4P2ZA

Structure of navms t207a/f214a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 35
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p2zA00
3X2QC 1M57C 4GX2A 1OCZC 3IFXA 2Q69A 3LDEA 4X8AA 3SJQC 3AG2C 3K0GA 4PDMA 2QTOA 3SYOA 3AG3C 3E8GA 3STZC 1ORQC 3RVYA 4RUEA 5CBFA 1ZWIC 3F5WC 4TWKA 4BW5A 1QLEC 3STLC 4WFGA 3E89A 2EIJC 2WLIB 4P9PA 4WFHA 3SPIA 4QNHB 1V54C 2HVJC 3LDCA 2ATKC 4J9YB 5E1AC 3TETA 2EIMC 2Q68A 2A79B 1KKDA 4G28B 2Q6AA 3ABLC 2H8PC 3RVZA 4KFMA 4PA9A 1XL6A 3E86A 2WLNA 2EINC 2KB1A 2YEVA 5EK0A 2WLMA 3SYPA 2K1EA 3HPLC 4H33A 1JVMA 3VOUA 2BOCC 4I9WA 5KUMA 4HYOA 2AHYA 3RBZA 2WLLB 4RAIA 2DYSC 4MS2A 4MVSA 2DWDC 2EILC 4WFFA 3F7YC 4X89A 2HJFC 3SPCA 2Q67A 4LBEC 4XDLA 4PDRA 4MTOA 4MVRA 3JYCA 2A0LA 4P30A 4MTFA 4XDKA 4MTGA 5IY5C 3RW0A 3K06A 4PA3A 5EC2C 3ABMC 3LUTB 4HZ3A 1K4DC 4MVMA 3R65A 4R6ZA 4P2ZA 3WG7C 2X6AA 4MVOA 2P7TC 4EKWA 2EIKC 1OCOC 2OCCC 5B1BC 5BZBA 1K4CC 4H37A 1P7BA 3T2MA 4MW8A 3IGAC 4MW3A 3SYCA 4G27B 3FB5C 2R9RB 1R3IC 2ITCC 4JTDB 2WLKA 4PA6A 3SYAA 3T1CA 3UKMA 2NLJC 5EBWC 1OCRC 3T4ZA 3LDDA 1LNQA 1R3JC 3KG2A 5CBHA 3F7VC 1BL8A 4LP8A 4QE7A 2A9HA 4JTCB 2JK5C 4R50A 3UM7A 3SPJA 3ASOC 1S5HC 3K04A 4MVZA 1V55C 5EBMC 3SYQA 3T4DA 1XL4A 2QKSA 2AHZA 4GX1A 3EFFK 2HFEC 2WLIA 2DWEC 4R7CA 4F4LA 4JTAB 3BEHA 3OGCC 2X6CA 3ABKC 3OR6C 4GX5A 1R3LC 2IH1C 3GB7C 4PDLA 4QE9A 3ZJZA 5B3SC 2WLHA 4OXSA 3SPHA 4RO2A 2BOBC 1M56C 3OUSA 4MVUA 4RUFA 3TCUA 1J95A 2ZD9A 4J9ZB 3FB8C 2W0FC 2ZXWC 3LNMB 3AG4C 4MVQA 1OCCC 2HVKC 4UUJC 4LCUC 5KUKA 2X6BA 3K08A 3OR7C 4PA7A 4P9OA 2WLLA 4WFEA 5B1AC 3OUFA 3K03A 5EC1C 5EBLC 3FB6C 4MSWC 3ZRSA 3AG1C 3SPGA 3E8FA 3K0DA 2DYRC 4R8CA 1R3KC 3E8BA 5CBGA 4ZBMA 4XDJA 2ITDC 4GX0A 1G4YB 3E83A 3FB7C 4DXWA 2WLJA 4PA4A 2Y69C 4PDVA 4CBCA 4X88A 3ASNC 5J9PC 2HG5C 3E8HA 3PJSK 2IH3C
chains in the Genus database with same CATH superfamily
5GW7A 3AK1A 4CS3A 3Q4HB 1M5IA 5JQGB 2P6JA 4IHJB 4F6RB 2Y69B 4B7EA 3ML0A 2WLIB 2PTMA 3SPIA 3H1JH 3VQYA 4DK1A 4UCUA 3BA9A 1VF5B 1FFXB 3T1HB 1SQVH 4DV0O 3E86A 3T2MA 2OTLV 1VMGA 4H33A 4X66O 3D8CA 4I9WA 3H1HH 2DMXA 1XREA 4X62O 2EJ7A 3WFVA 2AXTZ 4RWUA 4DV2B 3K3WA 4AHCA 4MTOA 4JAVA 3ZMUA 4A5UB 1RP3B 3ETGA 4GT1A 4LFBO 4TV9B 2CTPA 4OGQB 4JAUA 2R9RB 2P5OA 1K33A 3I5DA 2V4DA 1R6KA 5FPRA 1BL8A 3P32A 1B6QA 2DE0X 4YY3B 4GCZA 4GX1A 2OIGA 1F4MA 1QQCA 3FFQA 5CMUA 1M56C 1DLBA 2IBZH 4RUFA 2R9IA 2ZD9A 4J9ZB 1GN4A 4JI0O 4I55A 5FLXN 4X65B 2UUBO 1NZ6A 1QHTA 1V9PA 1AJQA 4WF9V 4I4TA 4K0KB 1K92A 4UXNA 3FYEB 5IJ0A 2EBOA 2Q7EA 5JVDA 3B8NA 4FK5C 2ZM6O 4Q20A 1Q7YW 1H2SB 1AI6A 1EZVH 2HHHB 5FNVA 4GZRB 1Y6XA 2QA4V 4JF3A 4TUYA 1YF2A 4UVBA 1X59A 4LF7O 2M7WA 3LSQA 1MABG 2WLLB 1WP8A 3ETDA 3SPCA 3RYHB 3IC9A 4JI1O 2BTOA 4TV8B 1Q86W 1B06A 4IIJA 4KP4A 2GUZA 4B08A 2RCVA 2JJ2G 3ABMC 3HR0A 3OM3B 5H5NA 3GWKC 4JYCA 2HP8A 4D7SA 2R70A 1L0NH 4QGPA 5IJ9A 3ABUA 4PI2A 1B3QA 3SYCA 2P22C 3CMAV 3G6BA 5CN0A 2ZE5A 1PP9H 1PD3A 1NTKH 2N74A 3FD9A 1YXBA 4WBNA 1WA8B 1IDSA 1Y66A 1YSCA 2JS5A 4B3TO 4B3SB 1L8DA 3ASOB 3CP1A 1SZTA 1I7FA 1V55B 5LA6B 4DV7B 2JEUA 1A32A 4DXWA 2IM9A 3LNMB 4UVAA 2X6BA 2UUCB 3C90A 3N27A 3K03A 1K5SA 1UPGA 5JJEB 4X1YB 4DR7B 2N04A 5CA3A 3UT5B 3KZIZ 2JVDA 4JYBA 1IBLB 5IWAB 1OHHG 5HFMA 2HLDG 3E8HA 3X2QC 2Z3YA 3IFXA 2Q69A 2R72A 3LDEA 4LF5B 3J7AU 3RVYA 1YJNV 4RUEA 2ARHA 1VF7A 1VQKV 4WFGA 1F4NA 4GYCB 1SETA 2YXYA 5LOVA 1NTMH 4J7ZA 2W6JG 1IURA 4I0XA 1O9GA 2Q8VA 5L3EA 3SDLA 1YI2V 1HP8A 2UUAO 5LP6C 5KX5B 3B2EE 1Y74B 2X0LA 1G1XB 4O4LB 3N2GA 2JRIA 1NS1A 2ODMA 4X20B 2F43G 4IYHA 2HHHO 1XNRO 2ZCEA 3O9OA 2YI8A 5CA0B 1S72V 3VQVA 2W6IG 3T4ZA 4CH4A 1UFIA 1K73W 1TUBA 3BABA 1HR0B 1OCRB 4R7CA 1P4RA 5IYZA 2Q73A 5LGNA 4QE9A 4OX9O 4TOIA 2QM7A 4CH6A 2JGDA 1SQBH 2W0FC 4JV5O 4IGGA 2CAZC 4ZI7B 1GTOA 1W0JG 4WFEA 3OUFA 5EC1C 1JX9A 3K59A 3E8BA 1VQNV 1WN7A 4EB6B 1BQZA 2L35A 4DV6O 5EIBD 1KKCA 2YUAA 1SERA 2ZE6A 5GONA 4NR1A 4JTCB 1M57C 5L3FA 4DR3B 3SJQC 3K0GA 4NKGB 1VEWA 3L73H 3TJTA 4EFEA 2ZR3A 5ITZA 1X4TA 1VARA 5DN6G 4JI4B 2FTKA 3GWOA 1NH2D 1NTZH 1THZA 4J11A 3ABLC 2CK3G 4MT8A 4DV7O 3JAMN 3EHBB 3AEIA 3JAKB 2AHYA 5IYBO 3G6EV 4MVSA 4HBNA 4LFAO 4I5SA 5FL7G 1PL4A 3CWBH 3Q4HA 1WPBA 5JQGA 2UXDB 5B66Z 5IWAO 2DYSB 1Z2GA 4P2ZA 4DUZB 3B40A 3CCRV 2XAQA 4LF5O 1GM8A 1K4CC 5E79Z 4LF8B 4MW8A 1CXZB 2ZIMA 1LUWA 2UU9B 3SYAA 2NLJC 1NVPD 5LYJB 4J7KA 1R3JC 1P49A 4U3JB 4DV4B 1QBZA 3A0BZ 4UB8Z 3LNNA 3UM7A 3M8AA 1XL4A 4DUYO 1NJIW 3THOA 2X6CA 3CCEV 3ZJZA 2WLHA 4OXSA 4ZHQA 1URFA 4TV9A 3CCUV 2QWRB 3TXQA 2CTWA 2Z5UA 3OW2U 1I5XA 3OTOB 4NXMB 2AZ0A 2DQ3A 1UJWB 4JZGA 4EEQA 1FKAO 1KC8W 3IAYA 4K3AA 1XUQA 4CH3A 4TQFA 2ZNIA 5B1AB 1W59A 2PF4E 1N32B 4QIWF 5LGTA 3K9AA 5KA6A 4LWSA 4DR1O 3AG1B 5EZYA 3E22B 1VIBA 5LGUA 4UCRA 1HR0O 4NYKA 4X66B 3F5WC 4BIUA 4X62B 2OTJV 4O4IB 4QNHB 2A06H 2ATKC 2P4KA 1XMQB 2QDOA 3AG3B 1SESA 2Q6AA 1XL6A 1KP3A 2WLMA 1QLEB 1P7GA 2Q7HA 2QR4A 1PNKA 1V54B 3W7TA 2EX3A 4DO2A 2Y0PA 1U97A 1GN2A 2KSDA 1E79G 3MDSA 3G80A 4WFAV 2EINB 3JATB 4NVPA 3RYFB 1KBHA 2H94A 3JYCA 2A0LA 2GBOA 2PZSA 3JD1A 1AP6A 2Y4UA 2YICA 5IY5B 4BW9A 4YXWG 1ZUQA 3QO5A 2CH7A 4YIOA 4QE7A 4FLTA 2OCCB 1WJZA 2UXNA 1KU9A 4U7NA 1N33O 3RYHA 2WPDG 4IL6Z 4TV8A 2VRZA 1FXKA 3CE2A 4BWAA 2UUBB 3FYIB 2JJ1G 4LF9O 5B3SC 1IBKO 4LH7A 4UV8A 4RO2A 1IX9A 1R73A 2BTQA 4ZOLA 3TCUA 3OMNB 2ZXWC 3QO8A 3AG4C 3AG7A 4K8XA 3ZMVA 2AZ2A 1E1RG 4ZIBA 2JIZG 1E1QG 1PM9A 3CS5A 2ZIOA 1BHBA 4O2BA 1O9HA 2YSUB 4J10A 1VQLV 4FFKA 3TK1A 3K5NA 4LF7B 1S77D 2BSKB 1Y76A 3RYIB 4TSFG 1SRYA 3AG2C 3DC5A 3JAWA 1WB8A 3L71H 2E76B 1ORQC 2F1MA 3STZC 5IYDO 1YEWA 3HKBA 3DSQA 3STLC 1DF5A 1Z5WA 2EIJC 4WFHA 3QNEA 3I55V 2OYQA 3EVKA 5KAFZ 2HVJC 2CDYA 3QG5A 1S76D 5E1AC 4JI1B 1N36O 1FD9A 1CEZA 4G28B 2LW1A 5LXTA 5L3CA 4NTXA 3ZHTA 2PY5A 4X1IB 3UCSC 5GTHZ 