3OGIB

Crystal structure of the mycobacterium tuberculosis h37rv esxop complex (rv2346c-rv2347c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
89
Chain Sequence
b'FMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ESAT-6-like protein 6
molecule tags Structural genomics, unknown function
source organism Mycobacterium tuberculosis
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
total genus 27
structure length 89
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3ogiB00
3FD9A 2DE0X 4I0XA 3TXSA 4LWSB 3O9OA 2KG7B 2VS0A 3FAVB 2B9ZA 3Q4HA 3GWKC 4ABMA 3GVMA 3G80A 3ZBHA 4GZRB 4I0XB 1WA8A 2KG7A 3Q4HB 3TXQA 3FAVA 4LWSA 2AZ2A 2VRZA 3OGIB 1WA8B 2AZ0A 3HR0A
chains in the Genus database with same CATH superfamily
4DR6B 2ADPA 5LL6Y 4LH7A 3CCMV 1KBHA 1EN4A 1THZA 1G6UA 4ZIBA 3B77A 4LF9B 5D5PA 4I55B 3SYAA 3UO3A 3IFXA 4UVAA 2PGGA 2UUCB 4DR3O 2ZDIC 1PP9H 4JI1B 2VWKA 3B09A 4PA9A 1BSMA 5B1AB 1AR1B 1IBKO 2LW7A 3K0DA 1SQPH 4K0KO 2ZD9A 5J2UB 5BMVA 3M7MX 1MA1A 2EINC 2F43G 5FL7G 3K08A 3AG7A 4QNHB 4B3RO 4RWUA 4UCVA 1XMOO 2ZIMA 3HPLC 1Y4MA 5EC2C 5H2FZ 2JS5A 5LXTB 3JAWB 5LA6A 5IJ9A 1AP5A 1H38A 2PYJA 1K9MW 1JFFB 4YIOA 2WA4A 1BZKA 3O65A 2LQTA 5CBHA 1XQ8A 4JYBA 2Z3YA 3EFFK 2VS0A 4EB6A 4QJFB 5B3SB 4X66O 1NS1A 4R50A 1Y74A 3JARA 1Q6IA 4DUYB 3TJTA 2QGNA 4GX5A 4EB6B 4GUNA 5GTIZ 3BFRA 1KKDA 4X89A 3AG3B 1VQNV 5K1XA 3JD2A 2WPDG 3TK1A 1KECA 2P4KA 2GHYA 3L9DA 3CSXA 4J11A 2Z5UA 4MTFA 2R9RB 1K3EA 4FFKA 1M90W 3AK1A 4PELA 1H2SB 2RMKB 4LH6A 4BR6A 4JYYA 1VQMV 2ZXWB 3KCYA 2UXBO 4DR6O 4DR5O 3E22A 4CS2A 4JZGA 1N36B 4H33A 1UPGA 4O4JA 1N34O 1JJ2U 4LF9O 5IYZA 5B1OA 3P32A 1FXVA 1MMMA 3D3QA 3RYCB 1GRJA 3JASB 2LO1A 2QKCA 2CK3G 5J2TA 2CH7A 3CE2A 1Y67A 2Q9LA 5JH7A 3IC9A 5B1BB 4PA4A 4KHPB 1M93A 4F4LA 3JATB 1WP7A 2EZOA 1XMOB 1GTOA 5BR8O 1FPOA 4ZI7A 5LHIA 3KKYA 2P22C 4DR2O 4DR1B 3T1CA 3SDLA 1ZX3A 2HR3A 2EX3A 1F23A 4DV1B 3ZHUA 3ZN1A 1FJGB 2W0FC 2CDYA 4MS2A 5LHHA 3CWBH 4GZRB 3BRCA 4BW5A 2P5OA 3E2EA 4LNUA 2IBZH 3BAAA 3DGEA 4H44B 1K7DA 4FLUA 3QO5A 1CXZB 1PNMA 2WLNA 1M4UA 4U3FH 1CP9A 2L35A 1DF5A 4JI7B 1EN5A 3K57A 3RYIB 1SS3A 4EFEA 4KXRA 4ABMA 1YJ9V 5EZYA 3JCZA 2H94A 1S77D 2YIDA 3CHXA 4FIPC 4I50A 5B1NA 4XDLA 3ML0A 3MHSC 4NTWA 1NVPB 3FFQA 2ITDC 5EZYB 2OCCB 2LJ2A 3C3TA 2BTOA 5CA1B 1FXKA 1LR1A 4D7SA 3ETGA 3SYPA 2YDEA 2JGUA 2UXDO 2XOKG 5IYDO 1NKDA 4LFBO 2RN9A 4WFHA 2X6AA 3R66A 1AR4A 3RYHA 4D6TH 2O57A 3CPWU 5KLVH 2E76B 5JWPA 2CE4A 2CUGA 4EEQA 4JAUA 3ABLC 1PPJH 2FMLA 2MK3A 4B7EA 1VP7A 2ZE8A 4JI0B 2EIMC 2CAZC 3LSQA 4TUYA 3G80A 2KKWA 2FL4A 2EIKC 4CH6A 2EIMB 1V54C 2UUBB 1DGSA 3ICXA 2ZM6B 2AHYA 5LMNB 4TUYB 2BE3A 1BCCH 3C90A 4XBFA 1I5XA 2GUZB 4JAAA 4X66B 4DW0A 3LDEA 3CC7V 1Q43A 1NH2D 4RQFA 4DUYO 4JZ2A 3TGUH 2V4DA 2WLKA 3ABMB 2QWPB 2DQ3A 4DXWA 3W7XA 2Y4UA 4GKKO 1SQGA 3BCCH 4CC5A 3WG7C 1TVKA 5L3FA 5LA6B 2RDCA 2WLHA 2ZR3A 4CC6A 1E79G 2BTQB 4IHJA 4H0LB 1JPXA 1XUQA 3GWKC 4DR4B 1XI1A 1FFXA 2YUAA 1JX9A 3ETDA 3SPJA 2BTQA 1IVSA 3OAAG 2HG5C 4HYOA 3RVZA 2FTKA 4LF7B 5CA0B 4OX9B 5H6QA 4ZOLB 3LDDA 5H9CA 3OMAB 4MVQA 4DR5B 3VBBA 1IDSA 2IW5A 4LWSB 2HHHO 2AW9A 1QHTA 1I7FA 5EYPA 4JI4B 1SA0B 5JJNB 1XL4A 1H2KA 2CTWA 4YJ2B 2YXYA 3FX7A 1HP8A 4X65O 3GVMA 1JQ0A 4B3MB 2YEVA 1WPXA 3K0GA 2X6BA 1JOYA 1OCRB 2LFSA 1RSOB 5CN0A 2CTQA 2P6JA 2EBOA 3ZRWB 1N34B 1YDXA 3N2KB 1KD1W 2JK5C 1N0JA 1YCIA 1F4NA 1JFFA 1YVWA 1VARA 4MVRA 3N2KA 1Q6HA 3CRAA 2QKSA 2F66C 2OIEA 4JI0O 1FYJA 2BSKA 2OIGA 4NTXA 4J9ZB 1X59A 2YIAA 2ZQMA 1MZEA 4G28B 1JR9A 1Y74B 3CJHB 1MZFA 3SJBC 1W0JG 1JA8A 1Z5VA 4R6ZA 3B40A 2EJRA 3OEEG 2ETNA 2K1EA 3ZS8C 4LFAB 1R73A 1YIJV 5E79Z 4UCOA 2Y48A 2ZE5A 1WJZA 3K5MA 3JATA 4DV6B 3OUSA 2QWQB 4FM2A 2R70A 2YSUB 3N27A 5KX5B 3CCVV 3B8MA 1SQQH 2Q0OC 2B9ZA 4H37A 2DYSC 4FLYA 2Q69A 4J10A 4H13B 4R8CA 1GM9A 3P3PA 4WBNB 5LMUB 4JI2B 4I9QA 4P2ZA 2VRZA 3ABLB 1K5QA 1S76D 2FKXA 1NBMG 1QVGU 4LNUB 3ABTA 