3APOA

Crystal structure of full-length erdj5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
746
structure length
688
Chain Sequence
b'FYSLLGVSKTASSREIRQAFKKNRAYEVLKDEDLRKKYDKYYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELSTGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGNDPELKKLKTLLKNEHIQVVRFDCSSAPGICSDLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWSPPSRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWSHPSQVLMPEWKRMARTLTGLINVGSVDCGQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWSGPSQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 198
structure length 688
sequence length 746
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA07
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA06
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA05
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA04
5H5QA 3ISOA 2KP1A 5IMDA 1M0UA 2L5OA 4OCEA 2TRCP 2L6LA 1X5DA 2LJRA 3DVWA 4I8BA 5IOWA 4NMUA 2RUEA 1BG5A 4MJBA 3ED3A 4MZCA 4NAXA 3DIEA 4MZBA 5HR1A 3BCKA 5IPGA 5ECKB 1YF0A 1HDJA 5D73A 2E0QA 4OWYA 3KH7A 1GULA 2REMA 1WRYA 2K8SA 2IMIA 1XZOA 4ZBDA 4HJMA 1YF1A 1ZL9A 1V98A 4RI7A 4I6XA 4GSNA 5JWOB 4KAEA 4HZ2A 3HD5A 3DEXA 6GSXA 2E2MA 2MMOA 2MMZA 3LYKA 1O73A 2N5AA 3EMPA 4K9ZA 1EZKA 5E59A 2DIYA 4GTUA 2VLUA 2YPMA 3D22A 2IL3A 3W8SA 3H8QA 1Z5YE 3HA9A 4JU5A 1BQ7A 2VL2A 6GSWA 1TW9A 4JBBA 3VWUA 4WR4A 3IRAA 1SJIA 4IS0A 14GSA 3KP9A 1FVKA 1GSFA 1GTUA 1Z6NA 2C8UA 2OACA 1ZYEA 5CRGA 2V32A 2CQ9A 3HVXA 3R2QA 5G1LA 1E2YA 5HQPA 1JLWA 2YV9A 3CBUA 2GT5A 4NV5A 4E8EA 1FPOA 3TKSE 4ECCA 2YNXA 3C1SA 2H6YA 2PBJA 4EDYA 4KH7A 1PN9A 1GNWA 2BTOT 2M80A 1SD9A 3Q74A 1R5PA 1KBNA 4G10A 4TW5A 3VWVA 1JZRA 3W6GA 2FWFA 1N8JA 3I69A 4PUFC 4CW9A 1XPVA 3IDVA 2ZNMA 3M1GA 5GAND 4YQVA 2QSIA 4BA7A 1A2JA 4POBA 3IA1A 5KN3A 4K6XA 5GAPD 1VF3A 4GLTA 4ZBAA 2LEGA 2YJHA 2DJ3A 3EINA 4MJAA 3UL3A 2HE3A 1VF4A 4HI7A 3F0IA 1ZGNA 4HU7A 2HSHA 5JCUA 3FR3A 1N4CA 3Q19A 1K3YA 4TR0A 5AIXA 1TK5B 2JSZA 4KX4A 4MA9A 4N10A 1XW9A 1LU4A 1KTEA 4HQZA 4GWRA 3KP8A 1THXA 1HNBA 5HR0A 2H30A 3F4TA 2CAQA 2LO1A 2O87A 4BVXA 4J56E 4IP6A 3EC3A 3TKPA 4L5OA 3KXOA 3BJ5A 2LNSA 2BJXA 2OADA 1O81A 1GUKA 4XS1A 4JR6A 5HFIA 3D4TA 2C3QA 4ML1A 1FHEA 1H75A 2LNTA 1OC9B 4ID0A 6GSVA 2I1UA 3LEFA 1V2AA 2ZCTA 4IW9A 2G2QA 2XBQA 2PPTA 4MP4A 3C73A 4EKZA 2F9SA 5JWQB 3O6TA 4DEJA 2H0HA 3SWLA 4K0GA 1T4YA 1AIUA 3UBKA 2CX4A 5DBQA 1G7OA 2Y4UA 1IURA 4ECJA 3KEBA 2N04A 4YAVA 1RK4A 3MWHA 3GSTA 1WPIA 1WOUA 3F8UA 5DAKB 4DSQA 1OE8A 5J9CA 2NTOA 1QUWA 3EU3A 1G6YA 2IPAA 3HJPA 1SKRB 3FY7A 4J57E 3CTFA 4WKWA 1TOFA 4OFNA 4JZQA 4F9ZA 4I97A 4XCSA 2A2RA 4KW6A 3ZITA 3LXTA 3UARA 2LUSA 2TRXA 3UJ1A 5AISA 5JWRB 3BCIA 2C1YA 4MPGA 3IBHA 5J3RA 3ZVJD 3LG6A 4Q5NA 4POLA 2AHEA 2IFQB 4ZB9A 4HUAA 4IBPA 1T1VA 4DSSB 3IE3A 1N2AA 2PGTA 2TIRA 3KTBA 3WT1A 4IELA 2PF4E 19GSA 2M72A 1J0FA 4QL9A 4TXOB 2IWTA 3M9JA 4N30A 4KDUA 2L4QA 2NBSA 2WJUA 1TTZA 4IKHA 3WGEA 1TK0B 5ECHB 5D9WA 1GTIA 3ME8A 3GTUA 4OFMA 1AXDA 2YZUA 3G7YA 3GMFA 4JE1A 3U5RE 5CYYA 1TKDB 3OR5A 3KMNA 2VO4A 1K3LA 4MZWA 5EPFA 3TJKA 1TU8A 2ON7A 3HZ4A 4WBRD 5DVBA 3HJOA 3UAPA 3QR6A 4GSTA 3A2WA 2FUG2 2HZEB 4XS4A 2XPDA 2XBIA 1M9AA 1ERWA 2EC4A 1AQVA 3Q6OA 4MF7A 2O85A 1T00A 1XVWA 5ELAA 3F9UA 5ABRA 1WMJA 4XHMA 1V57A 2WB9A 3GUSA 4Q5QA 2GQLA 4L0WA 1F6MC 4JRRA 5EY6A 2P31A 4EXJA 1Q4JA 5IOXA 2VOCA 4KNDA 2GGTA 1WWJA 2AJQB 1Z9HA 1XOAA 1XW5A 2I81A 3ZVJA 3D6IA 1PX7A 4XS6A 11GSA 3IAM2 1GRXA 5J9BA 3QDNA 3GV1A 2RIIA 3MSZA 5DJLA 1Z7PA 2CVDA 3M3MA 5IMAA 1J08A 2V1MA 5L71A 1A24A 2QWRB 1SK0A 4TVEA 1A8YA 1ABAA 3ZZXA 5COHA 2GDRA 2H1BA 3GNJA 2QWPB 3NZNA 1K0OA 3TDGA 1QK8A 2PU9C 1K3OA 1R5AA 1B4PA 2HYXA 1NZ6A 2JU5A 1T3BA 4WF5A 4I2UA 1G0TA 3D0ZA 1FVJA 2L59A 2FA8A 4ULXA 1JZDA 2M6YA 4WF4A 3CSJA 3CTGA 2GSTA 2B3SA 1ERTA 3CYNA 3FHKA 3GL5A 3BOAA 4OMVA 2GT6A 4D73A 3ERFA 5ID2A 2HRFA 3IK7A 4V1Ag 5ECSA 2L57A 2LV3A 3H1NA 1PX6A 4PQ1A 4EDZA 3KMOA 1JZWA 4RQRA 2H8LA 5FT3A 3FR9A 1B4QA 4L5LA 1GNEA 1BQ0A 1V58A 5DALA 3EVIA 3LFLA 1BX9A 1W4VA 1HNAA 3TJBA 2LQQA 2YP6A 1KEBA 4MJCA 2VCTA 5G5EA 4F0BA 1HQOA 1WIKA 2O7KA 5DDLA 3GX8A 2GUZA 4HJ2A 2C0DA 1FG4A 3KJYA 2I9HA 3O3TA 4PQHA 2LJAA 5HR3A 4K0NA 5FWGA 5GSSA 2FD3A 4MCUA 5IMVA 1YEPA 5ECLB 2I4AA 1UC7A 5A4WA 3BBYA 1DE1A 2P5QA 1M7TA 3L4NA 2MBTA 4PXOA 2VCQA 2KP2A 1WP0A 1F9MA 1U87A 5J5NA 4EUYA 4TR1A 4RQXA 3WGXA 4K7NA 4MABA 2H6XA 2JACA 3H93A 3IOSA 2HLSA 3GX0A 1NHYA 3GKXA 3GKKA 3TUEA 2VLTA 3DXBA 2LQOA 1T8EB 2GQKA 4HQSA 4RWUA 1VGLA 3DVXA 4WR5A 4F82A 3VLNA 4XTSA 4AJ8A 5AIVA 1PGTA 18GSA 3BD2A 3F6FA 1T4ZA 1EEMA 4NHZA 1AAZA 1XWAA 4TKYA 1SK1A 2V41A 5CNWA 5IO2A 1EGOA 1YDKA 1OKTA 3MAKA 2RUFA 2CTPA 1IYIA 3TKQA 1YEXA 1TU7A 1S3AA 4HEA2 4N0ZA 2K18A 1SKSB 4H86A 3H4KA 1GL8A 2BMXA 1MDIA 4K7OA 5ECIB 2QSAA 3RDWA 2CAIA 3ERWA 4O7HA 4AGSA 2NDOA 4L0UA 1SL0B 1B9YC 4EL1A 1NSWA 2ALBA 1M2DA 2VM1A 3APQA 2LJKA 5DCGA 5GZZB 1VRSD 4TOPA 3F6DA 4DVCA 4ZL9A 1AC1A 1SL1B 2LKUA 2YZHA 2C0FA 1OVNA 1XIYA 4F03A 3G7JA 5ECPB 4XRAA 3D5JA 3KZQA 1THOA 3Q18A 3IR4A 2H72A 3FYGA 2DJ2A 3GRXA 3A3TA 2B7KA 3DRNA 3HCZA 4PNGA 4V2MA 4KB3A 1G7EA 4TR4A 3TJFA 2PUKC 17GSA 2Z9SA 2IMEA 2K9FA 2JZTA 2AUVA 5ELGA 