3APOA

Crystal structure of full-length erdj5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
746
structure length
688
Chain Sequence
b'FYSLLGVSKTASSREIRQAFKKNRAYEVLKDEDLRKKYDKYYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELSTGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGNDPELKKLKTLLKNEHIQVVRFDCSSAPGICSDLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWSPPSRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWSHPSQVLMPEWKRMARTLTGLINVGSVDCGQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWSGPSQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 198
structure length 688
sequence length 746
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA07
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA06
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA05
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA04
5ECNB 1GSFA 3IDVA 1F3AA 4HQZA 2JL4A 5B7CA 2HZEB 1QFNA 3G7YA 1B48A 2ON5A 2M80A 3DGQA 1DSBA 2GQKA 2JADA 2C1YA 4N11A 2LJRA 3O76A 4IVFA 3F9UA 3HVSA 4YH2A 3CBUA 1K3OA 3GSSA 5H5RA 3L0HA 4F03A 3GKKA 5ECOB 2YZUA 2P31A 5D93A 2DJKA 2IFQB 2WGRA 1EWXA 3ME7A 2L59A 4G19A 5DAKA 20GSA 3ZZXA 13GSA 4G10A 2ALBA 1PKWA 4MZBA 4NHZA 2OE1A 3UJ1A 5CYYA 5KN2A 2M6YA 1R26A 2L4CA 2DLXA 3NIVA 3RPPA 1Q4JA 1R4WA 1EEMA 1GUKA 3WT1A 5ECKB 1PD21 3IE3A 4DVCA 5DDLA 2WDUA 1T8EB 3D0ZA 5KN1A 1XCCA 6GSYA 4KUNA 3SBCA 2V2GA 4LL4B 1SK0A 3WGXA 4IELA 5GZZB 2YV9A 5DCGA 4TR1B 4HS1A 3CXGA 3F3RA 2RLIA 4FYCA 2H6XA 3HD5A 1XWKA 4RUVA 2FCHA 4Q5QA 2R5GA 4TXOB 2AV4A 4KSMA 1OKTA 4DSSB 6GSTA 3UVHA 1GTUA 1SD8A 2TRCP 2PVOC 3RDWA 1M2AA 5ID2A 1Y6EA 4J2FA 1THOA 1DBYA 4WR5A 3D5JA 5D9VA 4CDOA 1U3AA 4ZL7A 2IWTA 2BTOT 1JZRA 4MJAA 1QUWA 4FO5A 1B9YC 1MD4A 3FR6A 4RWUA 3TJKA 3LFLA 4TW5A 3M1GA 2A4VA 1WOUA 3QPMA 2DN9A 1OC9A 3I6AA 3GUSA 1DE2A 3H79A 1G6YA 1WJZA 1O73A 1ON4A 4ZBDA 4ID0A 4EVMA 2MMZA 5D8IA 1TP9A 10GSA 2H8LA 1BG5A 2IJYA 3CMIA 4NWYA 3GV1A 3APOA 4NAXA 1X9MB 1TJDA 2DMMA 2PVQA 4YAVA 4TKYA 6GSVA 3KJYA 1T4ZA 3UEMA 4KX4A 2PU9C 3P7XA 3FRCA 1GNEA 4HZ2A 4DSRA 4K0NA 1MD3A 3S9FA 4TRXA 2QWPB 1I5GA 5IM9A 3KP9A 3ZLPA 3M0FA 4HU7A 4GRFA 2E2GA 1MDJA 3FZ5A 4LLRA 5G5EA 1SU9A 5DAKB 2YWOA 3RHBA 3DMLA 2MBSA 3IXRA 3LEFA 8GSSA 1GSDA 2LJKA 1LBKA 1SK1A 4EL1A 2KP2A 3LYKA 5DCHA 3TDGA 2Z9SA 2AB6A 5G1KA 1EP7A 3G7IA 1H75A 2GSQA 4NV5A 1SKSB 1QQ2A 1MTCA 4XRAA 1JFUA 1TXXA 3NOFA 5A5KA 2LTKA 3WD6A 1YDKA 4F9ZA 4IHUA 1X9SB 3RBTA 1RQMA 2HSYA 3DVWA 5CRDA 4TXVA 2DBCA 1M2DA 2PN8A 3GKNA 1EP8A 3WYWA 5ENUA 2X8GA 3EMPA 1SENA 2VIMA 2J23A 4MJCA 4PQIA 3ERWA 1MEKA 3L9VA 1SD9A 1GP1A 4LMVA 4ECCA 5ID2B 5A4VA 1K0NA 3GKMA 2DJJA 1OYJA 3GIXA 3EMXA 3R2QA 1FW1A 4DSQA 1A0RP 4Q5NA 2IN3A 3U6VA 1HNBA 3PH9A 1WPIA 2C0EA 3F0IA 1FVKA 2YNXA 5ECLB 3HYPA 4EC0A 2KUCA 3GN3A 1ZGNA 1PL1A 4JR4A 1XIYA 2H70A 2JSYA 1XXUA 2CTWA 2LJAA 1FVJA 3KEBA 3KH7A 4ML1A 4XCSA 3ZMKA 1OC9B 5AGYA 5CRGA 3H8QA 4GLTA 2AJQB 3I69A 1WRYA 4XTSA 3H4KA 4MPFA 1UA5A 4PGTA 1G7OA 4KDXA 2DJ2A 3QR6A 1EV9A 3TKQA 5GAND 1WIKA 2YOIA 5LNKe 3L9SA 2NDOA 4K7OA 4MJEA 4ZXGA 2R4VA 4I2TA 1WMJA 2PWJA 4O32A 4MK3A 3LGCA 3TKSC 5AISA 4XS4A 3A2WA 4WBRD 4N0ZA 3HJMA 5J4UA 2B7KA 2CZ2A 3TJJA 3DEXA 3IV4A 3TRPA 2H6ZA 4YAPA 2K6VA 2H30A 2VLTA 1ZMAA 3MWHA 1URMA 2OA7A 2QWQB 2OE0A 1FO5A 4QQ7A 3VWWA 1TRUA 2GS3A 5IPHA 3US3A 2H76A 3ERGA 3H93A 2Y4TA 2L5OA 1U3IA 1VF4A 3F63A 5CP1A 1YF1A 1H4OA 4EF0A 1E2YA 2LS5A 1DUGA 1XPVA 3CRTA 2H66A 4GSSA 2DC5A 4ECBA 2RM6A 3Q74A 3KCMA 3HJOA 2IMDA 3LORA 3BCKA 11GSA 2VLVA 6GSUA 1SK2A 2IPAA 2IFQA 1M9BA 4L5LA 4ZB8A 1YKAA 4PUFC 3LJRA 6GSXA 1VF3A 2K9FA 2EC4A 1Q98A 4POMA 1S3CA 1NHOA 1VRSD 2HSHA 3ZVJD 2EIOA 4NV2A 2I1UA 1W89A 3I43A 2I3YA 2QWRB 1HQOA 4PQHA 4XHMA 1M7TA 2YCDA 4P3YB 1A2JA 2P0GA 1BX9A 4WF4A 1JLVA 2RUEA 4IQAA 2LO1A 3KTLA 3N9JA 5F0GA 2DJ0A 5J9CA 3LYPA 2OADA 3TOUA 2CX4A 3GL3A 1BQ7A 3GFKA 3FK8A 1GTIA 2O87A 4ZIJA 2N5AA 1SJ6A 2AYTA 5EY6A 2CUGA 3EURA 4KSOA 22GSA 2N5FA 9GSSA 4IGJA 1PGTA 1G0TA 1CQGA 4OO4A 1EEJA 3ERFA 3IOSA 1QK8A 4ECIA 3ZFLA 2K8VA 4TXOA 1OVNA 4MH2A 3TKSA 3M9KA 5IMZA 2GZZA 5ELAA 2VUPA 4V2LA 2GSTA 1OC8A 3UL3A 5ECHB 1EGRA 1GSEA 4ZB9A 1BQ0A 2GQMA 2H73A 3UOMA 4MCUA 4F0BA 1WWJA 3F3QA 1TRWA 4XS4B 5AN1A 1WJKA 1FAFA 2X8HA 4WEYA 2OCHA 2RUFA 2LUSA 1Z7RA 5CO3A 1OE8A 5ECRB 3HXSA 5GSTA 5J9BA 4RQRA 4I6XA 3A3TA 5FT3A 2C3QA 4X43A 2DJ1A 5C00A 3BVOA 3CYNA 2RIIA 1XZOA 1GH6A 4IP1A 4ECJA 3D22A 4Q5RA 2EIRA 4IS0A 3LWAA 3GHAA 1G6WA 1I9DA 1X9WB 2GT6A 4ZL9A 3KH9A 4N10A 1A2MA 3IAM2 1ST9A 3D6IA 3UBKA 2CX3A 4PQ1A 4L5OA 2PMTA 3LXTA 3C1RA 1X5DA 3UIWA 1A8YA 1VF2A 2H01A 1A8LA 1SYXA 3GA4A 1PX6A 3QAVA 4WETA 5KN3A 1FB6A 1WP0A 2V1MA 3VI7A 3OR5A 2MMNA 2WS2A 4WBJA 4ZILA 5GSSA 2L5LA 1FOVA 3CTGA 4LL1B 3H1NA 5L71A 3PGTA 3A2VA 2FGXA 4ZB6A 1IYIA 2ZCTA 3TKPA 3Q18A 5B8AA 4CHSA 2O85A 2FWFA 4KH7A 3F4TA 3L78A 5IO2A 1Z3EA 1WE0A 5DALA 5G31A 2O8VB 4LMWA 3IPZA 5F07A 3GX8A 4ZBBA 1TTZA 5ECMB 2R3XA 3JCML 5G1LA 3HA9A 5KN0A 3IK7A 4POKA 2HNLA 2LRNA 1ACVA 3C71A 3J7Yb 3C1SA 2Y4UA 2VCVA 3TGZA 2GTUA 4GSNA 4AJ7A 1PKZA 5J3RA 3TJGA 3IR4A 3EYTA 1FAAA 3P90A 2ZUPA 1R5AA 1F37A 2GZPA 1B9XC 3PR8A 1K0BA 2JU5A 1V98A 2V6OA 1YQ1A 3GKXA 2WJUA 5DQYA 2HRNA 2A2RA 