3ASNB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asnB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asnB02
4FA7B 1M56B 1IC0A 3X1GA 1AANA 1AZNA 3X1BA 1OE1A 2J56A 2X88A 1ZDSA 2EILB 1AS6A 2VW7A 5EHFA 1AQ8A 1CYWA 3AY2A 5B7MA 2XU9A 1L9RA 4EF3A 1YLBB 2GC4C 3CVBA 4HHGA 4GYBA 5A7EA 2UXTA 1OV8A 3BVDB 1OE3A 2BZCA 2XWZA 1XB6A 2UXVA 1PLCA 4UAHA 1SF3A 1XB8A 2MRYA 2YAPA 1L9OA 2FNWA 4E9XA 1SJMA 5ANHA 2AVFA 5B1BB 4AKOA 4A2HA 1N70A 3ABMB 2HLEB 4AX3A 1R1CA 3WIAA 2EIMB 2PCYA 4DP9X 3OMIB 3H4HA 1OOWA 3AG2B 1PAZA 2HX7A 5B1AB 2GHZA 2GI0A 3QJRB 2AZUA 4FAAB 4UANA 3T6WA 2X87A 1ILSA 5I6LA 2B08A 2BP0A 1M9WA 4WKXA 2Q5BA 3NSCA 4BDVA 3X2QB 3X1FA 1I53A 2WO3B 2YAOA 7PAZA 3NSFA 1DYZA 3WI9A 3EHBB 4UF7C 1OF0A 3TASA 2YAMA 2LLNA 3QJSB 2XV2A 4JHVA 1PZCA 1NZRA 2XV0A 1RZPA 1ADWA 2YARA 1L9SA 4ENZA 2WSDA 3X1NA 2FQEA 2CALA 4KOCA 2VSKB 4KO5A 5IY5B 1SNRA 2CCWA 1ASQA 4DP1X 3NP3A 1JXGA 3CDZB 1GS6X 1J9SA 2BWIA 4YVNA 4F2FA 2BWDA 2AANA 4YSCA 3PCYA 1PNCA 2ZONA 3FSVA 2IWKA 2PPAA 1NPJA 1SHXA 4HALA 1TEFA 1B3IA 2ZOOA 4YSSA 2YAFA 1NWPA 1BYOA 1SHWA 2P80A 1AZBA 1V55B 1RCYA 1ET5A 2IDSA 4JKNA 3FU9A 1AIZA 3JTBA 2IH9A 3FS9A 1KDJA 3SBRA 1PZBA 3OD3A 3S3BB 3T6XA 3WNIA 3HB3B 1L9PA 1V54B 1AOZA 2FQFA 3T71A 1HFUA 4GY4A 3WKQA 3FYIB 4E9SA 2J55A 5I28A 1WA2X 1HAUA 3AG1B 1JXDA 4P5RA 2RACA 4PCYA 1GYCA 2FJSA 3JT2A 4A2EA 1IBYA 4E9TA 4QKTA 2QDVA 1ZPUA 4BWWA 1JXFA 1L9QA 2YXVA 3FT0A 1JZIA 5AKRA 2Q9OA 1BAWA 2I7SA 2IDTA 3N2JA 2PPFA 4KNTA 2GBAA 4W1TA 1JZFA 3V9CA 1BXUA 4BDVB 1ASOA 2PP9A 4DPAX 2GB2A 1GS7A 1PNDA 2PP7A 3D12B 3FSWA 3BQVA 1ZIAA 3FU7A 1E65A 4KNUA 3ERXA 1NINA 1WS8A 1NPNA 1RKRA 3T6VA 4JHUA 4BXVA 2H47C 4BXSV 3QJVB 1MZYA 5I6NA 4A2DA 3MBWB 5F7BA 1JZEA 3T6ZA 2CBPA 3PPSA 1MDAA 3AG4B 1V10A 2VSMB 4P5SA 3ABKB 1IUZA 3FSZA 3X1EA 2R7EB 4DPBX 2H3XC 2BO0A 4A66A 1JZHA 1ZIBA 3PAUA 3NJGA 3CVCA 3T9WA 4RH4A 2XXFA 3N55A 7PCYA 1AZCA 2IDQA 1JZJA 2P80D 3OQRA 4HHWA 1J5CA 1JERA 1XB3A 2VW4A 2H5UA 4X4KA 2EINB 3FQ2A 1AZUA 2OJ1A 2XX1A 4KOBA 2GSMB 4Q89A 1HAWA 4A67A 1BXAA 2YEVB 3ZBMA 5I5JA 3S8FB 1AG0A 3AG3B 4E9WA 4ZK8A 3NJIA 2BW4A 2EIJB 2BP0B 2FT6A 1JZGA 1J9TA 2JXMA 4PAZA 1J5DA 5I26A 2A3TA 2MTAA 2YQBA 1NIAA 1PLAA 4HCIA 1E67A 1WA0X 3IBOA 3IEAA 3UACA 2GC7C 4HCGA 3H4FA 1AS8A 4GP8B 4KO7A 1MG3C 9PCYA 1PLBA 1N68A 5B1JC 1XMEB 1AS7A 2YAHA 4E9RA 2BP8A 4DP5X 1FWXA 2YAEA 1T5KA 2DYRB 1AACA 1BYPA 3DTUB 1JOIA 2VW6A 3QJUB 1WS7A 3EH5B 3CZUB 4HAKA 3FPXA 1NIFA 2N0MA 2QPDB 4CSPA 4YSUA 3SBPA 4K9JA 1KCWA 2W8CA 3FQYA 4G7QB 4Q8BA 4L0PB 3TBBA 3UGEA 3NP4A 5B7FA 3TA4D 1X9UA 2WO2B 2AZAA 1OCRB 1CYXA 1NIBA 3NJMA 4MFHA 1DZ0A 4DP7X 3GDCA 1NTDA 3PAZA 5I6MA 2FT7A 2ZXWB 1A4CA 1ID2A 3IN0A 2BZ7A 4YSEA 1EHKB 2HX8A 3WNJA 4G72B 3L45A 1PMYA 3S3CB 2FT8A 3S8GB 2XLLA 2HX9A 4N4YB 4M4RB 5AZUA 3EF4A 4KO9A 3WG7B 2PLTA 4BK5C 4KO6A 1F56A 2XUWA 3NJNA 3FPYA 4YSRA 3KW7A 2VM3A 4AKQA 1PY0A 1SDDA 2PCFA 3G5WA 3PLYA 2OCCB 4W9ZA 4TXVB 6PCYA 1ASPA 1OCCB 1KDIA 3QJTB 4DPCX 8PAZA 3ABLB 1NIDA 1TU2A 1PF3A 2XX0A 1E5ZA 1MZZA 4E9QA 4AKPA 1NDTA 2IWEA 3ABGA 1E5YA 4AI7A 3NJJA 3ASOB 5I5MA 3NJHA 2QPEB 5PAZA 3CVDA 1BQ5A 2GIMA 2PPEA 3ASNB 1BQRA 2TSAA 3QJQB 1ZDQA 2QT6A 2DWTA 1QLEB 4YL4A 3MX0B 1ET7A 2XYBA 2HXAA 1NICA 3GYRA 1L9TA 2CUAA 2IDUA 3SBQA 2YAQA 2IWFA 5B1KA 2XVBA 3IN2A 2QDWA 3WKPA 3ZDWA 4YSAA 3EH4B 3KW8A 1CUOA 1SDDB 3ZIYA 4F2EA 1ETJA 3EH3B 3NYKA 1W6WA 4YSDA 2IDFA 2R7EA 2FTAA 1FA4A 4GP5B 2JKWA 4YSQA 1SF5A 2E86A 1GR7A 1WAEA 3HEIB 2UX7A 2I7OA 3NSDA 4DP0X 2PPDA 5I5IA 4KNSA 1BQKA 5I6OA 2UXFA 1A3ZA 3UAAA 5B3SB 2FQDA 3AZUA 1IBZA 2IH8A 2VM4A 4E9YA 1KBWA 1SFHA 1VLXA 2UXGA 2PPCA 1BXVA 3TU6A 1A4BA 1AAJA 1URIA 4E9VA 2J57A 1GSKA 4BWTA 4YSTA 1RZQA 1TKWA 1KCBA 1KYAA 2XV3A 2DYSB 1J9RA 2TSBA 1AG6A 4A68A 1GW0A 3NJFA 3PAVA 1QHQA 1AR1B 4DP2X 1EZLA 4AZUA 4GP4B 1TEGA 3UABA 4G71B 1CC3A 5B7EA 4M3HA 4WTQA 2CAKA 1J9QA 2HRGA 2J5WA 2YXWA 3FU8A 5PCYA 5TK4A 1GS8A 4GXFA 1A65A 3GXUB 2DV6A 3C75A 4HIPA 1NWOA 4DP6X 1FFTB 1NIEA 2JFCA 3U25A 2FQGA 4G7SB 1BEXA 5D4JA 4N8UA 1ILUA 4DP4X 5B1JA 3OMAB 4NAJA 1CURA 1UATA 4YSPA 2PP8A 3FYEB 2BW5A 2IAAC 1PCSA 2B3IA 2ZWNA 5I6KA 4HZ1A 4G70B 2Y1AA 2DY2A 3QPKA 1KV7A 4QLWA 1GY1A 1GY2A 2VN3A 2Y69B 3QQXA 5I6PA 3NJLA 1JVLA 3ZX1A 3FQ1A 1M57B 4DP8X 1SFDA 4BWUA 3NJKA 1PZAA 3CDZA 3H56A 5TK2A 1OCOB 2DWSA 4CSZA 3AW5A 3NT0A 3UAEA 2BHFA 4NB7A 3PXLA 2FWLB 2BP8B 4HCFA 3S3DB 1KBVA 1ET8A 3IE9A 6PAZA 1A8ZA 2HZHA 1MG2C 5F7AA 5AFAA 3SQRA 3DKHA 1E30A 1A4AA 3UADA 1KGYE 1JVOA 2W88A 5LDUA 2OV0A 2XXGA 4YVUA 1X9RA 4NERA 5FC9A 2NRDA 2UX6A 1W6LA 3OM3B 3TBCA 2VMJA 4A2FA 3RYMA 3NSYA 1AZRA 2AFNA 1IKOP 1OCZB 3OMNB 1OE2A 1QNIA 2I85A 3CG8A 4G7RB 2CJ3A 1ZV2A 2HRHA 3FSAA 4YSOA 5D4IA 3FU7B 4A2GA 5E9NA 4F7KA 5D4HA 1W8EA 1WA1X 3V9EA 2EIKB 3DIVA
chains in the Genus database with same CATH superfamily
