3OGIB

Crystal structure of the mycobacterium tuberculosis h37rv esxop complex (rv2346c-rv2347c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
89
Chain Sequence
b'FMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ESAT-6-like protein 6
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 27
structure length 89
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3ogiB00
3TXQA 1WA8A 2KG7A 3G80A 4LWSA 3FD9A 3TXSA 3HR0A 4GZRB 2KG7B 1WA8B 2VS0A 2DE0X 3GVMA 3FAVA 2VRZA 4I0XA 3ZBHA 4LWSB 2AZ2A 3Q4HA 3FAVB 4I0XB 3OGIB 3Q4HB 4ABMA 3O9OA 3GWKC 2B9ZA 2AZ0A
chains in the Genus database with same CATH superfamily
2WLHA 4JI6O 4O4JB 2G38A 3B8MA 3CC2V 1YZBA 3CXCU 3OEEG 2W0FC 2XAHA 1NI8A 3E22A 3HR0A 1Y6XA 2WLNA 4B3RO 4IYHA 3FAVA 4FMTA 4X8AA 5LHGA 1VQ5V 2M6YA 2ETNA 4W4LA 4Z2WA 5KUKA 3D36C 1N32B 4NXMB 1IBKB 2P4VA 3WU2Z 3K08A 3L72H 5IY5B 4RQEA 2OT5A 2OCHA 4O4IA 3N2GA 1IURA 3F7YC 1YTFD 5GTHZ 2FKXA 1PNKA 3CCMV 2LW7A 3TK1A 1AJPA 1P84F 1VQNV 3THOA 3OTOB 1P49A 5LGTA 3P32A 4JI5B 2PYJA 3EVKA 2XTAA 5J2UA 2R9RB 2HJDA 2XT9A 2P90A 1N36O 3CRAA 4K3AA 1IDSA 4QIWF 3BCCH 3R66A 4DR1B 1JCHA 4LF8B 3B4SA 3ASNC 1FKAO 2IW5A 1WAZA 3CE2A 2ILMA 1FYJA 1COWG 3A8TA 5IJ0B 4DR6B 3TETA 2WLJA 4LF7O 4GX2A 4LC1A 4B3SB 1MNGA 1SERA 1NZ6A 3D3IA 4X20A 1FFXA 5JQGA 1AJNA 1S0VA 1QU7A 1BHAA 4IGGA 4LFAO 1BSMA 4JI8B 2VRZA 3KCYA 2AZ2A 5EZYB 4JYBA 1ORQC 2JJ1G 2X6CA 4U7NA 3UT5A 2NNUA 1XL4A 3D3QA 4HAMA 4RWUA 2YEVA 1ZX3A 2XUMA 2WSSG 4DV0O 3A0HZ 2PI4A 4DV5B 2E5LB 4D7TA 4N21A 1M1KW 3ABLC 4B7EA 3CCVV 1RFYA 2QR4A 3G4SV 3BVOA 1L0LH 4X62O 1WN7A 3SYOA 1QVGU 1OJHA 1H2LA 1K92A 1Y76B 4MVQA 3ABKB 1Z2GA 1VARA 3ZHSA 5TISZ 1HNZO 4X65O 1XREA 5IWAO 2BSKB 2UU9B 1QCEA 5JJJB 2KB1A 3LNMB 3T1HO 1I0HA 3STLC 4MTOA 2F66C 4IT5A 1AR4A 4YY3O 2X7RB 5L3DA 2P22C 2JGUA 2JK5C 5BZBA 1DF4A 1MSWD 2ZIMA 3A2FA 4DO2A 1L8DA 1GN3A 1AI5A 1EM1A 3APQA 4HNAA 3ZHQA 4WBNB 1K34A 1VF6A 1AI4A 1X4TA 5H2FZ 1WPBA 1KYOF 3ABMB 1IBLB 3ZHRA 1JJOA 4JPRA 4CC6A 4FZ0A 1GM7A 3JD2A 5BMVB 3RWRD 2B1GA 4DW0A 3SPHA 1Z5WA 4F6RA 5LP6C 2CDYA 3JATB 2JS3A 3WB1A 1J95A 4GYCB 2QWRB 2JS5A 4YJ3A 4DW1A 2HLDG 1TVKB 1AI6A 3OUSA 5LP6A 4U7OA 3RVYA 2OWOA 3ETDA 2AGAA 1GK9A 4O4LB 1UJWB 5L3BA 4YXWG 5L3FA 1H38A 4NXNB 4DUYB 3CRCA 1XI1A 2KG7A 1SETA 3W7SA 1OCRC 1BHBA 1E1RG 2V4DA 3WG7B 1KKCA 2PUSA 3HKEB 1EZJA 3CS5A 1GN6A 1I94O 1NVPD 2DYRC 1KB9F 2JEUA 1XL6A 5GONB 1NKDA 1O9GA 5CA0A 5FNVB 1WNSA 4I7ZB 2AXTZ 4TV8B 1YEWA 4E2LA 1AVMA 4H13B 4MVZA 1EN6A 4HYOA 1GAXA 1OCOC 3ZMUA 3JAWB 3HKCA 3OE7G 2QTSA 2PGGA 1Q90D 3CCQV 1MZFA 1MABG 5FL7G 4KL1A 4QJFB 3HPLC 1TA8A 4UV9A 1YI2V 2XAQA 2QKSA 4BW9A 4JYAO 4QPJA 1GO3F 1F7YA 3E2EA 4OPAA 5DEDA 1YITV 3FFQA 2CTQA 5L3CA 1GKFA 5LYJA 1XMOB 1M57C 4I0XA 1KKDA 1URFA 1R1BA 4UCOA 1PM9A 1Q7YW 1SF9A 3AK3A 5KHJA 3QF7A 3OMNB 3ZIAG 4QNHB 4PELA 3CCJV 1S5HC 2R72A 4WFGA 3K03A 3IC9A 5L3GA 2BCCH 3HKBB 1WJZA 5JVDA 3W7TA 4DV6B 2Y69C 2CH7B 5B1AB 1S5LZ 4ABMA 3I56V 1M93A 2GTSA 5IYZA 5CB4A 2H8PC 2FYUH 3QO5A 4HZ3A 2F4VB 4YHHO 4DV1B 5LXTA 4X1YB 1TUBB 3SYQA 1RM1C 1B06A 3ZRVA 4PV1B 2DYSB 1XMQO 1W59A 3SJCC 1AB3A 1SQPH 3ABUA 1S77D 1M56B 4DR4O 4TSFG 2YXHA 2ZQMA 3CP1A 1QR8A 5IJ9A 4JAVA 2UUCB 1LUWA 4L8JA 4C7UA 4DK0A 4B3TO 3N2KA 4UVCA 4DR7B 1E79G 4ZOLB 4CS4A 2QM8A 4WFFA 3ZRXA 1X59A 3RYFB 4FLVA 5KHIA 5B3SB 5KA5A 4L87A 2DMXA 3CB2A 5IYBO 3FB6C 3SPIA 4IIJA 4IHJA 1XOUA 2EJRA 1W0JG 1IZ3A 1IBMO 4JI7O 4FLXA 1N34B 2X6AA 2ZR2A 3RYHB 4UCRA 4LWSA 4FLUA 1BQZA 2PY5A 3RGBA 1H2GA 1F23A 2DWDC 1RPOA 2LP7A 3MAQA 5JCOC 1P4RA 2W6JG 2VWKA 4KUMA 2UUBB 3VQXA 1YIJV 2Q73A 1K33A 4FLZA 1SZXA 2QTOA 4WFHA 4IYIA 2ZDIA 2F23A 3JD3A 2RCVA 3K0DA 1OCZB 3WB2A 3BRCA 3ZN1A 4NTYA 1Y74B 2LW1A 4O4HA 1F4MA 2A9HA 1K9MW 3TJTA 2HJFC 4PDLA 2E76B 4JI4B 4NVPA 1HWYA 1FXHA 2F93B 2R9IA 4GZRB 4O2AB 2WLIA 1H2MA 5K1PA 4J41A 5IYDO 1JFFA 4LF9O 1K3EA 1KECA 2UXDO 2BE3A 4Z1VA 4LFCB 3BABA 