3OGIB

Crystal structure of the mycobacterium tuberculosis h37rv esxop complex (rv2346c-rv2347c)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
89
Chain Sequence
FMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ESAT-6-like protein 6
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 27
structure length 89
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3ogiB00
3GWKC 3Q4HB 3HR0A 4LWSB 2B9ZA 1WA8B 3Q4HA 2KG7B 3G80A 4I0XB 4LWSA 3FAVB 1WA8A 2VS0A 2KG7A 2AZ0A 4GZRB 2VRZA 3FAVA 4I0XA 3TXQA 4ABMA 2DE0X 3TXSA 3OGIB 2AZ2A 3FD9A 3ZBHA 3GVMA 3O9OA
chains in the Genus database with same CATH superfamily
5CA1B 3ML0A 1I0HA 3D8CA 3CP1A 1XL4A 1HDJA 3JATB 5AG2A 3IFXA 1AJQA 1TUBB 1Z5VA 4H44B 3L75H 4ASUG 4J7KA 2IH1C 1ZWIC 1GAXA 1FFXB 5B1BC 2P4KA 4GX1A 1WPBA 1EZJA 2UXNA 4MW3A 4NXMB 3P3PA 2KKWA 5CBGA 1VF5B 2QJ1A 3CC7V 1W59A 5GONA 2ZE8A 4LH7A 4Z1MG 3U0ZA 3CMEV 5JH7B 3FB6C 4IYHA 2ZXWC 4PA6A 4PDMA 2OWOA 1IBKB 1NH2B 2GDSA 1Q8IA 4I4TB 2YIBA 4LC1A 1BT8A 1FXKA 2UUBB 1P49A 3SJAC 4GKJB 1TUEB 5JJJB 2CAZC 4W4KA 4WFFA 4UXNA 2JK5C 3BVOA 3ABMB 1HW7A 3CRMA 5CN0A 1GM7A 4QGPA 2RCVA 1M5IA 1IBKO 2CE4A 1GM8A 5IJ9A 1DLBA 1YTFD 2UUBO 1RFYA 2DOSA 4GKJO 5C8YA 1L0LH 3CE2A 4MT8A 2KSDA 2B1IA 4NB5A 2ITDC 1G4YB 4JI5B 5H6QA 2UXDO 4FFBA 4X1YA 2NLJC 4FLVA 3U10A 1K92A 2PI4A 3MDSA 2N05A 4I0XB 4TQDA 4ZHQB 2HEPA 5H2FZ 4JI5O 4Z1VA 4WFEA 2AHYA 3JAKA 4CBCA 2WLNA 1LUWA 3T1HO 4FZ1A 2F66C 1MSWD 2E74B 3OFNG 4BIZA 2WA3A 3RYCB 5B66Z 1HNZO 5CB4A 1VQLV 2EINC 1K5SA 1WAZA 1RM1B 2XUMA 2ARHA 2FYUH 3CS5A 2XTAA 1JOYA 2HJFC 1Y74B 4J9YB 3UT5B 4DR2B 3ZHRA 3ZMUA 1JVMA 2QWOB 4DR4O 2W0XA 1SQGA 1H38A 2CDYA 1DGSA 3AG1C 1JA8A 1E79G 4MVQA 3CD6V 2P6JA 4X62B 2DYRC 1H2KA 2HVJC 3HKEA 1AR4A 2JVDA 4WBNB 3D3IA 2E5LB 1OV9A 4YIPA 2RDCA 4WF9V 3E83A 5EYPB 4X62O 3K03A 1VIBA 4HYOA 4EFEA 3ETEA 4JYBA 5H9CA 4FFKA 3WB2A 1JFFB 1NI8A 2Q7HA 5EBLC 4PDRA 5IYDO 1YTFB 3ABTA 2YSUB 3IGAC 1M1KW 1GK9A 4D7TA 1ZL8B 2NR5A 1F51A 2Q67A 3N2KA 5FL7G 4OXSA 4UB8Z 1P7BA 1FAFA 3WU2Z 4CH3A 4JI8B 1IXBA 1D2DA 2ADPA 5B1AC 4LP8A 1MNGA 1B04A 2DWDC 2QM8A 4DV2B 3G71V 2QEXV 4TSFG 3J80N 3HKDB 1Z5WA 2QE7G 3ZJZA 4PA9A 4DV5B 4O4LB 4IHJB 5IYCO 2BTQB 4DV2O 4CS2A 3JD2A 4UUJC 3T1YO 3ZRVA 1TVKB 4MVOA 1VP7A 5BMVA 1ZLZA 4DV5O 1ZUQA 1S76D 2NN4A 1QQCA 1N0NA 5LP6B 2YEVA 1M56B 3APQA 3QO5A 4JYYA 1K4CC 1MA1A 3JAMN 2Y0PA 3S3XA 3L71H 1NTKH 4DV0B 1EN6A 3C3TA 4JF3A 2EILB 3VQWA 3F7YC 5HFLA 2OIGA 4CS4A 1Q82W 1M57C 4DV0O 3RYIA 5IYBO 2BSKB 2IU3A 3GWKC 1FD9A 4TUYA 2PYLA 2ZR3A 3SPHA 1OCZC 4X20B 1IBLB 5CBFA 4Q6GA 3AG2C 3W7UA 1SQVH 5JQGA 2HFEC 2IJHA 1QNMA 3H9VA 2QWRB 5IDJA 1H8EG 4D6TH 1HR0B 4TWKA 2F43G 4P9PA 3K79A 2YXHA 4ZI7B 1PM9A 5IJ0B 1N8RW 3BAAA 1HR0O 5C93A 4TV9A 4NTYA 4LF9O 4YY3O 1WB8A 4KXRA 2OIEA 1VEWA 2KB1A 5L3GA 1Y67A 2LGWA 4MW8A 2EIKC 4MVSA 5F2VO 2A9HA 4JYAO 4FLXA 4LWSA 3CJHB 2AZ0A 1N32B 1EM1A 3D3QA 4X1IB 3OGCC 4O2AB 3OGIB 2EULA 3BCCH 3MHHC 5DECA 2CTPA 3L74H 3AK1A 4ZIBA 3K9AA 1N32O 1AP5A 1BQZA 3UM7A 1QCEA 3AEIA 2WLIA 1R6NA 2V1DA 2VS0A 2JRIA 3W7TA 1AVMA 4ICGA 3FYIB 4ZOLB 4HAMA 4F4LA 2PTMA 3K5MA 1G1XB 4JI1B 4KHPB 4JGSA 4O4JB 2F1MA 3EXAA 1KYOF 3SGIA 3H1LH 3SYOA 3ZS8C 1VF7A 1US6A 1GN2A 2DYSB 3K08A 1THZA 4JI1O 4KHPO 1K73W 1QLEB 3ZN0A 4LF6B 5K1XA 1ZX3A 4GLXA 1Q6IA 4KL1A 2PYJA 2RQ6A 1P84F 2ILMA 5EBWC 5B3SC 1V55B 3H1JH 3E86A 1LUVA 2UUAO 4LF6O 3ZHVA 4YJ3B 2XOKG 3CRCA 3ASNC 4CS3A 3P3NA 5LXTA 3CCLV 2G38A 1Y76B 2YIBD 4RUFA 1AJNA 3LNNA 5HFMA 5KMGA 3JSNA 1VQMV 3ZRWB 4TV8B 3H1IH 3DC5A 3W7WA 1XL6A 2R70A 2YUAA 3SYCA 1XNRB 3WB1A 1I94B 1VQKV 4TOIA 5LBQA 1O9HA 3ZHSA 3BRCA 1PP9H 3U11A 4BIUA 1I94O 2VQEB 3ASOB 1XREA 3RYHA 1V54C 2ZINA 4U3JA 5IYZB 4LF7B 1HNXB 4RQEA 4DXWA 1ZAUA 1YSCA 2XNDG 4CH5A 1VQ9V 3JARB 2VQEO 5LMUB 1AB3A 2Q4PA 2EIMB 1WA8B 1XNQB 3CC4V 1S5JA 3T4ZA 4LF7O 1HNXO 1NS1A 2CH7B 1HNWB 4UFZA 4IIJB 1I7FA 5LMUO 4IGGA 2GTAA 1VF6C 1XUQA 2CGOA 4G27B 2YS8A 1L1FA 1XNQO 3FD9A 2JIZG 4LNUA 4JI3B 1WNSA 5LYJA 5BY1A 4QE9A 2OCCB 3K57A 4DRXA 1SC5B 2RNBA 4LF5B 1Y4MA 1YJNV 5BR8B 3LDEA 5IWAB 1K34A 4H13B 2ZD9A 4JI3O 3PN1A 2CTRA 2VRZA 3VQVA 4AHCA 4I55A 1FS0G 4DR6B 5BR8O 1VARA 3OW2U 1N36O 3MAQA 5IWAO 4HZ3A 4RO2A 4WFAV 1BZKA 1OCCB 4WFGA 4R6ZA 4CH6A 5H6RA 1PL0A 2Z3YA 4EB6A 4DR6O 4IT5A 2KG7A 1NBMG 3FAVA 5KX5B 4R50A 5LA6A 2Q69A 3BHPA 4DK0A 4FLYA 3A0RA 3ZMVA 1G8MA 2CTWA 1UPGA 1AI5A 1KECA 2XAJA 2DJVA 5C8YB 1YZBA 4NYKA 3L73H 1XEQA 2D2CB 2XAFA 4JTCB 1BMFG 3B40A 2Z0AA 5JJNB 2QKAA 2EIJB 4DV6B 3CCRV 1SF9A 1O9GA 3L72H 4XDJA 1NR7A 3RWRD 4ZBMA 1NZ6A 4I7ZB 5JJEB 3MD0A 4DV6O 2N04A 1YCIA 4FMTA 2YI9A 2UU9B 2PF4E 1F4NA 3ZX6A 1K97A 3ABMC 1XMOB 3ICXA 3B2EE 3O9OA 1SRYA 5CB4B 4QNHB 4O4HA 2WA4A 4J11A 3M99B 3JCUZ 3AG7A 4JZ2A 1CEZA 2JGDA 5GTHZ 3HKCA 2IW5A 5L3CA 4NXMO 1AROP 2WLJA 2ZR2A 3DXRA 3WFVA 2QDOA 3KKYA 5IY5B 1WN7A 3ZMTA 1N34B 3RYFA 1VF6A 1X59A 3T2MA 4MVMA 1SKVA 2WLMA 3TETA 4X1KB 3X2QB 1N34O 3E22A 4DV3B 1IX9A 1NU1H 2UXCB 4YJ2A 2KQXA 3AK2A 1VQ6V 4LCUC 1RM1C 2UUCB 1SZTA 4FLTA 3L70H 1XI1A 4DV3O 5KUMA 3JALB 1X4TA 3N2KB 4AQYB 3JSLA 2UXCO 4GKKB 4LFCB 1K7DA 2UUCO 3JASB 2AZ2A 3VQYA 4O2BB 4AQYO 3QO7A 3R66A 1VQNV 2QSAA 3B8NA 4GKKO 5CA1A 4LFCO 2H3OA 4LR3A 3UO2A 4J7JA 3BY6A 4LH6A 2YDEA 2BOBC 4K35A 3TXSA 4QPKA 3ABUA 2H8PC 2ZDIC 5KLVH 4QIWF 3STLC 1FFXA 4L8JA 5J2TB 1KQSU 2XAHA 4YHHB 4XBFA 5BMVB 4NTWA 3VBBA 2DQ3A 2JEXA 4DR2O 1LNQA 4QPJA 2Q9LA 3RW0A 5B5EZ 3OMNB 1V9PA 4K0KB 2YEVB 3AK3A 1XOUA 5JVDB 1M9NA 3AG3B 3DTUB 2DN9A 2AGAA 5LGUA 4WFBV 4I4TA 1J95A 2A79B 3QVNA 4K0KO 4O4IB 1JJOA 2CTQA 5LHGA 3OR7C 2CUGA 2GUZB 2Y48A 1TAEA 4X9QA 4DV1B 2E5LO 2LFSA 1N33B 3AG4C 1JJ2U 1S0VA 3VQXA 4PA4A 3E8FA 5KHGA 4N23A 4BWAA 2K9PA 2Q5ZA 5J2UB 1K33A 2JEUA 4DV1O 1VQ7V 4DR5B 2A3QA 3KCYA 5JQGB 3UKMA 1K5QA 3S3WA 4PD4F 4JPRA 4D7SA 5L3DA 1TA8A 5LP6C 1XMQB 1KC8W 1M56C 4ZHQA 4DR5O 1JMKC 2QWNB 4JI8O 1F4MA 2CGNA 3P32A 1RP3B 2DYRB 1XMQO 2HJDA 2OCHA 2EILC 4G2KA 4X66B 3UQ8A 2Y69B 5GTIZ 4HNAB 2WWWA 5EIBD 4B3SB 2WLLA 2EJRA 1VQ4V 3TGUH 2Q6AA 4X66O 1H2LA 3APOA 4CC6A 2P67A 4QJFB 3IC9A 4LF8B 4LFBB 2DW4A 2P90A 4PDVA 2BOCC 4F6RB 4LWSB 3JD3A 4B3SO 3FB8C 1AP6A 2R9AA 2QTOA 4UCTA 3RN4A 4LF8O 4LFBO 2D3OW 4AI8A 4Q20A 2F93B 3C3SA 5CA0B 3UCSC 4E4EA 2JJ2G 2LP7A 1IURA 1WJZA 3JAWA 4WBNA 3CMAV 4GX2A 5ITZB 2WLIB 2ZQMA 1YXBA 2PY5A 3OUFA 2P5OA 2QM7A 1Q43A 3HPLC 4R8CA 1U97A 1SQBH 1NQTA 2LQTA 4MVUA 2ZDIA 1JFFA 3LNMB 2W6IG 4LFAB 1OCOB 4PDLA 3CEIA 3BA8A 1IBLO 5EC1C 1NVPD 3K3WA 3JYCA 4JI2B 2BCCH 3K0GA 3WB0A 2WLKA 4LFAO 4NXNB 3OAAG 2Q0OC 4I9WA 3H1HH 4I50A 1OCRB 4IL6Z 1Q6UA 3CXHF 2FKXA 3FX7A 4JI2O 3ZHQA 5LHHA 3CCUV 2LO1A 4NXNO 2LJ2A 2QA4V 2YC0A 2WPDG 1F23A 1M57B 5KMGB 3Q4HA 4O4LA 1YF2A 2N74A 5FNVA 4H37A 5EC2C 1GMGA 3F5TA 3CCJV 1PV0A 1TVKA 3CWBH 1WLEA 1S3JA 1OJHA 3QF7A 4DR7B 3SJCC 2ATKC 4X8AA 2DYSC 5KHKA 3WG7B 1QLEC 1IVSA 1JPXA 2HHHB 3RVZA 4QE7A 2F23A 1NJIW 2NNUA 4DR7O 3LSQA 3QO8A 5E79Z 2UXBB 4FM1A 3KCXA 1PNKA 2HHHO 3ZMZA 4UV8A 3FYEB 3K5OA 4JI7B 4GX0A 2O57A 3CC2V 2HLDG 4BW5A 2UXBO 2BSKA 2FTKA 4B08A 3W7SA 2EIKB 1DTOA 1NTMH 4PA3A 4X20A 3OTFA 4JI7O 2JGUA 2ZT9B 2XHBA 1QVGU 5LYJB 1E1RG 4DRXB 1S5LZ 1XBLA 2ITCC 2VQFB 1DK1A 4PELA 2F4VB 3ZHTA 1NVPB 3F7VC 1BHBA 3HB3B 2YICA 1T5EA 4I55B 5IJ0A 4UCSA 1SS3A 2VQFO 5B1NA 3O65A 1M90W 4MTOA 2WSSG 4FVMA 2EIMC 3G6BA 3ZBHA 1P4RA 4E2LA 5LMNB 1QVFU 3FFQA 1E1QG 2Q0AA 2OT5A 1XHXA 3CCVV 2CK3G 3R65A 4JI6B 5K1PA 1RPRA 4FM2A 3A0HZ 5LOVB 1MABG 4DUYB 1XNRO 3CB2A 5LA6B 1B3QA 5KA6A 4XDKA 2OCCC 1UFIA 2Z5UA 1F7YA 2BTOA 2MW2B 3CJHA 4JI6O 4G28B 4X1IA 4DUYO 5L3EA 2P06A 4KP4A 1EFRG 5JWPA 2GV9A 1W2BU 5DEDA 3HKBB 2QWQB 3D36C 1M4UA 5LL6Y 3A8TA 5EBMC 4B3MB 3SDLA 3OUSA 2RN9A 3SJQC 1ENVA 3CXCU 4MS2A 5TISZ 4PV1B 1GO3F 5KHIA 4P30A 1H2GA 2WLHA 1KB9F 1HNWO 1NKDA 5B1OA 2X7RB 4PI2A 4ZOLA 4B3MO 4B7KA 1KBHA 4X88A 2XASA 3DGEA 