4DW1A 3CD6V 2JS3A 2KG7B 5J2TA 2XNDG 1IXBA 1GKFA 4XDKA 3HKDB 1JFFA 4DK0A 1N32O 2C2AA 4KL1A 4O4HB 5DEDA 4LFCO 1EN6A 4EKWA 3ZRXA 1P7BA 4NXMO 1NBMG 1RSOB 2WLKA 4U7OA 3B4SA 1NQTA 1YTFB 4B3TB 3K5LA 1XMQO 1M4UA 4QJFB 1S5HC 2BCCH 1N0JA 2UXBB 2DWEC 1J5EB 3RYCB 4C7UA 3JALA 2WSSG 5D5QA 3OUSA 4O2AB 2XUMA 5KAIZ 4MVQA 4TQDA 1TUEB 3L70H 4UUJC 1EZJA 3UO2A 3J80N 2KQXA 4HAMA 1BMFG 1TGOA 1M56B 1VP7A 4ZBMA 3OT7A 3ZRWB 3CXHF 3BFRA 2VQFO 5H6QA 3A8TA 3BHPA 4PDMA 3R66A 4OPHA 2XAHA 4I50A 2UUAB 1Q6HA 5HFLA 3JCZA 4K8ZA 5JJNB 4DR4B 3P3NA 4J80A 4I9QA 2PUSA 3FAVB 1TAEA 4KFMA 4PA9A 4Z2WA 2KB1A 1GN3A 3ZHVA 5BMVB 5TISZ 2Q0OC 1VF6A 4N23A 3ZHUA 4DR5O 3OGIB 2XOKG 4DV3B 1XNRB 3JD0A 2DQ0A 4AILC 2VWKA 3RW0A 3K06A 1COWG 4MVMA 1K4DC 3OE7G 1NT2B 3JARB 3JSNA 1KECA 1F7YA 1TA8A 5BR8B 4H37A 4DRXA 4BR6A 4B3RO 4Q6GA 3VQWA 3L75H 2RN9A 1NI8A 5BY1A 2CGOA 3ABMB 3K5OA 3T1CA 1H2MA 1GO3F 4UCVA 5C8YA 4FM2A 4OX9B 3UO3A 2DOSA 2A9HA 5K1PA 2XAJA 3G71V 3SPJA 3K04A 2ZNJA 3K9SA 4JV5B 3L74H 2YEVB 1FXVA 1KMIZ 3CRMA 5GTIZ 2HR3A 2YDEA 1R3LC 3K79A 4J42A 3ZN1A 2CE4A 1FJGB 1FPOA 4DV6B 1M90W 2HVKC 1ZL8B 3K5MA 2GSMB 5LMUO 1NU1H 1AR1B 5KMGB 4AI8A 5EIBC 4GX0A 4FLXA 1FYJA 4E4EA 1NH2B 3HKEB 3UQ8A 4CBCA 3ASNC 5B1NA 1VQMV 3NR7A 3CJHA 2QTOA 1OZ0A 3E8GA 3U10A 1QCEA 1G8MA 2UXBO 1J5EO 3D3IA 2A3QA 2GDSA 3X2QB 2EZPA 1WB7A 4LFAB 2JEXA 4JI3B 2ZT9B 1VQOV 2EIMC 3HKCA 1SF9A 3BVOA 3ZBHA 2E75B 1SS3A 2K1EA 3S3WA 3B09A 2X7RB 4MS2A 2EILC 3MHSC 4JASA 1XEQA 3CCJV 4U3FH 2ZE7A 1QR9A 1QNMA 5DECA 4PDRA 1AJPA 4P30A 4X64B 2D2CB 1NVPB 3ZHRA 3TGUH 3P30A 3B8MA 5LP6B 4YJ2A 3QTCA 2QGNA 1BGYH 2ADPA 3D3QA 1ZTEA 4G27B 3FB5C 1MZFA 1PNLA 4DUYB 3JASA 4FM1A 1IZ3A 1Q8IA 1RPOA 2RMKB 4CS4A 1ENVA 4DR4O 4LC1A 4R50A 2QTSA 4ASUG 3APQA 2QKSA 2AHZA 2Q4PA 1G6UA 3ZS8C 5IT9N 3ABKC 3W7WA 2IJHA 4YIPA 4JI5B 3E35A 4DV3O 1DTOA 2NNUA 1HNXB 2BOBC 4MVUA 3T4DA 4K35A 3W7SA 4LCUC 4DR1B 3H01A 1B04A 5JH7A 3ZRSA 5J2UB 2HJDA 5BR8O 1AR5A 4RQEA 2XTAA 1M1KW 2FL4A 3FB7C 2QM8A 1Q6UA 2CTQA 4FZ0A 1OCZC 1SA0A 4LF4B 2N05A 3E2EA 3ZIAG 3MAQA 1JMKC 5CA1A 1EFRG 1M57B 2V1DA 1Q5OA 2QSAA 3M7MX 3CC7V 2DW4A 4KHPO 2MK3A 1IBMB 1AB3A 1YCIA 1BQ0A 1R6TA 1FJGO 2QE7G 3CRCA 2EULA 4ZKIA 1ZAUA 4I55B 4X89A 2HJFC 3ABLB 4CS2A 1K9MW 2P67A 4CC6A 2VWJA 4I4TB 4FM0A 4X1KA 3JSLA 5IJ0B 5EC2C 5JVDB 1N33B 4UCOA 4R6ZA 4LNUA 3ETQA 1WP7A 3U11A 1R3IC 4JTDB 2YIAA 4FVMA 5FNVB 5EBWC 4WFBV 4FLUA 4LF9B 4JYYA 5F2VO 4JI3O 4TUYB 1IBKB 1VF6C 4G2KA 4PHZA 2YIDA 3NXSA 2ILMA 4IHJA 4F6RA 3CSXA 2YIBA 2WLIA 4F4LA 3OGCC 1L0LH 2IJIA 1BCCH 2R9AA 1W2BU 2ZKOA 1FFXA 1IVSA 3B77A 2WWWA 5JJJB 4DV5B 4W4LA 4X64O 3FB8C 4IIJB 1OCCC 1RSOA 2Q5ZA 4DV1B 1HDJA 1YJWV 2LO1A 3FB6C 5A2QN 5D5PA 2H3OA 4RQFA 3O65A 5IJ9B 3CCSV 4B3MO 4PA4A 1N36B 1I08A 3RT3C 4YHHB 1LUVA 2OIEA 5KHGA 1EM1A 3SR2C 4WBNB 1AI5A 4JI5O 2Q68A 3CCVV 1HNXO 3H1LH 2E74B 2WLNA 5EK0A 3ZHQA 4OPAA 2BE3A 3ZCCA 2F4VO 4FJCC 1H2KA 5KLVH 5KUMA 4LF6B 4LFCB 3H1KH 1W0KG 2DWDC 1GAXA 3ZHSA 1AJNA 3KKYA 3K57A 1BT8A 2YC0A 4JZ2A 5EYPB 2GTAA 2B9ZA 1VQPV 4MVOA 3DGEA 5AG2A 1OCOC 4L8JA 5H2FZ 4LF4O 3FAVA 1I94B 1AI7A 5JCOA 2Y0IA 5BMVA 2YXLA 3WG7C 3JD2A 5LBQA 1XBLA 1HNWO 4LP8A 2JK5C 5LOVB 1IBMO 3OMAB 4LR3A 1H2GA 4I0XB 1SC5B 1R1BA 4CH5A 4EFBA 1SKVA 1XHXA 3KCYA 2B5UA 2B1IA 1Y4MA 4DR6O 1AILA 5JWPA 1HW7A 3OD4A 2QKAA 3BA8A 3N2GB 2WAMA 2WLLA 5B3SB 2VQFB 4UB6Z 2IJKA 2E3CA 4PD4F 1JA8A 1ZX3A 2DYRC 1JPXA 3K58A 2GV9A 2ZXWB 3AG4B 1N8RW 1S0VA 1NKDA 1K34A 3E83A 2UXCO 3SPHA 3CRQA 1AROP 3W7XA 1TUBB 5CBFA 2FKXA 4TWKA 4JYAO 1DGSA 2PI4A 4DR5B 5IYZB 1H8EG 1JR9A 4J9YB 3AG2B 3FX7A 2QEXV 1GK9A 2H8PC 1IXMA 4DV5O 1MMMA 4JI6O 3HPLC 1WA8A 3CMEV 4JGSA 4FLYA 2EIJB 4LH6A 2AGAA 1JVMA 4DV1O 3CCQV 3OEHG 4DYLA 3LSUA 4B3RB 2Q67A 1VQ5V 4LBEC 5CB4B 5LA6A 4L87A 2P90A 4MVRA 2F66C 1AI4A 2CGNA 2F95B 4UCTA 1Q90D 2UXXA 4YHHO 1BZKA 4X1YA 1VQ6V 2EIKC 5B1BC 1TVKB 2V7QG 3UT5A 3RWRD 4GKKO 4MW3A 3OMIB 5ITZB 2ITCC 1KQSU 3A0HZ 2E5LO 2HEPA 4JI8O 1EN4A 4DW0A 4F6EA 3DXRB 3BEHA 4LF6O 3C3TA 5LMUB 4E2LA 1XHZA 2WA4A 1AVMA 1RM1C 1M93A 3RGBA 1Q3EA 3APOA 4PA7A 1YJ9V 5KX5A 4ICGA 2IU0A 1Y74A 4AQYB 1I94O 1EBOA 4O4LA 1L1FA 1I5YA 1JCHA 2Y69C 2QKCA 4PDVA 4X88A 5KHKA 3IC7A 1VQ9V 4GX2A 3RN4A 1MA1A 4X20A 2CUGA 2QWOB 1R6NA 5CA0A 3TXSA 5K1XA 1S3JA 2M6YA 2ZE8A 3LDCA 5C93A 1K5QA 3C3SA 5J2UA 3ZMTA 3I56V 4ZHQB 3ABTA 5KHJA 5IE9A 1SQXH 2BOCC 4IT5A 2EZOA 1H38A 3PN1A 1FFTB 1HNZO 3ZMZA 5DM6V 4BAYA 4ZI7A 1US6A 4MTGA 1XMOB 4D6TH 4UVCA 2PI5A 2PGGA 4LWSB 1MNGA 5EZYB 2P7TC 1JQ0A 3HB3B 2LFRA 4EB6A 3IGAC 1GH6A 4BIOA 4PA6A 3LDDA 1QR8A 1YVWA 3KG2A 2LP7A 1QVGU 3S3XA 2ETNA 5FPOA 1D5AA 1BSMA 1N34O 3D36A 4YJ3B 2Y4TA 1SQFA 3VQXA 3OFNG 2JDIG 2Y48A 4IYIA 3OAAG 4H0LB 4FLZA 1VQ8V 2FYUH 2RDCA 3JAKA 5JCOC 4PJ0Z 4DR2B 3F5TA 2JGUA 3E8FA 3K0DA 1WAZA 5B1OA 2Q0AA 3BCCH 4FLWA 4GKJB 2IJJA 4H13B 2YS8A 1YHQV 1G4YB 1F51A 2WLJA 1JJ2U 3EXAA 1Q43A 2ZDIA 5A9GA 1DF4A 5KUKA 1T5EA 4KHPB 2CH7B 1EN5A 3QVNA 4HNAB 3SYOA 3WU2Z 1WPXA 4GLXA 5BXZA 4JI7O 1S5JA 1FXKB 2FB5A 4FFBB 3ASNB 1NR1A 1SQQH 5LYJA 4JI2O 4U3JA 4MTXA 1GM9A 1WLEA 4FIPC 3CPWU 4JAAA 4X9QA 2BTQB 4ZOLB 2OCHA 1FXKC 1K7DA 3L72H 1SQGA 4HYOA 3RBZA 1VQ7V 3ZMSA 2YIBD 2YXHA 2EIMB 3W7UA 2XAFA 1RFYA 3T1HO 4AQYO 1GRJA 2IU3A 4O2BB 3QF7A 1KP2A 2LGWA 2QWQB 4PA3A 2EILB 4HZ3A 1MZEA 1YITV 4PV1B 1Y76B 1YTFD 2RJZA 5BZBA 4DV2O 1DK1A 2QWPB 2P06A 1Q82W 3JAWB 1LR1A 1U96A 4CC5A 1K8AW 3SGIA 4GUNA 4O4JB 4NB5A 3HKBB 2OWOA 3E22A 1LNQA 2KKWA 2DJVA 3QO7A 3ASOC 4MVZA 1V55C 5LXTB 4I7ZB 2HFEC 1CPYA 3BY6A 4O4IA 1CP9A 3N2KB 5EYPA 4GX5A 2IH1C 5LL6Y 1Z5VA 3A2FA 5J2TB 1PNMA 2G38A 3CHXA 2XT9A 3WB0A 2CTRA 4B3MB 4YY3O 1JFFB 1XMOO 1QVFU 3ABKB 3JD3A 1D5NA 5EBLC 4MSWC 3JATA 1Y67A 1R3KC 3RYFA 2RQ6A 1SZXA 2ITDC 1H2LA 1OJHA 1ZLZA 5J9PC 4FPPA 4X65O 3MD0A 4X8AA 