3GHAA 3GL3A 2YWNA 3LSZA 2ZUPA 4KSOA 1GWCA 5D9TA 2FNOA 20GSA 3J7Yk 4K8MA 3ZYWA 3IAS2 3KH9A 4KE3A 3TGZA 2JZSA 3TKSC 3DGQA 1YY7A 2K6VA 1HNCA 5A4UA 2CA8A 3RHCA 1R7HA 1PL1A 2VCWA 3LQ7A 2H0IA 3L0HA 2KLXA 2EJ7A 2AB6A 3K8NA 1S3CA 1EWXA 2OBKA 4ECBA 1DSBA 4TXVA 1SKWB 4OCFA 4ILFA 1U88A 5G30A 1HYUA 2OE3A 4G2EA 4KDYA 4IQAA 2Y4TA 3ZTLA 1PQNA 4O32A 6GSSA 3IHQA 1WJZA 3ZREA 1OKDA 1MDKA 3MNGA 1GSYA 4OO4A 2QGVA 4XRDA 3UBLA 5B8BA 3ZFLA 4IN0A 3J7Yb 3UOMA 3VURA 4RUVA 4J80A 1B48A 5CREA 4WXTA 1USBA 1SJ6A 4F0CA 2R4VA 4NV2A 1F37A 2VL9A 4ECIA 3LXZA 1TRSA 2GS3A 4HS1A 4K7IA 6GSUA 2JL4A 2GTUA 1EEJA 3QAWA 1K0CA 3CRTA 2YCDA 3FZAA 1SENA 1K0AA 1Z3EA 3ZIVA 5G5FA 4ML6A 5F07A 2A4VA 2GSSA 3TRQA 1Q98A 1GLQA 2CZ3A 4POKA 3TJGA 4BVYA 3L9SA 12GSA 2QKEA 2DBCA 2DJ0A 2GQMA 4YH2A 1TRWA 5DAKA 5KN2A 1X9WB 2R5GA 2C3NA 2ES7A 2H76A 2H01A 5IQYA 1GP1A 3KM6A 3P7XA 3CXGA 3RPNA 5LNKe 4LL4B 1QFNA 2H73A 1F2EA 2R3XA 3VPTA 1BAYA 4DSRA 2MYGA 1W89A 3CRUA 1GSQA 1Y6EA 1GSSA 4TN8A 2PWJA 1J9BA 1TP9A 4E8HA 1FAFA 2IFQA 4OFTA 1E6BA 4DSSA 2VM2A 1GLPA 5HFGA 1SJZA 3AG7A 2IMFA 5LD0A 4V2NA 4AJ7A 5A5KA 3PINA 4TXOA 3ZFBA 5IMZA 4MF6A 2HXKA 4MH3A 5C00A 2GZPA 1I9DA 3HYPA 2YS8A 2B1KA 2YJ7A 1GSEA 2VCZA 3IV4A 4FO5A 4AJ6A 2DMLA 1U3AA 3UO3A 2LS5A 2B5YA 3WGDA 2K8VA 1YKCA 4MH2A 2E2GA 5CRHA 1MD4A 2DMXA 1BJXA 3C1RA 2JADA 3KD0A 1ZZYA 2PVOC 4G19A 4PNFA 1EOGA 2YWIA 1DE2A 1U6TA 1OAZA 4MJEA 5DCHA 2WFCA 3FZ9A 1F3BA 2B5XA 4GSSA 1O6JA 1A0RP 1FO5A 3DKSA 3FEUA 5ECQB 5LCZA 2RM6A 3A5WA 2LRCA 2XPEA 2HZEA 1O7UA 2DJJA 4GQCA 3FZ4A 2OJLA 2FWGA 1A23A 1QXHA 1TI1A 1SU9A 4X43A 4K1FA 2AV4A 3F3QA 1R4WA 1PA3A 2B1LA 1BQZA 3KTLA 3UVHA 1PKWA 4ZB8A 4ZIJA 4KCAA 3FW2A 2VUPA 1A2LA 2H19A 1XFLA 3WYWA 3IPZA 4HU9A 2GLRA 2N5FA 2IIYA 1TXXA 1AQWA 2HI7A 1GUMA 1TJDA 5G2ZA 2VIMA 4CHSA 4L8EA 3GN3A 5B6MA 5CRWA 2XHFA 4F2IA 5GSTA 4GXZA 1GH6A 6GSTA 2GVPA 4N0VA 4D73B 2VL2C 3ZL5A 2A2SA 1HD2A 2V6KA 1FB6A 4LA1A 3NOFA 2O8VB 2E7PA 1G6WA 1Z6MA 3N9JA 1LJRA 3APSA 3C7MA 2B7JA 5D96A 3BVOA 1ERVA 2V6OA 3TCOA 1X5EA 1TRUA 9GSSA 5CP1A 2B5EA 2X64A 1V40A 2CVKA 3AY8A 2YV7A 2KUCA 4BWSA 3LJRA 1ST9A 2L4CA 3ZMKA 4Q5FA 2YWOA 8GSSA 1ON4A 2IMDA 3CSHA 3U6VA 1OC8A 4HZ4A 2YWMA 3TRPA 4G9HA 3UEMA 3M8NA 2I3YA 4MLYA 4WBJA 3I9V2 3LGCA 4PUAA 1YQ1A 2QWOB 2DJKA 1PD21 1PL2A 3A2XA 4OD7A 10GSA 3QFAC 1VF2A 2P0GA 3V1WA 1XWBA 3VWXA 4TRXA 2JSYA 5D93A 4MDCA 3TOTA 3VWWA 3KIJA 3QCPA 2CTQA 1ACVA 1XVQA 1XBLA 2X8GA 4KUNA 3G9BA 2WGRA 2X8CA 2M46A 4TR1B 4ACSA 2EIOA 1K0NA 2X99A 13GSA 4LLRA 2HSYA 1QMVA 1SL2B 1MEKA 3D21A 1EOHA 4P3YB 1TI3A 5EL8A 4KCEA 2HT9A 5DJMA 5HR2A 4YAPA 4JR4A 3KCMA 3A2VA 3H79A 1LBKA 1MDJA 1FW1A 1K0DA 2J23A 4IT5A 1K0BA 2AYTA 3DD3A 3GKMA 3GFKA 2JZRA 5IO0A 5INYA 1V9WA 1FB0A 1X0RA 1VF1A 3IK9A 3GH9A 1IYHA 3W8JA 1X5CA 1ILOA 1CQHA 4YQUA 4NWYA 3L9VA 3ME7A 2YN1A 3P2AA 3L78A 2FCHA 5IMCA 3RBTA 5F06A 3P8WA 2WULA 4PX1A 3HY2A 1EGRA 4IJ3A 4IGJA 1RW1A 2AAWA 4FH8A 4V1Ap 2V2GA 4MMMA 2CZ2A 5C04A 1TK8B 2OKAA 2PN8A 4PGTA 2XC2A 2KOKA 1BEDA 2WRTA 1BYEA 1X9MB 2VCVA 4OO5A 1XWKA 2VL3A 1Z7RA 2VD0A 7GSSA 2H71A 5ECOB 2C0GA 4BL7A 3EU4A 2DJ1A 2KQXA 5F8BA 4POMA 2L5LA 1SYXA 4KDXA 1DBYA 3HVVA 5EVOA 2R2JA 4JEDA 2DSAA 3SBCA 4IP1A 5E4WA 2N05A 3QPMA 3RAZA 2PERA 3FRCA 1ZYQB 4LL1B 1EP7A 4RI6A 4GF0A 3F63A 2C3TA 1RQMA 1TDIA 3I43A 4FIWA 5G31A 1ERUA 1MD3A 1SYRA 3PH9A 4ISDA 2H74A 3GIXA 3EMXA 2EIRA 1XOBA 3WD6A 4BWQA 3IC4A 3GKNA 3EYTA 1WE0A 3LWAA 4IQ1A 2IJYA 1PSQA 2B6MA 3MDKA 4LMVA 4NPBA 1TRVA 1QGVA 1PRXA 1R26A 3CMIA 4I5QA 16GSA 3PGTA 3VI7A 3JCML 3UO2A 4IHUA 3WT2A 4WEYA 3APOA 5JCWA 1U3IA 3GURA 3PR8A 1O85A 1OYJA 5HFKA 1PKZA 4TR3A 2YOIA 2H1AA 1M2BA 1OC3A 1SD8A 3UMAA 5G1KA 2L6CA 2H75A 5IIZA 2HZFA 3LORA 1JLVA 3ZLPA 1OC9A 3HKRA 1M2AA 1M99A 2MBSA 4AF2A 5ENUA 3UCSC 5CAXA 2CUGA 2GZZA 5JCGA 2N5BA 3O76A 4FYBA 4CDOA 5B6NA 2WZ9A 2X8HA 4IVFA 1EV9A 2R37A 3FKFA 22GSA 2FLSA 3C71A 4O92A 3QOUA 3DMLA 4PURA 2OBIA 2H1DA 3TB2A 2R6KA 3FZ5A 1GUHA 1GSUA 1NHOA 4GCIA 2LGWA 1FOVA 4NHWA 3D4MA 4XIHA 3CSIA 2NPBA 4HDEA 3UIWA 1A0FA 4EO3A 1ML6A 3VI5A 2LRNA 1XBSA 1KNGA 1NM3A 3IXRA 2CX3A 2RM5A 2WS2A 3N5OA 3HJMA 5AGYA 3GSSA 4ZL7A 1UN2A 5J41A 2FY6A 1SK2A 3GTUB 5D9XA 5ECRB 6GSYA 3F4SA 4ZB6A 2FA4A 2J9HA 2QWNB 2C80A 2YUAA 2HNLA 1DUGA 2QWQB 5J4UA 1URMA 1S3DA 4EF0A 4FYCA 3FK8A 4N11A 3M0FA 3TKSA 1O8WA 2MMNA 2H70A 4EVMA 3TJJA 1PMTA 4XS4B 4J7ZA 4EC0A 4HOJA 1EV4A 1XXUA 3QFBC 1AQXA 4BPYA 2EIQA 3RHBA 3E3EA 1AW9A 2GSQA 3GH6A 3HVSA 1JHBA 5CRDA 4KGIA 1UVZA 3FR6A 3RPPA 3GYKA 1X9SB 1EP8A 2HFDA 1MTCA 1GH2A 5CO3A 2F3MA 2OCHA 4ZBBA 2NVLA 1B9XC 2GSRA 2VCXA 2FGXA 1FAAA 5AN1A 3P90A 1XWGA 2CT6A 4GRFA 3HXSA 3ERGA 2FHEA 3C8EA 3VFIA 5B7CA 2MMAA 5H5RA 4LMWA 2PMTA 2FWEA 1O8XA 5KEJA 2D2ZA 3HDCA 3EWLA 4I2TA 4KSMA 1JZOA 3S9FA 3QAGA 3HHVA 2VAFA 3TOUA 1GTAA 1T7PB 4QQ7A 2YANA 2C4JA 3F3RA 1M9BA 2LTKA 4FYUA 2H1GA 3I6AA 1XCCA 2VLVA 4GQFA 3QMXA 1JFUA 2O89A 2FWHA 3F4RA 5ECMB 2KHPA 2RLIA 3EURA 1YZXA 4K2DA 4ZXGA 4J2FA 4WETA 2QC7A 1NW2A 5D8IA 3TKRA 4X0XA 2LSTA 3NIVA 2DN9A 1UA5A 3US3A 3VPQA 4PQIA 1F3AA 1ZOFA 3L9UA 2CTWA 2G0FA 2CV4A 4ZL8A 1K0MA 2IN3A 5D9VA 2C0EA 4ZILA 3TRXA 1ZMAA 4V2LA 3QD9A 2H6ZA 5ECNB 1XW6A 1QQ2A 2L6DA 2HRNA 2P5RA 2DC5A 2WCIA 3ZIJA 1C72A 2DLXA 4MPFA 5KN0A 3LYPA 1Y25A 3UVTA 5KN1A 3E9JB 5ID2B 5IPHA 3QAVA 5FHIA 3GA4A 5DQSA 3DYRA 4NXIA 1CQGA 1B8XA 2CVBA 4EE0A 2OE1A 5DQYA 2H0GA 2MZCA 2DMMA 5B8AA 4O5RA 3DWVA 4Q5RA 2VD1A 1ZCPA 5IMFA 4YQMA 2GZYA 2OA7A 2PVQA 5IM9A 1GSDA 4MK3A 1AUCA 1XWCA 2F8FA 3VK9A 3HZ8A 4MF5A 5DALB 2OE0A 1GTBA 1OE7A 2CTRA 5F05A 4IJIA 5F0GA 1H4OA 2LRTA 1I5GA 4X1UA 3G7IA 4QL7A 3KGKA 2DIZA 2IMKA 5H5SA 4Z7XA 3M9KA 3ZRDA 2F8AA 2ON5A 2GUZB 3E0UA 5A4VA 1YJ6A 1A8LA 2WDUA 1WJKA 1YKAA 2H66A 3ZMLA 3EE2A 1A2MA 4KA0A 2F51A
chains in the Genus database with same CATH superfamily
3RYFA 4PA6A 3K06A 3ZRWA 5FNVA 2IJKA 5H5QA 3ISOA 2KP1A 1WNSA 1XMOB 5IMDA 4JV5B 1M0UA 2UXNA 3CCUV 1PL4A 2XAHA 2L5OA 4OCEA 4OX9B 5EC1C 2TRCP 2L6LA 2BTOA 1X5DA 2LJRA 3DVWA 4I8BA 1URFA 2LGQA 4NMUA 5IOWA 4O4LB 2RUEA 1NS1A 1BG5A 2ADPA 3ABLB 4UVCA 4MJBA 3IJ4A 3UT5A 4I50B 1KQSU 3ED3A 1TUBA 4MZCA 4NAXA 1NU1H 1OZ0A 3JALB 3DIEA 4MZBA 3LW9A 3BCKA 5HR1A 5ECKB 1YF0A 1HDJA 5IPGA 1K4DC 5D73A 2Q67A 2E0QA 4OWYA 2X7RB 3KH7A 1WPBA 1V55C 1GULA 2REMA 5BXZA 1WRYA 4HSCX 1K33A 2K8SA 2ZE8A 2H8PC 4B3MB 1XZOA 1PNLA 2IMIA 4ZBDA 1GM9A 3T1HO 4HJMA 1YF1A 1ZL9A 1V98A 4RI7A 3JSLA 4DK1A 4I6XA 2R9AA 1N32O 4GSNA 5JWOB 4NB5A 4KAEA 1E79G 4HZ2A 4NR1A 3CMEV 1WB7A 1FJGO 3HD5A 4TQDA 3DEXA 6GSXA 1IXBA 2E2MA 2RNBA 2MMOA 3ZHUA 1CXZB 2MMZA 2KG7A 3LYKA 1O73A 2HP8A 3OEEG 4DV0B 2N5AA 3EMPA 4K9ZA 3QO5A 3K5NA 4LF6O 1EZKA 5E59A 1VQOV 5JJEB 4N21A 2DIYA 2AHZA 4GTUA 3DXRB 2VLUA 2YPMA 2CH7B 3ZRSA 1AROP 1O9GA 2R9IA 3U0ZA 1QVGU 3A2FA 3F5TA 3D22A 2IL3A 2ZINA 3W8SA 2R0GA 1GM7A 4JASA 1Z5YE 2IJIA 3H8QA 2UXDO 3HA9A 4DUZO 1Q7YW 4JU5A 1J95A 3JD0A 1BQ7A 3K9SA 2VL2A 1TW9A 3E8BA 6GSWA 4DW1A 4DR3B 1TGOA 4JBBA 3VWUA 5LGTA 1VQ5V 1VQ4V 4WR4A 3G67A 3IRAA 1SJIA 1QLNA 4IS0A 14GSA 3G6BA 2GBOA 3KP9A 1FVKA 1GSFA 4JI6B 3CC7V 1GTUA 1Z6NA 1DGSA 1ROPA 1XHZA 4ICGA 2C8UA 2PYLA 1ZYEA 2OACA 2XAJA 5CRGA 2V32A 5LYJA 2CQ9A 3HVXA 3CE2A 5H6QA 3R2QA 4K2XA 5G1LA 1E2YA 3R3EA 1SQVH 1ZAUA 3RT3C 1GTOA 5HQPA 1JLWA 1XG8A 2YV9A 4HBNA 3CBUA 5LMNO 2GT5A 1CP9A 4NV5A 2IH1C 3W7SA 5FPOA 4CH3A 4E8EA 1FPOA 3TKSE 1I94O 4JI3O 2Q7GA 4ECCA 2YNXA 3EHBB 3CCJV 3C1SA 2H6YA 3TXSA 2PBJA 4EDYA 5CBFA 3HKEA 4KH7A 4FFBA 1PN9A 1NH2D 1BZKA 1GNWA 1DTOA 4PDVA 4XDKA 2BTOT 4Z2RA 3K58A 2M80A 4DYLA 1YEWA 4P9PA 3ETQA 4QPKA 1SD9A 3L9DA 3Q74A 3AK3A 1R5PA 1KBNA 5J2UA 4G10A 4YHHO 4TW5A 4LF7O 2EX3A 2AXTZ 1JZRA 3A8TA 4X64O 3VWVA 3W6GA 4MVQA 3T1HB 2FWFA 1N8JA 5KOWA 3I69A 4PUFC 1R6TA 4CW9A 1KKDA 3DC6A 2LFRA 1XPVA 3IDVA 2ZNMA 4JI0B 3M1GA 5GAND 4YQVA 1N32B 2Y0PA 2LW7A 5EC2C 2QSIA 1BHBA 4BA7A 1COWG 3SPJA 1IBKO 5KX5B 1HP8A 4KXRA 1VF6A 1A2JA 4WFGA 4IHJA 3K0GA 3IA1A 4POBA 5KN3A 2HJDA 4K6XA 5GAPD 1VF3A 4GLTA 4DW0A 4ZBAA 3CPWU 3L70H 2LEGA 2YJHA 2DJ3A 3EINA 4MJAA 2OCCC 5L3CA 3SR2C 5KA5A 1HR0O 4LF6B 4UV8A 1P84F 3UL3A 2HE3A 1VF4A 3HKBB 5E1AC 2B1IA 5LOVB 4HI7A 1JFFA 3F0IA 1O9HA 1BSMA 1KECA 4I0XA 3RW0A 1ZGNA 1Q81W 3CD6V 1IX9A 1FD9A 1AVMA 3T1CA 4DV1O 4HU7A 1OCZC 2HSHA 5JCUA 2UXDB 4DUZB 4QE7A 3FR3A 2F43G 2PTMA 1N4CA 3Q19A 1NI8A 2IW5A 1I08A 2WLLB 2YEVA 4TOIA 2IJHA 1K3YA 3M8AA 1JJOA 4GX1A 4YKGA 4TR0A 5AIXA 3K59A 4PDLA 1TK5B 2JSZA 4KX4A 2Y69C 4MA9A 4N10A 3AG3C 1XW9A 4HNAB 4YY3O 1LU4A 1KTEA 4HQZA 4GWRA 3KP8A 4G0LA 3K0DA 2YDEA 3E22A 3KCXA 1HNBA 1THXA 1VARA 5LMNB 5HR0A 3H1KH 2H30A 3F4TA 3HKDB 2CAQA 1R3LC 2LO1A 3E83A 4AQYO 2O87A 1I94B 4JI3B 3G6EV 4BVXA 4J56E 4IP6A 3EC3A 3TKPA 4L5OA 3KXOA 3BJ5A 2LNSA 3BABA 2BJXA 2PI4A 4ZIBA 3E8GA 4FLTA 1M5IA 2OADA 1O81A 1XEQA 2HVKC 1JJ2U 1GUKA 4XS1A 4JR6A 1M93A 4PHZA 5HFIA 3D4TA 2ZM6O 2JEUA 2C3QA 4ML1A 1FHEA 3SYOA 1VQMV 1H75A 4YHHB 2LNTA 1OC9B 4ID0A 6GSVA 4X64B 2I1UA 3LEFA 1V2AA 2ZCTA 2P06A 2LW1A 1W0JG 2EILC 4IW9A 4Z2TA 2G2QA 2JK5C 2XBQA 4AHCA 2PPTA 4MP4A 1PNKA 4ZI7B 1IBKB 3C73A 4EKZA 3ABTA 2F9SA 5JWQB 5IYBO 2JDIG 3W7UA 4FLWA 3O6TA 4DEJA 2H0HA 3SWLA 1MMMA 4K0GA 3J81N 1AIUA 1T4YA 1IBMO 3FFQA 3UBKA 2WAMA 1VF5B 3AG1B 4LWSA 1S5HC 1S0VA 1HR0B 2CX4A 5DBQA 3CCMV 1G7OA 2EIKB 2Y4UA 1PL0A 3BA8A 1MNGA 4FZ0A 1IURA 1Q43A 2OCCB 4X1YA 4ECJA 3KEBA 1G6UA 1AR1B 2N04A 4YAVA 2JS3A 4X1KB 4BVYB 1RK4A 3E35A 3MWHA 4DV1B 3GSTA 1WPIA 1V9PA 3ZHSA 4MVUA 1WOUA 3F8UA 3OGIB 5DAKB 5H2FZ 1K92A 4DSQA 1OE8A 5J9CA 2NTOA 1QUWA 2CGNA 4U7NA 3EU3A 1RSOB 1OCZB 1G6YA 3S3XA 5B66Z 2IPAA 1F23A 3HJPA 1SKRB 5CA3A 3FY7A 3OTFA 4J57E 3HR0A 4FZ1A 3CTFA 4I4TA 1P7BA 4WKWA 3FB8C 2P4KA 3IAYA 4YY3B 1A32A 1TOFA 4OFNA 1WLEA 4JZQA 4F9ZA 4I97A 4XCSA 2A2RA 4KW6A 3ZITA 4P2ZA 1VQ8V 1D2DA 2Y69B 3LXTA 1FXHA 4UCSA 4AQYB 2LUSA 3AG3B 4RUFA 2TRXA 3UARA 3UJ1A 1YCIA 5AISA 4ZOLB 4I7ZB 5JWRB 3BCIA 2C1YA 4MPGA 4IGGA 1AJQA 1H2NA 3ZMSA 2NLJC 5KUMA 1N33O 5B5EZ 4JI4O 3IBHA 1BGYH 5J3RA 3LSQA 3ZVJD 2CGOA 2W0XA 5BZBA 3LG6A 4P30A 1IXMA 2BE3A 4TV9A 4Q5NA 1ZUQA 4UV9A 2A2PA 2AHEA 2IFQB 4IIJA 4ZB9A 4POLA 4HUAA 4IBPA 4F6RB 2IH3C 1T1VA 4DSSB 3HVNA 5CBGA 3IE3A 2ZM6B 3JD4A 5J2TA 1N2AA 2PGTA 2R72A 2TIRA 1KC8W 3KTBA 3WT1A 4JYYA 5D5QA 3ZCCA 1VQKV 4IELA 2PF4E 19GSA 2M72A 1J0FA 2ETNA 2KB1A 4PELA 3X2QC 4QL9A 4KHPB 4LFBO 4TXOB 4PD4F 5JCOC 2IWTA 4B7EA 3M9JA 4UCOA 4N30A 4JTAB 1TVKB 3G4SV 5LP6C 4KDUA 3O9OA 2R9RB 5EYPA 2L4QA 2GV9A 4XBFA 2NBSA 2EILB 2WJUA 1BS3A 