1Y67A 5CBFA 1FXKC 2B9ZA 5ITZA 3CC7V 3E8FA 2N04A 4JI3B 1XEQA 1GMGA 3K59A 4JASA 1V54B 4X66B 3H1HH 4PI2A 1ENVA 2EILB 5LMUO 1B6QA 3AG2B 1VQOV 1BGYH 2IJKA 4BIZA 4JGSA 3JD1A 4ZI7B 4AQYB 4ZKIA 1D5NA 5BR8B 4DR5B 2VQEO 5F2VO 3FYEB 5KAIZ 4B3MO 3FX7A 1HR0O 2QEXV 1Q6HA 1I5YA 1K8AW 1RP3B 1XUQA 5AG2A 2ZT9B 1NTZH 1VQ4V 3MHSC 4JAAA 4TWKA 3E22B 2VQFO 4F6EA 3JCZA 3FAVB 1N33O 4MS2A 4WF9V 5JJNB 3T4DA 3UQ8A 4K8ZA 1SESA 3VQWA 3QNEA 5J2TB 4O4IB 2EBOA 3N2GB 3UCSC 1ZL8A 4I50A 3ZRWA 1WB7A 2Z0AA 3SJBC 4UCUA 1PNMA 2DQ3A 4TV9A 2P5OA 1HNWB 4JI0B 2LGWA 1HDJA 4AI8A 4I55A 1CEZA 5B5EZ 1I08A 2D3OW 1BZKA 2LGQA 1R3JC 3ZCCA 2ITCC 5J2UB 4NTXA 4JV5O 1H2SB 4LH6A 2IJJA 3D8CA 4KHPB 1JPXA 5KHGA 5FPRA 4YIPA 2YIAA 4IL6Z 2BTQA 2NN4A 5B1NA 4DUZB 1Q3EA 2QKCA 1ZLZA 1DTOA 3CMEV 3I5DA 5H5NA 2EIJC 4GKJB 2UUAO 1WA8A 4X20B 5K1XA 3T2MA 5JQGB 2ZM6O 1SQQH 1SQGA 2HVJC 2XHBA 3LNNA 1QHTA 4KXRA 1S5JA 1YF2A 3CPWU 1GRJA 5JWPA 4CH4A 2W0XA 4MVRA 4LCUC 5H6QA 1I7FA 4PA3A 3T4ZA 3UT5B 3VQVA 3TXQA 1XNQB 1PD3A 2YEVB 3CCEV 2OTLV 4BAYA 2LQTA 3D36A 5LBQA 4FK5C 1K4CC 3QG5A 1MZEA 4XDLA 4GCZA 2FTKA 2RDCA 2YXYA 1JX9A 1FD9A 1E1QG 4X89A 2EIKC 2F43G 1PV0A 3W7UA 4FVMA 2PI5A 1CPYA 3E8BA 2HFEC 2Q7EA 4WCEV 4I5SA 1F51A 2WLMA 4BWAA 2W6IG 3K5MA 3CD6V 3ETEA 4DK1A 3CMAV 1J5EB 4NYKA 1N32O 2YIDA 3EFFK 4NXMO 3Q4HA 1IBKO 2FB5A 4G27B 4PA6A 3APOA 1GM8A 1NTMH 3DXRA 2RMKB 2YIBD 4TUYA 4J9YB 4QE9A 1KU9A 1Z5VA 1LR1A 1NQTA 5KHKA 1SA0A 1RSOA 4PD4F 3OTOO 1L1FA 4JI5O 1EFRG 4EEQA 4LF4B 4O2BB 2P06A 1G4YB 4H37A 3ASOB 4GX1A 2Y4TA 3QO8A 2XAFA 3WFVA 5CMUA 4DR1O 4LF8O 2YXLA 1PPJH 4DV7B 4F6RB 4UXNA 1XNRB 1QVFU 5IY5C 3W7XA 5LGNA 5A2QN 3CC4V 4DR6O 1QLEB 4YJ3B 5KLVH 4B3SO 1ZAUA 3DC5A 4GUNA 2E75B 5LMNB 2UXNA 4P9PA 2A0LA 3K0GA 4GX0A 3K5LA 3ZHTA 4JI8O 4K35A 1W2BU 4G2KA 2KG7B 2LO1A 2IU0A 4W4KA 3SJQC 3X2QB 3CCUV 2QA4V 3QTCA 3JALB 3SYAA 1M90W 5EC1C 2KSDA 4FM1A 3B77A 4DV5O 2E5LO 4OPHA 2YIBA 3LSUA 2LFSA 1GH6A 4MVMA 1SQVH 4DR3B 1XBLA 4JI1B 2EIMB 1HW7A 5CA0B 1CP9A 2ADQB 1G6UA 5IDJA 3SPGA 1IVSA 1YJ9V 4X1KB 3SGIA 4OXSA 3VOUA 4LF6B 1HNXB 1VMGA 4P2ZA 1SRYA 2Q7GA 1NT2B 4EFBA 2HP8A 2UU9O 2YSUB 3C3SA 3L74H 4LR3A 2UXBB 4B08A 4OX9B 4J10A 5EZYA 5IE9A 3A0RA 4LF5B 3ABTA 4XDKA 4LFBB 4R8CA 5CA1A 1Q6UA 2AHYA 5LYJB 1JVMA 4MVSA 4I0XB 4HBNA 4MSWC 4MTGA 3JSLA 2Q7HA 4FIPC 3CRQA 1OCCB 1EN5A 3JASA 2A79B 1IBLO 3CCSV 3FD9A 2CTPA 4TQDA 2N74A 3A0BZ 3ABKC 3IJ4A 1H8HG 1KQSU 2YI9A 3BEHA 3CXHF 2P6JA 1Y76A 3F5TA 3RBZA 1G8MA 4J80A 3U10A 5HFLA 4JF3A 5JVDB 2HHHB 2PYLA 1AP6A 2IM9A 2ODMA 5DECA 4RUFA 3H01A 4JAUA 2Q67A 5IYZB 5CB4B 3CSXA 3TXSA 1R6NA 1XHXA 5LXTB 3OT7A 4GKKB 4RO2A 1N8RW 4BIUA 4NXNO 4DUYO 2JGDB 5EYPB 3ABMC 3DSQA 2RQ6A 1S3JA 4BR6A 3T1CA 1VQ6V 1V55B 3ZX6A 1N0NA 4WBNA 3M99B 3RYCA 3BFRA 1R3LC 2WA3A 2F95B 3UO3A 3ZHVA 3N2KB 4LBEC 2ZKOA 1R73A 5EIBC 3AG7A 2CGNA 4DV4B 2HKOA 2V7QG 5D5PA 5C8YB 4EFEA 4I4TA 4K0KB 1UPGA 3BAAA 3EXAA 2AHZA 1Q43A 1NH2D 4J42A 3HKDA 1GM9A 2MK3A 2HEPA 4X64B 2ZNJA 1ROPA 1FS0G 2RN9A 2ZXWB 2F1MA 3WG7C 4FFKA 4G28B 1AI7A 2K1EA 3K06A 1AJQA 1TUEB 4DV3B 5J9PC 1XMOO 4JZ2A 4EB6A 2BOCC 3HKEA 1YJNV 2DN9A 1F4NA 2EX3A 4FPPA 1IXMA 1WP8A 3K5OA 4O4HB 2ZNIA 1S76D 5FNVA 3C3TA 3OMAB 4YIOA 2CE4A 3CX5F 3KG2A 1JMKC 3B40A 4GX5A 5EC2C 3RT3C 1YXBA 4DV6O 1K5QA 2CAZC 2XOKG 3LDEA 3ZEDA 3AG3B 5KUMA 3JD4A 1FJGB 1MG1A 1Y66A 3AG4B 3OD4A 2ITDC 1MOFA 2KKWA 2F4VO 4DV1O 4ASUG 1YDXA 2CTRA 3OM3B 3OMIB 5ITZB 2GBOA 2P67A 1US6A 4GT1A 1L0NH 3RFRA 1JR9A 3K9SA 3JARA 4JZGA 3L9DA 4JI2B 3AK2A 2QM7A 2UUCO 3K58A 3JSNA 3OR7C 4DR7O 3BHPA 4UB6Z 2M7WA 4KP4A 4MVOA 5B1AC 2P4KA 1H8EG 5B1BB 5JCOA 5JH7A 1KC8W 3S3XA 3DGEA 1AILA 3B2EE 1DK1A 2HG5C 1ZSPA 1KBHA 3K9AA 3FKSG 2OIGA 2DYSC 3OGIB 1DGSA 2C2AA 5LOVA 1N34O 2X0LA 5H9CA 1M56C 3AG1B 3SYCA 3PN1A 4U3FH 4R6ZA 2OCCB 2ZE6A 3P3NA 1TAEA 4DRXA 2IJHA 3LSSA 2MW2B 4U3JA 3SDLA 4CH3A 2UUBO 1W0KG 3S3WA 2HR3A 1ZL8B 4I50B 3ZRWB 5B3SC 1M9NA 