1MSWD 2F4VB 4K0KO 1ZWIC 4BW5A 4P9PA 1JJOA 1OCZB 4FZ1A 1ROPA 3JALB 1KKDA 2HKOA 4UV9A 4DR2O 1D2DA 4RAIA 4WFFA 4NTWA 2YI9A 4XDLA 4GKJO 3AK2A 4FLVA 1RPRA 3MHHC 5KHHA 1HNWB 3CRRA 2ADQB 1XQ8A 2ZQMA 2W0XA 2X6AA 2O57A 4PELA 2IH3C 5IYCO 1BE3H 3FKSG 2PYJA 3UKMA 2LQTA 3ETEA 1OCRC 2BSKA 3RYIA 1K97A 4I50B 4NXNB 4DR6B 5B5EZ 1N4CA 1MG1A 5CB4A 4KUMA 1QLNA 3CYOA 1GN6A 3L9DA 4J7JA 5LHHA 2LJ2A 1KB9F 1TVKA 3ZN0A 1J95A 3SJBC 4B7KA 2UXCB 3JD4A 1YDXA 3DC6A 4X1IA 5IDJA 2K9PA 2KG7A 2VQEB 1GM7A 4B3SO 3SJAC 3WB2A 1OCCB 4DRXB 3D36C 4JYAB 1SQPH 3HKDA 3CRAA 3ZRVA 1XNQB 4JPRA 3U0ZA 2XAGA 3DXRA 3OTFA 4O4HA 3CCMV 3A0RA 3PJSK 3R65A 3OEEG 5C8YB 2UUCO 1XILA 4JI6B 2GUZB 1FS0G 4BIZA 3CXCU 4DR7O 1WNSA 3VBBA 4N21A 2Q7GA 5H9CA 2XASA 1N0NA 1IBLO 4D7TA 5LMNB 1XDCA 3WB1A 2EJRA 3CC4V 3VOUA 3RYCA 2DYSC 2ZDIC 4GKKB 2AW9A 4O2AA 1HWYA 3T1YB 1PL0A 1PV0A 3ICXA 3LUTB 2E5LB 2IW5A 1YZBA 1I0HA 2Q9LA 2D3OW 4JI8B 3BPZA 3CJHB 3ZRWA 2LGQA 4QPJA 3CB2A 1PPJH 1OCOB 3CC2V 3HKCB 1S5LZ 2WA3A 5EBMC 3WG7B 3EFFK 1BHAA 3GB7C 4PDLA 4DV0B 2QM4A 4J41A 1M9NA 3K08A 4P9OA 3OR7C 1FXHA 5B1AC 1Q6IA 4YJ2B 2NR5A 3AG1C 3H9VA 2DN9A 3BAAA 2LFSA 4YJ3A 5CBGA 1AP5A 4ABMA 4XDJA 5KHIA 3G67A 2FMLA 3JASB 1KYOF 3BRCA 5LHGA 1MSDA 3JARA 3J81N 2GTSA 2A7WA 4NXNO 1VQ4V 2B1GA 1AR4A 2DYRB 4UFZA 4Z1VA 2LW7A 1F23A 2XHBA 2ZR2A 4LFBB 1H8HG 3AG3C 4W4KA 4WCEV 3SJCC 1QLEC 3E89A 1YIJV 1V54C 3TETA 5KA5A 1HNZB 2P4VA 4Z1MG 2A79B 3RVZA 4XBFA 4DR3O 2YEVA 2EINC 4FMTA 3SYPA 4TT3G 4PI0A 1MOFA 2L6LA 3M99B 1KUQA 5L3GA 4JI4O 2Z0AA 3F7YC 2VQEO 5JH7B 2ZINA 4HNAA 2GHYA 2F23A 1ZL8A 4MTFA 1XNQO 4UCSA 2OT5A 4FFBA 5IY5C 4JI0B 1K3EA 1N34B 1OV9A 2VS0A 1SA0B 3IJ4A 5KMGA 2OCCC 3P3PA 5L3DA 4QPKA 3H1IH 2JGDB 1XI1A 3HKEA 3DTUB 2ZM6B 2UXDO 1Q81W 1GMGA 5CA1B 5CBHA 2EIKB 3F7VC 3RFRA 5B1BB 5LMNO 1JOYA 4DUZO 3CCLV 1P84F 3GVMA 1FAFA 2RNBA 3SYQA 4LF8O 3LSSA 4KXRA 4CZZA 1BS3A 2QWNB 4NTYA 4JTAB 2UU9O 5GONB 5LHIA 3OR6C 1NR7A 4DV4O 3AK3A 3ZX6A 3G4SV 3CEIA 1QU7A 4R8CA 2MW2B 2QJ1A 3T1YO 1ZSPA 4X1KB 4O4JA 1XOUA 1H2NA 1PKXA 2NN4A 2F93B 1RM1B 5L3BA 4H44B 3SPGA 3CX5F 4LNUB 4JI7B 3JCUZ 1KD1W 3ZEDA 2PYLA 3KCXA 4JI2B 5LP6A 3N2KA 3OTOO 2HG5C 5H6RA
chains in the Genus database with same CATH topology
5GW7A 1OCZC 5LGUA 3SYOA 1WPXA 3E2EA 2P6JA 3ZIAG 3F5WC 1FXKB 4BIUA 2Y69B 3ASNB 3ML0A 1NR1A 2WLIB 2OTJV 3SPIA 1EFRG 1M57B 4QNHB 2V1DA 4MTXA 3CC7V 2ATKC 2DW4A 1GM9A 2MK3A 3AG3B 1WLEA 1SESA 2Q6AA 4FIPC 3CPWU 1XL6A 3E86A 3T2MA 1KP3A 2OTLV 2WLMA 1QLEB 2QE7G 4H33A 1FXKC 1K7DA 4I9WA 1PNKA 1V54B 4HYOA 3RBZA 4ZKIA 1VQ7V 3W7TA 3ZMSA 3W7UA 2EIMB 2XAFA 4DO2A 4X89A 2HJFC 3ABLB 3WFVA 1K9MW 1E79G 2P67A 4WFAV 2EINB 3K3WA 4MTOA 2H94A 4JAVA 3ZMUA 2IU3A 2A0LA 3JYCA 1KP2A 3ETGA 4PA3A 3JD1A 4GT1A 5EC2C 2EILB 4HZ3A 4R6ZA 1YITV 1YTFD 5BZBA 1Q82W 5IY5B 4JAUA 1K8AW 2R9RB 4YXWG 1R3IC 4JTDB 3QO5A 5EBWC 4WFBV 1K33A 1LNQA 1R6KA 4QE7A 1BL8A 2OCCB 2UXNA 3P32A 4U7NA 3QO7A 2WPDG 1B6QA 3ASOC 4G2KA 4MVZA 1V55C 3NXSA 4GCZA 1FXKA 4GX1A 2HFEC 1CPYA 2WLIA 3BY6A 4F4LA 1F4MA 1CP9A 3FYIB 3OGCC 2IJIA 1W2BU 2JJ1G 4GX5A 5B3SC 2IH1C 3B77A 4UV8A 2WWWA 1PNMA 4RO2A 5CMUA 1M56C 1DLBA 1R73A 4RUFA 3TCUA 2R9IA 2ZD9A 4J9ZB 3FB8C 3OMNB 2ZXWC 3QO8A 3AG4C 1OCCC 5KUKA 1QVFU 3ABKB 3JD3A 1YJWV 3ZMVA 5EBLC 1E1RG 3FB6C 2JIZG 4MSWC 1E1QG 1AJQA 4WF9V 1R3KC 4RQFA 1BHBA 1K92A 2YSUB 4UXNA 1VQLV 3CCSV 2ITDC 3FYEB 2EBOA 4PA4A 3B8NA 4FK5C 3TK1A 5J9PC 4FPPA 4Q20A 1S77D 1Q7YW 1AI6A 4TSFG 3MD0A 1SRYA 4X8AA 3AG2C 1MSWD 3STZC 1ORQC 5IYDO 1ZWIC 4BW5A 3STLC 1AI5A 1DF5A 2EIJC 4P9PA 2QA4V 4WFHA 4JF3A 3QNEA 3I55V 1OCZB 4UVBA 2HVJC 1S76D 5E1AC 1ROPA 2Q68A 1CEZA 1KKDA 4G28B 2M7WA 3CCVV 2HKOA 4UV9A 2WLNA 5EK0A 5L3CA 3LSQA 3ZCCA 4FJCC 5KUMA 1MABG 2WLLB 1W0KG 4RAIA 4WFFA 2DWDC 3ETDA 3SPCA 3CD6V 1AJNA 4XDLA 2XNDG 1Q86W 4KP4A 1GKFA 1RPRA 4XDKA 3MHHC 2JJ2G 2C2AA 3ABMC 3OM3B 2ZQMA 4JYCA 2X6AA 1VQPV 4MVOA 3DGEA 4EKWA 1OCOC 3ZRXA 3ABUA 1P7BA 4PELA 3SYCA 1AI7A 5IYCO 1NBMG 3FKSG 3WG7C 2WLKA 3JD2A 4U7OA 3UKMA 5LBQA 3ETEA 1NQTA 1OCRC 3CMAV 1YTFB 1K97A 5CN0A 4LP8A 2JK5C 1PD3A 3OMAB 1MG1A 1S5HC 4QJFB 4KUMA 1QLNA 3CYOA 1H2GA 1Y66A 1YSCA 2DWEC 5LHHA 3ASOB 3CP1A 1SZTA 2B5UA 1V55B 2B1IA 1Y4MA 2WSSG 3OUSA 3ZN0A 2JEUA 1J95A 4DXWA 3LNMB 4MVQA 1TUEB 4UUJC 1EZJA 4UVAA 2X6BA 3JD4A 2WAMA 2WLLA 5B3SB 4HAMA 1BMFG 3K03A 1K5SA 5IDJA 2IJKA 1M56B 1GM7A 2DYRC 1JPXA 2ZXWB 3AG4B 4ZBMA 1OCCB 1N8RW 5CA3A 1S0VA 3ZRWB 3ZRVA 1NKDA 1K34A 4JYBA 3E83A 4JPRA 2XAGA 1OHHG 5HFMA 3CCMV 2HLDG 3SPHA 3E8HA 3A0RA 3PJSK 3R65A 3OEEG 3X2QC 2Z3YA 3IFXA 2Q69A 3LDEA 5H6QA 4PDMA 1AROP 3W7XA 3RVYA 1YJNV 4RUEA 1FS0G 4BIZA 5CBFA 3CXCU 2XAHA 4TWKA 3VBBA 4N21A 1VQKV 4WFGA 5H9CA 2PI4A 1F4NA 1H8EG 2XASA 5HFLA 1SETA 3JCZA 4J9YB 3AG2B 2W6JG 2QEXV 1GK9A 2H8PC 1IXMA 4KFMA 4PA9A 2KB1A 2EJRA 3HPLC 3CMEV 4JGSA 2EIJB 3CC4V 5L3EA 1JVMA 3VOUA 1YI2V 3CCQV 3OEHG 4N23A 2DYSC 2ZDIC 2XOKG 2Q67A 1VQ5V 4LBEC 2X0LA 3JD0A 4L87A 1HWYA 2DQ0A 2P90A 4MVRA 1PL0A 1AI4A 3RW0A 3K06A 1COWG 3LUTB 4MVMA 1K4DC 3OE7G 1KECA 2UXXA 2IW5A 1VQ6V 2EIKC 2D3OW 5B1BC 2F43G 4H37A 2V7QG 3ZRWA 4MW3A 4QPJA 3OMIB 1S72V 3ABMB 2ITCC 1KQSU 3T1CA 2W6IG 3T4ZA 1GO3F 1OCOB 2A9HA 3CC2V 2XAJA 3G71V 3SPJA 3K04A 1K73W 5EBMC 2YEVB 3WG7B 1FXVA 3EFFK 1OCRB 1BHAA 4R7CA 1P4RA 3BEHA 5LGNA 2HR3A 4E2LA 1R3LC 4QE9A 3GB7C 4PDLA 1RM1C 3K79A 3ZN1A 2QM7A 2W0FC 1M90W 2HVKC 1M9NA 2GSMB 3K08A 4PA7A 3OR7C 4P9OA 1GTOA 1YJ9V 1W0JG 4WFEA 1FXHA 5B1AC 3OUFA 5EC1C 1JX9A 3AG1C 2IU0A 1AR1B 3E8BA 1VQNV 2LFSA 5CBGA 1EBOA 4XDJA 1L1FA 4GX0A 1I5YA 1NH2B 1JCHA 2Y69C 4PDVA 4CBCA 4X88A 3ASNC 5LHGA 1SERA 5B1NA 1VQMV 3IC7A 4JTCB 1M57C 1VQ4V 2B1GA 2DYRB 4GX2A 1VQ9V 5L3FA 1F23A 2ZR2A 3SJQC 3K0GA 2QTOA 1OZ0A 1H8HG 3AG3C 3E8GA 1R6NA 2ZR3A 4WCEV 1QCEA 1G8MA 5DN6G 1QLEC 