3WFVA 2WLJA 1TTZA 4IKHA 3WGEA 4X20A 1IBMB 4EB6A 1TK0B 3M7MX 4LNUB 5ECHB 3H1HH 5D9WA 3JATB 1GTIA 5KHJA 3D36A 2YIDA 3ME8A 2ZDIA 1W2BU 1J5EO 3OE7G 3GTUA 4OFMA 3CXHF 1AXDA 2YZUA 3G7YA 3GMFA 4JE1A 4L87A 3U5RE 5CYYA 3IGAC 1SETA 2PUSA 3IFXA 3CSXA 3JYCA 2JGDB 1VQ6V 1TKDB 4DRXB 3OR5A 3RGBA 3OR7C 1BT8A 3KMNA 2VO4A 1K3LA 4MZWA 5EPFA 1RPRA 1TU8A 5F2VO 3TJKA 4FM1A 2ON7A 3HZ4A 2ODMA 4WBRD 5DVBA 1SQGA 1P4RA 3CJHA 4WBNA 3HJOA 4CY6A 4WFBV 4K35A 3CS5A 3P3PA 4CBCA 2RQ6A 1KP2A 3FB5C 4GX2A 2RDCA 1K4CC 2BOCC 4TSFG 3QR6A 4GSTA 3UAPA 3A2WA 2FUG2 2HZEB 4XS4A 2XPDA 2QKSA 2XBIA 4DXWA 1M9AA 1ERWA 5B1AC 2EC4A 1TUEB 1AQVA 4YIPA 1WPXA 3ASNC 3Q6OA 4MF7A 1N33B 4JI4B 2ZIMA 2O85A 1T00A 3UM7A 1XVWA 4MW3A 5ELAA 5E79Z 4UVBA 2WLKA 1U97A 4OGQB 5A9GA 3F9UA 4IL6Z 2QKCA 4J7KA 2Q7HA 3OFNG 5C8YB 3JARB 1WP8A 4ABMA 5ABRA 1WMJA 1JOYA 3OMNB 3THOA 1R3KC 2EIJC 4XHMA 5GONA 1V57A 2WB9A 4RQFA 3OGCC 4B3SB 3GUSA 4Q5QA 4TV8A 2GQLA 4R7CA 1AILA 2WLHA 1P49A 4L0WA 1F6MC 3F7VC 3JAKA 2RCVA 4JRRA 4IYHA 5EY6A 2P31A 4EXJA 1Q4JA 5IOXA 3QO7A 2VOCA 4JTCB 4O2AA 4PA3A 3SPCA 4KNDA 2GGTA 1KBHA 1WWJA 2AJQB 5GTIZ 1Z9HA 3FD9A 1Q86W 1XOAA 1XW5A 3MDSA 2I81A 3X2QB 3ZVJA 3K9AA 4PDMA 3QTCA 3SGIA 1G1XB 5LP6B 4FK5C 2Y0IA 4JI2B 3D6IA 1PX7A 4XS6A 11GSA 3KCYA 3IAM2 1GRXA 2WA4A 5J9BA 3QDNA 3GV1A 2RIIA 4TWKA 3MSZA 1J5EB 5DJLA 2ZKOA 1Z7PA 4FM0A 3AK2A 5EK0A 5BMVA 2CVDA 2HLDG 3M3MA 1EM1A 1SS3A 5IMAA 1J08A 3RVZA 1ZYPA 3BAAA 4GLXA 3ABLC 2V1MA 3JCUZ 4OX9O 5L71A 3ZBHA 1A24A 2W6IG 4X4JA 4XDJA 2QWRB 1SK0A 3CXCU 4TVEA 1A8YA 1ABAA 3OW2U 3ZZXA 4EKWA 3ZMVA 5COHA 2GDRA 4I9QA 2H1BA 3GNJA 2QWPB 3ZMZA 3R66A 3NZNA 3Q4HB 1K0OA 3TDGA 1IBLO 3ZN1A 1QK8A 2PU9C 3OEHG 1NR1A 1K3OA 2YI8A 3FMWA 1R5AA 2FMLA 2HRKA 2Z3YA 1B4PA 4KL1A 2HYXA 1QLEC 4X8AA 1XQ8A 3JAWB 3RYHA 2WPDG 4GX5A 1NZ6A 2JU5A 1T3BA 4DV7B 1THZA 2FB5A 1I5XA 4I2UA 3AK1A 4WF5A 4O2BB 1G0TA 4PDRA 1XHXA 1QCEA 1FVJA 3D0ZA 3P3NA 2X6AA 1VQLV 2L59A 2X0LA 4FLYA 2YSUB 1FFTB 2V1DA 4MT8A 2FA8A 4K5SA 4ULXA 2UUBO 5CA1A 1JZDA 2M6YA 4WF4A 3CSJA 2IU3A 1EFRG 3CTGA 1K73W 2GSTA 3ASNB 2B3SA 1ERTA 3CYNA 3FHKA 2IJJA 1SC5B 4W4LA 3GL5A 1UPGA 2QKAA 3BOAA 1FFXA 2CAZC 4O4IB 3VBBA 4OMVA 1GK9A 3A0BZ 1MOFA 2GT6A 4EFBA 1Y76B 2ZE6A 3ERFA 4D73A 5ID2A 2HRFA 4QGPA 1FXKA 2NNUA 3IK7A 4V1Ag 5ECSA 3JASA 2L57A 4ZHQB 2LV3A 2AHYA 4Z1MG 4DR3O 3H1NA 4YJ2A 5LXTB 3JSNA 3QVNA 4MTXA 1PX6A 2BTQA 4FQUA 4D7TA 4PQ1A 4EDZA 2A4HA 2FTKA 3KMOA 4GYCB 1JZWA 1GN4A 3DC5A 3B09A 3F7YC 2F1MA 2H8LA 4RQRA 3SYPA 5FT3A 3A0HZ 3CCRV 3D3IA 3W7WA 3FR9A 1B4QA 4L5LA 1GNEA 1FYJA 1BQ0A 4KFMA 3UKMA 3SJAC 1V58A 2FYUH 5DALA 3EVIA 3LFLA 1BX9A 1W4VA 1HNAA 3TJBA 4XDLA 2LQQA 2YP6A 1YF2A 1KEBA 4MJCA 2VCTA 4U3JA 4X1IA 4DR5O 5G5EA 4F0BA 2Q9LA 3OR6C 1OCOC 1KKCA 1HQOA 4JI5O 2QEXV 1WIKA 2O7KA 1PV0A 5DDLA 1KU9A 3RYIA 3GX8A 4R50A 2GUZA 1IBLB 4HJ2A 1KMIZ 3I56V 5CBHA 2C0DA 3W7XA 1FG4A 3VOUA 3KJYA 2Q8VA 5CA0A 2Q7EA 2I9HA 3O3TA 1I0HA 2XAGA 4DUYO 4PQHA 2LJAA 4EIPA 1NJIW 5HR3A 4K0NA 3SPIA 5FWGA 5IJ0B 5GSSA 2FD3A 4MCUA 5IMVA 1YEPA 5ECLB 2ADQB 4FFKA 2I4AA 1AJPA 4JI0O 3LDDA 3ZMTA 1YJNV 1UC7A 4BIOA 5A4WA 4QNHB 1QLEB 4X89A 3BBYA 1DE1A 3K03A 2HFEC 2P5QA 3BHPA 5KOXA 1M7TA 2UUBB 3L4NA 2MBTA 4PXOA 2A7WA 1ZLZA 3MHSC 2VCQA 4O4LA 1ZL8B 1XILA 3ASOC 2WLMA 2KP2A 1K5SA 4YJ3B 1QVFU 1WP0A 1F9MA 4I50A 2JEXA 2UXBO 1U87A 5LA6B 5J5NA 4J10A 4EUYA 4GUNA 3JALA 3RFRA 1K8AW 4RQXA 2ZXWC 4TR1A 3E89A 3WGXA 1SQBH 3CCSV 3CP1A 2QE7G 5JVDB 1VEWA 4K7NA 2IU0A 4MABA 2R0CA 1Z5WA 2H6XA 2JACA 3H93A 3IOSA 2HLSA 3GX0A 1NHYA 3GKXA 3GKKA 3TUEA 2VLTA 3DXBA 1M4UA 1Y74B 2LQOA 3L75H 2M7WA 2RN9A 1T8EB 3GB7C 2GQKA 3I5DA 4HQSA 4RWUA 3DTUB 1VGLA 5LGUA 3DVXA 3TXQA 4QPJA 3B8MA 2YXHA 4WR5A 5CMUA 4F82A 3GVMA 3O65A 3VLNA 4XTSA 2PGGA 3ABKB 4RQEA 4AJ8A 3ZEDA 5AIVA 1PGTA 1DLBA 18GSA 3BD2A 3F6FA 3STZC 1T4ZA 1QBZA 1JCHA 1EEMA 4NHZA 3ZS8C 3KZIZ 1AAZA 2IM9A 1XWAA 4TKYA 3DXRA 5LHIA 2F23A 1SK1A 2V41A 5CNWA 5IO2A 1EGOA 4FLZA 1YDKA 2CH7A 3NR7A 1OKTA 3MAKA 2QA2A 4UUJC 2RUFA 2CTPA 4O4HB 4FLVA 1IYIA 3SDLA 3OTOO 4DR5B 3MYDA 3TKQA 4PV1B 1YEXA 4Q6GA 3M99B 3ZMUA 1TU7A 3ZHQA 3D8CA 1S3AA 1WB8A 4HEA2 4N0ZA 2DW4A 4JI5B 5BY1A 2K18A 1L0NH 4BL7B 2QR4A 1SKSB 1N0NA 4H86A 3H4KA 4IYIA 2CK3G 2BMXA 1GL8A 1MDIA 1OCOB 2LP7A 4JYAO 1M56C 4K7OA 1H8HG 1R1BA 5ECIB 2QSAA 3RDWA 2CAIA 3DGEA 3ERWA 3R65A 3WB1A 3CCLV 4DUYB 3QF7A 4O7HA 1G4YB 4AGSA 2NDOA 4L0UA 1VF7A 1SL0B 1B9YC 4EL1A 1NSWA 2ALBA 2QDOA 1M2DA 2VM1A 3APQA 3OM3B 1K5QA 2LJKA 3IC8A 2YI9A 2E75B 2FL4A 5DCGA 3AG1C 5GZZB 1B6QA 1VRSD 1R3JC 2NN4A 3MAQA 1W0KG 3F6DA 4TOPA 4DVCA 1QQCA 2EIKC 2UUAO 4ZL9A 1AC1A 1JMKC 1SL1B 4U3FH 3JD1A 5IYZB 2LKUA 2YZHA 2C0FA 2UXBB 1OVNA 1XIYA 4F03A 4OPHA 3G7JA 5ECPB 3OUFA 4E2LA 2F93B 4XRAA 1XL4A 3D5JA 3KZQA 3ASOB 1THOA 2QTOA 4FPPA 3Q18A 4DO2A 3IR4A 2H72A 4G2KA 3FYGA 2R70A 4GT1A 2DJ2A 3GRXA 3A3TA 2B7KA 3DRNA 4O4JB 3HCZA 4PNGA 2ZXWB 5EZYB 4V2MA 4KB3A 3ZJZA 2HR3A 5FLXN 1G7EA 2OIGA 4FIPC 4TR4A 3TJFA 2PUKC 17GSA 2Z9SA 2IMEA 1HNWO 2K9FA 2JZTA 3WB0A 2AUVA 5ELGA 2V7QG 3GHAA 3GL3A 1GN3A 2B1GA 5KX5A 2YWNA 3LSZA 2ZUPA 4GKKO 3OUSA 4KSOA 3RYCB 1GWCA 5D9TA 5KA6A 2FNOA 3JCZA 3E2EA 2GTSA 3CEIA 1KYOF 20GSA 2HSMA 3J7Yk 1YJ9V 4K8MA 3HKBA 3ZYWA 5LOVA 