3ASNB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asnB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asnB02
5B1JA 2H47C 4NB7A 1AAJA 3NSCA 4HCIA 1ZDSA 1IC0A 3JT2A 5AFAA 5F7BA 2I7OA 4YSCA 4GYBA 4A2HA 3EH4B 2TSAA 1KYAA 1BXVA 4DP9X 2CALA 4RH4A 1AG0A 2FQDA 4A67A 1DZ0A 1UATA 4DP8X 4BWUA 3NJFA 5ANHA 2BWIA 1XB3A 1MG3C 3TASA 1IKOP 4DP4X 2PPAA 3ASNB 1L9RA 2JFCA 3NJKA 4HHWA 4GP5B 1A3ZA 2YAMA 1SFHA 3EH3B 2HZHA 5E9NA 1GR7A 3X1NA 4M3HA 1E5YA 1NIBA 3NP3A 1ETJA 1ET8A 2YARA 1JZFA 2DYRB 1KCWA 2IWEA 3T9WA 1JOIA 4F7KA 3PPSA 1AIZA 5I26A 5FC9A 2XX1A 1V55B 4DP2X 3S3CB 4E9YA 4YSQA 3ABMB 1A8ZA 1PLAA 1PZBA 3ABGA 1ZV2A 2NRDA 4AX3A 1M9WA 1PZCA 3EF4A 4CSPA 1MG2C 2BO0A 2WO2B 2XXGA 4BWWA 3FU7B 4QLWA 1FFTB 3QJUB 4GY4A 2BWDA 1NINA 1PNCA 1CYWA 1PNDA 4BDVB 1W6LA 5B1AB 4A2DA 2GB2A 2GIMA 4KOCA 2QPDB 3UGEA 1ID2A 2ZWNA 2A3TA 3PAUA 2CJ3A 3NJMA 4KO6A 1TU2A 2WO3B 4BXSV 3N55A 3OMIB 2J57A 5B1JC 3PAZA 3MBWB 3FS9A 1BQ5A 1T5KA 4HCFA 8PAZA 3PLYA 3PXLA 1IUZA 1PLBA 4JHVA 1GS6X 4KO7A 3TU6A 1WS8A 3FYIB 2GI0A 2VSKB 2DY2A 3RYMA 2FQFA 3AG3B 3OMNB 2EINB 3X1FA 3GXUB 1IBZA 3L45A 2YXWA 4N8UA 1HFUA 3WI9A 1CYXA 3FT0A 2J55A 3DKHA 5B7MA 2PPFA 1QHQA 2CAKA 4HIPA 1JZJA 1ET5A 1OE3A 3CVBA 2BP8A 5TK2A 4P5RA 4AKQA 2HLEB 5I6PA 2FT6A 3NP4A 4BDVA 3IE9A 1JVOA 2CBPA 2DYSB 3CG8A 1BXAA 1PCSA 2BZCA 3QJRB 3X1GA 2EIJB 2PP8A 1SDDB 1CC3A 3C75A 3T6WA 2YEVB 5I6NA 4HHGA 3H56A 1AZCA 4MFHA 2UXGA 5F7AA 2ZXWB 4ZK8A 1SHWA 3WG7B 4M4RB 1NWOA 3X1EA 2XV2A 5B1BB 3EHBB 4W9ZA 2DWSA 3CZUB 1J9RA 1N70A 1CURA 2QPEB 3FPYA 2YAHA 4G72B 2IWKA 3TA4D 1NDTA 2ZONA 4DP5X 1L9QA 4TXVB 1OCZB 5LDUA 7PAZA 3AG2B 1NZRA 2FNWA 4BWTA 2XVBA 3BQVA 2IH9A 2YAPA 1PMYA 3IN0A 3IN2A 5I6KA 2PPEA 1HAWA 3QJTB 1SDDA 6PCYA 1WS7A 3EH5B 1AS6A 2WSDA 1EZLA 1GY1A 1ILSA 3CDZA 1J9QA 2GSMB 2IWFA 1ZIAA 2Q5BA 5AZUA 2XUWA 3CVCA 2GC4C 3UAEA 2VM4A 3UAAA 1R1CA 4YL4A 1L9PA 4YSAA 2IDFA 1CUOA 2I7SA 3FSZA 2VN3A 2UX7A 3QJQB 4QKTA 1PY0A 2YXVA 2IDSA 2MRYA 2AZAA 1AZRA 2AANA 4W1TA 6PAZA 4E9RA 4DP0X 1URIA 1AOZA 5PCYA 1A4AA 3WIAA 5I5MA 4DPAX 2VSMB 1RCYA 5B7FA 4UF7C 1E65A 4GP8B 1ZDQA 2BP8B 1NPJA 4DP1X 1ZIBA 4P5SA 1L9OA 1FA4A 3NJJA 4YSOA 2J56A 1OOWA 2OV0A 1J9TA 3FQ1A 3HEIB 4HZ1A 3ASOB 1PF3A 2YAQA 1WA0X 4PAZA 3H4FA 4Q8BA 3OD3A 1NIAA 2TSBA 1OV8A 2GC7C 2IDQA 5B1KA 3NSDA 3WNIA 1BXUA 3NT0A 2VMJA 2DV6A 1YLBB 1RKRA 1AG6A 2X87A 2PP7A 1SNRA 2YAOA 2QDVA 2HX8A 3ERXA 2PPCA 4A68A 4Q89A 3IEAA 3NYKA 1OF0A 1BYPA 2VW6A 2IH8A 2XLLA 1JZIA 4X4KA 1V54B 3PAVA 5I28A 2YQBA 4YVNA 2BW4A 3G5WA 1ZPUA 1AACA 1NIFA 5IY5B 4AI7A 3S8GB 3OQRA 4KNTA 1IBYA 1OCCB 1AZBA 3T6ZA 4F2EA 2QDWA 4KO9A 3CDZB 9PCYA 2OCCB 1N68A 1KBVA 2AZUA 2PPDA 2PLTA 4HALA 4E9QA 4E9XA 3GDCA 1J5DA 4G7SB 3ABKB 4G7RB 2ZOOA 2AFNA 2PCFA 3ZX1A 3IBOA 4JHUA 3QJSB 3ZIYA 1M57B 1MDAA 2LLNA 2P80D 4WTQA 1OCOB 5D4JA 2B08A 1ILUA 1JXFA 1OCRB 1A65A 3N2JA 5EHFA 3OMAB 4A2GA 1EHKB 1ASPA 3D12B 2BW5A 3ZDWA 4E9WA 7PCYA 1VLXA 3MX0B 4A2EA 1NIDA 4DP7X 2X88A 1JZHA 1W8EA 5B7EA 3WKPA 1BAWA 3T6VA 1BQRA 1PLCA 2VM3A 1E5ZA 2UXVA 1XB6A 2E86A 2XYBA 1KDJA 2CCWA 2FJSA 3T6XA 3TBCA 2UX6A 2HXAA 3SBQA 4PCYA 2J5WA 4YSPA 2JKWA 3CVDA 2FQEA 3AY2A 1ADWA 1NPNA 5D4HA 1OE2A 1SF5A 4A2FA 1X9RA 2I85A 2HX7A 3JTBA 2N0MA 2P80A 3DTUB 3QJVB 1JVLA 2H3XC 2GHZA 3QPKA 1MZYA 3V9EA 4FAAB 4ENZA 3FQ2A 1AR1B 1GW0A 2IAAC 4UANA 1I53A 1L9TA 5I6MA 3NJNA 5AKRA 4L0PB 1KV7A 2Q9OA 3FYEB 2FTAA 3FPXA 2YAFA 1GS8A 1JXGA 3UACA 2VW4A 2HRGA 3SBRA 4AKPA 3FU9A 3QQXA 2XX0A 1M56B 1MZZA 4E9VA 3NJHA 1XMEB 2FQGA 2DWTA 1F56A 3AG4B 4DPBX 1TEFA 3ABLB 2IDUA 1ET7A 3AG1B 1OE1A 2XXFA 2IDTA 2XWZA 2PP9A 3DIVA 1X9UA 1KGYE 1W6WA 2R7EA 2XV3A 2BHFA 1J5CA 2FT8A 5B3SB 1GS7A 1L9SA 3FSAA 2UXFA 1E30A 5D4IA 4CSZA 4E9TA 3NSFA 4WKXA 4KO5A 1QLEB 4BK5C 4JKNA 3S3DB 2BP0B 4N4YB 1FWXA 3AW5A 1E67A 2OJ1A 1A4BA 3U25A 4FA7B 1DYZA 5I6LA 5I5IA 2AVFA 3BVDB 2YAEA 3NJIA 1RZPA 4UAHA 1PZAA 1JERA 3UABA 2PCYA 3UADA 2H5UA 4GXFA 1BQKA 1NWPA 2FWLB 1GSKA 3SQRA 1AZNA 2HRHA 1KCBA 2EIMB 1KDIA 4YSSA 1TKWA 1J9SA 1SF3A 4G7QB 2GBAA 4YVUA 1BEXA 3HB3B 1A4CA 4DPCX 4NAJA 2MTAA 1AZUA 3S3BB 3AZUA 1AQ8A 1RZQA 1WA1X 3NSYA 1AS8A 1BYOA 1AS7A 3TBBA 4F2FA 3FSVA 4AKOA 3X1BA 2EIKB 4DP6X 1SHXA 3FSWA 4G70B 1KBWA 3WNJA 1WA2X 2BP0A 4HAKA 4YSEA 1QNIA 3FQYA 1GY2A 2Y1AA 3FU7A 3S8FB 1NIEA 2QT6A 4YSDA 2XU9A 3KW8A 1ASOA 2CUAA 4HCGA 4K9JA 2JXMA 3NJGA 5A7EA 1NICA 2RACA 4AZUA 1JZGA 4EF3A 5PAZA 5I6OA 4G71B 2EILB 1AANA 1TEGA 1NTDA 3V9CA 3T71A 3PCYA 3ZBMA 1SJMA 2B3IA 4YSUA 1HAUA 3NJLA 2FT7A 1WAEA 4YSRA 3KW7A 4YSTA 5I5JA 3OM3B 1SFDA 2BZ7A 2W8CA 4E9SA 3GYRA 1V10A 1GYCA 2HX9A 3FU8A 1XB8A 4KNUA 4NERA 3SBPA 4KOBA 5TK4A 4BXVA 1JZEA 1B3IA 2XV0A 3WKQA 1JXDA 1PAZA 2UXTA 3H4HA 3X2QB 2VW7A 2W88A 4A66A 4GP4B 1ASQA 2R7EB 2Y69B 4KNSA
chains in the Genus database with same CATH superfamily