5DJLA 1BQZA 1GSSA 2CTQA 1TK5B 5A4WA 3L9UA 3GSTA 2QWNB 4HJ2A 3FZ4A 2FUG2 1PSQA 4FYBA 2LNTA 4IT5A 4EE0A 2VAFA 2V41A 4KCEA 5IIZA 4JU5A 4N0VA 5CREA 3VPQA 1TI3A 1A2LA 2VOCA 2OE3A 3UARA 2CAIA 3EE2A 3ZREA 4I97A 3IK9A 2B1LA 5B8BA 1TU7A 1USBA 3GMFA 3HZ4A 4MPGA 2LGWA 2GLRA 2HI7A 4I8BA 2PF4E 3ZL5A 1OAZA 1U6TA 2OBKA 1XBLA 1ABAA 4BWQA 2KHPA 2NPBA 19GSA 1NM3A 4IN0A 2DIZA 4MZCA 2DMLA 1F3BA 2C0FA 1SKWB 2VL3A 3GL5A 5LCZA 2QKEA 2VD0A 1AIUA 5E59A 3KMOA 1KEBA 1GUMA 3ZMLA 3GH9A 3ZTLA 4RQXA 4F82A 3EINA 1S3AA 1AC1A 1OE7A 2E0QA 2VLUA 1NZ6A 2XBQA 3DRNA 5HR1A 2HZFA 5IMVA 1Z5YE 3MDKA 3TKRA 1UVZA 5CRHA 2H1DA 1QXHA 2YJHA 4XS1A 3GX0A 2QSAA 5EL8A 5JCWA 5HR2A 2V6KA 5D96A 3A2XA 5D9XA 5B6NA 4GWRA 2KLXA 5DALB 2CTRA 4KCAA 2OACA 2FWEA 1GTBA 2H1AA 1EGOA 4IBPA 1UN2A 2FA4A 3ED3A 3FKFA 2L6LA 2VCXA 1X5CA 1AW9A 4O92A 3IAS2 2WCIA 3FY7A 5IMFA 2CVKA 4EDZA 2CA8A 4JRRA 5B6MA 5HQPA 1HYUA 3IC4A 1SKRB 2FWGA 5DVBA 1UC7A 2FY6A 3DD3A 1EOGA 2C0DA 3KP8A 1X0RA 2GT5A 2H72A 2YANA 3K8NA 3FR9A 1GSUA 5H5SA 4EXJA 5JWRB 5FHIA 3CTFA 4CW9A 1XOBA 5EVOA 1PQNA 1Z9HA 3VWVA 2MBTA 4G2EA 1GLQA 2H0IA 1ZOFA 2FWHA 3HY2A 5CNWA 3QFBC 16GSA 1NHYA 3L4NA 3UVTA 4ZBAA 1SJIA 2HE3A 2L4QA 2B6MA 3MNGA 3APQA 2X64A 2LQOA 1B4PA 1YZXA 2QC7A 3DXBA 2GUZA 3KXOA 4MA9A 5HFKA 1O8WA 4EKZA 4OCEA 2XHFA 2HLSA 3GNJA 4QL9A 1XVQA 5IOXA 2B1KA 3HVVA 1TK0B 2WRTA 4I2UA 3GTUA 2X8CA 3E0UA 4WKWA 5GAPD 3D4MA 2O89A 2GDRA 2LEGA 1VF1A 1A0FA 1YY7A 3F6FA 1B8XA 4MZWA 2CVBA 1KTEA 2YUAA 4TR0A 1XW9A 4MF7A 1GL8A 1JZOA 4POBA 1VGLA 4ZL8A 1EZKA 2AUVA 3ZITA 1ZL9A 1K0DA 3RAZA 3ZVJA 4EO3A 1GLPA 3ISOA 1TK8B 3CSJA 5IO0A 3MSZA 1U88A 2LKUA 2VCTA 1HD2A 2H19A 1V57A 1SYRA 4V2NA 2FHEA 1SJZA 4RI7A 2HYXA 3TB2A 3P8WA 3EVIA 5G5FA 3ZFBA 1ERWA 4YQVA 2HRFA 1M0UA 1S3DA 1R5PA 3TUEA 1XVWA 1O85A 1J0FA 4GQFA 3D21A 3DYRA 3M8NA 3VPTA 3HHVA 2JZSA 2I81A 5DJMA 3WT2A 4XIHA 4IP6A 4ISDA 4MF5A 3TOTA 1O7UA 3Q6OA 3KMNA 1YEXA 3O3TA 4MDCA 1AQVA 2L6DA 5IMAA 4MMMA 3FZ9A 2CAQA 4BWSA 4GXZA 2TIRA 2JACA 5G30A 3ZRDA 1AQXA 4GQCA 3ZIVA 4NXIA 3LG6A 5DQSA 3QAWA 2IMEA 4OFTA 1OKDA 2ES7A 4OFNA 4K8MA 2F8FA 1Z7PA 2NBSA 4DEJA 4GSTA 2GUZB 1AXDA 2LRCA 4KDUA 4F2IA 2B5YA 2REMA 3GTUB 3TRQA 4WR4A 3KZQA 4MH3A 2F3MA 2H6YA 3QAGA 3PINA 3C8EA 2FD3A 5H5QA 2H1GA 3F6DA 1O6JA 4JZQA 3FZAA 3AG7A 1M2BA 4KNDA 4V1Ag 4E8HA 1BJXA 4AJ8A 3QCPA 2IMIA 14GSA 2VCZA 3EU3A 2H75A 1Z6MA 5IOWA 3GYKA 5D9TA 2LRTA 3M9JA 1IYHA 1N8JA 4HQSA 2MMAA 1XWCA 1RK4A 2C3TA 2GQLA 1QGVA 3RPNA 3GRXA 3TRXA 1GWCA 1R7HA 2VM2A 2IMFA 1FB0A 3J7Yk 2GSSA 2GGTA 1SL0B 1E6BA 1PL2A 2KP1A 1XFLA 3F8UA 4KE3A 1PMTA 2QWOB 2R37A 2B3SA 5J41A 1C72A 4BVYA 4ULXA 1Z6NA 1GRXA 3HKRA 4K7IA 3C7MA 2L57A 4OWYA 2WB9A 2DMXA 1XWAA 2K18A 4YQUA 1N2AA 1SL1B 1M9AA 4BPYA 4V1Ap 7GSSA 1XWGA 1JHBA 2VL9A 1TI1A 4HU9A 4JBBA 1B4QA 1Y25A 3GH6A 4IQ1A 4JR6A 1OC3A 1GULA 3VWXA 3QDNA 1GSQA 4NPBA 1THXA 2R6KA 6GSSA 3EU4A 1GTAA 2DIYA 3IBHA 3HZ8A 1K0AA 4JEDA 3UCSC 4IW9A 5HFGA 3DWVA 4HI7A 4PNFA 2EJ7A 2YWIA 4MF6A 2G2QA 3HJPA 2NTOA 2CVDA 2H1BA 4PURA 3IA1A 3BBYA 5ECSA 2PPTA 4PUAA 5JWQB 4BVXA 1PA3A 3W8JA 1F9MA 4J57E 1TKDB 2XPDA 4HZ4A 1PRXA 3HDCA 1SL2B 4OO5A 2BJXA 3BD2A 2VM1A 3SWLA 2E2MA 3V1WA 2JZTA 2MMOA 3BOAA 2GSRA 2R2JA 3UO3A 3KIJA 2GVPA 3FEUA 1TOFA 1KNGA 3KTBA 5E4WA 1BAYA 2VL2C 3FR3A 2E7PA 2IMKA 1EV4A 4TOPA 3BCIA 2K8SA 4FH8A 3EC3A 2HXKA 12GSA 4JE1A 4O5RA 2IL3A 5CRWA 4L0WA 4TN8A 4L0UA 4XRDA 1T7PB 4XS6A 3UAPA 2XBIA 1K3YA 1EOHA 5F06A 3IRAA 4J80A 5ECQB 2F8AA 4D73A 5JCUA 2VO4A 1AAZA 4G9HA 4NMUA 5IMCA 3LQ7A 3EWLA 2CTPA 1F2EA 4KAEA 1XW6A 4ILFA 2YJ7A 2B5XA 2KQXA 2IIYA 4HOJA 3I9V2 5JCGA 3VFIA 3VURA 1G7EA 4BL7A 3VI5A 4K1FA 4OMVA 3W8SA 1YEPA 2XPEA 5EPFA 3G9BA 2YS8A 2D2ZA 3DKSA 1M99A 3O6TA 3E9JB 1XWBA 5F05A 3TJBA 4IJ3A 4KB3A 3DVXA 5AIXA 1JZDA 1O8XA 5AIVA 4BA7A 2HT9A 4IKHA 5IMDA 1A23A 1FHEA 3CSIA 2A2SA 5D73A 2I9HA 4PX1A 1O81A 3QMXA 17GSA 3QD9A 2C0GA 4GF0A 1X5EA 1MDKA 2N5BA 2H0HA 4N30A 4OD7A 6GSWA 5G2ZA 1T00A 4K6XA 2NVLA 1K0CA 3KGKA 1ZYEA 2JSZA 5HR0A 2V32A 2C3NA 5KEJA 4I5QA 3DIEA 1GUHA 2DJ3A 1YKCA 3P2AA 2AHEA 4LA1A 2M72A 5CAXA 2P5RA 3TJFA 1QMVA 3VLNA 2PUKC 1W4VA 2O7KA 5A4UA 4GCIA 4K0GA 5HFIA 1FPOA 4V2MA 2VL2A 1V58A 4ACSA 4K2DA 1V2AA 1TW9A 2G0FA 4EUYA 1T4YA 3IHQA 1TDIA 3TKSE 1XW5A 2F9SA 2TRXA 4FYUA 4TR3A 4AF2A 2BMXA 4OFMA 2CQ9A 2WZ9A 1IURA 4OCFA 1J9BA 3Q19A 3WGDA 1V9WA 3D4TA 2ZNMA 2C4JA 3VK9A 5ECIB 2HFDA 4ML6A 1AUCA 3HVXA 3RHCA 2F51A 1K0OA 1TRSA 1JZWA 1DE1A 3C73A 2KOKA 2QSIA 1NSWA 1LJRA 5DBQA 4D73B 2OBIA 2N04A 3M3MA 4AJ6A 5F8BA 4MABA 3CSHA 2X99A 4HUAA 4J56E 1ERTA 3ZYWA 2I4AA 2LSTA 1J08A 2RM5A 1TU8A 4MP4A 4K9ZA 3G7JA 4PXOA 1HDJA 3UBLA 1GNWA 3CRUA 1HNAA 4KDYA 1NW2A 1F6MC 3KD0A 1V40A 3WGEA 3VWUA 2VCWA 4WXTA 4KW6A 4E8EA 4HEA2 2J9HA 1AQWA 1TRVA 1PX7A 1KBNA 4EDYA 2YWMA 4X0XA 2XC2A 4Z7XA 2LV3A 18GSA 2N05A 3HCZA 3F4SA 5ELGA 5IQYA 1ZCPA 1MDIA 2CT6A 4KGIA 4X1UA 1ZYQB 1XOAA 2QGVA 2LQQA 2YZHA 2HZEA 2OKAA 3QFAC 1GSYA 2EIQA 3MAKA 3ME8A 1CQHA 2FA8A 5C04A 5LD0A 1T3BA 4HDEA 1N4CA 2B5EA 1ERVA 1YF0A 2YWNA 2ON7A 2MYGA 2FNOA 2FLSA 5J5NA 4NHWA 4PNGA 1ZZYA 4MJBA 4FIWA 1PN9A 2C8UA 4TVEA 4TR4A 3ZIJA 2WFCA 1BYEA 4KA0A 2H71A 2M46A 3E3EA 3NZNA 1A24A 2JZRA 2CZ3A 4AGSA 2GZYA 4O7HA 2MZCA 4POLA 2H0GA 1K3LA 1JLWA 2AAWA 4J7ZA 2OJLA 3N5OA 5ECPB 3FW2A 1RW1A 4QL7A 2VD1A 3UO2A 2YV7A 3AY8A 3BJ5A 2PERA 1K0MA 3KM6A 4K7NA 5FWGA 4TR1A 4Q5FA 2C80A 2P5QA 1T1VA 4WF5A 3F4RA 3QOUA 2WULA 4H86A 2YP6A 3GURA 4YQMA 1GH2A 5IPGA 1XBSA 3TCOA 2YN1A 5JWOB 3A5WA 4GTUA 4F0CA 2CV4A 4DSSA 3LSZA 5D9WA 1YJ6A 2H74A 5COHA 1U87A 2B7JA 1BEDA 2LNSA 3U5RE 4RI6A 4HJMA 2VCQA 4MLYA 1HNCA 3APSA 3FHKA 1FG4A 1LU4A 3FYGA 2L6CA 5ABRA 2DSAA 3UMAA 4L8EA 2PBJA 1ERUA 5HR3A 2PGTA 1ILOA 3W6GA 4IJIA 1ML6A 2YPMA 3LXZA 5INYA