3QWRD 1JA8A 5E4IA 1SXNA 4PVNA 3J2PA 3OHXA 3BLBA 5EU6E 3DUUB 4KKQA 1N4XL 4XP6L 3MFGB 2N4IA 1Z9PA 2DTSA 5IK3A 4RO2A 3HFML 4FQCH 3UDWA 3G6JE 1RPRA 4XVUC 2JCCA 4ODXB 2MJWA 2RHEA 4JQIA 1W16A 1T0NB 2NW3A 3F6LA 3KBPA 3KPSB 4I3GA 1IEBB 2IAMB 3IU3B 1QG3A 4M00A 2MW2B 3RYHB 4Y88A 5GW7A 4X7FC 2ZE6A 1SJHA 1Y1UA 3JASB 4A2HA 4PFEA 2GTWA 1Y66A 4D8OA 1R1CA 4Q9RL 4ZIBA 2WAMA 4DP9X 3WIFB 3MFFB 2A3QA 1ECZA 2VNCA 2WKGA 3WJLA 4GX0A 4HH9A 2Z3YA 4MJIA 3VQWA 2EINC 1O9ZA 5CR8A 3TBYA 3H9SD 4Z18A 2N7AA 5I6XC 1R6NA 1EN5A 4JI7O 3DOIA 1SYSA 3MBED 2O5ZL 3GB7C 2F5AL 4Z7VB 2EDOA 1M9WA 2XIIA 1DQLH 4CVXB 1A6AA 2IQ9H 3K5NA 2LGNA 3RYCB 1INDL 2WGNB 3NSFA 5AOZA 4BFKA 4KK5C 5IHBA 3GDBA 5CFHA 3FZUD 4H1LH 1GZHA 2X6BA 1Y6KR 4RA0C 4CMHC 1B4RA 3GBEA 3TL5A 4A2LA 5JORB 4Q58C 2AV7A 4GRLA 3DUSB 4JHVA 2GTZB 4IRJC 3R8QA 2ATKC 4CW1A 7FABH 1RZPA 4WDIB 1QW8A 1P7GA 4F9PC 2R23A 1QRND 5BRZA 2DB8A 4KDTA 5EBLB 2QSCL 4LKCA 3N2GA 1QW9A 4HWNA 1FAIH 3JATB 3C6EA 1ASQA 3OKNA 3EYSH 1FV1B 5GGTH 2VL4A 3O9WB 3TEZA 5CINL 2BERA 2FNBA 2EDBA 2YLKA 4JPVH 3A23A 5H37H 1SJEB 1Z7JA 4ENEC 4XGZB 2WPGA 2DBLL 3O4OC 4F2FA 4Z0BH 2R0WH 4CS2A 3EDDA 4M48L 5JUEL 3PCYA 2HVKA 1E6OL 1H6EA 4M6AA 5IJ9B 1DVFB 3Q8CA 3BKJL 3RGVD 4LH7A 3F6IA 2PPAA 3UZEA 4MVUA 4JI8O 5D2NB 2B59A 3AAZA 5EDSA 4HPOH 3VFTA 4BZ2A 3VRJB 2FLBT 5IE9A 1JNNH 2XWJB 1SLVA 1U42A 2YD1A 3BKJH 3E80A 2ESVE 3MV9E 4XCYA 2M2DA 4XB8A 5DWUL 1U8PA 2J5LC 3W9EB 4RLDA 3VG9B 2ZCZA 5I0VA 3ARDB 2F15A 5CSZA 4R4NC 1TXKA 2A6DB 3NIFE 1YTFD 1P7BA 4KQ3L 3DROA 4L4TA 4WEBL 1J8HB 4YO0B 3FAXA 3RX7A 5E99L 3EZ8A 2YIBA 3SOBL 3UMNA 3KNBA 3MRBA 2YD6A 1COBA 2PWGA 4HLJA 4Y5XA 4YWGH 2BH0A 4N20A 3UTSE 3VH8G 4E9SA 3WLWC 4ATTA 2VDOL 4U33A 3VFOA 3VUAA 4GW5A 3FO2B 4JVWA 3VFMB 3QNXB 2V3DA 4GBXC 3RJQB 1D2PA 1MOEA 1RJLB 4LL4A 3PIQB 4ZMXA 1I1FA 1MUJB 4RGMB 4DGUA 4RX4A 3QUMB 2YICA 3D0AA 4XI5D 3OZ9H 3VXSE 3FUDA 3N2JA 2NQCA 1UWGL 3O2DL 4IRSB 3RT3C 4KNTA 4LHUB 3A24A 3IXAA 4J3SA 4K71C 1NAML 1CFSA 1AD0A 2ADIA 3G08A 4HIHA 4LLMA 3PU7A 3OT7A 4RAVB 3KYNB 1OB1B 5DD3H 1L0LH 3BQVA 3NCFB 4IOSD 1WUNT 2X40A 3LPWA 4KP4A 4V11A 3QIBC 4KNUA 1G5AA 4B9CA 1U92A 1PYWA 3PL6D 5GZOC 3W7SA 3Q8FA 1BP3B 2ERJC 4JHUA 4M02A 1T1XB 4L0YA 3DSQA 1EN4A 1YA5A 4M8RA 1HINL 5F7BA 4NQVA 2H3NB 3U36A 4OD2A 4X6CF 2AMGA 3TO2B 4RWUA 1HN1A 1RULH 1V10A 5KX5A 3BUYA 4NQXA 4P5SA 3MLPA 3IU4H 4DPBX 5FFOA 4NTWA 3CN0A 1T5XB 2NW2A 4MVZA 2HJKB 2F19L 3B3IB 1LDSA 5DC0A 4PJAB 3OAUH 2NT0A 1CL7I 4CVUA 1I7FA 3HUJF 2RJZA 5KUMA 2XHNA 1BJ1H 4LHUG 4YXHH 4KHPO 4S0HA 1Z5LA 1KENH 1IILE 5IVXB 2IFFH 2X7LB 4YDIL 5C07B 2R2BA 1TYEB 3VGEA 4FDWA 4J6RL 3RBGA 3MCKA 1RV6X 4JJ5A 3IFXA 2XPYA 4JJHA 1E6JH 1XMWA 3QCUH 1H8EG 4TOIA 2MKWA 8FABA 2XY1A 3VD9A 3RKDC 2EIJB 3NEXA 3ARBB 3M99B 4N6RA 5D71H 1JPSH 3HZKB 4I77L 4F5CA 1N6QL 1Q9LB 2IALA 4M9PA 3FQTA 1NIAA 3LKOB 1IAKB 1VIWA 4RGOH 4YHKH 3ZT7A 2RD0A 2A6JB 4X64B 1ZSPA 3EXAA 2ZNIA 2DL9A 1KBBA 4X5WB 3MV8A 1DDHA 1I8UA 5IB2A 5AWNL 1SBSH 1F4NA 4XXDA 2HVJC 2BLFA 3KPNB 1VQLV 2AEQL 4PELA 3DX3A 1BV8A 3L3DA 2IQAA 4YIQB 1DJZA 4YL9A 1GOGA 2O6PA 2R23B 4WFHD 5AKTA 5E5MB 5J7CC 2J25A 2CKBL 1KGCE 4FNTA 1HKLH 1VF5B 4RGMC 4EFEA 3B5HA 3BDYL 4N24A 3SKJL 5J3HC 4D6TH 5A3ID 2VW6A 5C08D 2DQIH 3AREA 3EH5B 3ESNA 3QHZL 4Y19D 1T2XA 3C9NB 2AXHA 3PUCA 5K1VA 4DJMA 4ASUG 2DDQH 1LE9A 1DBML 1S7UB 5CA0A 1LO4L 4U6YA 4TOYH 1XGRB 2LU3A 3V4LA 5CS7A 5FPRA 1EXUB 3VGFA 3HI5H 4JQXA 1J1PH 1ZL8B 1J1XH 3CCHB 4IRJB 4M4RA 2WYHA 1P5UB 2DDQL 1BZ7A 1OCRB 1ZTEA 1YMME 2AC0A 4U7KA 3TCUA 5CJ5A 4L4TD 1Y6NR 1XBDA 4HWZA 5L88H 1R3HB 4IHBA 4JX0A 3GWJA 4ORGB 4G2KA 4Z3TA 3DXAA 3OEHG 4UIMB 2HX8A 1KULA 2DJUA 4LFCB 3WO4C 3QCTH 3ULUD 1RP9A 4R3SA 5FUCE 4O2AB 4TQPA 3VWKB 1OWWA 1GZHC 2YUVA 3WUZA 15C8H 1EMTL 1FZMA 3GJFK 1LE5A 5CSZB 4I4TA 3QEUB 4I0XB 4PJEF 4NAQA 2AMUA 5JHDE 4DERA 5FPIA 1WTLA 3U2JA 5HHVL 3V4VB 4TSBL 2ZYSA 3F62A 1H9DA 1CMOA 3EJQA 3TCTA 1P7KB 3FC8A 4N68A 4RQQA 3INOA 3VDCA 4M5ZL 1ZEAH 4XC3H 3UAJA 2XASA 2Y7NA 3M88A 4KZDL 2Q86B 3O6KH 2A73A 4IOSA 4OLUH 3C2AH 5HHOD 3DV4B 4S1RL 1TYRA 1FAKT 5D7JC 3I6LD 3MRKB 1E90A 1MZZA 1HQRA 2NY4B 4HUMB 4HWBL 3QHFH 3EFDH 4LLVA 4F80A 3VH8A 1V7MH 5KVMC 4MMYB 1NGXB 3GI9H 2DIEA 1DANU 5LA6B 1CFBA 5LMNB 3ZR6A 4JI0B 3Q8BA 3V4UH 1QEWB 2J6EA 4NUQA 2ATAA 4Z5RA 4AG4L 4TYUA 4A6YL 2FJGB 1BX2B 3H53A 2HXAA 5ISZD 1QMUA 5CZXC 1JV2B 3V9FA 1W0KG 3QO8A 1TQBB 2J73A 4NQEA 2IDUA 4IGBB 5EN2A 4EZMA 3JD3A 3NFNA 4CH6A 2K7PA 4DN4H 1I1YB 2UY6B 4QTHA 4UUJB 4Y7MA 1CUOA 2I9LA 2Y06H 2CKBA 2VERN 1HQ4B 1MFAL 1UZ8A 3H6AA 1N6VA 5AOKA 3UPAA 4AEIL 4X66O 3RWJA 2ZD9A 3JAKB 1R47A 2NY2D 3Q8EA 5DJ6A 3U0TA 5EEUA 2EIMC 4MA8H 4ZFOB 4W9JC 3CXHJ 2R7EA 1KYDA 4MD0B 2KQMA 3BISA 1FO0L 1OP5H 4NKMA 4YPGA 3K0DA 3ARDD 3P3UA 5EBWA 2DMBA 4I18A 3EYVA 3VXUE 2W65B 4NWUH 3VD7A 3CVHL 5C07A 3LEYH 1T0PB 3II1A 4BYHA 5E2JA 2X4TA 4HWUA 3AQZA 5DCCA 1D5ZA 3KPRB 4W9CC 4N0UA 2BPBA 1CFVH 5CGYD 5F8QC 3IJEA 3GRWA 4UMGA 1EAPA 5CO1A 3LS5L 4JY4B 4KXBA 4LCWA 2H6PA 4F15B 4TUYB 3V6OE 2NYYD 4UM8A 3APQA 4BWTA 4MZ3A 1FE8H 3ARED 3HZMB 1PY4A 4LSRL 4WGVB 4Y19A 3FFDB 5LBQA 2MNJB 2WWOA 1Q0YH 2Q8AH 3KMDA 1EFQA 1ZT1A 3V95A 4LHUD 1OT4A 5BMVA 2OL3A 2RDCA 2EYSA 4ELMA 1AI5A 3D8MA 2PXYD 4QTFA 1U8QA 5E5MA 3CEIA 5I8CB 2HFGL 2GUZA 5E4OA 3E86A 4MLIA 2CAKA 2RH0A 1QYGH 3C09B 4O2EA 1SOQA 5AW1B 1I7RA 2Z91A 5ETUA 3Q06A 2XZZA 4ZUTB 2J6WA 5LOVB 1GS8A 1PZSA 3AM8A 1A65A 1LP9B 4HAGA 5KTEH 1NWOA 