1BMFG 4ZW8A 3FUNA 2BOCA 4APQC 1DBAH 1NBVH 4KKQA 3DURB 2YIDA 2JJTA 3JT2A 3QFJD 4IOFC 3DJRA 4OZGA 3V5DA 1RIVL 1MREL 2JK5B 4MAYC 3BH8B 2O72A 2ADFL 3N85L 5AYTA 1U8IA 1BXVA 4H8UA 5CGYD 1K4DA 2X6BA 1BBJA 4DV4B 3IDMA 4PRPE 3RZCD 5DT1L 1HKFA 4X6FB 1I3RB 2YEZA 5T1KD 4BWUA 5HYQA 3GUTA 3MFFB 5J12C 1YZZA 5LMNO 4Q74A 2WLLA 1JMKC 3LSUA 3BKJH 3GIVA 3KG5A 4L9LA 4LLMA 4DR2B 4AV0A 4TUKH 1DF5A 4MTXA 1JCHA 1VFBB 2ENYA 1N5AB 1QX1A 2GSIB 3QUXA 5BXFB 1B0GB 1AIFB 1ET8A 1Q9KB 2BNUA 4NJAL 3S4SG 4FA8A 2A9NH 4KRPD 5J5EA 3CZNA 3BZEA 3TA3C 3PDDA 3AVEA 5IBUB 4NBXB 1ERNA 4KXRA 2VWEC 4F7KA 5DJ6B 3MRHB 5BZDB 1X6LA 3KVDD 3WY3A 2CBQA 4WENB 3ILQD 4ODHL 5BW7A 4YWGL 2G9HA 4JY4B 5C9JA 2K3TA 4R0LC 5MENB 3N44B 4ZSOB 1HYSC 4HZ3A 2VUOA 3GO1L 3EOAA 3UZVA 1HQ4A 4QRQA 5FCSH 1IM9A 5FO7A 1K3EA 3L3HB 2VDQL 4JB9L 5CAYB 3FUKA 3HKZA 4H1LB 2EVFA 5JCOC 1EBOA 1PNCA 3OR6A 4DUZB 1U91A 1J8RA 3MRIA 1X5HA 1RHHA 3BN3B 4A2DA 2QPDB 3SZKC 4AZ8A 5IQ9A 5C07B 1AO7E 2WV3A 2APSA 3NJMA 3PYCA 4DCQA 4M7KL 1TU2A 4S10A 3N55A 1AO7A 5IEHB 5B1JC 3JSNA 5B66Z 3TETA 3DGGB 3APQA 3LKPB 1WG3A 3ARFB 4JQIL 1HS6A 4YHYB 3GSXB 1QFWL 2CO2A 4M5TA 4HCRL 3SCMC 2XNDG 3HE7B 4RAUB 2Q6WA 3S36H 3P4MB 4ZUVA 5GGUA 2IGFH 4U1NA 4XCEB 1NUGA 3PABA 1DBKL 1IGJB 3BAIA 3NCBB 3KPRE 1A6PA 2EYRA 4N8UA 5LNEA 1J0IA 5C08E 1HCVA 4Y5XB 4XCYB 1OP5K 4GKSA 2NLJB 2GYSA 4FG6C 3LD8B 1A66A 5C08A 2Q8AL 5I1IL 5I1AB 2XG5A 2BP8A 4FFZH 3N3EA 1S7TB 4P5RA 4Y1AE 5CZXC 1KGXA 4TSBL 3RKDD 4AKQA 5I18H 1ZA3A 1WZMA 5JW5B 5LMUB 3FD9A 4DR1B 4AYBA 4NHUB 4FTVE 5D96C 4FVMA 1SJVA 3U1PA 2VB5A 2X9ZA 1XF1A 2ZWYA 4X8JB 2ZX5A 3RWHB 1BXAA 4MB4A 5LP6C 2EIJB 1F58L 2AK1L 4FKKA 4JMXA 1SDDB 1XGZA 3QVNA 5DECA 5C2BH 2JGDA 2VLKB 3QB7C 2CRIA 4OCMC 5BJTB 3CVIL 1MSWD 4PLJC 2CLZA 4OIFA 4XNYH 3S6CA 2BSED 1ZHKB 5HHPA 3WKYA 3CHXA 2J4WL 4YHHO 1R3LC 2R0KH 2YQ3A 3B9KB 4BW9A 1E5BA 2ADJB 3EYSH 4FQ1L 4UILH 2X6UA 5F0JB 4KXDA 3BQUB 2XFXB 4XPBH 3DHPA 3IMUA 2XFGB 2CIKA 4G6JH 1IAOA 3SJCC 1CK0H 4G72B 1ZE3C 4IRJB 3DA0A 1PL4A 4WI3A 4UB6Z 4F9PA 3FF7A 2HG5C 4LARL 2AITA 1QR4A 3BP6A 4HD9A 3CPWU 1NZRA 2YD0A 5FYJL 5LL6Y 5LCVA 3GRWL 4AEEA 1R5IA 4E41D 2ICWI 3HG2A 3KLLA 3P11L 1CDYA 2PPEA 1U3NA 1XREA 1CU4L 1FO0H 2Z3FA 4LMQE 3AT8A 5HDBB 1RPOA 5IEKA 3ZK0A 1NS1A 2H3NB 4KK6C 3VAEA 5MEOA 4XNUH 5B3NA 1KIUB 2FATH 3IMVA 5C0AE 3WE6B 2CHXA 4RZCB 4C59B 3GSQA 4U7OA 5EZLB 5C0AA 5K33A 3PHAA 2VQEO 3QDMB 15C8H 5KVFH 4L8SC 3QZNA 2E6QA 1HCYA 1CE1L 1ROCA 2Y7NA 3HNTH 2F4VO 4X89A 1CDHA 4QKTA 1UACL 4UT9H 3K58A 3STZB 1QFWM 1KGIA 4FG0A 2EICA 1ZHNA 1URIA 2XICA 5FOBA 5JDSB 3A0HZ 1VQOV 5JNYB 3T2NL 2MCMA 1KTKE 3SE8H 3EH2A 4N2LA 4JI8B 3QIUC 3MJ7B 3IDXL 5LG1A 4M29A 3PP3H 2K7QA 5C8JA 3UJJL 2BP5M 4BH8A 1E65A 3P0GB 4RFNB 1D2DA 4IRSD 4KDWA 1T6VN 5HVGB 4UM8B 2NDFA 1KGJA 5EUKA 1ONQA 4N90D 3R8BB 3QRFM 3KPSE 4AITA 2GJ6E 5HPMA 1AMXA 5B1NA 3BPLC 1J5OH 4MMZA 3CXCU 4KGLA 5DK3A 4A7SA 4JRLA 2A4ZA 5GJTH 3BFOA 4GIOA 1K4CC 3B83A 3P30H 2Y3AA 1EFRG 4ODXB 5C09E 1HZKA 4UZSA 5I5RA 1HU8A 1UYWH 3Q1SL 1JPFB 3N42B 5C09A 1FGNH 1QI5A 1HHJA 1UH4A 5B38A 4X6DB 1TCMA 3FULA 4WDIA 1M7UA 3OSVA 2J2ZB 1LHZA 1XNQO 2PCFB 4PWFA 4WWNA 3SO5A 1IZKA 2F53E 4BAYA 2VDLL 1PP9H 2JQZA 4NNYB 4WY7L 4ANWA 4B3RB 4JQVC 2AQPA 4IIJB 4OJYA 1UTDA 1MCQA 3GI8H 4QXVA 4WI8A 3F12B 5KG9A 3T1CA 4PBVC 4K8RL 3MV7B 4JM2D 5I1HL 5DYFA 2UXDB 5F7NC 4YDNA 2Q7HA 5EU6E 4IBUA 2ZP0T 2P7TB 4LOVA 4UV7L 5DTFB 3CSGA 3ZMZA 1T5WA 1GHFL 2HFEA 3I3BA 2E6PA 1WHPA 5EU6A 2JELH 1KZQA 5JJJB 2J8UB 2PO6B 5TQ2H 4AI7A 3JAKB 4MXVF 4YDKH 5HYJB 4R26H 3MODL 4TLKA 4HF5L 3H2QA 2OCCB 1JVKA 3FKUS 3L75H 1NUFA 3KJ6H 1QKZH 2E47A 5I1KL 2OZNA 3OKNB 1O7DC 3PNRB 3V8OA 2VKWA 2K45A 4QHLB 4NQSA 3UAJC 3V0GA 1HWHB 1Z9OA 4POYA 5JPNA 2LLNA 5CSZA 4MYWB 3BMVA 5EHFA 1IB5A 3D12B 2YSSA 3H9HB 5CB4B 2EIZB 3JWDH 5F6IC 1P2CB 4S2SA 4A2EA 1NUNB 1H8NA 2A83A 4ZBMA 1IBMB 5DMJB 1G7LB 4JANB 1SOQA 4CMMA 1WWCA 3CQPA 5F3HA 1ACCA 4EZJA 3CHOA 1Z7JA 1T5EA 5JQHC 2E3VA 5I75C 1AMYA 2RIKA 1KBPA 5C86A 3LDEA 2CE6A 4IK6A 5HYSG 5C0DA 5HHNB 1N26A 4R7CA 3IWUA 2ZKHL 1BV8A 3ZX1A 4KZDH 3HR5B 3JTSA 3RDTD 3RNQA 2ETWA 1OTSD 3DC0A 4I18A 2NY2B 5FM5M 1N19A 4LFHD 1TPXC 4TV8B 1RZIB 3ZDXF 2QADC 3DSNB 4XMPH 4ATTA 4LRIA 5KSAA 5IVNA 1NKOA 4GQZA 5FR3A 1BF2A 5HHXL 3AU1A 1F41A 2F5AL 1TUEB 4FFYA 2X4NB 2GW5A 1CDGA 4XHQA 1GRJA 1KPVB 1NDGA 1XGPB 4QYOB 5HDWA 3TVMC 1KEGH 1TXKA 1QEXA 1PNKA 4J3OD 3QPKA 4PJ5D 1QTYT 3DIFB 3KPMA 4NC2B 3MQIA 3UZEA 3L1OL 3OLDA 4IBZA 3UO1L 4PDMA 1QRND 1FFOB 2Z4QB 4X83A 4YUEL 3O11B 5SWZD 1F1AA 4ZXBB 2HHHO 5AKRA 1CFBA 2BMKA 1KV7A 4X5WB 3LZFH 1B4LA 2CCLA 2I25N 4EDWH 4MJ2A 2P8PA 3ZSTA 4R9HA 1DUZB 3EDDA 5CLTA 1IBGL 5BZZA 2CWRA 1OM3L 4X7CC 4MVOA 4NYLB 5ALCL 4MD4A 5CF3A 1QLRA 4IDLA 1Z3GL 1QD0A 1XSOA 1BIHA 4MNGB 4TYUA 4WUUD 4I77H 4TF4A 5FCUL 4KTGA 5CLXA 5TPWL 4Q4IA 5F7LB 2APVA 4ELDA 1X9UA 3FNKA 1E7VA 5KZCB 3HI5H 4MAYB 4WNQA 4AMXA 4X65O 1UCBL 4IHJB 4NENA 5FYKE 5FEBA 1NH6A 5ICZA 4L4TB 4CC6A 2BVOB 4M5ZH 2IQ9L 4JG1L 2AEQL 4HJ0D 1T1XA 1NGWB 4B97A 1TZIB 2BERA 2VCOA 3MV8E 3CSYA 3R19A 5IROA 1SQXH 4LVOC 4CDGC 2Z7UA 4JRWA 3UCSC 4BKSC 2V1DA 1EZVH 2PYJA 1BQSA 1TT6A 4NOFA 4W9CC 2NY4D 3T04D 3HVDA 1IBKB 1MCKA 4N9GB 2JJWA 1XCTA 5DI8B 2HTLD 3BVTA 5EWIL 3TA3B 4Y4HD 1A5FH 3QAZC 2CTPA 1FJ1A 1LDPH 4K94L 3S35H 5DC4B 1EFXA 2E4TA 1D5XB 4JFFA 1NFIB 2ZX9A 2HH0H 1UCTA 4PGDA 4PJBB 5HHME 1BVLB 4R5TA 1RP3B 3L95A 4JLRB 4H20L 2XIBA 4G8AC 2N59A 