2YC0A 5DEDA 1BE3H 3IAS2 3T4DA 3KH9A 4KE3A 3TGZA 4B7KA 2HHHB 3OTOB 1Q3EA 2JZSA 1M9NA 5A2QN 2B9ZA 2H94A 3TKSC 4X88A 3DGQA 1YY7A 2K6VA 1HNCA 5A4UA 1YIJV 5B1OA 2CA8A 3RHCA 5JQGB 5K1XA 4FLXA 1PL1A 1R7HA 2VCWA 4PI0A 4JYAB 2JGUA 2WLLA 1GM8A 3LQ7A 3B8NA 2H0IA 2C2AA 1Z5VA 4Z1VA 3L0HA 5JH7B 2KLXA 2EJ7A 2AB6A 2VS0A 1Q90D 3K8NA 2MW2B 4UB6Z 5IYCO 1EWXA 1S3CA 2OBKA 4ECBA 1DSBA 1M56B 2DKIA 3ETDA 4TXVA 1SKWB 3BEHA 4OCFA 4HNAA 4ILFA 4D6TH 1U88A 4KHPO 4BIKA 3VQVA 5G30A 1HYUA 1R6NA 2OE3A 3K3WA 2XTAA 3CX5F 4G2EA 4KDYA 4MVZA 1XDCA 4IQAA 2Y4TA 1NTKH 2ZR3A 1I7FA 3ZTLA 1PQNA 4O32A 6GSSA 3IHQA 3WB2A 1NT2B 2UUAB 5CB4B 4I55B 4B3TO 1WJZA 1NR7A 3LSUA 3ZREA 1S76D 2A79B 4DV4O 1MDKA 1OKDA 3MNGA 4G27B 5FPRA 5KAIZ 1GSYA 4OO4A 2QGVA 4XRDA 2E3CA 3UBLA 5B8BA 3ZFLA 4IN0A 1BHAA 3U10A 5BRTA 3J7Yb 3OD4A 4DR2O 3RWRD 3ABUA 5ITZB 3UOMA 3VURA 4EFEA 4J80A 1B48A 4RUVA 4JAUA 5CREA 4WXTA 1USBA 4QJFB 1SJ6A 4F0CA 3BRCA 4UFZA 2R4VA 4NV2A 1DK1A 2OYQA 4PA4A 1QHTA 4HAMA 1F37A 1HNWB 3PPUA 4X66O 2ITCC 4UB8Z 2VL9A 3RN4A 4ECIA 2VRZA 5IYDO 4ZI7A 3HKCB 1TRSA 2GS3A 3LXZA 4HS1A 4K7IA 6GSUA 1ZYNA 2JL4A 3AEIA 4DR6O 2GTUA 3P30A 4GKKB 1EEJA 3QAWA 4BIUA 2P7TC 1K0CA 4JI7O 3CRTA 2YCDA 1WA8B 5B1NA 4K8XA 1SENA 3FZAA 1K0AA 1Z3EA 3ZIVA 1H2GA 1PM9A 1NVPB 5G5FA 3CCVV 4ML6A 1N0JA 5F07A 4IIJB 2A4VA 2GSSA 1ENVA 3TRQA 1Q98A 1GLQA 2ZE7A 4K0KB 2MK3A 2CZ3A 4POKA 3TJGA 1K97A 4W4KA 5KHHA 4BVYA 4X1KA 3L9SA 1YSCA 12GSA 4JI1B 2QKEA 2A9HA 4JAVA 2DBCA 2DJ0A 2ITDC 2GQMA 2XOKG 2BCCH 4YH2A 1TRWA 1F7YA 5DAKA 5KN2A 1X9WB 2R5GA 3T1YO 2C3NA 2YXYA 2ES7A 2HVJC 2H76A 2H01A 5IQYA 1RSOA 3LUTB 2B5UA 5KMGB 2YICA 1MZFA 1GP1A 3KM6A 3P7XA 4B3SO 1AP5A 3CXGA 3MHHC 2GDSA 2HJFC 4X20B 3RPNA 5LNKe 4EEQA 4LF8O 1H2KA 1N34O 2ZIOA 4LL4B 1QFNA 2H73A 1F2EA 5IE9A 2R3XA 4DR4O 2A0LA 3VPTA 1BAYA 5H9CA 1YXBA 4JPRA 4DSRA 2MYGA 4K3AA 1W89A 2BSKA 3CRUA 4LF9B 3C3TA 3RVYA 3LNMB 1GSQA 2IBZH 2F4VO 1D5AA 4LP8A 4LBEC 2Q6AA 1Y6EA 1GSSA 3K57A 2QA4V 4P9OA 2GHYA 5H5NA 4ZOLA 4TN8A 2WLNA 1K9MW 1KD1W 4JI8O 4B3TB 1VQ7V 4TUYB 4JI2O 4DV4B 2JJ1G 2PWJA 4I5SA 3N2KB 4X62O 1J9BA 1YI2V 4CH6A 1TP9A 4E8HA 2ZNIA 2WWWA 3AG2C 4CZZA 1FAFA 2IFQA 4F6RA 3CMAV 4OFTA 3L72H 4DR2B 1E6BA 4DSSA 2VM2A 1GLPA 3OMAB 2P4VA 5HFGA 1SJZA 3AG7A 1SF9A 2X6CA 2IMFA 5LD0A 4V2NA 4AJ7A 4J7JA 4J9YB 5A5KA 3TCUA 1L8DA 2DWDC 1CEZA 3PINA 4TXOA 1VMGA 3ZFBA 5IMZA 4X66B 4UCTA 4MF6A 2HXKA 1TVKA 2DYRB 4MH3A 5C00A 2GZPA 1I9DA 4CC5A 3HYPA 2YS8A 4DR6B 4G28B 4JTDB 4OXSA 2B1KA 4JI7B 5IJ9B 4K5RA 2YJ7A 1Y6XA 4LNUA 1GSEA 1EBOA 3JATA 1FOHA 2VCZA 3IV4A 4DR7O 4FO5A 1T5EA 2XAQA 4AJ6A 4MS2A 4DV7O 2GTAA 4ZBMA 2DMLA 5B3SC 2O57A 1U3AA 3CC2V 1ZWIC 4LFAB 3UO3A 2LS5A 5DM6V 2B5YA 1SQQH 3WGDA 2K8VA 1YKCA 4MH2A 2E2GA 5JJNB 2JGDA 5CRHA 1JPXA 1MD4A 2DMXA 3H1JH 5JJJB 2JADA 4DRXA 3C1RA 1BJXA 3KD0A 5HFLA 2ATKC 4U7OA 5GTHZ 1ZZYA 2PVOC 4G19A 5KHKA 4PNFA 4KP4A 3T1YB 2VWJA 1Q6HA 1EOGA 1NKDA 2YWIA 2A06H 1DE2A 1RPOA 2QM7A 1U6TA 3ICXA 1OAZA 1AI5A 1MABG 4MJEA 5DCHA 2WFCA 3FZ9A 1F3BA 2B5XA 4LH6A 4GSSA 1O6JA 1A0RP 1FO5A 3CRQA 3U11A 4LF4O 4GZRB 4LF8B 1N34B 2LQTA 4DR4B 3DKSA 3FEUA 5ECQB 5LCZA 1PPJH 1E1RG 2W6JG 2RM6A 3A5WA 2LRCA 2XPEA 2HZEA 1O7UA 2DJJA 4GQCA 3FZ4A 2OJLA 2F4VB 3E8FA 4EIQA 1SQPH 2EJRA 3A0RA 4JZ2A 2ZE5A 2FWGA 2BOBC 1A23A 4UCRA 1QXHA 3A5IA 1TI1A 4JI8B 3IC7A 1SU9A 4X43A 4K1FA 1XNRO 1KB9F 2K1EA 4TQFA 2AV4A 4Z2UA 1V54C 3F3QA 1N36O 1PA3A 2AW9A 1R4WA 2B1LA 2K9PA 4X62B 1BQZA 3KTLA 2HKOA 3UVHA 2VQFO 1PKWA 2KSDA 5C8YA 4ZB8A 4ZIJA 3JARA 3J80N 4KCAA 4GX0A 3FW2A 2VUPA 3AG2B 4Z2WA 1A2LA 2H19A 1XFLA 4JYCA 3IPZA 4HU9A 3WYWA 2QGNA 5LL6Y 2GLRA 1Q5OA 1UJWB 2WLIB 1BMFG 1DF5A 4PI2A 2N5FA 4OPAA 5IWAO 2IIYA 4F6EA 1EN5A 1TXXA 1AQWA 2HI7A 4BW5A 2Q0OC 1W59A 1GUMA 1XL6A 1TJDA 5JCOA 5G2ZA 3VQYA 2VIMA 4CHSA 4L8EA 3GN3A 5EIBC 3TETA 5LP6A 3ZHTA 2EINC 3L71H 5B6MA 4DR7B 5CRWA 4YXWG 1M57C 2XHFA 1SA0B 1QNMA 4F2IA 5GSTA 5IY5C 4GXZA 1GH6A 6GSTA 1JVMA 2GVPA 4N0VA 2HG5C 4D73B 4DV6O 4GKJO 2VL2C 1TAEA 3ZL5A 1R3IC 5HFMA 2A2SA 1HD2A 3SPHA 2V6KA 1YTFB 1FB6A 4LA1A 3NOFA 5B3SB 2O8VB 1JA8A 2E7PA 1UFIA 4A5UB 1G6WA 1Z6MA 1HWYA 3OAAG 3N9JA 1LJRA 4TT3G 3APSA 3C7MA 3N2GB 2B7JA 5D96A 4MVOA 3BVOA 1ERVA 2V6OA 3Q4HA 3OT7A 3TCOA 4LF4B 3LDEA 1X5EA 1TRUA 3EPTA 9GSSA 5CP1A 2B5EA 2X64A 1V40A 1PD3A 2RMKB 3RYFB 3ZRWB 2CVKA 5FNVB 3JAWA 1F4MA 3AY8A 1WAZA 2YV7A 2KUCA 4BWSA 3PJSK 3LJRA 3B77A 1MSWD 1QR9A 1ST9A 4O2BA 3CWBH 2L4CA 3ABKC 3ZMKA 4Q5FA 1XNRB 2YWOA 8GSSA 1ON4A 2H3OA 1AI4A 1N36B 2IMDA 3CSHA 3U6VA 1OC8A 4HZ4A 2Q73A 1AI6A 4DV2O 2YWMA 3M8NA 4G9HA 3TRPA 5GW7A 3UEMA 3UT5B 3SYAA 1LUWA 2VQFB 1TUBB 2ZR2A 2I3YA 4MLYA 1ZSPA 4WBJA 3I9V2 1V54B 4NXNO 2DYSC 4ZKIA 4O4IA 3LGCA 2HEPA 1D5NA 4PUAA 1Y76A 2Q5ZA 3JD3A 2OTLV 1YQ1A 2QWOB 3L73H 2DJKA 5BR8O 4QE9A 1AJNA 1P7GA 3FAVA 4I9WA 5ID2B 4HYOA 1PD21 1PL2A 4H13B 1VF6C 3A2XA 5IWAB 4OD7A 1ZX3A 4ZHQA 1U96A 10GSA 1L0LH 3QFAC 1VF2A 2P0GA 3ZX6A 3V1WA 2UXXA 4LR3A 1TA8A 3SYCA 5LXTA 1XWBA 3VWXA 4TRXA 3W7TA 3CHXA 2JSYA 1IDSA 5D93A 2VWKA 1YITV 4MDCA 3TOTA 3VWWA 2KG7B 4JGSA 3KIJA 2CTQA 3QCPA 3FYEB 3H1LH 1ACVA 1XVQA 2V4DA 1XBLA 2X8GA 1S77D 4KUNA 1PN0A 2AGAA 1YJWV 3G9BA 2WGRA 2X8CA 3EVKA 5KUKA 2ARHA 4RAIA 2EINB 3SJQC 