3E89A 3D3IA 3X2QB 1S3JA 2EZPA 2FTKA 3GWOA 1YIJV 1V54C 1NH2D 2JEXA 3LDCA 5C93A 3TETA 1THZA 1VQOV 1K5QA 2EIMC 5KA5A 4Z1MG 2A79B 3RVZA 3ABLC 2CK3G 4XBFA 4MT8A 2YEVA 2EINC 4FMTA 3EHBB 4TT3G 3SYPA 3ZMTA 2K1EA 3ABTA 3AEIA 3I56V 1MOFA 2BOCC 3M99B 2AHYA 2EZOA 5IYBO 5L3GA 3G6EV 2X7RB 1H38A 4MS2A 4MVSA 2EILC 3F7YC 3MHSC 4JASA 3CCJV 4I5SA 5FL7G 1FFTB 1QR9A 2GHYA 3ZMZA 4PDRA 1AJPA 5DM6V 4P30A 4BAYA 4MTFA 1NVPB 2OT5A 4MTGA 5IY5C 1K3EA 2DYSB 4UVCA 3P30A 3B8MA 2PI5A 4P2ZA 2HG5C 2P7TC 1JQ0A 3HB3B 3CCRV 2XAQA 2OCCC 1GM8A 1K4CC 4QPKA 2LFRA 5L3DA 4MW8A 3IGAC 4G27B 3FB5C 1PNLA 3DTUB 4PA6A 3SYAA 2NLJC 1NVPD 3LDDA 1QR8A 1RPOA 1GMGA 1Q81W 1R3JC 3KG2A 2LP7A 1QVGU 1QBZA 5CBHA 1ENVA 2EIKB 3F7VC 5B1BB 4LC1A 4R50A 3D36A 3UM7A 1JOYA 3CCLV 4ASUG 3SYQA 1XL4A 2QKSA 3LSSA 2AHZA 4CZZA 3OFNG 1NJIW 4JTAB 2JDIG 2X6CA 5LHIA 2Y48A 3ABKC 3OR6C 3W7WA 3OAAG 2IJHA 3CCEV 1NR7A 3ZJZA 3E35A 1DTOA 2WLHA 2NNUA 4OXSA 2BOBC 3G4SV 4MVUA 1VQ8V 3T4DA 4R8CA 3CCUV 2Z5UA 3OW2U 3W7SA 4LCUC 1I5XA 3H01A 1PKXA 2DQ3A 1UJWB 1RM1B 5L3BA 3ZRSA 1KC8W 3SPGA 3E8FA 3K0DA 5B1OA 2IJJA 4RQEA 1M1KW 1KD1W 1YHQV 1G4YB 3FB7C 2QM8A 5B1AB 4QIWF 1F51A 2WLJA 3K9AA 5KA6A 5LGTA 1JJ2U 2ZDIA 1DF4A 3AG1B 5H6RA 2IH3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q C;  1M57 C;  4GX2 A;  1OCZ C;  3IFX A;  2Q69 A;  3LDE A;  4X8A A;  3SJQ C;  3AG2 C;  3K0G A;  4PDM A;  2QTO A;  3SYO A;  3AG3 C;  3E8G A;  3STZ C;  1ORQ C;  3RVY A;  4RUE A;  5CBF A;  1ZWI C;  3F5W C;  4TWK A;  4BW5 A;  1QLE C;  3STL C;  4WFG A;  3E89 A;  2EIJ C;  2WLI B;  4P9P A;  4WFH A;  3SPI A;  4QNH B;  1V54 C;  2HVJ C;  3LDC A;  2ATK C;  4J9Y B;  5E1A C;  3TET A;  2EIM C;  2Q68 A;  2A79 B;  1KKD A;  4G28 B;  2Q6A A;  3ABL C;  2H8P C;  3RVZ A;  4KFM A;  4PA9 A;  1XL6 A;  3E86 A;  2WLN A;  2EIN C;  2KB1 A;  2YEV A;  5EK0 A;  2WLM A;  3SYP A;  2K1E A;  3HPL C;  4H33 A;  1JVM A;  3VOU A;  2BOC C;  4I9W A;  5KUM A;  4HYO A;  2AHY A;  3RBZ A;  2WLL B;  4RAI A;  2DYS C;  4MS2 A;  4MVS A;  2DWD C;  2EIL C;  4WFF A;  3F7Y C;  4X89 A;  2HJF C;  3SPC A;  2Q67 A;  4LBE C;  4XDL A;  4PDR A;  4MTO A;  4MVR A;  3JYC A;  2A0L A;  4P30 A;  4MTF A;  4XDK A;  4MTG A;  5IY5 C;  3RW0 A;  3K06 A;  4PA3 A;  5EC2 C;  3ABM C;  3LUT B;  4HZ3 A;  1K4D C;  4MVM A;  3R65 A;  4R6Z A;  4P2Z A;  3WG7 C;  2X6A A;  4MVO A;  2P7T C;  4EKW A;  2EIK C;  1OCO C;  2OCC C;  5B1B C;  5BZB A;  1K4C C;  4H37 A;  1P7B A;  3T2M A;  4MW8 A;  3IGA C;  4MW3 A;  3SYC A;  4G27 B;  3FB5 C;  2R9R B;  1R3I C;  2ITC C;  4JTD B;  2WLK A;  4PA6 A;  3SYA A;  3T1C A;  3UKM A;  2NLJ C;  5EBW C;  1OCR C;  3T4Z A;  3LDD A;  1LNQ A;  1R3J C;  3KG2 A;  5CBH A;  3F7V C;  1BL8 A;  4LP8 A;  4QE7 A;  2A9H A;  4JTC B;  2JK5 C;  4R50 A;  3UM7 A;  3SPJ A;  3ASO C;  1S5H C;  3K04 A;  4MVZ A;  1V55 C;  5EBM C;  3SYQ A;  3T4D A;  1XL4 A;  2QKS A;  2AHZ A;  4GX1 A;  3EFF K;  2HFE C;  2WLI A;  2DWE C;  4R7C A;  4F4L A;  4JTA B;  3BEH A;  3OGC C;  2X6C A;  3ABK C;  3OR6 C;  4GX5 A;  1R3L C;  2IH1 C;  3GB7 C;  4PDL A;  4QE9 A;  3ZJZ A;  5B3S C;  2WLH A;  4OXS A;  3SPH A;  4RO2 A;  2BOB C;  1M56 C;  3OUS A;  4MVU A;  4RUF A;  3TCU A;  1J95 A;  2ZD9 A;  4J9Z B;  3FB8 C;  2W0F C;  2ZXW C;  3LNM B;  3AG4 C;  4MVQ A;  1OCC C;  2HVK C;  4UUJ C;  4LCU C;  5KUK A;  2X6B A;  3K08 A;  3OR7 C;  4PA7 A;  4P9O A;  2WLL A;  4WFE A;  5B1A C;  3OUF A;  3K03 A;  5EC1 C;  5EBL C;  3FB6 C;  4MSW C;  3ZRS A;  3AG1 C;  3SPG A;  3E8F A;  3K0D A;  2DYR C;  4R8C A;  1R3K C;  3E8B A;  5CBG A;  4ZBM A;  4XDJ A;  2ITD C;  4GX0 A;  1G4Y B;  3E83 A;  3FB7 C;  4DXW A;  2WLJ A;  4PA4 A;  2Y69 C;  4PDV A;  4CBC A;  4X88 A;  3ASN C;  5J9P C;  2HG5 C;  3E8H A;  3PJS K;  2IH3 C; 
#chains in the Genus database with same CATH topology
 5GW7 A;  3AK1 A;  4CS3 A;  3Q4H B;  1M5I A;  5JQG B;  2P6J A;  4IHJ B;  4F6R B;  2Y69 B;  4B7E A;  3ML0 A;  2WLI B;  2PTM A;  3SPI A;  3H1J H;  3VQY A;  4DK1 A;  4UCU A;  3BA9 A;  1VF5 B;  1FFX B;  3T1H B;  1SQV H;  4DV0 O;  3E86 A;  3T2M A;  2OTL V;  1VMG A;  4H33 A;  4X66 O;  3D8C A;  4I9W A;  3H1H H;  2DMX A;  1XRE A;  4X62 O;  2EJ7 A;  3WFV A;  2AXT Z;  4RWU A;  4DV2 B;  3K3W A;  4AHC A;  4MTO A;  4JAV A;  3ZMU A;  4A5U B;  1RP3 B;  3ETG A;  4GT1 A;  4LFB O;  4TV9 B;  2CTP A;  4OGQ B;  4JAU A;  2R9R B;  2P5O A;  1K33 A;  3I5D A;  2V4D A;  1R6K A;  5FPR A;  1BL8 A;  3P32 A;  1B6Q A;  2DE0 X;  4YY3 B;  4GCZ A;  4GX1 A;  2OIG A;  1F4M A;  1QQC A;  3FFQ A;  5CMU A;  1M56 C;  1DLB A;  2IBZ H;  4RUF A;  2R9I A;  2ZD9 A;  4J9Z B;  1GN4 A;  4JI0 O;  4I55 A;  5FLX N;  4X65 B;  2UUB O;  1NZ6 A;  1QHT A;  1V9P A;  1AJQ A;  4WF9 V;  4I4T A;  4K0K B;  1K92 A;  4UXN A;  3FYE B;  5IJ0 A;  2EBO A;  2Q7E A;  5JVD A;  3B8N A;  4FK5 C;  2ZM6 O;  4Q20 A;  1Q7Y W;  1H2S B;  1AI6 A;  1EZV H;  2HHH B;  5FNV A;  4GZR B;  1Y6X A;  2QA4 V;  4JF3 A;  4TUY A;  1YF2 A;  4UVB A;  1X59 A;  4LF7 O;  2M7W A;  3LSQ A;  1MAB G;  2WLL B;  1WP8 A;  3ETD A;  3SPC A;  3RYH B;  3IC9 A;  4JI1 O;  2BTO A;  4TV8 B;  1Q86 W;  1B06 A;  4IIJ A;  4KP4 A;  2GUZ A;  4B08 A;  2RCV A;  2JJ2 G;  3ABM C;  3HR0 A;  3OM3 B;  5H5N A;  3GWK C;  4JYC A;  2HP8 A;  4D7S A;  2R70 A;  1L0N H;  4QGP A;  5IJ9 A;  3ABU A;  4PI2 A;  1B3Q A;  3SYC A;  2P22 C;  3CMA V;  3G6B A;  5CN0 A;  2ZE5 A;  1PP9 H;  1PD3 A;  1NTK H;  2N74 A;  3FD9 A;  1YXB A;  4WBN A;  1WA8 B;  1IDS A;  1Y66 A;  1YSC A;  2JS5 A;  4B3T O;  4B3S B;  1L8D A;  3ASO B;  3CP1 A;  1SZT A;  1I7F A;  1V55 B;  5LA6 B;  4DV7 B;  2JEU A;  1A32 A;  4DXW A;  2IM9 A;  3LNM B;  4UVA A;  2X6B A;  2UUC B;  3C90 A;  3N27 A;  3K03 A;  1K5S A;  1UPG A;  5JJE B;  4X1Y B;  4DR7 B;  