3OGIB

Crystal structure of the mycobacterium tuberculosis h37rv esxop complex (rv2346c-rv2347c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
89
Chain Sequence
FMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
molecule keywords Putative ESAT-6-like protein 6
molecule tags Structural genomics, unknown function
source organism Mycobacterium tuberculosis
total genus 27
structure length 89
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3ogiB00
3Q4HB 2AZ2A 1WA8A 4I0XB 2DE0X 2B9ZA 3Q4HA 2VRZA 4I0XA 3GWKC 3TXQA 3FAVB 3GVMA 2KG7B 3FAVA 3O9OA 3HR0A 4ABMA 2KG7A 2AZ0A 4LWSB 3TXSA 3OGIB 4GZRB 3FD9A 4LWSA 3ZBHA 3G80A 2VS0A 1WA8B
chains in the Genus database with same CATH superfamily
3D36C 5L3DA 4WBNA 3OE7G 3Q4HA 2PZSA 4XDJA 3L73H 1RM1C 1YTFB 1G8MA 1SQVH 4TUYA 4FZ1A 4F4LA 2ZE7A 3CHXA 3SJCC 2BCCH 1RM1B 2MW2B 2ZNIA 4D7SA 2P22C 3ZJZA 2AGAA 3B2EE 3AK2A 3G71V 4B3TB 5BZBA 1KB9F 4DR6B 3EXAA 5EIBC 4AQYB 2ZM6O 1KUQA 3T4ZA 1ZAUA 1EM1A 4PHZA 3K5OA 4DV5B 1CP9A 4UUJC 1VQOV 4J11A 4QE7A 3B77A 5KHHA 5DECA 2V7QG 4G28B 2LO1A 2WA3A 4B3RB 1K4CC 3E22A 4DXWA 4JI2B 3SPGA 4YJ2A 2HKOA 2B1GA 5KHIA 4FFBA 4UCVA 2JDIG 3JD1A 2W0XA 2EX3A 1QU7A 2KG7B 3W7WA 1Q90D 5IWAB 1QCEA 4JASA 5JJJB 5B1NA 3T1HO 2JIZG 1K8AW 4YY3B 1CXZB 1KKDA 4TQFA 2ITDC 1S0VA 1RSOA 2N74A 4NTXA 1ZWIC 2GDSA 1GK9A 3FAVB 2ZIOA 2JEUA 2DMXA 4JV5O 3CSXA 4UCTA 5B3SC 1NH2B 1NU1H 2HFEC 4NYKA 4LWSA 3LDDA 2WLJA 5IJ0B 2NLJC 2EJ7A 1R6TA 3CCVV 2JGDA 3JSNA 3FX7A 1Y67A 4IYIA 1ENVA 3ETQA 4UXNA 1OCRC 4IIJA 3UT5B 3JAWA 4LF9O 2A9HA 1U96A 1PNKA 1OCRB 2P4VA 5FL7G 3FD9A 1Y74A 1R1BA 4HBNA 2X6CA 1SETA 5J2UB 3JAKB 3OR6C 1LR1A 3OT7A 2IH3C 1BL8A 5C8YA 2HVKC 4C7UA 4Z2WA 4DR2O 1AJNA 3DC5A 1J5EB 4ICGA 2DOSA 3L75H 5B1AC 2QM8A 4JI8B 1H2KA 1MABG 4G27B 1JJOA 3BVOA 2YICA 3BFRA 4X20A 4JYCA 5B1AB 1F4NA 1WA8B 5CA1A 2P90A 2QGNA 3N2KB 1YIJV 3CXHF 4QNHB 2WWWA 2X0LA 1SC5B 4J9YB 1XOUA 3JASB 2IU3A 1PD3A 3ZRXA 2YXLA 4TV9A 5L3BA 1IVSA 2UXDO 3FYIB 3JD4A 2CH7B 1VQ9V 4K0KO 1YDXA 3ZS8C 4DW0A 3ABLC 1V54C 2Q4PA 4J80A 2BTOA 2JJ1G 1V54B 1XREA 2OTJV 1ZSPA 4ZOLA 3ZMSA 2UUAB 2ZCEA 2ZXWC 3JCZA 1HR0O 1IBMB 2ZXWB 2Q6AA 5JJNB 5ITZA 4NXMB 3OEEG 4KUMA 4PDLA 1NS1A 2M6YA 3JATB 2EILC 4O4IA 2A0LA 4JAAA 3JCUZ 4DR1O 1H2GA 2YIBA 2EILB 4X9QA 5GTHZ 1Y76A 1YXBA 3E89A 2JK5C 1EFRG 2QWOB 3C3SA 3RVZA 1N0NA 4O4HB 3OAAG 1NR1A 4DV6O 4I4TB 1EZVH 1PNMA 2P5OA 3CCJV 4XBFA 2JVDA 2P06A 3I5DA 2Q0AA 2Z3YA 3CMAV 1VARA 1ZL8A 3ZRVA 1IURA 3ABMC 1MZEA 3RFRA 1KECA 3CCMV 2A06H 5JCOA 1WPXA 3HKCA 3ABMB 2Q73A 1DF5A 4PA9A 2HJFC 2IJKA 2XHBA 3UM7A 5H9CA 2Y48A 3CRAA 5BMVB 1IZ3A 2ZE8A 3BPZA 1P4RA 3M99B 1SS3A 4WFAV 3MD0A 3BY6A 3H9VA 1LUWA 3S3WA 2X6BA 1YVWA 1BGYH 2DQ3A 4OPHA 4GKJO 1MSDA 1M57C 2ODMA 1AR4A 3LDCA 2GUZB 1IX9A 5D5PA 2NNUA 4MT8A 2PI4A 1M5IA 3T1HB 3E86A 1COWG 3I56V 3SPHA 3DXRB 4R50A 4DYLA 1FKAO 3LNMB 4PDMA 3UO2A 1M56C 4R7CA 4JV5B 1YSCA 4XDLA 4O4JA 4FLYA 3RYFB 3UQ8A 2AHZA 3N2GA 1ZLZA 1QLEC 1M56B 4B3SO 2XUMA 1VQPV 1AJQA 4J7JA 1LUVA 2A3QA 2AZ0A 4DV7O 1QLEB 4YJ3B 1HDJA 5H6RA 2HLDG 4PV1B 4GX0A 4RWUA 4ZBMA 3H1KH 3K5NA 3L71H 4LF9B 1IBKO 4BAYA 3P3PA 5J2TA 2IJIA 5LGUA 4OX9O 4WFGA 4AHCA 3B8NA 1SZXA 5KUKA 3ZBHA 1NZ6A 4IHJB 1SZTA 3AK1A 1FAFA 1K92A 3ZIAG 4DR2B 2BTQB 1K9MW 1XQ8A 3ML0A 1GM7A 1K3EA 1NVPD 2GSMB 1D2DA 1Z5VA 1PPJH 5L3GA 3E8BA 2E5LO 1BHAA 4Q6GA 3AG4B 3LUTB 3DC6A 1DK1A 2E3CA 4FLTA 3RWRD 4ZHQB 4U3JA 2OYQA 1VF7A 3CWBH 2V4DA 2EJRA 1NQTA 4KHPO 4EB6A 3ASNC 1AI4A 1WJZA 1N32O 4HZ3A 2WLLB 5EK0A 1X4TA 3VOUA 2QDOA 5IYBO 3E8HA 4I55A 2UXDB 2CTRA 3JAMN 4AILC 1KMIZ 2LGQA 3W7XA 2LFSA 4K0KB 1QHTA 3OTOO 1RPRA 2V1DA 1KD1W 5EC2C 3BHPA 4BR6A 1AB3A 2UUBO 2UUCO 4NKGB 3K58A 2G38A 2EZOA 4J7ZA 5LP6C 4MVSA 3P32A 4TT3G 5KUMA 2R70A 5LP6B 2QWNB 3RYCA 2ARHA 3AK3A 1RPOA 4F6EA 3GVMA 4FK5C 1HR0B 4O2AB 1TVKB 1GH6A 3QVNA 1HP8A 2CTPA 3ICXA 1UJWB 4L87A 4ZI7A 1XNQB 2Y0PA 2UXBB 4TV8A 