chains in the Genus database with same CATH superfamily
1EN5A 1PV0A 1GSFA 5ECNB 1V9PA 4O2AA 4LFCB 3RFRA 3IDVA 4DV1O 1F3AA 1EZVH 1VARA 4HQZA 2JL4A 5B7CA 2HZEB 1QFNA 3G7YA 1B48A 2ON5A 4IL6Z 2M80A 3DGQA 1DSBA 1UPGA 2LFRA 5KAFZ 3UQ8A 2GQKA 2JADA 3CEIA 5C93A 2C1YA 3OUFA 4N11A 3ABMB 2B1IA 2LJRA 3BA9A 2YEVA 4A5PA 3O76A 4IVFA 2Q0AA 3F9UA 3HVSA 3J80N 4YH2A 3CBUA 1K3OA 3CCJV 3GSSA 2AZ0A 1Q3EA 5KHJA 5ITZA 2EINC 5H5RA 3L0HA 1ZL8B 4F03A 4FIPC 3K9AA 3GKKA 2Y48A 5ECOB 2YZUA 3SDLA 2P31A 5D93A 2DJKA 3OAAG 3CXHF 2IFQB 1EWXA 4LF9B 2WGRA 3ME7A 2L59A 4G19A 5DAKA 20GSA 3ZZXA 1U97A 13GSA 2F23A 3RYIA 2QA4V 4G10A 3E83A 2ALBA 1PKWA 4MZBA 4NHZA 2OE1A 3UJ1A 5CYYA 1P7GA 2M6YA 5KN2A 4DV7O 4L8JA 1R26A 2L4CA 1GTOA 4I9WA 2EBOA 2DLXA 4JTCB 4UB6Z 3G6EV 1WA8B 3NIVA 3SYAA 2A0LA 1Q4JA 3RPPA 1U96A 1R4WA 1EEMA 5LGNA 4DR5O 4MTXA 1H8EG 1GUKA 2PTMA 2CGOA 3WT1A 5ECKB 4EFEA 3ABKC 5CB4B 1NH2B 1PD21 4J9YB 3N2KB 2Q8VA 4O4JB 3K57A 3UKMA 3IE3A 3DTUB 2M7WA 4DVCA 1ZLZA 3UM7A 5DDLA 2H3OA 2WDUA 1T8EB 3D0ZA 2ZM6O 4EIQA 5KN1A 3LNMB 4ABMA 2DW4A 3BFRA 3CSXA 1XCCA 6GSYA 5H6RA 2OIEA 4KUNA 3E8HA 2QGNA 3QO8A 1HNXO 3SBCA 4KHPO 2V2GA 4LL4B 1SK0A 3WGXA 3B40A 4IELA 5GZZB 2YV9A 5DCGA 4TR1B 5B1AC 1NR7A 3ASNB 3B4SA 4HS1A 3UT5A 1S72V 3CXGA 3F3RA 1Y66A 5CA1A 3OEHG 2EIMC 2BTQB 3OEEG 2RLIA 5LMUB 4FYCA 5IDJA 2H6XA 1I08A 4K8ZA 1S3RA 3HD5A 4JI0O 3RYCB 1XWKA 4RUVA 2VQFB 2FCHA 4Q5QA 2R5GA 4TXOB 3TETA 2AV4A 4KSMA 1OKTA 4DSSB 4YXWG 5JWPA 2GTSA 6GSTA 5IJ0B 3UVHA 1GTUA 1SD8A 2TRCP 2PVOC 5IYBO 3OTFA 1M2AA 4H37A 3RDWA 1Y6EA 5ID2A 4J2FA 2JIZG 5FLXN 2HRAA 1Y74B 1THOA 1DBYA 4WR5A 3IFXA 3D5JA 5D9VA 3DC6A 4CDOA 3FAVB 1U3AA 4MT8A 4K2XA 4ZL7A 4BIOA 2IWTA 1RFYA 2BTOT 3ZS8C 1JZRA 4MJAA 1QUWA 3T1CA 1Q86W 4FO5A 1B9YC 2WLIB 1MD4A 3H1LH 3FR6A 4FZ1A 4RWUA 4PDLA 3K5NA 4KF9A 3TJKA 1K5QA 3LFLA 4TW5A 1NKDA 3AG3B 1WLEA 3M1GA 1PM9A 3MAQA 2A4VA 1WOUA 3K5OA 3QPMA 3RT3C 2DN9A 4FM2A 1OC9A 3I6AA 2NLJC 3GUSA 1DE2A 3H79A 1G6YA 1WJZA 1O73A 2QM4A 4CH6A 1ON4A 4ZBDA 1FFTB 4ID0A 2P67A 4DV7B 4DUYO 4U3JB 4I55A 4NVPA 4PJ0Z 4DW0A 2HEPA 2MMZA 4EVMA 3ZRVA 3OMAB 4J7JA 1NVPD 2UXDB 5D8IA 1TP9A 10GSA 2H8LA 1TVKB 1BG5A 2IJYA 3CMIA 1F23A 4NWYA 4DR5B 3GV1A 3APOA 1AP5A 4O5QA 4NAXA 2ODMA 2EIKB 4GKKB 2GBOA 1X9MB 3FB5C 1RPOA 4KXRA 1TJDA 2DMMA 2PVQA 4YAVA 1NJIW 4TKYA 3KJYA 1ZYPA 5IYCO 6GSVA 1T4ZA 4J11A 3UEMA 2A4HA 5DM6V 3AEIA 3JARA 4OXSA 4KX4A 2XAGA 2PU9C 1XMOO 3P7XA 3FRCA 2P7TC 1RP3B 1GNEA 1NTKH 2YEVB 4HZ2A 4XBFA 5KHIA 4DSRA 4K0NA 1RM1B 2UXCO 1MD3A 3S9FA 4Z2WA 1F4NA 4TV9A 2ZE7A 1N36O 2JRIA 4TRXA 5ITZB 2QWPB 1I5GA 1IDSA 4YIPA 5IM9A 3KP9A 3ZLPA 3CWBH 3M0FA 4WBNA 4HU7A 1CXZB 4GRFA 2E2GA 1SQVH 2Q67A 1MDJA 3FZ5A 4LLRA 5G5EA 1SU9A 5DAKB 2YWOA 1PKXA 4LP8A 3RYIB 1ENVA 3RHBA 1KB9F 5H5NA 1KU9A 3DMLA 2Z3YA 3F5TA 2MBSA 4JI0B 3IXRA 3WB1A 3LEFA 2RDCA 4X64O 8GSSA 1GSDA 3BPZA 3CB2A 2LJKA 3MHSC 4ICYA 4FMTA 1LBKA 3CRAA 1SK1A 4EL1A 3T1YO 1F51A 4DRXB 4UV8A 2KP2A 2YDEA 4X1IA 3LYKA 2MK3A 3OMNB 5DCHA 1R6KA 3AG1C 3TDGA 4BW5A 2Z9SA 4NXMO 2F66C 2AB6A 5G1KA 1EP7A 3G7IA 1H75A 2GSQA 3DXRA 4NV5A 1SKSB 1QQ2A 1MTCA 3B2EE 5B5EZ 4XRAA 1JFUA 4DV3O 2QKSA 1TXXA 4MTFA 1GN4A 3IJ4A 1XI1A 5BR8O 3W7UA 1VQPV 3NOFA 4OPAA 4X1KB 5A5KA 1SERA 1FFXA 1KP3A 3RW0A 2LTKA 3WD6A 1YDKA 4F9ZA 3ABMC 4IHUA 3BHPA 1X9SB 1WPXA 3RBTA 3HB3B 5E1AC 4JI8O 2LGQA 3I56V 1XHZA 1RQMA 2HSYA 4RQEA 3DVWA 5CRDA 4TXVA 4X62O 3UT5B 2XHBA 5CA1B 2DBCA 1M2DA 2PN8A 2ETNA 3WB0A 3E8BA 3GKNA 5LGTA 2F43G 1EP8A 3WYWA 5ENUA 4PA9A 2X8GA 4H33A 4PA7A 4RUEA 3EMPA 1SENA 2VIMA 2J23A 2RN9A 2E74B 4MJCA 2NR5A 1PN0A 4PQIA 4IIJB 3CCQV 3ERWA 5KX5A 1YF2A 1KQSU 4I0XA 3F7YC 1MEKA 3L9VA 1SD9A 4NTXA 1VQNV 1GP1A 4YY3O 4LMVA 4ECCA 1NVPB 4MVOA 5ID2B 1EM1A 1V54B 5A4VA 1K0NA 3JD1A 1XMOB 1TAEA 3GKMA 4W4KA 2DJJA 3ZEDA 2JJ2G 5LHHA 1OYJA 3GIXA 3EMXA 3R2QA 1QVFU 3JAWB 5CN0A 1FW1A 1A0RP 4Q5NA 4DSQA 2UXCB 4LWSA 3A5IA 3E22A 2C2AA 1FS0G 2HJDA 4DK1A 4ZI7A 1N36B 1GKFA 2IN3A 3U6VA 2VQEO 1HNBA 3PH9A 3NR7A 4DK0A 3ETQA 4Z1MG 1WPIA 3JAMN 1OCRB 3E8GA 4GKJO 2C0EA 4DUZO 1FVKA 3F0IA 3QO7A 1HNWB 2YNXA 3HYPA 5ECLB 4EC0A 2QR4A 2KUCA 1RSOB 4PA4A 3GN3A 1ZGNA 4BWAA 1IBMB 1PL1A 4JR4A 4FFBA 3JSLA 1XIYA 2H70A 2JSYA 3CP1A 1M90W 1XXUA 2ZCEA 4TT3G 2QKCA 2CTWA 2QDOA 2LJAA 2F1MA 1FVJA 3KEBA 3KH7A 4ML1A 4XCSA 1OC9B 3ZMKA 5GW7A 5JCOC 1VQMV 2X49A 5AGYA 5CRGA 1AR4A 3H8QA 2D2CB 4GLTA 4X64B 1SQFA 3I69A 2AJQB 1WRYA 4XTSA 3H4KA 1D5AA 5FPOA 3BRCA 4I55B 4MPFA 3P30A 1UA5A 5L3CA 4PGTA 3H1HH 1G7OA 3T1YB 4KDXA 2DJ2A 3QR6A 1EV9A 3ASNC 2OIGA 3TKQA 1T5EA 1TUEB 2Q9LA 3K06A 5GAND 1WIKA 3B8NA 1NQTA 2YOIA 2QJ1A 2YSUB 5LNKe 4DR1O 3L9SA 4O5UA 1DGSA 2NDOA 4NXMB 4K7OA 3CD6V 4H13B 4MJEA 