The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
198
|
sequence length |
746
|
structure length |
688
|
Chain Sequence |
FYSLLGVSKTASSREIRQAFKKNRAYEVLKDEDLRKKYDKYYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELSTGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGNDPELKKLKTLLKNEHIQVVRFDCSSAPGICSDLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWSPPSRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWSHPSQVLMPEWKRMARTLTGLINVGSVDCGQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWSGPSQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb |
molecule keywords |
DnaJ homolog subfamily C member 10
|
source organism |
Mus musculus
|
molecule tags |
Oxidoreductase
|
total genus |
198
|
structure length |
688
|
sequence length |
746
|
ec nomenclature | |
pdb deposition date | 2010-10-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00085 | Thioredoxin | Thioredoxin |
A | PF00226 | DnaJ | DnaJ domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | DnaJ domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin |