3APOA

Crystal structure of full-length erdj5
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
746
structure length
688
Chain Sequence
FYSLLGVSKTASSREIRQAFKKNRAYEVLKDEDLRKKYDKYYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELSTGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGNDPELKKLKTLLKNEHIQVVRFDCSSAPGICSDLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWSPPSRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWSHPSQVLMPEWKRMARTLTGLINVGSVDCGQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWSGPSQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 198
structure length 688
sequence length 746
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA07
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA06
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA05
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apoA04
2G0FA 5J3RA 2ES7A 2AV4A 5COHA 3EURA 4G2EA 2LKUA 1YY7A 3LG6A 2A4VA 1KEBA 1Q4JA 5DCHA 4ZIJA 5D9TA 2JZRA 1MTCA 3TKSE 3BOAA 4FH8A 5ID2A 1M7TA 5DAKA 1AIUA 2VL9A 6GSSA 1SU9A 1EEMA 2WB9A 2GT5A 5CNWA 5DALA 2GS3A 1M99A 3VURA 1ABAA 4OFTA 1ZMAA 3M8NA 5IM9A 2R2JA 4MF7A 4X0XA 4F82A 3H8QA 3FKFA 3I43A 2EIQA 1OC9B 2YWIA 4MJBA 2MMNA 2M6YA 4F2IA 2IFQA 2WGRA 3FZ9A 3E0UA 2DJKA 1G6YA 4MZWA 1DE2A 3HXSA 1PKZA 1S3CA 4HEA2 2CVKA 1OC3A 3GH9A 5G5EA 4J57E 3LWAA 4D73A 2C8UA 4ZL9A 4GWRA 4K0NA 3ZFBA 3ZTLA 3APOA 1X5CA 5ECLB 1ACVA 1M9BA 3QD9A 1GLPA 1PMTA 3VLNA 2F9SA 3CTFA 3E9JB 2XBQA 1QQ2A 4IW9A 1R4WA 4ECCA 2N5FA 2RM6A 3A5WA 1GH2A 2VCVA 2I4AA 1YDKA 3GURA 5G5FA 1SD8A 2GZZA 4PUAA 1XBLA 2QWOB 4NV2A 4AJ7A 2JL4A 1TI3A 4OWYA 4P3YB 2IMIA 4HJMA 3W8SA 5H5SA 5KN0A 2GT6A 3P90A 2VL3A 2R6KA 2OA7A 2R37A 3GKKA 4GRFA 2X64A 1VF1A 2OJLA 2VD0A 3EE2A 4IQAA 1QMVA 5FHIA 2DN9A 1TDIA 4N10A 1CQHA 2VOCA 1TK8B 4L8EA 1XFLA 1N4CA 4I97A 1GSQA 2XPDA 1K0OA 4XS4B 4RWUA 1VF3A 4KCAA 5GAPD 4K6XA 1UC7A 3KIJA 3KP9A 5DQSA 2KHPA 1N2AA 2R5GA 2GSQA 2YOIA 2IMDA 4POBA 1V98A 3GH6A 2H73A 2GUZB 1USBA 2GVPA 3O6TA 4OCEA 3RDWA 1HDJA 2CA8A 2QWQB 3GHAA 2REMA 1MD4A 3GTUB 4GF0A 1WIKA 3TKQA 1SL1B 2HRNA 2LRTA 3H93A 2IMFA 2DJ0A 4TR3A 3MNGA 4LA1A 4AJ6A 3UARA 1SJ6A 2GZPA 4I6XA 2KUCA 3N9JA 2YPMA 2C1YA 4YH2A 9GSSA 2CX4A 3I6AA 3UO3A 2H30A 2B7JA 2ZUPA 4O92A 6GSYA 3NZNA 1EWXA 3Q6OA 3VFIA 3QFBC 3CRTA 1Z9HA 3VWXA 1WMJA 2K6VA 3HZ8A 3M3MA 3BD2A 5ECQB 2VCZA 2GDRA 3HHVA 3ZVJD 1EV9A 4HUAA 4EC0A 2FD3A 3D0ZA 4HDEA 1Z7PA 3GL5A 3LYPA 2HZFA 4L0WA 1ZYEA 4IS0A 2DLXA 1YEXA 3G7YA 2C0EA 4K0GA 2L5LA 3ZIVA 4LLRA 2GUZA 2DMLA 4G9HA 2B3SA 2FWFA 2IWTA 1YKCA 2L5OA 3SWLA 4ZXGA 2GQMA 1TI1A 3FK8A 4ZL8A 2AUVA 3KM6A 1FAFA 1NM3A 3BBYA 2LTKA 1GTIA 4IHUA 4BPYA 3ZFLA 5F8BA 5DJLA 4KGIA 3G7IA 5FT3A 2FUG2 1IYHA 1V57A 3ERWA 3KH7A 1TKDB 5B6MA 4GLTA 5EPFA 4X1UA 1ERWA 3VWVA 2P31A 1URMA 1JLWA 1PGTA 2WS2A 3EU3A 1UA5A 1I5GA 2CTQA 3ME8A 4XHMA 3QFAC 3IE3A 1M0UA 5ECOB 4DSRA 3F4SA 1J9BA 4L0UA 2H01A 1AQVA 2XC2A 1K3YA 4PNFA 2H66A 4RI6A 3F63A 5IOWA 4KSMA 3DRNA 3IBHA 3LGCA 1Y6EA 5IPHA 5ECPB 1TK5B 5JCGA 1XWGA 1SKWB 5KN1A 3F3QA 3TJJA 4BWSA 1GTAA 1XPVA 1E6BA 1SJZA 4MJAA 1OE7A 1B48A 3HZ4A 4TXOA 3WT1A 3GN3A 2OBIA 1KNGA 1DSBA 2VLTA 3CSIA 3D6IA 2V41A 3TJFA 3MDKA 3L4NA 5JCWA 2H8LA 2GQLA 4KCEA 2FA4A 1JFUA 1GLQA 3N5OA 1SD9A 3U6VA 6GSVA 17GSA 1V9WA 5B8AA 4GQCA 2ZCTA 1A2LA 1FO5A 2H6XA 2YCDA 1GUKA 1JZDA 1G0TA 2TIRA 4ECIA 2H6ZA 2LJAA 5LNKe 2VUPA 3L9VA 4LL1B 2CAIA 3FYGA 3D22A 2ALBA 1V2AA 1XCCA 2H1BA 5G31A 2CVBA 2QSAA 2HT9A 1X5EA 4Q5NA 3RAZA 4JRRA 3FR3A 5J41A 5CYYA 1GUMA 2QKEA 3QDNA 2Z9SA 1U87A 1PX7A 3F8UA 3E3EA 1M2BA 3KMOA 2DC5A 2DSAA 4JEDA 3ERFA 3F3RA 5ECMB 2LUSA 2YZHA 3W6GA 3ZITA 3ZRDA 1ERTA 4BWQA 4YQUA 3KP8A 2RIIA 4BVXA 4E8EA 1GH6A 1NHYA 2FCHA 2EIOA 3TRXA 3H1NA 2MBSA 4MPGA 2DJJA 2PU9C 2VCWA 2CUGA 3I69A 2WDUA 3KJYA 4IKHA 2HE3A 3ZL5A 5CRDA 1OKDA 2DMMA 4EXJA 2H0GA 4F0BA 4E8HA 5IO0A 2H0HA 2QGVA 1PL2A 20GSA 3L78A 4K7IA 1FAAA 1B9YC 3CTGA 5L71A 4O7HA 3F4RA 3M0FA 5ECNB 5DCGA 5ECIB 4EL1A 4ECBA 3JCML 1O7UA 1TTZA 4Q5FA 1QUWA 4KDYA 3RHCA 2GSRA 5C04A 3MAKA 2LQQA 2YWOA 2OADA 1FPOA 1MDIA 2R3XA 5J9BA 3C71A 4KE3A 1XW6A 2H0IA 1ON4A 1TP9A 1HD2A 2IIYA 2J23A 6GSTA 2OE1A 2VM1A 3GX0A 4IJIA 3APQA 3TRQA 3TRPA 4DSQA 4WR5A 5E59A 4MZCA 5H5RA 4TR1A 3VK9A 1XW5A 2MBTA 1AW9A 2VO4A 3TB2A 3UMAA 2A2SA 4TR0A 2VM2A 1EOGA 3FR6A 1PA3A 2L4QA 4HJ2A 1Z7RA 2FLSA 1GUHA 5D96A 5AN1A 1BJXA 4GXZA 3L0HA 5DDLA 1SYXA 1N8JA 3HJOA 4AJ8A 2PMTA 3GL3A 4ZBDA 3CSHA 2YV9A 2F8AA 1O85A 1F6MC 3CBUA 1T1VA 3KH9A 1MD3A 1GSUA 2DJ2A 3UBKA 2PVQA 5CO3A 4PQHA 2NTOA 1ZZYA 1XOBA 1BQ7A 2I9HA 1G7OA 3EMPA 3FW2A 3QAVA 2OE0A 2H76A 4F0CA 3Q18A 3LORA 4NAXA 2PF4E 1GRXA 5JWRB 1ILOA 1K0NA 1TRSA 1VRSD 5EVOA 5INYA 1YEPA 3WGEA 4JR6A 3DXBA 4ZB8A 1WJZA 4NXIA 5E4WA 5AISA 4I2UA 3DVWA 2B1KA 2C3TA 2EIRA 4FO5A 1F2EA 1GL8A 12GSA 3A2XA 2D2ZA 1E2YA 1OC9A 4TRXA 1XXUA 1S3DA 1R26A 1EV4A 2YP6A 1AAZA 1BQ0A 1TW9A 1K0CA 3GNJA 5A4WA 1TOFA 1SJIA 4DSSB 3A2WA 3TOTA 3UVHA 3ZYWA 4EKZA 1TRUA 4ECJA 4WF5A 2C0DA 3TJBA 2HFDA 5AGYA 2K8SA 1XWKA 1QFNA 2WZ9A 3AY8A 3KZQA 4RQRA 2HSHA 2L6LA 2V1MA 3IAM2 2HXKA 1PD21 3CSJA 1XVQA 4N11A 3EVIA 4EUYA 4GSSA 1SKRB 4EVMA 2RUFA 2LGWA 1OKTA 5JWQB 4XIHA 3UCSC 