5E1AC 1Y6XA 1M93A 1FJGB 1BL8A 3TK1A 3ABKB 1BHAA 5EZYA 1BSMA 3KZIZ 3OM3B 4LF5O 4K8XA 4UCVA 4O4HB 1FJGO 3DSQA 3E8GA 5GONB 2IM9A 2QGNA 3J7AU 2JGDB 3LSSA 1MOFA 3CCMV 3HKCB 2IH3C 1SA0A 2PGGA 2EIJC 4J9ZB 1ROPA 3PJSK 1H2SB 4KFMA 4JAAA 4U3FH 1NH2D 1FXKB 1HWYA 3B09A 1Y76A 2V4DA 4OPHA 2EZPA 1GN3A 3RYFB 3CYOA 3EFFK 3ETQA 3EVKA 3G6EV 4NTXA 5IJ9B 4OX9B 4J7ZA 4LF4B 2Q73A 3LDDA 3A0BZ 3N2GA 5FPOA 2X0LA 1PNLA 2LW7A 4FFBB 4X1YB 2YXYA 4OX9O 1SETA 1AJPA 5IYZA 4B3TB 4LF4O 4L87A 4MSWC 2IJKA 2ZNJA 3JD0A 3JARA 3K04A 4JZGA 3JAKB 2OTLV 1IXMA 1WA8A 1BQ0A 4B3TO 1H2MA 2LGQA 1MZFA 2CH7A 5IY5C 3CX5F 4CZZA 3EHBB 3BPZA 4DW0A 1EN5A 1RSOA 4UVBA 3OMIB 3GVMA 1PPJH 1K4DC 2PZSA 1S77D 3LDCA 2UU9O 1AI7A 3X2QC 1I5YA 2X6CA 2LFRA 1TGOA 3CCEV 5KAIZ 3OMAB 3RFRA 1XMOO 5BZBA 1Q5OA 1QR9A 3ABLB 1KP2A 4FK5C 1VQOV 4IYIA 2V7QG 3BFRA 3W7XA 2R72A 3D36A 2ZM6B 3E35A 2XAQA 1R3JC 4W4LA 5KHHA 3JD1A 2K1EA 3LSUA 4FZ0A 1K3EA 3SPJA 2ZM6O 1R3IC 3HKEB 1N4CA 2QKCA 1MG1A 2X6BA 4PJ0Z 2Y0IA 5KX5A 3SYQA 2XAGA 2YIDA 3ETDA 2DMXA 2ODMA 1BCCH 4UCUA 2P22C 2UXDB 1YJ9V 5B1BB 5LGNA 2ETNA 3CPWU 2HKOA 3K5LA 4UV9A 4PHZA 1WB7A 3H1KH 1KU9A 3T1CA 1MSDA 1YJWV 2E75B 3FKSG 1B06A 4RWUA 4JI4B 1R3KC 2LW1A 3ETGA 5A2QN 1DF4A 4JYCA 1MZEA 3J81N 1GM9A 2ZXWB 3OT7A 1CXZB 1ZSPA 3T1HB 2X6AA 3B8MA 3OTOB 4JI4O 4P9OA 2EJ7A 3AG3C 4BAYA 1QHTA 1I5XA 3JATA 4GZRB 4TT3G 3SR2C 1HNZB 1KUQA 1JX9A 3BEHA 4K8ZA 4JV5B 1PKXA 4I9QA 2P4VA 1TUBA 5KA5A 3E8BA 3OTOO 1VQ5V 2ZE6A 3QNEA 1AR1B 1NT2B 4UB6Z 4B7EA 2FMLA 3F5WC 3L9DA 5CMUA 3C90A 1PNMA 4JV5O 1R73A 1BE3H 5IT9N 2WLLB 2FB5A 4R7CA 1D5AA 4DR4B 5KAFZ 4NR1A 2VWKA 3SPCA 5JH7A 2A06H 3K59A 4YHHO 3IAYA 4NKGB 3G67A 4F6EA 1OHHG 2ZIMA 1HP8A 1W0KG 2YIAA 3CHXA 3OD4A 4JAVA 4U7OA 1KP3A 2P7TC 3OEEG 1WP7A 4WCEV 5DN6G 4ABMA 1QBZA 1XDCA 3BABA 2EINB 3JAWB 1W0JG 4GT1A 4X1KA 2Y69C 3RYIB 3K5NA 4TUYB 2QR4A 3CCQV 1DF5A 1SQXH 1N33O 1OZ0A 3G80A 1H8HG 2HR3A 1COWG 1YEWA 4DUZB 3JALA 3GWOA 2L35A 4I0XA 1EN4A 2W0FC 3AG1B 4NVPA 1AI6A 3ZRXA 2AXTZ 2EBOA 1A32A 3JASA 4DV4B 3STZC 4PI0A 1FYJA 4DUZO 1L0NH 1PD3A 4MVRA 4TV9B 3M7MX 4O2BA 4WFHA 1NR1A 4I50B 3RYCA 4RQFA 2A0LA 1GKFA 3B4SA 2GHYA 3NXSA 2OTJV 1KD1W 4DV4O 2OYQA 3SYAA 2B1GA 4CC5A 3T1YB 1IZ3A 3RBZA 3AG4B 4BIOA 3LUTB 3K06A 4DO2A 5FLXN 5JCOC 1Y74A 3Q4HB 3UT5A 1URFA 1GRJA 5FNVB 1SQPH 4DR1B 1OCOC 2EZOA 3VOUA 4J80A 5J2TA 3I5DA 1FPOA 3B77A 4OPAA 4PA7A 2M7WA 2L6LA 3K58A 4AILC 2FL4A 2ZKOA 2QKSA 4X65B 3K9SA 1VQ8V 5B1AB 5D5QA 4DR1O 3FB5C 5JVDA 1J5EB 4LBEC 1OCRC 1BGYH 3P30A 4FIPC 2B9ZA 4X89A 4X65O 4N21A 4J41A 5EYPA 4O4IA 1J5EO 4X64B 2PI5A 3CRAA 1Q3EA 2GUZA 4H33A 2Y4UA 1IBMB 3SJBC 1FXHA 1XQ8A 3JCZA 1EZVH 1ZL8A 2GSMB 3OEHG 5H5NA 4X64O 3OR6C 2HG5C 3IJ4A 4BR6A 5J2UA 5EIBC 1Q81W 4FJCC 1IBMO 4FLUA 3ZIAG 3M8AA 1SQFA 1Q90D 1YDXA 2R9IA 2ZIOA 3CSXA 5EK0A 2ADQB 1FXVA 2ZE5A 1S72V 3WG7C 4LF9B 4JASA 3T4DA 4MTXA 3OE7G 4YY3B 2QM4A 1JR9A 1WPXA 3E8HA 4A5UB 4OGQB 5LXTB 1I08A 1ZTEA 4C7UA 3HKDA 2W6JG 3QG5A 4IHJA 4EFBA 3ZHUA 2BTQA 1XHZA 1OCZB 2JS3A 4JYAB 2RMKB 4UCRA 1Q6HA 3AG2B 4HNAA 1R6TA 2DQ0A 4UVAA 1SESA 1RPOA 2A7WA 4HBNA 3N27A 3RVYA 1GTOA 5LP6A 4JTDB 2M6YA 3CRQA 4F6RA 4J42A 1GH6A 3A2FA 2H94A 3KG2A 1L8DA 3RYHB 2WAMA 4U3JB 1VQPV 3TCUA 1V55C 3MHSC 5CA0A 5L3FA 5DM6V 3K0DA 1B6QA 1U96A 2R9RB 2B5UA 5D5PA 2VWJA 5ITZA 4JI0B 4RAIA 2GTSA 3QTCA 1BS3A 4YIOA 5JCOA 4LNUB 1LR1A 4MVZA 2YXLA 3RT3C 4FPPA 4K3AA 4FM0A 1FKAO 1VMGA 2QTSA 4JI0O 1N0JA 3UO3A 3HR0A 3ZRSA 5J9PC 2IJIA 2PUSA 4U7NA 2Q7GA 3ASOC 2C2AA 5BXZA 1XILA 1Q7YW 5EZYB 1KKCA 1SERA 4ZI7A 1CP9A 2ZE7A 2UUAB 3JD4A 2IU0A 1R6KA 1GN4A 3E89A 5L3BA 4UVCA 2F4VO 3SPGA 2HVKC 3BA9A 3NR7A 1Z2GA 3TJTA 1SA0B 1D5NA 3DC6A 4J10A 1YHQV 4EB6B 2KG7B 4DV7B 2QWPB 3FAVB 1QU7A 1S5HC 5LMNO 2JJ1G 5GW7A 1PL4A 2JS5A 2GBOA 4KUMA 2XT9A 3FB7C 4DV7O 4O2AA 2RJZA 4EEQA 2MK3A 4EKWA 1AI4A 3ABKC 5LHIA 3RGBA 2ZCEA 3N2GB 5KHJA 1IDSA 2UXXA 4GUNA 1YVWA 4I5SA 5B3SB 