3E86 A;  4JI6 B;  5F2V O;  1ZL8 A;  1AI4 A;  2UXC B;  5CB4 A;  2LGW A;  4LF5 O;  3KZI Z;  5JCO A;  2IH1 C;  3JAW B;  2LP7 A;  2HKO A;  4DUY B;  1QR8 A;  1ZWI C;  2ZIO A;  4TV8 A;  3NXS A;  4LF6 B;  1NVP B;  4J42 A;  3JAK B;  5HFL A;  3P3P A;  2IJK A;  3SPI A;  4DR7 B;  4LF8 O;  2YIB A;  4JI5 B;  4FM1 A;  3RGB A;  5KX5 A;  3T1Y O;  3M7M X;  2AGA A;  4EB6 A;  4PEL A;  5KAF Z;  5LOV A;  2WWW A;  2UXN A;  5B1A C;  2CGO A;  4ZKI A;  2YXL A;  1V9P A;  4JI5 O;  2ZIN A;  4H33 A;  3RYH B;  1GMG A;  4DR7 O;  4LBE C;  2QWO B;  4DV2 B;  3FB6 C;  1PNL A;  3AG2 B;  1FS0 G;  2YID A;  2WA4 A;  2Y4T A;  3JAS A;  3BA8 A;  3WB0 A;  2BE3 A;  3JAM N;  3F7Y C;  1YTF B;  3CXC U;  4ASU G;  4DV3 O;  1VEW A;  4P30 A;  2UXC O;  1CEZ A;  5ITZ B;  3GB7 C;  4JI6 O;  3CCS V;  4ZOL A;  3LDD A;  3I56 V;  3OUS A;  4ZOL B;  5EBW C;  3DTU B;  1XL6 A;  2L35 A;  2IW5 A;  4ZHQ A;  2FYU H;  2W6I G;  1H8E G;  4JI1 B;  1Q6I A;  1RM1 C;  2DJV A;  4R6Z A;  1TA8 A;  2OIG A;  2ATK C;  2WLN A;  1FKA O;  2C2A A;  4L87 A;  5D5Q A;  1K4C C;  4JTC B;  1RPO A;  2Q4P A;  2QKA A;  4I5S A;  4JYB A;  1NTM H;  3D8C A;  3JD4 A;  4GX2 A;  1DGS A;  4NXM O;  2YC0 A;  3IC9 A;  1AJP A;  4FM2 A;  1WJZ A;  4MTG A;  2FB5 A;  5TIS Z;  4MVU A;  5K1P A;  3W7S A;  4UB8 Z;  4MVM A;  1H2S B;  1VQO V;  3QTC A;  4LF7 B;  4Z2W A;  1MSW D;  4DV7 B;  3CRR A;  5CB4 B;  3FKS G;  3B8M A;  3UO2 A;  2KG7 A;  2ZE6 A;  1AI6 A;  4LF9 B;  4JI4 O;  1QR9 A;  1B6Q A;  2F66 C;  4PI0 A;  2E75 B;  3G6E V;  3K5L A;  2Q67 A;  3B77 A;  4IGG A;  1I7F A;  2RN9 A;  1A32 A;  4JYY A;  4LWS A;  3G80 A;  1L0N H;  1J5E B;  1VQN V;  1SQF A;  5IYB O;  4FFK A;  3A0R A;  2EX3 A;  2QM8 A; 
#chains in the Genus database with same CATH homology
 3D3I A;  4N23 A;  4UVB A;  5EC1 C;  1NVP D;  3E2E A;  3ABU A;  5KA5 A;  3OM3 B;  4X89 A;  1WPX A;  1VQM V;  3X2Q C;  3SPC A;  1Q81 W;  4DXW A;  1GK9 A;  1JCH A;  3ML0 A;  5DM6 V;  4WF9 V;  1S3J A;  2WPD G;  1F4N A;  5DN6 G;  1M57 C;  1QLE B;  2H94 A;  4TT3 G;  4UV9 A;  3RVY A;  3CME V;  3CCM V;  1E1Q G;  1FXK B;  1OCZ B;  2WLL A;  4MT8 A;  1KP2 A;  3ABT A;  1S77 D;  5LGT A;  4WFG A;  4MSW C;  2HFE C;  3FYE B;  3MHS C;  4TSF