1CDJA 1FO0H 2NQDA 3UP6A 2ZWSA 1VGEH 4XDJA 3S48A 2YBGA 1F58L 3EJYD 3C08L 3ETGA 1OAUL 2F8VA 2Z4QA 1ILUA 3S7GA 4XMKH 1U36A 3TNNB 4YSPA 4HWZB 2WXFA 4MW8A 3IXTB 2IAAC 2BS9A 2F53D 5F6IB 3LKSB 4MHHI 3STZB 3SE3C 4P9MH 1MWOA 1VIBA 1SY6H 2CQVA 4KTDL 2UUCB 5C6WH 2FX7H 4CGTA 1RM1C 1JPTL 4NI6A 4FM2A 1O9VA 3LS5H 3GSNH 4IHJA 3L17A 2VLMD 3QJXA 5IDJA 2Q73A 3RX8A 5KAFZ 5IJBC 3SHSA 3GSQB 5HHOA 4FL4C 1FPOA 2L3BA 4LF5O 3TGXA 4FFWC 3LEVL 2DWSA 4GKJB 4PRHE 1TZHB 1WZAA 5GJTL 2F93B 1LYQA 4NB7A 1PKQE 5GZND 4C56D 3NXSA 1C5DB 4G8GA 5HPMA 1S7TA 4RNRA 4XMPH 2G2PA 1EEQA 1YYCA 3FF7A 3G6JB 2H8PC 3O11B 2X70B 4U7SA 3QNZA 3DLQR 3RKPA 1IFGA 4NQDE 4PTTB 3PNRB 4M7JL 5I76B 1G43A 4DO6A 43C9A 4Z7WA 1GYUA 4P5MB 3DVIA 1BHGA 2QZ5A 2FE0A 2XG4B 3C5ZB 1AXTH 3MJ6A 5EWIH 4RSYA 1B2YA 4KKCD 4NKIL 3GSUB 1BAFL 4ZPVB 2FO1A 3ULVE 5IM7A 5KBDA 4OZ4B 2ZE5A 2VUKA 4DSYA 1E40A 4ZMTA 2LTQC 1IBKO 3L5JA 3K2IA 3CFNA 1NTKH 1WPCA 2AFNA 4ADIA 3MHHC 1I8AA 4RZKA 3E8UL 3WY1A 4MTXA 4ZUVB 4GKNA 3D3VE 4QXGH 1QHTA 1UM6L 2YSTA 3ZTJG 4CH3A 1Z5VA 5BXFA 2FJFB 3F84A 1KPRB 2RB8A 5AW8B 2OMYB 1MCPH 4KRMB 1JR9A 1UOWA 5E00B 5GTHZ 2FECL 3MUY1 3B2DC 3RUGF 1OCWL 3ZBHA 3H42L 5I82A 3X1GA 2PKDA 4PP1D 5BRQA 3U9UA 2H1LM 1PIGA 1JL8A 4MD0A 2BSTB 1CYWA 2OA9A 3H3KA 3TO2A 4BE6A 5D4QA 3SE8L 1JZDC 1QFPA 4XOEA 1SMDA 2EEXA 4U05A 5LBSA 1YLBB 2C9VA 1S0VA 5AW2B 2V37A 3NZHL 4GSDH 1MCRA 2XFGB 4KVCL 3T09A 1M2VA 2BVPB 2V2XA 2ZPKH 3OKOA 3JVGA 2AQPA 1XIWB 4JG1L 4P5TC 5CEZE 2F7PA 4QHNB 4L8SA 2Q1EA 3C6SA 4JCLA 4LF3B 2AVFA 3CQQA 4R90L 1HH6B 2VDNB 3OG6B 2V9QA 4MHHG 4PCTA 5TE4L 2DICA 1NH2D 2G3NA 2O5YH 1ZUQA 1A9BB 5C09A 1A64A 2KYIA 4YUEH 3GGWB 2VDNL 4DR1O 1QO3B 1PX4A 5AW0B 3UL4A 4LLQB 5T1KD 3ZS8C 3K58A 1JPFB 4NJAL 4P06A 3RKDD 4G3YH 1J0HA 1G0YR 3V0WH 4FTVA 1ERNA 4Y4FA 4XVTH 5FO7A 5FFLA 1SM3L 1RZFH 4W9IC 2ADFL 4GRWE 4UTCA 1KC5H 4F27A 2XAJA 4GW5B 2ZKWA 2OXGA 5JNYA 4XRCB 1EJ8A 4ZD3L 4Y1TA 5LP6C 4OLZH 4PJHE 3L7FA 3VXRA 1I7ZA 5JJEB 2VZ1A 4G82A 1CICB 2AW9A 4UF7C 5D7EA 5J6GA 1KJ2B 1VQ9V 3LYRA 4IIJA 1A0QH 2ZE8A 2VABA 2CBOA 4K7FB 3CXHF 5GSRB 2AK4D 1F3RB 2LLNA 3FOMA 5DRNA 1TZGL 3PP3K 4CSSA 2GJPA 5KMGB 3FTSA 4Z3HA 4CGUB 3M07A 4H8PA 4DO2A 5HGHB 1WISA 4G6FB 4XVJL 4ENZA 2BJML 4EAEA 1MG1A 5E23A 5L3CA 1OOAA 1VFUA 1UT9A 4MSWA 4RAVA 3OF6D 4NRZB 4M56A 1YDPA 4PJ6A 1CF8L 3UEQA 1IAMA 2CCWA 2K9PA 1MFBL 2MQGA 2OCJA 2QQKL 4JG1H 3EFFK 4KKBC 2Q0ZX 1JXGA 3CFEA 5DK0A 1D5IL 5G5DB 1AGFB 4FE9A 5GGRY 2IANB 4IRSC 3IJYB 4KH9A 3TN0D 4XNDA 2BWIA 2VZSA 2ZCLH 3VMPA 4IKLA 5TE4H 3QDAA 2HLAB 3VXNA 3ZMRA 1BPVA 5JCOC 3H2WA 1EUTA 1LEIB 3KPPB 4HC1H 4QE7A 2YFOA 3FCUB 3CE2A 2I07A 4X80L 5J13B 5JA8B 4U0QB 4XMWA 1MJ7H 3QO7A 2VH5L 1GW6A 2C1PA 4NXMB 1U3JA 3CZFA 3ARFA 3FUFA 4W6XB 4X8CA 5I17A 1OM9A 5DTFA 2MNUA 1KBKA 2ZSWA 3V5DB 2PCPA 2N01B 5C3IA 1K3EA 1TZHA 4M6OH 1K72A 2OMZB 4H1LG 3CLFH 4OIAA 3M7FB 4U1HB 3U1SL 2FD6L 3SGIA 3CJHB 3DTDA 4IBSA 4QHMA 1MH5A 2YC0A 2VQ4A 1DP0A 3H7BB 3RLSA 1RCYA 5C9JB 1U4EA 2F54E 2WZAA 3VQLA 4PTTA 5DD6A 2ZP9A 3NIDE 4QE9A 4LIQL 5C0RL 3HR5A 1XGYL 5JXAL 3WNIA 1YEDA 4U1SB 3LIZL 3NEOA 4TVPH 3RILA 5D1XE 4DNLA 1FNHA 1N7MH 2ZOLA 3WKQA 4FL4B 1AOZA 4Y1AE 3WTVA 5EIBD 3L3JA 2CO7A 2CE6A 4N2MA 5F7FA 1OO2A 2QGNA 3CH8A 4HIEA 2E75B 3IDXH 4NVPA 1RFDH 4YBLB 4DAGL 4JAVA 4AJYV 4OZGE 2VLJD 4O9HH 2Z8WC 1WAAF 4LDLB 1J0YA 5CF3A 1FFXA 5EUOB 2YXVA 4ABMA 1G9NC 1JS4A 1U30A 4CSTA 5BQDA 2JS5A 4G9DA 2IDTA 4JFXA 1E4HA 3TZVA 4L18A 4ELKA 2XBZA 4ETQB 2AJUL 2VQ1B 3HNVH 2VQEO 5GRYA 3ZE2F 2BSEA 1BX2A 3KDPB 5F3HB 4AMXA 4YHNB 2GTAA 2EKSB 1HP8A 2NT1A 2KSDA 2OMNA 3FQXA 3L3KB 1FCGA 1HNFA 4TN9A 3O8XC 4HUVA 3MJWA 2YA1A 1HNWO 3G6JF 4U31A 1NPNA 2F2HA 3NCYS 1Z5WA 5JIDA 1ED3B 1F02I 3D4ZA 4PJFA 1QBLL 1J0ZA 1BZ7B 4I87A 2XTJE 4LMQE 2DMCA 5HHNB 4ZAKB 4C83B 3R06A 1S3JA 2R7EB 4I9WA 3RL2A 4DVBA 1GAFL 3LN5A 3VG9C 1RURL 1GJIA 1XGYH 5C0FA 3RWHB 5JXAH 3OGOE 3HE6B 4Y4HD 4XPTH 3O4LD 1RZKH 3BOVA 3CVCA 5IMMB 2VLKB 1FFPA 4UT6L 3UJTL 4L4VA 5IESL 1A3QA 1U8OB 2ZDIA 2IDQA 4U2ZA 2X1PA 2J8UA 4TLTA 4ZT1A 4NNPL 4QRQA 4JANA 1XGUA 5HHPB 4D94A 3TO4C 3CP1A 3BLKA 1A3LL 5LQBH 4X83A 2DH2A 4L29B 4MJIE 5HY9A 4A67A 4EOWH 3D18A 4CC0A 4OZFA 1ML0A 4GT7A 1EAPB 1NC4D 3MDSA 5DMJB 5I5JA 1JPGA 4F92B 5HVFB 2H6PB 4GIAA 4E9WA 3MUJA 4EKWA 1DO6A 4PJ8C 1YN6B 4X7DC 4E5XG 3HNVL 3HS0C 3QUYD 1YJWV 2A3TA 4K23L 4KZCA 4PP2B 1XX9C 2C3VB 2VLLA 3IBOA 4M6MH 1FGVH 4M61B 3SIKA 2PO6A 1CBVH 3IMBA 5HJ3A 3H85A 1P5UC 2R4RL 3HE7A 3OB0K 1AQKH 5F1IA 3ATDA 4ODSL 4MAYB 4A2MA 3KGUA 2HTKC 2GYSA 3TXAA 1L6ZA 1AS7A 3H1KH 2SEBA 4BIKA 1U8JA 3TEWA 2R39A 1BCCH 4NB5A 4BCZA 4ZTEA 3S96B 2QTEA 3UGXA 3VXME 1UPGA 4JFED 3QYCA 5T5FA 1V05A 3PDOB 4JI4O 1XH1A 3NESA 3LKPB 3SO5A 1IGMH 1T1WA 2N0MA 2ZNWA 4MAUH 3TWCL 3OKEB 4UDUB 3ZX6A 5FYJU 5I18H 1KP2A 2X6UA 2Y1ZA 4HXAL 2DM2A 4XN7A 1H6FA 3E22A 4Q8BA 4TV9B 4X7TB 3CN4A 1QSEA 2DI8A 4TL4A 3UJTH 3SD2A 1ACYH 4GQRA 5L2JB 4IBZA 1F51A 2A9DA 3M1CA 1K8AW 2GFBA 1M7DB 4PN6A 3UJIH 2R1XB 1O9GA 4YJ3B 1H0DB 3DETC 4G8FB 4OXSA 1M71A 4WY7L 4IGBC 3IN0A 4LLUB 4B7IA 3UBGA 5T3XL 3JWDC 2VUOA 1PCXA 3EH1A 4LZKA 4E36A 4U6VH 2Z8VC 3K6SA 