1JQ0A 4DK1A 4JTAB 1UJWB 3ASNB 1K9MW 1OCCC 5CA3A 2Q68A 1SQQH 1FFTB 1AILA 1JCHA 3THOA 2E76B 4O4JA 1FXKC 4CH4A 5KUKA 3IC7A 2HP8A 1AR5A 1YIJV 4BW9A 4RUEA 3G4SV 3ZEDA 1RSOB 3TXQA 1SZXA 4FLZA 1R1BA 1R3LC 2AW9A 3SPIA 2EX3A 2Q7EA 3CRRA 4DR3B 2Y4TA 5IE9A 4DW1A 4H0LB 1Y66A 1V54B 2YI8A 4P2ZA 4B3RB 1WP8A 1N36B 3GB7C 1G6UA 4GCZA 2IBZH 4DR3O 4YJ3A 2DWEC 3ZCCA 1YITV 3SYPA 4GX5A 3ZN1A 4DYLA 5LGTA 1H2NA 3DXRB 5FPRA 2F95B 4B3RO 2ZNIA 3ZRWA 4TV8A 3CCSV 1CPYA 5A9GA 3I56V 4TQFA 4MTFA 1MMMA 1KKDA 1EBOA 3ZMSA 3I55V 4FLWA 4ZKIA 1QLNA 5LOVA 3E22B 2JDIG 1YI2V 2IJJA 1K8AW 3H01A 4YJ2B 4YXWG 5CBHA 2AHZA 2E3CA 2Q8VA 1KMIZ 3ABLC 1ORQC 4MTGA 3E2EA 3HKBA 1Q86W 1P7GA 1QR8A 2DE0X 1NTZH 4JAUA 4GYCB 4XDLA 1GN6A 4Z2WA 2BE3A 4IIJA 4UCOA
chains in the Genus database with same CATH topology
3GWKC 3Q4HB 3HR0A 4LWSB 2B9ZA 1WA8B 3Q4HA 2KG7B 3G80A 4I0XB 4LWSA 3FAVB 1WA8A 2VS0A 2KG7A 2AZ0A 4GZRB 2VRZA 3FAVA 4I0XA 3TXQA 4ABMA 2DE0X 3TXSA 3OGIB 2AZ2A 3FD9A 3ZBHA 3GVMA 3O9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWK C;  3Q4H B;  3HR0 A;  4LWS B;  2B9Z A;  1WA8 B;  3Q4H A;  2KG7 B;  3G80 A;  4I0X B;  4LWS A;  3FAV B;  1WA8 A;  2VS0 A;  2KG7 A;  2AZ0 A;  4GZR B;  2VRZ A;  3FAV A;  4I0X A;  3TXQ A;  4ABM A;  2DE0 X;  3TXS A;  3OGI B;  2AZ2 A;  3FD9 A;  3ZBH A;  3GVM A;  3O9O A; 
#chains in the Genus database with same CATH topology
 5CA1 B;  3ML0 A;  1I0H A;  3D8C A;  3CP1 A;  1XL4 A;  1HDJ A;  3JAT B;  5AG2 A;  3IFX A;  1AJQ A;  1TUB B;  1Z5V A;  4H44 B;  3L75 H;  4ASU G;  4J7K A;  2IH1 C;  1ZWI C;  1GAX A;  1FFX B;  5B1B C;  2P4K A;  4GX1 A;  1WPB A;  1EZJ A;  2UXN A;  4MW3 A;  4NXM B;  3P3P A;  2KKW A;  5CBG A;  1VF5 B;  2QJ1 A;  3CC7 V;  1W59 A;  5GON A;  2ZE8 A;  4LH7 A;  4Z1M G;  3U0Z A;  3CME V;  5JH7 B;  3FB6 C;  4IYH A;  2ZXW C;  4PA6 A;  4PDM A;  2OWO A;  1IBK B;  1NH2 B;  2GDS A;  1Q8I A;  4I4T B;  2YIB A;  4LC1 A;  1BT8 A;  1FXK A;  2UUB B;  1P49 A;  3SJA C;  4GKJ B;  1TUE B;  5JJJ B;  2CAZ C;  4W4K A;  4WFF A;  4UXN A;  2JK5 C;  3BVO A;  3ABM B;  1HW7 A;  3CRM A;  5CN0 A;  1GM7 A;  4QGP A;  2RCV A;  1M5I A;  1IBK O;  2CE4 A;  1GM8 A;  5IJ9 A;  1DLB A;  1YTF D;  2UUB O;  1RFY A;  2DOS A;  4GKJ O;  5C8Y A;  1L0L H;  3CE2 A;  4MT8 A;  2KSD A;  2B1I A;  4NB5 A;  2ITD C;  1G4Y B;  4JI5 B;  5H6Q A;  2UXD O;  4FFB A;  4X1Y A;  2NLJ C;  4FLV A;  3U10 A;  1K92 A;  2PI4 A;  3MDS A;  2N05 A;  4I0X B;  4TQD A;  4ZHQ B;  2HEP A;  5H2F Z;  4JI5 O;  4Z1V A;  4WFE A;  2AHY A;  3JAK A;  4CBC A;  2WLN A;  1LUW A;  3T1H O;  4FZ1 A;  2F66 C;  1MSW D;  2E74 B;  3OFN G;  4BIZ A;  2WA3 A;  3RYC B;  5B66 Z;  1HNZ O;  5CB4 A;  1VQL V;  2EIN C;  1K5S A;  1WAZ A;  1RM1 B;  2XUM A;  2ARH A;  2FYU H;  3CS5 A;  2XTA A;  1JOY A;  2HJF C;  1Y74 B;  4J9Y B;  3UT5 B;  4DR2 B;  3ZHR A;  3ZMU A;  1JVM A;  2QWO B;  4DR4 O;  2W0X A;  1SQG A;  1H38 A;  2CDY A;  1DGS A;  3AG1 C;  1JA8 A;  1E79 G;  4MVQ A;  3CD6 V;  2P6J A;  4X62 B;  2DYR C;  1H2K A;  2HVJ C;  3HKE A;  1AR4 A;  2JVD A;  4WBN B;  3D3I A;  2E5L B;  1OV9 A;  4YIP A;  2RDC A;  4WF9 V;  3E83 A;  5EYP B;  4X62 O;  3K03 A;  1VIB A;  4HYO A;  4EFE A;  3ETE A;  4JYB A;  5H9C A;  4FFK A;  3WB2 A;  1JFF B;  1NI8 A;  2Q7H A;  5EBL C;  4PDR A;  5IYD O;  1YTF B;  3ABT A;  2YSU B;  3IGA C;  1M1K W;  1GK9 A;  4D7T A;  1ZL8 B;  2NR5 A;  1F51 A;  2Q67 A;  3N2K A;  5FL7 G;  4OXS A;  4UB8 Z;  1P7B A;  1FAF A;  3WU2 Z;  4CH3 A;  4JI8 B;  1IXB A;  1D2D A;  2ADP A;  5B1A C;  4LP8 A;  1MNG A;  1B04 A;  2DWD C;  2QM8 A;  4DV2 B;  3G71 V;  2QEX V;  4TSF G;  3J80 N;  3HKD B;  1Z5W A;  2QE7 G;  3ZJZ A;  4PA9 A;  4DV5 B;  4O4L B;  4IHJ B;  5IYC O;  2BTQ B;  4DV2 O;  4CS2 A;  3JD2 A;  4UUJ C;  3T1Y O;  3ZRV A;  1TVK B;  4MVO A;  1VP7 A;  5BMV A;  1ZLZ A;  4DV5 O;  1ZUQ A;  1S76 D;  2NN4 A;  1QQC A;  1N0N A;  