2KSDA 3L71H 3Q4HA 2UU9O 3JALA 4NB5A 4K35A 4J9YB 4PDLA 4TV9A 2LGWA 4LFCB 5L3BA 5J2TB 4U3JB 1EZJA 1OCZC 4E2LA 1K8AW 3VQXA 4MVUA 5JVDA 1R6NA 4JAVA 1ZTEA 1H2NA 4MTOA 1BE3H 1XEQA 5ITZB 2H8PC 3P30A 2Q8VA 1ZWIC 2WLLB 4N23A 4IT5A 2A7WA 1I0HA 3E86A 5BY1A 2EILB 2ZM6O 3APQA 4ICGA 3B8NA 3CS5A 4BW9A 1NU1H 4XDKA 5ITZA 2WLLA 1QLNA 3HKCB 5JJJB 1MABG 4NR1A 3CRMA 1HNWB 4LF5O 5IWAB 1HW7A 5DECA 2AHZA 5H5NA 1YF2A 2ARHA 4MT8A 1EZVH 3CCRV 1D5AA 3CC2V 1E1QG 4JTCB 3KG2A 1IBLO 3JSNA 1XILA 2JVDA 5B5EZ 3ZRVA 1NTKH 3UQ8A 3TCUA 2ZNJA 1BQZA 3T1HO 3DC5A 1VQOV 1N32B 5LGUA 3PJSK 2A9HA 1ZUQA 1Z2GA 3SYQA 2R9AA 2VQEB 1F51A 1Q86W 1XL6A 1NH2B 4LC1A 2WA3A 4NYKA 1P49A 3N2GB 3BHPA 3OT7A 1SZTA 1N8RW 3IJ4A 5BXZA 1RPRA 5L3EA 5L3DA 5LOVA 3HKBB 4Q6GA 2ZINA 3ZBHA 1VQ7V 2P90A 5KAIZ 5LP6B 3CP1A 5HFLA 2YC0A 2VWJA 4GCZA 2N05A 3CC4V 2OTLV 1OHHG 4YY3O 3ZHRA 3JYCA 2IH1C 1R1BA 2CGNA 3BABA 2XTAA 2OYQA 1BMFG 4KUMA 1WPBA 1R6TA 1AROP 4HAMA 2HLDG 3SJQC 2Y0PA 5AG2A 4JYCA 3SJCC 4O4HB 4I55A 5EBWC 3K04A 2W6JG 1AI7A 4X1IA 2F23A 2WSSG 3OD4A 5DN6G 1P4RA 4MVSA 2XAFA 4ZKIA 4FLZA 1PD3A 3OMIB 4OPAA 2VQFB 4IHJB 4FZ1A 1LUWA 3BVOA 2W0XA 5LXTA 1GN2A 2PUSA 5H6RA 1FD9A 1Q3EA 1QBZA 5LMNO 4O2AB 2UXBB 3TXSA 3L75H 3H1IH 2V1DA 2QA4V 3SR2C 1G4YB 2IU0A 4PA7A 1YXBA 3E35A 2HP8A 4TV8A 1IBKB 3OTOB 1ORQC 3K3WA 1NTZH 3RYFA 3K9AA 3QTCA 1H8HG 3JARB 5LMUO 4TV8B 4FFBB 4LF6B 4JPRA 1K4CC 2ODMA 1VF6C 2ADQB 4UCUA 5JQGA 2ATKC 3T1YB 3E8GA 1W0KG 2DYRB 3OEHG 4B3SO 3W7SA 2UXCB 1N4CA 4DV5O 3THOA 5JQGB 2Q73A 4F6RA 3HKDB 2Y69C 1GO3F 4FVMA 3GWOA 5LHGA 2EULA 1J95A 1SRYA 3CB2A 1HNXB 2E75B 3H01A 2KG7B 4KL1A 1N0NA 1XBLA 1RM1C 3HKDA 5DM6V 3SGIA 2WLJA 1KQSU 1FKAO 1GN6A 1WA8A 4DV7O 4GKJO 1R3IC 2XAGA 5KUKA 1F7YA 4MTXA 1UFIA 2B1IA 3ZHQA 3ETQA 5LGNA 3STLC 2ZCEA 1L0NH 4FLXA 4WFGA 2GSMB 1BHAA 3CXHF 2X0LA 5J2UA 1SESA 1HNZB 1D2DA 1VQ4V 4DO2A 4X1KA 1B06A 3BEHA 4DV6O 2DMXA 1P7GA 3K79A 3B2EE 3IC7A 2QWRB 3QNEA 5IJ9B 4ZHQB 4C7UA 4G2KA 5LBQA 1VQ6V 1U97A 1OCZB 3IGAC 4ZOLA 4UFZA 3ABMC 4JYAB 4X88A 4JI3B 1PM9A 4YJ2A 2QSAA 3HKEA 1XREA 3OM3B 2JEUA 1IBMO 5FLXN 2A06H 3HKEB 4QE7A 2HVKC 4J42A 4O4LB 4MTGA 4IGGA 3K59A 4B3TB 3F7YC 4YIPA 4WCEV 3TXQA 1RM1B 4LP8A 4FPPA 1Q82W 4U7OA 4GX2A 5EBLC 1QLEB 1X4TA 3I5DA 2WWWA 2Y69B 4PDMA 2EJ7A 3QO8A 3SPHA 4O2BA 2VQFO 4ZBMA 1M56B 1HR0B 2QWNB 2JRIA 4LF5B 3ASNB 1LUVA 4JV5O 1I5YA 4TWKA 4K8XA 2YI9A 4TQDA 2XAJA 3STZC 2E5LO 3X2QC 2ITCC 2GBOA 3AG4C 5EBMC 2EIJB 3X2QB 4RUFA 5CB4A 3AG4B 1VQPV 3VQVA 1IXBA 1HWYA 3H1JH 2QDOA 3SYCA 2OWOA 4Z1MG 4JI5O 4X1YB 3VQWA 1CEZA 2Q67A 1BQ0A 5FPOA 2Q7GA 2QM8A 3AK3A 3ZJZA 4LR3A 1FAFA 5KMGB 5IE9A 1IBMB 1E1RG 3DSQA 4WFEA 1TUBA 3SPIA 4J7KA 3DTUB 2DOSA 2QR4A 3LNMB 4O4JB 3FYIB 2ZE7A 1PV0A 1FXKC 3E89A 1YI2V 4FM0A 1ZSPA 3ZMUA 2IJIA 4TSFG 2F1MA 1VF7A 4DR4O 4IIJA 2OCHA 3JALB 4CS4A 1XMQO 4PI0A 4KFMA 1WAZA 4P9PA 4OX9O 4XDJA 4PD4F 4JTAB 4IIJB 3VOUA 5IDJA 2JDIG 4B3SB 2P06A 4DRXA 4LFBB 4O2AA 4I5SA 3A0BZ 4B7KA 1L0LH 1YTFB 1GM8A 2E5LB 2D2CB 2YXHA 1XDCA 2UXDB 1Y66A 1JVMA 3JAKB 1NQTA 2OT5A 3RYFB 2EINB 2QM7A 1DF4A 1WB7A 2P7TC 2YIBA 1MNGA 3HB3B 1GKFA 2GTAA 1EFRG 1GM7A 2XT9A 4AQYO 1R3KC 4JV5B 1VF5B 3ZX6A 1K73W 1QQCA 3OMNB 3CD6V 4A5UB 3F5WC 3SPGA 1GN4A 3I55V 1V54B 5L3CA 3FB7C 3J7AU 4MVZA 4UXNA 1FXKB 2HKOA 3NXSA 1PL0A 3OFNG 5K1PA 2Q5ZA 3MD0A 2P67A 2YXLA 1ZL8A 3L74H 1YTFD 2HJFC 1BL8A 1OCCB 1NZ6A 3ZRXA 3RYHB 5IT9N 3QG5A 3BA8A 4LBEC 3ZHSA 5KHIA 1FFTB 5IJ0B 1F4MA 4JTDB 4F6EA 1XHXA 4UUJC 4UVCA 3BY6A 3CRRA 1R3LC 3CCEV 3GB7C 4PV1B 2QJ1A 1IXMA 2F4VB 4UCRA 4JI4O 2AGAA 1R3JC 1AI4A 2QM4A 4Q20A 2A0LA 1M56C 2A3QA 1XNRO 4LF7O 4JASA 2CGOA 2JIZG 3CYOA 4Z2WA 3UT5A 2K9PA 2PF4E 2HHHB 4GKJB 5L3GA 3AG2C 4BAYA 2CTPA 2PY5A 1TVKB 4I9WA 3OGCC 4E4EA 1Q81W 3L72H 1IBLB 1IX9A 4PHZA 2Y4TA 2YEVB 5KUMA 1H2LA 4JF3A 2NNUA 4R7CA 3JAMN 1RPOA 1FFXB 2ZT9B 3RBZA 4D7TA 4JI5B 4RQEA 1WNSA 5A9GA 1HNXO 1DLBA 4HZ3A 2ZNIA 1OCRC 2Q0AA 2XUMA 