3CCRV 1NKDA 5EBWC 2Q9LA 1JVMA 3F7YC 4DR1B 3WG7C 3OMIB 4Z1MG 1WNSA 4LF5O 3P30A 5IY5C 2WLMA 3T2MA 5LOVA 4F6RB 1ZX3A 4DV6B 4UB6Z 4PD4F 4DV4O 2RNBA 1BE3H 2R9RB 3AG7A 1B6QA 1B04A 2P7TC 4TQDA 2LGWA 4X1IA 3TCUA 2XAGA 2PUSA 4JTCB 1PP9H 5IT9N 1FFXA 1TUBB 1SQPH 3CEIA 1TA8A 4LF8O 4JYYA 5H2FZ 1P7BA 1LNQA 4RUEA 4GX1A 4YHHO 3VBBA 5BY1A 4BW9A 2HHHO 1K97A 4DK0A 1VP7A 4LH6A 3OMNB 4PA4A 3C3TA 4PJ0Z 1K33A 2BSKA 5L3CA 5HFMA 2PY5A 2IH1C 4H13B 1BS3A 1N4CA 4OPAA 4GKJB 2ZE5A 1SA0A 3OUFA 3K5MA 5BR8O 4UVAA 1GN6A 4O2BB 3CXCU 1NT2B 3FYEB 4UV9A 1GKFA 4HNAB 3DSQA 4K8ZA 4P9PA 3AEIA 1YI2V 2CTWA 3OR7C 1FXKC 4MVRA 2HR3A 4X1KB 2EIKC 4JI1O 5KLVH 1VEWA 5LL6Y 2WLIB 4LNUB 1H8HG 3HKBA 4B3SB 1S5LZ 1V55C 4DV7B 3TGUH 1AR5A 2ATKC 1V55B 1SQFA 1E1RG 1IXBA 3K06A 4FPPA 4CS2A 2EZPA 1M9NA 3ZHSA 3R65A 2DWDC 5JVDB 3SYCA 2EBOA 2QKSA 2QSAA 1IBKB 3KG2A 1OCOC 4OX9B 4EFEA 2BOBC 1OCOB 3FB7C 2DN9A 2FB5A 2JJ2G 3RGBA 3ABKB 2YDEA 3CC7V 2Q5ZA 3E2EA 4JI4O 4RO2A 4UCOA 4RQEA 3OGIB 1KU9A 4X62O 3JYCA 2YEVA 3RYIA 3CRRA 4JYAO 1P84F 5J2UA 2E5LB 4I9QA 1QNMA 5GONA 4CC6A 1WAZA 1H2NA 2CGOA 2LQTA 4KHPB 4I50A 4TWKA 4K35A 5EBMC 1N32B 2CUGA 1JFFB 1YJNV 2ADQB 2GBOA 1XMOO 2PYJA 3H1IH 2GTSA 2LFRA 5IJ9B 1QR9A 4IYHA 1G1XB 3OD4A 5L3FA 3HKEA 3ZRWA 3OTOB 3X2QC 2UUBB 2UUCB 4FZ0A 2ZE6A 2XAFA 3RT3C 3HKDA 4PA7A 3X2QB 3VQWA 4MW8A 3SDLA 2XT9A 4PDVA 1THZA 4WBNB 3Q4HB 2F4VO 4OXSA 3F5TA 3G4SV 5JH7A 4TUYB 4AI8A 1G6UA 1YEWA 3HB3B 4I0XA 3SR2C 2XNDG 5K1PA 4IL6Z 3K0DA 4YIPA 4N23A 2LW1A 1SQXH 2ITCC 4LF6O 3WU2Z 3APOA 2F95B 1WP7A 4K8XA 2QTSA 1US6A 3ZHTA 1OHHG 1JMKC 5LXTA 4BIOA 1VQ4V 5CB4A 4LF5B 2UXXA 2H3OA 3ASOB 4JTDB 4DV4B 3QF7A 3GWOA 1H2MA 1DGSA 5LYJA 1O9HA 3PN1A 3E22B 4DR5O 4GYCB 5EZYA 4YJ2B 1R3KC 1VF6A 4FFBB 1S77D 4LF8B 1V9PA 3D3QA 1HWYA 1UFIA 2YXHA 4YHHB 1AI6A 3T1YO 2ZIMA 2HHHB 2Q67A 1GM9A 2KQXA 4LCUC 5FNVA 4RAIA 1RSOB 2ZT9B 1W0KG 1JX9A 3C90A 3H1JH 5BR8B 1XEQA 4H37A 4B3MO 4LWSB 4GT1A 2JGDB 4QJFB 1XNQO 5JWPA 2UXBO 2Z5UA 1AROP 3M8AA 4JI1B 3UCSC 1PNLA 3AG2C 4RQFA 4KFMA 2Q7GA 1S5JA 4IIJB 5CA0A 4X65O 3DTUB 3JAWB 5KHKA 3AG2B 3HR0A 2KB1A 1Y74B 2AXTZ 4X1YA 4MVOA 1DTOA 5DN6G 1IBLO 4LH7A 2YIAA 4KL1A 1SESA 1SERA 1MOFA 1I08A 1BCCH 5C8YB 1GN4A 2LJ2A 1PL0A 2RDCA 5IYZA 1EZJA 5IDJA 4PI0A 3AG1B 1SQGA 1YF2A 3CYOA 4ABMA 4X20B 5LGNA 1GMGA 1B3QA 4FIPC 4DR7O 3L74H 5CA1B 2P4KA 2PTMA 4UVBA 4DV2O 2C2AA 3SPIA 2F1MA 1S3JA 3F5WC 1FPOA 2CAZC 1Q3EA 3A2FA 5FLXN 4JI4B 4FLWA 1H2LA 1Q82W 4TV9B 2GHYA 4X62B 2YS8A 1I5XA 4GUNA 2IW5A 5CBGA 1U97A 4JYAB 2QWRB 3N27A 5GTIZ 5JQGB 4MVMA 1SF9A 1WB8A 1H2SB 3UKMA 2Q7HA 3BEHA 1YITV 4NXNO 1VQ7V 3J7AU 5LA6A 1N34O 2L35A 2QEXV 1BT8A 3BAAA 3K59A 4ZOLB 1XMOB 3W7SA 3AG3C 1R73A 4MVQA 2O57A 2Y69C 4I7ZB 1E79G 3CS5A 3ETEA 3AG3B 4CH5A 5ITZB 4XDKA 2E75B 4H44B 2Y69B 3U0ZA 4O4IB 4QE9A 2JS3A 3ZMUA 4J41A 1BZKA 3CCUV 1S72V 1Y76B 1Y6XA 4EFBA 3H1HH 3ZHQA 2F4VB 2YC0A 3RYHA 2YI8A 4W4KA 2Y4UA 5KX5A 3CRCA 3TK1A 3B8MA 2DE0X 4OGQB 1VQ5V 4B7KA 4LF6B 3QO8A 2OCHA 3TXQA 4JAUA 3DGEA 3CE2A 5JCOC 2Y4TA 1ZL8B 2PGGA 4I5SA 2YI9A 1FXVA 3JARA 3CJHA 3ZN0A 3MAQA 1ORQC 4BW5A 1JJ2U 1KKCA 1L0LH 3HKCB 3RBZA 3RW0A 3CC2V 5KHJA 3AG4C 5H5NA 2XAHA 5E1AC 4NVPA 1K34A 4MW3A 4TSFG 4DR5B 1WP8A 4MVUA 1FS0G 1CPYA 1URFA 3MDSA 3JALB 1AI7A 3HPLC 5KMGA 1I7FA 4CC5A 5CN0A 1F51A 3QO5A 4JZ2A 4WF9V 2IBZH 4PA6A 3T1YB 1Q6HA 3TETA 4H33A 1KQSU 5LMNO 5EYPA 1MMMA 2Q68A 1YTFD 2X6AA 2AW9A 3D3IA 4YIOA 2HJDA 5FPRA 1GN3A 3WB2A 5LHIA 3ZHRA 1I0HA 4FFKA 1VQKV 4DV3O 3OM3B 1BQZA 4JI0O 4DRXA 4D6TH 2UXCO 4O4LA 1L0NH 5LMUO 1VIBA 4O4JB 3N2GB 4LC1A 4B3MB 3SPJA 3J80N 2JGUA 5EIBD 3LSSA 1WB7A 2NN4A 3J81N 2HP8A 2OCCC 4LFAO 3EVKA 1JR9A 4PELA 2OCCB 4X65B 1Z5WA 2Z0AA 1AR1B 1PKXA 5J2TB 1BMFG 1JCHA 2P67A 2ZD9A 4UV8A 2DYSB 1H8EG 3SYPA 1IBLB 1FXKA 3I55V 2IJJA 4DR3O 1KC8W 4A5UB 4HYOA 4NTYA 3BA8A 1D5NA 3CB2A 4JI5O 3STLC 1R6KA 3CRQA 4NR1A 2VQFO 3D36A 4DR7B 4I9WA 1AP5A 4DO2A 5B1BC 