3APOA

Crystal structure of full-length erdj5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
746
structure length
688
Chain Sequence
FYSLLGVSKTASSREIRQAFKKNRAYEVLKDEDLRKKYDKYYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELSTGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGNDPELKKLKTLLKNEHIQVVRFDCSSAPGICSDLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWSPPSRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWSHPSQVLMPEWKRMARTLTGLINVGSVDCGQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWSGPSQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords DnaJ homolog subfamily C member 10
total genus 198
structure length 688
sequence length 746
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA07
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA06
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA05
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA04
4IP6A 2VD0A 3US3A 4O7HA 3TJGA 1M99A 4POLA 3GRXA 4XRDA 1YEPA 3F8UA 1W4VA 1M9BA 4PX1A 2MMOA 3ZVJD 2LRCA 2B5EA 2IFQA 4LL1B 1U3AA 2GQMA 1S3AA 1PKZA 5DQYA 1S3DA 3UIWA 3LYKA 2CVDA 4IQ1A 4ECIA 4GTUA 1XWCA 1AAZA 4GLTA 4FO5A 5J9BA 4XS1A 2WFCA 4HJMA 2IFQB 2NVLA 2QWOB 4L5OA 2TRXA 1TU8A 3LEFA 3R2QA 1B4PA 3PINA 4JR6A 4ZB6A 1WE0A 3D4MA 4K7NA 1HD2A 2GDRA 2L59A 2LUSA 5EY6A 4H86A 5ECSA 3DRNA 2CAQA 4TW5A 1BX9A 1B9YC 1ZMAA 5CP1A 2DJ0A 3P2AA 3HKRA 4Z7XA 11GSA 3MDKA 3KH7A 4IVFA 3ZIVA 3G7YA 4HU7A 3A2VA 4JEDA 1TI3A 1KTEA 1TU7A 2AAWA 3UO3A 5AIXA 3DGQA 2C4JA 3TB2A 4N0VA 2E2GA 2VO4A 2IN3A 2TIRA 2E2MA 3EU3A 1PSQA 1SJIA 3BJ5A 3D21A 4RQRA 5FWGA 2FWHA 3UBKA 3GKXA 1N8JA 3TJBA 2K18A 4GCIA 5FT3A 2H19A 1X9MB 5D9XA 2BMXA 2WRTA 2I3YA 1HNCA 2V1MA 2VCQA 1C72A 5IIZA 4PQIA 4WBJA 5DBQA 1DE2A 1XW5A 4YQUA 3FY7A 5D93A 3EINA 1PL2A 1Z9HA 3TDGA 3APOA 1T3BA 3QAVA 1SL0B 2EC4A 2H30A 4FYBA 1ILOA 3VFIA 2QWPB 3A3TA 1SJZA 4JR4A 2O87A 1GSEA 2VOCA 3D22A 1THOA 2P0GA 4CW9A 4IJIA 1XBSA 1AC1A 2H01A 1T7PB 3RBTA 2O89A 1TDIA 4RWUA 5IM9A 2KP1A 2GZPA 3TKSC 2BJXA 1XOAA 5J41A 1BQ7A 1DBYA 3LGCA 2L6DA 2IMIA 3AY8A 3IHQA 2JADA 3GN3A 2WDUA 3TJFA 4ML1A 3VPQA 3VWVA 2KUCA 3PGTA 5JWRB 1MDJA 5L71A 3NOFA 5DJMA 2WJUA 2YCDA 1GUMA 3OR5A 2CT6A 3WD6A 1TTZA 3EVIA 2YV7A 2O8VB 2VLTA 3QOUA 5IMVA 3A2WA 1OE7A 2N5BA 4MZWA 1K0OA 3Q6OA 2FLSA 3FZAA 5ABRA 3KJYA 5HFGA 3MSZA 3FKFA 2OE1A 3FYGA 3E0UA 13GSA 2LO1A 4IN0A 2ON5A 1WMJA 4GSNA 4F9ZA 2CTPA 14GSA 2VCVA 4IT5A 1V58A 2H66A 1M2AA 2XC2A 3TUEA 1SD8A 4ZL9A 3GTUB 3ZLPA 2FGXA 1G7EA 2J23A 1Y25A 3W8JA 4K7IA 2RUFA 1KNGA 3C8EA 1O6JA 5JCGA 1M2BA 2DMMA 5DAKB 1X9SB 2L4CA 1RW1A 4IKHA 3UVTA 5KN1A 2LQQA 4G9HA 3KMNA 2LKUA 1K0DA 3IPZA 4HOJA 2HSHA 2XHFA 1TRSA 1V9WA 3Q18A 5G2ZA 1FAAA 5E59A 4ZILA 3LQ7A 4OFMA 2NTOA 1SU9A 3HJOA 1PRXA 4PUAA 4L5LA 2OE3A 1QK8A 2DC5A 2HZFA 2JACA 5AN1A 3M3MA 4ECJA 4TRXA 1Q4JA 4J7ZA 1GLQA 3HY2A 2HZEA 4MF5A 5B7CA 5C00A 4J80A 1G0TA 1JZRA 2VCTA 4K6XA 4MH3A 1V57A 5DCHA 4XCSA 1VF3A 1AQWA 2G2QA 4TXOB 4MJAA 2ALBA 3U6VA 2GS3A 1BEDA 1B4QA 3HZ8A 2B1KA 1M2DA 2PBJA 5ECLB 4OCEA 18GSA 2C8UA 2VM1A 4D73A 1EOHA 5KN0A 4TXOA 1RQMA 3BBYA 4OO5A 4Q5RA 2H76A 1ZCPA 4GF0A 2NDOA 5IQYA 1LU4A 1V40A 4D73B 7GSSA 1FHEA 4ZB9A 2JU5A 3GFKA 1EP7A 4NXIA 1WPIA 1FAFA 3M8NA 2F3MA 3ZTLA 3KM6A 5IMCA 1HNAA 3VPTA 5INYA 2CVBA 4K7OA 20GSA 3L4NA 2PPTA 1O8XA 4ECCA 4E8EA 1TK5B 3N9JA 4J57E 3IXRA 2RUEA 3HD5A 1GH2A 2IPAA 1JLVA 3FW2A 3VWXA 1OC9B 4MK3A 3MNGA 2L4QA 5A4UA 2XBQA 2H70A 2GLRA 3QCPA 3C7MA 3BVOA 1TI1A 1YQ1A 3ZFBA 4HQSA 4KB3A 5D9VA 1Z3EA 4RI7A 1O8WA 2F9SA 1VF1A 4IGJA 4V2MA 2IMEA 1G6WA 2GUZA 9GSSA 1XWBA 5KN3A 3IK7A 4BA7A 3WGXA 4G2EA 3VI7A 3CXGA 3ME7A 2E0QA 1K0BA 5ECNB 3HJPA 4WF4A 5COHA 2Z9SA 4Q5NA 2YOIA 1R5AA 5D73A 2QSIA 1F2EA 1T00A 3H8QA 3MAKA 2GUZB 4PNGA 3S9FA 1H4OA 5GZZB 2FA4A 4IJ3A 6GSXA 1AW9A 1I9DA 3CBUA 3P8WA 5IPGA 2LRTA 4ACSA 4HZ2A 1GP1A 3TGZA 1F6MC 1USBA 2H0IA 2PF4E 2H0GA 2YN1A 3LXZA 2V6KA 4XTSA 2H74A 12GSA 4IS0A 4EUYA 1XWGA 2IMDA 4JE1A 4GXZA 2HT9A 3TOTA 1DUGA 3C73A 1PD21 5DALA 4ZB8A 3GX0A 3H93A 2YZHA 2XBIA 1A2LA 1WP0A 2PMTA 5ELAA 1MD4A 2H73A 4KX4A 4GSSA 1M9AA 3QAWA 2E7PA 3UARA 4RI6A 4TXVA 4F82A 4PUFC 3APSA 2PGTA 4KCEA 5ECIB 2GSQA 4POBA 4MH2A 4K2DA 3D5JA 3TOUA 4HEA2 3ME8A 4V1Ap 3BOAA 1F9MA 3PH9A 2GGTA 3DMLA 5HR0A 4IP1A 2GZYA 5IMAA 4F0CA 2CV4A 5CRGA 2I4AA 3ZRDA 3ZVJA 2WULA 2OBIA 1M0UA 1BG5A 1HNBA 1ABAA 3LFLA 1WOUA 3L0HA 2QGVA 1X9WB 5F07A 1J9BA 3TKPA 4MPFA 3VLNA 2VL3A 2JL4A 4PQHA 2M6YA 1SK0A 3FZ5A 4O5RA 1GTAA 3ERFA 2MMZA 1HYUA 1Z6MA 4TOPA 4KDXA 4OMVA 4TR1B 4TKYA 2OACA 1KEBA 2F51A 3D0ZA 3ZYWA 1BJXA 1QXHA 5DJLA 1J08A 3E9JB 3F3RA 2YPMA 2AJQB 4V2NA 4KA0A 5D8IA 2ON7A 4MJCA 1ZZYA 2AUVA 4DSRA 2DJKA 3QR6A 1NSWA 2V32A 2YZUA 3IV4A 2H72A 4IQAA 1GH6A 3F0IA 4WF5A 5ECPB 3GKNA 5LNKe 1X5CA 5ECKB 4JRRA 2VL9A 5CRDA 2G0FA 3ZMLA 1PL1A 2XPEA 1TW9A 1YDKA 3UEMA 17GSA 1YZXA 2YNXA 3L78A 2YV9A 3UVHA 5A5KA 2WCIA 1LJRA 3QFAC 5HR3A 3PR8A 4MCUA 2LJKA 2FY6A 1T4ZA 3ED3A 2R2JA 4EE0A 2LJAA 2OKAA 2MMNA 3EC3A 3CSIA 3GH6A 2A2SA 1ML6A 1OKTA 1EV4A 2KQXA 1GLPA 2DJ3A 4XRAA 2OADA 2JZRA 4MF7A 3QFBC 5ECHB 1NHOA 1GUKA 3M1GA 16GSA 2VUPA 4QQ7A 1NZ6A 3WT1A 19GSA 2N04A 1QGVA 2CZ3A 1GSFA 1Q98A 5DCGA 2P31A 