1GMGA 4HNAB 3JSLA 4LF4B 1YJWV 1XNQB 1T5EA 2UUBO 1PNLA 3OE7G 5IY5B 3BA9A 5KHGA 5KAFZ 2XAQA 1JMKC 4TT3G 3T2MA 1N36O 4X62B 3WB2A 1WB8A 3UKMA 2CTRA 1VF6A 4JI3O 3ZRWA 1NVPD 4O4IB 4QPKA 3UO2A 1N33B 4MVMA 1ZLZA 3B4SA 4FK5C 4L87A 1SQFA 1NTMH 3L73H 4CH4A 5KA5A 3ASOC 1L1FA 2KB1A 4X20B 4DUZB 2ZXWC 4MW8A 1FXHA 2QKAA 1YHQV 1QCEA 1Q7YW 4FLWA 1XMQB 3ZMSA 1SQVH 4LCUC 1M1KW 3L70H 1K34A 2Q6AA 3LNNA 3DXRA 2UXNA 2LW1A 3CX5F 4DR2B 3S3XA 4WFBV 1B6QA 5CMUA 2AZ2A 4JYAO 3E83A 4CBCA 3LSUA 4LFCO 2RCVA 5EC1C 4O2BB 2IU3A 1ROPA 1XOUA 3SJAC 1S72V 4NXMB 2Y0IA 1VQ8V 1KKCA 4X64O 1NT2B 4AHCA 3JASA 1SZXA 2R9IA 1KU9A 4G27B 1URFA 4PA6A 3BPZA 2ZIOA 5C93A 1AR5A 2ILMA 1AI5A 3QVNA 4B3TO 1VQKV 1QNMA 5BR8B 5A2QN 2A79B 2UUAB 4I0XA 4X62O 1TA8A 4DV4O 1QR9A 1H8EG 4DR1O 1Q90D 1VQLV 2PYLA 2ZR2A 3JCUZ 1IURA 1VIBA 4I0XB 1AB3A 1TAEA 3MDSA 1KUQA 3LUTB 3CCSV 1BT8A 5KX5A 3CCUV 1D5NA 1B04A 4OPHA 3ZMTA 2L6LA 4DV3B 2EIJC 3E22B 3RW0A 3ZN0A 1SETA 2IM9A 4AQYB 4O4HA 2OTJV 4WBNA 1U96A 3HKCA 4DR7O 1TGOA 2B5UA 4IL6Z 4BIZA 1GH6A 3K9SA 4JI7O 4L8JA 2P4VA 1BS3A 2KQXA 4K3AA 1SQXH 4LFAO 2RQ6A 3FAVA 4YHHB 2DW4A 3VQYA 2E3CA 2HFEC 2VQEO 3ZCCA 2GTSA 4TV9B 2AXTZ 3CCQV 4JI6B 3EXAA 4U3JA 1J5EO 4NXNO 4K8ZA 2HJDA 1WP8A 5JVDB 3FB5C 5CA1A 4RO2A 1QR8A 1XNRB 4J41A 2DN9A 1AJPA 3U0ZA 2M6YA 5IJ0A 1EBOA 3APOA 2QE7G 3OUFA 1AI6A 2F95B 1WLEA 5F2VO 5E1AC 2LFRA 2UU9B 4PI2A 4DW1A 3ABKB 4OXSA 4X64B 5B1BC 1P84F 5CB4B 2Q7EA 3AEIA 4QGPA 2QTOA 3ABUA 2JGDA 4Z1VA 2OCCC 1G8MA 1OZ0A 4F6RB 4FMTA 3G71V 3KCXA 4IYIA 5KMGA 4BIOA 4CH3A 4DYLA 2E74B 3D36C 2GUZA 4IYHA 5B1AC 1G1XB 3ASNC 4KHPO 4GLXA 4CH5A 2EZPA 1EN6A 4GX0A 2F93B 4PDRA 4QPJA 4I7ZB 4TOIA 5JCOA 1US6A 1K4DC 3K5NA 4JI6O 1JJOA 1M5IA 2X6CA 3E8BA 2XNDG 3P3NA 1YJNV 5C8YB 3H1HH 3E8HA 4DV1O 3RYCA 3U10A 5JCOC 3RWRD 3ZHVA 3RT3C 4LF8B 4YJ3A 4DRXB 2Q7HA 3FD9A 3G67A 3S3WA 3FKSG 2QEXV 5LP6A 1AVMA 1A32A 3FB8C 4YJ3B 1OJHA 1MSWD 5GONB 2R72A 4CZZA 3H1LH 3W7WA 1N32O 1Z5WA 1BGYH 3K5LA 2Z0AA 5LGTA 2UXCO 1NI8A 3JD0A 2IJKA 2DE0X 1B3QA 1S5HC 1RSOA 4DV0O 1PKXA 3G6EV 2NN4A 5BMVB 1H2GA 1W59A 2EILC 4NXMO 1GN3A 4DV2B 1FS0G 1NR7A 4JI8O 4N21A 4FJCC 3W7UA 4O4LA 4DV4B 1QU7A 4GT1A 1FJGO 2YS8A 1OCOB 3JD4A 3LSSA 3ZHTA 5IY5C 3EHBB 4HNAA 1O9GA 4PA3A 5CA3A 1UJWB 4FLVA 1O9HA 2G38A 3AK2A 4X9QA 3MAQA 2LP7A 4MW3A 5KA6A 1MOFA 1DK1A 1KYOF 3SPCA 1AILA 1HDJA 5EK0A 4LWSA 3WB1A 3OGIB 4DV7B 1WA8B 3AG3C 2LGQA 1TUEB 2QWOB 2N04A 4FM1A 5CBFA 4X65B 5DEDA 1N33O 2ZE6A 5HFMA 2C2AA 3CCJV 1K92A 3A8TA 2XHBA 1SKVA 4DUZO 5B66Z 3J81N 2FYUH 1MSDA 5GTHZ 3ZMZA 4TQFA 1YSCA 1VQ5V 4JGSA 3FB6C 1S5JA 5FPRA 3ZRSA 3WFVA 2WAMA 1OV9A 1H2MA 3ZIAG 5LP6C 2YIBD 1Q6UA 1I94O 2H3OA 1J5EB 4NXNB 4JI8B 4WFAV 3CJHA 5D5QA 4EKWA 1YEWA 4FLTA 1K5SA 2V7QG 1SERA 2YICA 2PZSA 4JI1O 2XASA 1PNKA 1V9PA 3CMAV 4YXWG 1P7BA 2ZKOA 3K06A 1K33A 5JJEB 4DV0B 2GV9A 3Q4HB 4B3MO 2EIKB 1HR0O 2MW2B 2HVJC 2XAHA 5KHJA 3T4ZA 4J80A 1OCCC 4X8AA 3JAWA 3W7TA 1SQBH 3JD1A 2IJJA 2QTSA 4FZ0A 1M9NA 1Y76B 3JAKA 3CMEV 5KHKA 4UB6Z 4ZHQA 5FNVA 4LF8O 3F7VC 4DV3O 3WB0A 4BIUA 4GX1A 2DYSB 3M8AA 5EYPB 2JEXA 3AG2B 1Y76A 1KMIZ 1SA0A 4NKGB 1OCOC 5FNVB 1RFYA 4O4IA 1BHBA 1COWG 3O9OA 3QO7A 2UUAO 1R6KA 3FAVB 5EIBC 3LDCA 3ASOB 1I94B 1YZBA 5IYCO 1SF9A 3E8FA 4QE9A 3RN4A 1GK9A 4X20A 1HNZO 3CEIA 1VMGA 1JCHA 2DWDC 3RYIA 2WLMA 4GKKB 4RAIA 4JI2O 3IAYA 3ETEA 4UCSA 1I08A 4UV9A 4B3RB 1ENVA 2NLJC 2GDSA 1YITV 3M99B 3DXRB 3CCLV 1AJQA 1DTOA 3SYOA 3WG7B 2BOCC 4DR3B 1QVFU 2DQ0A 3A2FA 3N2GA 2RNBA 1TUBB 1KB9F 2JS3A 3K58A 4K0KB 3OW2U 4ASUG 5C8YA 4QIWF 3G6BA 5CBGA 5LOVB 4DK0A 3OR7C 3H1KH 3U11A 5BZBA 4YHHO 4GYCB 5LYJB 1KC8W 1M57C 3D36A 1QLEC 4X1YA 3CRCA 5IYZB 1GAXA 1M57B 1W2BU 3UCSC 1IZ3A 2Q68A 4BWAA 5LYJA 2CH7B 2BCCH 3D8CA 2JGDB 2DYRC 4U7NA 2NR5A 5JH7B 2AZ0A 1AP6A 2PTMA 3RFRA 4WF9V 3OR6C 3K5OA 5GW7A 3G4SV 1K97A 3J80N 3OTOO 4AI8A 4I4TA 4UCTA 1EM1A 1LNQA 4MSWC 3H9VA 2JJ1G 3ZEDA 1WN7A 2UXXA 4I4TB 4EFBA 4WFFA 4DK1A 1SC5B 2BOBC 3FYEB 4KP4A 1MG1A 1HNWO 3DC6A 4P30A 1XNQO 3MHHC 1XHZA 2F4VO 4CS3A 4UV8A 1NR1A 2JJ2G 2N74A 3T1HB 4X1IB 3WU2Z 3EVKA 3CXCU 2HEPA 1CPYA 2PI5A 2Q4PA 1S0VA 2DWEC 1S5LZ 3NR7A 4PDVA 5KHHA 4NTYA 1PL4A 5TISZ 2UUCO 5CA0A 3C3SA 4ZI7B 4FFBA 2DJVA 3CRQA 5IYBO 4YY3B 3KZIZ 1ZL8B 3D3IA 4J7ZA 3A0RA 4RUEA 5B3SC 3HR0A 3A0HZ 2IH3C 2W6IG 2IJHA 1L8DA 3T4DA 2PI4A 5J9PC 1VEWA 2M7WA 2X7RB 2YI8A 4UVBA 1ZAUA 2D3OW 3PN1A 3QF7A 1KP3A 3TETA 1Q8IA 3AG1C 1KP2A 4MVOA 1VQ9V 4PJ0Z 4B08A 1S3JA 3F5TA 4AILC 3JD3A 1V55C 3K03A 3RGBA 2WLIB 2BSKB 1V55B 4I50B 2RJZA 1Q5OA 4W4LA 2WLIA 3AG1B 2KG7A 3ABKC 3UM7A 3OTFA 4NVPA 4LF6O 3I56V 4DV2O 3HKBA 4HBNA 4LF4O 2B1GA 2ZDIA 5IWAO 3T1YO 4UB8Z 3R65A 1RP3B 4W4KA 4OGQB 3RVYA 4DR7B 4DV5B 3ZMVA 1NJIW 1AJNA 5EIBD 1Y6XA 3UT5B 4P9OA 2FB5A 4X1KB 4J7JA 5GONA
chains in the Genus database with same CATH topology
3FD9A 2DE0X 4I0XA 3TXSA 4LWSB 3O9OA 2KG7B 2VS0A 3FAVB 2B9ZA 3Q4HA 3GWKC 4ABMA 3GVMA 3G80A 3ZBHA 4GZRB 4I0XB 1WA8A 2KG7A 3Q4HB 3TXQA 3FAVA 4LWSA 2AZ2A 2VRZA 3OGIB 1WA8B 2AZ0A 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD9 A;  2DE0 X;  4I0X A;  3TXS A;  4LWS B;  3O9O A;  2KG7 B;  2VS0 A;  3FAV B;  2B9Z A;  3Q4H A;  3GWK C;  4ABM A;  3GVM A;  3G80 A;  3ZBH A;  4GZR B;  4I0X B;  1WA8 A;  2KG7 A;  3Q4H B;  3TXQ A;  3FAV A;  4LWS A;  2AZ2 A;  2VRZ A;  3OGI B;  1WA8 B;  2AZ0 A;  3HR0 A; 
#chains in the Genus database with same CATH topology
 4DR6 B;  2ADP A;  5LL6 Y;  4LH7 A;  3CCM V;  1KBH A;  1EN4 A;  1THZ A;  1G6U A;  4ZIB A;  3B77 A;  4LF9 B;  5D5P A;  4I55 B;  3SYA A;  3UO3 A;  3IFX A;  4UVA A;  2PGG A;  2UUC B;  4DR3 O;  2ZDI C;  1PP9 H;  4JI1 B;  2VWK A;  3B09 A;  4PA9 A;  1BSM A;  5B1A B;  1AR1 B;  1IBK O;  2LW7 A;  3K0D A;  1SQP H;  4K0K O;  2ZD9 A;  5J2U B;  5BMV A;  3M7M X;  1MA1 A;  2EIN C;  2F43 G;  5FL7 G;  3K08 A;  3AG7 A;  4QNH B;  4B3R O;  4RWU A;  4UCV A;  1XMO O;  2ZIM A;  3HPL C;  1Y4M A;  5EC2 C;  5H2F Z;  2JS5 A;  5LXT B;  3JAW B;  5LA6 A;  5IJ9 A;  1AP5 A;  1H38 A;  2PYJ A;  1K9M W;  1JFF B;  4YIO A;  2WA4 A;  1BZK A;  3O65 A;  2LQT A;  5CBH A;  1XQ8 A;  4JYB A;  2Z3Y A;  3EFF K;  2VS0 A;  4EB6 A;  4QJF B;  5B3S B;  4X66 O;  1NS1 A;  4R50 A;  1Y74 A;  3JAR A;  1Q6I A;  4DUY B;  3TJT A;  2QGN A;  4GX5 A;  4EB6 B;  4GUN A;  5GTI Z;  3BFR A;  1KKD A;  4X89 A;  3AG3 B;  1VQN V;  5K1X A;  3JD2 A;  2WPD G;  3TK1 A;  1KEC A;  2P4K A;  2GHY A;  3L9D A;  3CSX A;  4J11 A;  2Z5U A;  4MTF A;  2R9R B;  1K3E A;  4FFK A;  1M90 W;  3AK1 A;  4PEL A;  1H2S B;  2RMK B;  4LH6 A;  4BR6 A;  4JYY A;  1VQM V;  2ZXW B;  3KCY A;  2UXB O;  4DR6 O;  4DR5 O;  3E22 A;  4CS2 A;  4JZG A;  1N36 B;  4H33 A;  1UPG A;  4O4J A;  1N34 O;  1JJ2 U;  4LF9 O;  5IYZ A;  5B1O A;  3P32 A;  1FXV A;  1MMM A;  3D3Q A;  3RYC B;  1GRJ A;  3JAS B;  2LO1 A;  2QKC A;  2CK3 G;  5J2T A;  2CH7 A;  3CE2 A;  1Y67 A;  2Q9L A;  5JH7 A;  3IC9 A;  5B1B B;  4PA4 A;  4KHP B;  1M93 A;  4F4L A;  3JAT B;  1WP7 A;  2EZO A;  1XMO B;  1GTO A;  5BR8 O;  1FPO A;  4ZI7 A;  5LHI A;  3KKY A;  2P22 C;  4DR2 O;  4DR1 B;  3T1C A;  3SDL A;  1ZX3 A;  2HR3 A;  2EX3 A;  1F23 A;  4DV1 B;  3ZHU A;  3ZN1 A;  1FJG B;  2W0F C;  2CDY A;  4MS2 A;  5LHH A;  3CWB H;  4GZR B;  3BRC A;  4BW5 A;  2P5O A;  3E2E A;  4LNU A;  2IBZ H;  3BAA A;  3DGE A;  4H44 B;  1K7D A;  4FLU A;  3QO5 A;  1CXZ B;  1PNM A;  2WLN A;  1M4U A;  4U3F H;  1CP9 A;  2L35 A;  1DF5 A;  4JI7 B;  1EN5 A;  3K57 A;  3RYI B;  1SS3 A;  4EFE A;  4KXR A;  4ABM A;  1YJ9 V;  5EZY A;  3JCZ A;  2H94 A;  1S77 D;  2YID A;  3CHX A;  4FIP C;  4I50 A;  5B1N A;  4XDL A;  3ML0 A;  3MHS C;  4NTW A;  1NVP B;  3FFQ A;  2ITD C;  5EZY B;  2OCC B;  2LJ2 A;  3C3T A;  2BTO A;  5CA1 B;  1FXK A;  1LR1 A;  4D7S A;  3ETG A;  3SYP A;  2YDE A;  2JGU A;  2UXD O;  2XOK G;  5IYD O;  1NKD A;  4LFB O;  