4U3JB 4DV2B 1MSWD 4X8AA 3WB0A 3SJAC 3TXSA 4EB6B 1P49A 1XDCA 2M7WA 2DJVA 3OTFA 1OCZC 5B1BB 4GKKO 3K0GA 1NH2D 5DM6V 2E76B 5JVDA 5IYDO 3ABTA 3SGIA 3LNNA 4P30A 1OCZB 5IYCO 1AJPA 4I55B 2HEPA 1XL4A 3L72H 1E1QG 4R8CA 2QWQB 5KAIZ 3SYAA 1FXHA 2XAJA 2PI5A 2HG5C 2WPDG 1NTMH 3OEHG 4NXNB 1FD9A 2EIJC 2YIDA 3E8GA 1P7GA 4DW1A 2QM4A 1N34B 2BOCC 4YXWG 3G6BA 1N36O 3RYCB 2EIJB 4ZI7B 3OMAB 1L8DA 2KG7A 4TV8B 2E74B 4DV1O 5HFLA 3VQXA 3QTCA 3KCYA 1XMQO 5FPOA 1YJWV 2R9IA 1DF4A 1VQNV 4UFZA 3ETDA 4FM2A 2UU9O 1SKVA 2QE7G 2WLKA 3SJBC 2VRZA 4KP4A 2YSUB 5LOVB 3FAVA 1TUEB 1M93A 2ADPA 4JPRA 4QIWF 4DR4O 3WB1A 2A79B 2H94A 4X1IB 1VMGA 3A0HZ 3K9SA 3ZMVA 5IJ0A 4FLXA 2KSDA 2FMLA 2B9ZA 3G67A 1FFXB 1YJ9V 2ZDIC 5CBHA 2QA4V 3ABKC 1WLEA 1A32A 1K7DA 3OW2U 2XAQA 3ZCCA 4U7NA 5C93A 3UT5A 4IT5A 4P9OA 1NTKH 4ASUG 2F66C 5KA5A 2H8PC 3ZRSA 4DV0O 4MVZA 1S76D 3JD3A 4DK1A 1XI1A 5CMUA 1JA8A 2QM7A 3K9AA 5D5QA 3JAKA 2BSKB 2VQEO 4MS2A 1BSMA 3H1LH 1QBZA 5IE9A 2JS5A 1EN4A 4JAVA 5LHGA 4LFBO 1SA0B 3FFQA 4LBEC 1PV0A 3EHBB 3K57A 1K5QA 1Q5OA 4X88A 3RVYA 4FLVA 1GTOA 5LMNB 2X7RB 1WA8A 3B4SA 2B5UA 1F23A 3N2KA 2P6JA 2W0FC 3JD2A 2PF4E 1JPXA 1Q7YW 3RN4A 1XHZA 2OTLV 4X66O 3JASA 4DV3B 1VF5B 2CK3G 4JF3A 4JI0B 2UXCB 4JI7O 2LW7A 1VQMV 2QR4A 5LMUB 3HKBB 4LF4O 2CH7A 4EEQA 4JI3O 3BCCH 1Q81W 1Q86W 1FJGO 2DWEC 4WFFA 2Q7EA 2XTAA 1HNWO 4MTOA 5DEDA 4GCZA 2FL4A 3T1CA 1KP2A 3IAYA 1BHBA 4G2KA 2F23A 5A2QN 5A9GA 1VQ8V 4LFAB 5JJEB 1AP6A 4FM0A 3SJQC 5B3SB 1VQ6V 1ROPA 2OT5A 1QLNA 3U11A 4N21A 2B1IA 3ASOC 3G6EV 4DUYO 1WN7A 5LBQA 4WFHA 4MTGA 3JATA 3CP1A 3K04A 4LFCO 4BWAA 4DR3B 2WLNA 3CCEV 4MTFA 3IC9A 2YEVB 3RYIB 1HNXO 1DLBA 2CE4A 1ZUQA 4JI5B 4L8JA 3BABA 5EC1C 5GONB 3W7TA 2VQFB 4O4HA 5F2VO 4I4TA 4CS4A 4I50B 1NTZH 3FB5C 1N8RW 3BA9A 4GKKB 2YIBD 3F7VC 2WLHA 4J9ZB 1UPGA 1N33O 4J10A 1XNRB 4X64O 2RQ6A 4MSWC 2IM9A 3HKEB 4Z1VA 3ZRWB 1M90W 5E79Z 1FYJA 2OIGA 3IFXA 3VQYA 2F43G 3TJTA 1W2BU 3HKDB 5BMVA 5J9PC 2WAMA 4FM1A 3IJ4A 4DUZB 1SRYA 1N36B 1L1FA 4IGGA 4QPKA 3G80A 5JQGA 5JH7B 2DQ0A 2QTOA 1OV9A 4U3FH 3STZC 1NI8A 4I0XB 5LHHA 1I94O 3K79A 3L70H 2EULA 3ABLB 3NXSA 4LF7O 4B08A 3H01A 4DV1B 4CBCA 2GUZA 4JYBA 1XMQB 4JTAB 2Q69A 3P3NA 3CPWU 3QNEA 3E35A 2UU9B 3DXRA 1QQCA 1SQQH 3O65A 3PJSK 4JZGA 4CH3A 3ZMZA 5LXTB 5CB4B 3AG1C 1O9GA 1W59A 4PDRA 4PI2A 3RYFA 2WSSG 2QJ1A 4DR4B 1AILA 4MTXA 5LYJB 1H38A 1EBOA 1VF6C 4JI6O 3K3WA 2QKAA 1EN5A 2JRIA 5EZYB 5EBLC 5BXZA 4FVMA 2MK3A 4YJ3A 3ABUA 1K5SA 4D7TA 1W0JG 1Q6IA 3GB7C 1F4MA 3CCSV 3CD6V 2RN9A 3ZX6A 3OGCC 3A0RA 5KAFZ 1PM9A 2Q8VA 4DV0B 1I5YA 2ZM6B 5FNVB 2ETNA 2VQEB 5TISZ 3FKSG 2K1EA 4RUFA 3ZHVA 4FLUA 3ZEDA 4CS3A 4IHJA 1XILA 3U10A 1Y4MA 3ETGA 4FJCC 1XL6A 2ZR3A 1QVGU 2RCVA 2RMKB 2D3OW 2BTQA 3KKYA 3FB6C 3OFNG 4LFBB 1YZBA 3FB8C 4LR3A 1ZTEA 5CA3A 4EKWA 4ZIBA 2KKWA 1NR7A 1S5HC 4H0LB 3JALA 3K03A 4ZHQA 1RP3B 3W7UA 5B1OA 4ZKIA 2WLLA 4X66B 3K08A 5CA0B 4JI7B 1M57B 3WFVA 2VWKA 1WPBA 2A7WA 4LF4B 2VWJA 1IDSA 2JEXA 2W6IG 2N05A 1SQBH 1XUQA 4X1YB 4JI3B 3SYQA 4W4LA 1OJHA 1FJGB 2F93B 2CGNA 1JOYA 1HNWB 3VQVA 2BE3A 4KXRA 3EFFK 1HNZO 2OWOA 5IYZB 2CDYA 1QR8A 3CRMA 5LP6A 3NR7A 5B5EZ 1KP3A 1YCIA 3L9DA 2XASA 1Q6UA 4R6ZA 4O2AA 1TVKA 4QGPA 5KA6A 1G4YB 4UB8Z 1EN6A 4DUYB 1R3LC 1Q43A 1X59A 4B3TO 3SYOA 3CCLV 3ZN1A 4DR6O 4LFCB 3GWKC 3QO7A 4AQYO 2HVJC 4E2LA 4BIUA 1F7YA 1HNXB 4FMTA 3CC4V 2L6LA 3MHHC 4DV5O 1K73W 4F6RA 2D2CB 1GN2A 3MHSC 1Q8IA 2QWPB 1VQLV 1XBLA 5KHGA 2Q0OC 4B3RO 1GM8A 5LA6B 4JI2O 1GRJA 4HAMA 4QPJA 2K9PA 1N33B 1TUBA 4UCRA 2AHYA 4X64B 3KCXA 5AG2A 3K5LA 1R6NA 5IWAO 1KBHA 4WFEA 1OCCC 2AZ2A 1CEZA 3ASNB 2DW4A 1R3JC 3A8TA 1M1KW 2ZQMA 1K4DC 1JQ0A 4YY3O 1OCCB 3LDEA 3IGAC 1AVMA 1FFTB 3B09A 3SPCA 1TGOA 2EIMC 2ZINA 2R72A 3LSQA 3M7MX 3RYHB 3CMEV 3B40A 1MG1A 1T5EA 4NB5A 4CH6A 1I94B 2EIMB 2CTQA 4GX5A 5KX5B 4LF7B 4O2BA 3OUSA 2OIEA 4HNAA 2IU0A 4UCSA 2UXNA 2DYSC 4TOIA 4CH4A 2R9AA 3JSLA 3KZIZ 2GV9A 1J95A 3A0BZ 3JARB 