4GRWB 3S34L 3D4CA 1MFDH 4NBYB 2XZZA 3QFDA 1MIEL 4GZRB 4GRLA 1KIRB 5H37H 5HVHC 3D30A 3SGEI 5D1XA 1A6TA 1YEWA 1H0DA 3NK4A 3LKNA 1QBLH 4JI4O 2G5UA 5F8RC 1NCJA 2V9QA 3A4EA 2ZKOA 5EU4A 1GY2A 2EXWC 3QZWB 5T33H 1KJMA 4TNGA 5DUML 3ZSSA 1V3LA 2HLAB 2D2CB 1E9OA 1BD2E 4PR5A 3QJFB 5G2NA 1U93A 1WC7B 1E8WA 1TG8A 4GG8A 2Z65C 4MKMA 3SCMB 2WA4A 5LQBL 5FO8B 1N8OE 5CFHA 4DKTA 2CK3G 2JKSA 2WJ5A 2WQWA 1PJWA 3MLUH 4LPWA 2AK4E 5ESVB 3L70H 4HXAH 2ED9A 4QHMA 4OBSA 3SO3C 4GKZA 1R3JA 4JN1L 2AK4A 3QF7A 1MI5A 1NC4A 2OMUA 4P2YA 4E9SA 2AS5M 2ZM6O 1MJ7H 3FB5A 3L16A 3QCVL 4XOEA 3M99B 4OKDA 3WSQL 4Z3JA 1NA8A 3VXMD 5AVYB 1WV7T 3IVKB 3D85B 3FH5A 5CBAA 2X0VA 2QA4V 1RURL 5B3JF 4HUUA 1I8KB 3QUYA 4A66A 3ZTJH 5K9KA 5DYOA 5IB5B 3KLAB 2WLIA 3SDXB 4X4YB 5ENWB 1N10A 5ITZB 2ZJSL 3RVTC 3NSCA 1BWMA 3KWUA 1R3LB 2H26B 4R6UA 4YHZH 3O2DA 5J6HB 4A2HA 4R90H 2CQVA 2FE0A 1MY5A 3L9RA 4DP9X 4TV9B 1BQHA 3LSOB 4P5MB 3UTTA 1UATA 4DP8X 4U1SB 5LHIA 1MW3A 3DV4A 4K3HA 3TBSA 4ODTL 3IXTA 2FGWH 3SYAA 4OD1H 5H4YA 1R5WB 5C8YA 2PPAA 4BZYA 1W72B 4I48B 5EF3A 2WTOA 1KC5H 3BPNC 4HHWA 2HG5B 4DV1B 4WHCA 4QRFA 1IE5A 2AI0L 3S5LG 2RTTA 5DJCA 2HUEA 3VFNA 1P84K 1J0YA 4OZGF 2J1WA 4KH2A 4DIXA 1ETJA 1BQLL 5IE9A 5M95B 4CAGA 1G7JB 4MLIA 1T7XA 2WTRB 3D39B 4OGYL 5KS9B 5T1DH 3WNLA 4AVKA 5EO0B 4X62O 3MLVL 5CP3A 2Y4UA 3WJJC 5DEFB 3B56A 2BDNH 1ETZA 3VI3E 2QWNB 2DM4A 2YOCA 4YHMH 3Q4HA 1DQTA 3R18A 4PREA 3V0IA 1T2QH 3NK3A 4YE4H 5ITFB 3MU3A 4TQHA 2HT2C 4ZMTA 3AGWA 3QFJA 3VH8A 3FO0H 3V5KB 2BFGA 3G08A 4G80A 2JKLA 4CSPA 1MG2C 3OLGA 4FM0A 2Z3YA 5EIVA 2MNJB 5F44A 1NCOA 3U1QA 3RZCA 1KIQA 4O2FB 1W0WA 3VX1A 3BCDA 3NPSC 1KLFA 4Y89A 5T1KA 1Q0EA 3RTQD 1FZKA 1VARA 3DV6A 3WIHH 4LNRB 1FDLL 4AQAA 2WOYA 1J0JA 3RX8A 4HIEA 1EXGA 4LIQH 4XPFH 2AZ0A 4HKXB 5EZJA 1E0OB 2BC4A 1TCRA 2WO3B 2EDFA 4RMRA 2J57A 4WFBV 2WCPA 4WFGE 4R2GD 2A79B 1GZQB 4OT1L 3WTUA 3KWWB 1T5KA 4N2KA 2V3FA 3QIUB 3SPCA 4OIIH 5EU7C 4NRZB 4PJAE 4Q7DA 2OIEA 1TLMA 5D1QE 3T0BA 4K0KO 2DEWX 1HINH 3NVQA 5E00B 3W9DB 4GBXD 1OSEA 3LRGA 1AXTL 3TU6A 2F18A 2PR4L 3LNGA 3ARGB 1XIWB 2Q67A 3L5WA 4XMTA 3GWKC 1R47A 1DN0B 2B7DT 2RALA 2VH5L 2Z1KA 4UNTA 4QE7A 4ZO6A 3PQYB 4PJEF 3HHSB 3BH9B 3I75B 3WI9A 3EUUA 1I8MA 1QMUA 1J5EB 3FT0A 5T8IA 1FZOA 2XAQA 4E36A 1P6AB 3BPLB 4HMEA 4NYKA 3SR2C 3CHPA 2LVCA 4O02A 1X9LA 2EH8L 1IL1B 2HLEB 1K4CB 5JHDD 3U2IA 4W4OA 1ODAA 2WXGA 4WV1C 3S3XA 5C6TL 2BSRB 3CVHA 1PZUB 1JVOA 5BO1H 3SIKA 2IJIA 1JNHB 3EJJX 4P8QA 4A04A 3MREA 4NN6B 3QEGH 3SQOL 4UINH 5E2VH 4MFHA 5F7AA 3HNVH 5AVWB 1OK8A 3PWJA 4LGSB 1AXSA 3MR9A 4O4YH 3DX2A 3DVIA 1F90H 1X7QA 5FGCE 2LFRA 4OCWL 5D71H 1CZ8H 2XV2A 4F2ME 3QO5A 1MUJA 3TBYB 1D9KA 2L7JA 4LBEC 4YS4A 2DD8L 3QDJB 3BUYB 2H6UA 3AAZB 3CZUB 2FLRT 2PZSA 4FI8A 5HI4D 2WC7A 1ZLVH 4S11A 4ZOEA 3QS2A 2O5ZL 4MHHI 5HXMA 5FYKH 2PYLA 3EOTL 1L9QA 1MH5B 1UOKA 2LU3A 1BQZA 1S8DA 2YWYA 1RK7A 3O3DA 3CMEV 2EDEA 4EIGB 3ATAA 1K97A 3CDGB 5D7JB 5EUOF 3E1F1 2RQ8A 3BMWA 3QQNA 2VDKL 5MHSD 3O6LH 3AK3A 1WS7A 4DKFH 2WMPB 5CBHA 3W7TA 3EFDH 5IHBA 1AS6A 4JK0D 2Y1ZA 5FHBH 2Y2WA 2N04A 3JWNC 4ZSOE 1JFFB 2Q5BA 4XXCA 3MAQA 3UCQA 4AIZA 5T3XD 4I0XA 2ZWKA 3AU0A 4KFZC 2VOTA 3GJFH 3MNWA 5F6IB 2BSEA 4TSCH 1GTNA 4PELA 3HN8A 1T20B 3GLDA 5T3ZE 3LZRA 3BCCH 3CJHB 3J80N 1ZTXE 2R9IA 2IDFA 1AFVH 3A0BZ 1A7PL 1CFSB 2CR0A 3GBML 4M6OH 4NIYE 4DV5B 1OSZA 2DI7A 2HTKD 1PY0A 3QO0B 1HNWB 4QTFA 3ZT6A 3DDGA 3KGSA 5GGSB 4B9IA 4O4JB 3NCYP 4IRZH 2B8OT 3KXFD 4HAFA 1M4KA 3VXSD 2B4CH 4EKWA 2X42A 3JV6A 3GFUA 1QBBA 1UKQA 1XH2A 2BFVH 4NLAA 3FQUB 2NNCA 1TZOA 1MCIA 4E41A 2R1YA 4NQVB 4AV4A 4ZTOL 4OKVB 3HMWL 3TT1L 2BIMA 1A6ZB 4AMKH 4MS6A 4UF7C 2XQ0A 2QBWA 3TVMB 5GS1A 5JORA 4QJ5B 1FNFA 3H1JH 3NACH 4P5SA 5D9SA 5J1TC 4HIHA 4QPKA 1WD9A 4GW5A 2QFRA 3AY4C 2HFGL 2ZICA 4QD2E 1PLGL 1B4RA 3UDWC 1QSZA 3ZKNC 1I3GH 2A6IA 4JFED 1RY7B 4KJPC 2R51A 3MV01 1C1EH 1E2WA 4YGAB 3HAEG 1F5WA 1KFAH 2IBBA 3F5WB 2KZBA 3MRJB 4RZKA 1G6UA 1D5IH 2ZNXA 3FX7A 2VMJA 4I2XB 5KLVH 1MHEB 3A5VA 3MGOB 4NZUH 2FECI 1RUQL 3D4ZA 1A0QL 1WITA 4Z77B 2P5WB 5D7IB 3ERXA 1E4JA 1SBSH 5H6QA 4U1HA 1OF0A 1HESA 4LNUB 5DGRA 1OEZW 5F72S 4CGTA 3EYVA 3TNNB 2WNGA 1DTUA 1Q1JH 1LM8V 2DBLH 1X4YA 3GI9H 4YVNA 2RMKB 1T1YB 3LUTB 1D7CA 1UXSA 3DXAD 3P0VH 4KBPA 1E5CA 4NWTL 4NQXA 4QTIL 3S96A 5I23A 1SJEB 3MTRA 1ZT7A 1YECH 3JV5A 4U1IB 2K8QA 4J8RB 3W9EB 3P02A 1RK0A 5GS0L 3L3OC 3QAZB 3DRTB 1ZRUA 2VLRD 5I1JL 1FSKC 1M7DB 4E9XA 2XJLA 3GDCA 1S3KH 4MT8A 1PVHA 1PKQE 2IOIA 3ATBA 4PRHB 5DD3L 3NCJH 3QORC 1DUYA 2EDNA 1JHKL 4NM4H 1JPGB 2F19L 3W39A 2P49B 4G5ZL 3STZA 1TJXA 3N2JA 4G6KL 4LDCA 5TF0A 3WJMB 1B0WA 4A2GA 3OEEG 4HK0A 3WTSA 4BQCA 3BGMB 1KIPB 3N43F 4PJHE 3TO2B 2WB7A 5FPIA 4OCNC 1OAZL 2AJZA 1RMFH 1Y6KR 4PS4L 5HVHB 2KQMA 4CJ1A 4DV6B 3G04A 4Z7UB 4AYFA 5AOIA 4UCTA 1JI2A 5FWRA 5E79Z 1CLVA 4FLYA 4TOIA 1CXEA 2EE9A 3IRCA 3QO1A 4JM2A 5D2LE 4QHUA 1JZ7A 2UXVA 2MTPA 3VTTA 1FYHB 1INEL 1YJWV 3MBEA 1JHLL 2YD4A 3MJ9L 4GXUN 2V7QG 1KDJA 2FJSA 3FMGL 1BJ1H 4HWBL 4RGNC 4W4NA 4F58H 5IMOB 1KPUA 5K59E 2UUAO 3FF8A 5B8CC 1CFVL 3I3DA 3QNXB 2HXAA 1KJ2B 2HVKB 2OSLA 1Z5HA 3RVVD 4E5XA 2J5WA 