2RN9 A;  4WFH A;  2X6A A;  3R66 A;  1AR4 A;  3RYH A;  4D6T H;  2O57 A;  3CPW U;  5KLV H;  2E76 B;  5JWP A;  2CE4 A;  2CUG A;  4EEQ A;  4JAU A;  3ABL C;  1PPJ H;  2FML A;  2MK3 A;  4B7E A;  1VP7 A;  2ZE8 A;  4JI0 B;  2EIM C;  2CAZ C;  3LSQ A;  4TUY A;  3G80 A;  2KKW A;  2FL4 A;  2EIK C;  4CH6 A;  2EIM B;  1V54 C;  2UUB B;  1DGS A;  3ICX A;  2ZM6 B;  2AHY A;  5LMN B;  4TUY B;  2BE3 A;  1BCC H;  3C90 A;  4XBF A;  1I5X A;  2GUZ B;  4JAA A;  4X66 B;  4DW0 A;  3LDE A;  3CC7 V;  1Q43 A;  1NH2 D;  4RQF A;  4DUY O;  4JZ2 A;  3TGU H;  2V4D A;  2WLK A;  3ABM B;  2QWP B;  2DQ3 A;  4DXW A;  3W7X A;  2Y4U A;  4GKK O;  1SQG A;  3BCC H;  4CC5 A;  3WG7 C;  1TVK A;  5L3F A;  5LA6 B;  2RDC A;  2WLH A;  2ZR3 A;  4CC6 A;  1E79 G;  2BTQ B;  4IHJ A;  4H0L B;  1JPX A;  1XUQ A;  3GWK C;  4DR4 B;  1XI1 A;  1FFX A;  2YUA A;  1JX9 A;  3ETD A;  3SPJ A;  2BTQ A;  1IVS A;  3OAA G;  2HG5 C;  4HYO A;  3RVZ A;  2FTK A;  4LF7 B;  5CA0 B;  4OX9 B;  5H6Q A;  4ZOL B;  3LDD A;  5H9C A;  3OMA B;  4MVQ A;  4DR5 B;  3VBB A;  1IDS A;  2IW5 A;  4LWS B;  2HHH O;  2AW9 A;  1QHT A;  1I7F A;  5EYP A;  4JI4 B;  1SA0 B;  5JJN B;  1XL4 A;  1H2K A;  2CTW A;  4YJ2 B;  2YXY A;  3FX7 A;  1HP8 A;  4X65 O;  3GVM A;  1JQ0 A;  4B3M B;  2YEV A;  1WPX A;  3K0G A;  2X6B A;  1JOY A;  1OCR B;  2LFS A;  1RSO B;  5CN0 A;  2CTQ A;  2P6J A;  2EBO A;  3ZRW B;  1N34 B;  1YDX A;  3N2K B;  1KD1 W;  2JK5 C;  1N0J A;  1YCI A;  1F4N A;  1JFF A;  1YVW A;  1VAR A;  4MVR A;  3N2K A;  1Q6H A;  3CRA A;  2QKS A;  2F66 C;  2OIE A;  4JI0 O;  1FYJ A;  2BSK A;  2OIG A;  4NTX A;  4J9Z B;  1X59 A;  2YIA A;  2ZQM A;  1MZE A;  4G28 B;  1JR9 A;  1Y74 B;  3CJH B;  1MZF A;  3SJB C;  1W0J G;  1JA8 A;  1Z5V A;  4R6Z A;  3B40 A;  2EJR A;  3OEE G;  2ETN A;  2K1E A;  3ZS8 C;  4LFA B;  1R73 A;  1YIJ V;  5E79 Z;  4UCO A;  2Y48 A;  2ZE5 A;  1WJZ A;  3K5M A;  3JAT A;  4DV6 B;  3OUS A;  2QWQ B;  4FM2 A;  2R70 A;  2YSU B;  3N27 A;  5KX5 B;  3CCV V;  3B8M A;  1SQQ H;  2Q0O C;  2B9Z A;  4H37 A;  2DYS C;  4FLY A;  2Q69 A;  4J10 A;  4H13 B;  4R8C A;  1GM9 A;  3P3P A;  4WBN B;  5LMU B;  4JI2 B;  4I9Q A;  4P2Z A;  2VRZ A;  3ABL B;  1K5Q A;  1S76 D;  2FKX A;  1NBM G;  1QVG U;  4LNU B;  3ABT A;  2KSD A;  3L71 H;  3Q4H A;  2UU9 O;  3JAL A;  4NB5 A;  4K35 A;  4J9Y B;  4PDL A;  4TV9 A;  2LGW A;  4LFC B;  5L3B A;  5J2T B;  4U3J B;  1EZJ A;  1OCZ C;  4E2L A;  1K8A W;  3VQX A;  4MVU A;  5JVD A;  1R6N A;  4JAV A;  1ZTE A;  1H2N A;  4MTO A;  1BE3 H;  1XEQ A;  5ITZ B;  2H8P C;  3P30 A;  2Q8V A;  1ZWI C;  2WLL B;  4N23 A;  4IT5 A;  2A7W A;  1I0H A;  3E86 A;  5BY1 A;  2EIL B;  2ZM6 O;  3APQ A;  4ICG A;  3B8N A;  3CS5 A;  4BW9 A;  1NU1 H;  4XDK A;  5ITZ A;  2WLL A;  1QLN A;  3HKC B;  5JJJ B;  1MAB G;  4NR1 A;  3CRM A;  1HNW B;  4LF5 O;  5IWA B;  1HW7 A;  5DEC A;  2AHZ A;  5H5N A;  1YF2 A;  2ARH A;  4MT8 A;  1EZV H;  3CCR V;  1D5A A;  3CC2 V;  1E1Q G;  4JTC B;  3KG2 A;  1IBL O;  3JSN A;  1XIL A;  2JVD A;  5B5E Z;  3ZRV A;  1NTK H;  3UQ8 A;  3TCU A;  2ZNJ A;  1BQZ A;  3T1H O;  3DC5 A;  1VQO V;  1N32 B;  5LGU A;  3PJS K;  2A9H A;  1ZUQ A;  1Z2G A;  3SYQ A;  2R9A A;  2VQE B;  1F51 A;  1Q86 W;  1XL6 A;  1NH2 B;  4LC1 A;  2WA3 A;  4NYK A;  1P49 A;  3N2G B;  3BHP A;  3OT7 A;  1SZT A;  1N8R W;  3IJ4 A;  5BXZ A;  1RPR A;  5L3E A;  5L3D A;  5LOV A;  3HKB B;  4Q6G A;  2ZIN A;  3ZBH A;  1VQ7 V;  2P90 A;  5KAI Z;  5LP6 B;  3CP1 A;  5HFL A;  2YC0 A;  2VWJ A;  4GCZ A;  2N05 A;  3CC4 V;  2OTL V;  1OHH G;  4YY3 O;  3ZHR A;  3JYC A;  2IH1 C;  1R1B A;  2CGN A;  3BAB A;  2XTA A;  2OYQ A;  1BMF G;  4KUM A;  1WPB A;  1R6T A;  1ARO P;  4HAM A;  2HLD G;  3SJQ C;  2Y0P A;  5AG2 A;  4JYC A;  3SJC C;  4O4H B;  4I55 A;  5EBW C;  3K04 A;  2W6J G;  1AI7 A;  4X1I A;  2F23 A;  2WSS G;  3OD4 A;  5DN6 G;  1P4R A;  4MVS A;  2XAF A;  4ZKI A;  4FLZ A;  1PD3 A;  3OMI B;  4OPA A;  2VQF B;  4IHJ B;  4FZ1 A;  1LUW A;  3BVO A;  2W0X A;  5LXT A;  1GN2 A;  2PUS A;  5H6R A;  1FD9 A;  1Q3E A;  1QBZ A;  5LMN O;  4O2A B;  2UXB B;  3TXS A;  3L75 H;  3H1I H;  2V1D A;  2QA4 V;  3SR2 C;  1G4Y B;  2IU0 A;  4PA7 A;  1YXB A;  3E35 A;  2HP8 A;  4TV8 A;  1IBK B;  3OTO B;  1ORQ C;  3K3W A;  1NTZ H;  3RYF A;  3K9A A;  3QTC A;  1H8H G;  3JAR B;  5LMU O;  4TV8 B;  4FFB B;  4LF6 B;  4JPR A;  1K4C C;  2ODM A;  1VF6 C;  2ADQ B;  4UCU A;  5JQG A;  2ATK C;  3T1Y B;  3E8G A;  1W0K G;  2DYR B;  3OEH G;  4B3S O;  3W7S A;  2UXC B;  1N4C A;  4DV5 O;  3THO A;  5JQG B;  2Q73 A;  4F6R A;  3HKD B;  2Y69 C;  1GO3 F;  4FVM A;  3GWO A;  5LHG A;  2EUL A;  1J95 A;  1SRY A;  3CB2 A;  1HNX B;  2E75 B;  3H01 A;  2KG7 B;  4KL1 A;  1N0N A;  1XBL A;  1RM1 C;  3HKD A;  5DM6 V;  3SGI A;  2WLJ A;  1KQS U;  1FKA O;  1GN6 A;  1WA8 A;  4DV7 O;  4GKJ O;  1R3I C;  2XAG A;  5KUK A;  1F7Y A;  4MTX A;  1UFI A;  2B1I A;  3ZHQ A;  3ETQ A;  5LGN A;  3STL C;  2ZCE A;  1L0N H;  4FLX A;  4WFG A;  2GSM B;  1BHA A;  3CXH F;  2X0L A;  5J2U A;  1SES A;  1HNZ B;  1D2D A;  1VQ4 V;  4DO2 A;  4X1K A;  1B06 A;  3BEH A;  4DV6 O;  2DMX A;  1P7G A;  3K79 A;  3B2E E;  3IC7 A;  2QWR B;  3QNE A;  5IJ9 B;  4ZHQ B;  4C7U A;  4G2K A;  5LBQ A;  1VQ6 V;  1U97 A;  1OCZ B;  3IGA C;  4ZOL A;  4UFZ A;  3ABM C;  4JYA B;  4X88 A;  4JI3 B;  1PM9 A;  4YJ2 A;  2QSA A;  3HKE A;  1XRE A;  3OM3 B;  2JEU A;  1IBM O;  5FLX N;  2A06 H;  3HKE B;  4QE7 A;  2HVK C;  4J42 A;  4O4L B;  4MTG A;  4IGG A;  3K59 A;  4B3T B;  3F7Y C;  4YIP A;  4WCE V;  3TXQ A;  1RM1 B;  4LP8 A;  4FPP A;  1Q82 W;  4U7O A;  4GX2 A;  5EBL C;  1QLE B;  1X4T A;  3I5D A;  2WWW A;  2Y69 B;  4PDM A;  2EJ7 A;  3QO8 A;  3SPH A;  4O2B A;  2VQF O;  4ZBM A;  1M56 B;  1HR0 B;  2QWN B;  2JRI A;  4LF5 B;  3ASN B;  1LUV A;  4JV5 O;  1I5Y A;  4TWK A;  4K8X A;  2YI9 A;  4TQD A;  2XAJ A;  3STZ C;  2E5L O;  3X2Q C;  2ITC C;  2GBO A;  3AG4 C;  5EBM C;  2EIJ B;  3X2Q B;  4RUF A;  5CB4 A;  3AG4 B;  1VQP V;  3VQV A;  1IXB A;  1HWY A;  3H1J H;  2QDO A;  3SYC A;  2OWO A;  4Z1M G;  4JI5 O;  4X1Y B;  3VQW A;  1CEZ A;  2Q67 A;  1BQ0 A;  5FPO A;  2Q7G A;  2QM8 A;  3AK3 A;  3ZJZ A;  4LR3 A;  1FAF A;  5KMG B;  5IE9 A;  1IBM B;  1E1R G;  3DSQ A;  4WFE A;  1TUB A;  3SPI A;  4J7K A;  3DTU B;  2DOS A;  2QR4 A;  3LNM B;  4O4J B;  3FYI B;  2ZE7 A;  1PV0 A;  1FXK C;  3E89 A;  1YI2 V;  4FM0 A;  1ZSP A;  3ZMU A;  2IJI A;  4TSF G;  2F1M A;  1VF7 A;  4DR4 O;  4IIJ A;  2OCH A;  3JAL B;  4CS4 A;  1XMQ O;  4PI0 A;  4KFM A;  1WAZ A;  4P9P A;  4OX9 O;  4XDJ A;  4PD4 F;  4JTA B;  4IIJ B;  3VOU A;  5IDJ A;  2JDI G;  4B3S B;  2P06 A;  4DRX A;  4LFB B;  4O2A A;  4I5S A;  3A0B Z;  4B7K A;  1L0L H;  1YTF B;  1GM8 A;  2E5L B;  2D2C B;  2YXH A;  1XDC A;  2UXD B;  1Y66 A;  1JVM A;  3JAK B;  1NQT A;  2OT5 A;  3RYF B;  2EIN B;  2QM7 A;  1DF4 A;  1WB7 A;  2P7T C;  2YIB A;  1MNG A;  3HB3 B;  1GKF A;  2GTA A;  1EFR G;  1GM7 A;  2XT9 A;  4AQY O;  1R3K C;  4JV5 B;  1VF5 B;  3ZX6 A;  1K73 W;  1QQC A;  3OMN B;  3CD6 V;  4A5U B;  3F5W C;  3SPG A;  1GN4 A;  3I55 V;  1V54 B;  5L3C A;  3FB7 C;  3J7A U;  4MVZ A;  4UXN A;  1FXK B;  2HKO A;  3NXS A;  1PL0 A;  3OFN G;  5K1P A;  2Q5Z A;  3MD0 A;  2P67 A;  2YXL A;  1ZL8 A;  3L74 H;  1YTF D;  2HJF C;  1BL8 A;  1OCC B;  1NZ6 A;  3ZRX A;  3RYH B;  5IT9 N;  3QG5 A;  3BA8 A;  4LBE C;  3ZHS A;  5KHI A;  1FFT B;  5IJ0 B;  1F4M A;  4JTD B;  4F6E A;  1XHX A;  4UUJ C;  4UVC A;  3BY6 A;  3CRR A;  1R3L C;  3CCE V;  3GB7 C;  4PV1 B;  2QJ1 A;  1IXM A;  2F4V B;  4UCR A;  4JI4 O;  2AGA A;  1R3J C;  1AI4 A;  2QM4 A;  4Q20 A;  2A0L A;  1M56 C;  2A3Q A;  1XNR O;  4LF7 O;  4JAS A;  2CGO A;  2JIZ G;  3CYO A;  4Z2W A;  3UT5 A;  2K9P A;  2PF4 E;  2HHH B;  4GKJ B;  5L3G A;  3AG2 C;  4BAY A;  2CTP A;  2PY5 A;  