2N04 A;  5CA3 A;  3UT5 B;  3KZI Z;  2JVD A;  4JYB A;  1IBL B;  5IWA B;  1OHH G;  5HFM A;  2HLD G;  3E8H A;  3X2Q C;  2Z3Y A;  3IFX A;  2Q69 A;  2R72 A;  3LDE A;  4LF5 B;  3J7A U;  3RVY A;  1YJN V;  4RUE A;  2ARH A;  1VF7 A;  1VQK V;  4WFG A;  1F4N A;  4GYC B;  1SET A;  2YXY A;  5LOV A;  1NTM H;  4J7Z A;  2W6J G;  1IUR A;  4I0X A;  1O9G A;  2Q8V A;  5L3E A;  3SDL A;  1YI2 V;  1HP8 A;  2UUA O;  5LP6 C;  5KX5 B;  3B2E E;  1Y74 B;  2X0L A;  1G1X B;  4O4L B;  3N2G A;  2JRI A;  1NS1 A;  2ODM A;  4X20 B;  2F43 G;  4IYH A;  2HHH O;  1XNR O;  2ZCE A;  3O9O A;  2YI8 A;  5CA0 B;  1S72 V;  3VQV A;  2W6I G;  3T4Z A;  4CH4 A;  1UFI A;  1K73 W;  1TUB A;  3BAB A;  1HR0 B;  1OCR B;  4R7C A;  1P4R A;  5IYZ A;  2Q73 A;  5LGN A;  4QE9 A;  4OX9 O;  4TOI A;  2QM7 A;  4CH6 A;  2JGD A;  1SQB H;  2W0F C;  4JV5 O;  4IGG A;  2CAZ C;  4ZI7 B;  1GTO A;  1W0J G;  4WFE A;  3OUF A;  5EC1 C;  1JX9 A;  3K59 A;  3E8B A;  1VQN V;  1WN7 A;  4EB6 B;  1BQZ A;  2L35 A;  4DV6 O;  5EIB D;  1KKC A;  2YUA A;  1SER A;  2ZE6 A;  5GON A;  4NR1 A;  4JTC B;  1M57 C;  5L3F A;  4DR3 B;  3SJQ C;  3K0G A;  4NKG B;  1VEW A;  3L73 H;  3TJT A;  4EFE A;  2ZR3 A;  5ITZ A;  1X4T A;  1VAR A;  5DN6 G;  4JI4 B;  2FTK A;  3GWO A;  1NH2 D;  1NTZ H;  1THZ A;  4J11 A;  3ABL C;  2CK3 G;  4MT8 A;  4DV7 O;  3JAM N;  3EHB B;  3AEI A;  3JAK B;  2AHY A;  5IYB O;  3G6E V;  4MVS A;  4HBN A;  4LFA O;  4I5S A;  5FL7 G;  1PL4 A;  3CWB H;  3Q4H A;  1WPB A;  5JQG A;  2UXD B;  5B66 Z;  5IWA O;  2DYS B;  1Z2G A;  4P2Z A;  4DUZ B;  3B40 A;  3CCR V;  2XAQ A;  4LF5 O;  1GM8 A;  1K4C C;  5E79 Z;  4LF8 B;  4MW8 A;  1CXZ B;  2ZIM A;  1LUW A;  2UU9 B;  3SYA A;  2NLJ C;  1NVP D;  5LYJ B;  4J7K A;  1R3J C;  1P49 A;  4U3J B;  4DV4 B;  1QBZ A;  3A0B Z;  4UB8 Z;  3LNN A;  3UM7 A;  3M8A A;  1XL4 A;  4DUY O;  1NJI W;  3THO A;  2X6C A;  3CCE V;  3ZJZ A;  2WLH A;  4OXS A;  4ZHQ A;  1URF A;  4TV9 A;  3CCU V;  2QWR B;  3TXQ A;  2CTW A;  2Z5U A;  3OW2 U;  1I5X A;  3OTO B;  4NXM B;  2AZ0 A;  2DQ3 A;  1UJW B;  4JZG A;  4EEQ A;  1FKA O;  1KC8 W;  3IAY A;  4K3A A;  1XUQ A;  4CH3 A;  4TQF A;  2ZNI A;  5B1A B;  1W59 A;  2PF4 E;  1N32 B;  4QIW F;  5LGT A;  3K9A A;  5KA6 A;  4LWS A;  4DR1 O;  3AG1 B;  5EZY A;  3E22 B;  1VIB A;  5LGU A;  4UCR A;  1HR0 O;  4NYK A;  4X66 B;  3F5W C;  4BIU A;  4X62 B;  2OTJ V;  4O4I B;  4QNH B;  2A06 H;  2ATK C;  2P4K A;  1XMQ B;  2QDO A;  3AG3 B;  1SES A;  2Q6A A;  1XL6 A;  1KP3 A;  2WLM A;  1QLE B;  1P7G A;  2Q7H A;  2QR4 A;  1PNK A;  1V54 B;  3W7T A;  2EX3 A;  4DO2 A;  2Y0P A;  1U97 A;  1GN2 A;  2KSD A;  1E79 G;  3MDS A;  3G80 A;  4WFA V;  2EIN B;  3JAT B;  4NVP A;  3RYF B;  1KBH A;  2H94 A;  3JYC A;  2A0L A;  2GBO A;  2PZS A;  3JD1 A;  1AP6 A;  2Y4U A;  2YIC A;  5IY5 B;  4BW9 A;  4YXW G;  1ZUQ A;  3QO5 A;  2CH7 A;  4YIO A;  4QE7 A;  4FLT A;  2OCC B;  1WJZ A;  2UXN A;  1KU9 A;  4U7N A;  1N33 O;  3RYH A;  2WPD G;  4IL6 Z;  4TV8 A;  2VRZ A;  1FXK A;  3CE2 A;  4BWA A;  2UUB B;  3FYI B;  2JJ1 G;  4LF9 O;  5B3S C;  1IBK O;  4LH7 A;  4UV8 A;  4RO2 A;  1IX9 A;  1R73 A;  2BTQ A;  4ZOL A;  3TCU A;  3OMN B;  2ZXW C;  3QO8 A;  3AG4 C;  3AG7 A;  4K8X A;  3ZMV A;  2AZ2 A;  1E1R G;  4ZIB A;  2JIZ G;  1E1Q G;  1PM9 A;  3CS5 A;  2ZIO A;  1BHB A;  4O2B A;  1O9H A;  2YSU B;  4J10 A;  1VQL V;  4FFK A;  3TK1 A;  3K5N A;  4LF7 B;  1S77 D;  2BSK B;  1Y76 A;  3RYI B;  4TSF G;  1SRY A;  3AG2 C;  3DC5 A;  3JAW A;  1WB8 A;  3L71 H;  2E76 B;  1ORQ C;  2F1M A;  3STZ C;  5IYD O;  1YEW A;  3HKB A;  3DSQ A;  3STL C;  1DF5 A;  1Z5W A;  2EIJ C;  4WFH A;  3QNE A;  3I55 V;  2OYQ A;  3EVK A;  5KAF Z;  2HVJ C;  2CDY A;  3QG5 A;  1S76 D;  5E1A C;  4JI1 B;  1N36 O;  1FD9 A;  1CEZ A;  4G28 B;  2LW1 A;  5LXT A;  5L3C A;  4NTX A;  3ZHT A;  2PY5 A;  4X1I B;  3UCS C;  5GTH Z;  4DW1 A;  3CD6 V;  2JS3 A;  2KG7 B;  5J2T A;  2XND G;  1IXB A;  1GKF A;  4XDK A;  3HKD B;  1JFF A;  4DK0 A;  1N32 O;  2C2A A;  4KL1 A;  4O4H B;  5DED A;  4LFC O;  1EN6 A;  4EKW A;  3ZRX A;  1P7B A;  4NXM O;  1NBM G;  1RSO B;  2WLK A;  4U7O A;  3B4S A;  1NQT A;  1YTF B;  4B3T B;  3K5L A;  1XMQ O;  1M4U A;  4QJF B;  1S5H C;  2BCC H;  1N0J A;  2UXB B;  2DWE C;  1J5E B;  3RYC B;  4C7U A;  3JAL A;  2WSS G;  5D5Q A;  3OUS A;  4O2A B;  2XUM A;  5KAI Z;  4MVQ A;  4TQD A;  1TUE B;  3L70 H;  4UUJ C;  1EZJ A;  3UO2 A;  3J80 N;  2KQX A;  4HAM A;  1BMF G;  1TGO A;  1M56 B;  1VP7 A;  4ZBM A;  3OT7 A;  3ZRW B;  3CXH F;  3BFR A;  2VQF O;  5H6Q A;  3A8T A;  3BHP A;  4PDM A;  3R66 A;  4OPH A;  2XAH A;  4I50 A;  2UUA B;  1Q6H A;  5HFL A;  3JCZ A;  4K8Z A;  5JJN B;  4DR4 B;  3P3N A;  4J80 A;  4I9Q A;  2PUS A;  3FAV B;  1TAE A;  4KFM A;  4PA9 A;  4Z2W A;  2KB1 A;  1GN3 A;  3ZHV A;  5BMV B;  5TIS Z;  2Q0O C;  1VF6 A;  4N23 A;  3ZHU A;  4DR5 O;  3OGI B;  2XOK G;  4DV3 B;  1XNR B;  3JD0 A;  2DQ0 A;  4AIL C;  2VWK A;  3RW0 A;  3K06 A;  1COW G;  4MVM A;  1K4D C;  3OE7 G;  1NT2 B;  3JAR B;  3JSN A;  1KEC A;  1F7Y A;  1TA8 A;  5BR8 B;  4H37 A;  4DRX A;  4BR6 A;  4B3R O;  4Q6G A;  3VQW A;  3L75 H;  2RN9 A;  1NI8 A;  5BY1 A;  2CGO A;  3ABM B;  3K5O A;  3T1C A;  1H2M A;  1GO3 F;  4UCV A;  5C8Y A;  4FM2 A;  4OX9 B;  3UO3 A;  2DOS A;  2A9H A;  5K1P A;  2XAJ A;  3G71 V;  3SPJ A;  3K04 A;  2ZNJ A;  3K9S A;  4JV5 B;  3L74 H;  2YEV B;  1FXV A;  1KMI Z;  3CRM A;  5GTI Z;  2HR3 A;  2YDE A;  1R3L C;  3K79 A;  4J42 A;  3ZN1 A;  2CE4 A;  1FJG B;  1FPO A;  4DV6 B;  1M90 W;  2HVK C;  1ZL8 B;  3K5M A;  2GSM B;  5LMU O;  1NU1 H;  1AR1 B;  5KMG B;  4AI8 A;  5EIB C;  4GX0 A;  4FLX A;  1FYJ A;  4E4E A;  1NH2 B;  3HKE B;  3UQ8 A;  4CBC A;  3ASN C;  5B1N A;  1VQM V;  3NR7 