3MD0A 1K97A 1VEWA 3BPZA 2VWJA 1S72V 4FM2A 3JAKA 3RYFA 4I55B 5C93A 1K4DC 2JVDA 3NR7A 4QE7A 1FXKA 2GTAA 3ZRSA 1XHZA 4JI4O 1BE3H 4CH5A 3O65A 4LNUA 4DV2B 3E8GA 3RYHA 2BTQB 1Q8IA 3CCRV 1DF5A 1IX9A 2WLLA 2O57A 2ZCEA 2QDOA 1QQCA 4RAIA 5JJEB 5EBWC 1WA8B 2EINB 4MW3A 1OCZC 2XAJA 4LFCO 2UXCB 4CS2A 2R70A 3T1YB 4WFEA 1R6KA 3CJHA 4JI3O 4JTDB 1R3KC 2Y0IA 1OHHG 4UUJC 2Q8VA 1O9HA 1BT8A 4X66O 1MMMA 1AR1B 1K5SA 3BY6A 4DR2B 3PJSK 4AQYO 5BR8O 4Q6GA 4DR5O 2WLKA 4NKGB 4Q20A 4X1IA 3ZMVA 3ZMSA 4KFMA 4D7SA 4UB8Z 2IU3A 1VQMV 3IC7A 1YJWV 4JI6B 1BL8A 1KD1W 1SQFA 3ZS8C 2CGOA 4K8XA 1V54C 3BA8A 4B3RB 2ZD9A 3Q4HB 4MTFA 3JYCA 4CZZA 2EILC 4J9ZB 1XILA 3AG2C 4FFBA 2RJZA 2GHYA 2AZ0A 3LDCA 5E1AC 2GUZA 4GLXA 3DXRB 2P7TC 3RVZA 1VQKV 3ASNB 4TUYB 1FFXB 3RW0A 1THZA 1HP8A 1PL0A 1SA0B 3ZBHA 1RSOB 1HNWO 4JI0O 1VQLV 5H6RA 4JYYA 1JJ2U 5GW7A 2KQXA 3E8HA 1H2NA 1K73W 5LA6A 2Y0PA 1WLEA 4PDMA 3OUFA 5KX5A 2IH1C 2YI8A 2QE7G 4ICGA 4KHPO 1QBZA 4J11A 1NU1H 2WWWA 1N36B 2BTOA 3ZJZA 3GWOA 4UCVA 1CXZB 4DUZO 5EBMC 4PDVA 3LUTB 4GKJO 2H3OA 1YTFB 3U11A 3RYIA 1PKXA 2E3CA 2E74B 1YCIA 4YJ2A 5J2TA 4LF7B 2Q68A 3ABLB 4PA7A 4ZHQA 1AROP 4MT8A 2YS8A 4N23A 4JYCA 2QWQB 4LFAB 4EKWA 5CBGA 1XNQO 1M5IA 4J7JA 4MW8A 3CEIA 5KMGA 3ZN0A 1P7GA 1Q81W 1OZ0A 5BY1A 2YUAA 3H1JH 4HNAB 3M8AA 4DV0B 1G1XB 4X9QA 2JDIG 2ZIOA 4RQFA 2NLJC 5CN0A 2R9AA 1GN4A 4O4JA 1FXVA 2EZPA 4PJ0Z 2B1IA 2OYQA 3RN4A 4X62B 4J7ZA 3ETGA 1J5EO 3SR2C 1U96A 5EK0A 2GDSA 1FAFA 3IGAC 4XBFA 1MSDA 2CTWA 5KHHA 1TGOA 1HNZB 4X65B 4BW5A 5IWAB 3T1HB 1VQPV 3L73H 5CA1B 2QSAA 2X6BA 5DN6G 5LP6B 4YY3B 4UCTA 1B3QA 1GN2A 3FB7C 3LDDA 2WPDG 4R7CA 4LF4O 2EJ7A 4CS3A 3JASB 3U0ZA 5FLXN 2JJ2G 3OAAG 4B7KA 1NR7A 4DV7O 3R65A 1XNRO 3JCUZ 1OCRB 3OEHG 1PNLA 3SPJA 2BOBC 4R50A 4Z1MG 2ARHA 5LMNO 1NJIW 1GTOA 4NB5A 3L70H 5IJ0A 3P3PA 1AR5A 1LUVA 2DYRB 2DWEC 1VF6C 3ASOC 3HKCB 3LSQA 3NXSA 2IH3C 3KKYA 1JA8A 4LP8A 2B5UA 3K57A 2OTJV 4TT3G 1BQ0A 4FLYA 1T5EA 4O2BA 1OCOB 3RYCB 4PA4A 2DOSA 1SKVA 3QO7A 3E35A 1QLEC 2Q9LA 4TQFA 1UFIA 3BA9A 4DR3O 3O9OA 4JI1O 3J7AU 2YDEA 1I94B 5DM6V 1SZTA 3MDSA 5EIBD 2A06H 4PHZA 4I4TB 3ZMTA 4CH6A 2FL4A 1M57B 2UXXA 3FYIB 4PI0A 4I9QA 4H33A 5LHHA 4LF6O 1HNXO 2JIZG 3HKDB 2Y4UA 2DW4A 2GSMB 2L6LA 3X2QC 2RNBA 2EZOA 2PZSA 1JOYA 2UXBO 1DLBA 3GWKC 4OX9O 4JTAB 3G71V 1WPXA 4LF5O 3I55V 2BSKA 1NVPB 2Q5ZA 4LFBO 2AW9A 5LGUA 3DC6A 5B1OA 4FJCC 3H9VA 4JYAB 2IBZH 2ZINA 4EB6B 2Q6AA 2Y69B 3KZIZ 3JALA 2EIMC 1BMFG 3ZHUA 1NS1A 2QJ1A 1NR1A 4UV8A 5EBLC 4F4LA 4E4EA 4P9OA 1RM1B 5IJ9B 5KA6A 3N27A 4X1KA 1VF5B 4AHCA 4H44B 4QGPA 2HHHO 2Y48A 3UO2A 4J7KA 5BMVA 3L75H 2GV9A 5FPOA 2QWOB 3VQYA 3ICXA 5A9GA 3CYOA 4A5UB 3HB3B 5B66Z 1XDCA 3JATA 2A7WA 2OIEA 5GTIZ 1AP5A 2NR5A 3DTUB 2YC0A 4IIJB 4IHJB 3K79A 3UKMA 1TVKA 4AILC 4GKKO 5KAFZ 1OCCC 3FB8C 3G6BA 2Q0OC 3FB5C 4LWSB 4O4LA 4YHHB 5D5QA 3JARB 1NH2B 2FMLA 1NTKH 2ZE8A 2XNDG 3E86A 1XMQB 1N0JA 4DR4B 3G67A 1WP7A 5IYCO 3ZMZA 1OV9A 1XQ8A 2JRIA 5JH7B 4DV4O 4B3TB 3B09A 2ZE7A 3OR6C 1KMIZ 1VP7A 2YICA 3F5WC 1A32A 1R6TA 2QM4A 4K0KO 4XDJA 1Q86W 3AK1A 3JD0A 5GONA 1U97A 5LOVB 4TV8A 5IT9N 2DJVA 3UM7A 3H1KH 1BS3A 2ZE5A 4X64O 3EHBB 1V55C 4WFAV 3G6EV 2QWNB 4ZIBA 2LJ2A 1IBMB 2JGDA 2WAMA 4JI7B 3QVNA 3JAWA 5EYPA 4DRXB 2L35A 1D2DA 4JTCB 1SS3A 2ATKC 2WLIB 4U3JB 3IFXA 5E79Z 3JAMN 4DV3O 1JFFB 1VQ9V 3K5NA 1SC5B 4FZ1A 3OW2U 1PL4A 3G80A 2Q4PA 4P30A 1B04A 2QKAA 3JAKB 1RPRA 1VF7A 1ZUQA 4UFZA 2K9PA 3SJAC 5C8YA 3KCXA 2EULA 1FXKB 1SQBH 1QLNA 4LNUB 2ZXWC 4MTXA 3ETQA 1VIBA 4CC5A 5CBHA 4UVBA 3W7WA 2WLLB 1FJGO 3HKBA 1Y4MA 1FPOA 4PA9A 5LHIA 3CWBH 2CH7A 2ZDIC 3B8NA 3J80N 2HVKC 3GB7C 4LF9B 4LH7A 2JEXA 4MVUA 4D6TH 1K7DA 1V9PA 2Z5UA 2IJIA 1Q6IA 1PP9H 1TUBA 4X1YA 4DXWA 2UXDB 1YSCA 3CJHB 1QR9A 3F7VC 2A3QA 1WB8A 4JI2O 1KP3A 4TOIA 1VQ8V 1NBMG 1ZWIC 2D2CB 3J81N 2CK3G 2Z3YA 4FLWA 3H1LH 3P30A 4PDRA 2XASA 3AG3C 2ADPA 1FFTB 1JQ0A 5HFMA 3ML0A 4ZOLA 5LMUB 3AG4C 3M7MX 