1TVK B;  4I9W A;  3OGC C;  4E4E A;  1Q81 W;  3L72 H;  1IBL B;  1IX9 A;  4PHZ A;  2Y4T A;  2YEV B;  5KUM A;  1H2L A;  4JF3 A;  2NNU A;  4R7C A;  3JAM N;  1RPO A;  1FFX B;  2ZT9 B;  3RBZ A;  4D7T A;  4JI5 B;  4RQE A;  1WNS A;  5A9G A;  1HNX O;  1DLB A;  4HZ3 A;  2ZNI A;  1OCR C;  2Q0A A;  2XUM A;  1GMG A;  4HNA B;  3JSL A;  4LF4 B;  1YJW V;  1XNQ B;  1T5E A;  2UUB O;  1PNL A;  3OE7 G;  5IY5 B;  3BA9 A;  5KHG A;  5KAF Z;  2XAQ A;  1JMK C;  4TT3 G;  3T2M A;  1N36 O;  4X62 B;  3WB2 A;  1WB8 A;  3UKM A;  2CTR A;  1VF6 A;  4JI3 O;  3ZRW A;  1NVP D;  4O4I B;  4QPK A;  3UO2 A;  1N33 B;  4MVM A;  1ZLZ A;  3B4S A;  4FK5 C;  4L87 A;  1SQF A;  1NTM H;  3L73 H;  4CH4 A;  5KA5 A;  3ASO C;  1L1F A;  2KB1 A;  4X20 B;  4DUZ B;  2ZXW C;  4MW8 A;  1FXH A;  2QKA A;  1YHQ V;  1QCE A;  1Q7Y W;  4FLW A;  1XMQ B;  3ZMS A;  1SQV H;  4LCU C;  1M1K W;  3L70 H;  1K34 A;  2Q6A A;  3LNN A;  3DXR A;  2UXN A;  2LW1 A;  3CX5 F;  4DR2 B;  3S3X A;  4WFB V;  1B6Q A;  5CMU A;  2AZ2 A;  4JYA O;  3E83 A;  4CBC A;  3LSU A;  4LFC O;  2RCV A;  5EC1 C;  4O2B B;  2IU3 A;  1ROP A;  1XOU A;  3SJA C;  1S72 V;  4NXM B;  2Y0I A;  1VQ8 V;  1KKC A;  4X64 O;  1NT2 B;  4AHC A;  3JAS A;  1SZX A;  2R9I A;  1KU9 A;  4G27 B;  1URF A;  4PA6 A;  3BPZ A;  2ZIO A;  5C93 A;  1AR5 A;  2ILM A;  1AI5 A;  3QVN A;  4B3T O;  1VQK V;  1QNM A;  5BR8 B;  5A2Q N;  2A79 B;  2UUA B;  4I0X A;  4X62 O;  1TA8 A;  4DV4 O;  1QR9 A;  1H8E G;  4DR1 O;  1Q90 D;  1VQL V;  2PYL A;  2ZR2 A;  3JCU Z;  1IUR A;  1VIB A;  4I0X B;  1AB3 A;  1TAE A;  3MDS A;  1KUQ A;  3LUT B;  3CCS V;  1BT8 A;  5KX5 A;  3CCU V;  1D5N A;  1B04 A;  4OPH A;  3ZMT A;  2L6L A;  4DV3 B;  2EIJ C;  3E22 B;  3RW0 A;  3ZN0 A;  1SET A;  2IM9 A;  4AQY B;  4O4H A;  2OTJ V;  4WBN A;  1U96 A;  3HKC A;  4DR7 O;  1TGO A;  2B5U A;  4IL6 Z;  4BIZ A;  1GH6 A;  3K9S A;  4JI7 O;  4L8J A;  2P4V A;  1BS3 A;  2KQX A;  4K3A A;  1SQX H;  4LFA O;  2RQ6 A;  3FAV A;  4YHH B;  2DW4 A;  3VQY A;  2E3C A;  2HFE C;  2VQE O;  3ZCC A;  2GTS A;  4TV9 B;  2AXT Z;  3CCQ V;  4JI6 B;  3EXA A;  4U3J A;  1J5E O;  4NXN O;  4K8Z A;  2HJD A;  1WP8 A;  5JVD B;  3FB5 C;  5CA1 A;  4RO2 A;  1QR8 A;  1XNR B;  4J41 A;  2DN9 A;  1AJP A;  3U0Z A;  2M6Y A;  5IJ0 A;  1EBO A;  3APO A;  2QE7 G;  3OUF A;  1AI6 A;  2F95 B;  1WLE A;  5F2V O;  5E1A C;  2LFR A;  2UU9 B;  4PI2 A;  4DW1 A;  3ABK B;  4OXS A;  4X64 B;  5B1B C;  1P84 F;  5CB4 B;  2Q7E A;  3AEI A;  4QGP A;  2QTO A;  3ABU A;  2JGD A;  4Z1V A;  2OCC C;  1G8M A;  1OZ0 A;  4F6R B;  4FMT A;  3G71 V;  3KCX A;  4IYI A;  5KMG A;  4BIO A;  4CH3 A;  4DYL A;  2E74 B;  3D36 C;  2GUZ A;  4IYH A;  5B1A C;  1G1X B;  3ASN C;  4KHP O;  4GLX A;  4CH5 A;  2EZP A;  1EN6 A;  4GX0 A;  2F93 B;  4PDR A;  4QPJ A;  4I7Z B;  4TOI A;  5JCO A;  1US6 A;  1K4D C;  3K5N A;  4JI6 O;  1JJO A;  1M5I A;  2X6C A;  3E8B A;  2XND G;  3P3N A;  1YJN V;  5C8Y B;  3H1H H;  3E8H A;  4DV1 O;  3RYC A;  3U10 A;  5JCO C;  3RWR D;  3ZHV A;  3RT3 C;  4LF8 B;  4YJ3 A;  4DRX B;  2Q7H A;  3FD9 A;  3G67 A;  3S3W A;  3FKS G;  2QEX V;  5LP6 A;  1AVM A;  1A32 A;  3FB8 C;  4YJ3 B;  1OJH A;  1MSW D;  5GON B;  2R72 A;  4CZZ A;  3H1L H;  3W7W A;  1N32 O;  1Z5W A;  1BGY H;  3K5L A;  2Z0A A;  5LGT A;  2UXC O;  1NI8 A;  3JD0 A;  2IJK A;  2DE0 X;  1B3Q A;  1S5H C;  1RSO A;  4DV0 O;  1PKX A;  3G6E V;  2NN4 A;  5BMV B;  1H2G A;  1W59 A;  2EIL C;  4NXM O;  1GN3 A;  4DV2 B;  1FS0 G;  1NR7 A;  4JI8 O;  4N21 A;  4FJC C;  3W7U A;  4O4L A;  4DV4 B;  1QU7 A;  4GT1 A;  1FJG O;  2YS8 A;  1OCO B;  3JD4 A;  3LSS A;  3ZHT A;  5IY5 C;  3EHB B;  4HNA A;  1O9G A;  4PA3 A;  5CA3 A;  1UJW B;  4FLV A;  1O9H A;  2G38 A;  3AK2 A;  4X9Q A;  3MAQ A;  2LP7 A;  4MW3 A;  5KA6 A;  1MOF A;  1DK1 A;  1KYO F;  3SPC A;  1AIL A;  1HDJ A;  5EK0 A;  4LWS A;  3WB1 A;  3OGI B;  4DV7 B;  1WA8 B;  3AG3 