A;  3CJH A;  2QTO A;  1OZ0 A;  3E8G A;  3U10 A;  1QCE A;  1G8M A;  2UXB O;  1J5E O;  3D3I A;  2A3Q A;  2GDS A;  3X2Q B;  2EZP A;  1WB7 A;  4LFA B;  2JEX A;  4JI3 B;  2ZT9 B;  1VQO V;  2EIM C;  3HKC A;  1SF9 A;  3BVO A;  3ZBH A;  2E75 B;  1SS3 A;  2K1E A;  3S3W A;  3B09 A;  2X7R B;  4MS2 A;  2EIL C;  3MHS C;  4JAS A;  1XEQ A;  3CCJ V;  4U3F H;  2ZE7 A;  1QR9 A;  1QNM A;  5DEC A;  4PDR A;  1AJP A;  4P30 A;  4X64 B;  2D2C B;  1NVP B;  3ZHR A;  3TGU H;  3P30 A;  3B8M A;  5LP6 B;  4YJ2 A;  3QTC A;  2QGN A;  1BGY H;  2ADP A;  3D3Q A;  1ZTE A;  4G27 B;  3FB5 C;  1MZF A;  1PNL A;  4DUY B;  3JAS A;  4FM1 A;  1IZ3 A;  1Q8I A;  1RPO A;  2RMK B;  4CS4 A;  1ENV A;  4DR4 O;  4LC1 A;  4R50 A;  2QTS A;  4ASU G;  3APQ A;  2QKS A;  2AHZ A;  2Q4P A;  1G6U A;  3ZS8 C;  5IT9 N;  3ABK C;  3W7W A;  2IJH A;  4YIP A;  4JI5 B;  3E35 A;  4DV3 O;  1DTO A;  2NNU A;  1HNX B;  2BOB C;  4MVU A;  3T4D A;  4K35 A;  3W7S A;  4LCU C;  4DR1 B;  3H01 A;  1B04 A;  5JH7 A;  3ZRS A;  5J2U B;  2HJD A;  5BR8 O;  1AR5 A;  4RQE A;  2XTA A;  1M1K W;  2FL4 A;  3FB7 C;  2QM8 A;  1Q6U A;  2CTQ A;  4FZ0 A;  1OCZ C;  1SA0 A;  4LF4 B;  2N05 A;  3E2E A;  3ZIA G;  3MAQ A;  1JMK C;  5CA1 A;  1EFR G;  1M57 B;  2V1D A;  1Q5O A;  2QSA A;  3M7M X;  3CC7 V;  2DW4 A;  4KHP O;  2MK3 A;  1IBM B;  1AB3 A;  1YCI A;  1BQ0 A;  1R6T A;  1FJG O;  2QE7 G;  3CRC A;  2EUL A;  4ZKI A;  1ZAU A;  4I55 B;  4X89 A;  2HJF C;  3ABL B;  4CS2 A;  1K9M W;  2P67 A;  4CC6 A;  2VWJ A;  4I4T B;  4FM0 A;  4X1K A;  3JSL A;  5IJ0 B;  5EC2 C;  5JVD B;  1N33 B;  4UCO A;  4R6Z A;  4LNU A;  3ETQ A;  1WP7 A;  3U11 A;  1R3I C;  4JTD B;  2YIA A;  4FVM A;  5FNV B;  5EBW C;  4WFB V;  4FLU A;  4LF9 B;  4JYY A;  5F2V O;  4JI3 O;  4TUY B;  1IBK B;  1VF6 C;  4G2K A;  4PHZ A;  2YID A;  3NXS A;  2ILM A;  4IHJ A;  4F6R A;  3CSX A;  2YIB A;  2WLI A;  4F4L A;  3OGC C;  1L0L H;  2IJI A;  1BCC H;  2R9A A;  1W2B U;  2ZKO A;  1FFX A;  1IVS A;  3B77 A;  2WWW A;  5JJJ B;  4DV5 B;  4W4L A;  4X64 O;  3FB8 C;  4IIJ B;  1OCC C;  1RSO A;  2Q5Z A;  4DV1 B;  1HDJ A;  1YJW V;  2LO1 A;  3FB6 C;  5A2Q N;  5D5P A;  2H3O A;  4RQF A;  3O65 A;  5IJ9 B;  3CCS V;  4B3M O;  4PA4 A;  1N36 B;  1I08 A;  3RT3 C;  4YHH B;  1LUV A;  2OIE A;  5KHG A;  1EM1 A;  3SR2 C;  4WBN B;  1AI5 A;  4JI5 O;  2Q68 A;  3CCV V;  1HNX O;  3H1L H;  2E74 B;  2WLN A;  5EK0 A;  3ZHQ A;  4OPA A;  2BE3 A;  3ZCC A;  2F4V O;  4FJC C;  1H2K A;  5KLV H;  5KUM A;  4LF6 B;  4LFC B;  3H1K H;  1W0K G;  2DWD C;  1GAX A;  3ZHS A;  1AJN A;  3KKY A;  3K57 A;  1BT8 A;  2YC0 A;  4JZ2 A;  5EYP B;  2GTA A;  2B9Z A;  1VQP V;  4MVO A;  3DGE A;  5AG2 A;  1OCO C;  4L8J A;  5H2F Z;  4LF4 O;  3FAV A;  1I94 B;  1AI7 A;  5JCO A;  2Y0I A;  5BMV A;  2YXL A;  3WG7 C;  3JD2 A;  5LBQ A;  1XBL A;  1HNW O;  4LP8 A;  2JK5 C;  5LOV B;  1IBM O;  3OMA B;  4LR3 A;  1H2G A;  4I0X B;  1SC5 B;  1R1B A;  4CH5 A;  4EFB A;  1SKV A;  1XHX A;  3KCY A;  2B5U A;  2B1I A;  1Y4M A;  4DR6 O;  1AIL A;  5JWP A;  1HW7 A;  3OD4 A;  2QKA A;  3BA8 A;  3N2G B;  2WAM A;  2WLL A;  5B3S B;  2VQF B;  4UB6 Z;  2IJK A;  2E3C A;  4PD4 F;  1JA8 A;  1ZX3 A;  2DYR C;  1JPX A;  3K58 A;  2GV9 A;  2ZXW B;  3AG4 B;  1N8R W;  1S0V A;  1NKD A;  1K34 A;  3E83 A;  2UXC O;  3SPH A;  3CRQ A;  1ARO P;  3W7X A;  1TUB B;  5CBF A;  2FKX A;  4TWK A;  4JYA O;  1DGS A;  2PI4 A;  4DR5 B;  5IYZ B;  1H8E G;  1JR9 A;  4J9Y B;  3AG2 B;  3FX7 A;  2QEX V;  1GK9 A;  2H8P C;  1IXM A;  4DV5 O;  1MMM A;  4JI6 O;  3HPL C;  1WA8 A;  3CME V;  4JGS A;  4FLY A;  2EIJ B;  4LH6 A;  2AGA A;  1JVM A;  4DV1 O;  3CCQ V;  3OEH G;  4DYL A;  3LSU A;  4B3R B;  2Q67 A;  1VQ5 V;  4LBE C;  5CB4 B;  5LA6 A;  4L87 A;  2P90 A;  4MVR A;  2F66 C;  1AI4 A;  2CGN A;  2F95 B;  4UCT A;  1Q90 D;  2UXX A;  4YHH O;  1BZK A;  4X1Y A;  1VQ6 V;  2EIK C;  5B1B C;  1TVK B;  2V7Q G;  3UT5 A;  3RWR D;  4GKK O;  4MW3 A;  3OMI B;  5ITZ B;  2ITC C;  1KQS U;  3A0H Z;  2E5L O;  2HEP A;  4JI8 O;  1EN4 A;  4DW0 A;  4F6E A;  3DXR B;  3BEH A;  4LF6 O;  3C3T A;  5LMU B;  4E2L A;  1XHZ A;  2WA4 A;  1AVM A;  1RM1 C;  1M93 A;  3RGB A;  1Q3E A;  3APO A;  4PA7 A;  1YJ9 V;  5KX5 A;  4ICG A;  2IU0 A;  1Y74 A;  4AQY B;  1I94 O;  1EBO A;  4O4L A;  1L1F A;  1I5Y A;  1JCH A;  2Y69 C;  2QKC A;  4PDV A;  4X88 A;  5KHK A;  3IC7 A;  1VQ9 V;  4GX2 A;  3RN4 A;  1MA1 A;  4X20 A;  2CUG A;  2QWO B;  1R6N A;  5CA0 A;  3TXS A;  5K1X A;  1S3J A;  2M6Y A;  2ZE8 A;  3LDC A;  5C93 A;  1K5Q A;  3C3S A;  5J2U A;  3ZMT A;  3I56 V;  4ZHQ B;  3ABT A;  5KHJ A;  5IE9 A;  1SQX H;  2BOC C;  4IT5 A;  2EZO A;  1H38 A;  3PN1 A;  1FFT B;  1HNZ O;  3ZMZ A;  5DM6 V;  4BAY A;  4ZI7 A;  1US6 A;  4MTG A;  1XMO B;  4D6T H;  4UVC A;  2PI5 A;  2PGG A;  4LWS B;  1MNG A;  5EZY B;  2P7T C;  1JQ0 A;  3HB3 B;  2LFR A;  4EB6 A;  3IGA C;  1GH6 A;  4BIO A;  4PA6 A;  3LDD A;  1QR8 A;  1YVW A;  3KG2 A;  2LP7 A;  1QVG U;  3S3X A;  2ETN A;  5FPO A;  1D5A A;  1BSM A;  1N34 O;  3D36 A;  4YJ3 B;  2Y4T A;  1SQF A;  3VQX A;  3OFN G;  2JDI G;  2Y48 A;  4IYI A;  3OAA G;  4H0L B;  4FLZ A;  1VQ8 V;  2FYU H;  2RDC A;  3JAK A;  5JCO C;  4PJ0 Z;  4DR2 B;  3F5T A;  2JGU A;  3E8F A;  3K0D A;  1WAZ A;  5B1O A;  2Q0A A;  3BCC H;  4FLW A;  4GKJ B;  2IJJ A;  4H13 B;  2YS8 A;  1YHQ V;  1G4Y B;  1F51 A;  2WLJ A;  1JJ2 U;  3EXA A;  1Q43 A;  2ZDI A;  5A9G A;  1DF4 A;  5KUK A;  1T5E A;  4KHP B;  2CH7 B;  1EN5 A;  3QVN A;  4HNA B;  3SYO A;  3WU2 Z;  1WPX A;  4GLX A;  5BXZ A;  4JI7 O;  1S5J A;  1FXK B;  2FB5 A;  4FFB B;  3ASN B;  1NR1 A;  1SQQ H;  5LYJ A;  4JI2 O;  4U3J A;  4MTX A;  1GM9 A;  1WLE A;  4FIP C;  3CPW U;  4JAA A;  4X9Q A;  2BTQ B;  4ZOL B;  2OCH A;  1FXK C;  1K7D A;  3L72 H;  1SQG A;  4HYO A;  3RBZ A;  1VQ7 V;  3ZMS A;  2YIB D;  2YXH A;  2EIM B;  3W7U A;  2XAF A;  1RFY A;  3T1H O;  4AQY O;  1GRJ A;  2IU3 A;  4O2B B;  3QF7 A;  1KP2 A;  2LGW A;  2QWQ B;  4PA3 A;  2EIL B;  4HZ3 A;  1MZE A;  1YIT V;  4PV1 B;  1Y76 B;  1YTF D;  2RJZ A;  5BZB A;  4DV2 O;  1DK1 A;  2QWP B;  2P06 A;  1Q82 W;  3JAW B;  1LR1 A;  1U96 A;  4CC5 A;  1K8A W;  3SGI A;  4GUN A;  4O4J B;  4NB5 A;  3HKB B;  2OWO A;  3E22 A;  1LNQ A;  2KKW A;  2DJV A;  3QO7 A;  3ASO C;  4MVZ A;  1V55 C;  5LXT B;  4I7Z B;  2HFE C;  1CPY A;  3BY6 A;  4O4I A;  1CP9 A;  3N2K B;  5EYP A;  4GX5 A;  2IH1 C;  5LL6 Y;  1Z5V A;  3A2F A;  5J2T B;  1PNM A;  2G38 A;  3CHX A;  2XT9 A;  3WB0 A;  2CTR A;  4B3M B;  4YY3 O;  1JFF B;  1XMO O;  1QVF U;  3ABK B;  3JD3 A;  1D5N A;  5EBL C;  4MSW C;  3JAT A;  1Y67 A;  1R3K C;  3RYF A;  2RQ6 A;  1SZX A;  2ITD C;  1H2L A;  1OJH A;  1ZLZ A;  5J9P C;  4FPP A;  4X65 O;  3MD0 A;  4X8A A;  1MSW D;  2F4V B;  4K0K O;  1ZWI C;  4BW5 A;  4P9P A;  1JJO A;  1OCZ B;  4FZ1 A;  1ROP A;  3JAL B;  1KKD A;  2HKO A;  4UV9 A;  4DR2 O;  1D2D A;  4RAI A;  4WFF A;  4NTW A;  2YI9 A;  4XDL A;  4GKJ O;  3AK2 A;  4FLV A;  1RPR A;  3MHH C;  5KHH A;  1HNW B;  3CRR A;  2ADQ B;  1XQ8 A;  2ZQM A;  2W0X A;  2X6A A;  2O57 A;  4PEL A;  2IH3 C;  5IYC O;  1BE3 H;  3FKS G;  2PYJ A;  3UKM A;  2LQT A;  3ETE A;  1OCR C;  2BSK A;  3RYI A;  1K97 A;  4I50 B;  4NXN B;  4DR6 B;  5B5E Z;  1N4C A;  1MG1 A;  5CB4 A;  4KUM A;  1QLN A;  3CYO A;  1GN6 A;  3L9D A;  4J7J A;  5LHH A;  2LJ2 A;  1KB9 F;  1TVK A;  3ZN0 A;  1J95 A;  3SJB C;  4B7K A;  2UXC B;  3JD4 A;  1YDX A;  3DC6 A;  4X1I A;  5IDJ A;  2K9P A;  2KG7 A;  2VQE B;  1GM7 A;  4B3S O;  3SJA C;  3WB2 A;  1OCC B;  4DRX B;  3D36 C;  4JYA B;  1SQP H;  3HKD A;  3CRA A;  3ZRV A;  1XNQ B;  4JPR A;  3U0Z A;  2XAG A;  3DXR A;  3OTF A;  4O4H A;  3CCM V;  3A0R A;  3PJS K;  3R65 A;  3OEE G;  5C8Y B;  2UUC O;  1XIL A;  4JI6 B;  2GUZ B;  1FS0 G;  4BIZ A;  3CXC U;  4DR7 O;  1WNS A;  3VBB A;  4N21 A;  2Q7G A;  5H9C A;  2XAS A;  1N0N A;  1IBL O;  4D7T A;  5LMN B;  1XDC A;  3WB1 A;  2EJR A;  3CC4 V;  3VOU A;  3RYC A;  2DYS C;  2ZDI C;  4GKK B;  2AW9 A;  4O2A A;  1HWY A;  3T1Y B;  1PL0 A;  1PV0 A;  3ICX A;  3LUT B;  2E5L B;  2IW5 A;  1YZB A;  1I0H A;  2Q9L A;  2D3O W;  4JI8 B;  3BPZ A;  3CJH B;  3ZRW A;  2LGQ A;  4QPJ A;  3CB2 A;  1PPJ H;  1OCO B;  3CC2 V;  3HKC B;  1S5L Z;  2WA3 A;  5EBM C;  3WG7 B;  3EFF K;  1BHA A;  3GB7 C;  4PDL A;  4DV0 B;  2QM4 A;  4J41 A;  1M9N A;  3K08 A;  4P9O A;  3OR7 C;  1FXH A;  5B1A C;  1Q6I A;  4YJ2 B;  2NR5 A;  3AG1 C;  3H9V A;  2DN9 A;  3BAA A;  2LFS A;  4YJ3 A;  5CBG A;  1AP5 A;  4ABM A;  4XDJ A;  5KHI A;  3G67 A;  2FML A;  3JAS B;  1KYO F;  3BRC A;  5LHG A;  1MSD A;  3JAR A;  3J81 N;  2GTS A;  2A7W A;  4NXN O;  1VQ4 V;  2B1G A;  1AR4 A;  2DYR B;  4UFZ A;  4Z1V A;  2LW7 A;  1F23 A;  2XHB A;  2ZR2 A;  4LFB B;  1H8H G;  3AG3 C;  4W4K A;  4WCE V;  3SJC C;  1QLE C;  3E89 A;  1YIJ V;  1V54 C;  3TET A;  5KA5 A;  1HNZ B;  2P4V A;  4Z1M G;  2A79 B;  3RVZ A;  4XBF A;  4DR3 O;  2YEV A;  2EIN C;  4FMT A;  3SYP A;  4TT3 G;  4PI0 A;  1MOF A;  2L6L A;  3M99 B;  1KUQ A;  5L3G A;  4JI4 O;  2Z0A A;  3F7Y C;  2VQE O;  5JH7 B;  2ZIN A;  4HNA A;  2GHY A;  2F23 A;  1ZL8 A;  4MTF A;  1XNQ O;  4UCS A;  2OT5 A;  4FFB A;  5IY5 C;  4JI0 B;  1K3E A;  1N34 B;  1OV9 A;  2VS0 A;  1SA0 B;  3IJ4 A;  5KMG A;  2OCC C;  3P3P A;  5L3D A;  4QPK A;  3H1I H;  2JGD B;  1XI1 A;  3HKE A;  3DTU B;  2ZM6 B;  2UXD O;  1Q81 W;  1GMG A;  5CA1 B;  5CBH A;  2EIK B;  3F7V C;  3RFR A;  5B1B B;  5LMN O;  1JOY A;  4DUZ O;  3CCL V;  1P84 F;  3GVM A;  1FAF A;  2RNB A;  3SYQ A;  4LF8 O;  3LSS A;  4KXR A;  4CZZ A;  1BS3 A;  2QWN B;  4NTY A;  4JTA B;  2UU9 O;  5GON B;  5LHI A;  3OR6 C;  1NR7 A;  4DV4 O;  3AK3 A;  3ZX6 A;  3G4S V;  3CEI A;  1QU7 A;  4R8C A;  2MW2 B;  2QJ1 A;  3T1Y O;  1ZSP A;  4X1K B;  4O4J A;  1XOU A;  1H2N A;  1PKX A;  2NN4 A;  2F93 B;  1RM1 B;  5L3B A;  4H44 B;  3SPG A;  3CX5 F;  4LNU B;  4JI7 B;  3JCU Z;  1KD1 W;  3ZED A;  2PYL A;  3KCX A;  4JI2 B;  5LP6 A;  3N2K A;  3OTO O;  2HG5 C;  5H6R A; 
#chains in the Genus database with same CATH homology
 5GW7 A;  1OCZ C;  5LGU A;  3SYO A;  1WPX A;  3E2E A;  2P6J A;  3ZIA G;  3F5W C;  1FXK B;  4BIU A;  2Y69 B;  3ASN B;  3ML0 A;  1NR1 A;  2WLI B;  2OTJ V;  3SPI A;  1EFR G;  1M57 B;  4QNH B;  2V1D A;  4MTX A;  3CC7 V;  2ATK C;  2DW4 A;  1GM9 A;  2MK3 A;  3AG3 B;  1WLE A;  1SES A;  2Q6A A;  4FIP C;  3CPW U;  1XL6 A;  3E86 A;  3T2M A;  1KP3 A;  2OTL V;  2WLM A;  1QLE B;  2QE7 G;  4H33 A;  1FXK C;  1K7D A;  4I9W A;  1PNK A;  1V54 B;  4HYO A;  3RBZ A;  4ZKI A;  1VQ7 V;  3W7T A;  3ZMS A;  3W7U A;  2EIM B;  2XAF A;  4DO2 A;  4X89 A;  2HJF C;  3ABL B;  3WFV A;  1K9M W;  1E79 G;  2P67 A;  4WFA V;  2EIN B;  3K3W A;  4MTO A;  2H94 A;  4JAV A;  3ZMU A;  2IU3 A;  2A0L A;  3JYC A;  1KP2 A;  3ETG A;  4PA3 A;  3JD1 A;  4GT1 A;  5EC2 C;  2EIL B;  4HZ3 A;  4R6Z A;  1YIT V;  1YTF D;  5BZB A;  1Q82 W;  5IY5 B;  4JAU A;  1K8A W;  2R9R B;  4YXW G;  1R3I C;  4JTD B;  3QO5 A;  5EBW C;  4WFB V;  1K33 A;  1LNQ A;  1R6K A;  4QE7 A;  1BL8 A;  2OCC B;  2UXN A;  3P32 A;  4U7N A;  3QO7 A;  2WPD G;  1B6Q A;  3ASO C;  4G2K A;  4MVZ A;  1V55 C;  3NXS A;  4GCZ A;  1FXK A;  4GX1 A;  2HFE C;  1CPY A;  2WLI A;  3BY6 A;  4F4L A;  1F4M A;  1CP9 A;  3FYI B;  3OGC C;  2IJI A;  1W2B U;  2JJ1 G;  4GX5 A;  5B3S C;  2IH1 C;  3B77 A;  4UV8 A;  2WWW A;  1PNM A;  4RO2 A;  5CMU A;  1M56 C;  1DLB A;  1R73 A;  4RUF A;  3TCU A;  2R9I A;  2ZD9 A;  4J9Z B;  3FB8 C;  