1KN2H 4J3XA 3W56A 3C87A 5KS9A 4LF9B 5BZZA 3SGDH 4KDVA 4YE0A 4MVOA 4NIYE 4WF7A 4NXMO 2EE9A 4JI2B 2E74B 2PLTA 2F7OA 4KO6A 3AG2C 3NJNA 3BGFB 2DMXA 3BC9A 2HMIC 1KN2L 2JKSA 2X2JA 4IBQA 4KK6C 1XCTA 1FFRA 1PG7H 3ESVF 1M05A 5EC2A 1DHKA 5K5YA 1A4KB 1NAMH 1E2WA 3L72H 4TXVB 5IY5C 3FT9A 4PY7B 1YMMD 3FFDA 3GC3A 4UT9H 1ZVSA 1IKFL 4P5MA 5CEXB 5C0AD 3VTTA 1JCHA 5LGHH 4F57L 2WO4A 2L7JA 4JL2A 4HZ3A 5C0DB 5C9KA 2WLNA 2OL3H 2ESVA 1Q3EA 3P0VL 4TUKL 2JMRA 2P5WB 3T3MF 4NS0A 4JE4B 1YNKL 1ZTXH 2C9QA 5I8CA 2VDRL 1BD2A 3CZEA 2H0EA 4TUJA 2IJHA 1QLFA 3EJZD 1WITA 5E8NB 5ADOL 2N3JA 3KCPB 4A6YB 1NEPA 4NQCD 3AQYA 2CXKA 1UB5A 3A4DA 4XO9A 1GKFA 4GKNB 3U30B 1OAJA 3R4DA 4UI2A 1HSBA 1D5MA 3UDWC 4Z95H 3L3IB 3R65A 5BS0B 5LL6Y 4PS7A 5TE6H 3VWJA 4R2GC 3ZGIA 1EN6A 3L70H 2NX5D 3PGCA 1I3VA 1SDAB 3MRQB 5DJAB 3HE7C 1D7DA 1H2KA 3L3HA 5J1AA 1OWRM 2OFQA 4JCMA 1S6NA 3ASOC 4R4BB 2B4CH 4D2NA 4HS8H 3ZIAG 5TD4A 1YYML 1UA7A 5CJ8A 3HE6A 4A7GF 4KJQC 3ZE1B 5IBLC 1WGVA 4PJ8A 5GGVY 5JLZA 4J2XA 1Q0EA 2CLRB 4KK9C 3QTCA 4KXAA 4N3UA 4LSQL 3PWNB 3GMLA 1XF4B 4IKKA 5DQ9B 5LCVL 5L0QC 3GBML 1YSOA 2PO6D 4QRRB 1BFVH 2HPOA 1I8LA 3SCMB 3U2SA 3SJAC 3GMNA 2FECI 5B3SB 3R0MA 3M8OL 4ZAKC 2B0SL 5ICYA 2F8XC 2LFEA 1BVOA 1JPST 4YHZL 5K9JL 1M1SA 3MC0A 4JM4L 3GI8H 4F7CA 1LEKA 3L9RA 4IBYA 5IQ7L 4IDJL 2P8MA 3VXUD 4I8DA 5LNDA 5DD5H 1N8ZB 4KVNL 2J3SA 4OCYL 2TSBA 1AG6A 3D8CA 2HRPL 2IPUK 2WUCL 4JI0O 4ZHQA 1M7XA 2VZOA 4R0LA 3ZE0E 4DV7B 2H4EA 5HI3C 5L8LB 4AZUA 5I5RA 5JPNB 4F37K 1WFNA 1U8JB 4FERA 3F2LA 5BUAA 4UT7H 1J87A 5ANME 4F58L 4N0RA 4P23D 4UYPA 5SV3A 3T2NL 3BDYH 3SKJH 3V6ZB 4NWTH 4LWSB 1M7UA 3HPJB 1G7IA 5KBLA 3UO2A 1U41A 4MA8L 4N85A 3IGFA 1E4KA 5F7NC 3PHSA 1F1GA 4AUJA 4DR7B 2H94A 2AQRA 3UYRL 5BO1H 5ECGA 4EUPH 1PX8A 1UXWA 3MJ8B 1FPTH 3E7JA 3PE9A 4IRSD 4UQBA 4P4KD 1MFCL 3A6CL 2PP8A 2BSTA 4JK0D 3FQWB 4LOUD 2FJHA 3D08A 3DI3B 3CSFA 3F5TA 3BH8B 3KPPA 4DGIH 3CUPB 5LXTB 3NN8A 1DJHA 2L8AA 5DMKA 3TPUB 5JXEC 4TVPE 4M3KB 1MFCH 4QRFA 2Y69B 3RHWF 1S5JA 1NC4B 15C8L 1EMTH 2F08A 5KUKA 3H9HA 5EU7E 3UM7A 2PR9A 3PJSB 3UTTB 4PW4A 2NY3C 3E6FA 4G80A 3HG3A 3UX9B 2BHFA 4FMVA 4QKXB 5I0WA 3VFNA 3BPOB 1KIQA 1BOYA 1S77D 1NMAH 2QMJA 3S4SA 3WGVB 1E28A 1U6AL 1A8ZA 5J8OA 3R7QA 3HLKA 3HR5B 2LW3A 1SMOA 2NLJA 4U1SA 4ZMYA 1A6PA 4ZUUA 2RMNA 5H5NA 3QCVH 4PB9L 3GJFH 4NO5A 3WS6C 1UXSB 1NGZB 3I9GH 2W60B 1A1OA 3JUYA 2BM3A 2QMKA 3IJ7A 4K0OA 4G1MA 1SC5B 1CD9B 2AEOA 3AFLA 2QL1A 5BO1L 3UYRH 1K8IA 4Y5YA 4IIJB 2V8LA 3FN9A 5AG9A 5I0DA 1F4WL 5JIQA 5DN6G 2XTJB 4PRAB 3NSYA 5EZJA 4IYHA 3BEHA 1WZMA 5C7ZA 1UTDA 3A6CH 3VA6A 1D5MB 2Y6SC 4DK0A 3TJTA 1NCCL 1OVZA 1YMHA 2W07A 3D06A 5HYSB 3LN9A 3CGTA 3THOA 2F7RA 2I85A 3CG8A 3CFCH 4LRNH 4TQEL 5LGNA 1YJNV 1HDMA 4ENED 1NCTA 2H26A 4D9LL 3BWAA 1WA1X 4FQQA 2CDFA 2DWXA 1K9TA 3GMPA 3GSOA 4XCCL 3GMRA 1AZNA 1KB5L 2J56A 1Q1JL 1KN4L 3C60D 3CXDL 5C0GB 2BFVL 1JBJA 3AY2A 3D5OF 1XMOB 2WOBA 3VQMA 5B7MA 3FQNB 2ITDB 2VN6A 1HHGA 4HBQA 3CSYB 3SR2C 1U6AH 3FUMA 1LO3H 3BVDB 3SY0A 1XB6A 3DGEA 2G2NA 4J80A 3WMSA 1E2VA 2YAPA 2LQRA 3SCMA 1G7JA 3LXAA 1ZSDB 4XCYB 3F7LA 5D1ZB 1UXMA 1A25A 3ZHDA 3OD4A 1NJ9A 3QIUC 4LCUC 4PRDA 3LNNA 4QEGA 4B9PA 4URKA 4WFGE 3V4VH 4AX3A 4F8OA 4GRMB 4KV5F 1YNLL 1XGUB 4XNUL 2AK4B 2WKOF 1RK1A 3LIZA 4P23A 2DZEA 2K3TA 4R26L 4XNYH 4XODA 5DD6B 3U4EB 1CJYA 3K0YA 5C08E 4F7CB 2AZUA 2YUAA 1ZA6A 1J1OL 3DX6B 4AH2B 3WAJA 3JVGC 4G6FD 4BFGA 2R56L 5F1SA 2EE2A 4NBYB 1BYNA 5DRXA 5LNGA 2X9WA 1Q9WA 3ZHSA 2GK0B 5F7WC 5IB4B 4HIEB 1WFIA 2GJ6B 1XZWA 4FNLH 5DMYA 3EHBB 1C8QA 4QRTB 4QCIB 3IS1X 2J1WA 4PJIB 1US6A 5GSVA 3UPRA 2JGDB 5DEGA 4WWPA 4U6HA 4I0KA 4TKWA 2X89A 1SOSA 3EJCA 2ZXGA 2IANE 2YARA 3C8DA 1VEWA 2KLRA 3HTLX 3FO0L 3MV9D 5DEJA 2B4CC 5EBMB 3GJEA 2FB4H 2OCFD 1U8KA 2C3XA 3NCJH 5HYQA 1JI1A 4JPQA 1T1ZB 1Z0MA 2WY3B 4KOCA 1NFKA 1HWGB 1IKNA 4DR3B 3WFVA 4ZUWB 3U7YL 5EOQL 5AAMC 3GK8H 3GEFA 3QUXD 2P3YA 4RISL 4ZMZA 1JV5A 4BZ2L 4BFJA 4O4JA 4Y5YC 2IIJA 1NCDH 3NQKA 5A16B 3FT1A 1Y18B 5DLML 4DVRL 2RQ6A 3UG4A 1DQVA 1DSWA 2W59A 4PIBA 2B1AL 5I1DA 3B9EA 4DV1B 4YFDB 4NHCL 1AO7B 3ABMC 2ZIDA 4WHTA 2X38A 4YJ3A 2F1EA 1L0QA 1R3LC 2CE4A 1FNGB 4TTDD 5CCJA 1NCNA 4YNYA 4DRXA 2WXLA 4MMXC 4N25A 3P0YH 5LXGH 2G2RB 4LBEC 4X4XA 2OYQA 3FMGH 4KI5D 3LKQB 2P52A 1UEMA 1NCIA 4DV7O 1TQUA 1NBMG 3IRZA 4LPUA 3SQBB 3K6SB 2YSUB 5KLVH 2VL5B 4X5RA 3VXTA 3SDAA 2Z7UA 1WCBA 3JV6B 1QX1A 1YY9D 3AT8A 1DN0B 2G3MA 4O51A 4BH7A 1USQA 2NY4C 1LP9F 4LSDA 1Q82W 1XZ0A 2IH9A 2YEZA 4L1TA 3GSVA 1I8KA 4UQIM 2HT2C 1TO4A 4IMLB 3MRNA 4TLSA 3UYPB 4KGJA 3ML8A 3T71A 2DKUA 1HFUA 1HXMA 1MJ8L 1Q9OB 4LEBA 4N86A 2HJDA 2EDNA 1HC1A 1SEQH 1EZUA 4DKEL 1GYCA 4PBXA 3EBHA 2EVIA 4HOMA 3WB2A 5IW1A 2QV4A 3UZQA 3VFRA 1ORSB 5DO2D 3W11C 1VKXA 3IETA 4E42B 1QLFB 4A7SA 5T1JA 1CLOH 4XPHH 4W9LC 2I7SA 1ULVA 2EC8A 1IE4A 3MXWL 3MOAL 3VA2C 1SS3A 2NXZC 5FKPA 1SQMA 3FFOA 4QXWA 2GB2A 4X0KB 3HS9A 5GHWH 2Q3ZA 1H2MA 1CK0H 2DQHL 2J12B 3L16A 3O4LB 3QJHB 2AQ2A 2MOGA 3G5VB 4CN6A 4NQDB 4N2LA 1NINA 4HK0B 4QO1A 3FDWA 3ASWA 2UU9O 2Y7QB 3WFBL 4B9YA 1J5IA 2GJZB 4O2BA 4JM2F 3FH8A 5I16B 2IF7A 4WLCA 2IH1A 2J43A 3GHBH 