4J2FA 3QAGA 4ZL8A 1B48A 1JLWA 5H5SA 3ZFLA 2CX3A 1FVKA 3GH9A 1BQZA 3JCML 4HJ2A 3TJJA 3KTLA 2KP2A 3L9UA 1FB6A 1Z6NA 5HFIA 4GSTA 3I6AA 2FNOA 3KZQA 1JFUA 4OO4A 4XIHA 1PA3A 1YF0A 5EVOA 1QUWA 4TR0A 2IMKA 5H5QA 2LQOA 1NM3A 3QMXA 2HSYA 2FWFA 1U87A 2IL3A 4QL7A 2YWIA 3UMAA 1YF1A 4POMA 2X64A 2HRFA 3RAZA 4V1Ag 4IW9A 5F8BA 1Z5YE 2PWJA 3D4TA 5IOXA 3AG7A 1A24A 3GV1A 1X5EA 3I9V2 4KGIA 1T8EB 2B3SA 1YY7A 1F37A 5EPFA 4BWSA 2ZNMA 2N5AA 1OKDA 3DVXA 5KEJA 3TJKA 2JZSA 2DIZA 3FZ4A 1A8LA 2YWMA 5J5NA 3RHBA 1IYIA 3IA1A 5IOWA 1F3AA 1AQVA 2JSYA 4CDOA 2B1LA 5IMZA 2GT6A 1QQ2A 1T1VA 5ECMB 4JBBA 3F6FA 1O85A 1YEXA 2PERA 3KCMA 10GSA 5ECRB 4ID0A 4X1UA 3HVSA 4BL7A 3FR9A 5AGYA 3N5OA 4O32A 3KXOA 4MJBA 4P3YB 4N30A 2I9HA 2DMLA 2IWTA 1JHBA 1H75A 2LNTA 2PU9C 4NPBA 4QL9A 2H1AA 4DSQA 2M72A 4PQ1A 5IPHA 1HDJA 5IMDA 1E2YA 3IK9A 5HR1A 2A2RA 2WGRA 4PGTA 3C1RA 3GMFA 5JCWA 5G1LA 1GSSA 4HI7A 3DEXA 3QDNA 3TKSA 1BQ0A 1OYJA 2D2ZA 1EGRA 1TP9A 2K6VA 4N0ZA 3Q74A 1K3YA 2OA7A 3KD0A 4AJ8A 2M46A 4ZBBA 3GIXA 2JSZA 3ISOA 2DIYA 3ERGA 4OFNA 1PGTA 2R5GA 4FYCA 3H4KA 3HHVA 2R3XA 4CHSA 2MBTA 3UOMA 3HVVA 2HNLA 3KEBA 1YKAA 3K8NA 1XIYA 2H71A 5LD0A 4L0UA 2Y4UA 4HDEA 3IR4A 3LWAA 4POKA 1Z7PA 1OVNA 2GQKA 3EE2A 3SBCA 5ID2A 4E8HA 2YWNA 3VI5A 5G5EA 3HVXA 3GTUA 3UCSC 1A0RP 4MDCA 4KSMA 2EIOA 5AIVA 1W89A 3VWWA 1EEMA 3ZL5A 3GKMA 5CAXA 4EO3A 1FB0A 5DAKA 2L5OA 1GSDA 3O3TA 5ID2B 4EL1A 3ZREA 1PQNA 4KDUA 3ZITA 2QWNB 2DLXA 2CZ2A 3A5WA 4LMWA 2FHEA 4XS4B 2V2GA 4AF2A 4MF6A 2K8VA 1XFLA 2B7KA 3SWLA 3CSHA 3RDWA 2C1YA 4NV5A 2TRCP 1MEKA 3O6TA 3NIVA 1X0RA 1DSBA 3L9VA 3F63A 4JZQA 4KDYA 4Q5QA 1A0FA 5B6MA 3UBLA 6GSSA 4ZBDA 2LRNA 3LSZA 1I5GA 2B5XA 2REMA 2I1UA 4MMMA 1WWJA 2PVQA 1JZWA 1UA5A 1TRUA 1TK0B 2L6CA 2X8GA 1SL2B 2FWGA 2H0HA 2HE3A 3KMOA 3GX8A 2KOKA 4L8EA 3I69A 3TKSE 3BCIA 1R5PA 4WEYA 1K3OA 3LORA 4EDYA 3KP8A 4YAVA 2YWOA 4HZ4A 4ULXA 4HS1A 1TJDA 2IIYA 2RIIA 3C71A 3G7JA 4MZCA 1GRXA 2GQLA 2QWQB 4X0XA 1A2MA 3FEUA 5D96A 3LG6A 3TRXA 4F2IA 2C80A 3G7IA 3F6DA 3GURA 4K9ZA 1NHYA 2HYXA 3GSTA 4LA1A 4PNFA 4I2TA 1MTCA 2LNSA 3F4SA 3IRAA 1A23A 1TRWA 1ZYQB 1O7UA 5GAPD 1K0AA 1PN9A 2X8CA 1CQGA 1MD3A 3NZNA 1EOGA 2WS2A 2B5YA 3CSJA 1YKCA 2K9FA 4TVEA 1SJ6A 1OE8A 2GVPA 1ON4A 2X99A 2MBSA 2L6LA 2VLUA 1A8YA 1Y6EA 2WB9A 3M0FA 2LJRA 1BAYA 5DQSA 4EXJA 3F4RA 1ERWA 1XVQA 5H5RA 2MZCA 5J3RA 2QKEA 5GSTA 3TRQA 22GSA 2GSTA 2VCWA 1DE1A 5J9CA 4YQVA 2YS8A 1RK4A 1O73A 2C3NA 1IURA 1GULA 3GL3A 1AUCA 5CRWA 2EJ7A 5ELGA 3D6IA 3J7Yb 5CREA 1UVZA 1ST9A 2HRNA 3QD9A 5CO3A 4RQXA 2GTUA 2P5RA 4OCFA 1OC9A 2N05A 2C3QA 1Z7RA 1URMA 1U88A 4ECBA 2XPDA 1FW1A 2C3TA 5G1KA 1WJKA 2H6XA 2LSTA 1EV9A 2GZZA 4PURA 4AJ7A 1JZDA 1PX7A 3CRTA 4NAXA 1S3CA 2N5FA 2VL2C 2X8HA 3GL5A 2H1GA 2VIMA 2Y4TA 3HJMA 4RUVA 1SD9A 3QPMA 1WJZA 1MDKA 1EEJA 3GUSA 1PMTA 5D9WA 2GT5A 2AHEA 1UC7A 2AB6A 2C0EA 2K8SA 3VURA 3HCZA 4MJEA 2H6ZA 3VWUA 1F3BA 2C0DA 2FUG2 3RPNA 2H6YA 4EDZA 2ES7A 2YJ7A 5JWOB 4MP4A 4GQFA 2RLIA 1XW6A 3EMXA 2DJ1A 1GWCA 2VM2A 1R26A 1VF2A 4NV2A 3CTFA 1GL8A 4AGSA 4IBPA 4ZXGA 5GSSA 2BTOT 2HLSA 3TRPA 2OJLA 5DDLA 5DALB 3DIEA 4NHZA 1WRYA 6GSWA 1FO5A 4OFTA 1SK1A 3DKSA 3TKRA 3KP9A 1QMVA 6GSUA 2CTQA 1A2JA 1GSYA 4TN8A 1J0FA 1ERVA 5EL8A 2CTWA 1M7TA 1CQHA 3M9JA 4ZIJA 2OE0A 4K0GA 1GTUA 2RM5A 1OC8A 3EU4A 2M80A 3MWHA 4GRFA 5G31A 4K0NA 3DVWA 4ISDA 1B9XC 2EIRA 4NHWA 4ZL7A 2F8FA 3UL3A 4MPGA 1XPVA 1ZL9A 1R4WA 3FHKA 4F03A 3TKQA 4YQMA 4LMVA 4IELA 3W6GA 2KHPA 3ERWA 1E6BA 4I2UA 2DN9A 2H1BA 4BWQA 3IOSA 5B8BA 2VL2A 2KLXA 1K0NA 1FPOA 1K3LA 1OAZA 4HUAA 2DJ2A 4TR1A 1FG4A 2O7KA 4I5QA 3CTGA 6GSYA 2H75A 2WZ9A 2GSSA 3KTBA 3HYPA 3GSSA 2OCHA 3WT2A 2PN8A 3CMIA 3GHAA 4EVMA 3IE3A 1TK8B 3IDVA 2L5LA 4G10A 4O92A 5F05A 4ML6A 5AISA 1XCCA 3EURA 1IYHA 1V98A 5DVBA 2LGWA 2GSRA 3GYKA 3UO2A 3HZ4A 2H1DA 2I81A 2HZEB 4EC0A 1ZYEA 5GAND 3IAM2 1GUHA 2LV3A 3LXTA 3WGEA 3L9SA 1PX6A 3RPPA 4J56E 5KN2A 2DSAA 4I8BA 2PVOC 4JU5A 2VD1A 1GTIA 3DYRA 4KE3A 1PKWA 2ZUPA 5E4WA 3J7Yk 2QC7A 2J9HA 5ECQB 2MYGA 1XWKA 1AIUA 4AJ6A 4NWYA 3V1WA 4MZBA 2MMAA 3HXSA 3H79A 5A4WA 3KIJA 2NBSA 4BVYA 4WKWA 5JWQB 4N11A 4KCAA 2LEGA 4HU9A 3IAS2 3ZZXA 2FWEA 1FVJA 4WETA 1EGOA 5ECOB 1GNEA 2HI7A 1EWXA 3M9KA 1MDIA 2QWRB 2YJHA 1XZOA 1GNWA 1U6TA 1K0CA 4MLYA 2B6MA 2H8LA 1K0MA 4LL4B 1O81A 1X5DA 1XOBA 4I6XA 3F9UA 4YH2A 1SK2A 1QFNA 4Q5FA 4KH7A 3IC4A 3LYPA 5G30A 2C0FA 5IO0A 1AQXA 1XWAA 2IJYA 3DD3A 5IMFA 2A4VA 5ENUA 2AV4A 4BVXA 5IO2A 1SYXA 2OBKA 3GA4A 3I43A 4PXOA 5CRHA 5JCUA 4GQCA 5HFKA 5G5FA 3UAPA 3FR3A 5J4UA 1ERTA 2ZCTA 1XBLA 8GSSA 1GTBA 2P5QA 3CYNA 4HQZA 5B8AA 2FA8A 3BCKA 4XHMA 1HQOA 3APQA 3KGKA 3W8SA 3BD2A 3O76A 3Q19A 3A2XA 1TRVA 1R7HA 2VCZA 4LLRA 1SYRA 3P7XA 2VCXA 1XXUA 2YANA 2HFDA 1EZKA 3H1NA 1N2AA 3F4TA 2AYTA 4KNDA 3GNJA 3HA9A 1G7OA 3IBHA 2DBCA 3DXBA 4FIWA 4K1FA 4DSSB 5FHIA 2FCHA 2C0GA 4WXTA 2CUGA 5C04A 3F3QA 2IMFA 3P90A 4OWYA 4G19A 1V2AA 5D9TA 4OD7A 2YUAA 2CTRA 1UN2A 2V6OA 4N10A 4WR4A 4WR5A 4MABA 3ZIJA 1VF4A 1T4YA 3FZ9A 4DSSA 3EWLA 1SENA 4ILFA 2R6KA 2QSAA 4EKZA 3HDCA 5CYYA 4DVCA 2VAFA 1LBKA 3EMPA 4EF0A 3GKKA 4BPYA 2VLVA 6GSVA 1VRSD 4KUNA 3KH9A 1GSQA 1GSUA 2DMXA 2LTKA 2V41A 4KSOA 4F0BA 1AXDA 4IHUA 5CNWA 1SKRB 6GSTA 2CX4A 2JZTA 1YJ6A 1ZOFA 5F0GA 3G9BA 2HXKA 2R4VA 3TCOA 4ZBAA 1WIKA 4YAPA 4FYUA 4NMUA 2LS5A 3WYWA 2R37A 1NW2A 1TKDB 1XW9A 4DEJA 4I97A 5B6NA 4X43A 5A4VA 4KAEA 2PUKC 1OC3A 3WGDA 3LJRA 2L57A 2B7JA 2YP6A 4TR3A 1U3IA 4K8MA 1B8XA 2O85A 2CQ9A 4MA9A 4WBRD 2EIQA 3U5RE 4FH8A 1TXXA 1KBNA 5HQPA 1JZOA 2CA8A 5HR2A 1G6YA 3FK8A 1VGLA 3FR6A 1THXA 1ZGNA 1XVWA 2NPBA 2CAIA 1TOFA 3RHCA 1N4CA 2RM6A 4XS6A 3ZMKA 5LCZA 1SKWB 1SL1B 4TR4A 4KW6A 3UJ1A 4XS4A 4L0WA 1ERUA 3EYTA 2CVKA 5F06A 1FOVA 1SKSB 1ACVA 2FD3A 3C1SA 3VK9A 3DWVA 1BYEA 3E3EA 4GWRA 2F8AA 2DJJA 4V2LA 3CRUA 1EP8A 3FRCA