3OMN B;  2ZXW C;  3QO8 A;  3AG4 C;  1OCC C;  5KUK A;  1QVF U;  3ABK B;  3JD3 A;  1YJW V;  3ZMV A;  5EBL C;  1E1R G;  3FB6 C;  2JIZ G;  4MSW C;  1E1Q G;  1AJQ A;  4WF9 V;  1R3K C;  4RQF A;  1BHB A;  1K92 A;  2YSU B;  4UXN A;  1VQL V;  3CCS V;  2ITD C;  3FYE B;  2EBO A;  4PA4 A;  3B8N A;  4FK5 C;  3TK1 A;  5J9P C;  4FPP A;  4Q20 A;  1S77 D;  1Q7Y W;  1AI6 A;  4TSF G;  3MD0 A;  1SRY A;  4X8A A;  3AG2 C;  1MSW D;  3STZ C;  1ORQ C;  5IYD O;  1ZWI C;  4BW5 A;  3STL C;  1AI5 A;  1DF5 A;  2EIJ C;  4P9P A;  2QA4 V;  4WFH A;  4JF3 A;  3QNE A;  3I55 V;  1OCZ B;  4UVB A;  2HVJ C;  1S76 D;  5E1A C;  1ROP A;  2Q68 A;  1CEZ A;  1KKD A;  4G28 B;  2M7W A;  3CCV V;  2HKO A;  4UV9 A;  2WLN A;  5EK0 A;  5L3C A;  3LSQ A;  3ZCC A;  4FJC C;  5KUM A;  1MAB G;  2WLL B;  1W0K G;  4RAI A;  4WFF A;  2DWD C;  3ETD A;  3SPC A;  3CD6 V;  1AJN A;  4XDL A;  2XND G;  1Q86 W;  4KP4 A;  1GKF A;  1RPR A;  4XDK A;  3MHH C;  2JJ2 G;  2C2A A;  3ABM C;  3OM3 B;  2ZQM A;  4JYC A;  2X6A A;  1VQP V;  4MVO A;  3DGE A;  4EKW A;  1OCO C;  3ZRX A;  3ABU A;  1P7B A;  4PEL A;  3SYC A;  1AI7 A;  5IYC O;  1NBM G;  3FKS G;  3WG7 C;  2WLK A;  3JD2 A;  4U7O A;  3UKM A;  5LBQ A;  3ETE A;  1NQT A;  1OCR C;  3CMA V;  1YTF B;  1K97 A;  5CN0 A;  4LP8 A;  2JK5 C;  1PD3 A;  3OMA B;  1MG1 A;  1S5H C;  4QJF B;  4KUM A;  1QLN A;  3CYO A;  1H2G A;  1Y66 A;  1YSC A;  2DWE C;  5LHH A;  3ASO B;  3CP1 A;  1SZT A;  2B5U A;  1V55 B;  2B1I A;  1Y4M A;  2WSS G;  3OUS A;  3ZN0 A;  2JEU A;  1J95 A;  4DXW A;  3LNM B;  4MVQ A;  1TUE B;  4UUJ C;  1EZJ A;  4UVA A;  2X6B A;  3JD4 A;  2WAM A;  2WLL A;  5B3S B;  4HAM A;  1BMF G;  3K03 A;  1K5S A;  5IDJ A;  2IJK A;  1M56 B;  1GM7 A;  2DYR C;  1JPX A;  2ZXW B;  3AG4 B;  4ZBM A;  1OCC B;  1N8R W;  5CA3 A;  1S0V A;  3ZRW B;  3ZRV A;  1NKD A;  1K34 A;  4JYB A;  3E83 A;  4JPR A;  2XAG A;  1OHH G;  5HFM A;  3CCM V;  2HLD G;  3SPH A;  3E8H A;  3A0R A;  3PJS K;  3R65 A;  3OEE G;  3X2Q C;  2Z3Y A;  3IFX A;  2Q69 A;  3LDE A;  5H6Q A;  4PDM A;  1ARO P;  3W7X A;  3RVY A;  1YJN V;  4RUE A;  1FS0 G;  4BIZ A;  5CBF A;  3CXC U;  2XAH A;  4TWK A;  3VBB A;  4N21 A;  1VQK V;  4WFG A;  5H9C A;  2PI4 A;  1F4N A;  1H8E G;  2XAS A;  5HFL A;  1SET A;  3JCZ A;  4J9Y B;  3AG2 B;  2W6J G;  2QEX V;  1GK9 A;  2H8P C;  1IXM A;  4KFM A;  4PA9 A;  2KB1 A;  2EJR A;  3HPL C;  3CME V;  4JGS A;  2EIJ B;  3CC4 V;  5L3E A;  1JVM A;  3VOU A;  1YI2 V;  3CCQ V;  3OEH G;  4N23 A;  2DYS C;  2ZDI C;  2XOK G;  2Q67 A;  1VQ5 V;  4LBE C;  2X0L A;  3JD0 A;  4L87 A;  1HWY A;  2DQ0 A;  2P90 A;  4MVR A;  1PL0 A;  1AI4 A;  3RW0 A;  3K06 A;  1COW G;  3LUT B;  4MVM A;  1K4D C;  3OE7 G;  1KEC A;  2UXX A;  2IW5 A;  1VQ6 V;  2EIK C;  2D3O W;  5B1B C;  2F43 G;  4H37 A;  2V7Q G;  3ZRW A;  4MW3 A;  4QPJ A;  3OMI B;  1S72 V;  3ABM B;  2ITC C;  1KQS U;  3T1C A;  2W6I G;  3T4Z A;  1GO3 F;  1OCO B;  2A9H A;  3CC2 V;  2XAJ A;  3G71 V;  3SPJ A;  3K04 A;  1K73 W;  5EBM C;  2YEV B;  3WG7 B;  1FXV A;  3EFF K;  1OCR B;  1BHA A;  4R7C A;  1P4R A;  3BEH A;  5LGN A;  2HR3 A;  4E2L A;  1R3L C;  4QE9 A;  3GB7 C;  4PDL A;  1RM1 C;  3K79 A;  3ZN1 A;  2QM7 A;  2W0F C;  1M90 W;  2HVK C;  1M9N A;  2GSM B;  3K08 A;  4PA7 A;  3OR7 C;  4P9O A;  1GTO A;  1YJ9 V;  1W0J G;  4WFE A;  1FXH A;  5B1A C;  3OUF A;  5EC1 C;  1JX9 A;  3AG1 C;  2IU0 A;  1AR1 B;  3E8B A;  1VQN V;  2LFS A;  5CBG A;  1EBO A;  4XDJ A;  1L1F A;  4GX0 A;  1I5Y A;  1NH2 B;  1JCH A;  2Y69 C;  4PDV A;  4CBC A;  4X88 A;  3ASN C;  5LHG A;  1SER A;  5B1N A;  1VQM V;  3IC7 A;  4JTC B;  1M57 C;  1VQ4 V;  2B1G A;  2DYR B;  4GX2 A;  1VQ9 V;  5L3F A;  1F23 A;  2ZR2 A;  3SJQ C;  3K0G A;  2QTO A;  1OZ0 A;  1H8H G;  3AG3 C;  3E8G A;  1R6N A;  2ZR3 A;  4WCE V;  1QCE A;  1G8M A;  5DN6 G;  1QLE C;  3E89 A;  3D3I A;  3X2Q B;  1S3J A;  2EZP A;  2FTK A;  3GWO A;  1YIJ V;  1V54 C;  1NH2 D;  2JEX A;  3LDC A;  5C93 A;  3TET A;  1THZ A;  1VQO V;  1K5Q A;  2EIM C;  5KA5 A;  4Z1M G;  2A79 B;  3RVZ A;  3ABL C;  2CK3 G;  4XBF A;  4MT8 A;  2YEV A;  2EIN C;  4FMT A;  3EHB B;  4TT3 G;  3SYP A;  3ZMT A;  2K1E A;  3ABT A;  3AEI A;  3I56 V;  1MOF A;  2BOC C;  3M99 B;  2AHY A;  2EZO A;  5IYB O;  5L3G A;  3G6E V;  2X7R B;  1H38 A;  4MS2 A;  4MVS A;  2EIL C;  3F7Y C;  3MHS C;  4JAS A;  3CCJ V;  4I5S A;  5FL7 G;  1FFT B;  1QR9 A;  2GHY A;  3ZMZ A;  4PDR A;  1AJP A;  5DM6 V;  4P30 A;  4BAY A;  4MTF A;  1NVP B;  2OT5 A;  4MTG A;  5IY5 C;  1K3E A;  2DYS B;  4UVC A;  3P30 A;  3B8M A;  2PI5 A;  4P2Z A;  2HG5 C;  2P7T C;  1JQ0 A;  3HB3 B;  3CCR V;  2XAQ A;  2OCC C;  1GM8 A;  1K4C C;  4QPK A;  2LFR A;  5L3D A;  4MW8 A;  3IGA C;  4G27 B;  3FB5 C;  1PNL A;  3DTU B;  4PA6 A;  3SYA A;  2NLJ C;  1NVP D;  3LDD A;  1QR8 A;  1RPO A;  1GMG A;  1Q81 W;  1R3J C;  3KG2 A;  2LP7 A;  1QVG U;  1QBZ A;  5CBH A;  1ENV A;  2EIK B;  3F7V C;  5B1B B;  4LC1 A;  4R50 A;  3D36 A;  3UM7 A;  1JOY A;  3CCL V;  4ASU G;  3SYQ A;  1XL4 A;  2QKS A;  3LSS A;  2AHZ A;  4CZZ A;  3OFN G;  1NJI W;  4JTA B;  2JDI G;  2X6C A;  5LHI A;  2Y48 A;  3ABK C;  3OR6 C;  3W7W A;  3OAA G;  2IJH A;  3CCE V;  1NR7 A;  3ZJZ A;  3E35 A;  1DTO A;  2WLH A;  2NNU A;  4OXS A;  2BOB C;  3G4S V;  4MVU A;  1VQ8 V;  3T4D A;  4R8C A;  3CCU V;  2Z5U A;  3OW2 U;  3W7S A;  4LCU C;  1I5X A;  3H01 A;  1PKX A;  2DQ3 A;  1UJW B;  1RM1 B;  5L3B A;  3ZRS A;  1KC8 W;  3SPG A;  3E8F A;  3K0D A;  5B1O A;  2IJJ A;  4RQE A;  1M1K W;  1KD1 W;  1YHQ V;  1G4Y B;  3FB7 C;  2QM8 A;  5B1A B;  4QIW F;  1F51 A;  2WLJ A;  3K9A A;  5KA6 A;  5LGT A;  1JJ2 U;  2ZDI A;  1DF4 A;  3AG1 B;  5H6R A;  2IH3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...