4OLVH 4QF1B 1UACH 3KLLA 4FK5C 1ZHKA 2P7TB 5CCKH 3HNSL 3CPLB 4YBQC 3S98A 5M94B 3E8HA 4FQHA 3Q6FA 5FUOH 4LCIH 2X53A 3S2AA 3OGCA 2DQ6A 5EU6D 3UAJD 1G6RH 5C0BA 2WXOA 2HKHH 2JIXD 4LSPH 4O2AA 1XEDA 5HI5D 2CK0L 1UM4H 2ZUQC 3PAUA 3F5WA 4IHOB 1F11A 1X5HA 1KBGL 2XXFA 2YUZA 3FULA 5I8KL 4ICGA 1AZCA 1RFYA 2OJEA 2VXSH 4DR2B 1NEZB 4F6RB 4MMXB 2GDSA 2HG0A 2JI3A 1J5CA 1XB3A 4FEMA 2CK0H 4O4IA 4KFMA 3FQ2A 3MROB 3CFJB 4KOBA 2BNQA 1ADQL 3RVXC 4IU3B 4PJAF 2ZJSL 2D03L 2YEVB 3K4ZA 3APCA 3WS3B 3LKNB 3MV9A 3Q48A 4YGVB 1Q9WB 4WWOA 5I1GL 4A7GA 1VERA 2BW4A 3HPLA 1JXKA 1P4LB 3B40A 3FQUB 1GYWA 3IFNL 3DGCR 5JO5A 4ZNEA 3T4AA 1TJMA 4HCIA 3OTFA 1B4JH 4XT1C 3G4SV 4MMYA 4HA1A 1Q4NX 1FBIL 4G6AD 4MB5A 5CBFA 4GP8B 4PWKA 3PQYB 1WCQA 4XBPB 1CR9H 5T33L 1F97A 4NP9A 3CFMA 4U1MB 5J2UB 5JOFB 4HISA 4N2AA 5AZEH 4ZODA 3EH2A 4LWSA 2NZ9D 1HDJA 1S9XB 3MSPA 4YZFE 4WW2F 4XO8A 2P45B 1S7RA 1A1MB 4RAIA 3BIKB 5KHHA 3VRLE 1NVPB 4M6OL 3OPZL 1SRDA 2MHAB 2I9LB 2Y5TA 2YQ3A 4NPYA 4G7QB 4Y16A 5FXCH 4Z0XA 2VRAA 3NP4A 3UGEA 4M6NH 1TFPA 2B1IA 4NKDB 4JI5B 3IAQA 2UXCO 1GJWA 1DJIA 2OX5B 5B8CC 1NTDA 5I6MA 3SSGA 1ZLWH 4PVMA 1CLCA 3CU1A 1QZNA 3WDIA 3Q01A 1HZKA 4J39A 4EXKA 1KTBA 3ROLA 4WFBV 1XAKA 3CIAA 2IGFL 3NTCH 3BP5B 1YJDH 3HZYA 1X7QB 4LOVA 1UYWH 4Z7QB 4XE0A 5K59F 1MRFL 5C2BL 2CMRL 3LZPA 4HJUA 4YFLF 2R0WL 4M48H 5AB0A 3EO0A 3AXLA 4ZPTB 2MCG1 1EZSA 1B4JL 5F7KC 5GRXG 4HEPA 1NUDA 4LIQH 3QW9A 4P46B 1JHTB 4M6ML 1AP2A 5C0RH 5I1IH 2GJ6D 2UVFA 1PG7W 2J72A 4OX9O 1AGDB 3ARGD 2A9AA 2VGLM 4ZDHA 5KJ4A 3P3SA 5DEFA 3RU8L 3W9DB 2WK2A 1N8ZA 4JRXD 4CBCA 1KDIA 5EU3A 3ABLB 1AFVH 1F4YH 4OFQA 1A4JA 3HPLC 3EFFB 5T1KB 4CKQA 3RTQA 1XCQA 3DBSA 1NCBL 3MLTA 1K8DA 1UEYA 4DIXA 4Q6IB 4ADGA 2O6EA 5JWPA 5F7LB 1I08A 2WLYA 3CLEL 3MOQA 3FT3B 1E1QG 4IK6A 1BSMA 1TETL 1WBXB 3CCRV 4BK5A 1KCSL 1IIKA 4OM0H 2OKMA 5CN1A 5BUPA 3O3AB 2JIXA 4X6BA 1PD0A 3CLEH 2QWQB 3TJPA 3X12B 2YMXL 4GKKO 3A4FA 3ZE2E 5TDPA 4XC1L 5IB1A 4YDKH 4XN4A 1WH0A 5HI4D 1KXQA 1QBLH 3TETA 4LFAO 2EVHA 3QZPA 4PJBF 5FYKH 2FCBA 4IRZH 5DJ8B 2DMGA 1N64L 3W57A 4Y4KA 5GS0H 4K7PX 1S4IA 3QAQA 1INQB 4TT3G 2RNBA 1HHGB 3AS1A 3GIZL 4YDLC 2JKWA 4C54A 3F5WB 4TQFA 4P2QB 3ECWA 4MNQB 3RIAF 1IL1B 4BFEA 1BG1A 2FAUA 1R6TA 4LVOB 3RPKA 4AGMA 3D48R 2WMPA 3LS4L 4D8PB 5D5PA 5KBKA 1NFIA 1NSNH 4U4BA 1X5GA 4KKRA 1P9MC 1IM9A 3NH7L 3LVTA 5IHZB 4FLQA 3SGKA 4OB5L 3LRSA 1L6XA 2QM4A 5JOEA 3HJ0A 4P23B 3QH3A 1EUUA 2ZKXA 5LHGA 3RUGB 1AI6A 3Q2NA 2RFXB 4DR5B 2HLFD 5HGBB 5L3FA 1PS3A 1TCRA 4WTZA 1AAJA 4YXHL 4KRPC 3W7UA 1DQDL 2QPSA 3HHSB 2X4OA 2A0LC 2Y9RT 1ES0A 3NCWA 3Q2WA 1AOHA 2EDQA 5DURB 2ORBL 4DV0O 4FQLH 3N04A 1LGVA 5AUMA 3TT3H 4UWQB 4UCUA 1HIML 4UM9D 2Z0BA 3GLEA 2D3LA 1TEGA 2WVTA 5C0JA 4OTXL 1TVHB 2PYEA 4AXWB 4BIZA 1HZHL 3NFSH 5E1QA 3FAWA 3MZGB 2A6IA 1OQXA 3ZSSA 2VQFO 1GH7A 1UZ6E 4J3OG 5ITZB 1A1NA 2WYTA 5IK3B 3D07A 3MREB 3OKDA 3T8XA 2DV6A 5EUKB 2FSDA 2YK1H 2Y5TB 3K5RA 2KZ1B 4HAMA 2OL3L 3O81A 3QQ9C 1GIGL 1MFDL 4ICXA 1YDXA 4RBPK 4UINL 5ITBH 2CHXA 3F7KA 4RSVA 3L4UA 4PJ9D 5CAYB 4A38A 1SVCP 2D2CC 3NA9L 4GKKB 2HHHO 2KKWA 3SE9H 3A0OA 1MSPA 3L5XH 1FIEA 2Q20A 1BLIA 3IT8D 3AADB 5C0GA 4H8WL 1YEIL 4LSVL 2DQ3A 2X4PB 2CIIA 5L9DH 3FF8A 3KD4A 4JRYB 5IBTH 5JPMC 1R3KC 2V33A 3JWOC 2Y1AA 3G6AA 4XVSH 3DX8A 5ALBL 1JVKA 4CU8A 3AITA 3E89A 3BQUA 5F70A 3HA0A 3UIYA 3TA3D 1TUBB 4N26A 1S5HC 1WPXA 4GAFB 4HCRH 2IJKA 3GGWA 2FL5A 1WA8B 2EH8H 3AUVA 3O6MH 4FG0A 4QD2E 4F7PB 4I5SA 1W8NA 2CO6A 1G6RB 4JV5B 2UWEB 4KUCF 4JF3A 4TVPD 3BVNA 6PAZA 3SYAA 1B9KA 1VSCA 3TH4T 3WTTA 2GSGA 5F93C 1JYXA 3PWLB 3MR9B 4WW2C 2DQ0A 2WAQA 3GRWL 4MKTA 3QJFA 1J8HD 4UQ3B 1I5YA 5D7LA 1TUEB 1HWWA 3IFOA 3MGOA 1X59A 3I75A 4O4LB 3BAEH 2F5BL 4GAGH 5CLZA 1FVCA 5JQIB 2VYRE 2AKRB 3V0DA 5DJZB 1AGEB 5GSVB 3ISYA 2D9QB 2DQIL 4AV0A 4TRPH 5IOKA 1SETA 2PWHA 3K6DA 4FZEH 1D5NA 5BUGA 2KI6A 3VI4A 3RP1A 5FECB 3QFJA 5E2TL 5L9DL 1RMFH 4MXQD 3Q9QA 4MJJA 1KWGA 2LABA 3AG7A 4N8PA 3U10A 2Y07H 1ZVNA 3UTSB 2IADB 5EFIA 1KUMA 4HQQH 1DEEB 5HDQH 1RIUL 1E9OB 2HFEB 3O0RL 4GRLC 2N7BA 5AALA 3ZIMA 3HB3C 3SB3A 4I77H 1N6QH 2BY2A 3OBAA 2IH1B 4DR1B 5FOJA 4UBDC 4WV1B 3VWJC 1YO4A 2WLMA 3BHBA 5EZLB 2EDHA 1VEMA 2HHHB 3CZFB 4YEEA 1SY6A 3BKML 3LJ3A 3B7UX 2G30A 5KVDL 3JTTB 4Q6YA 4DN4L 5D7KD 3WKYA 2UXVA 4G6KH 1SF3A 2EAEA 5SWZE 3KGTA 4NQCE 4N2FA 3WFDH 1SJMA 2AXFB 2YLHA 3EBGA 5D1QE 3ABMB 1Q8IA 5SWSE 3A6BH 5A40E 4XCNB 4A6YH 5H6RA 1CFVL 3LRMA 1XZ0B 1I1FB 3LXUX 4XB7A 4OI7A 2GI0A 3N06B 1IVTA 4HUXA 3T6WA 4AGNA 4JDVB 3QPXH 3IPEA 4X62O 5K9OB 3MV9B 5FA4A 3SDCB 5H37A 1G4YB 4LLWA 3WEMA 4RQFA 1JN6B 4U3JB 3WJMA 5HVGB 4DTGL 1AGCA 3QHFL 2P5EB 4PRIB 4ERSL 3TWYA 4JFEB 4U7OA 1IBHA 3IXAB 4MWFB 5TTRA 2BSKA 3WY4A 4ACTA 4CS3A 1S3KH 4ANUA 3SBWA 4J4PC 1NJIW 3DPDA 2PCXA 5F7DA 4DTGH 1L3NA 2QVMA 4W81A 4TNVF 4KROD 4AE1A 4R97C 1XDCA 3BPZA 3BKCH 3JVFC 3SPJA 3WIIL 5EO0B 3OAZH 4XWGH 1IB5A 4CVZA 5AVVB 5JHDD 2NR6D 4Z77A 2KZBA 1KGCD 1DBBL 4I1RA 4IOFC 1TQBC 4J1UA 3B6SA 1J10A 3WEOA 4NHUA 1SHSA 2HJKA 1HEZA 4GQQA 4K94C 3WDHA 2HP4A 1A6WL 5JXEA 3JSLA 5KBPA 5JOPE 2ZOTA 5HHNA 3LNDA 4APQC 3VQXA 5E79Z 1Z5LB 2QSAA 1VCAA 