4ZBMA 1VQ7V 4TV9B 3C90A 4X1IB 3OFNG 3MHHC 4FM0A 1H2KA 4I9WA 2VQEB 4BIOA 4B3MB 1EN4A 1YHQV 4FLTA 1HR0B 3OGCC 1ZTEA 4RUEA 4OGQB 4UVAA 1R3IC 1KP2A 1YVWA 2DQ0A 2QGNA 2VQFB 1N4CA 1D5AA 2V1DA 1EBOA 1N33B 2N05A 4FFBB 2PTMA 2GUZB 1I5XA 2LFRA 5B1BC 4DYLA 2H94A 1EZVH 1M4UA 2QWPB 3K3WA 2EIJB 3OTFA 5LL6Y 4CBCA 3AG1C 3WB0A 5LA6B 3CCLV 1Y74A 3VBBA 5KX5B 2OCCC 5BXZA 3TGUH 2VS0A 2DE0X 4DV2O 3K04A 1LNQA 4JV5B 3CRMA 1IXBA 4WFBV 4QPKA 3TCUA 3RYIB 4O2AA 1BCCH 2UXCO 1P7BA 4UCSA 2Q69A 4YJ2B 1Q5OA 3T1YO 3CHXA 2UUAB 3H1IH 4ZHQB 2ZM6B 4X88A 2EIKB 4NTWA 3AEIA 1QNMA 1SQXH 3E89A 4NR1A 1Q82W 2XAGA 5L3EA 2CUGA 2PF4E 3STZC 2WA4A 4DR2O 4H0LB 5KMGB 2Q0AA 1KUQA 3GVMA 3CRRA 3SYPA 3SPCA 2EINC 4ZI7A 1MA1A 5CA3A 2ZR3A 3IAYA 3E83A 3L71H
chains in the Genus database with same CATH topology
3TXQA 1WA8A 2KG7A 3G80A 4LWSA 3FD9A 3TXSA 3HR0A 4GZRB 2KG7B 1WA8B 2VS0A 2DE0X 3GVMA 3FAVA 2VRZA 4I0XA 3ZBHA 4LWSB 2AZ2A 3Q4HA 3FAVB 4I0XB 3OGIB 3Q4HB 4ABMA 3O9OA 3GWKC 2B9ZA 2AZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXQ A;  1WA8 A;  2KG7 A;  3G80 A;  4LWS A;  3FD9 A;  3TXS A;  3HR0 A;  4GZR B;  2KG7 B;  1WA8 B;  2VS0 A;  2DE0 X;  3GVM A;  3FAV A;  2VRZ A;  4I0X A;  3ZBH A;  4LWS B;  2AZ2 A;  3Q4H A;  3FAV B;  4I0X B;  3OGI B;  3Q4H B;  4ABM A;  3O9O A;  3GWK C;  2B9Z A;  2AZ0 A; 
#chains in the Genus database with same CATH topology
 2WLH A;  4JI6 O;  4O4J B;  2G38 A;  3B8M A;  3CC2 V;  1YZB A;  3CXC U;  3OEE G;  2W0F C;  2XAH A;  1NI8 A;  3E22 A;  3HR0 A;  1Y6X A;  2WLN A;  4B3R O;  4IYH A;  3FAV A;  4FMT A;  4X8A A;  5LHG A;  1VQ5 V;  2M6Y A;  2ETN A;  4W4L A;  4Z2W A;  5KUK A;  3D36 C;  1N32 B;  4NXM B;  1IBK B;  2P4V A;  3WU2 Z;  3K08 A;  3L72 H;  5IY5 B;  4RQE A;  2OT5 A;  2OCH A;  4O4I A;  3N2G A;  1IUR A;  3F7Y C;  1YTF D;  5GTH Z;  2FKX A;  1PNK A;  3CCM V;  2LW7 A;  3TK1 A;  1AJP A;  1P84 F;  1VQN V;  3THO A;  3OTO B;  1P49 A;  5LGT A;  3P32 A;  4JI5 B;  2PYJ A;  3EVK A;  2XTA A;  5J2U A;  2R9R B;  2HJD A;  2XT9 A;  2P90 A;  1N36 O;  3CRA A;  4K3A A;  1IDS A;  4QIW F;  3BCC H;  3R66 A;  4DR1 B;  1JCH A;  4LF8 B;  3B4S A;  3ASN C;  1FKA O;  2IW5 A;  1WAZ A;  3CE2 A;  2ILM A;  1FYJ A;  1COW G;  3A8T A;  5IJ0 B;  4DR6 B;  3TET A;  2WLJ A;  4LF7 O;  4GX2 A;  4LC1 A;  4B3S B;  1MNG A;  1SER A;  1NZ6 A;  3D3I A;  4X20 A;  1FFX A;  5JQG A;  1AJN A;  1S0V A;  1QU7 A;  1BHA A;  4IGG A;  4LFA O;  1BSM A;  4JI8 B;  2VRZ A;  3KCY A;  2AZ2 A;  5EZY B;  4JYB A;  1ORQ C;  2JJ1 G;  2X6C A;  4U7N A;  3UT5 A;  2NNU A;  1XL4 A;  3D3Q A;  4HAM A;  4RWU A;  2YEV A;  1ZX3 A;  2XUM A;  2WSS G;  4DV0 O;  3A0H Z;  2PI4 A;  4DV5 B;  2E5L B;  4D7T A;  4N21 A;  1M1K W;  3ABL C;  4B7E A;  3CCV V;  1RFY A;  2QR4 A;  3G4S V;  3BVO A;  1L0L H;  4X62 O;  1WN7 A;  3SYO A;  1QVG U;  1OJH A;  1H2L A;  1K92 A;  1Y76 B;  4MVQ A;  3ABK B;  1Z2G A;  1VAR A;  3ZHS A;  5TIS Z;  1HNZ O;  4X65 O;  1XRE A;  5IWA O;  2BSK B;  2UU9 B;  1QCE A;  5JJJ B;  2KB1 A;  3LNM B;  3T1H O;  1I0H A;  3STL C;  4MTO A;  2F66 C;  4IT5 A;  1AR4 A;  4YY3 O;  2X7R B;  5L3D A;  2P22 C;  2JGU A;  2JK5 C;  5BZB A;  1DF4 A;  1MSW D;  2ZIM A;  3A2F A;  4DO2 A;  1L8D A;  1GN3 A;  1AI5 A;  1EM1 A;  3APQ A;  4HNA A;  3ZHQ A;  4WBN B;  1K34 A;  1VF6 A;  1AI4 A;  1X4T A;  5H2F Z;  1WPB A;  1KYO F;  3ABM B;  1IBL B;  3ZHR A;  1JJO A;  4JPR A;  4CC6 A;  4FZ0 A;  1GM7 A;  3JD2 A;  5BMV B;  3RWR D;  2B1G A;  4DW0 A;  3SPH A;  1Z5W A;  4F6R A;  5LP6 C;  2CDY A;  3JAT B;  2JS3 A;  3WB1 A;  1J95 A;  4GYC B;  2QWR B;  2JS5 A;  4YJ3 A;  4DW1 A;  2HLD G;  1TVK B;  1AI6 A;  3OUS A;  5LP6 A;  4U7O A;  3RVY A;  2OWO A;  3ETD A;  2AGA A;  1GK9 A;  4O4L B;  1UJW B;  5L3B A;  4YXW G;  5L3F A;  1H38 A;  4NXN B;  4DUY B;  3CRC A;  1XI1 A;  2KG7 A;  1SET A;  3W7S A;  1OCR C;  1BHB A;  1E1R G;  2V4D A;  