4X1KA 4J42A 3CJHB 5H6QA 1R3IC 4BIZA 3THOA 3ZMTA 2Y0IA 2GTAA 3QG5A 3ZHUA 4GX2A 1M4UA 4Q20A 2WLIA 4LNUA 4J7KA 3E83A 2FTKA 1GO3F 1IXMA 2FKXA 2WA4A 4JI6B 3BRCA 3WG7B 1NJIW 1YHQV 3T4DA 2N04A 4UVCA 5KMGB 2DYRC 5IY5B 3E8FA 4WFBV 1J5EO 4UCUA 4JI8O 2LP7A 2DYRB 2ZKOA 1TAEA 1Y66A 2XOKG 2QKCA 4K3AA 5EYPB 4GLXA 2PYLA 1XNRO 1BQ0A 1MA1A 5B66Z 4B7EA 1NBMG 1QVFU 2RJZA 2ZDIA 4NTWA 3CCQV 1KYOF 4DRXB 4JGSA 4O4LB 2EINC 1Z2GA 2ZR2A 2VS0A 4P2ZA 2FYUH 4E4EA 2EINB 4DUZO 1AI5A 3D8CA 1N0JA 2W6JG 1OZ0A 3UO3A 1HW7A 3APQA 4FLZA 4U7OA 4WCEV 1B06A 3CX5F 1JFFA 4GZRB 4LP8A 2YUAA 5GW7A 1XHXA 5CBFA 4X89A 5LGTA 2UUAO 1PL4A 2ZNJA 4PA3A 1NVPB 5IJ9A 3JD0A 5K1XA 2IJHA 3R66A 1IBMO 3LSUA 1RFYA 1D5AA 4NXMO 2YXYA 2ILMA 1FXKB 1MZFA 3O9OA 5L3EA 3S3XA 4CZZA 2EIKB 1HNZB 2NR5A 1GAXA 1MNGA 3IC7A
chains in the Genus database with same CATH topology
3Q4HB 2AZ2A 1WA8A 4I0XB 2DE0X 2B9ZA 3Q4HA 2VRZA 4I0XA 3GWKC 3TXQA 3FAVB 3GVMA 2KG7B 3FAVA 3O9OA 3HR0A 4ABMA 2KG7A 2AZ0A 4LWSB 3TXSA 3OGIB 4GZRB 3FD9A 4LWSA 3ZBHA 3G80A 2VS0A 1WA8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4H B;  2AZ2 A;  1WA8 A;  4I0X B;  2DE0 X;  2B9Z A;  3Q4H A;  2VRZ A;  4I0X A;  3GWK C;  3TXQ A;  3FAV B;  3GVM A;  2KG7 B;  3FAV A;  3O9O A;  3HR0 A;  4ABM A;  2KG7 A;  2AZ0 A;  4LWS B;  3TXS A;  3OGI B;  4GZR B;  3FD9 A;  4LWS A;  3ZBH A;  3G80 A;  2VS0 A;  1WA8 B; 
#chains in the Genus database with same CATH topology
 3D36 C;  5L3D A;  4WBN A;  3OE7 G;  3Q4H A;  2PZS A;  4XDJ A;  3L73 H;  1RM1 C;  1YTF B;  1G8M A;  1SQV H;  4TUY A;  4FZ1 A;  4F4L A;  2ZE7 A;  3CHX A;  3SJC C;  2BCC H;  1RM1 B;  2MW2 B;  2ZNI A;  4D7S A;  2P22 C;  3ZJZ A;  2AGA A;  3B2E E;  3AK2 A;  3G71 V;  4B3T B;  5BZB A;  1KB9 F;  4DR6 B;  3EXA A;  5EIB C;  4AQY B;  2ZM6 O;  1KUQ A;  3T4Z A;  1ZAU A;  1EM1 A;  4PHZ A;  3K5O A;  4DV5 B;  1CP9 A;  4UUJ C;  1VQO V;  4J11 A;  4QE7 A;  3B77 A;  5KHH A;  5DEC A;  2V7Q G;  4G28 B;  2LO1 A;  2WA3 A;  4B3R B;  1K4C C;  3E22 A;  4DXW A;  4JI2 B;  3SPG A;  4YJ2 A;  2HKO A;  2B1G A;  5KHI A;  4FFB A;  4UCV A;  2JDI G;  3JD1 A;  2W0X A;  2EX3 A;  1QU7 A;  2KG7 B;  3W7W A;  1Q90 D;  5IWA B;  1QCE A;  4JAS A;  5JJJ B;  5B1N A;  3T1H O;  2JIZ G;  1K8A W;  4YY3 B;  1CXZ B;  1KKD A;  4TQF A;  2ITD C;  1S0V A;  1RSO A;  2N74 A;  4NTX A;  1ZWI C;  2GDS A;  1GK9 A;  3FAV B;  2ZIO A;  2JEU A;  2DMX A;  4JV5 O;  3CSX A;  4UCT A;  5B3S C;  1NH2 B;  1NU1 H;  2HFE C;  4NYK A;  4LWS A;  3LDD A;  2WLJ A;  5IJ0 B;  2NLJ C;  2EJ7 A;  1R6T A;  3CCV V;  2JGD A;  3JSN A;  3FX7 A;  1Y67 A;  4IYI A;  1ENV A;  3ETQ A;  4UXN A;  1OCR C;  4IIJ A;  3UT5 B;  3JAW A;  4LF9 O;  2A9H A;  1U96 A;  1PNK A;  1OCR B;  2P4V A;  5FL7 G;  3FD9 A;  1Y74 A;  1R1B A;  4HBN A;  2X6C A;  1SET A;  5J2U B;  3JAK B;  3OR6 C;  1LR1 A;  3OT7 A;  2IH3 C;  1BL8 A;  5C8Y A;  2HVK C;  4C7U A;  4Z2W A;  4DR2 O;  1AJN A;  3DC5 A;  1J5E B;  4ICG A;  2DOS A;  3L75 H;  5B1A C;  2QM8 A;  4JI8 B;  1H2K A;  1MAB G;  4G27 B;  1JJO A;  3BVO A;  2YIC A;  3BFR A;  4X20 A;  4JYC A;  5B1A B;  1F4N A;  1WA8 B;  5CA1 A;  2P90 A;  2QGN A;  3N2K B;  1YIJ V;  3CXH F;  4QNH B;  2WWW A;  2X0L A;  1SC5 B;  4J9Y B;  1XOU A;  3JAS B;  2IU3 A;  1PD3 A;  3ZRX A;  2YXL A;  4TV9 A;  5L3B A;  1IVS A;  2UXD O;  3FYI B;  3JD4 A;  2CH7 B;  1VQ9 V;  4K0K O;  1YDX A;  3ZS8 C;  4DW0 A;  3ABL C;  1V54 C;  2Q4P A;  4J80 A;  2BTO A;  2JJ1 G;  1V54 B;  1XRE A;  2OTJ V;  1ZSP A;  4ZOL A;  3ZMS A;  2UUA B;  2ZCE A;  2ZXW C;  3JCZ A;  1HR0 O;  1IBM B;  2ZXW B;  2Q6A A;  5JJN B;  5ITZ A;  4NXM B;  3OEE G;  4KUM A;  4PDL A;  1NS1 A;  2M6Y A;  3JAT B;  2EIL C;  4O4I A;  2A0L A;  4JAA A;  3JCU Z;  4DR1 O;  1H2G A;  2YIB A;  2EIL B;  4X9Q A;  5GTH Z;  1Y76 A;  1YXB A;  3E89 A;  2JK5 C;  1EFR G;  2QWO B;  3C3S A;  3RVZ A;  1N0N A;  4O4H B;  3OAA G;  1NR1 A;  4DV6 O;  4I4T B;  1EZV H;  1PNM A;  2P5O A;  3CCJ V;  4XBF A;  2JVD A;  2P06 A;  3I5D A;  2Q0A A;  2Z3Y A;  3CMA V;  1VAR A;  1ZL8 A;  3ZRV A;  1IUR A;  3ABM C;  1MZE A;  3RFR A;  1KEC A;  3CCM V;  2A06 H;  5JCO A;  1WPX A;  3HKC A;  3ABM B;  2Q73 A;  1DF5 A;  4PA9 A;  2HJF C;  2IJK A;  2XHB A;  3UM7 A;  5H9C A;  2Y48 A;  3CRA A;  5BMV B;  1IZ3 A;  2ZE8 A;  3BPZ A;  1P4R A;  3M99 B;  1SS3 A;  4WFA V;  3MD0 A;  3BY6 A;  3H9V A;  1LUW A;  3S3W A;  2X6B A;  1YVW A;  1BGY H;  2DQ3 A;  4OPH A;  4GKJ O;  1MSD A;  1M57 C;  2ODM A;  1AR4 A;  3LDC A;  2GUZ B;  1IX9 A;  5D5P A;  2NNU A;  4MT8 A;  2PI4 A;  1M5I A;  3T1H B;  3E86 A;  1COW G;  3I56 V;  3SPH A;  3DXR B;  4R50 A;  4DYL A;  1FKA O;  3LNM B;  4PDM A;  3UO2 A;  1M56 C;  4R7C A;  4JV5 B;  1YSC A;  4XDL A;  4O4J A;  4FLY A;  3RYF B;  3UQ8 A;  2AHZ A;  3N2G A;  1ZLZ A;  1QLE C;  1M56 B;  4B3S O;  2XUM A;  1VQP V;  1AJQ A;  4J7J A;  1LUV A;  2A3Q A;  2AZ0 A;  4DV7 O;  1QLE B;  4YJ3 B;  1HDJ A;  5H6R A;  2HLD G;  4PV1 B;  4GX0 A;  4RWU A;  4ZBM A;  3H1K H;  3K5N A;  3L71 H;  4LF9 B;  1IBK O;  4BAY A;  3P3P A;  5J2T A;  2IJI A;  5LGU A;  4OX9 O;  4WFG A;  4AHC A;  3B8N A;  1SZX A;  5KUK A;  3ZBH A;  1NZ6 A;  4IHJ B;  1SZT A;  3AK1 A;  1FAF A;  1K92 A;  3ZIA G;  4DR2 B;  2BTQ B;  1K9M W;  1XQ8 A;  3ML0 A;  1GM7 A;  1K3E A;  1NVP D;  2GSM B;  1D2D A;  1Z5V A;  1PPJ H;  5L3G A;  3E8B A;  2E5L O;  1BHA A;  4Q6G A;  3AG4 B;  3LUT B;  3DC6 A;  1DK1 A;  2E3C A;  4FLT A;  3RWR D;  4ZHQ B;  4U3J A;  2OYQ A;  1VF7 A;  3CWB H;  2V4D A;  2EJR A;  1NQT A;  4KHP O;  4EB6 A;  3ASN C;  1AI4 A;  1WJZ A;  1N32 O;  4HZ3 A;  2WLL B;  5EK0 A;  1X4T A;  3VOU A;  2QDO A;  5IYB O;  3E8H A;  4I55 A;  2UXD B;  2CTR A;  3JAM N;  4AIL C;  1KMI Z;  2LGQ A;  3W7X A;  2LFS A;  4K0K B;  1QHT A;  3OTO O;  1RPR A;  2V1D A;  1KD1 W;  5EC2 C;  3BHP A;  4BR6 A;  1AB3 A;  2UUB O;  2UUC O;  4NKG B;  3K58 A;  2G38 A;  2EZO A;  4J7Z A;  5LP6 C;  4MVS A;  3P32 A;  4TT3 G;  5KUM A;  2R70 A;  5LP6 B;  2QWN B;  3RYC A;  2ARH A;  3AK3 A;  1RPO A;  4F6E A;  3GVM A;  4FK5 C;  1HR0 B;  4O2A B;  1TVK B;  1GH6 A;  3QVN A;  1HP8 A;  2CTP A;  3ICX A;  1UJW B;  4L87 A;  4ZI7 A;  1XNQ B;  2Y0P A;  2UXB B;  4TV8 A;  3CCR V;  1NKD A;  5EBW C;  2Q9L A;  1JVM A;  3F7Y C;  4DR1 B;  3WG7 C;  3OMI B;  4Z1M G;  1WNS A;  4LF5 O;  3P30 A;  5IY5 C;  2WLM A;  3T2M A;  5LOV A;  4F6R B;  1ZX3 A;  4DV6 B;  4UB6 Z;  4PD4 F;  4DV4 O;  2RNB A;  1BE3 H;  2R9R B;  3AG7 A;  1B6Q A;  1B04 A;  2P7T C;  4TQD A;  2LGW A;  4X1I A;  3TCU A;  2XAG A;  2PUS A;  4JTC B;  1PP9 H;  5IT9 N;  1FFX A;  1TUB B;  1SQP H;  3CEI A;  1TA8 A;  4LF8 O;  4JYY A;  5H2F Z;  1P7B A;  1LNQ A;  4RUE A;  4GX1 A;  4YHH O;  3VBB A;  5BY1 A;  4BW9 A;  2HHH O;  1K97 A;  4DK0 A;  1VP7 A;  4LH6 A;  3OMN B;  4PA4 A;  3C3T A;  4PJ0 Z;  1K33 A;  2BSK A;  5L3C A;  5HFM A;  2PY5 A;  2IH1 C;  4H13 B;  1BS3 A;  1N4C A;  4OPA A;  4GKJ B;  2ZE5 A;  1SA0 A;  3OUF A;  3K5M A;  5BR8 O;  4UVA A;  1GN6 A;  4O2B B;  3CXC U;  1NT2 B;  3FYE B;  4UV9 A;  1GKF A;  4HNA B;  3DSQ A;  4K8Z A;  4P9P A;  3AEI A;  1YI2 V;  2CTW A;  3OR7 C;  1FXK C;  4MVR A;  2HR3 A;  4X1K B;  2EIK C;  4JI1 O;  5KLV H;  1VEW A;  5LL6 Y;  2WLI B;  4LNU B;  1H8H G;  3HKB A;  4B3S B;  1S5L Z;  1V55 C;  4DV7 B;  3TGU H;  1AR5 A;  2ATK C;  1V55 B;  1SQF A;  1E1R G;  1IXB A;  3K06 A;  4FPP A;  4CS2 A;  2EZP A;  1M9N A;  3ZHS A;  3R65 A;  2DWD C;  5JVD B;  3SYC A;  2EBO A;  2QKS A;  2QSA A;  1IBK B;  3KG2 A;  1OCO C;  4OX9 B;  4EFE A;  2BOB C;  1OCO B;  3FB7 C;  2DN9 A;  2FB5 A;  2JJ2 G;  3RGB A;  3ABK B;  2YDE A;  3CC7 V;  2Q5Z A;  3E2E A;  4JI4 O;  4RO2 A;  4UCO A;  4RQE A;  3OGI B;  1KU9 A;  4X62 O;  3JYC A;  2YEV A;  3RYI A;  3CRR A;  4JYA O;  1P84 F;  5J2U A;  2E5L B;  4I9Q A;  1QNM A;  5GON A;  