1K3IA 1ZT4B 2BWDA 4UIKH 4UQDA 3RWHA 2MTPA 1KQSU 1VGEL 4KTDH 2ISDA 3T2PA 2FSEB 4BCYA 5FIEA 3FSVA 1TUBA 4XWOD 1L6PA 1FL3A 4XNZB 3CFQA 4R4ND 4ZFGL 1A7RH 2AF2A 4EBQH 3AY4C 3G71V 3O8XD 1MN4A 4NO0B 1BFTA 1PD1A 2LT9A 1OP5K 4BHUI 1NWPA 5A2BA 5GJTH 1SLWA 1SY6L 1AZBA 5LWYH 2KPWA 2X4UA 1J05B 4N9GB 4BJLA 4X66B 1JHTA 4LF9O 4XBGA 1WNSA 3RGVC 2VKXA 1MY7A 2XKNA 2Q8AL 3LQMA 4XNUH 3KYAA 4OU3A 5IT2H 1LO0L 3KLQA 4LLDA 3ZY7A 4GY4A 1P84K 3CFCL 3A8TA 4OUUB 4TQEH 5I28A 4ZJ9A 3GQFA 3TO4A 1C5BH 2AKRA 4PQXA 5K59E 1NCJA 1P4RA 4NXNO 2JI1A 2H2PC 3LSSA 2DQCH 4BH8A 4X50A 2EYRB 1ZWIC 4GKOA 3T4YA 3ZMVA 1BCIA 5I1AB 1CBJA 5A7BA 5C0EB 3ZZ1A 2J44A 2GBAA 1JJ2U 3VSQA 1X3DA 4GBXD 2JIXB 5F44A 1B9ZA 1HHHB 4J3WA 1VEPA 4D7SA 1QFWI 1LO5A 3E22B 5IWAO 3VYNA 1BGXH 3DGDA 2W0KA 4KKLC 4ORGA 3QUGA 2NN4A 1NBCA 2Q6WA 4LXFA 1XOUA 2F4VB 4YK4C 2JXMB 2H47C 2MSPA 4ABWA 2BSCA 1NKGA 1EHLL 3JWDH 4XNQB 2ED9A 1IGIH 4G43B 2F8OA 1M1KW 1JTOA 2EDYA 2RGSA 3P9LA 3PPSA 1JWSB 5F9OL 4ZXBA 1LO3L 1L0PA 1NAMA 3DWTA 3NG5A 1A2YB 3BZEB 2R29L 3S35X 3DTXB 2G38A 4CJ1A 5JMRA 3RWCB 2DEYX 4NKIH 8CGTA 2LW1A 1QHOA 1TLMA 4PJ5A 2RCSH 3VXUB 3C12A 3KBHE 2WQVA 3U1QA 1XD1A 1R73A 4JGSA 4IK7A 1FFQA 3N55A 5MEOA 1Q81W 1T0OA 3L75H 2IH3A 3FD9A 1RSOB 1JERA 4RMSA 1GM9A 2Z6FA 3VTMA 1OTUD 1SZTA 4OM1L 4EQ3A 2H0JA 3P3RA 1KBHA 1F1DA 2XI9A 1CFTB 3EIFA 3TCLA 4C59B 4QOKA 3M1OA 4TVUA 2APFA 4DKFH 2RFXA 1Y0LA 4NKQB 4LF8B 2QGDA 5CB4A 4XO4A 5DEFB 5DR5H 1ZVHA 4ILDA 1J5DA 4OVUA 3GUTB 2P5WA 5A2AA 4XB3A 1MZFA 3DJ9A 2QVKA 1N8OE 3BLPX 3VX0A 2MOVA 4OLZL 1BD2B 2A99A 1JUFA 1SXBA 1HXYA 1HTYA 5AUMB 3ZTEA 2XXCB 5GS0C 4UTBA 3UTSD 2YPVA 4XMLH 5KJRH 4P4KB 1FL6A 5FWQA 4FXLA 4MCZB 5I74C 1XH2A 3NRPA 2QHRH 3JWDL 3HE6D 1NC2D 4R2GD 3LPOA 5JHAA 1XGZA 5IROC 5CJQL 4KZEH 1UACL 3OEEG 3L4CA 2FATL 3D33A 4KKAD 3BYYA 3CZUB 4OZIB 1A6TA 4NQEE 4PCKA 5EEXA 2FGZA 1F00I 3N41B 1QUPA 2M8XA 2AEPL 1R6VA 2EKJA 2CTRA 5LMUO 5GGRA 1OAKL 4UZGA 2F23A 3FQYA 4DV3O 4JLRA 1A9VA 4JPRA 3B4NA 1CE6B 2BNUB 4NT6B 1X9UA 4F93B 4FLVA 1H8SA 2LR4A 5A3IC 2FLMA 2KG7B 1NM9A 3D2UB 1VFOA 2GK2A 1BAGA 5AW7B 3SKNA 43CAB 2A6KB 5DUPH 4OCLC 1KC5L 5I75C 2DN7A 1AXSA 3QRGL 1NDMA 2IJIA 4MNGA 1H6UA 4CDHA 5ES4B 1D5IH 3ZHKA 4YSEA 1MEXL 3IJ8A 3RURA 3KPSD 1E43A 3O3DA 4Y2DD 1H3VA 1S78D 5LGUA 2Z35B 1OPGL 5DVMA 1PMYA 2A9MH 3HZVA 1WICA 4PV8B 3MJ7B 2LHAA 3VXQB 2WIIB 4XBGB 3D69A 1GZQB 3K8KA 4BK5C 1QI5A 4Z2WA 3L4VA 3OJMB 5E4EB 3PHQA 3D0LA 3CFBB 4H1LA 2XG5B 1QVOB 3VAEA 3QYMA 5GHWL 4ZHQB 4HMEA 5DJYB 4P2OC 4XO5A 3M6DA 2H32B 1JWMA 1WV7T 3MO1B 4N5EC 1ONQB 2J1KA 3I50L 5A2LH 1SN0A 5IUCA 1MCLA 2XQBH 2N04A 3RIFF 2JRIA 1EDHA 1TOXA 1S7XA 2ZX6A 2F5AH 2VDKH 3MOBH 4GX5A 3W7WA 4AXWA 4B3SO 5CBGA 2ZKYA 1LO2H 4KTYA 4NZJA 4W6YB 1WJ3A 1YF2A 3WN6A 3BD4A 2TSAA 5BV7B 1HZLA 2O5YL 1ZDQA 3JAWA 4ECNA 5HYJD 4YL4A 1KCKA 2Z7ZA 4PGCA 1PX3A 3BA9A 1BZ8A 4O9HL 4ZRGA 3ARYA 3T77A 4AQZA 3I85A 5C7XH 4XN1A 5IEKA 3UTZB 2D9CA 3N42B 3P77B 4DV2O 1TTFA 4OI8A 3FB8C 1VAHA 5E9DE 1RUMH 2WLIB 2ZX5A 2XVBA 4JN1L 4NZDA 4PJ7F 3WN5C 5KVDE 3FQWA 2EIJC 1JD7A 1HILB 1SDDB 1S5LZ 1VRSA 3CQPA 3KW8A 4OZGA 5AOJA 3S36L 3UZVB 1OZTG 3WJLC 1MCDA 1PG7X 4KI5F 4K8ZA 2OTUB 1N7ML 4F3FA 4G9FA 2MEJB 4WJ5A 2PWFA 2F53A 4K8RH 4N28A 3IK2A 5J6SA 1B0GA 4GP5B 5C0AB 1BREA 3V7AG 5TGBA 2Y24A 4PA3A 3B34A 4IMKA 5KHIA 1GR7A 5GGUA 1I82A 2HKOA 4EN3B 4QLRA 4AVHA 4PJAE 5DURD 1QWNA 1LDPH 1RZ7H 3O9OA 2OYMA 3HZ3A 5EB9A 4IBUA 1TJGL 4NQQA 1N3NB 1UA6H 3HI1A 3V2AR 4MJ5A 4KRLB 4C56A 2KUTA 4E9YA 4K3DL 1LQBC 1D7FA 5E5LA 4X7EC 1BXVA 2VMFA 4HUXB 1URIA 1GSKA 4YSTA 4KV5E 4IGGA 3LPPA 5C0CD 1J8RA 5FM8A 4AENB 3IFPB 3WMPA 2EDWA 2P5EA 4PRIA 1U0QA 3H9YA 4MJ6B 1LILA 1QHQA 5C3TA 5F1NB 5E8DH 1AR1B 1KXQE 1IFRA 5EC1A 1AQKL 1OP9A 2UXDB 3QDMD 2BTOA 1KF9B 3EJYC 4XCFL 5F6IC 4DOHB 4HOZA 3BIAX 2PN5A 5K1NA 4UV4H 2CJUH 2CO1A 1ITCA 3U9UB 5IVNA 2GTQA 3T0EE 5HGAA 3H9VA 5TK4A 3UO8B 5B1BC 2H26B 1O6TA 3PF2A 4JYAB 1XGTB 4FQQB 3T3MB 3ZKXC 2C2AA 3B6SB 3U25A 2IADA 3FN3A 5JW5B 4MAUL 3TWCH 4FQ1H 4MQSB 3ULVC 3CBRA 3F5WC 5ANMB 5E2VL 4L3FA 5BV7C 3EO1B 3EYQC 2RTTA 4P3DB 4UZUA 3TN0C 5SWZA 4PV1B 1F18A 1IAIH 3GWKC 1DLHA 1TZAA 4TUUA 2YPLD 2A6KA 4PJDF 4N0CC 1KELH 3QAZB 3FB7C 3MYJB 5B1NA 2B3IA 4J42A 2Y23A 2ZWNA 3QXAA 1MABG 3MLXH 4OGAD 5HGDB 4MTGA 2ZXQA 4NYLA 1E6OH 4MDRA 3M7MX 4EEQA 1TNNA 4HJEA 3O3DB 3O2VL 4UCFA 1D6VL 5GONA 3JCZA 1ROWA 1T3FB 2NY6B 3LSOB 1ZSDA 3KR3H 5IZ7A 2YA2A 1J9CT 5SWSB 2VDOB 5AVZB 5KVEH 5JJJB 3BW9B 3FQ1A 4FQXA 1SFDA 4NBZB 2HKAA 4RESB 3NJKA 1BQHA 3LQAH 4HIJB 4H13B 1A5FL 3D3VD 4JL1A 3S9DB 4GG8A 3VTAA 3T3ME 2F1BA 1NSNL 4QRRE 4DKDC 3S3DB 3GSWB 1AB3A 1SGKA 3F7VB 3S6CA 5DJYA 1ZGLA 2ZX7A 1KIUB 2N59A 4DOHE 4J6RH 2OAAA 3RDJA 1JWMB 4PGJA 3ESOA 1AD9A 1Y1DA 2C3WA 4Q9BA 5F97E 4I3SH 1I8MB 5KMGA 5IQ9B 1U9KA 2FIKA 1CTNA 2XN9E 4QRTA 3T1FB 3PQYE 3BVXA 2ZKHL 1FV1A 3QBTB 1M7IB 4QRUB 4NERA 5E2VH 3JV4B 4X98B 1BF2A 4KU1A 1FIGL 4IKJA 4LKXB 5EF1A 2E5LB 2JF1A 2VISA 4MCYA 1JFFB 4MTMA 1DUYA 5KANG 4PGCB 1VGKB 3HKCA 3US9A 4E41B 5C0EA 2QTOA 3SE4C 1BHAA 1F42A 2OJZH 3FFQA 4PD4J 2PUQT 1FIGH 2H2SC 4L8SC 4EJ1C 4EOWL 5A6MA 1IURA 