1IQWL 2R0ZL 3TYFA 5E9DD 3I9IA 3ULVD 1C5BH 3HFMH 3ZHKA 3APDA 4K7FA 4BK4A 1LP9A 4W9DC 4H8WH 4YR6B 1YNTA 5I16A 1TZHA 1VPOL 4AVHA 2DQGH 3OB0K 4IMLB 4W9KC 3VM7A 1OJHA 2VLKE 4TQEL 2ZX6A 2X1XR 3LXAA 4GX1A 3U7WH 3P32A 3S5YA 4Q6IB 2BCCH 4KKCC 1I5YA 3TN0D 3KPOB 5DLML 3ESPA 2NNXA 5A2BA 3BUQA 4AGPA 5IQ7L 3FOMB 3ESMA 5HHQA 5E4EC 3ZGHA 4W9FC 2FVNA 2EEAA 4MXQC 2O6DA 4JYYA 3ZE1B 4WFFA 5DJXB 3RDTA 4LDOB 3B2UC 2F7PA 2VDPH 2AGJH 3LZOA 1ZLWH 3CSXA 1ET7A 1N34O 1IBLB 5TISZ 1K3IA 5GSVA 5F3BB 2KI6A 3K80A 4JI2O 2BK8A 2AHYA 2A9BA 3ZE2F 3ZT7A 2BHFA 3IMTA 3PWPB 1HXMB 1MRFL 2DIBA 2FJHB 4FQQB 4PP1D 2YA0A 1JWMB 3K72A 1P4BL 2A9AA 1DLHA 2VZ1A 4HXBH 4GX2A 4OFKA 4QPEA 1MRCL 5DRXB 3OAYK 1MLBA 2IFGA 3N1PC 5HDBE 1KBGH 1G6RA 4ESKA 1GGIL 2NCEA 4PJ5A 1DJSA 1OY3B 1FWXA 2DJSA 5SWZA 1QRNA 4K2UL 5FFGA 1ETB1 1QO3B 5ITBL 3DHMA 1OP9A 4TUJB 3MXVH 3B7SA 3WO3B 2AP2A 3DJZA 3VI4E 1INQB 2CHWA 5MP6H 3BVDB 3OX8B 3NJIA 3V8CA 3QDME 4CSTA 3COOA 1PZAA 3JV4B 4FLWA 4R96B 3VI4A 5A2QN 4QNPE 1EAPB 1XNRO 5ECJE 5ETUA 3V4PB 4MJIE 4IBWA 3AT0A 4NKOA 1NC2B 2MHAA 4WUUA 4LF5O 2YO3A 1OAYH 1NCBL 5CEZD 2JH2A 1LDSA 3PL6C 3PWVB 2BIOA 5F1IA 5F93C 1VFAA 1W9XA 2NY5H 1Y74A 3BCFA 2MW2B 4M8QA 4EFEA 3U6XS 2V2XA 3S3BB 5I2IB 4QXGH 3FO2A 4G8GD 4MNQD 1OD9A 3P3NA 1AS8A 2ZOLA 3RVXC 4ENEC 1AS7A 2RAMA 4OQ1A 1VQKV 4F91B 1QNMA 5J06A 3B40A 3C8HA 1VQPV 4BZ1H 3HA0A 2EH7L 5GRYA 5T3ZH 1Y18A 3L48A 5C1MB 4JVPA 2CKBH 3UBXB 3MRLB 1ZTXH 5C0CB 3MROB 2XU9A 1MFAH 2YD9A 4ZFGL 3OZ9H 2W9EL 3O9WC 4LSSH 1YCSA 4FXTA 4HU8A 5GRVK 1NTDA 1A6UL 1KENH 5HJDA 4BH7A 1DE4B 3OKOA 4YDVB 5F88A 4EOWL 1J7VR 5KVEH 4X6DE 1M71A 2ARJQ 3I6LD 2VDRB 2WYZA 3QZBA 4RBPK 1A7QL 5LGKA 2IM9A 3U11A 3SPGA 1XGUB 3MLXL 2ZQKA 4HJTA 1Q81W 2L0DA 4JO2L 4PJFA 1SFDA 1J8HE 5G55A 1FGVL 4Y2DC 2Q8BH 2VDMH 4LSUL 4D0CA 2FEDD 2VUYA 1SESA 3BW9A 3F7KA 1U95A 1DQML 2MQGA 2V17L 4WV1B 4FMTA 1AI4A 1JZEA 3OF6D 1B3IA 4KKLD 3VFPB 3WKQA 3U36A 3BYYA 3O9OA 2EIEA 3H4HA 3IWVA 4R7XA 1ASQA 3MRFB 3MLTB 1KZYA 3GSRB 4NJ9L 3HPJA 3KNBB 4U3HA 2I5YL 4QRUA 3RJQB 3NJVA 2G4EA 1FYTD 5G4NA 3ABLC 5HYJE 2H32H 3TJTA 1RUPH 2BWQA 3CXHJ 4PD4J 4E4EA 4C47A 4GAJL 3MAWA 1N0NA 2EJRA 2ZE5A 1YUHB 3RYIB 3UO2A 2E7LC 1PDKB 4AOFA 1H6TA 3RPIB 4OFDA 1KB9F 1MCRA 3TCUA 1RFDL 2CALA 3B1TA 1TETL 2EEBA 4Z7QF 4B3MO 1MAMH 5EA0L 3NJFA 1D5MB 2BWIA 3J81N 4GQ9H 1W0VA 3GSNL 3NJKA 4G7VL 3IDJA 3VXME 1A1NB 5CJQH 1OF2A 3O4LE 2F74A 4L23A 4GKOA 4DV7O 5CN1A 4PV8B 1OARL 1GK9A 3FK3A 3LQZB 3VXMA 4XI5C 2HKAA 3H1ZA 5D5MB 2JKRM 4U6XB 1I85A 1AHWC 4DV2O 3AB0B 4R3SB 2X6MA 1U97A 3ILPB 4F24A 1JTTA 3GBDA 4HH9B 3WN5C 4JFQA 2HFTA 2NUTB 1KUQA 2XX1A 2X4UB 1HHKB 4L0YA 1DQQA 5T1LD 2CUIA 2JLPA 1A9BA 5FL7G 4JYAO 2W9DH 3D18B 3A2FA 4YLQT 2Z8VC 3TJHD 2WSSG 4H1LH 3EF7A 1HHHA 1NCHA 3LIZH 2X44D 1RSFA 3QQDA 4P59L 3O8XB 1KB9J 3TGUH 2BVTA 2WIMA 1PAMA 1I7FA 3EOBA 1U58A 3CH1A 1OCCC 1NCWL 5DQ9A 4ZYKB 5ABAA 5SWQB 2UUBB 3MCLH 3VWKC 4GKNB 1T1WA 5HYQB 4BXSV 4K8RC 1T7VA 4R6ZA 5F89A 1NDMA 1Q94B 2MQ3A 3UP1A 5H6RA 1BQ5A 1NH2B 1P7QB 2G5RA 1KTLA 2OBGA 8PAZA 4Z8FH 3CSPA 3F7LA 1FBIL 2BVUA 1PLBA 5E0FA 3S3SA 4B6ZA 3GNML 4BQ6A 3EBHA 3JBG7 3MLZH 4R5VA 3HKDB 4KO7A 4NQQA 4PGEA 2WNXA 4JTCB 4PP2B 3FYIB 4OJEH 3L3IB 4R4FH 3H6JA 4UU9A 1WP8A 3SE4A 4H5SA 4S0SD 2KZWA 3CCLV 3APNA 4XAKD 4JPSA 1UM6L 5FKAB 3WGUB 4UOW0 3BRGC 2D0FA 4TVUA 3RB5A 3CLFL 3RU8H 1KCRH 3C5ZD 1VERA 3QQ4B 4L3AA 1C5DA 1OGPA 2HVJC 3WUWB 1DP0A 3TV3L 3A6CL 3T8XA 2IFFH 1ORSA 4Z1VA 1D5ZA 5AW3B 4E42B 4BDVA 5J8OA 4MB5A 4GRMA 1L9NA 3FT2B 1P7HL 4HOXA 1VF5B 4I4TA 1NBYB 2G4GA 3X1GA 1ML0A 2IMNA 3OAZH 3STLC 1CC3A 4M7JL 4ODUA 3ZDYB 3PE9A 2XTLA 4CADA 2YEVB 5JPMA 3V5HB 1GXEA 3MO1A 3IJSA 2OMZB 3SODB 2XSKA 5D6CA 4UT6H 5CO1A 3SQBB 3VGFA 3PJLA 3GJEB 4XZUA 4I9QA 2CA4A 3QIWD 4F80A 5ID1A 4GBXA 4OAWB 3WYRA 4OCRL 3EO1A 4HPOH 4RFOL 1W8NA 3KGUA 2AXFA 1DJHA 1QACA 3CTTA 1BJ1J 3MJWA 1Q0YL 1L0LH 3QIBD 3EJPA 1WFMA 4MZIA 4V1DE 5IDJA 3GSVA 3WELA 4ADGA 1D6EB 4X1KB 2BS9A 2WVSA 1JJUA 5DRNB 1LWRA 3HS0B 2YAHA 2EZ0D 2VXUH 4EVNB 2FB5A 1GGBH 5CJOL 4U3SA 4NRXA 4OGQC 3FFCD 1I5XA 5IBUG 2OT5A 4JQXA 3IAGC 3KDPB 5JHDA 3ZX6A 3B7RL 4V33A 3A21A 3WU1A 3L3OB 3LS4L 4HS3B 3VX0A 2P22C 2DH2A 1A2YA 3BQVA 3MUHL 3JQOB 1FSKB 3WFVA 3NDYE 1VP7A 3V4VA 3QJTB 5EN2A 1YAZA 5MERB 4FLTA 2NY1D 1S5JA 3MV11 2P43B 2FWOA 3K9AA 2J6EA 2X28A 1RUMH 1LUWA 1HKLH 3MRPA 2V7HA 1SRYA 4XX5A 1ILSA 5ADPL 2CMRH 1H3TA 4NQCB 1I7ZB 2JCCB 5DK0A 2IALB 2WK2A 2QEJA 4IHOA 4YGVB 5IJKC 3MUGA 4C83A 3NOIA 4GEIA 1UWXK 1JGEB 1XV8A 1OAUH 2IADA 1HNGA 1O6VA 4DV4O 2FX7L 4OSUL 2UZXA 5DJDB 4EIBA 2WP3T 4V2CB 2D4DA 2I26N 1RJZB 3IC7A 4NQUA 3NCXA 1T0OA 3BEHA 1RJYA 1XQ4A 3CLEH 4QY8B 4FQCL 4TUKL 3MX0A 1CF1A 4DR2O 2DQCH 5HGBB 4BSVA 5JUEH 3G67A 1J1OH 4PJ7E 4TVSa 6FABH 4RGNB 4DP0X 1GC1H 4HWEH 5GONB 1Z1WA 3IPEA 1K7DA 5A2FA 5B8CB 4C58B 4PJ7A 4FK5C 4OLXL 3RURA 5F9JB 2VRZA 5AOJA 2ZD0A 1R3IL 3ARXA 4BQBA 8FABB 5MHSE 1T3FB 2RFXB 2ZWSA 4EKXA 4LLWA 5DJ8A 2BSCA 1RCYA 3P3PA 4KZEH 3K04A 1FNHA 1NEZB 1CD0A 1YJDL 3GHBL 4OGAC 1FV1B 3BXNA 1I7RA 4DP1X 5T3XE 2B9ZA 3FN9A 4GMTL 3RJOA 2MMXA 2W65B 1L9OA 4NDMB 4GAYB 4N0RA 4AW7A 