chains in the Genus database with same CATH superfamily
4IP6A 1JPXA 4A5UB 2VD0A 1THZA 3US3A 4XDKA 5H6RA 1G1XB 3LW9A 3M7MX 4O7HA 1N33B 3TJGA 1XDCA 1YDXA 4HAMA 1M99A 4DV3O 4POLA 3GRXA 4XRDA 1YEPA 1AROP 1AI7A 3F8UA 1W4VA 2PYLA 3BABA 5EIBD 4MVSA 1M9BA 1BL8A 4PX1A 2MMOA 3ZVJD 4DV0O 2LRCA 4FPPA 2EINB 2B5EA 2IFQA 4LL1B 4JYYA 1U3AA 3TJTA 3AG1C 2GQMA 1S3AA 3T1HO 1PKZA 2HP8A 4LNUB 2Q0OC 4NR1A 5DQYA 1L1FA 4DR3O 1S3DA 3UIWA 4OPAA 3LYKA 2CVDA 1RPRA 5CBHA 3SPCA 1F23A 4IQ1A 4ECIA 2RDCA 4GTUA 1XWCA 3CCEV 3UM7A 3E2EA 1K73W 1AAZA 4GLTA 4FO5A 5J9BA 4FVMA 4XS1A 2IJKA 4PA3A 2P7TC 4L87A 2WFCA 5J2UB 2BTOA 3OEHG 1K97A 3KCXA 3RBZA 4HJMA 2LFRA 2E5LB 1FKAO 3GWKC 2XNDG 2IFQB 2NVLA 2QWOB 4L5OA 2TRXA 1TU8A 1BHBA 3LEFA 3R2QA 4K8XA 4HZ3A 1B4PA 1JR9A 3PINA 4JR6A 4ZB6A 2K9PA 1WE0A 1TVKA 3D4MA 1MNGA 3CCQV 4K7NA 3E22B 1HD2A 2GDRA 1YJWV 2L59A 2LUSA 5GW7A 4ZKIA 3QNEA 2B1IA 5EY6A 4H86A 5LP6C 5ECSA 3GVMA 4LH7A 1V55B 2CAQA 3DRNA 4J9ZB 4LFAB 1BX9A 4TW5A 1UPGA 2IH1C 3MHSC 1B9YC 1ZMAA 4Q20A 5CP1A 1OCCB 2DJ0A 3P2AA 1NBMG 3HKRA 3QVNA 4FZ1A 1WP8A 4Z7XA 11GSA 3MDKA 3KH7A 4IVFA 3ZIVA 4TQDA 2BOCC 3G7YA 1H2KA 4HU7A 3A2VA 4JEDA 1TI3A 2ITCC 2YICA 2ATKC 3AG1B 1KTEA 1TU7A 3ASNC 2AAWA 4X20B 3UO3A 1TUBA 5AIXA 3DGQA 2C4JA 3TB2A 1TVKB 3ZRSA 2E2GA 2VO4A 4N0VA 1KQSU 2IN3A 3E22A 2TIRA 5KOXA 2L35A 2E2MA 3EU3A 1PSQA 4G28B 4O4JA 3K5MA 1DK1A 1XMQO 3THOA 1SJIA 1NH2D 3BJ5A 1YHQV 3D21A 2Z0AA 4JI3O 1L0LH 4RQRA 1FD9A 5KA5A 3RW0A 5FWGA 2FWHA 4P30A 3UBKA 1I0HA 4X65O 4WFGA 3G6EV 1XHZA 3HKBB 2P90A 3JALB 3GKXA 2WLKA 1N8JA 3CRRA 3TJBA 2K18A 3N2GA 2Q73A 2ADPA 4NTYA 4DV4O 4GCIA 5LHHA 5FT3A 2CDYA 2H19A 4X20A 1X9MB 1TUBB 5LMUB 5D9XA 2BMXA 1G8MA 4DR1O 5L3EA 4W4KA 2WRTA 3D3IA 2I3YA 2HRAA 1HNCA 4O4JB 2V1MA 2ZE7A 4AI8A 2VCQA 1C72A 2JGUA 5IIZA 4PQIA 4WBJA 5DBQA 1DE2A 1XW5A 5L3GA 4YQUA 2UUBO 1P7GA 3FY7A 5D93A 2R9IA 3EINA 1PL2A 3JALA 1Z9HA 3MIXA 3TDGA 2O57A 3APOA 2KG7B 2MK3A 3VQXA 1T3BA 2XAJA 3QAVA 3AG3C 5H6QA 3JD4A 2XASA 5KOWA 2JK5C 5CA3A 1HNZB 1SL0B 1FXHA 3O9OA 2ZE6A 2YI8A 5CB4A 1VQLV 3CE2A 2EC4A 2ZKOA 2H30A 2WLHA 4FYBA 1ILOA 5IJ9B 3ABLB 4BL7B 3VFIA 1K7DA 2QWPB 1V54B 2OYQA 3A3TA 3G71V 4LF7O 2B1GA 1SJZA 4JR4A 4DRXA 1BGYH 4FZ0A 1BMFG 2O87A 3STZC 2QKSA 1GSEA 2VOCA 2KG7A 4LFCB 3D22A 1THOA 2P0GA 2QM7A 4CW9A 4IJIA 1XBSA 1QCEA 1AC1A 3IC9A 3K3WA 2H01A 1T7PB 3RBTA 4PHZA 2O89A 1TDIA 4L8JA 3MHHC 4RWUA 5IM9A 3ZRVA 3K0DA 5CB4B 2KP1A 1QLNA 2GZPA 1FXKA 3TKSC 2BJXA 4DV1O 4NTWA 1XOAA 5J41A 3H1LH 1BQ7A 2DYRB 1DBYA 3LGCA 3ABMB 2L6DA 2WLMA 3RGBA 2IMIA 1KP2A 1VIBA 3AY8A 3IHQA 2JADA 4MVZA 2UXNA 2WDUA 4BAYA 3GN3A 3TJFA 1MZEA 2P67A 3B77A 4ML1A 2DOSA 3ZMSA 5K1PA 3VPQA 1GRJA 3VWVA 3JAWB 2KUCA 2HEPA 3PGTA 5JWRB 1GM9A 2H94A 1MDJA 5L71A 1S3JA 3NOFA 3ZEDA 4EKWA 1A32A 2WJUA 5DJMA 3AG4C 2YCDA 3HB3B 1GUMA 4GYCB 3B8NA 3FYEB 5DEDA 1XMOO 4XDJA 3OR5A 3HKEA 4WFFA 2CT6A 3CCRV 4USSA 5GONB 3WD6A 1TTZA 3EVIA 2YV7A 4X62B 1ZLZA 3K08A 2O8VB 3IFXA 2VLTA 2HKOA 3QOUA 5IMVA 1V54C 4AILC 4RUEA 3W7TA 1OE7A 3A2WA 3KCYA 2N5BA 1GN6A 4MZWA 3SPJA 1AP5A 3E8GA 1K0OA 3Q6OA 1VQPV 4NXNO 2FLSA 3VQWA 3JAWA 3FZAA 5ABRA 5BZBA 3KJYA 3MSZA 5HFGA 1F4MA 1CP9A 3GWOA 1R1BA 3FKFA 2HJDA 3CRAA 3I56V 2OE1A 3FYGA 2ZM6B 1PPJH 1ZX3A 2AGAA 3E0UA 13GSA 2LO1A 4IN0A 2ON5A 1MSWD 1OCRC 5TISZ 4X8AA 3UT5B 1KUQA 1MSDA 1WMJA 4GSNA 4F9ZA 2VWJA 2CTPA 4AHCA 5JCOA 3R65A 2VCVA 4IT5A 14GSA 1V58A 1GTOA 2H66A 1M2AA 2XC2A 3B2EE 4FJCC 4X88A 3TUEA 1SD8A 3W7XA 1SERA 4PI0A 5K1XA 3C3TA 1Q82W 4ZL9A 4X64O 1M9NA 2P6JA 3H1JH 3JD3A 1RPOA 2ETNA 4LF8B 3GTUB 3ZLPA 2FGXA 1VARA 1G7EA 3CRCA 5EBMC 2J23A 1Y25A 3W8JA 4K7IA 3SJQC 2RUFA 1KNGA 3C8EA 1O6JA 5JCGA 2P06A 1OHHG 4DV5B 2QDOA 1M2BA 2DMMA 5DAKB 3RVZA 4RQEA 1X9SB 4TWKA 2L4CA 3SPIA 5LYJA 1RW1A 4IKHA 3UVTA 4PDVA 4UV8A 2UUAB 5KN1A 2LQQA 4G9HA 2GTAA 1HNXO 4UCUA 1JJ2U 3ZS8C 3FFQA 3KMNA 2LKUA 5KUKA 1K0DA 3ZMTA 3IPZA 2ZD9A 4HOJA 2HSHA 2XHFA 4FLTA 3OR6C 1TRSA 1V9WA 3ZN0A 3Q18A 5G2ZA 4JV5B 1FAAA 5E59A 4I55A 2V7QG 2WA3A 3OFNG 4B3TB 4ZILA 4UCTA 3JAKA 3A8TA 3LQ7A 3IC7A 3RYHA 2F1MA 5J9PC 1H2GA 1FJGO 4OFMA 2DE0X 2NTOA 1SU9A 2ZIOA 4F6RA 3HJOA 3VQVA 2VQFB 1PRXA 3MYDA 4PUAA 4L5LA 2OE3A 1QK8A 1R3KC 2DC5A 2LW1A 2HZFA 2JACA 3T1YB 4MTGA 1NKDA 3O65A 4JTAB 4P2ZA 1OCCC 2GHYA 4WCEV 5AN1A 3M3MA 4ECJA 2Y69C 4TRXA 1QVGU 2HG5C 4J7ZA 1GLQA 1Q4JA 3WT2A 1SF9A 4CH6A 2V1DA 4LWSB 3EHBB 4DV2O 4I55B 3HY2A 5ITZB 2HZEA 5IWAB 1GK9A 5L3CA 4MF5A 5B7CA 2PI4A 1YJ9V 5C00A 4JTDB 2YC0A 2HJFC 4J80A 2ODMA 1G0TA 3D3QA 1JZRA 2ZXWC 3OGIB 1VQKV 2VCTA 2VRZA 4K6XA 3H9VA 5IYZA 4ZHQB 4MH3A 1K4CC 1V57A 5HFMA 1FFTB 4NTXA 5DCHA 4XCSA 4DK1A 1VF3A 1GMGA 2JEUA 3W7UA 