5LP6 B;  2YEV A;  1M56 B;  3APQ A;  3QO5 A;  4JYY A;  1K4C C;  1MA1 A;  3JAM N;  2Y0P A;  3S3X A;  3L71 H;  1NTK H;  4DV0 B;  1EN6 A;  3C3T A;  4JF3 A;  2EIL B;  3VQW A;  3F7Y C;  5HFL A;  2OIG A;  4CS4 A;  1Q82 W;  1M57 C;  4DV0 O;  3RYI A;  5IYB O;  2BSK B;  2IU3 A;  3GWK C;  1FD9 A;  4TUY A;  2PYL A;  2ZR3 A;  3SPH A;  1OCZ C;  4X20 B;  1IBL B;  5CBF A;  4Q6G A;  3AG2 C;  3W7U A;  1SQV H;  5JQG A;  2HFE C;  2IJH A;  1QNM A;  3H9V A;  2QWR B;  5IDJ A;  1H8E G;  4D6T H;  1HR0 B;  4TWK A;  2F43 G;  4P9P A;  3K79 A;  2YXH A;  4ZI7 B;  1PM9 A;  5IJ0 B;  1N8R W;  3BAA A;  1HR0 O;  5C93 A;  4TV9 A;  4NTY A;  4LF9 O;  4YY3 O;  1WB8 A;  4KXR A;  2OIE A;  1VEW A;  2KB1 A;  5L3G A;  1Y67 A;  2LGW A;  4MW8 A;  2EIK C;  4MVS A;  5F2V O;  2A9H A;  4JYA O;  4FLX A;  4LWS A;  3CJH B;  2AZ0 A;  1N32 B;  1EM1 A;  3D3Q A;  4X1I B;  3OGC C;  4O2A B;  3OGI B;  2EUL A;  3BCC H;  3MHH C;  5DEC A;  2CTP A;  3L74 H;  3AK1 A;  4ZIB A;  3K9A A;  1N32 O;  1AP5 A;  1BQZ A;  3UM7 A;  1QCE A;  3AEI A;  2WLI A;  1R6N A;  2V1D A;  2VS0 A;  2JRI A;  3W7T A;  1AVM A;  4ICG A;  3FYI B;  4ZOL B;  4HAM A;  4F4L A;  2PTM A;  3K5M A;  1G1X B;  4JI1 B;  4KHP B;  4JGS A;  4O4J B;  2F1M A;  3EXA A;  1KYO F;  3SGI A;  3H1L H;  3SYO A;  3ZS8 C;  1VF7 A;  1US6 A;  1GN2 A;  2DYS B;  3K08 A;  1THZ A;  4JI1 O;  4KHP O;  1K73 W;  1QLE B;  3ZN0 A;  4LF6 B;  5K1X A;  1ZX3 A;  4GLX A;  1Q6I A;  4KL1 A;  2PYJ A;  2RQ6 A;  1P84 F;  2ILM A;  5EBW C;  5B3S C;  1V55 B;  3H1J H;  3E86 A;  1LUV A;  2UUA O;  4LF6 O;  3ZHV A;  4YJ3 B;  2XOK G;  3CRC A;  3ASN C;  4CS3 A;  3P3N A;  5LXT A;  3CCL V;  2G38 A;  1Y76 B;  2YIB D;  4RUF A;  1AJN A;  3LNN A;  5HFM A;  5KMG A;  3JSN A;  1VQM V;  3ZRW B;  4TV8 B;  3H1I H;  3DC5 A;  3W7W A;  1XL6 A;  2R70 A;  2YUA A;  3SYC A;  1XNR B;  3WB1 A;  1I94 B;  1VQK V;  4TOI A;  5LBQ A;  1O9H A;  3ZHS A;  3BRC A;  1PP9 H;  3U11 A;  4BIU A;  1I94 O;  2VQE B;  3ASO B;  1XRE A;  3RYH A;  1V54 C;  2ZIN A;  4U3J A;  5IYZ B;  4LF7 B;  1HNX B;  4RQE A;  4DXW A;  1ZAU A;  1YSC A;  2XND G;  4CH5 A;  1VQ9 V;  3JAR B;  2VQE O;  5LMU B;  1AB3 A;  2Q4P A;  2EIM B;  1WA8 B;  1XNQ B;  3CC4 V;  1S5J A;  3T4Z A;  4LF7 O;  1HNX O;  1NS1 A;  2CH7 B;  1HNW B;  4UFZ A;  4IIJ B;  1I7F A;  5LMU O;  4IGG A;  2GTA A;  1VF6 C;  1XUQ A;  2CGO A;  4G27 B;  2YS8 A;  1L1F A;  1XNQ O;  3FD9 A;  2JIZ G;  4LNU A;  4JI3 B;  1WNS A;  5LYJ A;  5BY1 A;  4QE9 A;  2OCC B;  3K57 A;  4DRX A;  1SC5 B;  2RNB A;  4LF5 B;  1Y4M A;  1YJN V;  5BR8 B;  3LDE A;  5IWA B;  1K34 A;  4H13 B;  2ZD9 A;  4JI3 O;  3PN1 A;  2CTR A;  2VRZ A;  3VQV A;  4AHC A;  4I55 A;  1FS0 G;  4DR6 B;  5BR8 O;  1VAR A;  3OW2 U;  1N36 O;  3MAQ A;  5IWA O;  4HZ3 A;  4RO2 A;  4WFA V;  1BZK A;  1OCC B;  4WFG A;  4R6Z A;  4CH6 A;  5H6R A;  1PL0 A;  2Z3Y A;  4EB6 A;  4DR6 O;  4IT5 A;  2KG7 A;  1NBM G;  3FAV A;  5KX5 B;  4R50 A;  5LA6 A;  2Q69 A;  3BHP A;  4DK0 A;  4FLY A;  3A0R A;  3ZMV A;  1G8M A;  2CTW A;  1UPG A;  1AI5 A;  1KEC A;  2XAJ A;  2DJV A;  5C8Y B;  1YZB A;  4NYK A;  3L73 H;  1XEQ A;  2D2C B;  2XAF A;  4JTC B;  1BMF G;  3B40 A;  2Z0A A;  5JJN B;  2QKA A;  2EIJ B;  4DV6 B;  3CCR V;  1SF9 A;  1O9G A;  3L72 H;  4XDJ A;  1NR7 A;  3RWR D;  4ZBM A;  1NZ6 A;  4I7Z B;  5JJE B;  3MD0 A;  4DV6 O;  2N04 A;  1YCI A;  4FMT A;  2YI9 A;  2UU9 B;  2PF4 E;  1F4N A;  3ZX6 A;  1K97 A;  3ABM C;  1XMO B;  3ICX A;  3B2E E;  3O9O A;  1SRY A;  5CB4 B;  4QNH B;  4O4H A;  2WA4 A;  4J11 A;  3M99 B;  3JCU Z;  3AG7 A;  4JZ2 A;  1CEZ A;  2JGD A;  5GTH Z;  3HKC A;  2IW5 A;  5L3C A;  4NXM O;  1ARO P;  2WLJ A;  2ZR2 A;  3DXR A;  3WFV A;  2QDO A;  3KKY A;  5IY5 B;  1WN7 A;  3ZMT A;  1N34 B;  3RYF A;  1VF6 A;  1X59 A;  3T2M A;  4MVM A;  1SKV A;  2WLM A;  3TET A;  4X1K B;  3X2Q B;  1N34 O;  3E22 A;  4DV3 B;  1IX9 A;  1NU1 H;  2UXC B;  4YJ2 A;  2KQX A;  3AK2 A;  1VQ6 V;  4LCU C;  1RM1 C;  2UUC B;  1SZT A;  4FLT A;  3L70 H;  1XI1 A;  4DV3 O;  5KUM A;  3JAL B;  1X4T A;  3N2K B;  4AQY B;  3JSL A;  2UXC O;  4GKK B;  4LFC B;  1K7D A;  2UUC O;  3JAS B;  2AZ2 A;  3VQY A;  4O2B B;  4AQY O;  3QO7 A;  3R66 A;  1VQN V;  2QSA A;  3B8N A;  4GKK O;  5CA1 A;  4LFC O;  2H3O A;  4LR3 A;  3UO2 A;  4J7J A;  3BY6 A;  4LH6 A;  2YDE A;  2BOB C;  4K35 A;  3TXS A;  4QPK A;  3ABU A;  2H8P C;  2ZDI C;  5KLV H;  4QIW F;  3STL C;  1FFX A;  4L8J A;  5J2T B;  1KQS U;  2XAH A;  4YHH B;  4XBF A;  5BMV B;  4NTW A;  3VBB A;  2DQ3 A;  2JEX A;  4DR2 O;  1LNQ A;  4QPJ A;  2Q9L A;  3RW0 A;  5B5E Z;  3OMN B;  1V9P A;  4K0K B;  2YEV B;  3AK3 A;  1XOU A;  5JVD B;  1M9N A;  3AG3 B;  3DTU B;  2DN9 A;  2AGA A;  5LGU A;  4WFB V;  4I4T A;  1J95 A;  2A79 B;  3QVN A;  4K0K O;  4O4I B;  1JJO A;  2CTQ A;  5LHG A;  3OR7 C;  2CUG A;  2GUZ B;  2Y48 A;  1TAE A;  4X9Q A;  4DV1 B;  2E5L O;  2LFS A;  1N33 B;  3AG4 C;  1JJ2 U;  1S0V A;  3VQX A;  4PA4 A;  3E8F A;  5KHG A;  4N23 A;  4BWA A;  2K9P A;  2Q5Z A;  5J2U B;  1K33 A;  2JEU A;  4DV1 O;  1VQ7 V;  4DR5 B;  2A3Q A;  3KCY A;  5JQG B;  3UKM A;  1K5Q A;  3S3W A;  4PD4 F;  4JPR A;  4D7S A;  5L3D A;  1TA8 A;  5LP6 C;  1XMQ B;  1KC8 W;  1M56 C;  4ZHQ A;  4DR5 O;  1JMK C;  2QWN B;  4JI8 O;  1F4M A;  2CGN A;  3P32 A;  1RP3 B;  2DYR B;  1XMQ O;  2HJD A;  2OCH A;  2EIL C;  4G2K A;  4X66 B;  3UQ8 A;  2Y69 B;  5GTI Z;  4HNA B;  2WWW A;  5EIB D;  4B3S B;  2WLL A;  2EJR A;  1VQ4 V;  3TGU H;  2Q6A A;  4X66 O;  1H2L A;  3APO A;  4CC6 A;  2P67 A;  4QJF B;  3IC9 A;  4LF8 B;  4LFB B;  2DW4 A;  2P90 A;  4PDV A;  2BOC C;  4F6R B;  4LWS B;  3JD3 A;  4B3S O;  3FB8 C;  1AP6 A;  2R9A A;  2QTO A;  4UCT A;  3RN4 A;  4LF8 O;  4LFB O;  2D3O W;  4AI8 A;  4Q20 A;  2F93 B;  3C3S A;  5CA0 B;  3UCS C;  4E4E A;  2JJ2 G;  2LP7 A;  1IUR A;  1WJZ A;  3JAW A;  4WBN A;  3CMA V;  4GX2 A;  5ITZ B;  2WLI B;  2ZQM A;  1YXB A;  2PY5 A;  3OUF A;  2P5O A;  2QM7 A;  1Q43 A;  3HPL C;  4R8C A;  1U97 A;  1SQB H;  1NQT A;  2LQT A;  4MVU A;  2ZDI A;  1JFF A;  3LNM B;  2W6I G;  4LFA B;  1OCO B;  4PDL A;  3CEI A;  3BA8 A;  1IBL O;  5EC1 C;  1NVP D;  3K3W A;  3JYC A;  4JI2 B;  2BCC H;  3K0G A;  3WB0 A;  2WLK A;  4LFA O;  4NXN B;  3OAA G;  2Q0O C;  4I9W A;  3H1H H;  4I50 A;  1OCR B;  4IL6 Z;  1Q6U A;  3CXH F;  2FKX A;  3FX7 A;  4JI2 O;  3ZHQ A;  5LHH A;  3CCU V;  2LO1 A;  4NXN O;  2LJ2 A;  2QA4 V;  2YC0 A;  2WPD G;  1F23 A;  1M57 B;  5KMG B;  3Q4H A;  4O4L A;  1YF2 A;  2N74 A;  5FNV A;  4H37 A;  5EC2 C;  1GMG A;  3F5T A;  3CCJ V;  1PV0 A;  1TVK A;  3CWB H;  1WLE A;  1S3J A;  1OJH A;  3QF7 A;  4DR7 B;  3SJC C;  2ATK C;  4X8A A;  2DYS C;  5KHK A;  3WG7 B;  1QLE C;  1IVS A;  1JPX A;  2HHH B;  3RVZ A;  4QE7 A;  2F23 A;  1NJI W;  2NNU A;  4DR7 O;  3LSQ A;  3QO8 A;  5E79 Z;  2UXB B;  4FM1 A;  3KCX A;  1PNK A;  2HHH O;  3ZMZ A;  4UV8 A;  3FYE B;  3K5O A;  4JI7 B;  4GX0 A;  2O57 A;  3CC2 V;  2HLD G;  4BW5 A;  2UXB O;  2BSK A;  2FTK A;  4B08 A;  3W7S A;  2EIK B;  1DTO A;  1NTM H;  4PA3 A;  4X20 A;  3OTF A;  4JI7 O;  2JGU A;  2ZT9 B;  2XHB A;  1QVG U;  5LYJ B;  1E1R G;  4DRX B;  1S5L Z;  1XBL A;  2ITC C;  2VQF B;  1DK1 A;  4PEL A;  2F4V B;  3ZHT A;  1NVP B;  3F7V C;  1BHB A;  3HB3 B;  2YIC A;  1T5E A;  4I55 B;  5IJ0 A;  4UCS A;  1SS3 A;  2VQF O;  5B1N A;  3O65 A;  1M90 W;  4MTO A;  2WSS G;  4FVM A;  2EIM C;  3G6B A;  3ZBH A;  1P4R A;  4E2L A;  5LMN B;  1QVF U;  3FFQ A;  1E1Q G;  2Q0A A;  2OT5 A;  1XHX A;  3CCV V;  2CK3 G;  3R65 A;  4JI6 B;  5K1P A;  1RPR A;  4FM2 A;  3A0H Z;  5LOV B;  1MAB G;  4DUY B;  1XNR O;  3CB2 A;  5LA6 B;  1B3Q A;  5KA6 A;  4XDK A;  2OCC C;  1UFI A;  2Z5U A;  1F7Y A;  2BTO A;  2MW2 B;  3CJH A;  4JI6 O;  4G28 B;  4X1I A;  4DUY O;  5L3E