4K94C 2J56A 5I30L 1FH5H 4HWUA 3HJEA 3K06A 1R3HA 4LQ1A 1DVZA 5KYYB 2E9JA 2AQSA 2NSMA 4UVBA 5AVTB 2F93B 1FXHA 4Y4FA 1CMOA 4DUZO 3OD3A 1LNUB 4HAMA 3KXFE 4ELKB 1N4XL 2UUCB 3LH8A 4UTBA 2YS8A 5E4EB 5I8OL 1LMIA 5HGDA 1OW0C 1A7RL 2VDQB 4EBQH 3KXFA 2F7OA 1N59B 3VXSA 3VQYA 2FJGB 2PWGA 4OZHE 1TUPA 4K3JH 4XP9H 4C8XA 4WF9V 2OAAA 2VQ4A 1BF8A 4UCFA 1C8PA 2VQFB 1A6AA 1SNRA 4OZHA 3KPLA 5HYSA 2Z9TA 4PRNA 1YN7B 4F33B 3JVGA 4F3FB 5CWSA 4YJ2A 4OLZH 1FQ9C 4OTXH 2PPCA 1XF4A 5E8NB 2I9TB 5IREA 4KK8D 2QKIB 1KY6A 2VW6A 1A3LL 2FO4A 2WLJA 1YQVH 2NT0A 4X4KA 3ZOAA 1CVSC 2X0LA 4O4HA 2QKSA 5DQDH 4ANKA 4XPTH 2ZAHA 1FC1A 1A6WH 1GL4B 1WBYA 5CLZA 4EXPX 4WWOA 3CCJV 1DL7H 3DXRB 1XCQB 4AXWA 3S8GB 1MNNA 5LMUO 2BJML 3FTGA 3RB7A 4DR1O 4JFTA 3S2AA 3KLHC 1SXAA 5CLYA 1D5BB 1KG0B 3KCWA 2C4FT 1AI1H 4JFEA 4TPRL 4XVSH 1U41A 1DBJH 2VR5A 3V6ZA 3VGGA 5KX5A 2CJTA 3IFLH 5DA0B 2BVEA 1UZGA 1EANA 2EO9A 2BTOA 3RUGF 1RZ7L 5C2BL 3B8MA 4PCSA 3TWYA 2BSKA 4HNAB 1F8TL 3GZOA 4HAGA 1N8ZB 3OVUB 3QJSB 3ZIYA 1Q9WA 1OKEA 2KQXA 1MDAA 1UOWA 2C1OB 3PL6B 4RQQB 1R9FA 2WLNA 5INCB 1RZKH 1A65A 3RL1B 3P0YH 3LN4A 2R0KL 4BGDA 3HUJB 4E9WA 1GJWA 4UQCA 4TRPH 3EYSL 4ANVA 3ASNC 1HEJC 3JASB 5GGRA 4D0BA 5IB2A 5ISZA 3UTZA 4RCAA 1WVZA 1ES0A 3PFUA 3WKPA 3DXAE 1EEYB 1H15A 2APXA 3DMMB 2X4QB 3AREC 2CXKA 1RP8A 1TITA 3QNZB 2J5LC 3DXAA 4Z0BH 5CMAB 3VQXA 1E9QB 2I9LA 2WBJC 2FLBT 4JN2B 2OX5B 2VXQL 3Q5YA 3MXWH 3BGAA 3F84A 1QATA 4LZKA 3WIIL 3B34A 2NXYC 4JHAH 4FC3E 2R2BB 2BINA 4YXHH 1VJSA 4U2YA 2VLRA 3VDCA 3CBRA 1E4XI 1IQDB 1FO0L 3ULUD 3U9PL 1EPFA 1HH6A 3ZUCA 4R83A 3IDNB 3V0VA 4X6BA 3LEXB 4FYSA 3P77B 2FATL 2M83A 2NY0D 4LE8A 4MVBD 1ACZA 1JNJA 2IPKB 2MOGA 4LRNH 3CN1A 3MA9H 3MHHC 2ENSA 2KERA 2RH0A 3C8KA 3R7RA 1EH9A 3GBLA 3SE3A 4KI5C 1Z0MA 4TQPA 3FAWA 1VIWA 5DD5H 4M1DH 5I6MA 2BNRA 2FEEL 3L3JA 1IEHA 4MGXA 4XAWH 3S48A 4KHTL 5GTIZ 1JXGA 4NAQA 5CUSL 2H3OA 2V3DA 3QDJE 5BRZB 3AM8C 1Q82W 2FX9H 2XX0A 1LP9F 4O00A 1TR7A 1HSBB 1I1CA 1YNTF 5DFAA 3ZL2A 2HN7B 1TTUA 3ZBHA 1OAJA 2YQ2A 3ABLB 1SY6H 2COVD 1IEBB 1N6QL 4JI8O 1QWHA 6TAAA 2NQCA 4CL7A 3ULVE 1FL3B 4GKJB 1D2PA 3DOHA 3K0WA 4WW1A 2R2EA 5E9DA 4XCNA 1ZJBA 1U2HA 4JEGB 4XBPA 1P69B 3P69A 1E30A 2V5MA 1O7DE 4LSTL 4KJYB 2UXXA 1U2YA 3KYNA 4GO8A 2N7SA 1EVTC 3T4AB 4MB1A 2Z0UA 4I7ZC 4ONOA 4OZ4A 3S3DB 3X11B 4BK5C 1CXZB 2BOBA 1M1KW 3BD4A 3ZHFA 1JGDA 5L6YH 3TN0A 3AW5A 4AL8L 5IY5C 2IF7A 3CPLA 5D8JH 3ZQ9A 4GT1A 1M4UA 2YIBA 1LEKB 2DTMH 4JHWH 5ACZA 1FLTX 1L3NA 1CEZA 2JKXA 2YAEA 1AHWB 1FGNL 4HBCH 4ZOLB 3H9SE 2QL1A 4YZWA 2QSAA 4J4PD 4WO4D 3WN5B 2OTLV 3Q3GB 5IB3A 2X89D 3MMEB 3TT3H 1CR9L 1FAIL 3QHFH 4Z18A 1NAMA 1RQ5A 3WNOA 2Q86B 4J3OF 4EZKA 4J10A 4YSSA 3CUPA 4BWAA 2WIIB 1UXWA 3G5XB 5FHAH 1E2VA 1H2GA 2HT4D 5EIBD 4Q9RL 3OL2A 2VDLB 4AQ1B 1CLOH 2DM7A 5I8EB 3B43A 5FYLE 1WGOA 4JNXA 2UXDO 4KHXL 4P46A 4ZAKD 1U8LB 4L4JA 1KCVH 2ZIMA 3BUBA 3VWKB 1WBXA 2D3OW 4G3YL 1FN4A 5A6LA 3R1GH 4H26A 4D2NA 1QNIA 1B6QA 4L1SA 4DKEH 2IBZH 4YXKL 4AT6B 4S1DC 1NLBH 1YEKL 4FQLH 3X12A 4B9GA 3SDLA 1YZBA 2WQUA 3BI9X 5D7HA 3T77B 3OPZL 2Z8WC 3FUJA 1YA5A 3V9FA 1NOLA 3MJ6A 3S5LA 2RQEA 3V9CA 2ITDC 3V2AR 5CXPA 2VL5A 3CPUA 3H3BC 5M7QA 1FPTH 4EUPB 3N1QC 1ZT4A 2CGRL 2R4SH 1NTMH 3SDDD 4XRCB 4LP4A 3TFKD 4Z78B 1UD6A 1WZ1H 2IH1C 4XCFL 3OR7A 4MNQE 2PW2B 4U1JA 1W2BU 1A1MA 2P5WE 1XI1A 2HVJB 3BHBA 5AL0A 1IBMO 1M42A 4NERA 5G5DA 5KSBE 4X1YB 2C3VA 1YDPA 2JCWA 3B3IB 4G8GA 4MDIB 4MNQA 1NUDA 3WGVB 1CTMA 3ZO9A 1AR2A 5FDYA 4J1UA 2ZX8A 1HVXA 4HPHA 4O4IA 1ZS8A 3STLB 5DRWB 5DRZB 4IYIA 1QP1A 2X4OB 5DEGB 4CC4C 4OGXL 1UUNA 4N86A 5JLZB 2BXYA 1RPUA 5SX5K 4XMPL 1Q9OA 3TX4A 4AEFA 5BZWB 2NXZC 4M61A 5FDWB 5K93A 4PJFF 1PV0A 1WGVA 2AQ1A 3DVNA 2IH3B 1CDUA 4U1MB 5HY9B 2P8LB 2F43G 4D7SA 1XF2A 3AXLB 3SPJA 3CK0H 2B2XL 2WWMD 1ZE3H 1A1OB 1W15A 4JO4L 1KTRL 3MOBL 1FVCA 5IVXA 4A67A 2JTDA 1YJ9V 1KMGA 5DHVB 4I85A 3IK2A 4A1RA 3FTZA 1WT5C 3KYMB 1F0LA 1XB3A 4EKJA 3CCEV 1G7IB 4PJ8A 5KJ4A 1CBVH 3A6BH 1MCSA 3D36C 4PHZA 4F7PB 4L1TA 4ZMWA 3ETSA 2YAMA 3LPWA 4Z7OF 3WY4A 3LRSA 3ZN0A 4L3EB 1JI1A 4JY6A 4NZTL 4UIKL 4AILC 2JIXB 5FS5A 3OF6A 4EDWL 3NJXA 4Z7UE 4G43A 4ODVH 4CVWA 2CBOA 2X7RB 4LOEA 4NAMA 1DCLA 4P23C 2H6PA 3APMA 3PPSA 3FFDA 3QR1A 5DZVA 2XBDA 2YD8A 2NYYD 4N2EA 1FYTA 2ICEA 4JDVA 5IW6B 5K9JL 1UXMA 4KMTH 3A0OA 1JF1A 1BBDH 1LTXA 3ARSA 5EBLC 5EC2A 4B9PA 1ESOA 3IJEA 4PB9H 5C0EB 5C0JA 2EX3A 1TMQA 3EF4A 3KPQA 3POHA 4JKPL 3BIKB 5D6DA 2YGOA 2VZSA 5T1MB 4B7LA 2GUYA 1QSFB 1GGCL 2C9PA 1OZUA 1P7GA 5KVGE 4H0GA 3PPEA 3QZWG 3SKUD 4PDRA 3N41F 2UWEE 4PHXA 5F1NB 5C07D 1DCEA 2IV9A 1BMGA 3W3BA 2VXVL 5AG9A 1T89C 1UT1A 3P3SA 5FLXN 1IBKO 1AKJB 4YIQB 2EYSB 3M88A 2OZ4H 1I08A 3EJTA 3U4KA 5MI0C 1M7IB 1L7TH 1LDPL 3MNVB 3SGDH 2GIXA 3M1BB 4QO1A 4KY2A 1OLLA 2WQXA 2XT1B 3C2SA 5LCVL 5AOZA 4XI5D 3EYFA 5E8DL 5LA6B 5E2WL 1GAFH 2F7IA 2PI5A 3QDGB 4LQFH 1LWJA 2HH0L 2BY0A 4XTRC 3GXUB 3VW3L 5T1LA 4XVUD 3QNEA 1L7IH 1LQBC 2W1NA 1FIGL 1QA9B 3DARA 3ZRVA 1GJIA 4YN3A 2QR0A 1MFDL 4IEFB 3O65A 4J3XA 5E23A 3CVBA 5TK2A 2H94A 3WS6C 3HKBA 5CBFA 2OLDA 2PUSA 2WAQA 3OLIA 3QH3A 4N2FA 1IC7L 4FG2A 4QRSA 5IVZA 3NP4A 