3WG7 B;  1KKC A;  2PUS A;  3HKE B;  1EZJ A;  3CS5 A;  1GN6 A;  1I94 O;  1NVP D;  2DYR C;  1KB9 F;  2JEU A;  1XL6 A;  5GON B;  1NKD A;  1O9G A;  5CA0 A;  5FNV B;  1WNS A;  4I7Z B;  2AXT Z;  4TV8 B;  1YEW A;  4E2L A;  1AVM A;  4H13 B;  4MVZ A;  1EN6 A;  4HYO A;  1GAX A;  1OCO C;  3ZMU A;  3JAW B;  3HKC A;  3OE7 G;  2QTS A;  2PGG A;  1Q90 D;  3CCQ V;  1MZF A;  1MAB G;  5FL7 G;  4KL1 A;  4QJF B;  3HPL C;  1TA8 A;  4UV9 A;  1YI2 V;  2XAQ A;  2QKS A;  4BW9 A;  4JYA O;  4QPJ A;  1GO3 F;  1F7Y A;  3E2E A;  4OPA A;  5DED A;  1YIT V;  3FFQ A;  2CTQ A;  5L3C A;  1GKF A;  5LYJ A;  1XMO B;  1M57 C;  4I0X A;  1KKD A;  1URF A;  1R1B A;  4UCO A;  1PM9 A;  1Q7Y W;  1SF9 A;  3AK3 A;  5KHJ A;  3QF7 A;  3OMN B;  3ZIA G;  4QNH B;  4PEL A;  3CCJ V;  1S5H C;  2R72 A;  4WFG A;  3K03 A;  3IC9 A;  5L3G A;  2BCC H;  3HKB B;  1WJZ A;  5JVD A;  3W7T A;  4DV6 B;  2Y69 C;  2CH7 B;  5B1A B;  1S5L Z;  4ABM A;  3I56 V;  1M93 A;  2GTS A;  5IYZ A;  5CB4 A;  2H8P C;  2FYU H;  3QO5 A;  4HZ3 A;  2F4V B;  4YHH O;  4DV1 B;  5LXT A;  4X1Y B;  1TUB B;  3SYQ A;  1RM1 C;  1B06 A;  3ZRV A;  4PV1 B;  2DYS B;  1XMQ O;  1W59 A;  3SJC C;  1AB3 A;  1SQP H;  3ABU A;  1S77 D;  1M56 B;  4DR4 O;  4TSF G;  2YXH A;  2ZQM A;  3CP1 A;  1QR8 A;  5IJ9 A;  4JAV A;  2UUC B;  1LUW A;  4L8J A;  4C7U A;  4DK0 A;  4B3T O;  3N2K A;  4UVC A;  4DR7 B;  1E79 G;  4ZOL B;  4CS4 A;  2QM8 A;  4WFF A;  3ZRX A;  1X59 A;  3RYF B;  4FLV A;  5KHI A;  5B3S B;  5KA5 A;  4L87 A;  2DMX A;  3CB2 A;  5IYB O;  3FB6 C;  3SPI A;  4IIJ A;  4IHJ A;  1XOU A;  2EJR A;  1W0J G;  1IZ3 A;  1IBM O;  4JI7 O;  4FLX A;  1N34 B;  2X6A A;  2ZR2 A;  3RYH B;  4UCR A;  4LWS A;  4FLU A;  1BQZ A;  2PY5 A;  3RGB A;  1H2G A;  1F23 A;  2DWD C;  1RPO A;  2LP7 A;  3MAQ A;  5JCO C;  1P4R A;  2W6J G;  2VWK A;  4KUM A;  2UUB B;  3VQX A;  1YIJ V;  2Q73 A;  1K33 A;  4FLZ A;  1SZX A;  2QTO A;  4WFH A;  4IYI A;  2ZDI A;  2F23 A;  3JD3 A;  2RCV A;  3K0D A;  1OCZ B;  3WB2 A;  3BRC A;  3ZN1 A;  4NTY A;  1Y74 B;  2LW1 A;  4O4H A;  1F4M A;  2A9H A;  1K9M W;  3TJT A;  2HJF C;  4PDL A;  2E76 B;  4JI4 B;  4NVP A;  1HWY A;  1FXH A;  2F93 B;  2R9I A;  4GZR B;  4O2A B;  2WLI A;  1H2M A;  5K1P A;  4J41 A;  5IYD O;  1JFF A;  4LF9 O;  1K3E A;  1KEC A;  2UXD O;  2BE3 A;  4Z1V A;  4LFC B;  3BAB A;  1Y67 A;  5CBF A;  1FXK C;  2B9Z A;  5ITZ A;  3CC7 V;  3E8F A;  2N04 A;  4JI3 B;  1XEQ A;  1GMG A;  3K59 A;  4JAS A;  1V54 B;  4X66 B;  3H1H H;  4PI2 A;  1ENV A;  2EIL B;  5LMU O;  1B6Q A;  3AG2 B;  1VQO V;  1BGY H;  2IJK A;  4BIZ A;  4JGS A;  3JD1 A;  4ZI7 B;  4AQY B;  4ZKI A;  1D5N A;  5BR8 B;  4DR5 B;  2VQE O;  5F2V O;  3FYE B;  5KAI Z;  4B3M O;  3FX7 A;  1HR0 O;  2QEX V;  1Q6H A;  1I5Y A;  1K8A W;  1RP3 B;  1XUQ A;  5AG2 A;  2ZT9 B;  1NTZ H;  1VQ4 V;  3MHS C;  4JAA A;  4TWK A;  3E22 B;  2VQF O;  4F6E A;  3JCZ A;  3FAV B;  1N33 O;  4MS2 A;  4WF9 V;  5JJN B;  3T4D A;  3UQ8 A;  4K8Z A;  1SES A;  3VQW A;  3QNE A;  5J2T B;  4O4I B;  2EBO A;  3N2G B;  3UCS C;  1ZL8 A;  4I50 A;  3ZRW A;  1WB7 A;  2Z0A A;  3SJB C;  4UCU A;  1PNM A;  2DQ3 A;  4TV9 A;  2P5O A;  1HNW B;  4JI0 B;  2LGW A;  1HDJ A;  4AI8 A;  4I55 A;  1CEZ A;  5B5E Z;  1I08 A;  2D3O W;  1BZK A;  2LGQ A;  1R3J C;  3ZCC A;  2ITC C;  5J2U B;  4NTX A;  4JV5 O;  1H2S B;  4LH6 A;  2IJJ A;  3D8C A;  4KHP B;  1JPX A;  5KHG A;  5FPR A;  4YIP A;  2YIA A;  4IL6 Z;  2BTQ A;  2NN4 A;  5B1N A;  4DUZ B;  1Q3E A;  2QKC A;  1ZLZ A;  1DTO A;  3CME V;  3I5D A;  5H5N A;  2EIJ C;  4GKJ B;  2UUA O;  1WA8 A;  4X20 B;  5K1X A;  3T2M A;  5JQG B;  2ZM6 O;  1SQQ H;  1SQG A;  2HVJ C;  2XHB A;  3LNN A;  1QHT A;  4KXR A;  1S5J A;  1YF2 A;  3CPW U;  1GRJ A;  5JWP A;  4CH4 A;  2W0X A;  4MVR A;  4LCU C;  5H6Q A;  1I7F A;  4PA3 A;  3T4Z A;  3UT5 B;  3VQV A;  3TXQ A;  1XNQ B;  1PD3 A;  2YEV B;  