1M57C 4F4LA 4DUYO 1AQWA 2G2QA 3ZIAG 4TXOB 3BAAA 3QO7A 2ALBA 4MJAA 3U6VA 2GS3A 1BEDA 1SZTA 4EIQA 5JWPA 1B4QA 4PDRA 3CCVV 3HZ8A 4E4EA 4JZ2A 3LDCA 3S3XA 2B1KA 1DTOA 1M2DA 2PBJA 3K9SA 4DV4B 5CMUA 5ECLB 4YJ2A 2JS5A 4OCEA 4BVYB 18GSA 2C8UA 3CJHA 2VM1A 4PA6A 4D73A 3X2QC 2Q67A 1XMQB 1EOHA 1YI2V 1FS0G 5KAFZ 5KN0A 1SRYA 1RQMA 4TXOA 3G4SV 3BFRA 4WF9V 3BBYA 4PELA 2X4AA 4PV1B 4OO5A 4Q5RA 2H76A 2HSMA 1ZCPA 3T4DA 4LCUC 4GF0A 4TQFA 1S3RA 2IU0A 1R73A 2NDOA 1Y4MA 5IQYA 4B3SO 1LU4A 1V40A 4D6TH 3CJHB 3U11A 4D73B 7GSSA 4J42A 1FHEA 2A9HA 4ZB9A 1W59A 2R9RB 2JU5A 1EP7A 3GFKA 4NXIA 1WPIA 1FAFA 3CCSV 2JGDB 3M8NA 4YXWG 2F3MA 2ZIMA 3ZTLA 3OD4A 2Q0AA 3KM6A 5IMCA 3RVYA 1HNAA 4ZI7B 2EZPA 3IGAC 3VPTA 4I50A 5INYA 3JD2A 2IJHA 2Z5UA 4IHJB 5H2FZ 4LF7B 2CVBA 4K7OA 20GSA 3L4NA 1I94B 2PPTA 4CY6A 3OUFA 2A3QA 2VS0A 4KHPB 5E1AC 1O8XA 1VF6C 4ECCA 4E8EA 1TK5B 1AI6A 3N9JA 5IYCO 4J57E 1MG1A 3WFVA 3IXRA 2QA2A 2RUEA 2DKIA 5EBWC 1SQFA 1GH2A 3HD5A 2YIDA 1KYOF 2IPAA 1JLVA 3AG4B 3FW2A 2QTOA 2Q7HA 3VWXA 3RYIA 1OC9B 4MK3A 1Y74A 4G0KA 4ZI7A 3ASNB 3MNGA 2L4QA 3M8AA 5A4UA 3CS5A 2XBQA 5B66Z 1M57B 1V9PA 1IBKO 2GLRA 4JI5B 2H70A 3EPTA 3CMEV 3C7MA 3BVOA 1TI1A 3QCPA 1YQ1A 3ZFBA 4HQSA 4GX1A 4KB3A 1IBMB 5D9VA 4R8CA 4U7NA 2WLIA 1Z3EA 3R3EA 2LFSA 3T4ZA 4RI7A 1O8WA 2HHHB 4G0LA 4Z2RA 1ZUQA 2NLJC 4CS2A 4WBNA 3NXSA 2F9SA 1VF1A 1N33O 5KA6A 1KD1W 4IGJA 4V2MA 1SQXH 3E8FA 2IMEA 1G6WA 1K92A 2GUZA 9GSSA 1XWBA 5KN3A 2Q5ZA 3IK7A 4BA7A 1GM7A 3WGXA 4G2EA 1OCOB 3VI7A 4LF5O 3QTCA 3RN4A 1P49A 2LJ2A 1E1QG 3CXHF 4JYBA 3CXGA 2ZM6O 3ME7A 3TXQA 4UFZA 4WFAV 2E0QA 1K0BA 2Y0PA 3BHPA 1X4TA 3A0HZ 2WLIB 5KX5A 3K0GA 2UU9O 3SJCC 5ECNB 1L0NH 3HJPA 4WF4A 4NXNB 5COHA 2Z9SA 4Q5NA 1OV9A 2YOIA 3TXSA 1R5AA 2EILB 5D73A 2QSIA 1F2EA 4OPHA 3RYFB 3H1IH 2PI5A 4CBCA 1N0JA 4LF5B 1T00A 2Y48A 3H8QA 4TUYB 3MAKA 2GUZB 1YJNV 4PNGA 3S9FA 1H4OA 2EILC 5GZZB 2BSKA 5CBGA 2QA4V 2FA4A 4IJ3A 6GSXA 1CPYA 3P3NA 1AW9A 1I9DA 3CBUA 3P8WA 4U3JA 4DR4B 2NN4A 1XMOB 5IPGA 2LRTA 2HHHO 2FTKA 4ACSA 4HZ2A 1M3JA 2NNUA 1GP1A 3TGZA 1F6MC 4KUMA 1USBA 2PF4E 2H0IA 1PP9H 5KX5B 4PD4F 2H0GA 2QR4A 2YN1A 2Q7EA 2UXDB 3LXZA 2V6KA 4O4HB 5LGNA 2XT9A 4XTSA 2H74A 12GSA 1NQTA 1N34O 4IS0A 4EUYA 1XWGA 2IMDA 4JE1A 2ZE8A 1ZYPA 5FL7G 2YI9A 4GXZA 5BMVB 5B1BB 4DV1B 2HT9A 3TOTA 1XILA 1DUGA 3C73A 1PD21 2BSKB 5DALA 1H2MA 3SYPA 5FPRA 4ZB8A 3GX0A 3H93A 2YZHA 1SQPH 3F7YC 5IT9N 2XBIA 1A2LA 1WP0A 2PMTA 4U3JB 5ELAA 5JVDA 3D36C 1MD4A 2H73A 4B08A 4LR3A 4GSSA 4KX4A 3OM3B 1M9AA 2W0XA 3QAWA 4UB6Z 3OTOB 1SETA 2E7PA 3N2KB 2IJJA 4RI6A 4TXVA 3UARA 4F82A 4PUFC 4X1YA 4FM0A 3APSA 4PDLA 5JJJB 3CD6V 4YY3B 2WPDG 4JYAB 4I7ZB 2GTSA 2PGTA 4KCEA 1EM1A 5ECIB 2GSQA 1MABG 4POBA 4MH2A 4K2DA 1H8HG 5H9CA 3D5JA 3TOUA 4HEA2 3ME8A 4V1Ap 3BOAA 1H2NA 4X9QA 1IX9A 1IBLB 1F9MA 2IU3A 3PH9A 2GGTA 3DMLA 1N32B 5JVDB 5HR0A 4IP1A 2GZYA 4UB8Z 5IMAA 2CAZC 4F0CA 2CV4A 5CRGA 2I4AA 3ZRDA 3ZVJA 2WULA 4FFKA 5FNVA 2OBIA 1V55C 1M0UA 2RJZA 4B3SB 1JFFA 1XNRB 4DW1A 1BG5A 1PL0A 1HNBA 2JIZG 1ABAA 3LFLA 1BZKA 1YF2A 2XAGA 4X1YB 1Z2GA 1WOUA 3L0HA 2QGVA 1X9WB 1MOFA 5B3SB 2ZNIA 1G4YB 5F07A 1J9BA 2ZCEA 2EULA 3TKPA 4MPFA 3K5OA 3VLNA 2VL3A 4YKFA 3OMIB 3DTUB 2JL4A 3PN1A 4PQHA 3C3SA 4CH5A 2M6YA 4K2XA 1IDSA 1WB7A 1Z5VA 1SK0A 3FZ5A 4O5RA 4DV6O 1GTAA 3ERFA 2MMZA 2EIJB 1HYUA 3JATA 5DN6G 1I5YA 5AG2A 2UXBB 4NXMO 2PYJA 2WWWA 1Z6MA 1LNQA 4TOPA 4KDXA 4OMVA 1R3JC 5EBLC 4TR1B 4TKYA 3STLC 2OACA 1KEBA 2F51A 4G0IA 3D0ZA 4LF6O 3ZYWA 3TGUH 2EBOA 3QO8A 3RT3C 1BJXA 1QXHA 1J08A 1I08A 4YJ3B 3E9JB 5DJLA 3F3RA 1PKXA 2YPMA 1KU9A 2AJQB 4DUYB 3DXRA 5B1NA 4V2NA 4KA0A 1BSMA 5CBFA 2QE7G 5D8IA 5B3SC 3TCUA 4A5PA 3ASOC 2ON7A 4MJCA 1ZZYA 2AUVA 4DSRA 1EZJA 2DJKA 3QR6A 2WSSG 3L75H 3MDSA 1E1RG 5D5QA 1NSWA 1Y76A 1YTFD 2V32A 2YZUA 3IV4A 2H72A 4IQAA 1XNQB 1GH6A 2LP7A 4LF9O 1SQGA 3F0IA 1K9MW 1D2DA 2HVKC 2UUCB 1T5EA 4WF5A 5ECPB 5IWAO 3GKNA 5LMNO 2YIBD 4FIPC 5LNKe 2W6IG 1X5CA 5ECKB 3QG5A 4JRRA 3A0RA 2VL9A 5CRDA 2CGNA 2G0FA 4YIOA 5D5PA 3ZMLA 1PL1A 4Z1VA 2XPEA 1TW9A 2ZXWB 3ZBHA 3JCUZ 1YDKA 2EZOA 3UEMA 17GSA 5EC1C 3OTOO 1QU7A 2RNBA 1YZXA 3FKSG 2YNXA 3L78A 2YV9A 3UVHA 3B8MA 4R7CA 1DGSA 3OW2U 3H1KH 5A5KA 4OX9O 4IGGA 1FJGB 2WCIA 1XI1A 1LJRA 4LH6A 1NTMH 3L71H 3QFAC 2AHZA 5HR3A 3K5NA 3TETA 3PR8A 2ZINA 4MCUA 2LJKA 4EB6B 4K3AA 1NH2B 2P5OA 4HSCX 1Q86W 2FY6A 3F5TA 1T4ZA 5J2TB 3ED3A 2R2JA 4EE0A 3ETDA 1HNWB 2LJAA 2OKAA 3Q4HB 3I55V 5KUMA 2MMNA 5BRTA 3EC3A 3CSIA 3WG7C 3GH6A 2A2SA 1OCZC 1ML6A 1OKTA 5KHJA 1EV4A 2KQXA 3AK2A 4X1IB 1GLPA 2DJ3A 4XRAA 2OADA 2JZRA 4MF7A 5LP6A 3QFBC 4Z2TA 4FMTA 4DO2A 4DR4O 2IM9A 3W7WA 1F51A 4JI4B 5ECHB 1NHOA 1I7FA 4KFMA 1GUKA 3C90A 3M1GA 1XQ8A 3W7SA 1VQ6V 2QEXV 2OTJV 4EB6A 4BR6A 16GSA 2VUPA 4QQ7A 1NZ6A 3WT1A 19GSA 2Q68A 2N04A 5JJNB 1QGVA 4FFBA 1RM1C 2CZ3A 1GSFA 1NTZH 3Q4HA 1Q98A 5DCGA 2P31A 4J2FA 2R70A 3QAGA 4ZL8A 4X1IA 5BR8B 1B48A 1JLWA 5H5SA 2GDSA 3ZFLA 2CX3A 4BVXB 1FVKA 5LP6B 3GH9A 1BQZA 3JCML 4HJ2A 2D2CB 4O2AA 1CEZA 5DECA 4B7EA 3TJJA 3SJBC 4DXWA 4GKJO 2KP2A 3KTLA 3L9UA 4DV7B 4GKJB 1FB6A 1DF5A 1Z6NA 5HFIA 1XREA 4GSTA 1AR1B 2EIJC 3I6AA 1B06A 3BEHA 4E2LA 2FNOA 3DGEA 4PDMA 3KZQA 1JFUA 4OO4A 1Q90D 4XIHA 3RWRD 2AW9A 1PA3A 2HR3A 1YF0A 