1S9KC 3MRDA 5BVPH 3AADB 3T3MF 1WTGT 3C2AH 5ESQA 3ESNA 4NPYB 3NIDE 1IGCH 1LILA 1TTFA 4G9FE 5FK9A 3T6WA 3V95A 3ES6B 4CVXB 4EAEA 3H56A 3O3AB 5AVZB 2UXGA 1CPUA 3FQXB 3PDOA 1SHWA 1UUSA 1Z2KA 3NCCB 1JK8A 1N6UA 1DBBL 4JFZH 5CJXC 3VXUB 1TF4A 1K2DA 2ZXQA 4XAKE 4F7TA 5L0QB 3NH7H 3QXDB 3ZHDA 1AP2B 2WZ6A 3BQUD 2GEQA 1T83A 2BLFA 1ZLSH 5ICYA 3NUKA 5GRUH 3AWFA 4LHUB 3V0HA 4FP8H 4KMQA 4PJIF 3ESVF 4IRJD 1MJ7L 1LO0H 2IWKA 4XMZA 3IJ9A 4CRPA 4PGBB 1PIFA 4AM0Q 3L7FB 3G5VA 4HKJA 4RQFA 4OV5B 2EDQA 1NFDF 4JRYE 4IYHA 1L3WA 4X50A 5TE6L 4JZNB 2HMID 3RY4A 4M43H 4XNZC 4XPGL 4WJG3 3K8LA 3VFWB 4OFYD 2I07A 1XUQA 3AACA 1AE6L 1NGXA 5DHYB 6PCYA 3K08A 3OHXB 7TAAA 1T4KB 3UBFA 3DX7A 3KD4A 1E6OH 3IDGB 1Y6MR 1OGSA 3HAEA 3DLQR 2KMWA 3VCLA 1HZHH 4M4RA 4YHZL 3QIWA 1MHPL 1YXBA 1ID5I 3P9LB 2B77A 4PJCE 3X13A 3CFDA 3VQ2C 5IR1B 3E22B 4CH3A 1BM3H 2RGSA 3QIBA 1PD0A 3SPVA 3BA8A 4PJDE 1EUTA 2HLFD 2UX7A 2FYYB 3AREB 3KDMB 3EYOA 4J6RL 2J5LB 3NCEB 4U4BA 5AD0A 3QWRD 1KC5L 2IDSA 2VIRB 5FUOL 1JPXA 3K3WA 2X05A 2EACA 5JWPA 1QUNA 3VFVB 4LF8B 4DV1O 2AANA 4AY0A 2PABA 3SDCC 2ZUWA 2H45A 3FFCA 2F1EA 2NXYB 2PW1B 5FYLH 4EJ1C 4KJQD 1HC1A 1FZJA 3IGAA 2VL4A 5GGVL 5I5MA 3L9DA 4JREC 3OEHG 4XOBA 2VSMB 1K8DB 2BDNL 3RYCA 4D9QE 2ZUUA 1EAQA 3UTPE 4B08A 1H8LA 1WFUA 1WISA 1NGZA 3LH2L 1UQSA 4YHML 1ZVYA 3NIGB 4BIKA 2ED8A 2D0GA 3CZSA 3QUMA 4YO0B 4JF3A 3HE6C 1BWWA 1FA4A 1BW8A 1LO4H 1U6AL 3G5YB 3RWEA 3RYHB 3MA7B 4HUXA 2FKXA 4LASL 1VQ4V 4BFRA 5JQGB 2DMGA 2Z7WA 3DPDA 5DCCA 3E1ZA 5CEYB 5JIPA 3UFIA 4F8PA 2IC2A 4X5RA 5TQ0H 3BUDA 3H42L 4O2AB 2D0HA 1MZFA 3QDAA 1TO4A 4GW4B 2OXGA 1UOLA 5HDQL 2HR3A 2I32A 3VD0A 2W07B 1UB5B 5LXVA 2A6JB 1EM1A 3BRDA 3ZRSA 3MRNA 3D3VA 4OIIL 3UP6A 4Z7WA 4J5VA 5B4MD 2DWEA 1HINL 3CAFA 2Y5TA 4H88L 2OXHB 3LDBC 4AENB 2YICA 1KN4L 3LZPA 3V7AG 4IKKA 3H9VA 4H44B 3GEWB 5FO9B 1A14H 4M6AA 4OLVH 1P5UC 2O6CA 12E8H 3MV7D 4FFYL 1J5EO 3JWNE 1FL5A 4I7ZB 2DWDA 4P2QD 2BW4A 3G6BA 1DFXA 2PO6D 4ZMXA 5IY5B 4EO5A 3FL7A 4ELMB 3A4DA 2JJSC 2PWEA 1EJOL 1AZBA 3PP4L 2W92A 4NO5B 5BO1L 5INDA 9PCYA 2PPDA 4TWKA 1KELH 1C12A 2XYCA 2V7NA 4GI8A 1JAEA 1P9MA 2CLVA 1T66D 3QEGL 3QHZL 1AROP 1UJ3A 4M5YL 3QUHA 2CO4A 1NBMG 4HDIB 3KKYA 4X0KA 5GRJH 2EDYA 3HNVL 1T22A 3UIZA 4CVZB 4HKZB 1JXFA 3EZJB 1ILUA 1MEXL 5GGVY 2XG4B 1EHKB 2ITCC 1THZA 2IU3A 1OB1A 3CXFA 3UH8A 3VXPB 4MQXD 1N2RA 3UT5B 4NB5A 2A77L 5FA4A 4C56B 4NFDA 4NZ8A 3F85A 4AH2B 3N9GL 4KFMA 2CLRA 5CHNA 5D1ZC 1BQRA 4YHOL 3OD4A 1OTTD 1G94A 2CE4A 4L8DB 2GPZA 4EQ3A 3OFNG 3LVTA 4OCYH 4S1SH 1XL4A 5D7LB 4FX5A 1KJ2H 3ZE0B 3KPNB 4RA3A 3RW0A 1CF8H 3RIAF 3D5OF 4AYEC 5IWLC 1PX8A 3NFNB 4JO1H 2ZUTA 3AWGA 4HG4K 3FUFA 4BIUA 1EN5A 5DZJA 5KVGH 2X4RA 2D03H 4IIQB 5EORH 2YPLB 4N1CA 3EDJA 4DKFL 2ITDB 3RKPA 2ROYA 2ZOKA 4TVPD 1IAKB 3ROLA 1ADWA 2QWRB 4WHTB 5HDRA 2ZUXA 3N5AA 4LLVB 3AQXA 2I85A 5EEUA 4RESB 1H3PL 6CGTA 4NNPH 2FD6L 4FLHA 4FA6A 2C3HA 4P3DA 3VGAB 4UOZA 5LGJA 4GG6A 3CEIA 1MZYA 2IH1B 3I02A 4DESA 3NAAH 3E8GA 3REVB 4F7CB 2LU4A 3GB7A 3GBNH 3VB8A 1AFVL 4UOW1 1I53A 4Y19B 2OJZL 4FNQA 2ZCZA 4G9DA 2BE3A 1VQNV 4M6OL 2R8SL 2LO1A 4XGZA 1H8OA 1SETA 3DUUB 4BQ8A 3AGVA 4DV5O 1SPDA 5ADOH 3DI2B 3WFBH 2YAFA 1HNWO 1LD9B 1GS8A 4UQAA 1JCKA 4Q97A 5FECA 4U7MA 1NKGA 2VAAB 3RWRD 2WB1A 1EGJH 3EYUH 1ND0A 3NJHA 2DJUA 2WXJA 3GMRB 4BIZA 4MD5A 1TSHA 3UYRL 4DPBX 1GYUA 2NXZB 3LB6D 3IBEA 4Q20A 4NKIH 5KZCD 2DRUA 1VZIA 3FB7C 5IYBO 4DF9A 1RJLA 1ZD6A 3PWNB 2Z31C 1MDTA 1NTKH 2AMUA 4X20B 4U49A 4I13B 3FU6A 3AABA 1FRGH 3S7GA 3M8OL 2GI7A 5DS8A 5CR1A 1XF3B 4FNUA 4QYAA 3NZ8B 1IC1A 1TSRA 3F7YB 1K8IB 4R7DB 3MOAH 4WW2A 3T4YB 2JCCE 3OKDA 1SMDA 2D8KA 2BCMA 2NDGA 1W80A 5LGHH 3HPLC 5KBKA 3V4PH 3Q5TA 1WBZA 1CFQA 2PCYA 1QLFB 4KPHL 3AWEA 4IGBC 2NZ9C 3RWFB 3ALXA 3ILDA 3ECVA 4P23B 4WO0A 5JXEC 4GO6B 1O6TA 4P06A 5C0ND 1CGXA 1LEGA 4NZUL 4DW2L 1RPKA 2ENPA 3PRZA 1OP3H 4ABWA 2QM8A 1F3JA 2KLSA 3FCSA 1M2VB 2EUWA 2YFOA 1PKOA 2BRRL 1OCRC 3QPXL 3BKYH 5EBLB 4F8NA 4EN3C 3V6OA 1XD1A 1A4CA 3MRMB 5AOMA 4J9YB 2XRAH 1S9VA 3FHAA 2D73A 3R65A 1UOVA 3S37L 4HSCX 3LPOA 3UGUA 4OD2B 1BYOA 2GV9A 3O2DL 4KTYA 3U7AA 3P0VL 2A5UA 4G6MH 3FJTA 2BP0A 3BABA 4NP4L 1XWVA 4RMSA 4K3EH 4N0YL 1KGWA 4NKDB 4N20A 4X0NA 4ANXA 4LLDA 4LL4A 5MI0B 2EZOA 1RZ8B 1RLBA 2XTJD 3TLRA 5IJCC 2AJSH 4JJOA 3FB8B 1OAXH 4CBZA 4WSGA 3US0A 4LSRH 1ZAGA 3NCJL 4J4PA 4WO4A 2VDRH 4Z3EA 2X89A 1J1XH 3HFFA 1HAUA 2GJZA 3C12A 1U8NA 4K23H 4N6RB 1FVDB 4D94A 1H8SA 4JFXA 4CH6A 1FH2A 4TNFA 4MVMA 4DV6O 5E6IB 4Q6GA 4RX4D 3U9UA 5GRZA 1KWGA 5FNVA 3D85D 4DK6A 4ZAKA 2UXTA 1JK9B 5EO9A 2Y2YA 1I8AA 1M05A 4ZMQA 4XXWC 3BAJA 3HNSL 4TNEA 3DJSA 4R4BB 1LO2L 2ZWLT 2ZKMX 5A2KH 2KS0A 3GWOA 3QP3A 1N7ML 1YMMD 3SDAD 3CFTA 1JPEA 2ZDIC 2I7OA 3LEYL 5EN3A 3TCLB 5IGXH 3WTYA 3I5DA 1S9XB 2LV4A 5I1EL 4Y4KC 5DVNA 4ZNEE 2YN5A 4QRPE 1ROWA 1R3IC 2H2PD 3O3BB 4D8PB 4XVTL 3SDDA 4DUWA 1KBHA 2XQBL 1NMCC 4FQIH 5SWSB 1IKOP 1GMEA 4IBQA 1J1PH 1YJDC 5DK2B 3CC5A 3P3RA 3NA9H 5DJYB 5IK3B 5IG7B 3W11C 3HUJE 3HLAA 3ZTDC 3J2PA 2Y36H 4FI7A 1S7UB 1G7HA 1OAKH 2NY7H 1NCUA 3EO0B 3WMQA 1UZ6E 4XNZB 3LTVA 5F7DA 3JWNH 3D39D 4PA4A 2VQTA 3GIZH 