2A7WA 4ZXGA 1M3IA 2R4VA 4I2TA 1WMJA 5J9PC 1BSMA 4GX0A 2PWJA 1XL6A 4O32A 4DV3B 4MK3A 4K35A 5TISZ 3LGCA 4KUMA 4DR6O 2WWWA 3L75H 3TKSC 5AISA 2A9HA 5BXZA 5EBWC 3FB6C 5LP6A 4ICGA 3OMIB 4TV9B 4XS4A 2R0GA 1JPXA 3A2WA 4WBRD 4N0ZA 4JI8B 3HJMA 5J4UA 4UVAA 2B9ZA 2B7KA 2CZ2A 1Q5OA 4WBNB 3TJJA 3DEXA 3IV4A 1G8MA 3TRPA 2H6ZA 4YAPA 4TUYA 4LCUC 4X62B 2K6VA 4GT1A 1Q8IA 5LGUA 2H30A 2VLTA 2ADPA 1ZMAA 2DKHA 3MWHA 1URMA 2OA7A 2R72A 2QWQB 1WPBA 2R70A 2OE0A 3OE7G 4QQ7A 1FO5A 3AG3C 1H2NA 4NKGB 1ZTEA 2CH7A 3VWWA 1TRUA 2GS3A 5IPHA 3US3A 2H76A 3ERGA 3KCYA 3H93A 1SQPH 2Y4TA 5L3BA 4YY3B 2L5OA 2IU3A 1U3IA 3E35A 2Q5ZA 1VF4A 3F63A 1KBHA 3DC5A 4LF8O 5CP1A 1YF1A 4UB8Z 1H4OA 1OZ0A 5IY5B 4EF0A 4EIPA 2DWEC 2EJRA 1FD9A 3E8FA 1E2YA 3DXRB 2GHYA 2LS5A 2VQEB 1DUGA 1XPVA 4DYLA 2OCCC 1EFRG 3CRTA 4Q20A 2H66A 4GSSA 2CAZC 2DC5A 2KSDA 4GKJB 4DUZB 4ECBA 3ASOB 4WFGA 2RM6A 3Q74A 3K0GA 4LH6A 1I5YA 3HJOA 3KCMA 4K0KO 2EIMB 2IMDA 3LORA 3BCKA 5H9CA 1OHHG 3L74H 11GSA 2VLVA 1SQBH 6GSUA 1SK2A 4X8AA 2IPAA 4Q6GA 1K73W 2IFQA 2Q4PA 1RM1C 1VQ4V 4HSCX 1M9BA 4L5LA 4ZB8A 1YKAA 4PUFC 3LJRA 6GSXA 3CC4V 1VF3A 4PV1B 3D36A 1GM9A 2K9FA 2EC4A 2Y0PA 1Q98A 4POMA 1S3CA 1NHOA 1R73A 2UUCO 4JPRA 1VRSD 2HSHA 3ZVJD 4MVMA 5CA0A 2EIOA 2XAJA 5JJJB 3PPUA 4NV2A 2I1UA 1W89A 1J5EO 1YI2V 3I43A 1KC8W 2QWRB 1HQOA 1IXBA 2I3YA 4PQHA 1B06A 4DR1B 1V55B 4D6TH 4XHMA 4I0XB 1N34O 1M7TA 2QTOA 4J7KA 4PA3A 2YCDA 4P3YB 1A2JA 2P0GA 3MYDA 5CB4A 1BX9A 1JLVA 4WF4A 2RUEA 3N2KA 2LO1A 3KTLA 4IQAA 3N9JA 5F0GA 2DJ0A 2WA3A 5J9CA 3LYPA 4PTSA 4CS3A 2OADA 3TOUA 3EPTA 4DR6B 4DR2O 1K9MW 1K4DC 2CX4A 4JASA 4X4JA 3OTOO 1YTFD 3ZJZA 3GL3A 1WB8A 1N33O 4LWSB 2ITDC 1IBKO 4ZI7B 2IJHA 5JCOA 1WP7A 1MMMA 4NR1A 4QPKA 3IC8A 5AG2A 2GV9A 3T1HO 1K8AW 2IBZH 2K1EA 1BQ7A 2W0FC 3GFKA 1LUVA 2R9AA 4FFBB 4PD4F 3FK8A 1GTIA 2O87A 1TUBA 4ZIJA 3P3PA 2VWJA 3ZCCA 2N5AA 4TV8A 1SJ6A 2AYTA 5EY6A 2CUGA 4UCUA 3EURA 3OR7C 2X0LA 2BTQA 22GSA 2N5FA 4KSOA 4IGJA 9GSSA 3E86A 4MTOA 1PGTA 1S5HC 4CS2A 1N32O 3VBBA 2LW7A 1G0TA 1GMGA 1CQGA 4OO4A 3ABLC 1EEJA 3ERFA 1SRYA 4MVSA 3IOSA 1QK8A 3EXAA 4ECIA 3M99B 1NT2B 5B66Z 1P4RA 3ZFLA 1G4YB 4F6RB 2K8VA 1I7FA 4LF4O 2X4AA 1XNRO 2A79B 1OVNA 4TXOA 4MH2A 1SF9A 4JI6B 4DV2O 3TKSA 1JA8A 1S5JA 3H1KH 2GZZA 3M9KA 5ELAA 5IMZA 3NXSA 3CC2V 3RVZA 5JH7A 2VUPA 4FK5C 4V2LA 1HW7A 2GSTA 1OC8A 3UL3A 4LFBB 3HR0A 2OWOA 1W0KG 5ECHB 1EGRA 1GSEA 4ZB9A 1BQ0A 2UUAO 4K5SA 2ZIOA 2GQMA 3ZN1A 1M3JA 3TGUH 2H73A 3UOMA 3CRRA 2UXBB 2WLIA 4MCUA 4F0BA 2RMKB 1MSWD 4K0KB 2YXYA 5LP6B 1WWJA 3CCEV 3F3QA 1Q6IA 4X88A 3KG2A 1TRWA 4XS4B 3VQXA 2ZE5A 2PYJA 3ZRXA 5AN1A 1WJKA 1FAFA 1FOHA 4MW8A 2X8HA 4WEYA 1VQKV 3JATB 2OCHA 5LL6Y 2RUFA 4PDVA 2HHHO 1Z7RA 2LUSA 5CO3A 1OE8A 5ECRB 3HXSA 5GSTA 1PD3A 4WFBV 5J9BA 4RQRA 2DQ3A 4BIUA 4LF7O 2DKIA 3A3TA 4I6XA 5FT3A 5LOVA 2C3QA 2UUCB 4DV0B 4X43A 2DJ1A 4U3JA 2F95B 5C00A 4Z1VA 3BVOA 4NTYA 3SPCA 3CYNA 1J5EB 2RIIA 1XZOA 1GH6A 4IP1A 4ECJA 1NTMH 2CH7B 2YIAA 3D22A 4Q5RA 2EIRA 4IS0A 3LWAA 1N34B 3GHAA 1G6WA 2HSMA 1I9DA 4EKWA 4MVUA 3ZHVA 1X9WB 4UCOA 2BSKB 2GT6A 1XDCA 1ZAUA 4CH3A 3CC7V 4ZL9A 4CY6A 4YKGA 3CMEV 2B5UA 4LF6O 3KH9A 4TWKA 4N10A 3CRMA 4DR2B 1A2MA 4FLYA 3IAM2 1ST9A 3D6IA 2E76B 3JCZA 3UBKA 1N33B 2CX3A 1IBKB 4PQ1A 4HNAA 2WA4A 5LA6B 2PMTA 3LXTA 4L5OA 3IAYA 3C1RA 1X5DA 4X20A 4LFAB 3MHHC 1VEWA 3UIWA 1AJQA 2QM8A 1A8YA 3T1HB 4GZRB 4JAVA 1VF2A 2H01A 1A8LA 1YTFB 1SYXA 2Z0AA 4U3FH 3GA4A 2WLLA 2HVKC 1IZ3A 1PX6A 1SA0B 1US6A 3QAVA 3GVMA 3JYCA 1I94B 4WETA 1X59A 4UCSA 1PFOA 1FB6A 1WP0A 2V1MA 5KN3A 5D5PA 4H0LB 3VI7A 3OR5A 1M1KW 1IVSA 4BIZA 3RYFA 3SJBC 2MMNA 2ZINA 2WS2A 1BHAA 4J10A 3H9VA 5C8YA 2L5LA 4WBJA 3CTGA 4ZILA 5GSSA 1FOVA 4LL1B 5CA0B 3SJCC 3H1NA 4LF4B 5L71A 1XNRB 3PGTA 4DRXA 3A2VA 5HFLA 2FGXA 1KECA 2X6AA 4ZB6A 1IYIA 2ZCTA 1QHTA 3TKPA 1SESA 2Y69B 3O65A 3Q18A 5B8AA 3MD0A 1XNQO 2AZ2A 4CHSA 2XUMA 2E75B 2O85A 2FWFA 4KH7A 3F4TA 3L78A 5IO2A 1Z3EA 1L0LH 2ZR3A 1WE0A 3CCLV 5DALA 1H2MA 4O4IA 4G2KA 5G31A 2O8VB 4X1KA 5B1BB 5J2UB 5IY5C 4LMWA 3IPZA 5F07A 3GX8A 1PNKA 4ZBBA 2HHHB 3ZIAG 2DQ0A 1TTZA 1VP7A 5ECMB 2R3XA 3JCML 5G1LA 3HA9A 1TUBB 5KN0A 3IK7A 2V1DA 3A8TA 4LF7B 3M8AA 3ASOC 4TV8B 2HNLA 2LRNA 4B3MB 4I9QA 1ACVA 3C71A 3O9OA 3J7Yb 2MW2B 3C1SA 5BMVA 2Y4UA 2VCVA 2WSSG 3TGZA 2GTUA 4KP4A 4GSNA 4AJ7A 4Z2UA 1PKZA 4MVQA 4FM0A 4DO2A 5J3RA 3TJGA 3IR4A 4ZOLA 1GN2A 5EC1C 3EYTA 1E1RG 4G0LA 1FAAA 3P90A 2ZUPA 1R5AA 1F37A 4IIJA 2B1GA 4DV1B 4LF5O 1B9XC 2GZPA 4YJ3A 3PR8A 3QVNA 1LR1A 3J7AU 1K0BA 1V98A 1BHBA 2JU5A 2R0CA 3QO5A 2V6OA 4LF6B 5JH7B 1YQ1A 1NR1A 3GKXA 3CYOA 4A5UB 4WFHA 1XHXA 2WJUA 5DQYA 1TGOA 2EULA 3E2EA 5CBFA 2HRNA 5JQGB 4X9QA 2A2RA 3JAWA 1V55C 1SC5B 5A9GA 1ZWIC 1Z2GA 5DJLA 4CH4A 1BQZA 1D5NA 4YHHO 4EEQA 1GSSA 2CTQA 1AI5A 1TK5B 4X65O 5A4WA 3L9UA 1RSOA 3AK1A 5KMGA 1G6UA 2QWNB 3GSTA 4HJ2A 3FZ4A 2FUG2 1PSQA 5IYDO 4FYBA 4WFFA 2LNTA 4IT5A 1P7BA 2ITCC 3TK1A 4J41A 4EE0A 1JCHA 2VAFA 2V41A 4KCEA 5IIZA 1TA8A 4HYOA 4CBCA 5LOVB 4JU5A 3CJHB 4N0VA 5CREA 3KKYA 3VPQA 1TI3A 3BAAA 4JTDB 1A2LA 2VOCA 2OE3A 3RYHB 3UARA 2CAIA 3EE2A 3ZREA 4I97A 3IK9A 2B1LA 4E2LA 5B8BA 1TU7A 1YCIA 1USBA 4UCVA 3GMFA 4EB6B 3HZ4A 4MPGA 2LGWA 2GLRA 2HI7A 4I8BA 2PF4E 4GUNA 3ZL5A 