2NY5L 2CJ3A 4PJEB 1UA3A 2GV9A 4B3RB 5LAXA 1BQZA 2ZQMA 3NZ8A 4IJ3C 4ZOLA 1NTZH 2BIPA 2GTWB 2OMZA 3ZKXB 3QQ4B 2X88A 4Y2DB 3EG9B 5FF6B 1LUVA 5T3XH 3BVOA 1TQSA 5IYCO 1FP5A 5TGBB 5K9QG 1SQQH 2MQCA 3DOHA 2CO4A 2CUHA 4KUZH 4QXUH 1P9MA 4G5AA 3N6YA 2Y5EA 1SKVA 4FC3E 4RIRA 5LO7A 3P73A 4KJYA 4P2RA 4PGBB 1HJBC 2BZCA 4PYGA 3HC3H 3ARFD 1MW2A 4CN4A 1NZ6A 1BSIA 1U97A 4BINA 3VFOB 3E9UA 4QGYA 3D1MC 4D0BB 1RJCA 2R9AA 3EOBB 1BIIB 2B5IB 4H44B 4Y4KC 5FGRA 5IBUG 2R72A 3OJ2C 4KROB 1FVDA 1PAZA 1KLUB 2IVFC 2WPDG 2J1XA 1S2EA 3IDJA 3P2TA 1WBZB 2HYMA 3KCXA 1X5IA 3GLDA 5CMAA 5I6LA 4XXWC 2WP3T 4W9EC 1P7HL 3MLUH 2BHYA 3BN3B 4CC5A 5E4AA 3UMTA 4K8RD 2Y36H 3ARZA 3CRCA 2LFRA 3X1FA 3TEUA 4X9QA 2IO5A 2ZE0A 4PJHF 2E27H 4RGOL 3D4YA 5D6CA 2H6OA 1OXYA 3LEXA 4H5SB 5T1MB 1MWAL 1JZ5A 2XRAH 1VQ8V 3BA8A 2XNAA 3VCLA 4GG6E 1FO0A 1RIUH 3O0RH 3LXCA 5AVYB 4DGYL 3IAPA 4JO8A 3QIBD 2A9HA 2VDMH 1MFEL 2WNWA 4LCYA 4MAYC 1TTGA 1TGOA 2WWKT 5EZOL 1HNZO 3NAAL 4Z7IA 2DBLH 4EB6B 3B3IA 3X17A 5KAQG 3D4CA 5GS1A 5DJXB 2Z0AA 2VSKB 3GF8A 4L1HA 4X7CC 5E6SB 5D2NA 4TNWK 4MA3A 3BH9B 1GS6X 4JQXC 3DVNA 4UILH 3QWOA 3D50A 4UDTA 1FVEB 1T4KA 2C4FU 3GSXA 5TQ2L 3ZN0A 2X4SA 5KVGL 3HUJB 2ZYHA 4Y9GA 2YUXA 3NQIA 3O6KL 3SDDD 2W0XA 4XNQA 3E8FA 3BSZA 3DETD 4BIUA 3MAWA 2WQ8A 3FFCA 3TYGH 3OL2A 3DTXA 3FU6A 3E0GA 3FTGB 3PAYA 4K94H 4U1NB 5ADOH 3GRWH 4WW2A 4ZTPL 1JE6A 3T0WA 1S5IH 1HS6A 1QFHA 3DBXB 4W4NA 4N0UE 3B8NA 2ILMA 1E8XA 2DYPB 3HG4A 3HZVB 1IT9H 5FUCC 4O4IB 3MROA 1RJLA 1USZA 3GXFA 2UUCO 1HVXA 3QAZC 3ES6B 4NWUL 1ZJBA 4V1DB 3TXSA 3HHRB 3X11A 3RWEB 4MNQE 2IDSA 1KEGL 5AKSA 1RUKL 1DF4A 1JCVA 3BPCA 3QA3A 3DV6A 5DT1H 4LPYA 3O41B 3FS9A 3D0LB 4S1DC 5CP7A 3T6XA 2YEQA 1PZBA 3C5XA 3F7YA 4MD4B 4NQTA 1L9PA 2J71A 2K0RA 3MV7E 1F3JA 3MGAA 4DGYH 1A21A 1A7OL 4FNSA 3UBXG 4X1YA 2DI9A 4AEIH 1TPXC 3FRPA 3AG1B 4RMVA 1RVFH 4P5RA 1PNLA 1ZK9A 3HN8A 1IIIA 4G27B 4CRPA 4OJAA 3O6FA 3ZE2B 1BVNT 4LSQH 2A74A 2YGVA 4HUWB 3B2XA 5FHBH 3RVXD 1DVYA 4X7TA 3L1FA 3U0WH 4BW9A 4EI6B 3DPBA 4WFHE 2WQSA 5CHNA 4DT2A 3IDMB 1AI1H 4YDJB 4CC1A 4RCAA 4LEEA 5FGCE 2ZG3A 5IJVB 3OB8A 3U30C 1SPDA 2YC1B 3EF7A 4OAWA 4CADA 4Y9EA 5GGVL 1IEBA 1Q0XL 2IAMA 3IU3A 4X4ZA 1UWEH 3NSXA 4BXSV 2IPTL 4N9OB 4OZGB 1MZYA 1WTGT 3P40A 1DANT 2R9HC 5I1JL 3CD4A 5IVOA 4NOFA 3QUZC 1P6WA 3SDAC 1KY7A 4AQ1C 3C6LB 5HVHB 1MZEA 1TZIA 3QPXL 3ARGA 5KA5A 3K5LA 4UOJA 1ZSHA 3ZN1A 4PJ9B 5D1XB 2CCLA 4YXWG 4HZAA 4Q9QH 2CDEB 3HAEA 1M05B 4PJXE 5ACZB 3E83A 1WVZA 3FOLB 3HZKA 1I94O 3BD3A 4JI2O 1R3LB 2HWZH 3TVMA 3R1GH 4WI6A 1B6QA 1Z0NA 2UU9B 2Y22A 4HEPG 5LXGL 1XNRO 3UGUA 3D25B 3SGKC 3MV7D 4X4KA 1ORQA 5JHBA 4DR4B 1QNZL 1FPTL 2BOCA 4P9HH 4NSKB 5BZDB 1E9PB 3ZBMA 2FB5A 2O1AA 2Z5UA 4PJBB 3KCPA 4YHPB 3NJIA 5I71B 3QXWA 3ZOAA 4MSWC 1XH3B 4XAWH 5I26A 3OXRB 3RY6C 2MTAA 2OR7A 3VFSB 5ERWA 3LEXB 3IEAA 1N59A 5DC9B 5KG9A 3PFUA 5DJDB 3SDDA 2OMBA 1A14H 3KXFD 4LRNL 5CN3A 4JPWL 1K5SA 3O3AA 3F58L 3QXUA 5A2KH 3LNIA 3F7PC 1H3PH 2BP8A 1AYOA 3T1CA 1NGWA 4JM2D 4YZWA 1T6BX 4R7NB 4LGPB 4FNLL 1GC1C 4XNXH 5HI4C 1A14L 4ZS7L 1HCZA 1HWHB 2V4LA 4HAKA 2AITA 3B9KB 3EYQD 5AVQB 3FTUA 1FJ1A 2PGGA 2DLFH 4Y5VB 4K3EL 4B50A 2EIDA 2VAAA 3HCVA 1SLXA 4L0PB 4N0CD 3GMLB 1NQTA 3EOAA 4XR8C 4IT5A 4BFRA 1KYOK 1VP7A 1T6VN 2C8NA 2X3BA 3FUHA 2CLZB 1JGEA 4M8UA 4MXVF 4DGVH 3HRZC 3Q2VA 2PR4L 4DHLA 2JVDA 2W0FA 5D7IB 2PI4A 4LP5A 2VWJA 3QJOA 3DXRA 1BA9A 1R1BA 1TVDA 2BZ7A 2JE8A 3ZDYB 1EHKB 2XFXA 1OEZW 2K7QA 4HGMA 4BZ2H 3KGRA 3NABL 4ES9A 3FCSA 4X6CB 5FV1L 2NY3D 2B1AH 3NZHH 2MQ0A 5LMUB 4S1SL 3VJ6A 2WWMD 3WUWB 5FYLD 3CV5A 4J3UA 4DCQA 5CIPA 2OMWA 3OKKB 4KRPD 5KYUA 3FO0H 1PKOA 3RB7A 4ONGL 1VACA 4UTAH 2QM8A 3V0HA 1MREL 4FFKA 1KPUB 1YJDC 4H26B 5DS1A 1BMWA 1JYWA 2OCCB 3DSFL 3KLAB 3E8GA 5KVFE 3Q1EA 4N2OA 3MHZA 2Q9LA 2OTWA 3FXIC 1B0RB 4B08A 3PWVA 4O2CA 1CFSB 2ADIB 4HIHB 1WFUA 2IAMD 1S9KC 1JHKL 4JFFA 1KP3A 2P5EE 4PRIE 1F90H 3C8KA 3MLVL 2IWEA 4UOQA 1NLBL 3ZLQC 4N8CH 2XAFA 5F96H 4ZO6A 5TJWK 4XMLL 1FNAA 5KJRL 1BQ5A 5K1JA 2Y06L 1KMIZ 5GRWA 4TNGA 1ET7A 4RISH 5BQ7A 4LLAA 3ALPA 1UD5A 4Z1MG 3NN8B 3NZSA 4XPAL 4K0KB 2WLZA 3ARTA 5SWZB 2FWOA 2P44B 5C0ND 1JFHA 2PCFB 4JRYA 5FWRA 5D8JL 4BEIA 3NK3A 3MLZL 4R4FL 2UZXA 1CG9A 2X7LA 1H5BA 1UM5H 1Q6IA 3JSSA 3BDBA 3V4PB 5FGBA 1UB6B 2WA4A 3BQUB 3WHE0 1P2CB 3C5SB 1JI2A 1HNWB 1NOAA 3UC0H 5I76A 4BRVA 3RRQA 4D7BA 2IJJA 2R2EB 1ACZA 3D3QA 1O7DC 4DP0X 5I5IA 4J7KA 1VPOH 2IXQA 4NFBA 2VMCA 3MNVB 3GFUA 4MZ2A 2CO6B 2APXA 4JQIH 4AEHH 2YD9A 4LCIL 4L3EB 1VQ5V 3ZYZA 1IAKA 2J5LB 1U8QB 1U8NA 5BS0E 5MENB 1KLUA 2APBA 2IPUG 4P30A 1KBWA 3OAYH 1CCZA 5LG1A 3UG5A 5DJCB 5I8OH 5IJ0B 1AO7E 1T20B 3Q3GA 5ETUB 2PO6C 3WFBH 1I85A 4ZSOA 1N9PA 3DXAE 2AERT 4XDLA 1FVCB 4X89A 4XAKD 2CR3A 1PQZB 4NPKA 1FDLL 5IMLB 3C9NA 1OSEA 2EXYD 3MOAH 5KYXA 3B1TA 3WHXA 1IBFA 1T03H 2YPLB 3MV8D 1KECA 4W9HC 2AQSA 2IEPA 4MDJA 4WU7B 1UGNA 3V4PL 5DUPL 2HRGA 4IS6A 3FB7A 1G9EA 1FFNA 5EFIB 5LAPA 2NY6D 4GXFA 4JDZA 4O2FA 2JJWA 3C75A 2DIBA 4WF9V 3QQDB 4DZ8A 2HVBA 2VQTA 1XIWA 2BZDA 3KPRD 3O9WD 5HYJE 3QZMA 2VJXA 1V9PA 5IROA 4G7SB 3IJHA 1WBYB 2GJ6E 2EQDA 1JYNA 4G5ZH 4HSAC 2L04A 