2YRBA 5ALBH 1XZ0B 2ZCKH 2VZTA 4OCXH 2ZSWA 4CNIB 5IVXF 3HZ3A 1IBLO 3KPPA 3PN1A 3QYNA 5EBMC 2F61A 3HTLX 2K70A 3NEXA 5DD1H 1EO5A 3DURA 2WGXA 4YSQA 5E1AC 2E5LB 4Z9KB 1PZBA 5BXZA 2JK5A 1WB8A 3FH8A 4CBCA 1FJGB 1TJGH 1G9HA 4RRPG 2IAMB 3BP4A 1XXFC 1ZTMA 3WCYA 2CBMA 3EJYD 4JFDD 3UBXG 4PLKC 4X6FA 1KBGL 5IOKA 5K1JA 1R24B 1XEUA 4O51A 1SQ2N 3TBWB 3FQWB 1G1KA 4I9WE 3UGEA 1ID2A 3P4NA 2C5DC 2A3TA 4WBNA 4NKGB 4O2CB 4OLUL 3OMIB 2XACC 5C3TA 1VFBA 25C8H 3PAZA 1TZGL 2GSIA 32C2A 4H25B 5HGGS 1MJ8H 5BXFA 2RCSH 1JD7A 1B0GA 1AIFA 4ZKIA 1EV2E 1Q9KA 1UURA 4XCCL 1IUZA 5C0GA 3F5TA 4MMXA 1RIHH 3WFDL 3FUMA 3VFRA 4QNHB 1AQMA 3GTNA 3I50L 1GGUA 4APXB 3ARGD 1XIWD 3MRHA 2VSKB 4F57H 2C4XA 3PQYD 2EINB 1Z9LA 4WRLA 3GKWL 4CW1B 5CFAA 2UZYB 3OG4B 4X7SH 2XKUA 2WZAA 3DKHA 3QBTB 3VFOB 3C60D 4W93A 1SM3L 4PJGF 5SX4H 1ET5A 4J3VA 3O6FC 3ZN6A 1IC4H 3TIEB 3L3HA 5D2NC 4KHPB 2XWCA 2ADQB 4KROB 4N2DA 2FT6A 4PJXE 4M8RA 2QGDA 3I6KB 2Y2TA 3C8DA 5JIMA 2B1HH 5C07A 3QJRB 4PJXA 5T3ZL 3X2QC 2CKBL 3BO8A 4U33A 5LGTA 2ATKA 3MRCB 5E6ZA 4K5OA 3R0NA 3RL2B 3GMLB 1U8OB 5IEHA 4X9FA 4XBEH 3UYOD 1RXLA 1PX4A 1SVCP 3DGGA 3LKPA 5E99L 3ARFA 5IB4B 3TURA 3GSXA 1MWAA 3ZHSA 2OYLA 2JI3A 4RAUA 1YSOA 1K5NB 2R1WB 1L4IA 3D48R 1AR1C 1NCAL 3P4MA 4K07A 3TO4D 2X7LA 2OP4L 1IGJA 2KPWA 1DSFH 4OFPA 3BYTA 4KXCA 4XCYA 2I27N 4XMXA 2QPEB 3K03A 1H19A 1I7UB 2JF1A 2AJYL 2R83A 1ZLUK 4FFVD 2NN4A 4DP5X 5CINL 3GXIA 4XE5B 1J48A 2JVDA 1DO5A 3V10A 3DOIA 2FIKB 2QSTA 4NHUA 3GK8H 3LEVL 3K57A 2ORBL 4FMFA 1CT8B 4KKZA 1AILA 2AQ2A 4X8JA 5D7JD 4DGWC 5I0XA 1S7VA 1S46A 4UCSA 3WB1A 2MCPH 1SDDA 4EB6B 1KYDA 4YZFE 2E3CA 5BY1A 1WAAF 4HJEA 1Z5LA 3MNDA 5EFIA 3EDEA 3TF4A 3FTYA 5BV7L 3CDYA 3CDZA 1J9QA 3NSJA 2H0JA 1TQWA 4QHNA 3P73B 2ITCB 4X9IA 1F3DH 1IGIL 5A6MA 4M93C 1ED3A 1HQRA 1KTBA 5HI3C 1RIVH 1MREH 2WBXA 1X5ZA 2XWEA 1L9PA 3ZMTA 4ZT1A 4A7VA 2ADFH 3N85H 4YSAA 5ILTH 2WD0A 4BR6A 4PJ9C 2IJKA 1YEFL 5F0PB 3BQUA 2XFXA 1WF5A 5DT1H 4QRRB 3QJQB 1PFCA 5JIKA 4IRJA 1V5JA 3WLWD 3GMMB 4HEME 4JZJB 1CXIA 4N25A 4NO0B 3PXHA 1YYML 1FNAA 4HEMA 4DGIH 1NGYB 4G42B 1BX2A 2M1KA 2FNBA 4UQBA 1TQBB 4NJAH 1GN3A 4LEOB 2PR9A 2EKSB 4OFYA 4AL8C 1SBBA 4IJ3C 1DVFD 4KWUA 3L6FB 4BEIA 2H3NA 1WIOA 2Z34A 1SXNA 4ODHH 1KIUA 4N23A 1U96A 4JPWL 4OU3A 4YSOA 4YWGH 3JARA 4MBOA 3WUWG 4QI3A 3MI6A 3MKKA 4RZCA 1KKCA 4PVNA 3OJDA 5EZLA 3WB2A 4N0UE 2J25A 3GO1H 2BP3A 3ZL4L 5E94B 3NESA 5E5LA 1NVPD 1BLIA 3ZDZB 2VDQH 1Q5OA 4JB9H 5GRWA 1QLNA 2WWKT 4IBLT 1QEWB 2BOCC 2UUBO 2BXZA 1EO7A 2D9CA 3T1WA 2X1WL 3QWRA 4HPYL 3ETGA 2OTJV 3MZGB 4J9ZB 3E38A 1Y76A 1SZNA 3FTXA 4XHJD 2JJTC 5B1KA 3NIFB 4HFWB 4YDJB 4D0DB 5IESL 1H9DA 1N0LA 1QSEB 2AABL 3QQ9C 5JDSA 4M7KH 5JNYA 3TK1A 5JDJA 3KL0A 1K92A 4URKA 3Q6FB 1XEQA 1ZSHA 3N2KB 2J72A 2WXPA 2E27L 1K4DC 3MJ7A 4I8DA 1URLA 4A7TA 1S78D 1YMHB 3L54A 1QFWH 4KV5F 3L3KA 1LEIB 2ESVD 3HKCB 5E5UB 4HCRH 3VXNA 5F2VO 4YJ3B 4NXNB 4I0PD 4L9LC 1MA1A 3ELQA 5MEND 4UM8A 1V54B 4AC2A 3MVSA 1DBKH 1DVSA 3D0VA 3LZLA 3F7QA 3I9GL 1GZHA 1WAPA 3QPQD 4JW3A 4R7VA 4XBFA 4KK5D 3RU8L 5IYZA 5FA3B 3G5WA 4AIOA 4UQ3B 1HZLA 2RB8A 3CWBH 1U8PA 3LKOB 2Q8AH 4ZUTB 4FIPC 2HYMA 3RWDA 5ACLA 2P67A 5I1IH 4KNTA 3UPAA 1MF2H 4TSBH 1OSYA 3HPLB 4UQ2B 3KLQA 4ODXA 4Z7NB 4PWHA 3DO4A 1JPFA 5BW7C 2DQFB 2DLHA 2P42B 4IGBB 5CIPH 4BFIB 3QZOA 4UBDD 1J5DA 2OTWB 4IBYA 2AK1H 3UTSD 1F1DA 2ED7A 2ZOOA 1RK1B 2J2ZA 2PCFA 4PRHD 4DVBB 2GK2A 4XX1E 3TM6A 2H41A 3N0PB 3WUZA 5IQMA 4XT1C 2YGVA 4NNYA 3QEUB 2B08A 2YZ8A 3CVIH 1OCRB 4IOIB 4WAFA 4YBQD 4NUGL 2A6DB 4JFHE 4EN3B 3OR6C 4LLYB 3IJYB 2F95B 4HPOL 2Q0ZX 4ETYA 2OW6A 4IIJA 2J4WH 5HYEA 3P1VA 4RFEB 2YPKB 3QUGA 3NEOA 3U0WL 4PRIB 4QWWD 3S36X 4FQ1H 3MV7A 2ENQA 1A4JA 4KUCF 3BH4A 2P4VA 2VM3A 2ZSVA 2P7TA 4UIMB 3K0DA 3LHAA 1AD9B 1CICB 1CD1A 1F6LL 3E6HB 4FJCC 4KRLB 4P2QA 3ZJZA 5DTFA 3ZMEA 1YY9C 2CDGA 3HG0A 2PO6A 2J8UA 5CBEA 4U3FH 3Q7JA 3ASWA 3JAKA 3T0XA 1G6RL 2RBLA 4LARH 1HE7A 3I9AA 3BDYL 1NEZG 1YIJV 1WWAX 4RDQG 3SBQA 4PIBA 3LSQA 5AZ2L 3GRWH 2E9BA 2GY5A 4JY5L 2CO1A 4YSPA 1T7YA 43CAA 3P11H 1JGLL 4G8IA 1GPOH 1VEWA 1KJ3H 4DZBB 4P4KD 1Y1UA 1HKLL 4HK3J 2V8MA 3BSZA 4XH2B 1CU4H 4QHLA 3WEMA 4LKXB 4HUVA 5HHOB 2XWJB 5JJNB 4A6YA 3E0GA 2WTPA 1GH7A 1KCSL 3AROA 4H0LC 4PRDA 5JO5B 3UX9B 3VXTA 4P2AA 3H9HA 1FS0G 2FTKA 3LKSA 4FZEL 2P5EE 5BNXD 2VZ3A 1HWYA 2DB8A 2PYFB 1E6JH 3AG7A 1EK3A 4G8FA 1G7LA 4JANA 4P0DA 3NJNA 1BGXL 1GTFA 1CE1H 1ODUA 1U36A 3CLEL 3FRPG 4MB3A 3ZIAG 3JTTB 1YPZB 2DQCL 1BIIA 1RULL 4M7ZC 3SBRA 1UACH 1S3RA 3FU9A 3NCYS 4R4ND 1GC1L 1A32A 4A7QA 2AV1B 4OBRA 2P24B 3IJHB 1GGYA 4WCYH 3T2NH 4GG6F 2ZT9B 1ZHBA 2JKIS 2D7NA 2DKMA 4TVPE 5JHLA 1FPOA 3NR7A 4JTAB 5FPOA 1HH9B 1JIBA 1AZZC 3IDXH 5EZIL 2ARJB 3CBJB 3FONA 5C0BB 3UJJH 1T0NB 2X4NA 4Y4KB 5MEPA 1SLXA 3FT3B 3ETTA 5L3GA 3QAQA 2UXFA 1KPVA 1XGPA 2EE2A 3SJVD 4QYOA 2AXWA 4YNYA 3MCYA 5CSBA 4F9PC 3STBA 4ZFZB 3V0FA 5DJZA 4KRMB 1YVWA 4Z2WA 4GT7A 4R8WL 4MWFA 5CZRA 3DROB 4NQDB 3T6QC 1HSAA 3BT0A 1K34A 1NI8A 3O11A 4JL1A 3ILEA 1FHNA 1CDCA 2QLVB 3UG5A 2UUCO 3G6JE 3BFQG 2NY6B 2UUDK 4MVZA 1DUZA 2VN5A 2WAHA 2XZAL 1UFGA 1CL7I 3G6JA 1GAXA 4K3JL 3UCRA 3NPZB 