1OAZA 1U6TA 2OCCB 2OBKA 1XBLA 4JAAA 1ABAA 1XNQB 2R0PA 4BWQA 3AK2A 4XDKA 3T4DA 2KHPA 3Q4HA 1H8HG 1I5XA 4JI1O 1MOFA 2NPBA 19GSA 2ZM6B 3BA8A 4NXNO 4HNAB 1NM3A 3HVNA 4IN0A 2DIZA 4MZCA 1YEWA 4X20B 3AG2B 1HNXB 2DMLA 4KHPB 1F3BA 2C0FA 1SKWB 1GAXA 3QG5A 1SKVA 1UFIA 3SPIA 2VL3A 3LUTB 3GL5A 5LCZA 2WLLB 2QKEA 2VD0A 1AIUA 5E59A 3KMOA 1ORQC 1KEBA 1GUMA 4MNNA 3ZMLA 3GH9A 5LP6C 2YICA 3ZTLA 4RQXA 4F82A 4FLUA 4B3RO 1NTZH 3RYFB 3EINA 1S3AA 1AC1A 1OE7A 2E0QA 3RVYA 5C8YB 2VLUA 1NZ6A 2XBQA 3DRNA 2UXXA 5HR1A 4ZIBA 3K58A 2HZFA 5IMVA 1Z5YE 2RQ6A 4LF5B 3MDKA 3TKRA 1LNQA 3CCSV 1UVZA 4MTGA 2H1DA 5CRHA 2AGAA 1QXHA 1O9GA 2YJHA 4XS1A 5LHGA 3GX0A 5EIBD 2QSAA 5EL8A 3D3QA 5JCWA 3SJAC 5HR2A 2V6KA 4UCRA 4RO2A 1URFA 2L35A 3ETEA 3IHGA 4DXWA 1K34A 5D96A 4WCEV 4JF3A 3A2XA 5D9XA 1PL4A 3L9DA 2KLXA 4GWRA 5DALB 4CC5A 1GRJA 4YHHB 5B6NA 2CTRA 1DF4A 4O4IB 1GN3A 2YIDA 2W6JG 2OACA 4JAUA 4KCAA 2QA1A 2FWEA 1GTBA 2H1AA 1EGOA 1XOUA 4IBPA 3ML0A 2DJVA 3ABLB 2UU9O 1UN2A 2FA4A 3ED3A 3FKFA 3JD0A 1AROP 2L6LA 2VCXA 1X5CA 1AW9A 4OGQB 3W7TA 1K92A 3IAS2 4O92A 2BE3A 3F7VC 2WCIA 4DUYB 3FY7A 5IMFA 5BMVB 2CVKA 5BRTA 1BS3A 3D8CA 4EDZA 2CA8A 4GX1A 2PGGA 1PL0A 2RJZA 5KUMA 2Q7EA 2OYQA 2QM7A 4JRRA 5B6MA 4ZOLB 1HYUA 5HQPA 3IC4A 1SKRB 3H1IH 2FWGA 5DVBA 2UXNA 1UC7A 2FY6A 3DD3A 5K1PA 1EOGA 2C0DA 3QTCA 3KP8A 4POKA 4YJ3B 3D36C 1X0RA 2GT5A 2H72A 2YANA 4R8CA 3FR9A 1QNMA 3K8NA 4K5RA 1GSUA 5H5SA 4EXJA 3L72H 2N74A 1E79G 1JX9A 5JWRB 4OPHA 2IJIA 3FB8C 5FHIA 3W7WA 3I5DA 5J2TB 3CTFA 4PDRA 4CW9A 4X1YB 1XOBA 4CC6A 4F4LA 5EVOA 4YKFA 4B7EA 1AP6A 1PQNA 1Z9HA 2EILC 3VWVA 1JJOA 2MBTA 2IJJA 1Z5WA 1GLQA 4G2EA 2Y69C 2H0IA 3K5LA 1ZOFA 3K5MA 2FWHA 3HY2A 4P2ZA 2WLHA 3SYQA 5CNWA 3QFBC 16GSA 1NHYA 5KMGB 3L4NA 1SZXA 3OFNG 3UVTA 2D3OW 2ZDIA 4ZBAA 2ZE6A 4JGSA 1SJIA 3N2GA 2HE3A 1DLBA 2L4QA 5B1BC 2B6MA 1X4TA 2P6JA 3MNGA 2A06H 3LW9A 2ZQMA 3APQA 1XG8A 2X64A 2LQOA 1VQ7V 1B4PA 1YZXA 2QC7A 4FQUA 1R3IC 3DXBA 4CY8A 2GUZA 3KXOA 4MA9A 4F6RA 3E89A 2HP8A 1K3EA 3F5WC 5HFKA 1M57B 1O8WA 4EKZA 3PJSK 2XHFA 2HLDG 4OCEA 1VQLV 1KUQA 2HLSA 3GNJA 1EBOA 4QL9A 1XVQA 5LXTA 5IOXA 2B1KA 1JOYA 3B77A 3HVVA 1TK0B 3Q4HB 4N21A 2WRTA 4I2UA 1MSDA 1L1FA 1GM8A 4QNHB 3GTUA 1SQQH 5BR8B 2X8CA 3E0UA 4WKWA 2LFSA 5GAPD 3HKDA 4GX5A 4NYKA 3D4MA 1IXMA 2O89A 5FL7G 2DE0X 2EZPA 4P9PA 2GDRA 2UU9B 1YIJV 2AHYA 1VQ9V 4BW9A 2LEGA 2RCVA 1BL8A 3JATA 1VF1A 5IT9N 2YI9A 2WAMA 1A0FA 1YY7A 1FXHA 1VQ5V 1MABG 3F6FA 1THZA 3IC9A 1N0NA 1B8XA 1SQGA 4FLTA 4MZWA 2CVBA 1KTEA 1QU7A 2YUAA 4TR0A 1XW9A 4MF7A 1GL8A 1ZYNA 1JZOA 3W7XA 4POBA 1VGLA 1KKDA 1AJNA 1EZKA 4ZL8A 2P4KA 3RN4A 2K9PA 2AUVA 1BGYH 1VIBA 3ZITA 2QTSA 1OJHA 1CPYA 1ZL9A 1K0DA 3RAZA 2BSKA 4KL1A 2XASA 3ZVJA 4EO3A 3I55V 2HR3A 1GLPA 2P90A 2EZOA 4MS2A 3ISOA 4BIKA 1AI6A 1R6TA 5EYPA 5K1XA 1TK8B 1WNSA 3K04A 3CSJA 5IO0A 3AK3A 1W2BU 2F4VO 3MSZA 1U88A 2LKUA 2VCTA 1HD2A 2H19A 4I5SA 5LA6A 3U0ZA 3K08A 1YDXA 4UFZA 1V57A 3X2QB 5HFMA 1SYRA 1RPRA 4V2NA 3R3EA 2FHEA 1SJZA 4RI7A 2X6CA 3ZMVA 3JD2A 2HYXA 3SPGA 5JJNB 2VS0A 3EVIA 3P8WA 5G5FA 3TB2A 1XUQA 3KZIZ 1SA0A 3ZFBA 1ERWA 4YQVA 1VQOV 1BT8A 3CCVV 1OCZC 2HRFA 4QIWF 4DR7O 3AG2C 3LDDA 1M0UA 1S3DA 3OUSA 5KUKA 4JYBA 5GONA 5F2VO 1R5PA 3TUEA 5EBLC 1XVWA 1O85A 4FZ0A 3K79A 1J0FA 2BOBC 4GQFA 3D21A 3DYRA 2DYSB 3M8NA 3VPTA 3HHVA 2JZSA 2I81A 3K3WA 2JS3A 5DJMA 3WT2A 5KAIZ 4XIHA 2PI4A 2NN4A 3OR6C 4IP6A 4ISDA 4MF5A 5JVDB 3TOTA 2R9RB 1O7UA 3Q6OA 3KMNA 1CEZA 1S5LZ 4BAYA 1YEXA 1SQXH 3K59A 3C90A 2Q73A 3O3TA 4MDCA 1AQVA 2L6DA 5IMAA 2Y0IA 4MMMA 3FZ9A 5DECA 1XMQO 2IU0A 2CAQA 5D5QA 3K03A 1GO3F 4BWSA 2V7QG 3GWOA 4U7NA 2OTLV 4GXZA 2ZNJA 2UUBO 2TIRA 3G6BA 2JACA 2E3CA 5FPRA 5J2UA 5G30A 3ZRDA 4O4HB 2A3QA 4FLXA 1AQXA 4O2BA 3CCUV 4LFCO 3OW2U 4GQCA 3ZIVA 5KA6A 4NXIA 2JGDA 3LG6A 3B8MA 3N2GB 1YITV 5B3SB 5DQSA 2AXTZ 3QAWA 1XREA 2RNBA 2IMEA 4OFTA 1OKDA 1ROPA 3G71V 1MZFA 2ES7A 4Z2TA 2HVJC 1QLNA 3LNNA 4K8MA 4OFNA 4JI4O 1PNLA 2F8FA 1L0NH 5KOWA 2IJKA 3AG4B 1FXKC 3CPWU 4FPPA 1Z7PA 1JJ2U 3TXSA 3WG7B 3CCRV 2NBSA 4KFMA 4DEJA 1AJPA 4J42A 3DSQA 2GUZB 3ZHSA 1AR5A 4GSTA 1AXDA 2LRCA 4O4LB 1Q6UA 1AILA 4LF8B 2YIBA 3QF7A 3RGBA 1P49A 4QE7A 3IGAC 5IWAO 4J9ZB 4WFAV 4KDUA 5LXTB 1R6NA 2F4VB 4B3TO 4F2IA 1OCOC 2ATKC 1KP2A 2B5YA 4DR4O 2HJFC 5JQGA 2REMA 3EHBB 3GTUB 3TRQA 4WR4A 3KZQA 1VF6C 1HWYA 2IH1C 1QLEC 4MH3A 2F3MA 2H6YA 3HKDB 3PINA 3QAGA 3C8EA 2FD3A 5H5QA 2H1GA 3F6DA 1O6JA 5EK0A 4JZQA 1YSCA 4YIOA 3FZAA 3CHXA 3AG7A 1M2BA 3LSUA 1AI4A 5DN6G 2IM9A 2BTOA 4KNDA 2OT5A 4DR7B 4V1Ag 4EFBA 5FNVA 2ZXWB 4E8HA 4HZ3A 1BJXA 4AJ8A 1UJWB 3QCPA 1AVMA 3CJHA 1R3KC 4ASUG 1Y76A 4B08A 2IMIA 5KOXA 14GSA 3RYHA 2VCZA 2YIBD 1R3LC 3EU3A 1VQ6V 2H75A 4EB6A 1Z6MA 5LMNO 5IOWA 3GYKA 5D9TA 2LRTA 2IH3C 2CGNA 1AB3A 3M9JA 1O9HA 1IYHA 1SETA 1N8JA 4HQSA 2MMAA 3OGIB 5EYPB 1XMQB 3W7SA 1RK4A 1XWCA 5KA5A 3CMAV 2XNDG 3OTOB 2PUSA 3BABA 5LMUO 2C3TA 2GQLA 4C7UA 1QGVA 2UUBB 4K8XA 2FYUH 2HRKA 1M57C 2Q6AA 3RPNA 3GRXA 3TRXA 1GWCA 1R7HA 4JI2O 2VM2A 2VQFO 2IMFA 2JDIG 1FB0A 3J7Yk 2GSSA 1PP9H 2GGTA 1SL0B 1EN6A 4DV4O 1E6BA 5EBMC 3ZHTA 1PL2A 3BEHA 2KP1A 1XFLA 3FYEB 3F8UA 1EN4A 3BCCH 4FLZA 2GDSA 5EIBC 4KE3A 3SGIA 1PMTA 2QWOB 2R37A 2B3SA 1WP8A 5J41A 4JI7O 1C72A 