3CCE V;  2OTL V;  4BAY A;  2LQT A;  3D36 A;  5LBQ A;  4FK5 C;  1K4C C;  3QG5 A;  1MZE A;  4XDL A;  4GCZ A;  2FTK A;  2RDC A;  2YXY A;  1JX9 A;  1FD9 A;  1E1Q G;  4X89 A;  2EIK C;  2F43 G;  1PV0 A;  3W7U A;  4FVM A;  2PI5 A;  1CPY A;  3E8B A;  2HFE C;  2Q7E A;  4WCE V;  4I5S A;  1F51 A;  2WLM A;  4BWA A;  2W6I G;  3K5M A;  3CD6 V;  3ETE A;  4DK1 A;  3CMA V;  1J5E B;  4NYK A;  1N32 O;  2YID A;  3EFF K;  4NXM O;  3Q4H A;  1IBK O;  2FB5 A;  4G27 B;  4PA6 A;  3APO A;  1GM8 A;  1NTM H;  3DXR A;  2RMK B;  2YIB D;  4TUY A;  4J9Y B;  4QE9 A;  1KU9 A;  1Z5V A;  1LR1 A;  1NQT A;  5KHK A;  1SA0 A;  1RSO A;  4PD4 F;  3OTO O;  1L1F A;  4JI5 O;  1EFR G;  4EEQ A;  4LF4 B;  4O2B B;  2P06 A;  1G4Y B;  4H37 A;  3ASO B;  4GX1 A;  2Y4T A;  3QO8 A;  2XAF A;  3WFV A;  5CMU A;  4DR1 O;  4LF8 O;  2YXL A;  1PPJ H;  4DV7 B;  4F6R B;  4UXN A;  1XNR B;  1QVF U;  5IY5 C;  3W7X A;  5LGN A;  5A2Q N;  3CC4 V;  4DR6 O;  1QLE B;  4YJ3 B;  5KLV H;  4B3S O;  1ZAU A;  3DC5 A;  4GUN A;  2E75 B;  5LMN B;  2UXN A;  4P9P A;  2A0L A;  3K0G A;  4GX0 A;  3K5L A;  3ZHT A;  4JI8 O;  4K35 A;  1W2B U;  4G2K A;  2KG7 B;  2LO1 A;  2IU0 A;  4W4K A;  3SJQ C;  3X2Q B;  3CCU V;  2QA4 V;  3QTC A;  3JAL B;  3SYA A;  1M90 W;  5EC1 C;  2KSD A;  4FM1 A;  3B77 A;  4DV5 O;  2E5L O;  4OPH A;  2YIB A;  3LSU A;  2LFS A;  1GH6 A;  4MVM A;  1SQV H;  4DR3 B;  1XBL A;  4JI1 B;  2EIM B;  1HW7 A;  5CA0 B;  1CP9 A;  2ADQ B;  1G6U A;  5IDJ A;  3SPG A;  1IVS A;  1YJ9 V;  4X1K B;  3SGI A;  4OXS A;  3VOU A;  4LF6 B;  1HNX B;  1VMG A;  4P2Z A;  1SRY A;  2Q7G A;  1NT2 B;  4EFB A;  2HP8 A;  2UU9 O;  2YSU B;  3C3S A;  3L74 H;  4LR3 A;  2UXB B;  4B08 A;  4OX9 B;  4J10 A;  5EZY A;  5IE9 A;  3A0R A;  4LF5 B;  3ABT A;  4XDK A;  4LFB B;  4R8C A;  5CA1 A;  1Q6U A;  2AHY A;  5LYJ B;  1JVM A;  4MVS A;  4I0X B;  4HBN A;  4MSW C;  4MTG A;  3JSL A;  2Q7H A;  4FIP C;  3CRQ A;  1OCC B;  1EN5 A;  3JAS A;  2A79 B;  1IBL O;  3CCS V;  3FD9 A;  2CTP A;  4TQD A;  2N74 A;  3A0B Z;  3ABK C;  3IJ4 A;  1H8H G;  1KQS U;  2YI9 A;  3BEH A;  3CXH F;  2P6J A;  1Y76 A;  3F5T A;  3RBZ A;  1G8M A;  4J80 A;  3U10 A;  5HFL A;  4JF3 A;  5JVD B;  2HHH B;  2PYL A;  1AP6 A;  2IM9 A;  2ODM A;  5DEC A;  4RUF A;  3H01 A;  4JAU A;  2Q67 A;  5IYZ B;  5CB4 B;  3CSX A;  3TXS A;  1R6N A;  1XHX A;  5LXT B;  3OT7 A;  4GKK B;  4RO2 A;  1N8R W;  4BIU A;  4NXN O;  4DUY O;  2JGD B;  5EYP B;  3ABM C;  3DSQ A;  2RQ6 A;  1S3J A;  4BR6 A;  3T1C A;  1VQ6 V;  1V55 B;  3ZX6 A;  1N0N A;  4WBN A;  3M99 B;  3RYC A;  3BFR A;  1R3L C;  2WA3 A;  2F95 B;  3UO3 A;  3ZHV A;  3N2K B;  4LBE C;  2ZKO A;  1R73 A;  5EIB C;  3AG7 A;  2CGN A;  4DV4 B;  2HKO A;  2V7Q G;  5D5P A;  5C8Y B;  4EFE A;  4I4T A;  4K0K B;  1UPG A;  3BAA A;  3EXA A;  2AHZ A;  1Q43 A;  1NH2 D;  4J42 A;  3HKD A;  1GM9 A;  2MK3 A;  2HEP A;  4X64 B;  2ZNJ A;  1ROP A;  1FS0 G;  2RN9 A;  2ZXW B;  2F1M A;  3WG7 C;  4FFK A;  4G28 B;  1AI7 A;  2K1E A;  3K06 A;  1AJQ A;  1TUE B;  4DV3 B;  5J9P C;  1XMO O;  4JZ2 A;  4EB6 A;  2BOC C;  3HKE A;  1YJN V;  2DN9 A;  1F4N A;  2EX3 A;  4FPP A;  1IXM A;  1WP8 A;  3K5O A;  4O4H B;  2ZNI A;  1S76 D;  5FNV A;  3C3T A;  3OMA B;  4YIO A;  2CE4 A;  3CX5 F;  3KG2 A;  1JMK C;  3B40 A;  4GX5 A;  5EC2 C;  3RT3 C;  1YXB A;  4DV6 O;  1K5Q A;  2CAZ C;  2XOK G;  3LDE A;  3ZED A;  3AG3 B;  5KUM A;  3JD4 A;  1FJG B;  1MG1 A;  1Y66 A;  3AG4 B;  3OD4 A;  2ITD C;  1MOF A;  2KKW A;  2F4V O;  4DV1 O;  4ASU G;  1YDX A;  2CTR A;  3OM3 B;  3OMI B;  5ITZ B;  2GBO A;  2P67 A;  1US6 A;  4GT1 A;  1L0N H;  3RFR A;  1JR9 A;  3K9S A;  3JAR A;  4JZG A;  3L9D A;  4JI2 B;  3AK2 A;  2QM7 A;  2UUC O;  3K58 A;  3JSN A;  3OR7 C;  4DR7 O;  3BHP A;  4UB6 Z;  2M7W A;  4KP4 A;  4MVO A;  5B1A C;  2P4K A;  1H8E G;  5B1B B;  5JCO A;  5JH7 A;  1KC8 W;  3S3X A;  3DGE A;  1AIL A;  3B2E E;  1DK1 A;  2HG5 C;  1ZSP A;  1KBH A;  3K9A A;  3FKS G;  2OIG A;  2DYS C;  3OGI B;  1DGS A;  2C2A A;  5LOV A;  1N34 O;  2X0L A;  5H9C A;  1M56 C;  3AG1 B;  3SYC A;  3PN1 A;  4U3F H;  4R6Z A;  2OCC B;  2ZE6 A;  3P3N A;  1TAE A;  4DRX A;  2IJH A;  3LSS A;  2MW2 B;  4U3J A;  3SDL A;  4CH3 A;  2UUB O;  1W0K G;  3S3W A;  2HR3 A;  1ZL8 B;  4I50 B;  3ZRW B;  5B3S C;  1M9N A;  3MD0 A;  1K97 A;  1VEW A;  3BPZ A;  2VWJ A;  1S72 V;  4FM2 A;  3JAK A;  3RYF A;  4I55 B;  5C93 A;  1K4D C;  2JVD A;  3NR7 A;  4QE7 A;  1FXK A;  2GTA A;  3ZRS A;  1XHZ A;  4JI4 O;  1BE3 H;  4CH5 A;  3O65 A;  4LNU A;  4DV2 B;  3E8G A;  3RYH A;  2BTQ B;  1Q8I A;  3CCR V;  1DF5 A;  1IX9 A;  2WLL A;  2O57 A;  2ZCE A;  2QDO A;  1QQC A;  4RAI A;  5JJE B;  5EBW C;  1WA8 B;  2EIN B;  4MW3 A;  1OCZ C;  2XAJ A;  4LFC O;  2UXC B;  4CS2 A;  2R70 A;  3T1Y B;  4WFE A;  1R6K A;  3CJH A;  4JI3 O;  4JTD B;  1R3K C;  2Y0I A;  1OHH G;  4UUJ C;  2Q8V A;  1O9H A;  1BT8 A;  4X66 O;  1MMM A;  1AR1 B;  1K5S A;  3BY6 A;  4DR2 B;  3PJS K;  4AQY O;  5BR8 O;  4Q6G A;  4DR5 O;  2WLK A;  4NKG B;  4Q20 A;  4X1I A;  3ZMV A;  3ZMS A;  4KFM A;  4D7S A;  4UB8 Z;  2IU3 A;  1VQM V;  3IC7 A;  1YJW V;  4JI6 B;  1BL8 A;  1KD1 W;  1SQF A;  3ZS8 C;  2CGO A;  4K8X A;  1V54 C;  3BA8 A;  4B3R B;  2ZD9 A;  3Q4H B;  4MTF A;  3JYC A;  4CZZ A;  2EIL C;  4J9Z B;  1XIL A;  3AG2 C;  4FFB A;  2RJZ A;  2GHY A;  2AZ0 A;  3LDC A;  5E1A C;  2GUZ A;  4GLX A;  3DXR B;  2P7T C;  3RVZ A;  1VQK V;  3ASN B;  4TUY B;  1FFX B;  3RW0 A;  1THZ A;  1HP8 A;  1PL0 A;  1SA0 B;  3ZBH A;  1RSO B;  1HNW O;  4JI0 O;  1VQL V;  5H6R A;  4JYY A;  1JJ2 U;  5GW7 A;  2KQX A;  3E8H A;  1H2N A;  1K73 W;  5LA6 A;  2Y0P A;  1WLE A;  4PDM A;  3OUF A;  5KX5 A;  2IH1 C;  2YI8 A;  2QE7 G;  4ICG A;  4KHP O;  1QBZ A;  4J11 A;  1NU1 H;  2WWW A;  1N36 B;  2BTO A;  3ZJZ A;  3GWO A;  4UCV A;  1CXZ B;  4DUZ O;  5EBM C;  4PDV A;  3LUT B;  4GKJ O;  2H3O A;  1YTF B;  3U11 A;  3RYI A;  1PKX A;  2E3C A;  2E74 B;  1YCI A;  4YJ2 A;  5J2T A;  4LF7 B;  2Q68 A;  3ABL B;  4PA7 A;  4ZHQ A;  1ARO P;  4MT8 A;  2YS8 A;  4N23 A;  4JYC A;  2QWQ B;  4LFA B;  4EKW A;  5CBG A;  1XNQ O;  1M5I A;  4J7J A;  4MW8 A;  3CEI A;  5KMG A;  3ZN0 A;  1P7G A;  1Q81 W;  1OZ0 A;  5BY1 A;  2YUA A;  3H1J H;  4HNA B;  3M8A A;  4DV0 B;  1G1X B;  4X9Q A;  2JDI G;  2ZIO A;  4RQF A;  2NLJ C;  5CN0 A;  2R9A A;  1GN4 A;  4O4J A;  1FXV A;  2EZP A;  4PJ0 Z;  2B1I A;  2OYQ A;  3RN4 A;  4X62 B;  4J7Z A;  3ETG A;  1J5E O;  3SR2 C;  1U96 A;  5EK0 A;  2GDS A;  1FAF A;  3IGA C;  4XBF A;  1MSD A;  2CTW A;  5KHH A;  1TGO A;  1HNZ B;  4X65 B;  4BW5 A;  5IWA B;  3T1H B;  1VQP V;  3L73 H;  5CA1 B;  2QSA A;  2X6B A;  5DN6 G;  5LP6 B;  4YY3 B;  4UCT A;  1B3Q A;  1GN2 A;  3FB7 C;  3LDD A;  2WPD G;  4R7C A;  4LF4 O;  2EJ7 A;  4CS3 A;  3JAS B;  3U0Z A;  5FLX N;  2JJ2 G;  3OAA G;  4B7K A;  1NR7 A;  4DV7 O;  3R65 A;  1XNR O;  3JCU Z;  1OCR B;  3OEH G;  1PNL A;  3SPJ A;  2BOB C;  4R50 A;  4Z1M G;  2ARH A;  5LMN O;  1NJI W;  1GTO A;  4NB5 A;  3L70 H;  5IJ0 A;  3P3P A;  1AR5 A;  1LUV A;  2DYR B;  2DWE C;  1VF6 C;  3ASO C;  3HKC B;  3LSQ A;  3NXS A;  2IH3 C;  3KKY A;  1JA8 A;  4LP8 A;  2B5U A;  3K57 A;  2OTJ V;  4TT3 G;  1BQ0 A;  4FLY A;  1T5E A;  4O2B A;  1OCO B;  3RYC B;  4PA4 A;  2DOS A;  1SKV A;  3QO7 A;  3E35 A;  1QLE C;  2Q9L A;  4TQF A;  1UFI A;  3BA9 A;  4DR3 O;  3O9O A;  4JI1 O;  3J7A U;  2YDE A;  1I94 B;  5DM6 V;  1SZT A;  3MDS A;  5EIB D;  2A06 H;  4PHZ A;  4I4T B;  3ZMT A;  4CH6 A;  2FL4 A;  1M57 B;  2UXX A;  3FYI B;  4PI0 A;  4I9Q A;  4H33 A;  5LHH A;  4LF6 O;  1HNX O;  2JIZ G;  3HKD B;  2Y4U A;  2DW4 A;  2GSM B;  2L6L A;  3X2Q C;  2RNB A;  2EZO A;  2PZS A;  1JOY A;  2UXB O;  1DLB A;  3GWK C;  4OX9 O;  4JTA B;  3G71 V;  1WPX A;  4LF5 O;  3I55 V;  2BSK