2M46A 2EZOA 4TR1B 4DV6B 2EULA 4ACSA 4GKJB 2EIOA 1M57B 1K0NA 4YKFA 5IY5B 2UXCB 1IVSA 3AG4B 2X99A 2JRIA 5LHGA 13GSA 4LLRA 2DE0X 2Q68A 2HSYA 4MTOA 3MIXA 1VQPV 1QMVA 3BA9A 1GO3F 1SL2B 4CH5A 1MEKA 5KAFZ 3D21A 4FVMA 1EOHA 4P3YB 1TI3A 1OCCC 5EL8A 2AZ2A 1OCRC 2P5OA 4USSA 1PFOA 4KCEA 5LYJB 2HT9A 5DJMA 3QO8A 1S5JA 3G80A 5HR2A 4NVPA 4AILC 4YAPA 5J9PC 2EIMC 5IJ0A 4JR4A 3KCMA 2KKWA 3QG5A 3A2VA 3H79A 1N8RW 4L8JA 1LBKA 1FW1A 1MDJA 5K1PA 5L3GA 2QM4A 1K0DA 2J23A 4IT5A 3NXSA 1K0BA 2AYTA 3DD3A 4WCEV 3GFKA 3GKMA 1XNQO 1OJHA 2JZRA 3LNNA 4DV2B 5IO0A 1V9WA 1FB0A 1X0RA 5INYA 3VQXA 3HKEB 1VF1A 3IK9A 5EBWC 4FFBB 4NTWA 1ZL8A 1KP3A 3GH9A 4YJ3A 1IYHA 4NXNB 2ZNJA 3W8JA 5LA6A 5CN0A 5EBLC 2P6JA 3K5LA 1X5CA 3JD2A 1VIBA 3N27A 1CQHA 1ILOA 4LC1A 1B3QA 3VQWA 5JVDA 2HHHO 4NWYA 5BR8B 3L9VA 3ME7A 4YQUA 4MTGA 2YN1A 5J2UB 2DYSB 3P2AA 3RBZA 3L78A 2FCHA 5IMCA 3RBTA 4JZGA 3BFRA 5F06A 3P8WA 1PKXA 1Y74A 4WF9V 2WULA 1FXVA 1RM1C 4PX1A 1K7DA 4IHJB 4NTYA 1XREA 3HY2A 1EGRA 4IJ3A 3QNEA 4IGJA 1H2MA 1RW1A 4MNNA 2AAWA 4FH8A 4V1Ap 3EXAA 2V2GA 4MMMA 2CZ2A 3CRRA 5C04A 1TK8B 2OKAA 2PN8A 4G0IA 4PGTA 1JFFB 4LFCO 2XC2A 3SPGA 2KOKA 2L35A 4I0XB 4WFHA 1BEDA 2WRTA 1LNQA 1SKVA 1BYEA 1X9MB 2VCVA 4OO5A 1XWKA 2VL3A 4O4HA 2OWOA 1Z7RA 2E76B 2EBOA 3MD0A 2VD0A 2Q4PA 7GSSA 2H71A 2Q69A 5ECOB 2C0GA 4C7UA 2FKXA 1V55B 4RO2A 4BL7A 2YEVB 5DECA 2XAFA 4MVMA 3TK1A 2YXLA 2XT9A 3EU4A 2DJ1A 4KF9A 2E5LO 2KQXA 5F8BA 1FJGB 1RP3B 4POMA 2L5LA 1SYXA 2PZSA 3H9VA 2Z5UA 3FB6C 4KDXA 2ILMA 1DBYA 1OCCB 4CC6A 4WFFA 4MW8A 2LJ2A 1OHHG 3E22B 4CS3A 3J7AU 3HVVA 1OCRB 5EVOA 2R2JA 4JEDA 2DSAA 3SBCA 4BVXB 1Q6UA 3IC9A 3BY6A 3K5OA 2EIMB 4LH7A 3ZHVA 2WA3A 1XNQB 4IP1A 5E4WA 2N05A 3QPMA 5IDJA 1WN7A 3RAZA 2PERA 3FRCA 1ZYQB 4LL1B 1EP7A 4RI6A 4D7SA 4GF0A 3ETEA 5IYZA 2HRAA 3F63A 2C3TA 1ORQC 1RQMA 1TDIA 2PYJA 1GAXA 3FKSG 4K0KO 3I43A 4FIWA 4WFEA 2UZ8A 2ZD9A 1NVPD 5G31A 1G8MA 1ERUA 4JI1O 1MD3A 1SYRA 3JAMN 2X4AA 3PH9A 2H74A 1AR4A 4ISDA 1EN6A 3GIXA 4O4JA 5EZYA 3K79A 3EMXA 3STLC 2EIRA 3ABMC 1XOBA 4RUEA 4O5UA 4F4LA 3WD6A 2YIBD 1WP7A 4BAYA 3D36C 4BWQA 3IC4A 3GKNA 2ZDIC 4GCZA 1NH2B 3EYTA 1GN6A 4J41A 4LWSB 1RM1B 1R6KA 1WE0A 3LWAA 3RYCA 4IQ1A 1GKFA 5LGNA 3BCCH 5KHIA 2IJYA 1PSQA 2B6MA 3MDKA 3FB7C 4NTXA 4LFCB 4LF9O 4LMVA 1TRVA 4NPBA 3KG2A 1QGVA 3L74H 4X1YB 3SJCC 1PRXA 3HKDA 1R26A 1K3EA 3CMIA 4J9ZB 4I5QA 16GSA 2XNDG 3PGTA 3VI7A 3JCML 5TISZ 3UO2A 4IHUA 3WT2A 1H2LA 5L3DA 1KUQA 4WEYA 3APOA 5JCWA 1U3IA 3GURA 3PR8A 2X49A 4LF7B 3C3SA 1SERA 1O85A 1OYJA 5HFKA 1PKZA 4TR3A 2UUCO 4NYKA 2YOIA 2H1AA 3TGUH 1M2BA 5JQGA 1LR1A 1OC3A 1SD8A 5L3BA 2E5LB 3UMAA 2LFSA 5G1KA 5B1BC 5AG2A 2D2CB 2H75A 2L6CA 5IIZA 2F95B 2HZFA 4JYBA 2Q0AA 5JH7A 3LORA 1JLVA 3ZLPA 3CB2A 4I4TB 2CDYA 1YHQV 2XUMA 1QR8A 2DYRC 5IT9N 1K34A 1OC9A 3HKRA 1M2AA 1M99A 2MBSA 1SESA 2A3QA 5ENUA 1B04A 4AF2A 1YVWA 1NBMG 3UCSC 3UQ8A 5CAXA 2CUGA 4K8ZA 2GZZA 2N5BA 5DN6G 2YIAA 3O76A 4FYBA 5JCGA 1US6A 4CDOA 5B6NA 2WZ9A 4MVSA 2X8HA 2X6BA 4IVFA 1EV9A 4NXMO 2R37A 1H8EG 3HB3B 3FKFA 5CB4A 4I55A 1FS0G 22GSA 2FLSA 3H1IH 3C71A 4TV9B 4O92A 3QOUA 3DMLA 3CQFA 2JVDA 4PURA 3T4ZA 2H1DA 2OBIA 4CY8A 4BW9A 3TB2A 2R6KA 3CYOA 4R6ZA 3DSQA 4LFAO 1GUHA 3FZ5A 4B3RO 1E1QG 1PNMA 5J2TB 3ZRXA 1GSUA 2E74B 2ZCEA 2G38A 5ITZA 1NHOA 4GCIA 2LGWA 3ZRVA 4NHWA 1FOVA 2PI5A 3D4MA 4G0KA 1XMQO 3CSIA 4XIHA 2NPBA 3GWKC 1AP6A 4HDEA 2BSKB 3UIWA 1A0FA 4EO3A 1ML6A 3VI5A 3K08A 2LRNA 5EYPB 2P90A 2UU9O 4ICYA 4N23A 1XBSA 1KNGA 1NM3A 3IXRA 2CX3A 3HKCA 2RM5A 1BCCH 2WS2A 3ABMB 3N5OA 4UVAA 1H2SB 4EB6B 3HJMA 5AGYA 3GSSA 4ZL7A 3EFFK 2DWEC 1UN2A 5J41A 1WA8A 2FY6A 1S5LZ 2N74A 4HZ3A 1L1FA 1SK2A 4BIZA 3GTUB 3CRMA 5D9XA 5ECRB 3E86A 4PA9A 1DF4A 6GSYA 1EZJA 4R8CA 1VP7A 3F4SA 5KHGA 2VQEO 4ZB6A 2FA4A 2J9HA 2QWNB 1LUVA 2YUAA 3KKYA 2D3OW 2C80A 1JX9A 2HNLA 2RJZA 4DR1O 1SQXH 4J11A 1DUGA 2YIBA 2UUCB 4PJ0Z 2EZPA 1Y66A 2QWQB 4Q20A 5J4UA 1URMA 1S3DA 4EF0A 4FLUA 4FYCA 3CJHB 4H44B 4WBNB 3FK8A 4N11A 3IHGA 3M0FA 5KMGA 3TKSA 4BWAA 2JS5A 2AZ0A 2QTSA 1O8WA 2MMNA 3S3WA 1M3JA 3TJTA 4FM2A 1NTMH 1XUQA 2H70A 4EVMA 3TJJA 2W0FC 1PMTA 5B1BB 2PY5A 4UCUA 4XS4B 2OT5A 1AI7A 4CS4A 4WFAV 2NR5A 4J7ZA 4EC0A 4HOJA 1EV4A 1XXUA 3QFBC 1AQXA 4LCUC 4BPYA 2EIQA 4H33A 3CC4V 2DQ0A 4DV5O 1AB3A 3RHBA 3F5WC 2ZT9B 3E3EA 1F4NA 4NXMB 3HPLC 1NTZH 1AW9A 2GSQA 3GH6A 5LMUO 3HVSA 4DV3O 1JHBA 5CRDA 4KGIA 1UVZA 4LF5O 3H01A 3FR6A 4TUYA 3GYKA 3RPPA 1X9SB 1EP8A 2HFDA 1MTCA 1XI1A 1GH2A 3E8HA 5CO3A 2F3MA 3N2KA 2OCHA 3C90A 4ZBBA 4X65O 5GONB 1FXKC 4UCVA 2DOSA 1OV9A 2NVLA 4B3RB 1B9XC 1Q82W 2GSRA 2VCXA 2ZQMA 2FGXA 4TV8B 4J42A 3JAKB 1FAAA 1HNXO 5LHHA 1XMQB 5AN1A 1R73A 3P90A 4O2AB 4O5QA 1X4TA 1XWGA 2CT6A 1SZTA 3HXSA 4GRFA 2XASA 1YTFD 5LBQA 1JQ0A 3ERGA 2FHEA 1MA1A 3C8EA 3VFIA 4B08A 3WG7C 2UU9B 1M3IA 5B7CA 2MMAA 3CRCA 5H5RA 2F66C 2JJ2G 4LMWA 2PMTA 1MG1A 2FWEA 1XOUA 4KUMA 1O8XA 5KEJA 2D2ZA 3HDCA 3EWLA 3SJBC 5IJ9A 2Y48A 4I2TA 4KSMA 1JZOA 3S9FA 3LSSA 3QAGA 3HHVA 2VAFA 3TOUA 1GTAA 3ML0A 1T7PB 3CRAA 4QQ7A 3PN1A 5BMVB 4MSWC 2YANA 2C4JA 3K5MA 3F3RA 1M9BA 1SZXA 2Z0AA 2DQ3A 2LTKA 2VQEB 4FYUA 2H1GA 3I6AA 1XCCA 2VLVA 4GQFA 3FYIB 3QMXA 1JFUA 4DR1B 2O89A 5KLVH 3B4SA 2FWHA 5C93A 4LFBB 1EZVH 3F4RA 5ECMB 1FKAO 2KHPA 2RLIA 2XHBA 3K04A 3EURA 1YZXA 4K2DA 4MVRA 4ZXGA 3CCEV 4A5PA 4J2FA 2P22C 1AR5A 4WETA 2QC7A 1NW2A 5D8IA 3TKRA 4X0XA 2QM8A 2LSTA 2DN9A 1M1KW 3NIVA 1UA5A 1HNZO 1ZTEA 3US3A 3VPQA 4PQIA 3D3QA 4FMTA 1F3AA 1ZOFA 3RYHB 3L9UA 2CTWA 1HW7A 1S3RA 2G0FA 2CV4A 4ZL8A 1K0MA 1JR9A 5D5PA 1XMOO 2IN3A 4DV5B 5D9VA 5EBMC 4JV5O 2OTJV 2CE4A 1GRJA 1YDXA 1M90W 2C0EA 4ZILA 1CPYA 5LMUB 3TRXA 1Z2GA 4DV3B 4E4EA 2OIEA 1ZMAA 2DJVA 5CA1B 4V2LA 4LF5B 3QD9A 3B2EE 4JF3A 2H6ZA 5ECNB 1XW6A 1QQ2A 4PTSA 2L6DA 2HRNA 2P5RA 2DC5A 4YIOA 1VQNV 2WCIA 3ZIJA 4CS2A 3G71V 1C72A 5L3EA 2DLXA 1GN2A 4MPFA 1FFXB 3AG4C 4X65B 5KN0A 3LYPA 4AI8A 1QU7A 1BL8A 1NQTA 3FX7A 1Y25A 3UVTA 5KN1A 3E9JB 1B06A 3B40A 4FJCC 2R0PA 5EIBD 1HNXB 3QAVA 3OMIB 5FHIA 5IPHA 2UXCO 3GA4A 5DQSA 3DYRA 1FXKB 4NXIA 1IZ3A 3JASB 1Q6IA 1CQGA 1B8XA 4B3MO 5FL7G 2CVBA 4EE0A 2WLIA 4JAAA 2OE1A 4YJ2B 5DQYA 4H37A 2H0GA 1PP9H 2DMMA 2MZCA 1YZBA 4CH4A 5B8AA 2BTQB 4O5RA 1VQ9V 2WSSG 3DWVA 4Q5RA 3I55V 1ZCPA 2VD1A 5IMFA 4YQMA 5H6RA 4X9QA 4UXNA 2GZYA 2OA7A 5B1AB 2PVQA 3WG7B 5IM9A 1GSDA 1S3JA 4QIWF 1MZEA 4MK3A 1F51A 1AUCA 1XWCA 2F8FA 3VK9A 3HZ8A 4DV0O 3T2MA 1SA0A 2GSMB 2JIZG 3ETGA 1Y67A 4MF5A 3BPZA 5DALB 4BR6A 1MSDA 2OE0A 1GTBA 1OE7A 1EN4A 2CTRA 2QJ1A 5F05A 3SYQA 4IJIA 4H0LB 3ZHRA 5L3FA 1Y4MA 3LDCA 1S72V 4U3JB 5F0GA 1H4OA 2QA1A 4X1IB 2LRTA 1I5YA 2P67A 2EIJB 5JWPA 1I5GA 3G7IA 4X1UA 4QL7A 3FAVB 1RFYA 3ZN0A 3KGKA 5BMUA 2DIZA 2IMKA 4NKGB 4DK0A 1SQFA 1SRYA 5H5SA 4Z7XA 4MTFA 3P32A 3RYIB 3M9KA 3ZRDA 2F8AA 2ON5A 2GUZB 3E0UA 1Q8IA 5A4VA 3ZIAG 3N2GA 4ASUG 1YJ6A 1A8LA 4PA7A 3CCQV 2WDUA 1WJKA 1X59A 5CA0B 1HNZB 4JI6O 1YKAA 2DKHA 2H66A 3WU2Z 3ZMLA 1H38A 3EE2A 3GWOA 1GMGA 1A2MA 4KA0A 2F51A
chains in the Genus database with same CATH topology
5H5QA 3ISOA 2KP1A 5IMDA 1M0UA 2L5OA 4OCEA 2TRCP 2L6LA 1X5DA 2LJRA 3DVWA 4I8BA 5IOWA 4NMUA 2RUEA 1BG5A 4MJBA 3ED3A 4MZCA 4NAXA 3DIEA 4MZBA 3LW9A 3BCKA 5HR1A 5ECKB 1YF0A 1HDJA 5IPGA 5D73A 2E0QA 4OWYA 3KH7A 1GULA 2REMA 1WRYA 2K8SA 2IMIA 1XZOA 4ZBDA 4HJMA 1YF1A 1ZL9A 1V98A 4RI7A 4I6XA 4GSNA 5JWOB 4KAEA 4HZ2A 3HD5A 3DEXA 6GSXA 2E2MA 2MMOA 2MMZA 3LYKA 1O73A 2N5AA 3EMPA 4K9ZA 1EZKA 5E59A 2DIYA 4GTUA 2VLUA 2YPMA 3D22A 2IL3A 3W8SA 2R0GA 3H8QA 1Z5YE 3HA9A 4JU5A 1BQ7A 2VL2A 6GSWA 1TW9A 4JBBA 3VWUA 4WR4A 3IRAA 1SJIA 4IS0A 14GSA 3KP9A 1FVKA 1GSFA 1GTUA 1Z6NA 2C8UA 2OACA 1ZYEA 5CRGA 2V32A 2CQ9A 3HVXA 4K2XA 3R2QA 5G1LA 1E2YA 3R3EA 5HQPA 1JLWA 2YV9A 3CBUA 2GT5A 4NV5A 4E8EA 1FPOA 3TKSE 4ECCA 2YNXA 3C1SA 2H6YA 2PBJA 4EDYA 4KH7A 1PN9A 1GNWA 2BTOT 4Z2RA 2M80A 1SD9A 3Q74A 1R5PA 1KBNA 4G10A 4TW5A 3VWVA 1JZRA 3W6GA 2FWFA 1N8JA 5KOWA 3I69A 4PUFC 4CW9A 1XPVA 3IDVA 2ZNMA 3M1GA 5GAND 4YQVA 2QSIA 4BA7A 1A2JA 4POBA 3IA1A 5KN3A 4K6XA 5GAPD 1VF3A 4GLTA 4ZBAA 2LEGA 2YJHA 2DJ3A 3EINA 4MJAA 3UL3A 2HE3A 1VF4A 4HI7A 3F0IA 1ZGNA 4HU7A 2HSHA 5JCUA 3FR3A 1N4CA 3Q19A 1K3YA 4YKGA 4TR0A 5AIXA 1TK5B 2JSZA 4KX4A 4MA9A 4N10A 1XW9A 1LU4A 1KTEA 4HQZA 4GWRA 3KP8A 4G0LA 1THXA 1HNBA 5HR0A 2H30A 3F4TA 2CAQA 2LO1A 2O87A 4BVXA 4J56E 4IP6A 3EC3A 3TKPA 4L5OA 3KXOA 3BJ5A 2LNSA 2BJXA 2OADA 1O81A 1GUKA 4XS1A 4JR6A 5HFIA 3D4TA 2C3QA 4ML1A 1FHEA 1H75A 2LNTA 1OC9B 4ID0A 6GSVA 2I1UA 3LEFA 1V2AA 2ZCTA 4IW9A 4Z2TA 2G2QA 2XBQA 2PPTA 4MP4A 3C73A 4EKZA 2F9SA 5JWQB 3O6TA 4DEJA 2H0HA 3SWLA 4K0GA 1T4YA 1AIUA 3UBKA 2CX4A 5DBQA 1G7OA 2Y4UA 1IURA 4ECJA 3KEBA 2N04A 4YAVA 4BVYB 1RK4A 3MWHA 3GSTA 1WPIA 1WOUA 3F8UA 5DAKB 4DSQA 1OE8A 5J9CA 2NTOA 1QUWA 3EU3A 1G6YA 2IPAA 3HJPA 1SKRB 3FY7A 4J57E 3CTFA 4WKWA 1TOFA 4OFNA 4JZQA 4F9ZA 4I97A 4XCSA 2A2RA 4KW6A 3ZITA 3LXTA 3UARA 2LUSA 2TRXA 3UJ1A 5AISA 5JWRB 3BCIA 2C1YA 4MPGA 3IBHA 5J3RA 3ZVJD 3LG6A 4Q5NA 2A2PA 4POLA 2AHEA 2IFQB 4ZB9A 4HUAA 4IBPA 1T1VA 4DSSB 3IE3A 1N2AA 2PGTA 2TIRA 3KTBA 3WT1A 4IELA 2PF4E 19GSA 2M72A 1J0FA 4QL9A 4TXOB 2IWTA 3M9JA 4N30A 4KDUA 2L4QA 2NBSA 2WJUA 1TTZA 4IKHA 3WGEA 1TK0B 5ECHB 5D9WA 1GTIA 3ME8A 3GTUA 4OFMA 1AXDA 2YZUA 3G7YA 3GMFA 4JE1A 3U5RE 5CYYA 1TKDB 3OR5A 3KMNA 2VO4A 1K3LA 4MZWA 5EPFA 3TJKA 1TU8A 2ON7A 3HZ4A 4WBRD 5DVBA 3HJOA 4CY6A 3UAPA 3QR6A 4GSTA 3A2WA 2FUG2 2HZEB 4XS4A 2XPDA 2XBIA 1M9AA 1ERWA 2EC4A 1AQVA 3Q6OA 4MF7A 2O85A 1T00A 1XVWA 5ELAA 3F9UA 5ABRA 1WMJA 4XHMA 1V57A 2WB9A 3GUSA 4Q5QA 2GQLA 4L0WA 1F6MC 4JRRA 5EY6A 2P31A 4EXJA 1Q4JA 5IOXA 2VOCA 4KNDA 2GGTA 1WWJA 2AJQB 1Z9HA 1XOAA 1XW5A 2I81A 3ZVJA 3D6IA 1PX7A 4XS6A 11GSA 3IAM2 1GRXA 5J9BA 3QDNA 3GV1A 2RIIA 3MSZA 5DJLA 1Z7PA 2CVDA 3M3MA 5IMAA 1J08A 1ZYPA 2V1MA 5L71A 1A24A 4X4JA 2QWRB 1SK0A 4TVEA 1A8YA 1ABAA 3ZZXA 5COHA 2GDRA 2H1BA 3GNJA 2QWPB 3NZNA 1K0OA 3TDGA 1QK8A 2PU9C 1K3OA 3FMWA 1R5AA 2HRKA 1B4PA 2HYXA 1NZ6A 2JU5A 1T3BA 4WF5A 4I2UA 1G0TA 3D0ZA 1FVJA 2L59A 2FA8A 4K5SA 4ULXA 1JZDA 2M6YA 4WF4A 3CSJA 3CTGA 2GSTA 2B3SA 1ERTA 3CYNA 3FHKA 3GL5A 3BOAA 4OMVA 2GT6A 4D73A 3ERFA 5ID2A 2HRFA 3IK7A 4V1Ag 5ECSA 2L57A 2LV3A 3H1NA 1PX6A 4FQUA 4PQ1A 4EDZA 2A4HA 3KMOA 1JZWA 4RQRA 2H8LA 5FT3A 3FR9A 1B4QA 4L5LA 1GNEA 1BQ0A 1V58A 5DALA 3EVIA 3LFLA 1BX9A 1W4VA 1HNAA 3TJBA 2LQQA 2YP6A 1KEBA 4MJCA 2VCTA 5G5EA 4F0BA 1HQOA 1WIKA 2O7KA 5DDLA 3GX8A 2GUZA 4HJ2A 2C0DA 1FG4A 3KJYA 2I9HA 3O3TA 4PQHA 2LJAA 4EIPA 5HR3A 