A;  2P06 A;  4KP4 A;  1EFR G;  5JWP A;  2GV9 A;  1W2B U;  5DED A;  3HKB B;  2QWQ B;  3D36 C;  1M4U A;  5LL6 Y;  3A8T A;  5EBM C;  4B3M B;  3SDL A;  3OUS A;  2RN9 A;  3SJQ C;  1ENV A;  3CXC U;  4MS2 A;  5TIS Z;  4PV1 B;  1GO3 F;  5KHI A;  4P30 A;  1H2G A;  2WLH A;  1KB9 F;  1HNW O;  1NKD A;  5B1O A;  2X7R B;  4PI2 A;  4ZOL A;  4B3M O;  4B7K A;  1KBH A;  4X88 A;  2XAS A;  3DGE A;  5E1A C;  1Y6X A;  1M93 A;  1FJG B;  1BL8 A;  3TK1 A;  3ABK B;  1BHA A;  5EZY A;  1BSM A;  3KZI Z;  3OM3 B;  4LF5 O;  4K8X A;  4UCV A;  4O4H B;  1FJG O;  3DSQ A;  3E8G A;  5GON B;  2IM9 A;  2QGN A;  3J7A U;  2JGD B;  3LSS A;  1MOF A;  3CCM V;  3HKC B;  2IH3 C;  1SA0 A;  2PGG A;  2EIJ C;  4J9Z B;  1ROP A;  3PJS K;  1H2S B;  4KFM A;  4JAA A;  4U3F H;  1NH2 D;  1FXK B;  1HWY A;  3B09 A;  1Y76 A;  2V4D A;  4OPH A;  2EZP A;  1GN3 A;  3RYF B;  3CYO A;  3EFF K;  3ETQ A;  3EVK A;  3G6E V;  4NTX A;  5IJ9 B;  4OX9 B;  4J7Z A;  4LF4 B;  2Q73 A;  3LDD A;  3A0B Z;  3N2G A;  5FPO A;  2X0L A;  1PNL A;  2LW7 A;  4FFB B;  4X1Y B;  2YXY A;  4OX9 O;  1SET A;  1AJP A;  5IYZ A;  4B3T B;  4LF4 O;  4L87 A;  4MSW C;  2IJK A;  2ZNJ A;  3JD0 A;  3JAR A;  3K04 A;  4JZG A;  3JAK B;  2OTL V;  1IXM A;  1WA8 A;  1BQ0 A;  4B3T O;  1H2M A;  2LGQ A;  1MZF A;  2CH7 A;  5IY5 C;  3CX5 F;  4CZZ A;  3EHB B;  3BPZ A;  4DW0 A;  1EN5 A;  1RSO A;  4UVB A;  3OMI B;  3GVM A;  1PPJ H;  1K4D C;  2PZS A;  1S77 D;  3LDC A;  2UU9 O;  1AI7 A;  3X2Q C;  1I5Y A;  2X6C A;  2LFR A;  1TGO A;  3CCE V;  5KAI Z;  3OMA B;  3RFR A;  1XMO O;  5BZB A;  1Q5O A;  1QR9 A;  3ABL B;  1KP2 A;  4FK5 C;  1VQO V;  4IYI A;  2V7Q G;  3BFR A;  3W7X A;  2R72 A;  3D36 A;  2ZM6 B;  3E35 A;  2XAQ A;  1R3J C;  4W4L A;  5KHH A;  3JD1 A;  2K1E A;  3LSU A;  4FZ0 A;  1K3E A;  3SPJ A;  2ZM6 O;  1R3I C;  3HKE B;  1N4C A;  2QKC A;  1MG1 A;  2X6B A;  4PJ0 Z;  2Y0I A;  5KX5 A;  3SYQ A;  2XAG A;  2YID A;  3ETD A;  2DMX A;  2ODM A;  1BCC H;  4UCU A;  2P22 C;  2UXD B;  1YJ9 V;  5B1B B;  5LGN A;  2ETN A;  3CPW U;  2HKO A;  3K5L A;  4UV9 A;  4PHZ A;  1WB7 A;  3H1K H;  1KU9 A;  3T1C A;  1MSD A;  1YJW V;  2E75 B;  3FKS G;  1B06 A;  4RWU A;  4JI4 B;  1R3K C;  2LW1 A;  3ETG A;  5A2Q N;  1DF4 A;  4JYC A;  1MZE A;  3J81 N;  1GM9 A;  2ZXW B;  3OT7 A;  1CXZ B;  1ZSP A;  3T1H B;  2X6A A;  3B8M A;  3OTO B;  4JI4 O;  4P9O A;  2EJ7 A;  3AG3 C;  4BAY A;  1QHT A;  1I5X A;  3JAT A;  4GZR B;  4TT3 G;  3SR2 C;  1HNZ B;  1KUQ A;  1JX9 A;  3BEH A;  4K8Z A;  4JV5 B;  1PKX A;  4I9Q A;  2P4V A;  1TUB A;  5KA5 A;  3E8B A;  3OTO O;  1VQ5 V;  2ZE6 A;  3QNE A;  1AR1 B;  1NT2 B;  4UB6 Z;  4B7E A;  2FML A;  3F5W C;  3L9D A;  5CMU A;  3C90 A;  1PNM A;  4JV5 O;  1R73 A;  1BE3 H;  5IT9 N;  2WLL B;  2FB5 A;  4R7C A;  1D5A A;  4DR4 B;  5KAF Z;  4NR1 A;  2VWK A;  3SPC A;  5JH7 A;  2A06 H;  3K59 A;  4YHH O;  3IAY A;  4NKG B;  3G67 A;  4F6E A;  1OHH G;  2ZIM A;  1HP8 A;  1W0K G;  2YIA A;  3CHX A;  3OD4 A;  4JAV A;  4U7O A;  1KP3 A;  2P7T C;  3OEE G;  1WP7 A;  4WCE V;  5DN6 G;  4ABM A;  1QBZ A;  1XDC A;  3BAB A;  2EIN B;  3JAW B;  1W0J G;  4GT1 A;  4X1K A;  2Y69 C;  3RYI B;  3K5N A;  4TUY B;  2QR4 A;  3CCQ V;  1DF5 A;  1SQX H;  1N33 O;  1OZ0 A;  3G80 A;  1H8H G;  2HR3 A;  1COW G;  1YEW A;  4DUZ B;  3JAL A;  3GWO A;  2L35 A;  4I0X A;  1EN4 A;  2W0F C;  3AG1 B;  4NVP A;  1AI6 A;  3ZRX A;  2AXT Z;  2EBO A;  1A32 A;  3JAS A;  4DV4 B;  3STZ C;  4PI0 A;  1FYJ A;  4DUZ O;  1L0N H;  1PD3 A;  4MVR A;  4TV9 B;  3M7M X;  4O2B A;  4WFH A;  1NR1 A;  4I50 B;  3RYC A;  4RQF A;  2A0L A;  1GKF A;  3B4S A;  2GHY A;  3NXS A;  2OTJ V;  1KD1 W;  4DV4 O;  2OYQ A;  3SYA A;  2B1G A;  4CC5 A;  3T1Y B;  1IZ3 A;  3RBZ A;  3AG4 B;  4BIO A;  3LUT B;  3K06 A;  4DO2 A;  5FLX N;  5JCO C;  1Y74 A;  3Q4H B;  3UT5 A;  1URF A;  1GRJ A;  5FNV B;  1SQP H;  4DR1 B;  1OCO