A;  1NVP B;  2Q5Z A;  4LFB O;  2AW9 A;  5LGU A;  3DC6 A;  5B1O A;  4FJC C;  3H9V A;  4JYA B;  2IBZ H;  2ZIN A;  4EB6 B;  2Q6A A;  2Y69 B;  3KZI Z;  3JAL A;  2EIM C;  1BMF G;  3ZHU A;  1NS1 A;  2QJ1 A;  1NR1 A;  4UV8 A;  5EBL C;  4F4L A;  4E4E A;  4P9O A;  1RM1 B;  5IJ9 B;  5KA6 A;  3N27 A;  4X1K A;  1VF5 B;  4AHC A;  4H44 B;  4QGP A;  2HHH O;  2Y48 A;  3UO2 A;  4J7K A;  5BMV A;  3L75 H;  2GV9 A;  5FPO A;  2QWO B;  3VQY A;  3ICX A;  5A9G A;  3CYO A;  4A5U B;  3HB3 B;  5B66 Z;  1XDC A;  3JAT A;  2A7W A;  2OIE A;  5GTI Z;  1AP5 A;  2NR5 A;  3DTU B;  2YC0 A;  4IIJ B;  4IHJ B;  3K79 A;  3UKM A;  1TVK A;  4AIL C;  4GKK O;  5KAF Z;  1OCC C;  3FB8 C;  3G6B A;  2Q0O C;  3FB5 C;  4LWS B;  4O4L A;  4YHH B;  5D5Q A;  3JAR B;  1NH2 B;  2FML A;  1NTK H;  2ZE8 A;  2XND G;  3E86 A;  1XMQ B;  1N0J A;  4DR4 B;  3G67 A;  1WP7 A;  5IYC O;  3ZMZ A;  1OV9 A;  1XQ8 A;  2JRI A;  5JH7 B;  4DV4 O;  4B3T B;  3B09 A;  2ZE7 A;  3OR6 C;  1KMI Z;  1VP7 A;  2YIC A;  3F5W C;  1A32 A;  1R6T A;  2QM4 A;  4K0K O;  4XDJ A;  1Q86 W;  3AK1 A;  3JD0 A;  5GON A;  1U97 A;  5LOV B;  4TV8 A;  5IT9 N;  2DJV A;  3UM7 A;  3H1K H;  1BS3 A;  2ZE5 A;  4X64 O;  3EHB B;  1V55 C;  4WFA V;  3G6E V;  2QWN B;  4ZIB A;  2LJ2 A;  1IBM B;  2JGD A;  2WAM A;  4JI7 B;  3QVN A;  3JAW A;  5EYP A;  4DRX B;  2L35 A;  1D2D A;  4JTC B;  1SS3 A;  2ATK C;  2WLI B;  4U3J B;  3IFX A;  5E79 Z;  3JAM N;  4DV3 O;  1JFF B;  1VQ9 V;  3K5N A;  1SC5 B;  4FZ1 A;  3OW2 U;  1PL4 A;  3G80 A;  2Q4P A;  4P30 A;  1B04 A;  2QKA A;  3JAK B;  1RPR A;  1VF7 A;  1ZUQ A;  4UFZ A;  2K9P A;  3SJA C;  5C8Y A;  3KCX A;  2EUL A;  1FXK B;  1SQB H;  1QLN A;  4LNU B;  2ZXW C;  4MTX A;  3ETQ A;  1VIB A;  4CC5 A;  5CBH A;  4UVB A;  3W7W A;  2WLL B;  1FJG O;  3HKB A;  1Y4M A;  1FPO A;  4PA9 A;  5LHI A;  3CWB H;  2CH7 A;  2ZDI C;  3B8N A;  3J80 N;  2HVK C;  3GB7 C;  4LF9 B;  4LH7 A;  2JEX A;  4MVU A;  4D6T H;  1K7D A;  1V9P A;  2Z5U A;  2IJI A;  1Q6I A;  1PP9 H;  1TUB A;  4X1Y A;  4DXW A;  2UXD B;  1YSC A;  3CJH B;  1QR9 A;  3F7V C;  2A3Q A;  1WB8 A;  4JI2 O;  1KP3 A;  4TOI A;  1VQ8 V;  1NBM G;  1ZWI C;  2D2C B;  3J81 N;  2CK3 G;  2Z3Y A;  4FLW A;  3H1L H;  3P30 A;  4PDR A;  2XAS A;  3AG3 C;  2ADP A;  1FFT B;  1JQ0 A;  5HFM A;  3ML0 A;  4ZOL A;  5LMU B;  3AG4 C;  3M7M X;  4ZBM A;  1VQ7 V;  4TV9 B;  3C90 A;  4X1I B;  3OFN G;  3MHH C;  4FM0 A;  1H2K A;  4I9W A;  2VQE B;  4BIO A;  4B3M B;  1EN4 A;  1YHQ V;  4FLT A;  1HR0 B;  3OGC C;  1ZTE A;  4RUE A;  4OGQ B;  4UVA A;  1R3I C;  1KP2 A;  1YVW A;  2DQ0 A;  2QGN A;  2VQF B;  1N4C A;  1D5A A;  2V1D A;  1EBO A;  1N33 B;  2N05 A;  4FFB B;  2PTM A;  2GUZ B;  1I5X A;  2LFR A;  5B1B C;  4DYL A;  2H94 A;  1EZV H;  1M4U A;  2QWP B;  3K3W A;  2EIJ B;  3OTF A;  5LL6 Y;  4CBC A;  3AG1 C;  3WB0 A;  5LA6 B;  3CCL V;  1Y74 A;  3VBB A;  5KX5 B;  2OCC C;  5BXZ A;  3TGU H;  2VS0 A;  2DE0 X;  4DV2 O;  3K04 A;  1LNQ A;  4JV5 B;  3CRM A;  1IXB A;  4WFB V;  4QPK A;  3TCU A;  3RYI B;  4O2A A;  1BCC H;  2UXC O;  1P7B A;  4UCS A;  2Q69 A;  4YJ2 B;  1Q5O A;  3T1Y O;  3CHX A;  2UUA B;  3H1I H;  4ZHQ B;  2ZM6 B;  4X88 A;  2EIK B;  4NTW A;  3AEI A;  1QNM A;  1SQX H;  3E89 A;  4NR1 A;  1Q82 W;  2XAG A;  5L3E A;  2CUG A;  2PF4 E;  3STZ C;  2WA4 A;  4DR2 O;  4H0L B;  5KMG B;  2Q0A A;  1KUQ A;  3GVM A;  3CRR A;  3SYP A;  3SPC A;  2EIN C;  4ZI7 A;  1MA1 A;  5CA3 A;  2ZR3 A;  3IAY A;  3E83 A;  3L71 H; 
#chains in the Genus database with same CATH homology
 3TXQ A;  1WA8 A;  2KG7 A;  3G80 A;  4LWS A;  3FD9 A;  3TXS A;  3HR0 A;  4GZR B;  2KG7 B;  1WA8 B;  2VS0 A;  2DE0 X;  3GVM A;  3FAV A;  2VRZ A;  4I0X A;  3ZBH A;  4LWS B;  2AZ2 A;  3Q4H A;  3FAV B;  4I0X B;  3OGI B;  3Q4H B;  4ABM A;  3O9O A;  3GWK C;  2B9Z A;  2AZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...