5IOXA 2B5EA 3LYKA 2H70A 1K0MA 4KDXA 4MZBA 1T3BA 3NIVA 2K18A 4J2FA 2CV4A 4GTUA 1OE8A 2X8GA 3QAGA 1FVKA 4ID0A 4G10A 2HZEB 2P5RA 5CRHA 2AYTA 1LU4A 1TK0B 3EWLA 4MK3A 4PURA 1B4PA 2TRCP 4K9ZA 1JZWA 2BMXA 5D9VA 5IPGA 4HZ4A 1U3AA 2OCHA 3R2QA 4LMVA 4XTSA 4HI7A 4XS4A 3GUSA 2GQKA 1WP0A 4OO4A 2CT6A 4IGJA 4JBBA 1GSEA 4TR4A 2OBKA 4HZ2A 6GSUA 2C0GA 4V2MA 3RPNA 4ACSA 4WETA 3D21A 2ON5A 2PBJA 1K3OA 3I9V2 2VAFA 3U5RE 1ST9A 3GTUA 2CQ9A 4J80A 1PRXA 3O3TA 4L5LA 1O81A 3ED3A 2L6CA 1SKSB 1EOHA 1J0FA 5HR3A 4MF6A 1GSFA 3WGDA 2DIYA 3ERGA 1SK2A 1THOA 2VL2A 4POMA 3G9BA 2MYGA 5H5QA 1JLVA 1R5PA 2MMOA 1NW2A 1YQ1A 4MLYA 4IP1A 2I81A 1ERVA 3O76A 4YAVA 22GSA 5KN2A 1M9AA 3D5JA 3EINA 3TCOA 1XIYA 4FYCA 1BYEA 1TXXA 4ML1A 3PH9A 2LJRA 2JSYA 1JHBA 2V32A 3FR9A 4OMVA 1PSQA 4KX4A 3CRUA 5DJMA 4G19A 1LJRA 3GYKA 4QQ7A 11GSA 4ULXA 1R7HA 4IJ3A 3GKMA 1SL2B 5GSTA 3J7Yb 4H86A 1O8WA 3OR5A 4NHZA 2F3MA 3ZZXA 4CW9A 1AQWA 2H71A 2RM5A 3UAPA 1GTUA 2HNLA 2HYXA 2P0GA 5HFIA 2VD1A 3QOUA 4WBJA 3FEUA 2YV7A 2QWRB 3HKRA 4L5OA 3DKSA 2VCXA 4K8MA 4IBPA 1LBKA 2CVDA 2L59A 4OFNA 2IPAA 1GSDA 5IMFA 2M80A 3ZIJA 3HCZA 4HU7A 1ML6A 1YKAA 4N0ZA 4NWYA 3GMFA 2NBSA 1EGRA 4AF2A 3W8JA 2WRTA 5IIZA 3GKXA 4XRDA 4ZB6A 2MZCA 3M9JA 4PXOA 1RW1A 1A8LA 2A2RA 2KP1A 4HQSA 3VPQA 3IDVA 3HJMA 1SK0A 4PQ1A 2C0FA 2QC7A 2VLVA 2FWHA 1MDKA 1FHEA 3GV1A 4PX1A 4XS6A 2VIMA 1B9XC 2FGXA 1F37A 3BCIA 2NVLA 2JZSA 2H75A 3F6DA 1SENA 1THXA 4AGSA 1HNAA 2C4JA 5ECSA 1XVWA 5G1LA 2LEGA 2CTRA 1DE1A 1X0RA 4J56E 2DMXA 5IO2A 3GX8A 3TJKA 4POLA 1X5DA 5F0GA 2JU5A 4KAEA 4ML6A 1W89A 3UOMA 3F6FA 2PERA 2RUEA 4K7OA 2VLUA 4K7NA 3QMXA 3GFKA 1A8YA 4PNGA 1V40A 1HNBA 4XRAA 4OCFA 2Y4TA 5LD0A 1R5AA 5AIXA 2TRXA 1EP8A 1AXDA 3MWHA 1GSYA 1ZYQB 3KXOA 1EP7A 2XHFA 4ZBBA 4DEJA 3F4TA 3Q74A 18GSA 1JZRA 2B5XA 3WYWA 3WT2A 2JSZA 1XWAA 1DUGA 3H4KA 4EDYA 3C1SA 8GSSA 4IQ1A 3CXGA 2JADA 4YAPA 5DQYA 2YWMA 1KTEA 3HVVA 3ZREA 2GSSA 5A5KA 5LCZA 3TOUA 1GNWA 2PPTA 3VWWA 3IC4A 2E7PA 3PGTA 3IAS2 2KQXA 4MJEA 4ILFA 5CP1A 1XWBA 2AJQB 4OO5A 1TU8A 3DIEA 3K8NA 1IURA 5ID2B 1EGOA 1K3LA 2WCIA 5G30A 1OC8A 1RQMA 1ZGNA 4ISDA 2ON7A 2L57A 2QSIA 4NPBA 1M2AA 4MP4A 5ECRB 2YZUA 4GSNA 3RHBA 1QXHA 3BCKA 3LSZA 1RK4A 3HY2A 2KP2A 2E0QA 1A2MA 2CTPA 5IQYA 4WEYA 1EZKA 2H19A 3VI7A 1AQXA 3J7Yk 3D4MA 3QAWA 5JWOB 4F03A 3IPZA 1VF2A 2IFQB 5ECHB 2LJKA 3HJPA 1ERUA 3GA4A 1Y25A 5D73A 2YJ7A 5ENUA 4BA7A 4ZL7A 1WOUA 2KLXA 5FWGA 4O5RA 5AIVA 2WJUA 1AC1A 1GSSA 3GKNA 2CAQA 2MMZA 2GGTA 1FG4A 4IT5A 4D73B 4Z7XA 3DGQA 2PWJA 3GIXA 2IN3A 2O89A 5DVBA 1U3IA 19GSA 2FNOA 1SYRA 1WPIA 4YQVA 2K8VA 3WGXA 5EY6A 3DVXA 2LQOA 1GTBA 2IMEA 2OKAA 2AHEA 5KEJA 1FB6A 4RI7A 2RLIA 3DWVA 1V58A 2H1DA 3UJ1A 2ZNMA 2H74A 2L4CA 2FY6A 1F3BA 1HNCA 3KD0A 1YZXA 1O73A 1GULA 2J9HA 1T4YA 1X9WB 2M72A 3ZMKA 1DBYA 2B6MA 10GSA 4KSOA 5A4UA 1YF1A 3DMLA 1TRVA 1QGVA 4QL7A 2N05A 2H72A 1MEKA 4WF4A 2DIZA 1X9MB 2GLRA 3HA9A 1ZL9A 2B1LA 1PL1A 4HU9A 2F51A 4RQXA 1VGLA 3LQ7A 3IOSA 4EF0A 4Q5RA 1NHOA 3FZ4A 2E2MA 2YWNA 4TXVA 2H6YA 1TRWA 1O8XA 1PQNA 4J7ZA 4BVYA 1WRYA 1SL0B 3LEFA 2PUKC 2HSYA 4POKA 3C8EA 4KH7A 1Z6MA 2B7KA 2YN1A 5IMCA 3L9SA 4XS1A 3DEXA 1YF0A 2V2GA 1JZOA 2P5QA 1J08A 1PN9A 2R4VA 2LRNA 3IA1A 3RBTA 1U88A 4MABA 3P2AA 1K0BA 2L6DA 1S3AA 2QWPB 2QWNB 2C80A 3TKSA 1M2DA 1H75A 2PN8A 3SBCA 2LNSA 1QK8A 5JCUA 3QPMA 3KCMA 2LSTA 4JR4A 2VL2C 1C72A 13GSA 4MF5A 5F05A 3FZAA 4GQFA 5F06A 3EC3A 4ZB9A 2N04A 3L9UA 3UO2A 2HLSA 2FWEA 5F07A 3RPPA 4EDZA 4MH2A 4TVEA 5D9XA 4TN8A 5B6NA 3Q19A 1T4ZA 3KGKA 3IXRA 4IVFA 4F9ZA 4N30A 3EYTA 5HR2A 5IMVA 1NZ6A 3IK9A 3PR8A 5CRWA 5D9WA 4OD7A 4PGTA 1PX6A 2FHEA 4LL4B 2IL3A 1ZOFA 5CRGA 5IMAA 2O85A 2OE3A 1GP1A 5DBQA 4MPFA 1Q98A 3IR4A 4IP6A 1FOVA 2CZ3A 2O8VB 2LS5A 4DSSA 2O7KA 6GSWA 2X8CA 2EC4A 3D4TA 1OVNA 1F3AA 1I9DA 2DJ3A 2X99A 4X43A 4FIWA 4K2DA 3NOFA 6GSXA 4V1Ag 1T00A 4TKYA 2C3QA 3F9UA 1NSWA 1PKWA 4TW5A 1BAYA 3IK7A 1OYJA 1U6TA 4KW6A 4WKWA 4WXTA 3WD6A 1A0FA 1IYIA 4GCIA 1HYUA 1XW9A 2JZTA 2XPEA 4CHSA 5G2ZA 16GSA 3KMNA 2Y4UA 1BG5A 3IHQA 2DBCA 3F0IA 1BX9A 5HQPA 2BTOT 2YNXA 2V6KA 4TOPA 5C00A 2YUAA 2LO1A 4CDOA 3DD3A 3G7JA 4MDCA 1T8EB 1XWCA 4K1FA 4XCSA 4NV5A 1H4OA 2F8FA 2HZEA 3HVSA 5B8BA 3ZMLA 3KEBA 1O6JA 5J5NA 2KOKA 5GAND 4WBRD 1TU7A 4V2LA 2AAWA 4KDUA 2PVOC 3C73A 1XBSA 2HI7A 3HYPA 4TXOB 2MMAA 4KUNA 2GTUA 5CAXA 4KB3A 3APSA 4Q5QA 4V2NA 2K9FA 4FYBA 2OACA 1K0AA 1G7EA 2BJXA 4IN0A 1FW1A 14GSA 3GRXA 3ZVJA 4FYUA 1UN2A 3P8WA 3DYRA 1FVJA 4ZBAA 3MSZA 4GSTA 5D8IA 2E2GA 3M1GA 3EMXA 4KA0A 1TJDA 2I3YA 1ZCPA 3FZ5A 2V6OA 4LMWA 5KN3A 2I1UA 1BQZA 2CTWA 3TKPA 4I8BA 2VCTA 3VI5A 1OAZA 1SK1A 3LJRA 4PUFC 2X8HA 4HQZA 1VF4A 5EL8A 3CYNA 1Z5YE 3LFLA 3A3TA 5IMZA 1BEDA 1EEJA 3BVOA 2YANA 1B8XA 3TGZA 4MMMA 2JACA 3BJ5A 5B7CA 5CREA 1A23A 5G1KA 1FB0A 2G2QA 3FHKA 2C3NA 2H1GA 4MH3A 4ZILA 3UBLA 3V1WA 2XBIA 4PQIA 2HRFA 4O32A 4EE0A 3TUEA 4YQMA 2IJYA 4WR4A 5ABRA 1CQGA 7GSSA 5GSSA 2B5YA 4KNDA 3QCPA 2AB6A 3TKRA 1GWCA 4NHWA 2FA8A 1YJ6A 2EJ7A 1WJKA 3VPTA 1HQOA 2CX3A 3A2VA 3ISOA 3UVTA 4I2TA 2N5BA 2N5AA 1F9MA 4JU5A 3GSSA 4JZQA 2WULA 1UVZA 4RUVA 3IV4A 2NDOA 2LV3A 2IMKA 3TDGA 1A2JA 4EO3A 2O87A 3HVXA 2FWGA 5ELGA 1K0DA 5HFGA 4IELA 3TJGA 3HD5A 3PINA 5J9CA 4NMUA 1B4QA 3UEMA 5J4UA 3S9FA 3KTLA 3LXTA 4HS1A 5HR0A 2GZYA 3UL3A 1Z3EA 2YS8A 1GNEA 3CMIA 1WE0A 4MJCA 4BL7A 3HDCA 4I5QA 3VWUA 5ECKB 3AG7A 4MCUA 3ME7A 1AUCA 2GSTA 3LXZA 3US3A 1G6WA 1Z6NA 2PGTA 2M46A 5DAKB 4OFMA 2LNTA 3FY7A 3QR6A 4V1Ap 4TR1B 5HFKA 2YJHA 3EU4A 4JE1A 4N0VA 3KTBA 1T7PB 5A4VA 4MA9A 2DJ1A 5DALB 4DVCA 5HR1A 1MDJA 1X9SB 3P7XA 2LRCA 2CZ2A 5IMDA 1W4VA 1WWJA 2VCQA 1XOAA 3IRAA 3C7MA 2WFCA 3FRCA 4HOJA 2H1AA 5ELAA 3ZLPA 3H79A 1A24A 1A0RP 3C1RA 4QL9A 3UIWA 3M9KA 5D93A 1KBNA 1XZOA 3TKSC 2NPBA 5GZZB 3GSTA