4CC6 A;  1WAZ A;  1H2N A;  2CGO A;  2LQT A;  4KHP B;  4I50 A;  4TWK A;  4K35 A;  5EBM C;  1N32 B;  2CUG A;  1JFF B;  1YJN V;  2ADQ B;  2GBO A;  1XMO O;  2PYJ A;  3H1I H;  2GTS A;  2LFR A;  5IJ9 B;  1QR9 A;  4IYH A;  1G1X B;  3OD4 A;  5L3F A;  3HKE A;  3ZRW A;  3OTO B;  3X2Q C;  2UUB B;  2UUC B;  4FZ0 A;  2ZE6 A;  2XAF A;  3RT3 C;  3HKD A;  4PA7 A;  3X2Q B;  3VQW A;  4MW8 A;  3SDL A;  2XT9 A;  4PDV A;  1THZ A;  4WBN B;  3Q4H B;  2F4V O;  4OXS A;  3F5T A;  3G4S V;  5JH7 A;  4TUY B;  4AI8 A;  1G6U A;  1YEW A;  3HB3 B;  4I0X A;  3SR2 C;  2XND G;  5K1P A;  4IL6 Z;  3K0D A;  4YIP A;  4N23 A;  2LW1 A;  1SQX H;  2ITC C;  4LF6 O;  3WU2 Z;  3APO A;  2F95 B;  1WP7 A;  4K8X A;  2QTS A;  1US6 A;  3ZHT A;  1OHH G;  1JMK C;  5LXT A;  4BIO A;  1VQ4 V;  5CB4 A;  4LF5 B;  2UXX A;  2H3O A;  3ASO B;  4JTD B;  4DV4 B;  3QF7 A;  3GWO A;  1H2M A;  1DGS A;  5LYJ A;  1O9H A;  3PN1 A;  3E22 B;  4DR5 O;  4GYC B;  5EZY A;  4YJ2 B;  1R3K C;  1VF6 A;  4FFB B;  1S77 D;  4LF8 B;  1V9P A;  3D3Q A;  1HWY A;  1UFI A;  2YXH A;  4YHH B;  1AI6 A;  3T1Y O;  2ZIM A;  2HHH B;  2Q67 A;  1GM9 A;  2KQX A;  4LCU C;  5FNV A;  4RAI A;  1RSO B;  2ZT9 B;  1W0K G;  1JX9 A;  3C90 A;  3H1J H;  5BR8 B;  1XEQ A;  4H37 A;  4B3M O;  4LWS B;  4GT1 A;  2JGD B;  4QJF B;  1XNQ O;  5JWP A;  2UXB O;  2Z5U A;  1ARO P;  3M8A A;  4JI1 B;  3UCS C;  1PNL A;  3AG2 C;  4RQF A;  4KFM A;  2Q7G A;  1S5J A;  4IIJ B;  5CA0 A;  4X65 O;  3DTU B;  3JAW B;  5KHK A;  3AG2 B;  3HR0 A;  2KB1 A;  1Y74 B;  2AXT Z;  4X1Y A;  4MVO A;  1DTO A;  5DN6 G;  1IBL O;  4LH7 A;  2YIA A;  4KL1 A;  1SES A;  1SER A;  1MOF A;  1I08 A;  1BCC H;  5C8Y B;  1GN4 A;  2LJ2 A;  1PL0 A;  2RDC A;  5IYZ A;  1EZJ A;  5IDJ A;  4PI0 A;  3AG1 B;  1SQG A;  1YF2 A;  3CYO A;  4ABM A;  4X20 B;  5LGN A;  1GMG A;  1B3Q A;  4FIP C;  4DR7 O;  3L74 H;  5CA1 B;  2P4K A;  2PTM A;  4UVB A;  4DV2 O;  2C2A A;  3SPI A;  2F1M A;  1S3J A;  3F5W C;  1FPO A;  2CAZ C;  1Q3E A;  3A2F A;  5FLX N;  4JI4 B;  4FLW A;  1H2L A;  1Q82 W;  4TV9 B;  2GHY A;  4X62 B;  2YS8 A;  1I5X A;  4GUN A;  2IW5 A;  5CBG A;  1U97 A;  4JYA B;  2QWR B;  3N27 A;  5GTI Z;  5JQG B;  4MVM A;  1SF9 A;  1WB8 A;  1H2S B;  3UKM A;  2Q7H A;  3BEH A;  1YIT V;  4NXN O;  1VQ7 V;  3J7A U;  5LA6 A;  1N34 O;  2L35 A;  2QEX V;  1BT8 A;  3BAA A;  3K59 A;  4ZOL B;  1XMO B;  3W7S A;  3AG3 C;  1R73 A;  4MVQ A;  2O57 A;  2Y69 C;  4I7Z B;  1E79 G;  3CS5 A;  3ETE A;  3AG3 B;  4CH5 A;  5ITZ B;  4XDK A;  2E75 B;  4H44 B;  2Y69 B;  3U0Z A;  4O4I B;  4QE9 A;  2JS3 A;  3ZMU A;  4J41 A;  1BZK A;  3CCU V;  1S72 V;  1Y76 B;  1Y6X A;  4EFB A;  3H1H H;  3ZHQ A;  2F4V B;  2YC0 A;  3RYH A;  2YI8 A;  4W4K A;  2Y4U A;  5KX5 A;  3CRC A;  3TK1 A;  3B8M A;  2DE0 X;  4OGQ B;  1VQ5 V;  4B7K A;  4LF6 B;  3QO8 A;  2OCH A;  3TXQ A;  4JAU A;  3DGE A;  3CE2 A;  5JCO C;  2Y4T A;  1ZL8 B;  2PGG A;  4I5S A;  2YI9 A;  1FXV A;  3JAR A;  3CJH A;  3ZN0 A;  3MAQ A;  1ORQ C;  4BW5 A;  1JJ2 U;  1KKC A;  1L0L H;  3HKC B;  3RBZ A;  3RW0 A;  3CC2 V;  5KHJ A;  3AG4 C;  5H5N A;  2XAH A;  5E1A C;  4NVP A;  1K34 A;  4MW3 A;  4TSF G;  4DR5 B;  1WP8 A;  4MVU A;  1FS0 G;  1CPY A;  1URF A;  3MDS A;  3JAL B;  1AI7 A;  3HPL C;  5KMG A;  1I7F A;  4CC5 A;  5CN0 A;  1F51 A;  3QO5 A;  4JZ2 A;  4WF9 V;  2IBZ H;  4PA6 A;  3T1Y B;  1Q6H A;  3TET A;  4H33 A;  1KQS U;  5LMN O;  5EYP A;  1MMM A;  2Q68 A;  1YTF D;  2X6A A;  2AW9 A;  3D3I A;  4YIO A;  2HJD A;  5FPR A;  1GN3 A;  3WB2 A;  5LHI A;  3ZHR A;  1I0H A;  4FFK A;  1VQK V;  4DV3 O;  3OM3 B;  1BQZ A;  4JI0 O;  4DRX A;  4D6T H;  2UXC O;  4O4L A;  1L0N H;  5LMU O;  1VIB A;  4O4J B;  3N2G B;  4LC1 A;  4B3M B;  3SPJ A;  3J80 N;  2JGU A;  5EIB D;  3LSS A;  1WB7 A;  2NN4 A;  3J81 N;  2HP8 A;  2OCC C;  4LFA O;  3EVK A;  1JR9 A;  4PEL A;  2OCC B;  4X65 B;  1Z5W A;  2Z0A A;  