4BVYA 1N32B 4ULXA 3FKSG 4JI4B 5GONB 4B7KA 1Z6NA 1GRXA 3HKRA 2R9IA 4K7IA 3C7MA 1MZEA 4JYAO 2L57A 5L3DA 5LYJA 1HP8A 4OWYA 4QE9A 2FTKA 2WB9A 3MIXA 4F6EA 2O57A 1GK9A 1HNZO 2DMXA 2GTAA 3CRQA 4IHJB 4DV2B 3KCXA 4IYIA 1Q6HA 4OX9O 1XWAA 2K18A 4YQUA 1N2AA 1JQ0A 3U11A 1SL1B 2EILB 5IWAB 1M9AA 5KHGA 4B3TB 2OTJV 4BPYA 4V1Ap 7GSSA 4DR4B 1XWGA 2CE4A 4G0KA 1JHBA 2UUAB 2VL9A 3P3NA 1TI1A 4HU9A 4JBBA 1B4QA 1Y25A 4JV5O 3GH6A 4IQ1A 4JR6A 1OC3A 1GULA 3VWXA 2UXDO 4W4LA 3K9SA 3C3SA 1GSQA 3QDNA 4NPBA 1THXA 2R6KA 2W0XA 6GSSA 3EU4A 3SR2C 4O2BB 1M93A 2XAHA 1GTAA 1WAZA 2DIYA 1K0AA 1AR1B 4GKKO 3HZ8A 3IBHA 1BZKA 4QPJA 3ZRWA 1XQ8A 2JGDB 1FXKA 3ETGA 5IJ9A 2ZD9A 3WB2A 4JEDA 3UCSC 4UVCA 3X2QC 1VF7A 2JS5A 1B04A 4IW9A 5HFGA 1JFFA 3DWVA 3ABUA 2BCCH 2ZT9B 1NU1H 1PPJH 4JI3O 1Y67A 4HI7A 3ZHQA 2F93B 4DV5O 4PNFA 2EJ7A 3CX5F 2A2PA 1SZTA 2YWIA 5KHKA 4MF6A 3SJQC 5LMNB 2G2QA 3HJPA 1B3QA 2NTOA 2CVDA 3JALA 2H1BA 1VF6A 3B09A 1YJ9V 4PURA 3IA1A 3BBYA 5ECSA 2PPTA 4PUAA 1FXVA 2JEXA 5JWQB 4BVXA 4MW3A 2ZR2A 3JAKA 3ABTA 2DYSC 1PA3A 3W8JA 5J2TA 4FLWA 2WLJA 5E79Z 4X1YA 2HG5C 1F9MA 4J57E 1TKDB 1VF5B 2DYRB 2XPDA 3WU2Z 4U7OA 4RQFA 4JI2B 5KLVH 4HZ4A 1PRXA 3LSSA 3HDCA 1SL2B 2P22C 4OO5A 2BJXA 2WLKA 1BCCH 4DV4B 2VM1A 3BD2A 3LDCA 4QJFB 5IE9A 3STLC 2E2MA 3SWLA 3V1WA 2JZTA 2MMOA 3BOAA 3HKEB 2GSRA 1AI7A 3R66A 1K4CC 2R2JA 3UO3A 2Q68A 3KIJA 1W59A 2P06A 2GVPA 4JI7B 3FEUA 1TOFA 2P4VA 5FNVB 1KNGA 3KTBA 5E4WA 1BAYA 2VL2C 3FR3A 2E7PA 2ZKOA 1EV4A 2IMKA 4TOPA 4JYAB 3BCIA 3G4SV 2K8SA 4FH8A 3EC3A 2HXKA 4AHCA 12GSA 4JE1A 1Y76B 5GTIZ 4ZHQB 2ZDIC 1J95A 2JJ1G 1HNZB 4O5RA 1Y4MA 4UUJC 4OX9B 3CS5A 3L70H 5B3SC 2JK5C 3JD4A 2IL3A 5CRWA 3LDEA 4L0WA 4TN8A 4L0UA 3N27A 4XRDA 3AG4C 4MVZA 3CCMV 1T7PB 4XS6A 3WG7C 3UAPA 4JV5B 4X89A 2XBIA 2EX3A 2WPDG 4DV6O 4Z2RA 3SPHA 1D2DA 2HFEC 1K3YA 3JASA 1EOHA 5F06A 4B3SO 1M56C 3IRAA 3FX7A 4J80A 1OCZB 2FMLA 5ECQB 2F8AA 3ZRSA 4D73A 4O2AB 2LP7A 3JD3A 3H01A 5JCUA 2VO4A 1R1BA 4I7ZB 1AAZA 4G9HA 3ETDA 4NMUA 5IMCA 1DF5A 3LQ7A 4R50A 3EWLA 2QEXV 2CTPA 3IC7A 1FKAO 1F2EA 2H94A 4FLVA 4KAEA 1XW6A 4ILFA 3OM3B 1JR9A 2YJ7A 4D7TA 2B5XA 2KQXA 4JI3B 2IIYA 4BVYB 4HOJA 3I9V2 4DV5B 5JCGA 3VFIA 3VURA 2EIJB 5B1OA 1G7EA 1I0HA 2DWDC 4BL7A 1YVWA 5LYJB 2JEUA 2AHZA 3VI5A 1VQ8V 4R7CA 1HNWO 1H2LA 2ZXWC 4K1FA 4OMVA 3W8SA 4MVRA 4N23A 2P5OA 1IBMO 4L87A 1YEPA 2XPEA 5EPFA 2JVDA 3G9BA 2YS8A 3J81N 2D2ZA 3DKSA 1M99A 3O6TA 1BMFG 3E9JB 1XWBA 4YJ2A 5F05A 4IJ3A 3TJBA 4KB3A 4LH7A 3DVXA 4XDJA 1QBZA 5AIXA 3RWRD 1JZDA 1O8XA 5AIVA 1OCCB 4BA7A 2HT9A 4IKHA 5IMDA 1A23A 1FHEA 3CSIA 2A2SA 5D73A 2VWKA 2KG7A 2I9HA 4PX1A 1O81A 3QMXA 17GSA 3QD9A 2C0GA 4IGGA 4G0IA 1B6QA 4X65B 1NS1A 3FYIB 4TQFA 4GF0A 1W0JG 2G38A 1X5EA 4JZGA 1MDKA 2N5BA 1K5SA 1YJNV 5EC2C 1WN7A 3ZRWB 2H0HA 4N30A 1FXKB 3FFQA 2BOCC 3JCUZ 1K33A 1H2SB 5IJ9B 4OD7A 4LR3A 6GSWA 5BZBA 5G2ZA 4WF9V 4JZ2A 4G27B 1T00A 1JFFB 4K6XA 1R3JC 2XT9A 1K0CA 2NVLA 3KGKA 4X66O 1ZYEA 1FYJA 4ZBMA 2JSZA 3L71H 3LSQA 1FJGO 2V32A 2C3NA 5HR0A 5KEJA 5BMUA 2GSMB 5LHIA 3RBZA 1OCOB 4I5QA 3STZC 3DIEA 4HBNA 4TOIA 3JALB 1GUHA 4DW1A 2DJ3A 5JVDA 1YKCA 5L3FA 2AHEA 3P2AA 2UZ8A 1QLEB 2M72A 4LA1A 1M4UA 4BVXB 3SYOA 3JAKB 5DEDA 3ZMSA 5CAXA 2P5RA 2E5LO 1JVMA 3R65A 4JI1B 4DV6B 3TJFA 1QMVA 3VLNA 3SYPA 2PUKC 4NXNB 1W4VA 4ZKIA 3T2MA 2O7KA 5A4UA 4B3SB 4GCIA 4K0GA 2VRZA 5HFIA 1JMKC 1FPOA 5H6QA 5EZYA 1XILA 4PI2A 3VQVA 3DGEA 4V2MA 4USSA 4PDMA 5GTHZ 4JI5O 2VL2A 2AW9A 2YXLA 4O4HA 1V58A 4ACSA 1MA1A 4K2DA 1F7YA 4FFKA 1V2AA 3HKCA 1TW9A 2G0FA 3U10A 2YI8A 1S77D 4NB5A 3EFFK 1VMGA 1QR8A 4UVBA 2FL4A 1T4YA 3IHQA 1TDIA 3QNEA 4EUYA 3TKSE 4B3RB 1XW5A 2F9SA 3CXCU 1NBMG 2DOSA 3M7MX 2TRXA 4FYUA 4TR3A 3ZHUA 3G80A 4AF2A 3TCUA 3ZMTA 1H38A 3ZMUA 2PI5A 2BMXA 4OFMA 2CQ9A 2WZ9A 1IURA 3VOUA 4OCFA 4I4TA 1J9BA 3Q19A 4PA6A 3WGDA 1V9WA 4WFEA 3D4TA 4LBEC 2ZNMA 1BE3H 4GX2A 2C4JA 4QGPA 4O4LA 3VK9A 5ECIB 2ZNIA 2X7RB 2HFDA 4ML6A 1AUCA 3MDSA 2PY5A 1H2KA 3HVXA 3RHCA 3VQWA 2F51A 2PZSA 4UXNA 3S3WA 5CBHA 1IBLO 4XDLA 1K0OA 3TXQA 1Q82W 3G67A 1TRSA 1Q90D 4JTAB 3HKBA 1KD1W 1JZWA 1DE1A 5BY1A 1QVGU 3JASB 4PI0A 3C73A 2KOKA 5CMUA 2QSIA 1NSWA 1LJRA 5DBQA 4D73B 3ZBHA 1Q81W 2OBIA 2N04A 3M3MA 4AJ6A 5F8BA 4AQYO 4MABA 2PYLA 3CSHA 2X99A 4HUAA 4J56E 1F4MA 2DYRC 1ERTA 3ZYWA 2I4AA 3ICXA 1GN6A 2LSTA 1J08A 2RM5A 2EINB 3GB7C 4P30A 1TU8A 3JARB 4MP4A 4K9ZA 4CH5A 3G7JA 4GLXA 4PXOA 1HDJA 2IW5A 3UBLA 1GNWA 4I50A 4RAIA 4X66B 5A2QN 2QE7G 2ILMA 4CZZA 3CRUA 1HNAA 4KDYA 1NW2A 1N8RW 1F6MC 3KD0A 1NI8A 1SS3A 1FJGB 1V40A 3WGEA 3VWUA 2VCWA 4K3AA 1E1QG 4BL7B 4WXTA 4KW6A 3K0DA 4E8EA 5IYZA 4AILC 4HEA2 2YC0A 2J9HA 1AQWA 1TRVA 1PX7A 1KBNA 4EDYA 1EZJA 2YWMA 2ZE8A 2E5LB 4X0XA 2XC2A 4YJ2B 4NTWA 4P9OA 4Z7XA 4PHZA 2LV3A 3OGCC 5CBGA 18GSA 4AI8A 4LNUA 1Y6XA 5CA3A 2N05A 3ABKB 1YXBA 3HCZA 1KKCA 3F4SA 5ELGA 5IQYA 1ZCPA 2X6BA 1MDIA 2CT6A 4KGIA 2KG7B 4JI5B 2XAQA 4X1UA 1ZYQB 1XOAA 2QGVA 5L3GA 2WLNA 3OT7A 2LQQA 2V4DA 4LC1A 4X1IB 2YZHA 4JI6O 4UCTA 2HZEA 2OKAA 1N0JA 3QFAC 1QQCA 1COWG 1GSYA 2EIQA 3MAKA 3ME8A 1QCEA 4CS4A 2Q7GA 3BY6A 4JYCA 1GM7A 1P84F 2CDYA 1ZX3A 4LFBO 1CQHA 2FA8A 5C04A 5LD0A 1T3BA 1XEQA 2Q0OC 2EIKC 2QA2A 4HDEA 1N4CA 2JGUA 5B1AB 2XTAA 3FB7C 2UXBO 2B5EA 1ERVA 