chains in the Genus database with same CATH superfamily
1COWG 1I08A 3RT3C 2G0FA 1FXVA 2ZM6O 5J3RA 4A5PA 2ES7A 4NXMO 1H8HG 4AQYB 4PDVA 2AV4A 1YHQV 3QO7A 5COHA 3EURA 4IHJB 2LKUA 4WFBV 4G2EA 1YY7A 4X4JA 3LG6A 2A4VA 1KEBA 2AXTZ 3JAKB 2AW9A 4JF3A 1PNMA 5F2VO 5LMUB 5B1OA 1Q4JA 2UUCO 5DCHA 4ZIJA 5KHGA 5D9TA 2JZRA 1MTCA 3TKSE 1N36O 3BOAA 2PY5A 4NVPA 4FH8A 5ID2A 4I5SA 1N34O 1M7TA 5DAKA 5EIBC 4DR5B 5LBQA 4C7UA 1AIUA 2R9IA 2VL9A 1DF5A 6GSSA 1SU9A 2Q0AA 3W7SA 2YC0A 4FFKA 2XHBA 4YY3B 4FLUA 4G2KA 3JD1A 2Q7EA 1DTOA 1K73W 5EBWC 3N27A 4JZ2A 2E3CA 4R8CA 1JOYA 1EEMA 2GS3A 2GT5A 1M99A 2WB9A 5CNWA 5DALA 3VURA 1ABAA 4OFTA 1ZMAA 3M8NA 5IM9A 2R2JA 1ZL8B 4MF7A 1UFIA 3WFVA 5FNVA 4X0XA 1TVKA 2ITCC 2EZPA 4WCEV 3OW2U 4F82A 4UCTA 3H8QA 3FKFA 3I43A 2EIQA 4W4LA 5ITZA 1KBHA 1OC9B 5D5QA 1TUEB 2YWIA 3ASNB 4MJBA 3DGEA 1FKAO 2MMNA 2M6YA 4F2IA 2IFQA 1AI6A 2WGRA 1Y74A 3SYCA 4F6RA 3FZ9A 3E0UA 3LSUA 1G6YA 2DJKA 2ZNJA 4MZWA 4LF4B 4ZOLB 2P06A 1DE2A 3HXSA 1PKZA 1S3CA 4HEA2 5B3SB 4B3MB 5CA3A 2CVKA 4P9OA 2YIBA 2GV9A 4PA9A 4DR7O 1OC3A 4PDLA 3GH9A 5G5EA 4J57E 1YCIA 3LWAA 4D73A 1FFXA 1FJGO 4FIPC 2C8UA 4ZL9A 1PNLA 4GWRA 3AG1B 4K0NA 1KP2A 5JWPA 5IYZA 3ZFBA 4DV0O 1F51A 3ZTLA 2EIKC 1VQ7V 5LA6B 3APOA 3T4DA 2Z0AA 4NXNO 3T1HO 1QVGU 1X5CA 5ECLB 1OV9A 1ACVA 2ZXWB 3E83A 1M9BA 3JAKA 5GTHZ 1XG8A 2GHYA 1GLPA 1PMTA 3QD9A 3VLNA 4B3TB 2F9SA 3CTFA 4X1KB 1Q7YW 2DKIA 3JD2A 3E9JB 3CCUV 2XBQA 2OIEA 1XL4A 4O2AB 2VQEO 2E75B 1QQ2A 4IW9A 3ETGA 1R4WA 1RPRA 4ECCA 2E76B 3S3XA 2N5FA 2RM6A 5LXTB 4P30A 3A5WA 1GH2A 2HHHO 2VCVA 3BA8A 2I4AA 1YDKA 3ASOB 2XAHA 2C2AA 3GURA 4PA3A 5B1AC 4K2XA 5G5FA 3TXQA 4B3SO 3FAVA 1SD8A 2OYQA 1PL4A 2GZZA 4PUAA 3LUTB 5C8YA 1XBLA 1YITV 3CD6V 3CC2V 2QWOB 4NV2A 4AJ7A 3JSLA 1BCCH 2JL4A 3WB1A 1QLEB 5LHIA 4LF6B 1TI3A 4OWYA 4P3YB 3ZRXA 2IMIA 3EHBB 1US6A 4HJMA 3W8SA 2N74A 3ZHQA 3CQFA 3H1IH 5H5SA 2GT6A 5KN0A 3P90A 2VL3A 3IC7A 4TQDA 3K04A 5FL7G 2R6KA 1PFOA 5BXZA 1KECA 2OA7A 2FB5A 2R37A 3GKKA 4GRFA 2X64A 4E2LA 5KX5B 4UV9A 1VF1A 3W7XA 2OJLA 2VD0A 3EE2A 4DRXA 3GB7C 1QMVA 4IQAA 5FHIA 2DN9A 1TDIA 4N10A 4J10A 1CQHA 2VOCA 4NTYA 1TK8B 4L8EA 1XFLA 1N4CA 4I97A 1GSQA 2XPDA 1K0OA 5J9PC 4X62O 3DXRA 4XS4B 4R50A 4RWUA 1SERA 1VF3A 3JYCA 4KCAA 5GAPD 2A0LA 1D5NA 2UZ8A 4K6XA 4LFBO 1GTOA 1UC7A 3KIJA 3KP9A 5DQSA 2KHPA 1H2KA 1N2AA 3CCMV 4WBNB 1ORQC 4X1KA 2UUBB 2R5GA 4QPKA 2GSQA 2RDCA 4IIJA 4J9YB 1JFFA 2YOIA 4O2AA 2LP7A 3ML0A 2IMDA 2P22C 4POBA 3B77A 4DR1B 1ZSPA 3HKBA 1V98A 1Y4MA 5B1BB 2H73A 3GH6A 2GUZB 1USBA 1N0NA 1YDXA 2GVPA 3O6TA 4OCEA 1Z5VA 1KMIZ 3RDWA 2KKWA 3NXSA 1L1FA 1HDJA 2CA8A 2QWQB 3GHAA 5DEDA 2X6AA 1RP3B 2E74B 3ZHTA 2REMA 1MD4A 3GTUB 4GF0A 3DTUB 5A2QN 1WIKA 3TKQA 2R0GA 2HRNA 2LRTA 1SL1B 3H93A 2F43G 1IZ3A 2IMFA 3CCQV 2DJ0A 3VBBA 1N8RW 3EPTA 4O2BA 4TR3A 2DWEC 3MNGA 5EYPA 4LA1A 4AJ6A 3UARA 2Y48A 1SA0B 1SF9A 1SJ6A 4O4LA 3RYCA 2GZPA 1H2NA 4MW8A 4O4IB 2KUCA 2YPMA 3N9JA 1V55C 2C1YA 4YH2A 2F1MA 2LGQA 2RJZA 1V9PA 3RYHA 9GSSA 1OZ0A 3JAMN 2CX4A 1XNQB 1X59A 3CYOA 3I6AA 3GVMA 3O65A 1VQ9V 1NS1A 1KKDA 3UO3A 1H2GA 1CEZA 2B7JA 2H30A 2ZDIC 2ZUPA 4Z2TA 2PYLA 1MSWD 4O92A 1TUBB 4PI2A 3OFNG 6GSYA 3NZNA 1EWXA 3Q6OA 3VFIA 3QFBC 3CRTA 1NTMH 1Z9HA 1Y76A 3JALB 1WMJA 2K6VA 3HZ8A 3M3MA 3VWXA 1BT8A 3BD2A 5ECQB 2OTJV 2VCZA 3SJQC 2EINB 2GDRA 1D2DA 3HHVA 3ZVJD 1EV9A 4UCVA 2JS5A 1MZEA 2ZNIA 4HUAA 4EC0A 2FD3A 2XT9A 4FLZA 3D0ZA 4HDEA 4H13B 4I4TB 1Z7PA 1FXHA 2B9ZA 2IH3C 3GL5A 3LYPA 2HZFA 4L0WA 1ZYEA 4IS0A 3OTOO 2DLXA 1S5JA 1YEXA 3G7YA 2C0EA 4LBEC 4UFZA 4K0GA 2L5LA 2QM8A 2JEXA 4GUNA 5L3EA 3ZIVA 4LLRA 2GUZA 1R6TA 1IBLB 5LMUO 2DMLA 2ZT9B 1GN6A 4G9HA 2B3SA 1XI1A 2FWFA 2XNDG 2IWTA 4YJ3A 3ABMC 4OX9B 3AG4B 3FYEB 2XAQA 1YKCA 3QO5A 3TGUH 3ZRWB 2L5OA 4K5RA 3SWLA 4DR5O 3AG3B 4ZXGA 1JJOA 1E1RG 2UXXA 5C93A 1TI1A 2GQMA 2LW7A 3FK8A 4ZL8A 2AUVA 4U7OA 4F4LA 2FMLA 3KM6A 4X89A 1M3JA 1FAFA 1WP7A 2RNBA 1KC8W 1NM3A 1GTIA 2LTKA 3BBYA 4ZKIA 4IHUA 4BPYA 4YXWG 3ZFLA 4GLXA 5HFLA 2ZM6B 5F8BA 5DJLA 1R1BA 2F23A 4KGIA 4NXMB 3G7IA 5FT3A 3P30A 2FUG2 1IYHA 1V57A 3ERWA 3KH7A 1QU7A 4ZHQB 1NBMG 1TKDB 5B6MA 3FX7A 1S77D 4JYBA 2IJJA 4GLTA 2UXBB 5EPFA 1VQ4V 3HKEB 4X1UA 5LGTA 1L0NH 1RFYA 1ERWA 2ZIOA 3ABTA 3VWVA 1N34B 2P31A 1URMA 1VQOV 1JLWA 1VF6C 4MVQA 4LF4O 2XUMA 2BSKB 1PGTA 2WS2A 2MK3A 3EU3A 2WPDG 1UA5A 1I5GA 2A06H 1VP7A 2CTQA 3N2KB 3ME8A 4XBFA 3LSSA 4DR3B 4ZIBA 1E1QG 1J95A 4XHMA 3QFAC 4H37A 3IE3A 5BY1A 4MVUA 1M0UA 5ECOB 4DSRA 3RFRA 1Q82W 3F4SA 1J9BA 1ZWIC 4HSCX 4L0UA 2H01A 1AQVA 2XC2A 1RSOA 4MVRA 3IHGA 1K3YA 4PNFA 2H66A 4RI6A 3F63A 5IOWA 4X65B 4KSMA 3DRNA 4B3TO 4R7CA 1ROPA 2OCCC 1Y67A 1ZYPA 3IBHA 4WF9V 3LGCA 4LF8O 1Y6EA 5IPHA 5ECPB 