4K0KB 5EVOA 5LGTA 1QUWA 2WLJA 2IMKA 4TR0A 5H5QA 4FLXA 4RQFA 1VF6A 2LQOA 1NM3A 3QMXA 2HSYA 2FWFA 1U87A 2IL3A 4QL7A 2OT5A 1G6UA 4O2AB 4FM1A 4JI5O 2YWIA 3HKCB 4LFBB 3UMAA 2IW5A 2P4VA 1YF1A 4POMA 2UXXA 1DF4A 1YTFB 2X64A 2HRFA 1RSOA 3RAZA 4V1Ag 4IW9A 1GN3A 3ETEA 5F8BA 4JI7B 1Z5YE 2PWJA 3D4TA 1JMKC 4QIWF 4DR5B 3DSQA 1VQ8V 5IOXA 3AG7A 1J5EB 3LSUA 1A24A 3GV1A 1X5EA 3I9V2 4KGIA 1KB9F 1T8EB 2B3SA 3K04A 4KXRA 4KHPO 1HNWO 3MAQA 1YY7A 5L3FA 5IY5B 1F37A 1I94O 5EPFA 3L70H 1SA0B 3ZMVA 2UXCO 2ZNMA 4BWSA 1AB3A 3B4SA 2N5AA 3CHXA 1OKDA 3WU2Z 2EIMB 3DVXA 1R3IC 2E3CA 4OGQB 5KEJA 3HKCA 2A7WA 3TJKA 2JZSA 1ZL8B 2DIZA 5JCOC 3G6BA 3FZ4A 2X6CA 1A8LA 2YWMA 5J5NA 4P9PA 3RHBA 1IYIA 4AQYO 1PV0A 3IA1A 3PPUA 2JDIG 4W4LA 5HFLA 2OCCB 5IOWA 1F3AA 1AQVA 4UCVA 2JSYA 4CDOA 1Q6HA 2B1LA 5IMZA 2CGOA 2GT6A 2YEVB 1QQ2A 4XBFA 1T1VA 5ECMB 5CN0A 4JBBA 3F6FA 1O85A 1I5XA 1YEXA 5IJ9A 2PERA 3KCMA 4TV9A 1GN2A 1N36B 10GSA 5ECRB 1DLBA 4ID0A 4X1UA 3HVSA 4BL7A 3FR9A 5AGYA 3N5OA 4O32A 3KXOA 4MJBA 1J95A 4P3YB 4Q6GA 1KECA 1SA0A 3BPZA 3SYAA 4N30A 4JI6O 4DR7B 2I9HA 2DMLA 4UCRA 1K5SA 4DRXB 2IWTA 1JHBA 1H75A 2LNTA 1QLEC 2PU9C 1ZL8A 2PUSA 4EFBA 2VQEO 4NPBA 4QL9A 3OUSA 2H1AA 3NR7A 4EEQA 4FQUA 1KKDA 4DSQA 3E86A 2M72A 4LF9B 4PQ1A 4JI7O 1FXVA 5IPHA 1ZTEA 3JSNA 1HDJA 3OMAB 3KZIZ 5IMDA 1H38A 2ZR2A 1D5AA 2YEVA 1E2YA 3EVKA 3DC5A 2A2RA 2WGRA 3IK9A 4MTFA 4FLZA 5HR1A 5LA6A 3ML0A 4BWAA 4TV9B 4PGTA 1XHXA 1OZ0A 3K79A 3EXAA 3C1RA 3GMFA 5JCWA 5G1LA 1GSSA 4HI7A 3CQFA 3AK3A 4OXSA 3WB0A 1GKFA 1S5JA 3DEXA 4YIPA 4QPJA 1FXKC 3I5DA 3WB1A 3QDNA 3TKSA 3AG3B 1BQ0A 1OYJA 2D2ZA 2XAHA 2DWDC 1EGRA 2RMKB 1URFA 1F7YA 3SYOA 1TP9A 1M93A 4FK5C 2K6VA 4N0ZA 3Q74A 1K3YA 2OA7A 4YKGA 1RM1B 3ZRWA 4PA7A 2EIMC 3WB2A 3KD0A 4AJ8A 3F7VC 2D3OW 1JQ0A 2B5UA 3CC2V 5LA6B 2XHBA 2M46A 1YZBA 4ZBBA 5IY5C 3CX5F 3AEIA 1JJOA 3GIXA 2JSZA 3HKDB 1Q7YW 3ISOA 2DIYA 4PA4A 3ERGA 4OFNA 1PGTA 2MW2B 2R5GA 5KHGA 4FYCA 4FM2A 2NR5A 5CA0B 3H4KA 3HHVA 5BMUA 2R3XA 4CHSA 3TK1A 1AI4A 1SS3A 3L74H 4BW5A 3CCMV 2MBTA 2JRIA 3UOMA 2VQEB 3HVVA 2HNLA 3E83A 3KEBA 3ZHVA 1HR0B 2DW4A 1YKAA 3K8NA 1XIYA 2H71A 2Q7GA 2JEXA 4TT3G 4DV2B 5LD0A 4L0UA 4I4TA 4ZOLA 2Y4UA 4HDEA 3A2FA 3ZRWB 3ZHSA 5EYPB 1FOHA 4J7KA 1XUQA 3IR4A 2HVJC 3LWAA 4IYIA 3ASOB 1MZFA 1OVNA 1Z7PA 2GQKA 4POKA 3EE2A 1L8DA 1P4RA 3SBCA 3UT5A 3HKDA 5ID2A 4E8HA 2YWNA 3VI5A 3CWBH 4U7OA 3OAAG 4GKKB 5CA0A 2H3OA 5LXTA 1NR1A 5G5EA 3HVXA 1VQ9V 3L73H 4UCSA 5IDJA 4JGSA 3OE7G 4JYAO 3GTUA 3UCSC 1A0RP 4MDCA 4KSMA 1WA8B 2EIOA 4CH3A 1VQNV 5AIVA 1W89A 4JI8B 3VWWA 2UXCB 4BIKA 1EEMA 4JYCA 4ZOLB 3JAMN 2E5LO 3ZL5A 3GKMA 5CAXA 4EO3A 2JVDA 3IC8A 1FB0A 5DAKA 2L5OA 3OMNB 4JAVA 1GSDA 5LYJB 3O3TA 5ID2B 1Q6UA 4EL1A 3K06A 1N0NA 3ZREA 1PQNA 4JI2B 4KDUA 4U3FH 3ZITA 2QWNB 2BE3A 2DLXA 2E76B 2CZ2A 3A5WA 4LMWA 3SYQA 2FHEA 4XS4B 2V2GA 5LXTB 1R6KA 1LUWA 2R9AA 4AF2A 1AI5A 4MF6A 4B3MO 2K8VA 1QNMA 3ABTA 1P7BA 1VQOV 4LFBO 1XFLA 2B7KA 3SWLA 4K5SA 1KKCA 3CSHA 3RDWA 2C1YA 4NV5A 2TRCP 1MEKA 3O6TA 3NIVA 3RYHB 1VF5B 2BTQA 3JASA 1Q8IA 1X0RA 3K57A 4F6RB 4O4IB 2GV9A 1DSBA 4R6ZA 3L9VA 3G80A 4NVPA 4JI1B 5KMGB 3F63A 4JZQA 4KDYA 4Q5QA 2UZ8A 3B09A 1A0FA 2A0LA 2P4KA 5B6MA 5L3BA 1QR8A 2EINC 3UBLA 1BT8A 4WFBV 6GSSA 3AG2B 4ZBDA 1UFIA 3ABKC 4LWSA 1I5GA 2LRNA 3LSZA 1X59A 4IIJA 2B5XA 4HYOA 1YIJV 2DYSC 2REMA 2I1UA 4MMMA 2VWKA 1WWJA 4LF6B 4Z2WA 2PVQA 4PI2A 1QBZA 2BTQB 3JASB 3N27A 1JZWA 1UA5A 1TRUA 1TK0B 2L6CA 1S5LZ 2X8GA 1SL2B 1IXBA 2Z3YA 2FWGA 1AR4A 5GTHZ 2H0HA 2OCCC 3P32A 1AILA 5KMGA 2UXBO 2P22C 5IYZB 4JF3A 2HE3A 1SESA 3KMOA 4DUZO 4X62O 3GX8A 2KOKA 4L8EA 3I69A 3TKSE 3BCIA 2Q8VA 1R5PA 4WEYA 5LOVB 1K3OA 3LORA 3KP8A 4EDYA 3CP1A 4YAVA 2YWOA 2H8PC 3P3PA 3ZHRA 4HZ4A 1M5IA 4ULXA 4HS1A 3FX7A 4IIJB 1TJDA 2IIYA 2RIIA 3C71A 1K33A 4GCZA 4X1KA 3G7JA 4MVRA 4MZCA 1GRXA 2GQLA 2QWQB 3CRQA 5J2UA 3DC6A 4X0XA 3BA9A 1KBHA 1A2MA 1W0JG 2ITDC 2R0GA 1SQVH 3FEUA 5D96A 3K03A 3LG6A 4ICGA 3TRXA 4CH4A 4F2IA 5B1AB 3OGCC 4YJ2B 2C80A 3G7IA 3F6DA 3GURA 4H44B 4K9ZA 1NHYA 2HYXA 3GSTA 4LA1A 4PNFA 2CH7B 1RFYA 4I2TA 1MTCA 2LNSA 3F4SA 3IRAA 4ICYA 1A23A 3SJAC 2ZT9B 1TRWA 1ZYQB 5KLVH 1O7UA 2FYUH 1N32O 5LOVA 5GAPD 1WLEA 4GUNA 1K0AA 4X66O 1PN9A 2X8CA 1CQGA 1MD3A 3NZNA 2JJ1G 3HPLC 4LP8A 2LQTA 4GX0A 4GZRB 4NKGB 1SZXA 4X1KB 4YHHB 1FYJA 1EOGA 2KKWA 2WS2A 2B5YA 3BY6A 2GBOA 2XOKG 3CSJA 5C93A 1HP8A 1GAXA 4O4LB 1YKCA 4X4JA 2K9FA 1B04A 4TVEA 1SJ6A 1OE8A 2OIEA 5IE9A 3PJSK 4QJFB 1M56B 1VQ5V 4UVCA 2HFEC 1O9HA 2GVPA 4B3RO 1ON4A 1B3QA 2X99A 2MBSA 2L6LA 2CH7A 2VLUA 1A8YA 1FFXA 1Y6EA 2WB9A 4DR6O 3JD0A 4K35A 4YHHO 3M0FA 2EIKC 3P30A 5LMNB 2LJRA 2UUCO 3VOUA 4G2KA 1BAYA 5DQSA 2JGDA 3OT7A 4EXJA 2IJIA 4CS4A 1EN4A 3F4RA 1ERWA 1XVQA 5BXZA 2YIAA 4B7KA 2MZCA 5H5RA 5J3RA 3HKBA 1H2SB 2QKEA 4TSFG 2K1EA 4O5QA 2LW7A 1U96A 4GT1A 5GSTA 3TRQA 2QKAA 3N2GB 4IHJA 1K5QA 2DKHA 4O4LA 22GSA 2GSTA 1YITV 1LUVA 3CEIA 2VCWA 5J9CA 1DE1A 4YQVA 2AXTZ 2YS8A 1Q43A 2KSDA 3KG2A 1RK4A 3OR7C 4KP4A 1O73A 2F4VB 2C3NA 1YEWA 1IURA 4BIZA 1GULA 1FFXB 3GL3A 1AUCA 3ZMUA 5CRWA 2EJ7A 5ELGA 4LBEC 3D6IA 1JA8A 3J7Yb 1VF7A 3E8HA 1AJPA 4Z1MG 2A2PA 1SKVA 5CREA 1UVZA 1ST9A 2HRNA 3QD9A 5CO3A 4RQXA 3BA8A 2GTUA 1JX9A 2P5RA 4OCFA 3RYIB 1OC9A 1US6A 