C;  2LGQ A;  1TUE B;  2QWO B;  2N04 A;  4FM1 A;  5CBF A;  4X65 B;  5DED A;  1N33 O;  2ZE6 A;  5HFM A;  2C2A A;  3CCJ V;  1K92 A;  3A8T A;  2XHB A;  1SKV A;  4DUZ O;  5B66 Z;  3J81 N;  2FYU H;  1MSD A;  5GTH Z;  3ZMZ A;  4TQF A;  1YSC A;  1VQ5 V;  4JGS A;  3FB6 C;  1S5J A;  5FPR A;  3ZRS A;  3WFV A;  2WAM A;  1OV9 A;  1H2M A;  3ZIA G;  5LP6 C;  2YIB D;  1Q6U A;  1I94 O;  2H3O A;  1J5E B;  4NXN B;  4JI8 B;  4WFA V;  3CJH A;  5D5Q A;  4EKW A;  1YEW A;  4FLT A;  1K5S A;  2V7Q G;  1SER A;  2YIC A;  2PZS A;  4JI1 O;  2XAS A;  1PNK A;  1V9P A;  3CMA V;  4YXW G;  1P7B A;  2ZKO A;  3K06 A;  1K33 A;  5JJE B;  4DV0 B;  2GV9 A;  3Q4H B;  4B3M O;  2EIK B;  1HR0 O;  2MW2 B;  2HVJ C;  2XAH A;  5KHJ A;  3T4Z A;  4J80 A;  1OCC C;  4X8A A;  3JAW A;  3W7T A;  1SQB H;  3JD1 A;  2IJJ A;  2QTS A;  4FZ0 A;  1M9N A;  1Y76 B;  3JAK A;  3CME V;  5KHK A;  4UB6 Z;  4ZHQ A;  5FNV A;  4LF8 O;  3F7V C;  4DV3 O;  3WB0 A;  4BIU A;  4GX1 A;  2DYS B;  3M8A A;  5EYP B;  2JEX A;  3AG2 B;  1Y76 A;  1KMI Z;  1SA0 A;  4NKG B;  1OCO C;  5FNV B;  1RFY A;  4O4I A;  1BHB A;  1COW G;  3O9O A;  3QO7 A;  2UUA O;  1R6K A;  3FAV B;  5EIB C;  3LDC A;  3ASO B;  1I94 B;  1YZB A;  5IYC O;  1SF9 A;  3E8F A;  4QE9 A;  3RN4 A;  1GK9 A;  4X20 A;  1HNZ O;  3CEI A;  1VMG A;  1JCH A;  2DWD C;  3RYI A;  2WLM A;  4GKK B;  4RAI A;  4JI2 O;  3IAY A;  3ETE A;  4UCS A;  1I08 A;  4UV9 A;  4B3R B;  1ENV A;  2NLJ C;  2GDS A;  1YIT V;  3M99 B;  3DXR B;  3CCL V;  1AJQ A;  1DTO A;  3SYO A;  3WG7 B;  2BOC C;  4DR3 B;  1QVF U;  2DQ0 A;  3A2F A;  3N2G A;  2RNB A;  1TUB B;  1KB9 F;  2JS3 A;  3K58 A;  4K0K B;  3OW2 U;  4ASU G;  5C8Y A;  4QIW F;  3G6B A;  5CBG A;  5LOV B;  4DK0 A;  3OR7 C;  3H1K H;  3U11 A;  5BZB A;  4YHH O;  4GYC B;  5LYJ B;  1KC8 W;  1M57 C;  3D36 A;  1QLE C;  4X1Y A;  3CRC A;  5IYZ B;  1GAX A;  1M57 B;  1W2B U;  3UCS C;  1IZ3 A;  2Q68 A;  4BWA A;  5LYJ A;  2CH7 B;  2BCC H;  3D8C A;  2JGD B;  2DYR C;  4U7N A;  2NR5 A;  5JH7 B;  2AZ0 A;  1AP6 A;  2PTM A;  3RFR A;  4WF9 V;  3OR6 C;  3K5O A;  5GW7 A;  3G4S V;  1K97 A;  3J80 N;  3OTO O;  4AI8 A;  4I4T A;  4UCT A;  1EM1 A;  1LNQ A;  4MSW C;  3H9V A;  2JJ1 G;  3ZED A;  1WN7 A;  2UXX A;  4I4T B;  4EFB A;  4WFF A;  4DK1 A;  1SC5 B;  2BOB C;  3FYE B;  4KP4 A;  1MG1 A;  1HNW O;  3DC6 A;  4P30 A;  1XNQ O;  3MHH C;  1XHZ A;  2F4V O;  4CS3 A;  4UV8 A;  1NR1 A;  2JJ2 G;  2N74 A;  3T1H B;  4X1I B;  3WU2 Z;  3EVK A;  3CXC U;  2HEP A;  1CPY A;  2PI5 A;  2Q4P A;  1S0V A;  2DWE C;  1S5L Z;  3NR7 A;  4PDV A;  5KHH A;  4NTY A;  1PL4 A;  5TIS Z;  2UUC O;  5CA0 A;  3C3S A;  4ZI7 B;  4FFB A;  2DJV A;  3CRQ A;  5IYB O;  4YY3 B;  3KZI Z;  1ZL8 B;  3D3I A;  4J7Z A;  3A0R A;  4RUE A;  5B3S C;  3HR0 A;  3A0H Z;  2IH3 C;  2W6I G;  2IJH A;  1L8D A;  3T4D A;  2PI4 A;  5J9P C;  1VEW A;  2M7W A;  2X7R B;  2YI8 A;  4UVB A;  1ZAU A;  2D3O W;  3PN1 A;  3QF7 A;  1KP3 A;  3TET A;  1Q8I A;  3AG1 C;  1KP2 A;  4MVO A;  1VQ9 V;  4PJ0 Z;  4B08 A;  1S3J A;  3F5T A;  4AIL C;  3JD3 A;  1V55 C;  3K03 A;  3RGB A;  2WLI B;  2BSK B;  1V55 B;  4I50 B;  2RJZ A;  1Q5O A;  4W4L A;  2WLI A;  3AG1 B;  2KG7 A;  3ABK C;  3UM7 A;  3OTF A;  4NVP A;  4LF6 O;  3I56 V;  4DV2 O;  3HKB A;  4HBN A;  4LF4 O;  2B1G A;  2ZDI A;  5IWA O;  3T1Y O;  4UB8 Z;  3R65 A;  1RP3 B;  4W4K A;  4OGQ B;  3RVY A;  4DR7 B;  4DV5 B;  3ZMV A;  1NJI W;  1AJN A;  5EIB D;  1Y6X A;  3UT5 B;  4P9O A;  2FB5 A;  4X1K B;  4J7J A;  5GON A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  2DE0 X;  4I0X A;  3TXS A;  4LWS B;  3O9O A;  2KG7 B;  2VS0 A;  3FAV B;  2B9Z A;  3Q4H A;  3GWK C;  4ABM A;  3GVM A;  3G80 A;  3ZBH A;  4GZR B;  4I0X B;  1WA8 A;  2KG7 A;  3Q4H B;  3TXQ A;  3FAV A;  4LWS A;  2AZ2 A;  2VRZ A;  3OGI B;  1WA8 B;  2AZ0 A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...