1TK5B 1NKDA 5JCGA 1XWGA 2QTOA 4LF9B 1SKWB 5GONB 5IY5B 5KN1A 5CA1B 3F3QA 3J80N 1AI4A 1K5SA 4MS2A 3CRMA 4NTXA 4UCRA 1Q43A 3TJJA 2QJ1A 4BWSA 1GTAA 5CB4B 1XPVA 1E6BA 3K9SA 5LYJB 4JYYA 4DV0B 3ZRSA 1NVPD 1NJIW 1SJZA 4I0XB 4MJAA 1OE7A 1B48A 3HZ4A 1AP5A 1KKCA 4TXOA 3WT1A 3GN3A 4G27B 1WN7A 3T1HB 3UT5B 4LFCB 3AEIA 2OBIA 2R0PA 2X4AA 1KNGA 1DSBA 5LP6B 4O4HA 5LMNB 2VLTA 3ZN1A 3CSIA 3D6IA 2V41A 4FVMA 3TJFA 1XL6A 4X1IB 1S3JA 1KUQA 4FQUA 1DF4A 3MDKA 3L4NA 5JCWA 2H8LA 2GQLA 1FXKC 1PL0A 4KCEA 4CY8A 1HWYA 2BSKA 2DYRB 3VQVA 1JFUA 1GLQA 2FA4A 3N5OA 1SD9A 3U6VA 6GSVA 17GSA 1V9WA 5B8AA 4GQCA 3W7UA 2ZCTA 1A2LA 1FO5A 2H6XA 2YCDA 4B7KA 3OTFA 1GUKA 1JZDA 5CA0A 1G0TA 2TIRA 4ECIA 2XTAA 3KG2A 2H6ZA 3K5NA 2LJAA 5LNKe 2VUPA 2VS0A 1HW7A 3L9VA 4LL1B 2CAIA 3FYGA 1Y6XA 4GX0A 4JI8B 3D22A 2ALBA 1V2AA 1XCCA 2H1BA 5G31A 3LDCA 4FFBB 4IGGA 2CVBA 5EC1C 3ABKB 4CH3A 2QSAA 3ABUA 1X5EA 2HT9A 4Q5NA 3RAZA 4JRRA 4CS2A 3FR3A 5J41A 1TGOA 1E79G 3WB0A 5CYYA 4OGQB 1GUMA 2UXDO 1GN3A 2QKEA 3QDNA 3K5OA 4X1YB 2IU0A 2Z9SA 3WG7C 1U87A 3CCEV 1PX7A 4HNAA 1ZTEA 3UM7A 1YTFB 3F8UA 3E3EA 1M2BA 3KMOA 4DUZB 2YSUB 4OXSA 1QHTA 3CXHF 1GM7A 3AK1A 3OM3B 3P32A 2DC5A 3SYAA 5JCOA 2DSAA 2V4DA 1SZXA 2VQFO 5CB4A 4JEDA 1XEQA 3ERFA 3F3RA 5ECMB 2LUSA 2YZHA 4X62B 3W6GA 3ZITA 3ZRDA 2ZINA 4I0XA 2DYSB 2B1GA 1ERTA 5HFMA 4BWQA 1IX9A 1S3RA 4YQUA 2B1IA 3RYIB 3KP8A 4YKFA 2RIIA 4BVXA 4E8EA 1JJ2U 1GH6A 3BHPA 1SQQH 4MNNA 1NHYA 2MW2B 2P67A 2R72A 1V54B 2FCHA 1JMKC 2PYJA 2EIOA 3TRXA 1NTZH 5AG2A 3H1NA 2MBSA 2WLLB 2A79B 5L3GA 4MPGA 5IWAO 2DJJA 2PU9C 4CZZA 2VCWA 3STLC 2CUGA 3I69A 3CC7V 2DW4A 4ASUG 2WDUA 3KJYA 1IDSA 2ZD9A 3JD0A 4QNHB 1M57C 1XMOB 1VQMV 4IKHA 2HE3A 2JGDB 4JV5B 3ZL5A 5KMGA 4DR2B 5CRDA 1OKDA 2DMMA 3MHHC 2P5OA 4EXJA 1HNZO 3M8AA 2H0GA 4F0BA 4Z2UA 4K5SA 1QQCA 3BABA 3D3IA 5EZYA 4E8HA 1W2BU 5IO0A 1L0LH 4ZBMA 4JI5B 2H0HA 4MTXA 2QGVA 1O9GA 2DJVA 1PL2A 20GSA 4KF9A 1SQXH 2EILB 3L78A 3A0RA 3QTCA 1HR0B 1P49A 4NYKA 1M90W 4K7IA 1FAAA 1B9YC 3CTGA 5L71A 2HSMA 5LGUA 5LL6Y 1LNQA 1QCEA 1ZUQA 3B40A 4O7HA 4EEQA 5IJ0A 3CB2A 1VF7A 4ZI7B 4UVAA 1IBLO 3F4RA 3QNEA 5KAFZ 3M0FA 1KB9F 1O9HA 3PPUA 5ECNB 5DCGA 1K33A 2PI5A 5ECIB 2A2PA 3FD9A 4OX9O 4EL1A 4HYOA 4ECBA 4Z2WA 3F5TA 3JCML 1O7UA 1TTZA 1G1XB 4Q5FA 1AB3A 1QUWA 3B4SA 1U96A 3QO8A 4B3RB 2YIDA 5LGNA 4N21A 4KDYA 3RHCA 2GSRA 4BR6A 4L87A 3RYIA 4JYCA 3JARA 1I5XA 2EULA 5C04A 3MAKA 2LQQA 2YWOA 2OADA 3SPHA 1LUWA 1FPOA 3ASNC 4Z1MG 1MDIA 3OTOB 2ZCEA 1M5IA 4EKWA 4RO2A 2R3XA 5J9BA 4Z2RA 3C71A 4KE3A 1XW6A 4XDLA 2H0IA 1ON4A 1MABG 4YJ2B 1TP9A 4D7TA 5KA5A 1HD2A 2IIYA 1LR1A 1OCZC 5EBLC 2UXBO 2J23A 6GSTA 2OE1A 2VM1A 3GX0A 4IJIA 3APQA 1M56C 3TRQA 2CH7B 2ITDC 3TRPA 1DLBA 4DSQA 4WR5A 5E59A 4MZCA 1VMGA 5H5RA 1XUQA 4TR1A 3VK9A 4W4KA 1XW5A 4BVYB 2MBTA 1AW9A 2VO4A 1AVMA 4G0IA 3TB2A 4DR3O 3U0ZA 2KG7B 5GW7A 2HFEC 1WAZA 2QGNA 3UMAA 3U11A 2A2SA 1IVSA 4TR0A 4GYCB 5IJ9A 2VM2A 1EOGA 3FR6A 1PA3A 2L4QA 1NU1H 1Z7RA 4HJ2A 2FLSA 1K7DA 1X4TA 3RVYA 1GUHA 5D96A 1AP6A 3ZHUA 1XNRO 5AN1A 1BJXA 4JGSA 4GXZA 3G6BA 4X65O 2IM9A 1EN4A 3L0HA 5DDLA 1SYXA 1N8JA 2HLDG 3CRCA 3HJOA 4AJ8A 5BMUA 2PMTA 1CPYA 1R3JC 4JPRA 3GL3A 4ZBDA 3CSHA 4CC6A 3ZBHA 4KXRA 2YV9A 2F8AA 4O5UA 1O85A 3L73H 1F6MC 4LF9O 3CBUA 1XOUA 4LNUB 1T1VA 3KH9A 1MD3A 1GSUA 5B1NA 2DJ2A 2DQ0A 2JRIA 3C90A 3UBKA 2PVQA 4ICYA 5E1AC 1WPBA 2WLKA 3E8GA 5EIBD 2W6JG 4DYLA 4PQHA 2NTOA 5CO3A 1ZZYA 1XOBA 1BQ7A 2I9HA 3BEHA 3IAYA 1G7OA 5J2UB 3EMPA 3FW2A 1NI8A 3QAVA 4IHJA 4KHPO 4LFCO 2OE0A 2H76A 4YJ2A 4MVMA 3Q18A 4F0CA 3LORA 1OCRC 4NAXA 1NR1A 4EB6B 3OD4A 5LMNO 2PF4E 1YJ9V 1GRXA 5JWRB 2IU3A 1ILOA 2K1EA 3CCRV 5IDJA 1K0NA 1TRSA 1VRSD 5EVOA 5INYA 4LR3A 3SYPA 1H2SB 1YEPA 3WU2Z 4LF8B 4J42A 1XQ8A 3W7TA 1FFTB 2W0FC 3GWOA 4JTAB 2JS3A 2AZ0A 4BW9A 3H1KH 3WGEA 4JAVA 4DV5B 4G0LA 3A0BZ 5L3BA 3DXBA 4JTDB 4JR6A 1URFA 3T4ZA 4ZB8A 1WJZA 2PGGA 1WB7A 4NXIA 5E4WA 5AISA 4I2UA 3IC9A 4Q20A 3DVWA 1ZL8A 2B1KA 4BW5A 2C3TA 4JI8O 2EIRA 4FO5A 1F2EA 1GL8A 1YI2V 12GSA 3A2XA 2D2ZA 3E86A 1E2YA 2YEVB 1OC9A 1SKVA 5B1BC 4TRXA 2ILMA 1XXUA 3ZMTA 3HKDB 1S3DA 1KU9A 1VQ8V 1R26A 4LFAO 4WFHA 1EV4A 4JR4A 1PM9A 1D5AA 1H2MA 4ZOLA 4LF7B 2YP6A 1Q6IA 3TXSA 1AAZA 3E8BA 4I55B 1BQ0A 1FOHA 1TW9A 3RW0A 1K0CA 4DUZO 2A9HA 3ZMVA 3GNJA 1HNWB 5A4WA 1TOFA 1SJIA 4DSSB 2H8PC 3A2WA 3TOTA 3UVHA 3ZYWA 4EKZA 1TRUA 3RYFB 4ECJA 4WF5A 2C0DA 3TJBA 2XASA 1JPXA 2HFDA 5AGYA 1WB8A 5LA6A 2K8SA 1XWKA 3X2QB 3MHSC 4QIWF 4RUFA 4WFGA 1QFNA 3ZX6A 2WZ9A 4JI1B 1Q86W 3AY8A 4CH6A 2WLJA 4J11A 4X66B 3KZQA 4RQRA 1FYJA 3HVNA 2UXDB 4NTWA 3S3WA 1P84F 2R9RB 4GT1A 2L6LA 2HSHA 2V1MA 3IAM2 2PI4A 2HXKA 2XAJA 1PD21 3CSJA 1XVQA 4N11A 4DV1B 3EVIA 5B1AB 5LXTA 4EUYA 5KHIA 1XMOO 3FB6C 4GSSA 1SKRB 2WWWA 4EVMA 3HR0A 4JV5O 5KA6A 4DR2O 1RM1C 1BE3H 2VQFB 2RUFA 2LGWA 3PN1A 1OKTA 4MTOA 2W0XA 1R73A 4I50B 4XIHA 5JWQB 3UCSC 4PV1B 4PA7A 5IOXA 2B5EA 4JI5O 4N23A 3LYKA 2H70A 1K0MA 4KDXA 4PA4A 4NKGB 1T3BA 2QA4V 4MZBA 2WA4A 3T2MA 3NIVA 1NH2D 2K18A 4J2FA 2CV4A 3MAQA 1HR0O 2V1DA 2YEVA 4GTUA 1OE8A 2X8GA 3B09A 3ZRVA 3QAGA 1FVKA 4JI3B 4ID0A 4DV7O 1HNXB 1M1KW 3K0GA 2HZEB 4G10A 2P5RA 5CRHA 2AYTA 5IWAB 3P3PA 3AG4C 3CRQA 1LU4A 2PZSA 1TK0B 3EWLA 1G4YB 4JI7B 4TUYB 4MK3A 2UUAB 3SPJA 2QM7A 4PJ0Z 4PURA 5KX5A 3CC4V 1B4PA 2TRCP 3B8MA 4K9ZA 5IYBO 3ZMUA 4FM1A 1JZWA 3CPWU 2BMXA 5D9VA 2HR3A 2IJIA 2EIMB 3HB3B 5DM6V 1U3AA 1AJPA 2JJ2G 4HZ4A 5IPGA 4MW3A 2OCHA 1HNZB 3R2QA 4LMVA 3L71H 4XTSA 4HI7A 2YI8A 1J5EO 2CGNA 4B3RO 3OGIB 3GUSA 4XS4A 2B5UA 5KUKA 2ZQMA 1WP0A 2GQKA 4OO4A 2CGOA 2EJRA 3BRCA 2CT6A 4IGJA 3OR6C 4MVOA 3OR7C 2OWOA 1OCOB 1OCCC 2P90A 4QE7A 3QG5A 4JBBA 4WBNA 4TT3G 1GSEA 5D5PA 4TR4A 2OBKA 4YIPA 4HZ2A 4EFEA 2XOKG 6GSUA 1GKFA 4O4JB 1UJWB 4DR6B 4U3FH 4CC5A 1Q5OA 3ZEDA 2C0GA 2DKHA 4PTSA 2ATKC 4V2MA 1VQNV 2L35A 3SJCC 2QKSA 3RPNA 1ENVA 4WETA 4ACSA 3OEEG 2H3OA 3D21A 5KHJA 2JIZG 2ON5A 2PBJA 4K8ZA 1K3OA 3I9V2 3VQXA 2VAFA 1GMGA 5BZBA 3U5RE 1ST9A 1PD3A 3GTUA 3R65A 3GSTA 5KOXA 1R3LC 2ZR3A 2CQ9A 4J80A 1PRXA 2AHYA 3O3TA 3JASB 2F66C 4L5LA 1O81A 4UCUA 2RN9A 3ED3A 1EFRG 2L6CA 1SKSB 3E22B 1EOHA 2Q7GA 1J0FA 5GTIZ 5HR3A 1TA8A 3ZIAG 4MF6A 2IJHA 3CCLV 1GSFA 1P7BA 3WGDA 3PJSK 2DIYA 3ERGA 1SK2A 1THOA 2VL2A 4POMA 3G9BA 2MYGA 3K08A 1SA0A 3JD4A 4UUJC 4IL6Z 2VRZA 5H5QA 1JLVA 4O4IA 1R5PA 2MMOA 2QKAA 3AG2C 1NW2A 1YQ1A 4IP1A 5JH7B 1WA8B 4L8JA 1ERVA 3FB7C 2I81A 3O76A 4YAVA 3K5LA 22GSA 5KN2A 2JEUA 4NB5A 1M9AA 3D5JA 1YIJV 3CMAV 2YXYA 3EINA 3TCOA 2ZE8A 1XIYA 1YEWA 1PV0A 4FYCA 4JI4O 1BYEA 1GN2A 3M7MX 2WAMA 1TXXA 4ML1A 3K9AA 3PH9A 1YXBA 1I7FA 2LJRA 2HEPA 3KCXA 2JSYA 1JHBA 1TUBA 3SGIA 2V32A 3FR9A 4OMVA 5JCOC 3CCSV 2AZ2A 3JALA 1PSQA 2BOCC 2BCCH 3I5DA 4U3JB 4KX4A 3CRUA 3B2EE 4J7KA 5DJMA 2M7WA 4G19A 1LJRA 3BCCH 5E79Z 3GYKA 4QQ7A 11GSA 1BS3A 2DQ3A 2IH1C 5LHGA 4ULXA 1R7HA 4IJ3A 3GKMA 2NN4A 4I4TA 4JTCB 1SL2B 5GSTA 3D8CA 3J7Yb 4H86A 1O8WA 1PNKA 3OR5A 2ZR2A 3G4SV 4NHZA 2F3MA 3ZZXA 4CW9A 3H1LH 2BTOA 4PHZA 4B08A 4MVZA 1AQWA 2H71A 2RM5A 3UAPA 1GTUA 1VEWA 4O4JA 2HNLA 4BIOA 5JJNB 1XNRB 2HYXA 4F6EA 2P0GA 5HFIA 2VD1A 3ABMB 3QOUA 4BAYA 2DYRC 1W0JG 1P4RA 4WBJA 4JAUA 4LCUC 5JJEB 3E2EA 3FEUA 2EZOA 2YV7A 1CP9A 3E89A 1XDCA 1GM8A 4UXNA 1IBMB 2QWRB 3HKRA 3ZRWA 4L5OA 2GBOA 2BTQB 1M3IA 2K9PA 3DKSA 4RQFA 4QGPA 3W7WA 2HVKC 2VCXA 4K8MA 4IBPA 1LBKA 2CVDA 4DV5O 2L59A 2CDYA 2Q5ZA 4OFNA 4EIPA 2WLMA 2IPAA 1GSDA 1KP3A 5IMFA 3DC6A 5CN0A 1H2LA 3D36A 2M80A 2ARHA 3ZIJA 2WLNA 3HCZA 4HU7A 1ML6A 1H8EG 3AK2A 1YKAA 3L9DA 4J41A 3DC5A 2Y69C 4N0ZA 4NWYA 2RQ6A 3UQ8A 3GMFA 2NNUA 2NBSA 1EGRA 4AF2A 5JH7A 3W8JA 4JYAB 2WRTA 4ZHQA 1R6NA 4KHPB 4GZRB 5IIZA 4DV2B 5J2TB 3GKXA 4K0KB 3FMWA 4XRDA 4ZB6A 1MOFA 2DE0X 2MZCA 3M9JA 4PXOA 1RW1A 3HKEA 1VQ6V 2FKXA 3Q4HB 1A8LA 1XHXA 2A2RA 2KP1A 1KYOF 1NVPB 4HQSA 2D2CB 3IDVA 3VPQA 2GTAA 1N32O 3HJMA 2NR5A 5LHHA 2DWDC 4BIUA 1SK0A 4PQ1A 4LF7O 2C0FA 2QC7A 2VLVA 3A0HZ 4H33A 2HRAA 3KKYA 2FWHA 1MDKA 1FHEA 3GV1A 4PX1A 4XS6A 3K06A 2F95B 2DYSC 3N2KA 1HNWO 2OIGA 1S76D 2VIMA 2LJ2A 1B9XC 2A4HA 2FGXA 1F37A 3BCIA 2JK5C 4WFFA 2NVLA 2JZSA 1VQKV 2H75A 3F6DA 1V54C 2IBZH 4PDMA 3K0DA 1SENA 1THXA 4AGSA 4TV9B 4TOIA 2QEXV 1HNAA 4BL7B 1YZBA 4JASA 2C4JA 3CRAA 1DGSA 5ECSA 3CCVV 3OMAB 1XVWA 5G1LA 2LEGA 1JR9A 2CTRA 1DE1A 3A2FA 1EM1A 1X0RA 3K03A 4J56E 2DMXA 4R6ZA 4JI1O 5IO2A 3GX8A 3UKMA 3JAWB 4X66O 3TJKA 4POLA 1X5DA 1BHAA 3D3QA 1K9MW 4LFAB 1AJNA 5F0GA 2JU5A 4KAEA 4ML6A 2BTQA 3JATB 5H6RA 1W89A 3UOMA 2P6JA 4DV1O 5GONA 3F6FA 5CA1A 2PERA 2LQTA 4NR1A 4JI0O 2NLJC 4DV6O 4FPPA 4HAMA 2RUEA 4K7OA 2VLUA 4K7NA 2EILC 2EIJB 3QMXA 3GFKA 3QF7A 1A8YA 3F5WC 4FM0A 2HJFC 4PNGA 5LYJA 1V40A 1HNBA 4X20B 5EK0A 4XRAA 4OCFA 2AGAA 2Y4TA 3TETA 5LD0A 3ZN0A 3CRRA 4WFEA 1R5AA 5AIXA 2TRXA 1EP8A 1VARA 2D3OW 3HKCB 3IGAC 2WLIB 1AXDA 3MWHA 3ABLC 3RVZA 3UT5A 3K58A 3CCJV 1GSYA 1ZYQB 3KXOA 3STZC 1S5LZ 1VIBA 1EP7A 2XHFA 1MA1A 4ZBBA 4DEJA 5LP6A 3F4TA 3Q74A 5K1PA 18GSA 2G38A 4DUYB 4JI3O 2XAGA 1JZRA 4QE9A 1HNXO 2B5XA 3LSQA 3R66A 3WYWA 4X1IA 3WT2A 1GRJA 1VQ5V 1G6UA 4JI7O 2JSZA 1XWAA 3MDSA 2UUAO 3F7YC 1DUGA 3H4KA 4EDYA 2DOSA 3C1SA 2CAZC 1DK1A 8GSSA 3T1YB 4IQ1A 3CXGA 2JADA 4YAPA 5DQYA 2YWMA 1KTEA 3HVVA 3ZREA 2GSSA 5A5KA 2BOBC 1I5YA 5LCZA 3TOUA 1GNWA 1SETA 3MIXA 2PPTA 5KOWA 1T5EA 2HJDA 3VWWA 3IC4A 2E7PA 3PGTA 4TV9A 3IAS2 2KQXA 4MJEA 4TSFG 1IXMA 4ILFA 2JVDA 5CP1A 1XWBA 3SYQA 2AJQB 4FFBA 4OO5A 1TU8A 2JJ1G 1K92A 3DIEA 3K8NA 2HP8A 1IURA 5ID2B 1EGOA 1K3LA 2WCIA 3WG7B 4DV7B 4K8XA 5G30A 1OC8A 1RQMA 1ZGNA 2X7RB 2P4VA 2ON7A 1BL8A 4ISDA 4DR6O 2L57A 2QSIA 4NPBA 1M2AA 4X1YA 2WSSG 2E5LO 2YZUA 4GSNA 4MP4A 2X0LA 1QXHA 5ECRB 3RHBA 3BCKA 3LSZA 1RK4A 3HY2A 4DR4B 4UVBA 4B7EA 1HP8A 4TQFA 2R70A 1Q90D 2KP2A 3EXAA 2E0QA 3ZHSA 4FLVA 1W59A 1A2MA 2VWKA 4USSA 2CTPA 4PD4F 1ZYNA 5IQYA 1CXZB 4WEYA 1EZKA 5FNVB 2H19A 3FB8C 3VI7A 1AQXA 3OMIB 1J5EB 1AJQA 3J7Yk 1JVMA 3D4MA 3QAWA 5ITZB 3K79A 5JWOB 1QBZA 4WFAV 2YIBD 4F03A 3IPZA 1VF2A 2XAFA 3G80A 2IFQB 2EBOA 1Y74B 5ECHB 4F6RB 2LJKA 3J7AU 3HJPA 1ERUA 2YXLA 3H1HH 3GA4A 1Y25A 5D73A 2YJ7A 1G8MA 5ENUA 2WLLA 4BA7A 4ZL7A 1SESA 1WOUA 4D7SA 2KLXA 5FWGA 4ABMA 4O5RA 3DSQA 1BZKA 5AIVA 2WJUA 3G71V 1AC1A 1M57B 4LF5B 4IYIA 1GSSA 3GKNA 2CAQA 2MMZA 2GGTA 1JX9A 1FG4A 4OPHA 3CHXA 4IT5A 4FLTA 4D73B 1FFXB 3DGQA 4Z7XA 5B3SC 3BFRA 3THOA 4H44B 4LWSB 2UXCB 1AROP 2PWJA 2JGDA 3GIXA 5JVDB 2IN3A 5KHKA 5IYZB 2GDSA 2O89A 5DVBA 2CK3G 19GSA 1U3IA 2FNOA 1SYRA 1WPIA 4DXWA 4YQVA 3AG1C 2K8VA 3WGXA 5EY6A 4I9WA 3DVXA 4D6TH 2LQOA 1GTBA 1M4UA 1I0HA 2IMEA 2OKAA 5KAIZ 3ZJZA 2AHEA 2ZXWC 1P7GA 5KEJA 1THZA 4MSWC 1FB6A 1IXBA 1XMQB 4RI7A 2RLIA 3DWVA 1V58A 1Z5WA 2H1DA 2KB1A 4ZI7A 5IT9N 2HVJC 3UJ1A 1TAEA 4JI4B 2ZNMA 3KZIZ 1QNMA 2H74A 4MTGA 2L4CA 1QR8A 2FY6A 1F3BA 3FAVB 1GN4A 1IBMO 1HNCA 3ASOC 3KD0A 1MSDA 4QJFB 4BIZA 1YZXA 5C8YB 1O73A 1GULA 4G28B 3A5IA 4JI2B 1T4YA 2J9HA 1X9WB 3FFQA 2M72A 3ZMKA 1VQLV 1DBYA 1PN0A 1F23A 2B6MA 3IJ4A 4PA6A 3JCZA 10GSA 4KSOA 4LH7A 3SYOA 5A4UA 1YF1A 1FD9A 3DMLA 1TRVA 1QGVA 4QL7A 1QLEC 2P4KA 2N05A 2H72A 2ADPA 1AI5A 3U10A 3SJAC 1MEKA 4WF4A 2ZE5A 4JYAO 2DIZA 1OCZB 1X9MB 1K4CC 2GLRA 3HA9A 4DV2O 1K34A 4K0KO 4JAAA 1M56B 4MTFA 4Z1VA 1ZL9A 2B1LA 1S5HC 4DRXB 1PL1A 4HU9A 4DW0A 2F51A 2YDEA 5H2FZ 5IE9A 4RQXA 1VGLA 1SQVH 4LWSA 3LQ7A 2CH7A 3IOSA 4EF0A 4Q5RA 5JVDA 3SJBC 2EX3A 1NHOA 3FZ4A 1XILA 1MMMA 3DXRB 2E2MA 2YWNA 4TXVA 3RWRD 2HG5C 2H6YA 4UCOA 1TRWA 1O8XA 1I94B 1PQNA 4J7ZA 4BVYA 1WRYA 1SL0B 1AR1B 1R3KC 3LEFA 4GX1A 2PUKC 2Q69A 2KG7A 2HSYA 4YHHB 4POKA 3C8EA 4KH7A 4IIJB 2UXNA 3X2QC 1QVFU 1JFFB 1W0KG 3CS5A 4FK5C 1Z6MA 2B7KA 1B6QA 2YN1A 5IMCA 3L9SA 4XS1A 3HKBB 1K4DC 1Q6HA 3DEXA 4G0KA 1YF0A 2V2GA 1B04A 2Q73A 2OTLV 1F4NA 1JZOA 2P5QA 1J08A 1PN9A 2WA3A 2LRNA 4DV3O 2R4VA 3IA1A 3RBTA 4FLYA 3EFFK 2AHZA 1U88A 4MABA 4BIKA 3CP1A 1GO3F 1BHBA 3P2AA 2FL4A 1K0BA 5BRTA 4LH6A 3TCUA 5DN6G 2A7WA 1JA8A 2ETNA 5B66Z 2LFRA 2UU9O 1S3AA 2QWPB 1N32B 2L6DA 1WNSA 2QWNB 2C80A 3CEIA 3TKSA 1YJWV 2FYUH 3G67A 3L72H 4LNUA 1M2DA 4O5QA 4O2BB 5K1XA 5EYPB 4GX5A 1H75A 3H01A 2PN8A 3SBCA 1YSCA 2GTSA 2LNSA 4JI6O 1QK8A 5JCUA 3VQYA 3QPMA 2EIKB 2RMKB 4O4LB 3RYCB 3CXCU 2LSTA 1NTKH 3KCMA 1NT2B 5JQGB 1C72A 1EZVH 2WLHA 5TISZ 2F4VB 2VL2C 3RYHB 13GSA 4LP8A 1IBKB 5CBHA 3CJHB 4MF5A 5F05A 3OGCC 3FZAA 4GQFA 2IW5A 1VF5B 3EVKA 5J2UA 1OCRB 1XHZA 4IYHA 5F06A 3EC3A 4ZB9A 2LFSA 4CY6A 2N04A 3E8HA 4EB6A 3L9UA 2VWJA 3UO2A 4DUYO 2HLSA 3OT7A 1MNGA 3IC8A 5H6QA 1A32A 1Y76B 2QDOA 1AI7A 4GKKO 2FWEA 1Y66A 3OUSA 5F07A 2R9AA 2EIMC 3RPPA 4EDZA 1Q6UA 4MH2A 3B8NA 4TVEA 5D9XA 4TN8A 1QLNA 5B6NA 2EINC 3E35A 3T1YO 4JI0B 3SPIA 4DV6B 3Q19A 3C3SA 1T4ZA 4FLXA 3KGKA 1K8AW 1OCOC 3IXRA 4IVFA 2Z3YA 4DV4O 4FZ0A 4I6XA 1EBOA 2V7QG 4F9ZA 4GKJO 3BPZA 3ZCCA 4N30A 4P9PA 1KQSU 3EYTA 4KP4A 5HR2A 5IMVA 1NZ6A 3R3EA 5DECA 1SQBH 3IK9A 2LW1A 3PR8A 1N33B 5EC2C 5CRWA 2YI9A 4YJ3B 1EZJA 5D9WA 4OD7A 4PGTA 3HKDA 1PX6A 4P2ZA 3BA9A 2FHEA 1EN5A 4LL4B 2IL3A 5BR8B 1BGYH 2QR4A 1ZOFA 1SS3A 5CRGA 5G1KA 5IMAA 4DK0A 3JD3A 2O85A 2OE3A 4UVCA 1NH2B 3AG3C 4DR4O 1GP1A 5DBQA 4MPFA 1Q98A 2BE3A 2X6CA 4I55A 3IR4A 2Q8VA 4IP6A 1FOVA 2CZ3A 2O8VB 4AHCA 3TJTA 2LS5A 5FLXN 4DSSA 2O7KA 6GSWA 1SQPH 1MZFA 1SC5B 3J81N 1WLEA 3D36C 1KD1W 2X8CA 2YXHA 2EC4A 4AI8A 3SPCA 4GX2A 3LNMB 3RYFA 5JQGA 5IYCO 3D4TA 1OVNA 4X64B 1F3AA 1I9DA 2DJ3A 2X99A 1PKXA 3I55V 4QPJA 4X43A 4FIWA 3CJHA 3NOFA 4UB6Z 4K2DA 6GSXA 4V1Ag 1T00A 4TKYA 2C3QA 3F9UA 1NSWA 1PKWA 4TW5A 1BAYA 2Q67A 3IK7A 3FKSG 1OYJA 3VOUA 3HPLC 4FMTA 1U6TA 4KW6A 4UV8A 4J7JA 5B5EZ 4CBCA 4WKWA 3FYIB 3H1JH 3IFXA 4WXTA 3CWBH 3WD6A 3LDDA 2E5LB 1A0FA 3SR2C 5H5NA 4LF5O 1IYIA 4GCIA 3ICXA 1HYUA 1XW9A 1Z2GA 2JZTA 2XPEA 4CHSA 1RM1B 5G2ZA 16GSA 3KMNA 2A3QA 2Y4UA 1NQTA 1BG5A 2UXCO 5LOVB 3IHQA 2Q0OC 3ZS8C 2DBCA 3F0IA 1BX9A 5HQPA 2BTOT 4I9QA 5CBFA 3M99B 2YNXA 4AQYO 1K97A 2V6KA 4I50A 2ZKOA 4J9ZB 4TOPA 5C00A 1RSOB 4TV8B 2YUAA 5BMVB 1SQFA 2LO1A 4CDOA 3OMNB 3DD3A 4BWAA 4A5UB 3G7JA 5EBMC 4MDCA 1T8EB 1XWCA 4K1FA 3OE7G 4XCSA 4NV5A 1V55B 1SQGA 1QR9A 1H4OA 2F8FA 2ODMA 1RPOA 1XMQO 2HZEA 3WB2A 2OT5A 3HVSA 5B8BA 3QVNA 3KEBA 3ZMZA 1O6JA 3ZMLA 5J5NA 2KOKA 3ETQA 5GAND 4TUYA 4WBRD 1PPJH 4YY3O 4CH5A 4PELA 1TU7A 4V2LA 5IY5C 2AAWA 1N0JA 4KDUA 3I56V 2PVOC 3C73A 1XBSA 3F7VC 2HI7A 3HYPA 4TXOB 1K3EA 2MMAA 4JI2O 1Q81W 4KUNA 2GTUA 3O9OA 4KB3A 5CAXA 1OCCB 3APSA 4Q5QA 2IJKA 4V2NA 4O4HB 1JCHA 2UUCB 2K9FA 4FYBA 2GSMB 2OACA 3LW9A 4RAIA 4MT8A 1N36B 1K0AA 1JQ0A 5JJJB 1G7EA 2QE7G 4GCZA 5LP6C 2BJXA 4IN0A 1FW1A 14GSA 4E4EA 1UPGA 1H38A 3GRXA 3ZHVA 4K35A 3ZVJA 4FYUA 4B3MO 1UN2A 3P8WA 4X8AA 3DYRA 1FVJA 4I7ZB 3TK1A 4ZBAA 1Q3EA 4YIOA 5CA0B 3K3WA 3MSZA 1F4MA 5LOVA 4GSTA 2QA1A 5D8IA 2E2GA 3M1GA 3MYDA 2Q7HA 2Q68A 3EMXA 4KA0A 1TJDA 2YIAA 2I3YA 1ZCPA 1I94O 3JASA 4TV8A 3FZ5A 5BMVA 3E22A 2V6OA 4LMWA 3L70H 1EN6A 5KN3A 1OJHA 2I1UA 1BQZA 3LNNA 2CTWA 4YHHO 3AG2B 3ABKC 2QA2A 3TKPA 4OPAA 4I8BA 3T1CA 1B3QA 2VCTA 3VQWA 3VI5A 1OAZA 5CMUA 1SK1A 1ZLZA 1WA8A 5CBGA 3LJRA 2X8HA 4HNAB 4HQZA 4PUFC 1R3IC 1VF4A 4AILC 5EL8A 1F7YA 3CYNA 2ZDIA 3RN4A 4DR7B 1Z5YE 4U7NA 3LFLA 3RBZA 3A3TA 1FJGB 1S0VA 5IMZA 3GWKC 1BEDA 1EEJA 3BVOA 2X49A 2H94A 4YKGA 4CH4A 3K59A 2YANA 4XDKA 1B8XA 3TGZA 2EIJC 4LC1A 1M9NA 1GK9A 4MMMA 3N2GB 1YJNV 3ETEA 2JACA 4U3JA 4NXNB 3BJ5A 1R6KA 5B7CA 4BVXB 5CREA 1A23A 5KHHA 1B06A 3K5MA 4LF6O 1FB0A 2G2QA 2HRKA 2C3NA 2R0CA 3FHKA 2H1GA 4MH3A 4RUEA 4ZILA 3UBLA 3V1WA 2F4VO 2XBIA 4PQIA 2HRFA 4O32A 2VQEB 3ETDA 3JCUZ 1IBKO 3TUEA 2FTKA 4YQMA 4EE0A 3CX5F 3OAAG 1ZX3A 2IJYA 4WR4A 5ABRA 2OCCB 4HZ3A 1CQGA 4DV3B 7GSSA 4FZ1A 2HHHB 5GSSA 2B5YA 1L8DA 4KNDA 3QCPA 2AB6A 3TKRA 3C3TA 5KMGB 1XREA 5KLVH 4B3SB 4KFMA 1FS0G 2UU9B 1GWCA 4NHWA 1AR4A 1OHHG 