C;  2EZO A;  3VOU A;  4J80 A;  5J2T A;  3I5D A;  1FPO A;  3B77 A;  4OPA A;  4PA7 A;  2M7W A;  2L6L A;  3K58 A;  4AIL C;  2FL4 A;  2ZKO A;  2QKS A;  4X65 B;  3K9S A;  1VQ8 V;  5B1A B;  5D5Q A;  4DR1 O;  3FB5 C;  5JVD A;  1J5E B;  4LBE C;  1OCR C;  1BGY H;  3P30 A;  4FIP C;  2B9Z A;  4X89 A;  4X65 O;  4N21 A;  4J41 A;  5EYP A;  4O4I A;  1J5E O;  4X64 B;  2PI5 A;  3CRA A;  1Q3E A;  2GUZ A;  4H33 A;  2Y4U A;  1IBM B;  3SJB C;  1FXH A;  1XQ8 A;  3JCZ A;  1EZV H;  1ZL8 A;  2GSM B;  3OEH G;  5H5N A;  4X64 O;  3OR6 C;  2HG5 C;  3IJ4 A;  4BR6 A;  5J2U A;  5EIB C;  1Q81 W;  4FJC C;  1IBM O;  4FLU A;  3ZIA G;  3M8A A;  1SQF A;  1Q90 D;  1YDX A;  2R9I A;  2ZIO A;  3CSX A;  5EK0 A;  2ADQ B;  1FXV A;  2ZE5 A;  1S72 V;  3WG7 C;  4LF9 B;  4JAS A;  3T4D A;  4MTX A;  3OE7 G;  4YY3 B;  2QM4 A;  1JR9 A;  1WPX A;  3E8H A;  4A5U B;  4OGQ B;  5LXT B;  1I08 A;  1ZTE A;  4C7U A;  3HKD A;  2W6J G;  3QG5 A;  4IHJ A;  4EFB A;  3ZHU A;  2BTQ A;  1XHZ A;  1OCZ B;  2JS3 A;  4JYA B;  2RMK B;  4UCR A;  1Q6H A;  3AG2 B;  4HNA A;  1R6T A;  2DQ0 A;  4UVA A;  1SES A;  1RPO A;  2A7W A;  4HBN A;  3N27 A;  3RVY A;  1GTO A;  5LP6 A;  4JTD B;  2M6Y A;  3CRQ A;  4F6R A;  4J42 A;  1GH6 A;  3A2F A;  2H94 A;  3KG2 A;  1L8D A;  3RYH B;  2WAM A;  4U3J B;  1VQP V;  3TCU A;  1V55 C;  3MHS C;  5CA0 A;  5L3F A;  5DM6 V;  3K0D A;  1B6Q A;  1U96 A;  2R9R B;  2B5U A;  5D5P A;  2VWJ A;  5ITZ A;  4JI0 B;  4RAI A;  2GTS A;  3QTC A;  1BS3 A;  4YIO A;  5JCO A;  4LNU B;  1LR1 A;  4MVZ A;  2YXL A;  3RT3 C;  4FPP A;  4K3A A;  4FM0 A;  1FKA O;  1VMG A;  2QTS A;  4JI0 O;  1N0J A;  3UO3 A;  3HR0 A;  3ZRS A;  5J9P C;  2IJI A;  2PUS A;  4U7N A;  2Q7G A;  3ASO C;  2C2A A;  5BXZ A;  1XIL A;  1Q7Y W;  5EZY B;  1KKC A;  1SER A;  4ZI7 A;  1CP9 A;  2ZE7 A;  2UUA B;  3JD4 A;  2IU0 A;  1R6K A;  1GN4 A;  3E89 A;  5L3B A;  4UVC A;  2F4V O;  3SPG A;  2HVK C;  3BA9 A;  3NR7 A;  1Z2G A;  3TJT A;  1SA0 B;  1D5N A;  3DC6 A;  4J10 A;  1YHQ V;  4EB6 B;  2KG7 B;  4DV7 B;  2QWP B;  3FAV B;  1QU7 A;  1S5H C;  5LMN O;  2JJ1 G;  5GW7 A;  1PL4 A;  2JS5 A;  2GBO A;  4KUM A;  2XT9 A;  3FB7 C;  4DV7 O;  4O2A A;  2RJZ A;  4EEQ A;  2MK3 A;  4EKW A;  1AI4 A;  3ABK C;  5LHI A;  3RGB A;  2ZCE A;  3N2G B;  5KHJ A;  1IDS A;  2UXX A;  4GUN A;  1YVW A;  4I5S A;  5B3S B;  1JQ0 A;  4DK1 A;  4JTA B;  1UJW B;  3ASN B;  1K9M W;  1OCC C;  5CA3 A;  2Q68 A;  1SQQ H;  1FFT B;  1AIL A;  1JCH A;  3THO A;  2E76 B;  4O4J A;  1FXK C;  4CH4 A;  5KUK A;  3IC7 A;  2HP8 A;  1AR5 A;  1YIJ V;  4BW9 A;  4RUE A;  3G4S V;  3ZED A;  1RSO B;  3TXQ A;  1SZX A;  4FLZ A;  1R1B A;  1R3L C;  2AW9 A;  3SPI A;  2EX3 A;  2Q7E A;  3CRR A;  4DR3 B;  2Y4T A;  5IE9 A;  4DW1 A;  4H0L B;  1Y66 A;  1V54 B;  2YI8 A;  4P2Z A;  4B3R B;  1WP8 A;  1N36 B;  3GB7 C;  1G6U A;  4GCZ A;  2IBZ H;  4DR3 O;  4YJ3 A;  2DWE C;  3ZCC A;  1YIT V;  3SYP A;  4GX5 A;  3ZN1 A;  4DYL A;  5LGT A;  1H2N A;  3DXR B;  5FPR A;  2F95 B;  4B3R O;  2ZNI A;  3ZRW A;  4TV8 A;  3CCS V;  1CPY A;  5A9G A;  3I56 V;  4TQF A;  4MTF A;  1MMM A;  1KKD A;  1EBO A;  3ZMS A;  3I55 V;  4FLW A;  4ZKI A;  1QLN A;  5LOV A;  3E22 B;  2JDI G;  1YI2 V;  2IJJ A;  1K8A W;  3H01 A;  4YJ2 B;  4YXW G;  5CBH A;  2AHZ A;  2E3C A;  2Q8V A;  1KMI Z;  3ABL C;  1ORQ C;  4MTG A;  3E2E A;  3HKB A;  1Q86 W;  1P7G A;  1QR8 A;  2DE0 X;  1NTZ H;  4JAU A;  4GYC B;  4XDL A;  1GN6 A;  4Z2W A;  2BE3 A;  4IIJ A;  4UCO A; 
#chains in the Genus database with same CATH homology
 3GWK C;  3Q4H B;  3HR0 A;  4LWS B;  2B9Z A;  1WA8 B;  3Q4H A;  2KG7 B;  3G80 A;  4I0X B;  4LWS A;  3FAV B;  1WA8 A;  2VS0 A;  2KG7 A;  2AZ0 A;  4GZR B;  2VRZ A;  3FAV A;  4I0X A;  3TXQ A;  4ABM A;  2DE0 X;  3TXS A;  3OGI B;  2AZ2 A;  3FD9 A;  3ZBH A;  3GVM A;  3O9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...