4HX1B 4MNGA 4CN1A 2VQFO 5EBMB 3SE9H 3CRRA 4O4LA 5E1AB 4HIJA 2VDLH 4MNHB 3KCXA 4OTXL 4WY7H 2GBAA 5MEQB 2OR7A 2R70A 5TH2B 4IHJA 5J3HD 2MTAA 4QF1A 4XVJL 4OD3H 4ZMOA 4N2OA 5E51A 1WK0A 2H3KA 5DQDL 5AEAA 1TZIA 3D3IA 2KBGA 4XPTL 4EZLA 3TV8A 3MRBB 4K8RH 4ZI8A 3MSPA 3FSWA 2XN9B 1U4EA 1HHGB 1KBWA 3GGWB 3H6AA 2R9AA 3PIQB 4N87A 4UV7H 5HVWA 3DX6B 4GEJA 3BISA 3ML8A 4X7TA 1DHKA 1GHFH 4QEGA 4CJ0A 2O61B 3VE0B 4HZLB 4N9GA 1NIEA 3RHWF 5JW4Q 2IOOA 4JO5A 3MODH 4HCGA 4HF5H 5ANMB 3TA3A 3B5HA 4JASA 4LPVA 2CO7B 2VLLA 4EUPH 2BRQA 5F6HJ 3FZUC 5I1KH 2G60L 5L2JA 1DVYA 1D5XA 2ICCA 3NZHH 1SJMA 3PJSB 1P7BA 1PCXA 1DANU 4MMZC 3T3PB 4LVNB 1NFIA 5CJ8A 3RWGA 4U1KB 4PW4A 4PJBA 3W37A 3IDIA 4JLRA 3FRUB 4NUPA 1WAEA 3HG4A 2XOTA 1LO5A 3PHOB 1HXYB 4GLXA 4TM9A 3L1GA 4BELD 3ELAT 4YFLI 2XXCB 1QFPA 35C8L 1T1ZB 3JAMN 3TBTB 5JOPD 3QNYB 2JTYA 1XF5B 3ISRA 4V2BA 2VERA 1NR1A 3RWCB 4BKTC 4OF5A 1QPKA 3MLPA 4U7KA 1P84J 2CM6A 5L2KB 2IPTH 4Z0BL 3X2QB 1QR1B 1ACYL 5DO2D 1H6EA 3RAJL 3QEQB 2Y69B 3HC0B 1TGOA 3OAWA 2BNQB 2ZKHH 5B1JA 1QVOA 5I15L 3QZWA 5KAFZ 2H47C 3CHQA 1JYXA 4M62L 3QTCA 3GXFA 3C5SB 4YXHL 3QJFA 3WB0A 3HI6L 4ZW5A 4YAQB 3SYOA 3CV5A 4ZDHA 2LW7A 5FO8A 1I82A 5DHVH 4WF7A 5HHXH 2F5AH 3ZHUA 2W0FA 4QR7A 2H2SC 2HFEC 2B3RA 3GRGA 4WFAV 3GINA 1FO0B 4XXDB 3OPUA 4NN5B 2YBRA 4LESA 3LPGA 4L8CA 4MA3A 4FN0A 4MA8L 2C3WA 3PGFL 5EPMA 1IILE 3GMOA 4U6HB 3ET9F 1MCBA 3L1OH 4NZRL 3DOSB 3UO1H 2CUGA 4YUEH 1GR7A 2UZIH 2FUTA 4RX4A 5KSVA 5LBVA 2QMKA 3IVKA 3D85A 3NN8B 5JZ7C 5J1AA 5JPNC 5CGMA 1TMCB 5FW8A 1I8KA 1Q90A 4M3KB 1BT8A 1CGSL 5IB5A 3C09C 3DX3A 1OM3H 3RDJA 4OZIE 3KLAA 3D69A 5ALCH 2KLTA 1FL6B 5TDPA 3SDXA 4PQXA 4X4YA 1Z3GH 3ZE0E 1YMME 5FCUH 1T7WA 3QEHA 1JMZA 5TPWH 3VA2C 1BZ7B 2LFSA 1X6NA 3DI3B 4M93B 1ZV2A 4GKJO 1YMMA 2NRDA 2EDDA 3ZKMC 2BIIA 4RWHA 4OFQA 2YPLE 1UCBH 3QWOB 3O8XD 1MFCH 4HHAB 4BZ2A 4PJ9B 3H7BB 2IQ9H 4JG1H 2AEQH 4U1SA 4NI6A 5FM5O 4I18C 4GKLA 2G38A 1HNXB 1VQ6V 2JXMB 4BFEA 1R5WA 3SGDI 3WFHA 1W72A 3PAUA 4LRIC 5KSAC 4IBSA 4OJDH 2RNBA 1G4RA 4CILA 1BVZA 1COBA 3BFRA 3FKSG 2BHUA 1J9CT 1ECZA 2YSTA 2EXYC 4N2HA 1KLUA 4WJKB 1NH2D 3Q05A 4O5LL 3TYGL 4Y16D 5EWIH 1E9PA 1G7JA 3LOWA 1T21A 2WTRA 3D39A 4IJ3B 2FH6A 4UOQA 3ZQWA 5KS9A 5TFSL 4ZPTA 4K94H 2LTQC 5EO0A 5I76B 4XC3L 5DEFA 2DQUH 3UZEC 1JQ0A 3QZMA 3V4VL 5LN4A 3EFFK 1B4JL 5JVDA 4P2RD 5EIQA 3L7EB 3PV6B 4U6YA 2PI4A 3HKEB 1CYXA 1MNUL 2J6EL 3TJEL 2TAAA 3KZIZ 2AQTA 3I74A 4H20H 4HMCA 4J27A 3IKKA 2F23A 2Y4SA 4JFDE 5C0IB 3BX7C 4U7SA 1MOFA 4WK0B 4M1GL 5ICXA 1MIEH 5I6PA 4O2FA 2OIGA 5EOCL 1I1AD 4RBPH 4LNRA 1TUBA 2ETNA 2NZIA 1NCGA 4QTHB 2HAZA 3V5DB 4DKEL 2OPCA 2YXYA 3R4DA 1GZQA 1U8IB 2VERN 1EZVX 2WWOA 5DUMH 5JOFA 1J5HA 4OR1A 1K4DB 1BBJB 1UM5L 3ZGIA 3N44F 2ZCHH 4MJJA 3GUTB 2YEZB 2VC2L 2GUZA 5E00A 2RQ6A 4PRPB 5IROC 2WLLB 5LQBH 4DVRL 1F51A 4L9LB 1Z66A 4LLMB 1AGFB 3ARGA 1XIWA 3S35X 5A3IC 3RWJA 1DN0A 1RUAL 1GRWA 3PQYA 1MQKL 3BH9A 4G27B 4TVPH 5FKPB 4G7YL 1WZ1L 2OKMA 2BNUB 3C60A 4JN1H 4AQZA 2CDFB 2OTUB 1ITBB 4F8LA 2BSSA 2UV3A 1GMIA 5T3XL 3V0EA 3QCVH 1IL1A 2WXNA 5A7BA 3C6SA 3WSQH 1KPRB 5BMVA 2GBVA 3CN2A 1IBFA 2PF6A 2BSRA 3MCG1 1TZ8A 2G9HB 4NS0A 2IH9A 3TOPA 2YAPA 5C9JB 1RURH 3VWJD 3W0WD 1Z9SB 4OJFL 3EOAB 3UZVB 4UTBL 2L04A 4YPJA 5FO7B 3CRQA 4L05A 4GRLC 4NQCD 3CVCA 1H2NA 3IAQA 2VM4A 3OR6B 5D1XC 1U91B 5K39A 1BJMA 1RHHB 4AZ8B 4LOUC 4ODWB 5IQ9B 3T0VA 3CK0L 2ZXGA 3BFWA 3H53A 3TO4A 1AO7B 3W7SA 5DHEA 5KVMC 4CA4A 4KXZH 3AAZA 4DXWA 4ODTH 3T1HB 5DSCB 3PDGA 6PAZA 4F9LA 3EVKA 4AUUA 2Q6WB 1AOZA 1KYOF 4ZUVB 5GGUB 2AI0H 2IGTA 4U1NB 1OPOA 3UTOA 4FXLA 3U30B 5C6PB 3RJDA 1MFBL 5CD3A 3CDGA 1BQLH 4FTDA 5D7JA 3L72H 5CN0A 5E2JA 4HLEA 3KS0H 4OGYH 1R3JC 3B9AA 3C5JB 3KPRB 2P5OA 5C08B 3WLBA 1M53A 2XG5B 1K3ZA 2BP8B 2IXQA 3MLVH 3FB5C 2ZE8A 3P40A 1EDQA 1ZA3B 1JFFA 3AG3C 2YDEA 3O0RL 1DTOA 4H0LB 1DVTA 4Y1AB 2ZP8A 1QFUL 4PB9L 4X7EC 2OV0A 4PRBB 4O9HL 3E7JA 1GOFA 3CJHA 2A74A 1WFJA 2YAQA 3QUYC 3ME0A 4JI6B 5I6XB 2JGDB 4FYTA 1CFSA 4MSWA 5HGHA 4B9ZA 1Q6HA 4PCKA 4G1EB 4UTAA 5E0QA 2OMWA 1IARB 2FCBA 4MX7B 4JFYA 3U6RA 1JBJA 2CLZB 1FDLH 5AENA 5HDBF 1HNFA 1PNMA 3Q5OA 2R1XA 4P9MH 4QKXB 2O93L 1N5YL 1RVFH 1FXKA 1BHBA 3FQUA 5F7KC 4EI5D 1LQSR 2YEQA 1S7XB 4IS6B 3R8QA 4NQVA 4X6CE 2P4KA 3CMAV 4I1NB 1A6ZA 1DVFA 3FOLA 3G6AA 2QLYA 4W9HC 1AXTH 4X6CA 4ZOBA 3UIYA 4B3EA 2IH8A 3K71A 1D3CA 2PR4H 3UPRB 3RIFF 2CTWA 2FSDA 3BP6B 4UQ9A 4UYPA 2Y6SC 3WNPA 5I1CL 1DF4A 4WWKC 2YQBA 4JDEB 1PL3A 3BOVA 4ZFOL 3ZW3A 2JEUA 3FO1A 2PMZA 3O41A 5CGTA 2QTSA 1A4KA 4NCDA 4C55A 3F83A 4I9XA 4N2MA 4U0RC 5J13C 3OW2U 1I8LA 1PPIA 4HV8B 2DQ0A 5IEKB 3T6ZA 1IX2A 4KKAD 5C6TH 1QYGL 1S7WA 3PGDB 4G7SB 4ZUSB 3F5WA 2JEXA 3GSQB 2A0LD 5BOZG 4I2XA 2CM5A 3O0LA 5C0AB 2JV6A 2OYQA 1MHEA 1IBBA 1SLVA 1IGYA 2VJXA 2F1BA 3MGOA 3SQOH 5EF0A 5CGYC 4GIAA 3FT4A 5JW4M 5KBDA 3Q2CA 3RZCC 2EC8A 1EUUA 1UA7A 3BIAX 5D7IA 1UD3A 4UDUA 5AVRB 4IKNA 5HJ3A 2ESVA 2KPNA 1QTPA 1RD6A 4FCAA 4OCWH 5KUMA 4J7KA 4I0PA 2V2TA 1ZHNB 3GMPA 5FOBB 5MENA 3C9NA 3N42F 2WINB 4HLZH 3DMMD 3ULVL 4DR6O 1PSKH 3LZQA 4YBLC 4X6DF 2WXHA 5CJBA 1TVKB 4DK1A 4KX7A 2BIQA 5C8JB 4KRPC 2YC1A