1YF0A 3CE2A 1ZUQA 1HR0O 3A0BZ 2YWNA 1FFXB 2ON7A 1ZL8A 4BR6A 2MYGA 2FNOA 2FLSA 4IHJA 2XOKG 5J5NA 4NHWA 4PNGA 1DTOA 2EIJC 3CRCA 4TSFG 3ZMZA 2ZIMA 2KKWA 1ZZYA 1IBLB 4MJBA 4PELA 1A32A 2QKAA 4FIWA 1PN9A 3L73H 2C8UA 4FJCC 2YXHA 4TVEA 3WFVA 4TR4A 3ZIJA 2WFCA 3CQFA 4DV0O 1M9NA 4G28B 4IYHA 1BYEA 4DR3O 2HKOA 3T4ZA 4KA0A 1Q7YW 3GWKC 5EZYB 3A0RA 2H71A 1WA8A 2M46A 1Z5VA 3E3EA 3NZNA 1A24A 4AQYB 5KX5B 2JZRA 2CZ3A 4AGSA 2GZYA 1OCCC 4O7HA 2MZCA 4POLA 3HKCB 2H0GA 1K3LA 4O4JA 2KB1A 1JLWA 2AAWA 5KHHA 3HPLC 4J7ZA 2OJLA 3N5OA 5ECPB 3ZX6A 1KMIZ 3E22B 3A2FA 3FMWA 3FW2A 3TJTA 2FB5A 5LBQA 1RW1A 2H8PC 1K97A 4LFAO 4QL7A 1L8DA 2VD1A 4FM1A 4I4TB 3UO2A 1Q43A 2YV7A 4TQDA 3AY8A 3BJ5A 1S0VA 2PERA 1OV9A 1K0MA 3KM6A 4K7NA 4UV9A 3A0HZ 5FWGA 2W6IG 4TR1A 2FKXA 3EVKA 4Q5FA 2C80A 2P5QA 2NNUA 1M56B 1DK1A 1T1VA 3P32A 4D7SA 4LF9O 1I94O 4WF5A 3F4RA 1S3JA 3QOUA 2WULA 1H2GA 4H86A 3VQYA 2YP6A 3GURA 4YQMA 1GH2A 1LUWA 4E4EA 3HKBB 5IPGA 1QR9A 1XBSA 3RYCA 3TCOA 1NH2D 2YN1A 5JWOB 3THOA 3A5WA 4GTUA 5JJEB 4F0CA 2CV4A 3S3XA 4DSSA 4RUFA 2XAFA 3D3IA 1PNMA 3FD9A 3LSZA 5D9WA 5IJ0A 2ADQB 3HKEA 4GYCB 5L3EA 2LW1A 1YJ6A 2H74A 5COHA 1G1XB 1U87A 4GCZA 1Y74A 2Q7HA 2B7JA 4R6ZA 3FAVA 2Z5UA 4MSWC 3C3TA 1BEDA 2LNSA 3U5RE 4HAMA 4I50B 2Q69A 4RI6A 4HJMA 1M5IA 1HR0B 2VCQA 1K7DA 2LJ2A 1V54C 2CK3G 3SPJA 4MLYA 4ZHQA 1HNCA 1MG1A 3APSA 3FHKA 3OD4A 2WLMA 1FG4A 1LU4A 3ZHRA 5IYZB 3FYGA 3PN1A 2L6CA 5ABRA 2DSAA 3UMAA 3ZN0A 4TUYB 1IX9A 1ZSPA 4L8EA 1KYOF 1OCRC 2PBJA 1ERUA 5HR3A 4B3MO 2PGTA 1ILOA 4FVMA 1YHQV 3W6GA 4IJIA 3SYCA 3AG1B 4DR3B 5H2FZ 4LNUB 4JYYA 3H1JH 1YJWV 1S76D 3JSNA 1ML6A 2YPMA 1MNGA 1XL4A 3LXZA 1CP9A 5B1NA 1TVKA 4H44B 2ARHA 1WB7A 2LQTA 5INYA 1YZBA
chains in the Genus database with same CATH topology
5ECNB 1GSFA 3IDVA 1F3AA 4HQZA 2JL4A 5B7CA 2HZEB 1QFNA 3G7YA 1B48A 2ON5A 2M80A 3DGQA 1DSBA 2GQKA 2JADA 2C1YA 4N11A 2LJRA 4A5PA 3O76A 4IVFA 3F9UA 3HVSA 4YH2A 3CBUA 1K3OA 3GSSA 5H5RA 3L0HA 4F03A 3GKKA 5ECOB 2YZUA 2P31A 5D93A 2DJKA 2IFQB 2WGRA 1EWXA 3ME7A 2L59A 4G19A 5DAKA 20GSA 3ZZXA 13GSA 4G10A 2ALBA 1PKWA 4MZBA 4NHZA 2OE1A 3UJ1A 5CYYA 5KN2A 2M6YA 1R26A 2L4CA 2DLXA 3NIVA 3RPPA 1Q4JA 1R4WA 1EEMA 1GUKA 3WT1A 5ECKB 1PD21 3IE3A 4DVCA 5DDLA 2WDUA 1T8EB 3D0ZA 4EIQA 5KN1A 1XCCA 6GSYA 4KUNA 3SBCA 2V2GA 4LL4B 1SK0A 3WGXA 4IELA 5GZZB 2YV9A 5DCGA 4TR1B 4HS1A 3CXGA 3F3RA 2RLIA 4FYCA 2H6XA 3HD5A 1XWKA 4RUVA 2FCHA 4Q5QA 2R5GA 4TXOB 2AV4A 4KSMA 1OKTA 4DSSB 6GSTA 3UVHA 1GTUA 1SD8A 2TRCP 2PVOC 3RDWA 1M2AA 5ID2A 1Y6EA 4J2FA 2HRAA 1THOA 1DBYA 4WR5A 3D5JA 5D9VA 4CDOA 1U3AA 4K2XA 4ZL7A 2IWTA 2BTOT 1JZRA 4MJAA 1QUWA 4FO5A 1B9YC 1MD4A 3FR6A 4RWUA 4KF9A 3TJKA 3LFLA 4TW5A 3M1GA 2A4VA 1WOUA 3QPMA 2DN9A 1OC9A 3I6AA 3GUSA 1DE2A 3H79A 1G6YA 1WJZA 1O73A 1ON4A 4ZBDA 4ID0A 4EVMA 2MMZA 5D8IA 1TP9A 10GSA 2H8LA 1BG5A 2IJYA 3CMIA 4NWYA 3GV1A 3APOA 4O5QA 4NAXA 1X9MB 1TJDA 2DMMA 2PVQA 4YAVA 4TKYA 6GSVA 3KJYA 1ZYPA 1T4ZA 3UEMA 2A4HA 4KX4A 2PU9C 3P7XA 3FRCA 1GNEA 4HZ2A 4DSRA 4K0NA 1MD3A 3S9FA 4TRXA 2QWPB 1I5GA 5IM9A 3KP9A 3ZLPA 3M0FA 4HU7A 4GRFA 2E2GA 1MDJA 3FZ5A 4LLRA 5G5EA 1SU9A 5DAKB 2YWOA 3RHBA 3DMLA 2MBSA 3IXRA 3LEFA 8GSSA 1GSDA 2LJKA 4ICYA 1LBKA 1SK1A 4EL1A 2KP2A 3LYKA 5DCHA 3TDGA 2Z9SA 2AB6A 5G1KA 1EP7A 3G7IA 1H75A 2GSQA 4NV5A 1SKSB 1QQ2A 1MTCA 4XRAA 1JFUA 1TXXA 3NOFA 5A5KA 2LTKA 3WD6A 1YDKA 4F9ZA 4IHUA 1X9SB 3RBTA 1RQMA 2HSYA 3DVWA 5CRDA 4TXVA 2DBCA 1M2DA 2PN8A 3GKNA 1EP8A 3WYWA 5ENUA 2X8GA 3EMPA 1SENA 2VIMA 2J23A 4MJCA 1PN0A 4PQIA 3ERWA 1MEKA 3L9VA 1SD9A 1GP1A 4LMVA 4ECCA 5ID2B 5A4VA 1K0NA 3GKMA 2DJJA 1OYJA 3GIXA 3EMXA 3R2QA 1FW1A 4DSQA 1A0RP 4Q5NA 3A5IA 2IN3A 3U6VA 1HNBA 3PH9A 1WPIA 2C0EA 3F0IA 1FVKA 2YNXA 5ECLB 3HYPA 4EC0A 2KUCA 3GN3A 1ZGNA 1PL1A 4JR4A 1XIYA 2H70A 2JSYA 1XXUA 2CTWA 2LJAA 1FVJA 3KEBA 3KH7A 4ML1A 4XCSA 3ZMKA 1OC9B 2X49A 5AGYA 5CRGA 3H8QA 4GLTA 2AJQB 3I69A 1WRYA 4XTSA 3H4KA 4MPFA 1UA5A 4PGTA 1G7OA 4KDXA 2DJ2A 3QR6A 1EV9A 3TKQA 5GAND 1WIKA 2YOIA 5LNKe 4O5UA 3L9SA 2NDOA 4K7OA 4MJEA 4ZXGA 2R4VA 4I2TA 1WMJA 2PWJA 4O32A 4MK3A 3LGCA 3TKSC 5AISA 4XS4A 2R0GA 3A2WA 4WBRD 4N0ZA 3HJMA 5J4UA 2B7KA 2CZ2A 3TJJA 3DEXA 3IV4A 3TRPA 2H6ZA 4YAPA 2K6VA 2H30A 2VLTA 2DKHA 1ZMAA 3MWHA 1URMA 2OA7A 2QWQB 2OE0A 1FO5A 4QQ7A 3VWWA 1TRUA 2GS3A 5IPHA 3US3A 2H76A 3ERGA 3H93A 2Y4TA 2L5OA 1U3IA 1VF4A 3F63A 5CP1A 1YF1A 1H4OA 4EF0A 4EIPA 1E2YA 2LS5A 1DUGA 1XPVA 3CRTA 2H66A 4GSSA 2DC5A 4ECBA 2RM6A 3Q74A 3KCMA 3HJOA 2IMDA 3LORA 3BCKA 11GSA 2VLVA 6GSUA 1SK2A 2IPAA 2IFQA 1M9BA 4L5LA 4ZB8A 1YKAA 4PUFC 3LJRA 6GSXA 1VF3A 2K9FA 2EC4A 1Q98A 4POMA 1S3CA 1NHOA 1VRSD 2HSHA 3ZVJD 2EIOA 3PPUA 4NV2A 2I1UA 1W89A 3I43A 2I3YA 2QWRB 1HQOA 4PQHA 4XHMA 1M7TA 2YCDA 4P3YB 1A2JA 2P0GA 3MYDA 1BX9A 4WF4A 1JLVA 2RUEA 4IQAA 2LO1A 3KTLA 3N9JA 5F0GA 2DJ0A 5J9CA 3LYPA 4PTSA 2OADA 3TOUA 3EPTA 2CX4A 4X4JA 3GL3A 3IC8A 1BQ7A 3GFKA 3FK8A 1GTIA 2O87A 4ZIJA 2N5AA 1SJ6A 2AYTA 5EY6A 2CUGA 3EURA 4KSOA 22GSA 2N5FA 9GSSA 4IGJA 1PGTA 1G0TA 1CQGA 4OO4A 1EEJA 3ERFA 3IOSA 1QK8A 4ECIA 3ZFLA 2K8VA 4TXOA 2X4AA 1OVNA 4MH2A 3TKSA 3M9KA 5IMZA 2GZZA 5ELAA 2VUPA 4V2LA 2GSTA 1OC8A 3UL3A 5ECHB 1EGRA 1GSEA 4ZB9A 1BQ0A 4K5SA 2GQMA 2H73A 3UOMA 4MCUA 