G;  4LC1 A;  3WFV A;  3H01 A;  1RM1 B;  4KFM A;  2P6J A;  3X2Q B;  1GM8 A;  1K5Q A;  5LGN A;  3K06 A;  2JJ2 G;  3CD6 V;  4QPJ A;  1JOY A;  3W7U A;  3SYQ A;  2JEX A;  1W0J G;  3CCV V;  1YIT V;  1OCZ C;  5KA6 A;  1YSC A;  3UKM A;  2EIJ C;  2JJ1 G;  2W0F C;  1AI7 A;  4GX0 A;  1SES A;  3WG7 B;  2WLI A;  1YJN V;  1ORQ C;  1K3E A;  2EIM B;  4J9Y B;  3E83 A;  3MHH C;  1COW G;  3ETG A;  2WLI B;  2XND G;  1KP3 A;  3CMA V;  4CBC A;  2IJJ A;  3ZRW A;  4R50 A;  2B5U A;  5CBH A;  4WCE V;  4X8A A;  3LDC A;  1M1K W;  4FIP C;  1NH2 B;  4F4L A;  1JJ2 U;  4BIZ A;  1F51 A;  3BY6 A;  3CYO A;  1H38 A;  1Y4M A;  5EK0 A;  1QVG U;  1NJI W;  1V55 C;  1KD1 W;  4QPK A;  3OE7 G;  3SJQ C;  5LGU A;  1XL4 A;  3ABM C;  4JPR A;  1DLB A;  3QO7 A;  4RQE A;  3ZMS A;  2ITC C;  2HG5 C;  2GHY A;  3CCQ V;  4U7N A;  2ZD9 A;  1GO3 F;  3CCU V;  3M99 B;  2EIL B;  3I55 V;  1ENV A;  1PL0 A;  2OT5 A;  4CZZ A;  2B1G A;  2A79 B;  4FPP A;  2ZDI C;  2Q68 A;  4WFE A;  3ZMU A;  4UV8 A;  1PD3 A;  1I5Y A;  4PDV A;  4GX1 A;  2ZQM A;  3K0D A;  3T2M A;  1OHH G;  3MD0 A;  3OEE G;  4FK5 C;  3OGC C;  2IJI A;  2X6B A;  2DWD C;  2Y48 A;  3ZMZ A;  3CC7 V;  4N21 A;  4QNH B;  1E1R G;  2W6J G;  1JX9 A;  1QLE C;  3GWO A;  4G27 B;  3SYP A;  4MW8 A;  1M56 B;  4JGS A;  3STL C;  3FB5 C;  4RO2 A;  5BZB A;  2D3O W;  1OCO B;  1W2B U;  1YJ9 V;  1Q7Y W;  4P9O A;  2EIJ B;  2BOB C;  5KUM A;  3RW0 A;  3TK1 A;  3WG7 C;  4RQF A;  4X88 A;  4EKW A;  5L3B A;  1THZ A;  1R73 A;  1EBO A;  2WLM A;  2XAG A;  3CC4 V;  2ZR2 A;  3IFX A;  2QE7 G;  1FXV A;  4WFA V;  2LFR A;  2X0L A;  4MS2 A;  2DQ0 A;  3G4S V;  1E79 G;  1TUE B;  3P30 A;  2GSM B;  1GM7 A;  3JCZ A;  2DYS B;  4RUF A;  2DYR C;  3VBB A;  1MAB G;  3F7V C;  3ZMV A;  2EZO A;  3ETE A;  2WSS G;  5CBG A;  4G2K A;  1VQ8 V;  1K4D C;  4HYO A;  2OTJ V;  4BIU A;  3ZCC A;  5LHI A;  1J95 A;  1S72 V;  5LHH A;  4PA7 A;  2MK3 A;  2M7W A;  3ABK C;  5B1N A;  2EIL C;  3UM7 A;  2H8P C;  3LSQ A;  5LBQ A;  3SYO A;  3OR6 C;  3LDE A;  5H6R A;  1BL8 A;  4I9W A;  2XAF A;  3T4D A;  1P7B A;  3K3W A;  2IU3 A;  2ZXW B;  3ZMT A;  1S0V A;  1CP9 A;  2A9H A;  2DYS C;  1YI2 V;  4LCU C;  4QIW F;  3D36 A;  2EJR A;  1S5H C;  