2DL2A 3OVUB 5AQ0A 4PH8A 3V55A 3HRPA 5GGTL 1FVEA 1RZ8B 3HLAA 1DBJL 5EPMB 3L9BA 1IXBA 4JPVL 5D7IA 1YY8A 2YXYA 2BW5A 1HHIB 2JKIS 3IGAB 2BVOA 5I6KA 4CMMA 3QZBA 4G70B 3WNOA 4APQA 1MHHA 4RRPM 1KV7A 4ZQKA 5MEPA 2P8PA 3QT2A 5E94B 1R0AH 1COWG 1CGYA 1H9VA 1GY1A 1SN2A 2AAAA 1D5RA 43C9B 1UKQA 4AH2A 3OAYK 4GRWF 3ZX1A 4CKVX 5CWSB 5HSFA 3BQUC 4YDVB 1PZ5A 3LPGA 3BESR 4PGDB 4KRNA 1WZKA 1NQBA 3UAEA 3ZTDC 1RZKL 2GSIB 4JPIA 3QRFM 2E47A 5EA0L 1HQRB 1U93B 1AR1C 5J2TA 1UD6A 1EGJA 4I55A 1UJTA 2K9UA 3C2SA 3VXPB 2XWCA 4NKOA 3BVWA 2A74C 2B1OA 3M45A 1RUAL 1GKEA 2Y7LA 1DJYA 1DSFL 2L0DA 3SQRA 1FHGA 3ZT5A 4I13B 4XP9H 3SGEI 4BA8A 2K9FB 3A47A 1HEHC 4X0NA 3CHPA 3ZJZA 3LN4A 4M03A 3V0IA 5FO8A 3CS5A 1G84A 4GQ9L 3ISRA 1QACA 1EFXB 1FXKC 4ZXBC 3O6FB 1X9RA 2L6LA 2ED6A 1ZKAA 2EXSA 2R1YB 4XXWA 1S7VA 1NLDL 3DXAD 2FR4A 1UM4L 3S36H 3B9KD 1W6LA 3HG0A 3NFNB 4K3DH 3TBCA 1W0JG 3KL5A 4GQ9H 2BIQA 3OGIB 4O00A 1XF1A 2A7WA 3TA3B 3HR6A 3AXHA 4JS7A 1LNQA 2I07B 1TQWA 4GFXA 4UV4L 2OYKA 3CDGB 3QG7H 3ZRSA 3MRFA 3ET9F 5ISZA 3S37H 2XT9A 3JASA 5IGXL 2VDPB 2VQUA 2YI8A 3BVUA 4GNKB 6FABH 2B9AA 3C6SB 4LF3A 3EYVB 1RFDL 2CH7A 1A6UH 3FB5A 5DDHA 3BGFC 3IFNH 2EUXA 4KROC 4Q2ZB 2VLKE 4PTUB 5C09B 1IGML 2BMKB 4V1DE 1L0YA 1NEUA 4JDEB 5D2LF 1CZ8L 2XT1B 3P4MB 3RPIA 3LIUA 1YEDB 4DKTA 4ZKIA 2ZCHH 3IVKB 3QIWD 1GGIL 4PRHD 1OV8A 3TXQA 1THCA 4UAHA 2R4SH 3WEBA 1PFCA 4ODHH 4UM8B 4N2KA 4L5FE 1R3JB 3WTWA 1CGWA 2N7SA 4Y19B 4XRCA 2Y4UA 5I1CL 3BXNA 3WIAA 2E76B 1VZHA 5DJCA 4LF5B 4YY3O 4EDWH 3F3HA 4U6VL 4NN7B 1D6EB 2HX7A 1KTKE 5GRUH 1THAA 2IGLA 5I23A 3S3JA 2JELH 3QB7C 5LN4A 1OCRC 4MA1C 3WV0A 1EDYA 2X87A 3CFTA 1ILSA 1UWGH 1NCBH 4NRYB 7CGTA 3QIUD 2XWXA 5DF0A 3FRPB 5DVLA 2Y7MA 4HPOL 3O9WA 1YMMB 2A83A 2WO3B 5AD0B 1EBAA 1LP9A 4AOFA 4MW3A 5DD0H 5FYKD 1JZ7A 1TETH 4QT5A 3LNMB 1Y76A 3CRMA 1P1VA 4UT9L 3WL9B 4G8AC 3GIZH 3J7HA 2VO8A 1A6UL 2HVKB 1U8LA 1BQ0A 2CWRA 2NUPA 3RG1C 3TNNA 5DD0L 4Y1AB 5DA0B 5JYMA 2XTAA 4MYPA 5EEVA 2F66C 4HIIB 2CKBH 4J3TA 1FHNA 1SUHA 4R7NA 1GA2A 3BI9X 1I5XA 4FFZA 4ZQTA 4A7UA 5DTFB 3GB7B 4WUUD 3MTRA 2JCCF 3G5ZA 1IBGL 2VITA 1PG7L 2EJ7A 3E2HC 5A1AA 5JDSA 4P2ZA 3CDZB 3WKNA 5EC2C 1KENL 3GSQA 5HHOB 1CBVL 3L5XL 5CEYA 5E5UB 4Z95L 2P9RA 3P9LB 1NBQA 1C7SA 1SQ2N 1UT2A 1YEGH 1I7UB 1UH4A 2KDGA 3GMOB 2XTSA 1BZ9A 2WVUA 1QR4A 3CMOL 4Y4HC 1CD1A 5DXWA 5E94A 4QHKJ 2B2XL 2NUTB 32C2B 3UJIL 2W0FB 5EOTB 3O65A 3B9DA 5I1KL 5D1XA 4YQXH 4K5PA 4DK6A 5C3LD 2OPCA 1J5OL 2XIDA 2B15A 4ZOCA 1WT5A 1T21A 1SN5A 3ZL4H 5B8CB 5HYIA 4KKLD 1JCKA 1KTRL 1KB5A 1MHEB 1CI3M 4YHYC 3UTQA 1EHXA 4AQ1B 4LH6A 4DR6O 1DCLA 1IKFH 3D25A 1JFQL 1L9MA 3ZDXE 4JFQA 4TTDC 2MIZA 2P8LA 1A6VH 2CCVA 4KWUA 5CCHE 4L8CB 5KYYB 1YECH 2R27A 3D2TA 3LY6A 4G8GD 2YXHA 2ZUSA 3MBEB 4Y16C 2YPVL 3P02A 4A1RA 1D9KD 4JHWL 1G7HB 4ELKB 4U1MA 1U8CA 3PV6B 3Q8AA 4OCXH 3DJSA 2WXNA 4HETA 1A3RL 1JXDA 2JV6A 3L1OL 5DZJA 1B0RA 3LHPL 3BP7B 3ARPA 3L3GB 3P3YA 5EG6C 3QEHB 4UTBL 2NY4D 1H3GA 3Q13A 3DDGA 4Z76A 2OMYA 2JB5H 1IBGH 3ZU8A 5J56B 3SPCA 1BL8A 1ED3A 5TF1L 1O6SB 4JGJA 2BCKA 1K4DA 2HRPH 4WO4A 4BELD 2AHYA 5TDNB 2FJUB 2X9ZA 3O3BB 2VQEB 3G6DL 1OTSD 3FT4A 3GZQA 3UOAB 1JZFA 2O93L 3MRDA 5HBBA 2Z92B 1EANA 3AQDA 4Q9CA 2DLTA 4WNQB 5EOCJ 4DPAX 3E38A 3QDMB 3IPFA 1UD2A 2Z0UA 2X2HA 3KPSA 3FSWA 5CIPH 5BQ7B 4JLRB 4Y5XC 3WO3B 4MQTB 3U6XA 4J8RB 1JGIA 3MRHA 2FYYB 1N4CA 4H0LC 2WKOA 1T2JA 3D2UA 1WIOA 1OTTD 1U3ZA 4CL7A 1C5CH 1JGEB 4OBSA 3UO1H 1HKLL 1MDAA 2Q7YA 3FBQA 2E3VA 1W2KT 2CDYA 3GLZA 2WWWA 2LQTA 1MWAB 1P2CA 2GAZA 3C5SA 3KCWA 5C2UB 1MNGA 4AQEA 2BO0A 5KVDH 4NN6C 1JZHA 1ZV5A 1AJNA 4JPKH 5JVDB 5DMGD 5DT1L 2ARHA 1Z9MA 1ENVA 3NIFB 4PREA 5C0CB 3VRIA 1RAMA 2HT3C 2A6JA 2Y4SA 4DR5O 4JAMB 4XN5A 4MS8D 5HD8D 3U1PA 7PCYA 5JR1L 4E0RB 3Q43A 4WU5A 1Q43A 1MNNA 1YHQV 1JHLH 1QA9B 1BZQK 2H5UA 5GRJL 4TSAL 1DLFL 2CKNA 4L23A 5SWSD 3MLYH 4XBMA 1I7ZB 1K4CB 1KJ2A 5JW4M 3Q44A 3FHEA 4JG5A 2GHYA 4G28B 1WF5A 3TS8A 1N2RA 1JHLL 1TJIH 4WDIA 3WEAA 4NNXA 4C4BA 1DQML 1DLFH 1ZOXA 4WWID 4UZSA 1S78C 2JJSA 3CMGA 4EI5B 5LG6A 1J9TA 5H8DA 3LKPA 4JFWA 2W9DH 2I5YH 4AITA 1FAFA 5I1EH 3M1BB 4FFVC 3UBHA 2B7DT 5MHSE 5DK2A 1QSEB 4CC4C 2OI9C 1RMFL 4K3JL 3CFEB 1OF2B 5FM5O 2GIXA 4G9FD 3MCYA 4UM9B 3BEVB 5ICZA 2NNRA 1RULL 3FB7B 4JZJC 4X8GA 4ODXA 1BYPA 1IAOA 5C09D 1I31A 1LUWA 5B21A 1U4FA 4LFCO 2PTTA 1NL0H 2YO3A 3RAJL 5IHWA 2OW6A 5D7IE 1FZMB 2BVYA 5KA6A 4QHUA 2P4VA 1JGLH 3QIWB 4PRHB 5GGSA 1O5DT 2QSQA 3FCTB 4F15C 4AGOA 4HV8A 4FN0A 3EJZC 1CS6A 1P6FA 2IFFL 3I9GL 4YDIH 4D9LH 3R1GL 5EN3A 5L4FA 2ICES 1BMZA 1XXFC 2V2WA 2VTFA 3GHEL 2A4ZA 4UVCA 4H2AA 4Z7VE 5L3GA 4HIXL 3X14A 2C5DC 2KQNA 2WANA 3T2NH 4MJIB 4EQ2A 2BS8A 3ULVH 1A6WH 3WN5A 2NY1B 1T22A 4F2MA 5JPMB 3DRTA 2Z1KA 3PS6A 1UJ3C 3WFHB 5DVNA 3L45A 1GHFH 4BD4A 4YLCA 3S3CB 2VERA 1PU0A 1UWEL 4FMTA 4MCNA 5FNVB 2FT8A 3N41F 3VSTA 4TV8B 2OYPA 5F2VO 1UURA 2EADA 2XWTB 4HLZH 3EF4A 1I9JL 3BH4A 3A6OA 2XUWA 2WLJA 2XETA 2DLGA 4ZTOL 5BPPA 4HNAA 2FJGA 1LP9E 3MRMB 3OG4B 3RNQB 1E2ZA 3HC4H 4KHTH 2KLSA 1IBMB 3I2CL 4WFED 5AVSB 1CXFA 4PJIE 4DW1A 2I60H 4M43L 4IGBA 4ZOEA 1RY7B 1YYLL 5FYLH 1A1NB 3G5XB 5DGQA