5EZYB 4FLWA 2FA8A 4XDJA 1YJ6A 4K3AA 4X9QA 2EJ7A 1VQPV 1WJKA 1YTFD 4Q6GA 3VPTA 1HQOA 2CX3A 2Y69B 1BSMA 4FJCC 4JI6B 2UUBO 5A9GA 3A2VA 3ISOA 3CSXA 3UVTA 1YF2A 5IJ0B 4I2TA 4DR1O 1WP8A 4RQEA 2ADQB 2N5BA 3L75H 2N5AA 1F9MA 4JU5A 3GSSA 4JZQA 4X88A 5J2TA 2WULA 1UVZA 4RUVA 1N33O 3IV4A 5IYDO 2NDOA 2LV3A 2IMKA 3TDGA 1A2JA 4EO3A 2O87A 3HVXA 1FXKB 2FWGA 5ELGA 3Q4HA 1K0DA 1VF6A 4KL1A 3K57A 5HFGA 1NR7A 4DK1A 4MVSA 3P3NA 4GKKB 3BY6A 4IELA 5BR8O 3TJGA 4UB8Z 3HD5A 4FM2A 4PDRA 3N2GA 1ZAUA 2QTSA 3PINA 1Q8IA 2PUSA 1PP9H 5J9CA 4NMUA 1B4QA 4LFBB 4PI0A 3UEMA 5J4UA 3S9FA 3JARB 2ZE6A 3OUFA 3BAAA 2ZE7A 3KTLA 3LXTA 4HS1A 5HR0A 3MD0A 4EFBA 4CS4A 2GZYA 2JDIG 3UL3A 1Z3EA 3RGBA 2YS8A 4DV4B 1GNEA 4X64O 3CMIA 1WE0A 4GKJB 3ZMSA 1GAXA 2Q4PA 4MJCA 4BL7A 5H9CA 1XNQO 3HDCA 4I5QA 5ECKB 3VWUA 2P7TC 1AILA 3FB5C 3AG7A 2KSDA 4MCUA 3AK3A 3ME7A 2PTMA 1AUCA 2GSTA 1WPXA 2JGUA 3LXZA 1U97A 3G6EV 3US3A 1G6WA 2W6IG 1Z6NA 2PGTA 4MLYA 2M46A 3JAWA 5DAKB 4OFMA 2O57A 2LNTA 4UCSA 3FY7A 5L3FA 2F93B 3QR6A 2Y0IA 4V1Ap 4TR1B 5HFKA 2YJHA 3H9VA 3JATA 3ZHRA 3EU4A 2CE4A 4JE1A 4N0VA 3KTBA 1YVWA 1T7PB 5A4VA 4MA9A 2Q6AA 2DJ1A 5DALB 4DVCA 2Z5UA 5HR1A 1MDJA 4ICGA 1X9SB 5KUMA 5IJ9B 1SZTA 2X6BA 3P7XA 1TVKB 3KCYA 4TWKA 3CMEV 5FPRA 3L74H 4X20A 2LRCA 3LDEA 2CZ2A 3ABLB 5IMDA 1W4VA 1WWJA 2QM4A 3E8FA 2VCQA 5L3DA 1XOAA 3HKCA 3IRAA 2WLIA 4DW1A 3C7MA 4CS3A 5FPOA 4JZGA 2WFCA 1M93A 3OEHG 2HKOA 3NR7A 3FRCA 1K5QA 2RCVA 4H0LB 4HOJA 4HBNA 2H1AA 2Q9LA 5ELAA 1FXKA 3ZLPA 5L3CA 3H79A 1A24A 4KUMA 1A0RP 3C1RA 4QL9A 2YICA 3JSNA 3UIWA 1GM9A 3M9KA 1S72V 2ZIMA 1LUVA 4DO2A 5D93A 4EIQA 1KBNA 3SPGA 1XZOA 3TKSC 3A8TA 2NPBA 1AR5A 3SDLA 2Y0PA 5GZZB 1MG1A 1SRYA 3CE2A 1BMFG 2QKCA
chains in the Genus database with same CATH topology
2G0FA 5J3RA 4A5PA 2ES7A 2AV4A 5COHA 3EURA 4G2EA 2LKUA 1YY7A 4X4JA 3LG6A 2A4VA 1KEBA 1Q4JA 5DCHA 4ZIJA 5D9TA 2JZRA 1MTCA 3TKSE 3BOAA 4FH8A 5ID2A 1M7TA 5DAKA 1AIUA 2VL9A 6GSSA 1SU9A 1EEMA 2WB9A 2GT5A 5CNWA 5DALA 2GS3A 1M99A 3VURA 1ABAA 4OFTA 1ZMAA 3M8NA 5IM9A 2R2JA 4MF7A 4X0XA 4F82A 3H8QA 3FKFA 3I43A 2EIQA 1OC9B 2YWIA 4MJBA 2MMNA 2M6YA 4F2IA 2IFQA 2WGRA 3FZ9A 3E0UA 2DJKA 1G6YA 4MZWA 1DE2A 3HXSA 1PKZA 1S3CA 4HEA2 2CVKA 1OC3A 3GH9A 5G5EA 4J57E 3LWAA 4D73A 2C8UA 4ZL9A 4GWRA 4K0NA 3ZFBA 3ZTLA 3APOA 1X5CA 5ECLB 1ACVA 1M9BA 3QD9A 1GLPA 1PMTA 3VLNA 2F9SA 3CTFA 2DKIA 3E9JB 2XBQA 1QQ2A 4IW9A 1R4WA 4ECCA 2N5FA 2RM6A 3A5WA 1GH2A 2VCVA 2I4AA 1YDKA 3GURA 4K2XA 5G5FA 1SD8A 2GZZA 4PUAA 1XBLA 2QWOB 4NV2A 4AJ7A 2JL4A 1TI3A 4OWYA 4P3YB 2IMIA 4HJMA 3W8SA 5H5SA 5KN0A 2GT6A 3P90A 2VL3A 2R6KA 2OA7A 2R37A 3GKKA 4GRFA 2X64A 1VF1A 2OJLA 2VD0A 3EE2A 4IQAA 1QMVA 5FHIA 2DN9A 1TDIA 4N10A 1CQHA 2VOCA 1TK8B 4L8EA 1XFLA 1N4CA 4I97A 1GSQA 2XPDA 1K0OA 4XS4B 4RWUA 1VF3A 4KCAA 5GAPD 2UZ8A 4K6XA 1UC7A 3KIJA 3KP9A 5DQSA 2KHPA 1N2AA 2R5GA 2GSQA 2YOIA 2IMDA 4POBA 1V98A 3GH6A 2H73A 2GUZB 1USBA 2GVPA 3O6TA 4OCEA 3RDWA 1HDJA 2CA8A 2QWQB 3GHAA 2REMA 1MD4A 3GTUB 4GF0A 1WIKA 3TKQA 2R0GA 2HRNA 2LRTA 1SL1B 3H93A 2IMFA 2DJ0A 3EPTA 4TR3A 3MNGA 4LA1A 4AJ6A 3UARA 1SJ6A 2GZPA 4I6XA 2KUCA 3N9JA 2YPMA 2C1YA 4YH2A 9GSSA 2CX4A 3I6AA 3UO3A 2H30A 2B7JA 2ZUPA 4Z2TA 4O92A 6GSYA 3NZNA 1EWXA 3Q6OA 3VFIA 3QFBC 3CRTA 1Z9HA 3VWXA 1WMJA 2K6VA 3HZ8A 3M3MA 3BD2A 5ECQB 2VCZA 2GDRA 3HHVA 3ZVJD 1EV9A 4HUAA 4EC0A 2FD3A 3D0ZA 4HDEA 1Z7PA 3GL5A 3LYPA 2HZFA 4L0WA 1ZYEA 4IS0A 2DLXA 1YEXA 3G7YA 2C0EA 4K0GA 2L5LA 3ZIVA 4LLRA 2GUZA 2DMLA 4G9HA 2B3SA 2FWFA 2IWTA 1YKCA 2L5OA 4K5RA 3SWLA 4ZXGA 2GQMA 1TI1A 3FK8A 4ZL8A 2AUVA 3KM6A 1FAFA 1NM3A 3BBYA 2LTKA 1GTIA 4IHUA 4BPYA 3ZFLA 5F8BA 5DJLA 4KGIA 3G7IA 5FT3A 2FUG2 1IYHA 1V57A 3ERWA 3KH7A 1TKDB 5B6MA 4GLTA 5EPFA 4X1UA 1ERWA 3VWVA 2P31A 1URMA 1JLWA 1PGTA 2WS2A 3EU3A 1UA5A 1I5GA 2CTQA 3ME8A 4XHMA 3QFAC 3IE3A 1M0UA 5ECOB 4DSRA 3F4SA 1J9BA 4L0UA 2H01A 1AQVA 2XC2A 3IHGA 1K3YA 4PNFA 2H66A 4RI6A 3F63A 5IOWA 4KSMA 3DRNA 1ZYPA 3IBHA 3LGCA 1Y6EA 5IPHA 5ECPB 1TK5B 5JCGA 1XWGA 1SKWB 5KN1A 3F3QA 3TJJA 4BWSA 1GTAA 1XPVA 1E6BA 1SJZA 4MJAA 1OE7A 1B48A 3HZ4A 4TXOA 3WT1A 3GN3A 2OBIA 2R0PA 2X4AA 1KNGA 1DSBA 2VLTA 3CSIA 3D6IA 2V41A 3TJFA 4FQUA 3MDKA 3L4NA 5JCWA 2H8LA 2GQLA 4KCEA 4CY8A 2FA4A 1JFUA 1GLQA 3N5OA 1SD9A 3U6VA 6GSVA 17GSA 1V9WA 5B8AA 4GQCA 2ZCTA 1A2LA 1FO5A 2H6XA 2YCDA 1GUKA 1JZDA 1G0TA 2TIRA 4ECIA 2H6ZA 2LJAA 5LNKe 2VUPA 3L9VA 4LL1B 2CAIA 3FYGA 3D22A 2ALBA 1V2AA 1XCCA 2H1BA 5G31A 2CVBA 2QSAA 2HT9A 1X5EA 4Q5NA 3RAZA 4JRRA 3FR3A 5J41A 5CYYA 1GUMA 2QKEA 3QDNA 2Z9SA 1U87A 1PX7A 3F8UA 3E3EA 1M2BA 3KMOA 2DC5A 2DSAA 4JEDA 3ERFA 3F3RA 5ECMB 2LUSA 2YZHA 3W6GA 3ZITA 3ZRDA 1ERTA 4BWQA 4YQUA 3KP8A 4YKFA 2RIIA 4BVXA 4E8EA 1GH6A 4MNNA 1NHYA 2FCHA 2EIOA 3TRXA 3H1NA 2MBSA 4MPGA 2DJJA 2PU9C 2VCWA 2CUGA 3I69A 2WDUA 3KJYA 4IKHA 2HE3A 3ZL5A 5CRDA 1OKDA 2DMMA 4EXJA 2H0GA 4F0BA 4Z2UA 4K5SA 4E8HA 5IO0A 2H0HA 2QGVA 1PL2A 20GSA 4KF9A 3L78A 4K7IA 1FAAA 1B9YC 3CTGA 5L71A 2HSMA 4O7HA 3F4RA 3M0FA 3PPUA 5ECNB 5DCGA 5ECIB 2A2PA 4EL1A 4ECBA 3JCML 1O7UA 1TTZA 4Q5FA 1QUWA 4KDYA 3RHCA 2GSRA 5C04A 3MAKA 2LQQA 2YWOA 2OADA 1FPOA 1MDIA 2R3XA 5J9BA 4Z2RA 3C71A 4KE3A 1XW6A 2H0IA 1ON4A 1TP9A 1HD2A 2IIYA 2J23A 6GSTA 2OE1A 2VM1A 3GX0A 4IJIA 3APQA 3TRQA 3TRPA 4DSQA 4WR5A 5E59A 4MZCA 5H5RA 4TR1A 3VK9A 1XW5A 4BVYB 2MBTA 1AW9A 2VO4A 4G0IA 3TB2A 3UMAA 2A2SA 4TR0A 2VM2A 1EOGA 3FR6A 1PA3A 2L4QA 4HJ2A 1Z7RA 2FLSA 1GUHA 5D96A 5AN1A 1BJXA 4GXZA 3L0HA 5DDLA 1SYXA 1N8JA 5BMUA 3HJOA 4AJ8A 2PMTA 3GL3A 4ZBDA 3CSHA 2YV9A 2F8AA 4O5UA 1O85A 1F6MC 3CBUA 1T1VA 3KH9A 1MD3A 1GSUA 2DJ2A 3UBKA 2PVQA 4ICYA 5CO3A 4PQHA 2NTOA 1ZZYA 1XOBA 1BQ7A 2I9HA 1G7OA 3EMPA 3FW2A 3QAVA 2OE0A 2H76A 4F0CA 3Q18A 3LORA 4NAXA 2PF4E 1GRXA 5JWRB 1ILOA 1K0NA 1TRSA 1VRSD 5EVOA 5INYA 1YEPA 3WGEA 4G0LA 4JR6A 3DXBA 4ZB8A 1WJZA 4NXIA 5E4WA 5AISA 4I2UA 3DVWA 2B1KA 2C3TA 2EIRA 4FO5A 1F2EA 1GL8A 12GSA 3A2XA 2D2ZA 1E2YA 1OC9A 4TRXA 1XXUA 1S3DA 1R26A 1EV4A 2YP6A 1AAZA 1BQ0A 1FOHA 1TW9A 1K0CA 3GNJA 5A4WA 1TOFA 1SJIA 4DSSB 3A2WA 3TOTA 3UVHA 3ZYWA 4EKZA 1TRUA 4ECJA 4WF5A 2C0DA 3TJBA 2HFDA 5AGYA 2K8SA 1XWKA 1QFNA 2WZ9A 3AY8A 3KZQA 4RQRA 2HSHA 2L6LA 2V1MA 3IAM2 2HXKA 1PD21 3CSJA 1XVQA 4N11A 3EVIA 4EUYA 4GSSA 1SKRB 4EVMA 2RUFA 2LGWA 1OKTA 5JWQB 4XIHA 3UCSC 5IOXA 2B5EA 3LYKA 2H70A 1K0MA 4KDXA 4MZBA 1T3BA 3NIVA 2K18A 4J2FA 2CV4A 4GTUA 1OE8A 2X8GA 3QAGA 1FVKA 4ID0A 4G10A 2HZEB 2P5RA 5CRHA 2AYTA 1LU4A 1TK0B 3EWLA 4MK3A 4PURA 1B4PA 2TRCP 4K9ZA 1JZWA 2BMXA 5D9VA 5IPGA 4HZ4A 1U3AA 2OCHA 3R2QA 4LMVA 4XTSA 4HI7A 4XS4A 3GUSA 2GQKA 1WP0A 4OO4A 2CT6A 4IGJA 4JBBA 1GSEA 4TR4A 2OBKA 4HZ2A 6GSUA 2C0GA 2DKHA 4PTSA 4V2MA 3RPNA 4ACSA 4WETA 3D21A 2ON5A 2PBJA 1K3OA 3I9V2 2VAFA 3U5RE 1ST9A 3GTUA 5KOXA 2CQ9A 4J80A 1PRXA 3O3TA 4L5LA 1O81A 3ED3A 2L6CA 1SKSB 1EOHA 1J0FA 5HR3A 4MF6A 1GSFA 3WGDA 2DIYA 3ERGA 1SK2A 1THOA 2VL2A 4POMA 3G9BA 2MYGA 5H5QA 1JLVA 1R5PA 2MMOA 1NW2A 1YQ1A 4MLYA 4IP1A 2I81A 1ERVA 3O76A 4YAVA 22GSA 5KN2A 1M9AA 3D5JA 3EINA 3TCOA 1XIYA 4FYCA 1BYEA 1TXXA 4ML1A 3PH9A 2LJRA 2JSYA 1JHBA 2V32A 3FR9A 4OMVA 1PSQA 4KX4A 3CRUA 5DJMA 4G19A 1LJRA 3GYKA 4QQ7A 11GSA 4ULXA 1R7HA 4IJ3A 3GKMA 1SL2B 5GSTA 3J7Yb 4H86A 1O8WA 3OR5A 4NHZA 2F3MA 3ZZXA 4CW9A 1AQWA 2H71A 2RM5A 3UAPA 1GTUA 2HNLA 2HYXA 2P0GA 5HFIA 2VD1A 3QOUA 4WBJA 3FEUA 2YV7A 2QWRB 3HKRA 4L5OA 3DKSA 2VCXA 4K8MA 4IBPA 1LBKA 2CVDA 4EIPA 2L59A 4OFNA 2IPAA 1GSDA 5IMFA 2M80A 3ZIJA 3HCZA 4HU7A 1ML6A 1YKAA 4N0ZA 4NWYA 3GMFA 2NBSA 1EGRA 4AF2A 3W8JA 2WRTA 5IIZA 3GKXA 3FMWA 4XRDA 4ZB6A 2MZCA 3M9JA 4PXOA 1RW1A 1A8LA 2A2RA 2KP1A 4HQSA 3VPQA 3IDVA 3HJMA 1SK0A 4PQ1A 2C0FA 2QC7A 2VLVA 2HRAA 2FWHA 1MDKA 1FHEA 3GV1A 4PX1A 4XS6A 2VIMA 1B9XC 2A4HA 2FGXA 1F37A 3BCIA 2NVLA 2JZSA 2H75A 3F6DA 1SENA 1THXA 4AGSA 1HNAA 4BL7B 2C4JA 5ECSA 1XVWA 5G1LA 2LEGA 2CTRA 1DE1A 1X0RA 4J56E 2DMXA 5IO2A 3GX8A 3TJKA 4POLA 1X5DA 5F0GA 2JU5A 4KAEA 4ML6A 1W89A 3UOMA 3F6FA 2PERA 2RUEA 4K7OA 2VLUA 4K7NA 3QMXA 3GFKA 1A8YA 4PNGA 1V40A 1HNBA 4XRAA 4OCFA 2Y4TA 5LD0A 1R5AA 5AIXA 2TRXA 1EP8A 1AXDA 3MWHA 1GSYA 1ZYQB 3KXOA 1EP7A 2XHFA 4ZBBA 4DEJA 3F4TA 3Q74A 18GSA 1JZRA 2B5XA 3WYWA 3WT2A 2JSZA 1XWAA 1DUGA 3H4KA 4EDYA 3C1SA 8GSSA 4IQ1A 3CXGA 2JADA 4YAPA 5DQYA 2YWMA 1KTEA 3HVVA 3ZREA 2GSSA 5A5KA 5LCZA 3TOUA 1GNWA 3MIXA 2PPTA 5KOWA 3VWWA 3IC4A 2E7PA 3PGTA 3IAS2 2KQXA 4MJEA 4ILFA 5CP1A 1XWBA 2AJQB 4OO5A 1TU8A 3DIEA 3K8NA 1IURA 5ID2B 1EGOA 1K3LA 2WCIA 5G30A 1OC8A 1RQMA 1ZGNA 4ISDA 2ON7A 2L57A 2QSIA 4NPBA 1M2AA 4MP4A 5ECRB 2YZUA 4GSNA 3RHBA 1QXHA 3BCKA 3LSZA 1RK4A 3HY2A 2KP2A 2E0QA 1A2MA 4USSA 2CTPA 1ZYNA 5IQYA 4WEYA 1EZKA 2H19A 3VI7A 1AQXA 3J7Yk 3D4MA 3QAWA 5JWOB 4F03A 3IPZA 1VF2A 2IFQB 5ECHB 2LJKA 3HJPA 1ERUA 3GA4A 1Y25A 5D73A 2YJ7A 5ENUA 4BA7A 4ZL7A 1WOUA 2KLXA 5FWGA 4O5RA 5AIVA 2WJUA 1AC1A 1GSSA 3GKNA 2CAQA 2MMZA 2GGTA 1FG4A 4IT5A 4D73B 4Z7XA 3DGQA 2PWJA 3GIXA 2IN3A 2O89A 5DVBA 1U3IA 19GSA 2FNOA 1SYRA 1WPIA 4YQVA 2K8VA 3WGXA 5EY6A 3DVXA 2LQOA 1GTBA 2IMEA 2OKAA 2AHEA 5KEJA 1FB6A 4RI7A 2RLIA 3DWVA 1V58A 2H1DA 3UJ1A 2ZNMA 2H74A 2L4CA 2FY6A 1F3BA 1HNCA 3KD0A 1YZXA 1O73A 1GULA 3A5IA 2J9HA 1T4YA 1X9WB 2M72A 3ZMKA 1DBYA 1PN0A 2B6MA 10GSA 4KSOA 5A4UA 1YF1A 3DMLA 1TRVA 1QGVA 4QL7A 2N05A 2H72A 1MEKA 4WF4A 2DIZA 1X9MB 2GLRA 3HA9A 1ZL9A 2B1LA 1PL1A 4HU9A 2F51A 4RQXA 1VGLA 3LQ7A 3IOSA 4EF0A 4Q5RA 1NHOA 3FZ4A 2E2MA 2YWNA 4TXVA 2H6YA 1TRWA 1O8XA 1PQNA 4J7ZA 4BVYA 1WRYA 1SL0B 3LEFA 2PUKC 2HSYA 4POKA 3C8EA 4KH7A 1Z6MA 2B7KA 2YN1A 5IMCA 3L9SA 4XS1A 3DEXA 4G0KA 1YF0A 2V2GA 1JZOA 2P5QA 1J08A 1PN9A 2R4VA 2LRNA 3IA1A 3RBTA 1U88A 4MABA 3P2AA 1K0BA 5BRTA 2L6DA 1S3AA 2QWPB 2QWNB 2C80A 3TKSA 1M2DA 4O5QA 1H75A 2PN8A 3SBCA 2LNSA 1QK8A 5JCUA 3QPMA 3KCMA 2LSTA 4JR4A 2VL2C 1C72A 13GSA 4MF5A 5F05A 3FZAA 4GQFA 5F06A 3EC3A 4ZB9A 4CY6A 2N04A 3L9UA 3UO2A 2HLSA 3IC8A 2FWEA 5F07A 3RPPA 4EDZA 4MH2A 4TVEA 5D9XA 4TN8A 5B6NA 3Q19A 1T4ZA 3KGKA 3IXRA 4IVFA 4F9ZA 4N30A 3EYTA 5HR2A 5IMVA 1NZ6A 3R3EA 3IK9A 3PR8A 5CRWA 5D9WA 4OD7A 4PGTA 1PX6A 2FHEA 4LL4B 2IL3A 1ZOFA 5CRGA 5IMAA 2O85A 2OE3A 1GP1A 5DBQA 4MPFA 1Q98A 3IR4A 4IP6A 1FOVA 2CZ3A 2O8VB 2LS5A 4DSSA 2O7KA 6GSWA 2X8CA 2EC4A 3D4TA 1OVNA 1F3AA 1I9DA 2DJ3A 2X99A 4X43A 4FIWA 4K2DA 3NOFA 6GSXA 4V1Ag 1T00A 4TKYA 2C3QA 3F9UA 1NSWA 1PKWA 4TW5A 1BAYA 3IK7A 1OYJA 1U6TA 4KW6A 4WKWA 4WXTA 3WD6A 1A0FA 1IYIA 4GCIA 1HYUA 1XW9A 2JZTA 2XPEA 4CHSA 5G2ZA 16GSA 3KMNA 2Y4UA 1BG5A 3IHQA 2DBCA