1AR1 B;  1PKX A;  5J2T B;  1BMF G;  1JCH A;  2P67 A;  2ZD9 A;  4UV8 A;  2DYS B;  1H8E G;  3SYP A;  1IBL B;  1FXK A;  3I55 V;  2IJJ A;  4DR3 O;  1KC8 W;  4A5U B;  4HYO A;  4NTY A;  3BA8 A;  1D5N A;  3CB2 A;  4JI5 O;  3STL C;  1R6K A;  3CRQ A;  4NR1 A;  2VQF O;  3D36 A;  4DR7 B;  4I9W A;  1AP5 A;  4DO2 A;  5B1B C;  4U3J B;  4DV2 B;  1MSW D;  4X8A A;  3WB0 A;  3SJA C;  3TXS A;  4EB6 B;  1P49 A;  1XDC A;  2M7W A;  2DJV A;  3OTF A;  1OCZ C;  5B1B B;  4GKK O;  3K0G A;  1NH2 D;  5DM6 V;  2E76 B;  5JVD A;  5IYD O;  3ABT A;  3SGI A;  3LNN A;  4P30 A;  1OCZ B;  5IYC O;  1AJP A;  4I55 B;  2HEP A;  1XL4 A;  3L72 H;  1E1Q G;  4R8C A;  2QWQ B;  5KAI Z;  3SYA A;  1FXH A;  2XAJ A;  2PI5 A;  2HG5 C;  2WPD G;  1NTM H;  3OEH G;  4NXN B;  1FD9 A;  2EIJ C;  2YID A;  3E8G A;  1P7G A;  4DW1 A;  2QM4 A;  1N34 B;  2BOC C;  4YXW G;  3G6B A;  1N36 O;  3RYC B;  2EIJ B;  4ZI7 B;  3OMA B;  1L8D A;  2KG7 A;  4TV8 B;  2E74 B;  4DV1 O;  5HFL A;  3VQX A;  3QTC A;  3KCY A;  1XMQ O;  5FPO A;  1YJW V;  2R9I A;  1DF4 A;  1VQN V;  4UFZ A;  3ETD A;  4FM2 A;  2UU9 O;  1SKV A;  2QE7 G;  2WLK A;  3SJB C;  2VRZ A;  4KP4 A;  2YSU B;  5LOV B;  3FAV A;  1TUE B;  1M93 A;  2ADP A;  4JPR A;  4QIW F;  4DR4 O;  3WB1 A;  2A79 B;  2H94 A;  4X1I B;  1VMG A;  3A0H Z;  3K9S A;  3ZMV A;  5IJ0 A;  4FLX A;  2KSD A;  2FML A;  2B9Z A;  3G67 A;  1FFX B;  1YJ9 V;  2ZDI C;  5CBH A;  2QA4 V;  3ABK C;  1WLE A;  1A32 A;  1K7D A;  3OW2 U;  2XAQ A;  3ZCC A;  4U7N A;  5C93 A;  3UT5 A;  4IT5 A;  4P9O A;  1NTK H;  4ASU G;  2F66 C;  5KA5 A;  2H8P C;  3ZRS A;  4DV0 O;  4MVZ A;  1S76 D;  3JD3 A;  4DK1 A;  1XI1 A;  5CMU A;  1JA8 A;  2QM7 A;  3K9A A;  5D5Q A;  3JAK A;  2BSK B;  2VQE O;  4MS2 A;  1BSM A;  3H1L H;  1QBZ A;  5IE9 A;  2JS5 A;  1EN4 A;  4JAV A;  5LHG A;  4LFB O;  1SA0 B;  3FFQ A;  4LBE C;  1PV0 A;  3EHB B;  3K57 A;  1K5Q A;  1Q5O A;  4X88 A;  3RVY A;  4FLV A;  1GTO A;  5LMN B;  2X7R B;  1WA8 A;  3B4S A;  2B5U A;  1F23 A;  3N2K A;  2P6J A;  2W0F C;  3JD2 A;  2PF4 E;  1JPX A;  1Q7Y W;  3RN4 A;  1XHZ A;  2OTL V;  4X66 O;  3JAS A;  4DV3 B;  1VF5 B;  2CK3 G;  4JF3 A;  4JI0 B;  2UXC B;  4JI7 O;  2LW7 A;  1VQM V;  2QR4 A;  5LMU B;  3HKB B;  4LF4 O;  2CH7 A;  4EEQ A;  4JI3 O;  3BCC H;  1Q81 W;  1Q86 W;  1FJG O;  2DWE C;  4WFF A;  2Q7E A;  2XTA A;  1HNW O;  4MTO A;  5DED A;  4GCZ A;  2FL4 A;  3T1C A;  1KP2 A;  3IAY A;  1BHB A;  4G2K A;  2F23 A;  5A2Q N;  5A9G A;  1VQ8 V;  4LFA B;  5JJE B;  1AP6 A;  4FM0 A;  3SJQ C;  5B3S B;  1VQ6 V;  1ROP A;  2OT5 A;  1QLN A;  3U11 A;  4N21 A;  2B1I A;  3ASO C;  3G6E V;  4DUY O;  1WN7 A;  5LBQ A;  4WFH A;  4MTG A;  3JAT A;  3CP1 A;  3K04 A;  4LFC O;  4BWA A;  4DR3 B;  2WLN A;  3CCE V;  4MTF A;  3IC9 A;  2YEV B;  3RYI B;  1HNX O;  1DLB A;  2CE4 A;  1ZUQ A;  4JI5 B;  4L8J A;  3BAB A;  5EC1 C;  5GON B;  3W7T A;  2VQF B;  4O4H A;  5F2V O;  4I4T A;  4CS4 A;  4I50 B;  1NTZ H;  3FB5 C;  1N8R W;  3BA9 A;  4GKK B;  2YIB D;  3F7V C;  2WLH A;  4J9Z B;  1UPG A;  1N33 O;  4J10 A;  1XNR B;  4X64 O;  2RQ6 A;  4MSW C;  2IM9 A;  3HKE B;  4Z1V A;  3ZRW B;  1M90 W;  5E79 Z;  1FYJ A;  2OIG A;  3IFX A;  3VQY A;  2F43 G;  3TJT A;  1W2B U;  3HKD B;  5BMV A;  5J9P C;  2WAM A;  4FM1 A;  3IJ4 A;  4DUZ B;  1SRY A;  1N36 B;  1L1F A;  4IGG A;  4QPK A;  3G80 A;  5JQG A;  5JH7 B;  2DQ0 A;  2QTO A;  1OV9 A;  4U3F H;  3STZ C;  1NI8 A;  4I0X B;  5LHH A;  1I94 O;  3K79 A;  3L70 H;  2EUL A;  3ABL B;  3NXS A;  4LF7 O;  4B08 A;  3H01 A;  4DV1 B;  4CBC A;  2GUZ A;  4JYB A;  1XMQ B;  4JTA B;  2Q69 A;  3P3N A;  3CPW U;  3QNE A;  3E35 A;  2UU9 B;  3DXR A;  1QQC A;  1SQQ H;  3O65 A;  3PJS K;  4JZG A;  4CH3 A;  3ZMZ A;  5LXT B;  5CB4 B;  3AG1 C;  1O9G A;  1W59 A;  4PDR A;  4PI2 A;  3RYF A;  2WSS G;  2QJ1 A;  4DR4 B;  1AIL A;  4MTX A;  5LYJ B;  1H38 A;  1EBO A;  1VF6 C;  4JI6 O;  3K3W A;  2QKA A;  1EN5 A;  2JRI A;  5EZY B;  5EBL C;  5BXZ A;  4FVM A;  2MK3 A;  4YJ3 A;  3ABU A;  1K5S A;  4D7T A;  1W0J G;  1Q6I A;  3GB7 C;  1F4M A;  3CCS V;  3CD6 V;  2RN9 A;  3ZX6 A;  3OGC C;  3A0R A;  5KAF Z;  1PM9 A;  2Q8V A;  4DV0 B;  1I5Y A;  2ZM6 B;  5FNV B;  2ETN A;  2VQE B;  5TIS Z;  3FKS G;  2K1E A;  4RUF A;  3ZHV A;  4FLU A;  3ZED A;  4CS3 A;  4IHJ A;  1XIL A;  3U10 A;  1Y4M A;  3ETG A;  4FJC C;  1XL6 A;  2ZR3 A;  1QVG U;  2RCV A;  2RMK B;  2D3O W;  2BTQ A;  3KKY A;  3FB6 C;  3OFN G;  4LFB B;  1YZB A;  3FB8 C;  4LR3 A;  1ZTE A;  5CA3 A;  4EKW A;  4ZIB A;  2KKW A;  1NR7 A;  1S5H C;  4H0L B;  3JAL A;  3K03 A;  4ZHQ A;  1RP3 B;  3W7U A;  5B1O A;  4ZKI A;  2WLL A;  4X66 B;  3K08 A;  5CA0 B;  4JI7 B;  1M57 B;  3WFV A;  2VWK A;  1WPB A;  2A7W A;  4LF4 B;  2VWJ A;  1IDS A;  2JEX A;  2W6I G;  2N05 A;  1SQB H;  1XUQ A;  4X1Y B;  4JI3 B;  3SYQ A;  4W4L A;  1OJH A;  1FJG B;  2F93 B;  2CGN A;  1JOY A;  1HNW B;  3VQV A;  2BE3 A;  4KXR A;  3EFF K;  1HNZ O;  2OWO A;  5IYZ B;  2CDY A;  1QR8 A;  3CRM A;  5LP6 A;  3NR7 A;  5B5E Z;  1KP3 A;  1YCI A;  3L9D A;  2XAS A;  1Q6U A;  4R6Z A;  4O2A A;  1TVK A;  4QGP A;  5KA6 A;  1G4Y B;  4UB8 Z;  1EN6 A;  4DUY B;  1R3L C;  1Q43 A;  1X59 A;  4B3T O;  3SYO A;  3CCL V;  3ZN1 A;  4DR6 O;  4LFC B;  3GWK C;  3QO7 A;  4AQY O;  2HVJ C;  4E2L A;  4BIU A;  1F7Y A;  1HNX B;  4FMT A;  3CC4 V;  2L6L A;  3MHH C;  4DV5 O;  1K73 W;  4F6R A;  2D2C B;  1GN2 A;  3MHS C;  1Q8I A;  2QWP B;  1VQL V;  1XBL A;  5KHG A;  2Q0O C;  4B3R O;  1GM8 A;  5LA6 B;  4JI2 O;  1GRJ A;  4HAM A;  4QPJ A;  2K9P A;  1N33 B;  1TUB A;  4UCR A;  2AHY A;  4X64 B;  3KCX A;  5AG2 A;  3K5L A;  1R6N A;  5IWA O;  1KBH A;  4WFE A;  1OCC C;  2AZ2 A;  1CEZ A;  3ASN B;  2DW4 A;  1R3J C;  3A8T A;  1M1K W;  2ZQM A;  1K4D C;  1JQ0 A;  4YY3 O;  1OCC B;  3LDE A;  3IGA C;  1AVM A;  1FFT B;  3B09 A;  3SPC A;  1TGO A;  2EIM C;  2ZIN A;  2R72 A;  3LSQ A;  3M7M X;  3RYH B;  3CME V;  3B40 A;  1MG1 A;  1T5E A;  4NB5 A;  4CH6 A;  1I94 B;  2EIM B;  2CTQ A;  4GX5 A;  5KX5 B;  4LF7 B;  4O2B A;  3OUS A;  2OIE A;  4HNA A;  2IU0 A;  4UCS A;  2UXN A;  2DYS C;  4TOI A;  4CH4 A;  2R9A A;  3JSL A;  3KZI Z;  2GV9 A;  1J95 A;  3A0B Z;  3JAR B;  4X1K A;  4J42 A;  3CJH B;  5H6Q A;  1R3I C;  4BIZ A;  3THO A;  3ZMT A;  2Y0I A;  2GTA A;  3QG5 A;  3ZHU A;  4GX2 A;  1M4U A;  4Q20 A;  2WLI A;  4LNU A;  4J7K A;  3E83 A;  2FTK A;  1GO3 F;  1IXM A;  2FKX A;  2WA4 A;  4JI6 B;  3BRC A;  3WG7 B;  1NJI W;  1YHQ V;  3T4D A;  2N04 A;  4UVC A;  5KMG B;  2DYR C;  5IY5 B;  3E8F A;  4WFB V;  1J5E O;  4UCU A;  4JI8 O;  2LP7 A;  2DYR B;  2ZKO A;  1TAE A;  1Y66 A;  2XOK G;  2QKC A;  4K3A A;  5EYP B;  4GLX A;  2PYL A;  1XNR O;  1BQ0 A;  1MA1 A;  5B66 Z;  4B7E A;  1NBM G;  1QVF U;  2RJZ A;  2ZDI A;  4NTW A;  3CCQ V;  1KYO F;  4DRX B;  4JGS A;  4O4L B;  2EIN C;  1Z2G A;  2ZR2 A;  2VS0 A;  4P2Z A;  2FYU H;  4E4E A;  2EIN B;  4DUZ O;  1AI5 A;  3D8C A;  1N0J A;  2W6J G;  1OZ0 A;  3UO3 A;  1HW7 A;  3APQ A;  4FLZ A;  4U7O A;  4WCE V;  1B06 A;  3CX5 F;  1JFF A;  4GZR B;  4LP8 A;  2YUA A;  5GW7 A;  1XHX A;  5CBF A;  4X89 A;  5LGT A;  2UUA O;  1PL4 A;  2ZNJ A;  4PA3 A;  1NVP B;  5IJ9 A;  3JD0 A;  5K1X A;  2IJH A;  3R66 A;  1IBM O;  3LSU A;  1RFY A;  1D5A A;  4NXM O;  2YXY A;  2ILM A;  1FXK B;  1MZF A;  3O9O A;  5L3E A;  3S3X A;  4CZZ A;  2EIK B;  1HNZ B;  2NR5 A;  1GAX A;  1MNG A;  3IC7 A; 
#chains in the Genus database with same CATH homology
 3Q4H B;  2AZ2 A;  1WA8 A;  4I0X B;  2DE0 X;  2B9Z A;  3Q4H A;  2VRZ A;  4I0X A;  3GWK C;  3TXQ A;  3FAV B;  3GVM A;  2KG7 B;  3FAV A;  3O9O A;  3HR0 A;  4ABM A;  2KG7 A;  2AZ0 A;  4LWS B;  3TXS A;  3OGI B;  4GZR B;  3FD9 A;  4LWS A;  3ZBH A;  3G80 A;  2VS0 A;  1WA8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...