3LNNA 1Y74B 4D7TA 2N05A 1WP7A 3CCJV 1IVSA 2C3QA 4IL6Z 1Z7RA 1URMA 1U88A 1VMGA 2W6JG 4ECBA 4NXMB 5B1AC 2XPDA 4X65B 1FW1A 2C3TA 1OCZB 4MVQA 3ABLC 4MW8A 5G1KA 1WJKA 2H6XA 3QO5A 3IJ4A 4H13B 1EV9A 2Y0IA 2GZZA 1PNKA 2LSTA 4PA9A 4PURA 1OJHA 3ZRXA 2QJ1A 3SGIA 4AJ7A 4J41A 1JZDA 1PX7A 3CRTA 4WBNB 4NAXA 1S3CA 2N5FA 2VL2C 3R66A 2X8HA 3GL5A 1AVMA 4QNHB 2H1GA 3A5IA 2VIMA 2Y4TA 3HJMA 4MVOA 4RUVA 1MA1A 4J10A 2ZNJA 1SD9A 3CCLV 1XNRO 2X49A 3QPMA 4JI1O 1WJZA 1MDKA 1EEJA 3OTFA 1RP3B 3GUSA 4MTXA 1BHAA 3ZCCA 3MD0A 1PMTA 5D9WA 2GT5A 2AHEA 1UC7A 2AB6A 2C0EA 2K8SA 1CXZB 4FLWA 3VURA 3HCZA 4EFEA 4LFAO 4MJEA 2EX3A 4HBNA 3ZHQA 1FXKB 1PFOA 1K4DC 2H6ZA 5C8YA 4MVUA 2PTMA 1IBMO 4X89A 3AG2C 2RCVA 3VWUA 1OCRB 1H2LA 1F3BA 2C0DA 4DK0A 2FUG2 3RPNA 1HW7A 3SPGA 4B3MB 2QA1A 1XOUA 4MNNA 2H6YA 4EDZA 3UQ8A 2ES7A 1PL4A 2YJ7A 1SQQH 1PD3A 5JWOB 3FMWA 3T1YO 1PN0A 4JI2O 4MP4A 4GQFA 1TA8A 2A79B 2E74B 2RLIA 1XW6A 3FB8C 3JARB 3EMXA 2DJ1A 4MSWC 1GWCA 2VM2A 3LUTB 1R26A 4JPRA 4X66B 2R0CA 3HKEB 1VF2A 1QLEB 3EFFK 4NV2A 1AJQA 5GONA 3CTFA 5C8YB 4O4HA 4AGSA 1GL8A 2CE4A 4IBPA 2ZE5A 4JV5O 4ZXGA 5GSSA 5L3DA 2BTOT 5BMVA 4BIOA 2HLSA 3TRPA 2HRKA 2OJLA 5DDLA 2ZDIA 3KKYA 3JSLA 4UUJC 5DALB 1M1KW 2E75B 3DIEA 4NHZA 4MTOA 1WRYA 6GSWA 2UUAO 1FO5A 4DW0A 2ZR3A 2WLNA 2B9ZA 1QR9A 3JARA 4OFTA 1SK1A 3CMAV 3DKSA 4DV3B 4Z2UA 3TKRA 1ZAUA 4DV5O 1KC8W 3KP9A 1QMVA 3RFRA 6GSUA 2X7RB 2CTQA 2JJ2G 1GN4A 4RO2A 4LC1A 1A2JA 1GSYA 4DYLA 1HR0O 1SQBH 4TN8A 1J0FA 1ERVA 2IBZH 2DQ3A 5EL8A 2CTWA 1K34A 1S76D 1M7TA 2DJVA 1PM9A 3SDLA 1W0KG 1JOYA 2UU9B 1CQHA 4MW3A 3M9JA 4ZIJA 2OE0A 1COWG 4K0GA 1P84F 1GTUA 4P9OA 4UCOA 5FNVB 2RM5A 5KHHA 1OC8A 1PNMA 3EU4A 1JFFB 2M80A 1TUEB 3CC7V 3MWHA 2LGQA 4GRFA 5G31A 1Q5OA 4K0NA 3DVWA 4ISDA 4K5RA 5LBQA 2C2AA 1B9XC 3SR2C 2EIRA 4H0LB 4NHWA 4ZL7A 2F8FA 3UL3A 4UVAA 4MPGA 1XPVA 4R50A 1TK8B 1ZL9A 1R4WA 3GB7C 3OEEG 2DYSB 2AZ2A 2OTLV 3FHKA 4F03A 3TKQA 3FB6C 4MVMA 2F4VO 4YQMA 1TAEA 3FB5C 4LMVA 2PGGA 1VQMV 4IELA 3W6GA 2KHPA 3ERWA 1E6BA 4I2UA 2DN9A 2H1BA 4BWQA 2XTAA 3JATB 4J11A 3IOSA 1IBKB 5B8BA 1Y66A 2VL2A 4RAIA 4UVBA 3JAKB 2KLXA 1K0NA 4MS2A 1FPOA 1K3LA 1OAZA 4HUAA 2DJ2A 4TR1A 1FG4A 2O7KA 4I5QA 3CTGA 6GSYA 2YXLA 4ZBMA 2H75A 4PJ0Z 2WZ9A 2GSSA 3KTBA 3HYPA 3GSSA 2OCHA 3L72H 1N8RW 3A0BZ 4QE9A 5LHIA 4DR6B 4F6EA 2PN8A 3CMIA 3GHAA 4DR7O 4EVMA 3K58A 3IE3A 4JI0O 3IDVA 2L5LA 1UJWB 4G10A 4O92A 3VBBA 3K5LA 4ML6A 5AISA 5F05A 3E35A 3BCCH 1XCCA 3EURA 3E89A 1IYHA 1V98A 1YXBA 5DVBA 2LGWA 4CS3A 2GSRA 3GYKA 3UO2A 2F93B 3HZ4A 4TV8A 2H1DA 4I5SA 4QPKA 2I81A 1NI8A 5ITZA 1ZYEA 2HZEB 3FYIB 4EC0A 3IAM2 1GUHA 5FPOA 2LV3A 5GAND 1K3EA 3LXTA 3WGEA 3L9SA 3LSSA 1PX6A 3RPPA 2VQFO 4J56E 5KN2A 3ABKB 2DSAA 4I8BA 1U97A 5A2QN 2PVOC 5JQGB 4JU5A 2VD1A 1GTIA 4TOIA 4ZHQA 2RN9A 3ZX6A 1M3IA 3DYRA 4KE3A 2WA4A 1PKWA 4CC5A 3D8CA 4CZZA 2ZUPA 3LSQA 5E4WA 3J7Yk 2QM8A 2QC7A 2J9HA 2QM4A 5ECQB 1Q3EA 1KP3A 1ZWIC 3CC4V 4JI0B 2MYGA 2XAFA 4EIPA 5IJ0A 1XWKA 2M7WA 4TV8B 1AIUA 1EBOA 4AJ6A 4NWYA 3V1WA 3FAVB 5EZYB 4RUFA 4MZBA 2MMAA 3HXSA 3H79A 1Z5WA 5A4WA 3KIJA 1NTKH 1M90W 5JQGA 2R0PA 1OCOC 2NBSA 1F4NA 4BVYA 4FLUA 4UXNA 1R6TA 4WKWA 5A9GA 5JWQB 4N11A 4DUZB 5EK0A 2LEGA 4KCAA 4HU9A 3IAS2 1Q81W 3ZZXA 1SC5B 2FWEA 1ROPA 5J2TA 1FVJA 4WETA 1EGOA 1GNEA 5ECOB 2HI7A 2WAMA 2XAQA 5IJ0B 3CPWU 1EWXA 3M9KA 4PTSA 2JS3A 5IYBO 1MDIA 2QWRB 2YJHA 2Q9LA 3ABMC 3FAVA 2EIKB 1XZOA 5EZYA 5LHGA 1GNWA 4CY8A 3X2QB 1U6TA 1BCCH 1K0CA 2PY5A 3SYCA 1S0VA 4MLYA 2B6MA 2H8LA 4JTCB 1B6QA 2IH3C 1K0MA 4LL4B 1O81A 1X5DA 1XOBA 5B1OA 1BS3A 2ZQMA 4I6XA 5H5NA 3F9UA 2X0LA 4JI3B 4YH2A 2F95B 4FFBB 1SK2A 1QFNA 5BR8O 4Q5FA 4KH7A 3IC4A 1EFRG 1WN7A 4MT8A 3LYPA 5G30A 2C0FA 5F2VO 5IO0A 2OWOA 1AQXA 4I50B 1NS1A 1XWAA 2IJYA 3DD3A 5IMFA 2A4VA 5ENUA 2A4HA 4KF9A 2AV4A 4BVXA 2Q6AA 5IO2A 1S72V 1SYXA 4JI6B 3T2MA 3CYOA 2OBKA 3GA4A 3B40A 4O2BA 2DWEC 2G38A 4BIUA 3I43A 4PXOA 2DYRC 5CRHA 4I9QA 2GSMB 5JCUA 4GQCA 1Y67A 3J80N 4CC6A 5HFKA 5G5FA 3UAPA 3FR3A 3JD1A 3JYCA 2FMLA 5J4UA 3K9AA 4JAAA 1ERTA 1WPBA 3G67A 2ZCTA 1XBLA 8GSSA 5B5EZ 2V4DA 1GTBA 2P5QA 3CYNA 4HQZA 4O5UA 1M56C 5B8AA 4B3TO 2FA8A 2YIBA 3BCKA 4XHMA 2KB1A 1HQOA 3APQA 3M99B 4JI8O 3KGKA 3W8SA 3ZN1A 1IZ3A 5KAIZ 4O2BB 1QVFU 1VEWA 3BD2A 3O76A 3Q19A 1S5HC 1EN5A 2OIGA 5JH7B 1TRVA 1R7HA 1YVWA 2VCZA 3A2XA 2QGNA 1RSOB 4LLRA 1SYRA 3P7XA 1J5EO 4OX9B 4GKKO 2ILMA 2VCXA 1Y6XA 1XXUA 2YANA 1HNXB 1AJNA 2HFDA 1NR7A 1EZKA 3H1NA 1N2AA 2RQ6A 2ZDIC 5FLXN 2PZSA 3LDEA 2AYTA 3F4TA 4KNDA 3GNJA 1AP6A 3HA9A 1G7OA 1GO3F 3CRMA 3HR0A 3IBHA 4DR3B 2DBCA 3DXBA 4FIWA 4K1FA 5FHIA 4DSSB 1WPXA 3T1HB 2FCHA 1XL4A 2FB5A 2C0GA 4WXTA 2CUGA 5C04A 2Q4PA 3F3QA 2IMFA 4GLXA 2F23A 3P90A 3IHGA 4OWYA 4G19A 4DV0B 1V2AA 4LF8O 4X64B 5JH7A 5D9TA 3IAYA 4OD7A 2YUAA 3ABUA 2CTRA 1UN2A 3U0ZA 2V6OA 4N10A 1VP7A 3RYFA 4WR4A 4WR5A 1PNLA 4TUYA 4MABA 2Q69A 1ORQC 2UUBB 1VF4A 3ZIJA 1O9GA 1T4YA 1NU1H 3FZ9A 4DSSA 3EWLA 4JAUA 1SENA 4ILFA 4QGPA 3RYCB 1R6NA 2AHYA 2R6KA 2QSAA 4J9YB 4I9WA 2HLDG 2QTSA 1TGOA 4EKZA 3CSXA 3S3WA 3ETQA 5B1BC 3HDCA 5CYYA 2WLLB 4J7JA 4DR1B 4DVCA 2YXHA 1EN6A 2VAFA 5LMUO 1GM8A 1LBKA 5LL6Y 5IYDO 3EMPA 3GKKA 4EF0A 4BPYA 3U10A 2VLVA 4LF4B 6GSVA 1NVPB 1VRSD 4HNAB 4KUNA 3JCZA 4QE7A 