4F0BA 1WWJA 3F3QA 1TRWA 4XS4B 5AN1A 1WJKA 1FAFA 1FOHA 2X8HA 4WEYA 2OCHA 2RUFA 2LUSA 1Z7RA 5CO3A 1OE8A 5ECRB 3HXSA 5GSTA 5J9BA 4RQRA 2DKIA 4I6XA 3A3TA 5FT3A 2C3QA 4X43A 2DJ1A 5C00A 3BVOA 3CYNA 2RIIA 1XZOA 1GH6A 4IP1A 4ECJA 3D22A 4Q5RA 2EIRA 4IS0A 3LWAA 3GHAA 1G6WA 2HSMA 1I9DA 1X9WB 2GT6A 4ZL9A 4CY6A 4YKGA 3KH9A 4N10A 1A2MA 3IAM2 1ST9A 3D6IA 3UBKA 2CX3A 4PQ1A 4L5OA 2PMTA 3LXTA 3C1RA 1X5DA 3UIWA 1A8YA 1VF2A 2H01A 1A8LA 1SYXA 3GA4A 1PX6A 3QAVA 4WETA 5KN3A 1FB6A 1WP0A 2V1MA 3VI7A 3OR5A 2MMNA 2WS2A 4WBJA 4ZILA 5GSSA 2L5LA 1FOVA 3CTGA 4LL1B 3H1NA 5L71A 3PGTA 3A2VA 2FGXA 4ZB6A 1IYIA 2ZCTA 3TKPA 3Q18A 5B8AA 4CHSA 2O85A 2FWFA 4KH7A 3F4TA 3L78A 5IO2A 1Z3EA 1WE0A 5DALA 5G31A 2O8VB 4LMWA 3IPZA 5F07A 3GX8A 4ZBBA 1TTZA 5ECMB 2R3XA 3JCML 5G1LA 3HA9A 5KN0A 3IK7A 4POKA 2HNLA 2LRNA 1ACVA 3C71A 3J7Yb 3C1SA 2Y4UA 2VCVA 3TGZA 2GTUA 4GSNA 4AJ7A 4Z2UA 1PKZA 5J3RA 3TJGA 3IR4A 3EYTA 4G0LA 1FAAA 3P90A 2ZUPA 1R5AA 1F37A 2GZPA 1B9XC 3PR8A 1K0BA 2R0CA 2JU5A 1V98A 2V6OA 1YQ1A 3GKXA 2WJUA 5DQYA 2HRNA 2A2RA 5DJLA 1BQZA 1GSSA 2CTQA 1TK5B 5A4WA 3L9UA 3GSTA 2QWNB 4HJ2A 3FZ4A 2FUG2 1PSQA 4FYBA 2LNTA 4IT5A 4EE0A 2VAFA 2V41A 4KCEA 5IIZA 4JU5A 4N0VA 5CREA 3VPQA 1TI3A 1A2LA 2VOCA 2OE3A 3UARA 2CAIA 3EE2A 3ZREA 4I97A 3IK9A 2B1LA 5B8BA 1TU7A 1USBA 3GMFA 3HZ4A 4MPGA 2LGWA 2GLRA 2HI7A 4I8BA 2PF4E 3ZL5A 1OAZA 1U6TA 2OBKA 1XBLA 1ABAA 2R0PA 4BWQA 2KHPA 2NPBA 19GSA 1NM3A 4IN0A 2DIZA 4MZCA 2DMLA 1F3BA 2C0FA 1SKWB 2VL3A 3GL5A 5LCZA 2QKEA 2VD0A 1AIUA 5E59A 3KMOA 1KEBA 1GUMA 4MNNA 3ZMLA 3GH9A 3ZTLA 4RQXA 4F82A 3EINA 1S3AA 1AC1A 1OE7A 2E0QA 2VLUA 1NZ6A 2XBQA 3DRNA 5HR1A 2HZFA 5IMVA 1Z5YE 3MDKA 3TKRA 1UVZA 5CRHA 2H1DA 1QXHA 2YJHA 4XS1A 3GX0A 2QSAA 5EL8A 5JCWA 5HR2A 2V6KA 3IHGA 5D96A 3A2XA 5D9XA 5B6NA 4GWRA 2KLXA 5DALB 2CTRA 4KCAA 2OACA 2QA1A 2FWEA 1GTBA 2H1AA 1EGOA 4IBPA 1UN2A 2FA4A 3ED3A 3FKFA 2L6LA 2VCXA 1X5CA 1AW9A 4O92A 3IAS2 2WCIA 3FY7A 5IMFA 2CVKA 5BRTA 4EDZA 2CA8A 4JRRA 5B6MA 5HQPA 1HYUA 3IC4A 1SKRB 2FWGA 5DVBA 1UC7A 2FY6A 3DD3A 1EOGA 2C0DA 3KP8A 1X0RA 2GT5A 2H72A 2YANA 3K8NA 3FR9A 4K5RA 1GSUA 5H5SA 4EXJA 5JWRB 5FHIA 3CTFA 4CW9A 1XOBA 5EVOA 4YKFA 1PQNA 1Z9HA 3VWVA 2MBTA 4G2EA 1GLQA 2H0IA 1ZOFA 2FWHA 3HY2A 5CNWA 3QFBC 16GSA 1NHYA 3L4NA 3UVTA 4ZBAA 1SJIA 2HE3A 2L4QA 2B6MA 3MNGA 3LW9A 3APQA 2X64A 2LQOA 1B4PA 1YZXA 2QC7A 4FQUA 3DXBA 4CY8A 2GUZA 3KXOA 4MA9A 5HFKA 1O8WA 4EKZA 4OCEA 2XHFA 2HLSA 3GNJA 4QL9A 1XVQA 5IOXA 2B1KA 3HVVA 1TK0B 2WRTA 4I2UA 3GTUA 2X8CA 3E0UA 4WKWA 5GAPD 3D4MA 2O89A 2GDRA 2LEGA 1VF1A 1A0FA 1YY7A 3F6FA 1B8XA 4MZWA 2CVBA 1KTEA 2YUAA 4TR0A 1XW9A 4MF7A 1GL8A 1ZYNA 1JZOA 4POBA 1VGLA 4ZL8A 1EZKA 2AUVA 3ZITA 1ZL9A 1K0DA 3RAZA 3ZVJA 4EO3A 1GLPA 3ISOA 1TK8B 3CSJA 5IO0A 3MSZA 1U88A 2LKUA 2VCTA 1HD2A 2H19A 1V57A 1SYRA 4V2NA 3R3EA 2FHEA 1SJZA 4RI7A 2HYXA 3TB2A 3P8WA 3EVIA 5G5FA 3ZFBA 1ERWA 4YQVA 2HRFA 1M0UA 1S3DA 1R5PA 3TUEA 1XVWA 1O85A 1J0FA 4GQFA 3D21A 3DYRA 3M8NA 3VPTA 3HHVA 2JZSA 2I81A 5DJMA 3WT2A 4XIHA 4IP6A 4ISDA 4MF5A 3TOTA 1O7UA 3Q6OA 3KMNA 1YEXA 3O3TA 4MDCA 1AQVA 2L6DA 5IMAA 4MMMA 3FZ9A 2CAQA 4BWSA 4GXZA 2TIRA 2JACA 5G30A 3ZRDA 1AQXA 4GQCA 3ZIVA 4NXIA 3LG6A 5DQSA 3QAWA 2IMEA 4OFTA 1OKDA 2ES7A 4Z2TA 4OFNA 4K8MA 2F8FA 5KOWA 1Z7PA 2NBSA 4DEJA 4GSTA 2GUZB 1AXDA 2LRCA 4KDUA 4F2IA 2B5YA 2REMA 3GTUB 3TRQA 4WR4A 3KZQA 4MH3A 2F3MA 2H6YA 3QAGA 3PINA 3C8EA 2FD3A 5H5QA 2H1GA 3F6DA 1O6JA 4JZQA 3FZAA 3AG7A 1M2BA 4KNDA 4V1Ag 4E8HA 1BJXA 4AJ8A 3QCPA 2IMIA 5KOXA 14GSA 2VCZA 3EU3A 2H75A 1Z6MA 5IOWA 3GYKA 5D9TA 2LRTA 3M9JA 1IYHA 1N8JA 4HQSA 2MMAA 1XWCA 1RK4A 2C3TA 2GQLA 1QGVA 2HRKA 3RPNA 3GRXA 3TRXA 1GWCA 1R7HA 2VM2A 2IMFA 1FB0A 3J7Yk 2GSSA 2GGTA 1SL0B 1E6BA 1PL2A 2KP1A 1XFLA 3F8UA 4KE3A 1PMTA 2QWOB 2R37A 2B3SA 5J41A 1C72A 4BVYA 4ULXA 1Z6NA 1GRXA 3HKRA 4K7IA 3C7MA 2L57A 4OWYA 2WB9A 3MIXA 2DMXA 1XWAA 2K18A 4YQUA 1N2AA 1SL1B 1M9AA 4BPYA 4V1Ap 7GSSA 1XWGA 4G0KA 1JHBA 2VL9A 1TI1A 4HU9A 4JBBA 1B4QA 1Y25A 3GH6A 4IQ1A 4JR6A 1OC3A 1GULA 3VWXA 3QDNA 1GSQA 4NPBA 1THXA 2R6KA 6GSSA 3EU4A 1GTAA 2DIYA 3IBHA 3HZ8A 1K0AA 4JEDA 3UCSC 4IW9A 5HFGA 3DWVA 4HI7A 4PNFA 2EJ7A 2A2PA 2YWIA 4MF6A 2G2QA 3HJPA 2NTOA 2CVDA 2H1BA 4PURA 3IA1A 3BBYA 5ECSA 2PPTA 4PUAA 5JWQB 4BVXA 1PA3A 3W8JA 1F9MA 4J57E 1TKDB 2XPDA 4HZ4A 1PRXA 3HDCA 1SL2B 4OO5A 2BJXA 3BD2A 2VM1A 3SWLA 2E2MA 3V1WA 2JZTA 2MMOA 3BOAA 2GSRA 2R2JA 3UO3A 3KIJA 2GVPA 3FEUA 1TOFA 1KNGA 3KTBA 5E4WA 1BAYA 2VL2C 3FR3A 2E7PA 2IMKA 1EV4A 4TOPA 3BCIA 2K8SA 4FH8A 3EC3A 2HXKA 12GSA 4JE1A 4O5RA 2IL3A 5CRWA 4L0WA 4TN8A 4L0UA 4XRDA 1T7PB 4XS6A 3UAPA 2XBIA 4Z2RA 1K3YA 1EOHA 5F06A 3IRAA 4J80A 5ECQB 2F8AA 4D73A 5JCUA 2VO4A 1AAZA 4G9HA 4NMUA 5IMCA 3LQ7A 3EWLA 2CTPA 1F2EA 4KAEA 1XW6A 4ILFA 2YJ7A 2B5XA 2KQXA 2IIYA 4BVYB 4HOJA 3I9V2 5JCGA 3VFIA 3VURA 1G7EA 4BL7A 3VI5A 4K1FA 4OMVA 3W8SA 1YEPA 2XPEA 5EPFA 3G9BA 2YS8A 2D2ZA 3DKSA 1M99A 3O6TA 3E9JB 1XWBA 5F05A 3TJBA 4IJ3A 4KB3A 3DVXA 5AIXA 1JZDA 1O8XA 5AIVA 4BA7A 2HT9A 4IKHA 5IMDA 1A23A 1FHEA 3CSIA 2A2SA 5D73A 2I9HA 4PX1A 1O81A 3QMXA 17GSA 3QD9A 2C0GA 4G0IA 4GF0A 1X5EA 1MDKA 2N5BA 2H0HA 4N30A 4OD7A 6GSWA 5G2ZA 1T00A 4K6XA 2NVLA 1K0CA 3KGKA 1ZYEA 2JSZA 5HR0A 2V32A 2C3NA