4K0NA 5FWGA 5GSSA 2FD3A 4MCUA 5IMVA 1YEPA 5ECLB 2I4AA 1UC7A 5A4WA 3BBYA 1DE1A 2P5QA 5KOXA 1M7TA 3L4NA 2MBTA 4PXOA 2VCQA 2KP2A 1WP0A 1F9MA 1U87A 5J5NA 4EUYA 4TR1A 4RQXA 3WGXA 4K7NA 4MABA 2R0CA 2H6XA 2JACA 3H93A 3IOSA 2HLSA 3GX0A 1NHYA 3GKXA 3GKKA 3TUEA 2VLTA 3DXBA 2LQOA 1T8EB 2GQKA 4HQSA 4RWUA 1VGLA 3DVXA 4WR5A 4F82A 3VLNA 4XTSA 4AJ8A 5AIVA 1PGTA 18GSA 3BD2A 3F6FA 1T4ZA 1EEMA 4NHZA 1AAZA 1XWAA 4TKYA 1SK1A 2V41A 5CNWA 5IO2A 1EGOA 1YDKA 1OKTA 3MAKA 2QA2A 2RUFA 2CTPA 1IYIA 3MYDA 3TKQA 1YEXA 1TU7A 1S3AA 4HEA2 4N0ZA 2K18A 4BL7B 1SKSB 4H86A 3H4KA 1GL8A 2BMXA 1MDIA 4K7OA 5ECIB 2QSAA 3RDWA 2CAIA 3ERWA 4O7HA 4AGSA 2NDOA 4L0UA 1SL0B 1B9YC 4EL1A 1NSWA 2ALBA 1M2DA 2VM1A 3APQA 2LJKA 3IC8A 5DCGA 5GZZB 1VRSD 4TOPA 3F6DA 4DVCA 4ZL9A 1AC1A 1SL1B 2LKUA 2YZHA 2C0FA 1OVNA 1XIYA 4F03A 3G7JA 5ECPB 4XRAA 3D5JA 3KZQA 1THOA 3Q18A 3IR4A 2H72A 3FYGA 2DJ2A 3GRXA 3A3TA 2B7KA 3DRNA 3HCZA 4PNGA 4V2MA 4KB3A 1G7EA 4TR4A 3TJFA 2PUKC 17GSA 2Z9SA 2IMEA 2K9FA 2JZTA 2AUVA 5ELGA 3GHAA 3GL3A 2YWNA 3LSZA 2ZUPA 4KSOA 1GWCA 5D9TA 2FNOA 20GSA 2HSMA 3J7Yk 4K8MA 3ZYWA 3IAS2 3KH9A 4KE3A 3TGZA 2JZSA 3TKSC 3DGQA 1YY7A 2K6VA 1HNCA 5A4UA 2CA8A 3RHCA 1R7HA 1PL1A 2VCWA 3LQ7A 2H0IA 3L0HA 2KLXA 2EJ7A 2AB6A 3K8NA 1S3CA 1EWXA 2OBKA 4ECBA 1DSBA 2DKIA 4TXVA 1SKWB 4OCFA 4ILFA 1U88A 5G30A 1HYUA 2OE3A 4G2EA 4KDYA 4IQAA 2Y4TA 3ZTLA 1PQNA 4O32A 6GSSA 3IHQA 1WJZA 3ZREA 1OKDA 1MDKA 3MNGA 1GSYA 4OO4A 2QGVA 4XRDA 3UBLA 5B8BA 3ZFLA 4IN0A 5BRTA 3J7Yb 3UOMA 3VURA 4RUVA 4J80A 1B48A 5CREA 4WXTA 1USBA 1SJ6A 4F0CA 4NV2A 2R4VA 1F37A 3PPUA 2VL9A 4ECIA 3LXZA 1TRSA 2GS3A 4HS1A 4K7IA 6GSUA 1ZYNA 2JL4A 2GTUA 1EEJA 3QAWA 1K0CA 3CRTA 2YCDA 3FZAA 1SENA 1K0AA 1Z3EA 3ZIVA 5G5FA 4ML6A 5F07A 2A4VA 2GSSA 3TRQA 1Q98A 1GLQA 2CZ3A 4POKA 3TJGA 4BVYA 3L9SA 12GSA 2QKEA 2DBCA 2DJ0A 2GQMA 4YH2A 1TRWA 5DAKA 5KN2A 1X9WB 2R5GA 2C3NA 2ES7A 2H76A 2H01A 5IQYA 1GP1A 3KM6A 3P7XA 3CXGA 3RPNA 5LNKe 4LL4B 1QFNA 2H73A 1F2EA 2R3XA 3VPTA 1BAYA 4DSRA 2MYGA 1W89A 3CRUA 1GSQA 1Y6EA 1GSSA 4TN8A 2PWJA 1J9BA 1TP9A 4E8HA 1FAFA 2IFQA 4OFTA 1E6BA 4DSSA 2VM2A 1GLPA 5HFGA 1SJZA 3AG7A 2IMFA 5LD0A 4V2NA 4AJ7A 5A5KA 3PINA 4TXOA 3ZFBA 5IMZA 4MF6A 2HXKA 4MH3A 5C00A 2GZPA 1I9DA 3HYPA 2YS8A 2B1KA 4K5RA 2YJ7A 1GSEA 1FOHA 2VCZA 3IV4A 4FO5A 4AJ6A 2DMLA 1U3AA 3UO3A 2LS5A 2B5YA 3WGDA 2K8VA 1YKCA 4MH2A 2E2GA 5CRHA 1MD4A 2DMXA 1BJXA 3C1RA 2JADA 3KD0A 1ZZYA 2PVOC 4G19A 4PNFA 1EOGA 2YWIA 1DE2A 1U6TA 1OAZA 4MJEA 5DCHA 2WFCA 3FZ9A 1F3BA 2B5XA 4GSSA 1O6JA 1A0RP 1FO5A 3DKSA 3FEUA 5ECQB 5LCZA 2RM6A 3A5WA 2LRCA 2XPEA 2HZEA 1O7UA 2DJJA 4GQCA 3FZ4A 2OJLA 4EIQA 2FWGA 1A23A 1QXHA 3A5IA 1TI1A 1SU9A 4X43A 4K1FA 2AV4A 4Z2UA 3F3QA 1R4WA 1PA3A 2B1LA 1BQZA 3KTLA 3UVHA 1PKWA 4ZB8A 4ZIJA 4KCAA 3FW2A 2VUPA 1A2LA 2H19A 1XFLA 3WYWA 3IPZA 4HU9A 2GLRA 2N5FA 2IIYA 1TXXA 1AQWA 2HI7A 1GUMA 1TJDA 5G2ZA 2VIMA 4CHSA 4L8EA 3GN3A 5B6MA 5CRWA 2XHFA 4F2IA 5GSTA 4GXZA 1GH6A 6GSTA 2GVPA 4N0VA 4D73B 2VL2C 3ZL5A 2A2SA 1HD2A 2V6KA 1FB6A 4LA1A 3NOFA 2O8VB 2E7PA 1G6WA 1Z6MA 3N9JA 1LJRA 3APSA 3C7MA 2B7JA 5D96A 3BVOA 1ERVA 2V6OA 3TCOA 1X5EA 1TRUA 3EPTA 9GSSA 5CP1A 2B5EA 2X64A 1V40A 2CVKA 3AY8A 2YV7A 2KUCA 4BWSA 3LJRA 1ST9A 2L4CA 3ZMKA 4Q5FA 2YWOA 8GSSA 1ON4A 2IMDA 3CSHA 3U6VA 1OC8A 4HZ4A 2YWMA 3TRPA 4G9HA 3UEMA 3M8NA 2I3YA 4MLYA 4WBJA 3I9V2 3LGCA 4PUAA 1YQ1A 2QWOB 2DJKA 1PD21 1PL2A 3A2XA 4OD7A 10GSA 3QFAC 1VF2A 2P0GA 3V1WA 1XWBA 3VWXA 4TRXA 2JSYA 5D93A 4MDCA 3TOTA 3VWWA 3KIJA 3QCPA 2CTQA 1ACVA 1XVQA 1XBLA 2X8GA 4KUNA 1PN0A 3G9BA 2WGRA 2X8CA 2M46A 4TR1B 4ACSA 2EIOA 1K0NA 4YKFA 2X99A 13GSA 4LLRA 2HSYA 3MIXA 1QMVA 1SL2B 1MEKA 3D21A 1EOHA 4P3YB 1TI3A 5EL8A 4USSA 4KCEA 2HT9A 5DJMA 5HR2A 4YAPA 4JR4A 3KCMA 3A2VA 3H79A 1LBKA 1MDJA 1FW1A 1K0DA 2J23A 4IT5A 1K0BA 2AYTA 3DD3A 3GKMA 3GFKA 2JZRA 5IO0A 5INYA 1V9WA 1FB0A 1X0RA 1VF1A 3IK9A 3GH9A 1IYHA 3W8JA 1X5CA 1ILOA 1CQHA 4YQUA 4NWYA 3L9VA 3ME7A 2YN1A 3P2AA 3L78A 2FCHA 5IMCA 3RBTA 5F06A 3P8WA 2WULA 4PX1A 3HY2A 1EGRA 4IJ3A 4IGJA 1RW1A 4MNNA 2AAWA 4FH8A 4V1Ap 2V2GA 4MMMA 2CZ2A 5C04A 1TK8B 2OKAA 2PN8A 4G0IA 4PGTA 2XC2A 2KOKA 1BEDA 2WRTA 1BYEA 1X9MB 2VCVA 4OO5A 1XWKA 2VL3A 1Z7RA 2VD0A 7GSSA 2H71A 5ECOB 2C0GA 4BL7A 3EU4A 4KF9A 2DJ1A 2KQXA 5F8BA 4POMA 2L5LA 1SYXA 4KDXA 1DBYA 3HVVA 5EVOA 2R2JA 4JEDA 2DSAA 3SBCA 4BVXB 4IP1A 5E4WA 2N05A 3QPMA 3RAZA 2PERA 3FRCA 1ZYQB 4LL1B 1EP7A 4RI6A 4GF0A 2HRAA 3F63A 2C3TA 1RQMA 1TDIA 3I43A 4FIWA 2UZ8A 5G31A 1ERUA 1MD3A 1SYRA 3PH9A 2X4AA 4ISDA 2H74A 3GIXA 3EMXA 2EIRA 1XOBA 4O5UA 3WD6A 4BWQA 3IC4A 3GKNA 3EYTA 1WE0A 3LWAA 4IQ1A 2IJYA 1PSQA 2B6MA 3MDKA 4LMVA 4NPBA 1TRVA 1QGVA 1PRXA 1R26A 3CMIA 4I5QA 16GSA 3PGTA 3VI7A 3JCML 3UO2A 4IHUA 3WT2A 4WEYA 3APOA 5JCWA 1U3IA 3GURA 3PR8A 2X49A 1O85A 1OYJA 5HFKA 1PKZA 4TR3A 2YOIA 2H1AA 1M2BA 1OC3A 1SD8A 3UMAA 5G1KA 2L6CA 2H75A 5IIZA 2HZFA 3LORA 1JLVA 3ZLPA 1OC9A 3HKRA 1M2AA 1M99A 2MBSA 4AF2A 5ENUA 3UCSC 5CAXA 2CUGA 2GZZA 5JCGA 2N5BA 3O76A 4FYBA 4CDOA 5B6NA 2WZ9A 2X8HA 4IVFA 1EV9A 2R37A 3FKFA 22GSA 2FLSA 3C71A 4O92A 3QOUA 3DMLA 4PURA 2OBIA 2H1DA 4CY8A 3TB2A 2R6KA 3FZ5A 1GUHA 1GSUA 1NHOA 4GCIA 2LGWA 1FOVA 4NHWA 3D4MA 4G0KA 4XIHA 3CSIA 2NPBA 4HDEA 3UIWA