3KH9A 1GSQA 1XG8A 1H8EG 3LDDA 1GSUA 2DMXA 2LTKA 3FD9A 2YDEA 1NT2B 2BOBC 1ENVA 2V41A 4KSOA 3ETGA 4G27B 4DV6B 3E8BA 4KL1A 3RYCA 4JI4O 4NB5A 4F0BA 4IYHA 1AXDA 4IHUA 5CNWA 4ABMA 1SKRB 1QHTA 6GSTA 2CX4A 2JZTA 1YJ6A 3CCUV 2EJRA 2WLLA 2BCCH 2DQ0A 5EC2C 3CB2A 1ZOFA 3J7AU 4FLVA 2F43G 3N2KA 5F0GA 4H33A 3FB7C 3G9BA 1ZYNA 2HXKA 4HNAA 2R4VA 3TCOA 3H1HH 1M4UA 4ZBAA 1WIKA 4YAPA 1N36O 3AK1A 4FYUA 4I0XA 4N23A 2A06H 4C7UA 4NMUA 3CXCU 2LS5A 3WYWA 2R37A 1IBLO 2R72A 3ZHUA 2AZ0A 1YSCA 1NW2A 1TKDB 1XW9A 4DEJA 2ARHA 4I97A 1BE3H 4AQYB 5B6NA 1NVPD 4LFCO 1VQ7V 4X43A 4B3RB 5A4VA 2XUMA 2Y69B 4KAEA 2PUKC 1OC3A 4YY3O 3LJRA 2L57A 3WGDA 1HWYA 2B7JA 2FKXA 3F5WC 5E79Z 1K8AW 2YP6A 5KHKA 4I4TB 4XDLA 4TR3A 4ASUG 2YSUB 5EYPA 1U3IA 4K8MA 4I0XB 1B8XA 2O85A 2X6AA 3J81N 5EIBC 2CQ9A 4MA9A 2FL4A 4WBRD 4DR5O 4FLYA 4NYKA 2EIQA 1HNZO 3U5RE 4WFHA 3SPHA 1WB8A 1KBNA 1JZOA 1TXXA 4FH8A 5HQPA 2CA8A 1S77D 5HR2A 1XNQO 2W0FC 1G6YA 3LNMB 5KHIA 4WFEA 1Q6IA 1WNSA 3FK8A 1QQCA 2X6BA 1VGLA 3FR6A 1THXA 1WA8A 3WG7B 1N34B 1ZGNA 1XVWA 2NPBA 1D5NA 2CAIA 3QF7A 3L9DA 1YCIA 1IXMA 1JVMA 2N74A 5DM6V 2UXDO 1JCHA 4GX5A 1TOFA 3RHCA 4H37A 3ZJZA 1XEQA 4K8ZA 1N4CA 1E79G 4YJ3A 4K0KO 3ZHTA 2RM6A 4XS6A 3ZMKA 5LCZA 1R3LC 2F66C 4N21A 4D7SA 3HVNA 3DXRB 1SKWB 1SL1B 5LGUA 4TR4A 5CA1B 4ZIBA 4KW6A 3UJ1A 2YXYA 1LR1A 3K59A 4XS4A 4L0WA 1WAZA 1ERUA 4DV7O 1VQ4V 1XL6A 3ZMZA 1Y76B 2ADQB 3EYTA 4JZGA 2CVKA 1W2BU 5F06A 1FOVA 4LF4O 3H01A 4DR2B 1SKSB 1ACVA 2CK3G 5GTIZ 2FD3A 4BW9A 4JASA 1AR5A 3C1SA 2QKCA 3D36A 3UKMA 4UV9A 3VK9A 1MMMA 3DWVA 1NJIW 3T1CA 1BYEA 4O4IA 3E3EA 4DR2O 4GWRA 5BY1A 1ZSPA 1KMIZ 2F8AA 3VQYA 3BRCA 4GX2A 5JJEB 5CA1A 2DJJA 4V2LA 1EZVH 3CRUA 4LNUA 1EP8A 3FRCA 3ICXA
chains in the Genus database with same CATH topology
4IP6A 2VD0A 3US3A 3LW9A 4O7HA 3TJGA 1M99A 4POLA 3GRXA 4XRDA 1YEPA 3F8UA 1W4VA 1M9BA 4PX1A 2MMOA 3ZVJD 2LRCA 2B5EA 2IFQA 4LL1B 1U3AA 2GQMA 1S3AA 1PKZA 5DQYA 1S3DA 3UIWA 3LYKA 2CVDA 4IQ1A 4ECIA 4GTUA 1XWCA 1AAZA 4GLTA 4FO5A 5J9BA 4XS1A 2WFCA 4HJMA 2IFQB 2NVLA 2QWOB 4L5OA 2TRXA 1TU8A 3LEFA 3R2QA 1B4PA 3PINA 4JR6A 4ZB6A 1WE0A 3D4MA 4K7NA 1HD2A 2GDRA 2L59A 2LUSA 5EY6A 4H86A 5ECSA 3DRNA 2CAQA 4TW5A 1BX9A 1B9YC 1ZMAA 5CP1A 2DJ0A 3P2AA 3HKRA 4Z7XA 11GSA 3MDKA 3KH7A 4IVFA 3ZIVA 3G7YA 4HU7A 3A2VA 4JEDA 1TI3A 1KTEA 1TU7A 2AAWA 3UO3A 5AIXA 3DGQA 2C4JA 3TB2A 4N0VA 2E2GA 2VO4A 2IN3A 2TIRA 5KOXA 2E2MA 3EU3A 1PSQA 1SJIA 3BJ5A 3D21A 4RQRA 5FWGA 2FWHA 3UBKA 3GKXA 1N8JA 3TJBA 2K18A 4GCIA 5FT3A 2H19A 1X9MB 5D9XA 2BMXA 2WRTA 2I3YA 2HRAA 1HNCA 2V1MA 2VCQA 1C72A 5IIZA 4PQIA 4WBJA 5DBQA 1DE2A 1XW5A 4YQUA 3FY7A 5D93A 3EINA 1PL2A 1Z9HA 3MIXA 3TDGA 3APOA 1T3BA 3QAVA 5KOWA 1SL0B 2EC4A 2H30A 4FYBA 1ILOA 4BL7B 3VFIA 2QWPB 3A3TA 1SJZA 4JR4A 2O87A 1GSEA 2VOCA 3D22A 1THOA 2P0GA 4CW9A 4IJIA 1XBSA 1AC1A 2H01A 1T7PB 3RBTA 2O89A 1TDIA 4RWUA 5IM9A 2KP1A 2GZPA 3TKSC 2BJXA 1XOAA 5J41A 1BQ7A 1DBYA 3LGCA 2L6DA 2IMIA 3AY8A 3IHQA 2JADA 3GN3A 2WDUA 3TJFA 4ML1A 3VPQA 3VWVA 2KUCA 3PGTA 5JWRB 1MDJA 5L71A 3NOFA 5DJMA 2WJUA 2YCDA 1GUMA 3OR5A 2CT6A 4USSA 3WD6A 1TTZA 3EVIA 2YV7A 2O8VB 2VLTA 3QOUA 5IMVA 3A2WA 1OE7A 2N5BA 4MZWA 1K0OA 3Q6OA 2FLSA 3FZAA 5ABRA 3KJYA 5HFGA 3MSZA 3FKFA 2OE1A 3FYGA 3E0UA 13GSA 2LO1A 4IN0A 2ON5A 1WMJA 4GSNA 4F9ZA 2CTPA 14GSA 2VCVA 4IT5A 1V58A 2H66A 1M2AA 2XC2A 3TUEA 1SD8A 4ZL9A 3GTUB 3ZLPA 2FGXA 1G7EA 2J23A 1Y25A 3W8JA 4K7IA 2RUFA 1KNGA 3C8EA 1O6JA 5JCGA 1M2BA 2DMMA 5DAKB 1X9SB 2L4CA 1RW1A 4IKHA 3UVTA 5KN1A 2LQQA 4G9HA 3KMNA 2LKUA 1K0DA 3IPZA 4HOJA 2HSHA 2XHFA 1TRSA 1V9WA 3Q18A 5G2ZA 1FAAA 5E59A 4ZILA 3LQ7A 4OFMA 2NTOA 1SU9A 3HJOA 1PRXA 3MYDA 4PUAA 4L5LA 2OE3A 1QK8A 2DC5A 2HZFA 2JACA 5AN1A 3M3MA 4ECJA 4TRXA 1Q4JA 4J7ZA 1GLQA 3HY2A 2HZEA 4MF5A 5B7CA 5C00A 4J80A 1G0TA 1JZRA 2VCTA 4K6XA 4MH3A 1V57A 5DCHA 4XCSA 1VF3A 1AQWA 2G2QA 4TXOB 4MJAA 2ALBA 3U6VA 2GS3A 1BEDA 4EIQA 1B4QA 3HZ8A 2B1KA 1M2DA 2PBJA 5ECLB 4OCEA 4BVYB 18GSA 2C8UA 2VM1A 4D73A 1EOHA 5KN0A 4TXOA 1RQMA 3BBYA 2X4AA 4OO5A 4Q5RA 2H76A 2HSMA 1ZCPA 4GF0A 2NDOA 5IQYA 1LU4A 1V40A 4D73B 7GSSA 1FHEA 4ZB9A 2JU5A 3GFKA 1EP7A 4NXIA 1WPIA 1FAFA 3M8NA 2F3MA 3ZTLA 3KM6A 5IMCA 1HNAA 3VPTA 5INYA 2CVBA 4K7OA 20GSA 3L4NA 2PPTA 4CY6A 1O8XA 4ECCA 4E8EA 1TK5B 3N9JA 4J57E 3IXRA 2QA2A 2RUEA 2DKIA 1GH2A 3HD5A 2IPAA 1JLVA 3FW2A 3VWXA 1OC9B 4MK3A 4G0KA 3MNGA 2L4QA 5A4UA 2XBQA 2H70A 2GLRA 3EPTA 3QCPA 3C7MA 3BVOA 1TI1A 1YQ1A 3ZFBA 4HQSA 4KB3A 5D9VA 1Z3EA 3R3EA 4RI7A 1O8WA 4G0LA 4Z2RA 2F9SA 1VF1A 4IGJA 4V2MA 2IMEA 1G6WA 2GUZA 9GSSA 1XWBA 5KN3A 3IK7A 4BA7A 3WGXA 4G2EA 3VI7A 3CXGA 3ME7A 2E0QA 1K0BA 5ECNB 3HJPA 4WF4A 5COHA 2Z9SA 4Q5NA 2YOIA 1R5AA 5D73A 2QSIA 1F2EA 1T00A 3H8QA 3MAKA 2GUZB 4PNGA 3S9FA 1H4OA 5GZZB 2FA4A 4IJ3A 6GSXA 1AW9A 1I9DA 3CBUA 3P8WA 5IPGA 2LRTA 4ACSA 4HZ2A 1GP1A 3TGZA 1F6MC 1USBA 2H0IA 2PF4E 2H0GA 2YN1A 3LXZA 2V6KA 4XTSA 2H74A 12GSA 4IS0A 4EUYA 1XWGA 2IMDA 4JE1A 1ZYPA 4GXZA 2HT9A 3TOTA 1DUGA 3C73A 1PD21 5DALA 4ZB8A 3GX0A 3H93A 2YZHA 2XBIA 1A2LA 1WP0A 2PMTA 5ELAA 1MD4A 2H73A 4KX4A 4GSSA 1M9AA 3QAWA 2E7PA 3UARA 4RI6A 4TXVA 4F82A 4PUFC 3APSA 2PGTA 4KCEA 5ECIB 2GSQA 4POBA 4MH2A 4K2DA 3D5JA 3TOUA 4HEA2 3ME8A 4V1Ap 3BOAA 1F9MA 