1G4Y B;  5E1A C;  1IXM A;  4PDL A;  5B1A B;  3CCE V;  5J9P C;  1M56 C;  1SET A;  5CBF A;  1V54 B;  4MVS A;  4E2L A;  5IYC O;  2LFS A;  2PI5 A;  2FTK A;  3OFN G;  5IDJ A;  4HZ3 A;  4PA3 A;  4Z1M G;  3ASO B;  4H37 A;  2X7R B;  4R8C A;  4FJC C;  3SPG A;  4JAV A;  2WLL B;  3ZIA G;  2KB1 A;  3K04 A;  2DYR B;  2HJF C;  5B1B C;  4KUM A;  4PA4 A;  3PJS K;  1K33 A;  3AEI A;  3EHB B;  3EFF K;  3K0G A;  1AI5 A;  1VQL V;  1F4M A;  2JIZ G;  5FL7 G;  3E89 A;  5L3G A;  2EIK C;  3OEH G;  3CCR V;  1NH2 D;  1JPX A;  1BHA A;  2YSU B;  3W7W A;  1AR1 B;  1K5S A;  4DO2 A;  1UJW B;  3TCU A;  5IY5 B;  3CP1 A;  2P90 A;  2Q69 A;  3FYI B;  2YEV A;  1VQ7 V;  4WFH A;  1K92 A;  3QO8 A;  1NR7 A;  2EIN B;  1OCR C;  1Y66 A;  2ITD C;  3SYC A;  3OMN B;  3K08 A;  1DF5 A;  1R3J C;  1R6N A;  3ASO C;  2WLJ A;  2P67 A;  3JD0 A;  5EC2 C;  1V55 B;  1BHB A;  1K7D A;  3LUT B;  2IH3 C;  4P2Z A;  1OCC B;  5LHG A;  3R65 A;  1EZJ A;  5H9C A;  4GCZ A;  3STZ C;  2DW4 A;  2R9I A;  3VOU A;  3KG2 A;  4UXN A;  2EZP A;  4MVR A;  1YTF D;  1M90 W;  5CMU A;  3ABL B;  3AG1 B;  4JF3 A;  3SPH A;  3W7T A;  1SZT A;  5CN0 A;  4JTD B;  1FXH A;  2ZXW C;  1VQ5 V;  4MW3 A;  1DF4 A;  5IY5 C;  2P7T C;  1H2G A;  5KUK A;  1G8M A;  4FMT A;  3W7X A;  1NQT A;  1FFT B;  1SER A;  3CC2 V;  2B1I A;  2R9R B;  3ASN C;  1V54 C;  4Q20 A;  2IJH A;  3E8F A;  2NNU A;  3ZRV A;  1GKF A;  3E35 A;  2NLJ C;  1KKD A;  1DTO A;  3FB8 C;  2Y69 B;  2V7Q G;  1ROP A;  3QNE A;  3ETD A;  2PI4 A;  1NKD A;  3SPJ A;  3TET A;  5B1B B;  1K73 W;  3LNM B;  4MTX A;  1JVM A;  2X6C A;  3P32 A;  4LP8 A;  1PKX A;  3LSS A;  2OCC B;  3JYC A;  5EBM C;  4XBF A;  3OMI B;  3T1C A;  2A0L A;  2DWE C;  3CCL V;  5C93 A;  3E8B A;  3IC7 A;  1LNQ A;  3E86 A;  1VQ9 V;  5EBL C;  1AI4 A;  1K97 A;  4PDM A;  4UVC A;  2K1E A;  4RAI A;  1PNK A;  3IGA C;  3K9A A;  1I5X A;  1VQ6 V;  1L1F A;  1N8R W;  1F23 A;  2QTO A;  4YXW G;  4JAU A;  1OCC C;  1YJW V;  2UXX A;  1EFR G;  2IH1 C;  2OCC C;  1MOF A;  2LP7 A;  3G71 V;  2HKO A;  4J9Z B;  1VQ4 V;  1QR8 A;  3BEH A;  1ZWI C;  2YEV B;  3AG4 B;  3NXS A;  1NR1 A;  4KP4 A;  1NVP B;  5HFL A;  2IJK A;  1RPR A;  3SPI A;  3AG1 C;  4PDR A;  4JTA B;  2HVJ C;  3AG3 B;  2XAQ A;  3CPW U;  3HB3 B;  1R3K C;  4PEL A;  2CK3 G;  3E8G A;  4MTF A;  2XAH A;  1OZ0 A;  2Q6A A;  2UXN A;  2WWW A;  5B1A C;  3ZRW B;  1K9M W;  2Z5U A;  3ASN B;  4ZKI A;  2HR3 A;  3JD2 A;  4MVQ A;  1K8A W;  4H33 A;  3ZN0 A;  1GMG A;  1AJN A;  3QO5 A;  4LBE C;  1AJQ A;  2Y69 C;  3CCJ V;  3RBZ A;  3ABM B;  3AG4 C;  2HVK C;  3OUF A;  1W0K G;  2JEU A;  3FB6 C;  1MG1 A;  1KQS U;  3E8H A;  1PNL A;  2WAM A;  3AG2 B;  4P9P A;  1FS0 G;  1NBM G;  4MTO A;  4BAY A;  3JD3 A;  1Q86 W;  5CA3 A;  1Q82 W;  3F7Y C;  1YTF B;  3CXC U;  4ASU G;  2QA4 V;  4P30 A;  4BW5 A;  4QJF B;  2XOK G;  1OCR B;  1CEZ A;  1QLN A;  3GB7 C;  5B3S C;  4TWK A;  3CCS V;  1M9N A;  1OCO C;  1S76 D;  1M57 B;  3DGE A;  3LDD A;  3I56 V;  4WFF A;  1R3I C;  2AHZ A;  3B8N A;  5L3D A;  3AG2 C;  2OTL V;  4UUJ C;  1CPY A;  3OUS A;  3ABK B;  4OXS A;  2QEX V;  5EBW C;  2JDI G;  1R3L C;  3DTU B;  2V1D A;  1XL6 A;  2IW5 A;  1PNM A;  2ZR3 A;  4ZBM A;  1P4R A;  2W6I G;  1H8E G;  3OMA B;  5L3C A;  1KEC A;  3ABL C;  3SYA A;  1RM1 C;  4XDL A;  1ARO P;  2JK5 C;  4R6Z A;  4GX5 A;  2IU0 A;  2ATK C;  2WLN A;  2QM7 A;  3ZRS A;  2C2A A;  4GT1 A;  3AG3 C;  4L87 A;  1K4C C;  4JTC B;  1RPO A;  5GW7 A;  4I5S A;  4R7C A;  4JYB A;  2BOC C;  3JD4 A;  4GX2 A;  1K34 A;  5H6Q A;  2F43 G;  1FXK C;  4QE9 A;  3RVZ A;  2WLH A;  4QE7 A;  1AJP A;  5B1O A;  1BMF G;  2Z3Y A;  5HFM A;  5L3F A;  2EIM C;  4MTG A;  4XDJ A;  1GTO A;  3FB7 C;  4MVU A;  4PA9 A;  3W7S A;  1VQP V;  2EIK B;  4MVM A;  1VQO V;  4G28 B;  4JAS A;  1WLE A;  4U7O A;  1MSW D;  3JD1 A;  1QVF U;  3ZN1 A;  3OR7 C;  2WLK A;  3F5W C;  3FKS G;  1R6K A;  3B8M A;  2EIN C;  1GM9 A;  2DQ3 A;  5L3E A;  1YIJ V;  1QBZ A;  4XDK A;  2HLD G;  3ZRX A;  2EBO A;  1AI6 A;  3OW2 U;  2XAJ A;  3OAA G;  4MVZ A;  1KC8 W;  1HWY A;  1VQK V;  2QKS A;  1QR9 A;  3HPL C;  2X6A A;  4UVA A;  3K79 A;  4RUE A;  1B6Q A;  1FXK A;  3K03 A;  3G6E V;  1YHQ V;  2Q67 A;  5IYD O;  3B77 A;  4JYC A;  5B3S B;  4WFB V;  3ZJZ A;  1JQ0 A;  4PA6 A;  4HAM A;  3T4Z A;  2AHY A;  1SRY A;  1VQN V;  4MVO A;  5IYB O;  2ZDI A;  2XAS A;  3A0R A;  1H8H G;  1QCE A;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...