3PH9A 2GGTA 3DMLA 5HR0A 4IP1A 2GZYA 5IMAA 4F0CA 2CV4A 5CRGA 2I4AA 3ZRDA 3ZVJA 2WULA 2OBIA 1M0UA 1BG5A 1HNBA 1ABAA 3LFLA 1WOUA 3L0HA 2QGVA 1X9WB 5F07A 1J9BA 3TKPA 4MPFA 3VLNA 2VL3A 4YKFA 2JL4A 4PQHA 2M6YA 4K2XA 1SK0A 3FZ5A 4O5RA 1GTAA 3ERFA 2MMZA 1HYUA 1Z6MA 4TOPA 4KDXA 4OMVA 4TR1B 4TKYA 2OACA 1KEBA 2F51A 4G0IA 3D0ZA 3ZYWA 1BJXA 1QXHA 1J08A 3E9JB 5DJLA 3F3RA 2YPMA 2AJQB 4V2NA 4KA0A 5D8IA 4A5PA 2ON7A 4MJCA 1ZZYA 2AUVA 4DSRA 2DJKA 3QR6A 1NSWA 2V32A 2YZUA 3IV4A 2H72A 4IQAA 1GH6A 3F0IA 4WF5A 5ECPB 3GKNA 5LNKe 1X5CA 5ECKB 4JRRA 2VL9A 5CRDA 2G0FA 3ZMLA 1PL1A 2XPEA 1TW9A 1YDKA 3UEMA 17GSA 1YZXA 2YNXA 3L78A 2YV9A 3UVHA 5A5KA 2WCIA 1LJRA 3QFAC 5HR3A 3PR8A 4MCUA 2LJKA 2FY6A 1T4ZA 3ED3A 2R2JA 4EE0A 2LJAA 2OKAA 2MMNA 5BRTA 3EC3A 3CSIA 3GH6A 2A2SA 1ML6A 1OKTA 1EV4A 2KQXA 1GLPA 2DJ3A 4XRAA 2OADA 2JZRA 4MF7A 3QFBC 4Z2TA 5ECHB 1NHOA 1GUKA 3M1GA 16GSA 2VUPA 4QQ7A 1NZ6A 3WT1A 19GSA 2N04A 1QGVA 2CZ3A 1GSFA 1Q98A 5DCGA 2P31A 4J2FA 3QAGA 4ZL8A 1B48A 1JLWA 5H5SA 3ZFLA 2CX3A 4BVXB 1FVKA 3GH9A 1BQZA 3JCML 4HJ2A 3TJJA 3KTLA 2KP2A 3L9UA 1FB6A 1Z6NA 5HFIA 4GSTA 3I6AA 2FNOA 3KZQA 1JFUA 4OO4A 4XIHA 1PA3A 1YF0A 5EVOA 1QUWA 4TR0A 2IMKA 5H5QA 2LQOA 1NM3A 3QMXA 2HSYA 2FWFA 1U87A 2IL3A 4QL7A 2YWIA 3UMAA 1YF1A 4POMA 2X64A 2HRFA 3RAZA 4V1Ag 4IW9A 5F8BA 1Z5YE 2PWJA 3D4TA 5IOXA 3AG7A 1A24A 3GV1A 1X5EA 3I9V2 4KGIA 1T8EB 2B3SA 1YY7A 1F37A 5EPFA 4BWSA 2ZNMA 2N5AA 1OKDA 3DVXA 5KEJA 3TJKA 2JZSA 2DIZA 3FZ4A 1A8LA 2YWMA 5J5NA 3RHBA 1IYIA 3IA1A 3PPUA 5IOWA 1F3AA 1AQVA 2JSYA 4CDOA 2B1LA 5IMZA 2GT6A 1QQ2A 1T1VA 5ECMB 4JBBA 3F6FA 1O85A 1YEXA 2PERA 3KCMA 10GSA 5ECRB 4ID0A 4X1UA 3HVSA 4BL7A 3FR9A 5AGYA 3N5OA 4O32A 3KXOA 4MJBA 4P3YB 4N30A 2I9HA 2DMLA 2IWTA 1JHBA 1H75A 2LNTA 2PU9C 4NPBA 4QL9A 2H1AA 4FQUA 4DSQA 2M72A 4PQ1A 5IPHA 1HDJA 5IMDA 1E2YA 3IK9A 5HR1A 2A2RA 2WGRA 4PGTA 3C1RA 3GMFA 5JCWA 5G1LA 1GSSA 4HI7A 3DEXA 3QDNA 3TKSA 1BQ0A 1OYJA 2D2ZA 1EGRA 1TP9A 2K6VA 4N0ZA 3Q74A 1K3YA 2OA7A 4YKGA 3KD0A 4AJ8A 2M46A 4ZBBA 3GIXA 2JSZA 3ISOA 2DIYA 3ERGA 4OFNA 1PGTA 2R5GA 4FYCA 3H4KA 3HHVA 5BMUA 2R3XA 4CHSA 2MBTA 3UOMA 3HVVA 2HNLA 3KEBA 1YKAA 3K8NA 1XIYA 2H71A 5LD0A 4L0UA 2Y4UA 4HDEA 1FOHA 3IR4A 3LWAA 4POKA 1Z7PA 1OVNA 2GQKA 3EE2A 3SBCA 5ID2A 4E8HA 2YWNA 3VI5A 5G5EA 3HVXA 3GTUA 3UCSC 1A0RP 4MDCA 4KSMA 2EIOA 5AIVA 1W89A 3VWWA 1EEMA 3ZL5A 3GKMA 5CAXA 4EO3A 3IC8A 1FB0A 5DAKA 2L5OA 1GSDA 3O3TA 5ID2B 4EL1A 3ZREA 1PQNA 4KDUA 3ZITA 2QWNB 2DLXA 2CZ2A 3A5WA 4LMWA 2FHEA 4XS4B 2V2GA 4AF2A 4MF6A 2K8VA 1XFLA 2B7KA 3SWLA 4K5SA 3CSHA 3RDWA 2C1YA 4NV5A 2TRCP 1MEKA 3O6TA 3NIVA 1X0RA 1DSBA 3L9VA 3F63A 4JZQA 4KDYA 4Q5QA 2UZ8A 1A0FA 5B6MA 3UBLA 6GSSA 4ZBDA 2LRNA 3LSZA 1I5GA 2B5XA 2REMA 2I1UA 4MMMA 1WWJA 2PVQA 1JZWA 1UA5A 1TRUA 1TK0B 2L6CA 2X8GA 1SL2B 2FWGA 2H0HA 2HE3A 3KMOA 3GX8A 2KOKA 4L8EA 3I69A 3TKSE 3BCIA 1R5PA 4WEYA 1K3OA 3LORA 4EDYA 3KP8A 4YAVA 2YWOA 4HZ4A 4ULXA 4HS1A 1TJDA 2IIYA 2RIIA 3C71A 3G7JA 4MZCA 1GRXA 2GQLA 2QWQB 4X0XA 1A2MA 2R0GA 3FEUA 5D96A 3LG6A 3TRXA 4F2IA 2C80A 3G7IA 3F6DA 3GURA 4K9ZA 1NHYA 2HYXA 3GSTA 4LA1A 4PNFA 4I2TA 1MTCA 2LNSA 3F4SA 3IRAA 4ICYA 1A23A 1TRWA 1ZYQB 1O7UA 5GAPD 1K0AA 1PN9A 2X8CA 1CQGA 1MD3A 3NZNA 1EOGA 2WS2A 2B5YA 3CSJA 1YKCA 4X4JA 2K9FA 4TVEA 1SJ6A 1OE8A 2GVPA 1ON4A 2X99A 2MBSA 2L6LA 2VLUA 1A8YA 1Y6EA 2WB9A 3M0FA 2LJRA 1BAYA 5DQSA 4EXJA 3F4RA 1ERWA 1XVQA 5H5RA 2MZCA 5J3RA 2QKEA 4O5QA 5GSTA 3TRQA 2DKHA 22GSA 2GSTA 2VCWA 1DE1A 5J9CA 4YQVA 2YS8A 1RK4A 1O73A 2C3NA 1IURA 1GULA 3GL3A 1AUCA 5CRWA 2EJ7A 5ELGA 3D6IA 3J7Yb 2A2PA 5CREA 1UVZA 1ST9A 2HRNA 3QD9A 5CO3A 4RQXA 2GTUA 2P5RA 4OCFA 1OC9A 2N05A 2C3QA 1Z7RA 1URMA 1U88A 4ECBA 2XPDA 1FW1A 2C3TA 5G1KA 1WJKA 2H6XA 2LSTA 1EV9A 2GZZA 4PURA 4AJ7A 1JZDA 1PX7A 3CRTA 4NAXA 1S3CA 2N5FA 2VL2C 2X8HA 3GL5A 2H1GA 3A5IA 2VIMA 2Y4TA 3HJMA 4RUVA 1SD9A 2X49A 3QPMA 1WJZA 1MDKA 1EEJA 3GUSA 1PMTA 5D9WA 2GT5A 2AHEA 1UC7A 2AB6A 2C0EA 2K8SA 3VURA 3HCZA 4MJEA 2H6ZA 3VWUA 1F3BA 2C0DA 2FUG2 3RPNA 2QA1A 4MNNA 2H6YA 4EDZA 2ES7A 2YJ7A 5JWOB 3FMWA 1PN0A 4MP4A 4GQFA 2RLIA 1XW6A 3EMXA 2DJ1A 1GWCA 2VM2A 1R26A 2R0CA 1VF2A 4NV2A 3CTFA 1GL8A 4AGSA 4IBPA 4ZXGA 5GSSA 2BTOT 2HLSA 3TRPA 2HRKA 2OJLA 5DDLA 5DALB 3DIEA 4NHZA 1WRYA 6GSWA 1FO5A 4OFTA 1SK1A 3DKSA 4Z2UA 3TKRA 3KP9A 1QMVA 6GSUA 2CTQA 1A2JA 1GSYA 4TN8A 1J0FA 1ERVA 5EL8A 2CTWA 1M7TA 1CQHA 3M9JA 4ZIJA 2OE0A 4K0GA 1GTUA 2RM5A 1OC8A 3EU4A 2M80A 3MWHA 4GRFA 5G31A 4K0NA 3DVWA 4ISDA 4K5RA 1B9XC 2EIRA 4NHWA 4ZL7A 2F8FA 3UL3A 4MPGA 1XPVA 1ZL9A 1R4WA 3FHKA 4F03A 3TKQA 4YQMA 4LMVA 4IELA 3W6GA 2KHPA 3ERWA 1E6BA 4I2UA 2DN9A 2H1BA 4BWQA 3IOSA 5B8BA 2VL2A 2KLXA 1K0NA 1FPOA 1K3LA 1OAZA 4HUAA 2DJ2A 4TR1A 1FG4A 2O7KA 4I5QA 3CTGA 6GSYA 2H75A 2WZ9A 2GSSA 3KTBA 3HYPA 3GSSA 2OCHA 3WT2A 2PN8A 3CMIA 3GHAA 4EVMA 3IE3A 1TK8B 3IDVA 2L5LA 4G10A 4O92A 5F05A 4ML6A 5AISA 1XCCA 3EURA 1IYHA 1V98A 5DVBA 2LGWA 2GSRA 3GYKA 3UO2A 3HZ4A 2H1DA 2I81A 2HZEB 4EC0A 1ZYEA 5GAND 3IAM2 1GUHA 2LV3A 3LXTA 3WGEA 3L9SA 1PX6A 3RPPA 4J56E 5KN2A 2DSAA 4I8BA 2PVOC 4JU5A 2VD1A 1GTIA 3DYRA 4KE3A 1PKWA 2ZUPA 5E4WA 3J7Yk 2QC7A 2J9HA 5ECQB 2MYGA 4EIPA 1XWKA 1AIUA 4AJ6A 4NWYA 3V1WA 4MZBA 2MMAA 3HXSA 3H79A 5A4WA 3KIJA