3ASNB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asnB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asnB02
1IC0A 1RZPA 3EHBB 3NJIA 4YSRA 2VSMB 2GB2A 2YAFA 2QDVA 2PLTA 1JXFA 1M56B 1SFHA 5AKRA 2X88A 2PPEA 2IWKA 3NYKA 2DWSA 2FQFA 3OM3B 4BWWA 3ABLB 3NJMA 3WKPA 4E9XA 5I6PA 1KCWA 3PAZA 1XB6A 3FQYA 2BO0A 4E9VA 3ASOB 2WO3B 1V54B 1L9QA 1MG2C 4YVNA 5I5IA 2PP8A 3L45A 1KBVA 4AKQA 1ASQA 2IDUA 5A7EA 4Q8BA 4WKXA 1YLBB 3N55A 1JZHA 3NSFA 1OV8A 3T71A 1XB3A 4YSEA 3ZDWA 4FAAB 1SDDA 3T6ZA 1AAJA 4A67A 4ENZA 4JHVA 1JZGA 1IBYA 1NWOA 4QLWA 1QNIA 3FPYA 2ZOOA 2H5UA 1L9PA 3AZUA 1AZNA 4DP9X 4E9YA 2UXFA 2YAEA 1GR7A 1VLXA 5B7EA 1PZAA 1A65A 2IWFA 3EH4B 5B7FA 1ZIBA 4M3HA 1SF3A 1TEFA 4GYBA 1A8ZA 2TSBA 2XYBA 2DYRB 4DP8X 4DP2X 4BXSV 3FU9A 4G72B 4FA7B 1AZRA 1V55B 1KDIA 3FSZA 4A2FA 5B1JA 1AANA 3S8GB 3FS9A 2UXTA 4JKNA 2J5WA 2I7OA 2RACA 1ILUA 2BP0B 1CYXA 3QJUB 2FQEA 3T6VA 3OMAB 1NPJA 5EHFA 1WS7A 5B7MA 2UXVA 3ASNB 1AS7A 4YSSA 2XU9A 3PCYA 3QJTB 1A4CA 1N70A 3NSDA 3WI9A 4KNSA 2YEVB 4HALA 1MDAA 2IH9A 2BP8B 4YSDA 2FNWA 1URIA 3G5WA 1HAUA 4N4YB 3GYRA 1OCRB 1QHQA 1AG0A 3T6WA 1ASPA 4YSOA 3JT2A 3CDZA 2AZAA 2GC7C 1SHWA 2EIKB 1M9WA 1PLBA 4QKTA 1ZDQA 2XVBA 3DKHA 3AY2A 3FSVA 5I5JA 3H4FA 3IEAA 1ETJA 3RYMA 1T5KA 3SBPA 2TSAA 4YSCA 4P5RA 3KW7A 4UANA 4E9WA 3SBQA 3S3BB 2HZHA 1L9TA 3NP3A 4A2HA 3S3DB 1FA4A 4F2FA 4HAKA 1AR1B 1L9SA 3IE9A 1L9OA 2QT6A 3FPXA 1BQKA 4DPBX 3FYIB 1E5YA 3TBBA 3UAAA 2OCCB 4BWTA 2IDQA 2HX7A 4DPAX 1PF3A 4NAJA 1X9RA 1IUZA 4BK5C 1JXGA 3OQRA 2PPDA 3ABMB 2QDWA 4KOCA 3GDCA 2H3XC 3SBRA 1BXUA 1KDJA 4UF7C 1X9UA 4Q89A 4BDVA 1WA2X 2EINB 2BWIA 2XXFA 3UAEA 3X1GA 1E30A 2J57A 4PAZA 1KCBA 3ZBMA 1A4AA 5FC9A 2UXGA 4G7RB 2J55A 3V9CA 4E9TA 1IBZA 1J9TA 3PXLA 3WNJA 2BW5A 3NP4A 1ZDSA 3X1BA 3NJFA 2XX1A 1W6LA 2WSDA 3NJHA 4YSUA 3FYEB 1SJMA 3NSYA 4YSPA 3WIAA 5F7BA 2IDFA 4L0PB 1AIZA 2CCWA 3QJRB 3QJSB 1GSKA 3QJQB 1AZCA 2PCYA 3OMNB 4DP1X 1OCZB 2XX0A 1HFUA 4PCYA 1RKRA 2I7SA 5I28A 6PAZA 3NJLA 4CSPA 2YAMA 1BXVA 3FSAA 4JHUA 4YSQA 1SNRA 2AZUA 1N68A 1DZ0A 3AG3B 3UGEA 2PPCA 1QLEB 3CG8A 3JTBA 1AOZA 1J9SA 2IH8A 2P80A 3X1NA 2XUWA 3WNIA 4EF3A 5I6KA 1WA0X 3AW5A 1R1CA 3IN2A 3WKQA 5B1AB 2FJSA 7PCYA 2EIMB 2W8CA 5F7AA 2I85A 1AS6A 1XB8A 1JOIA 2FT6A 5E9NA 3ABGA 3T6XA 1A4BA 1ZIAA 2HLEB 3CVDA 1NWPA 4HIPA 3NJJA 3S3CB 2Q9OA 2N0MA 1ILSA 4KOBA 2XXGA 1JZIA 4TXVB 1BYPA 5ANHA 4AI7A 1OF0A 1CURA 3FU7B 2IAAC 2GSMB 2FT7A 2HRHA 4A2GA 4KO5A 2IWEA 2DYSB 2BZ7A 1DYZA 3TBCA 1WAEA 4AKOA 2E86A 3AG2B 1CC3A 4MFHA 1AG6A 2YXVA 2XV3A 2HX8A 2MRYA 4DP6X 2HX9A 3IBOA 2GC4C 4G70B 1OCOB 4NERA 5I26A 3U25A 2BP0A 1PZCA 2VN3A 1NINA 4G7SB 5IY5B 2JFCA 4GP5B 3AG4B 1NIBA 3WG7B 2Y69B 1JERA 2Q5BA 1KGYE 1E67A 4AKPA 3EF4A 1J5DA 2R7EB 3NSCA 4W1TA 4RH4A 3UACA 2BP8A 5TK4A 1NIDA 2X87A 1MZZA 1NTDA 3QQXA 3IN0A 2BW4A 3FQ2A 2CJ3A 3NT0A 2AANA 1OE1A 4KO9A 3HB3B 1KBWA 4E9RA 1WA1X 5AZUA 1TKWA 2FT8A 2GBAA 2CAKA 1BAWA 8PAZA 2H47C 4M4RB 3X2QB 1J9QA 2AFNA 2GHZA 3FSWA 2HXAA 5B1KA 2LLNA 4HHWA 2YXWA 2FTAA 2DWTA 3FU8A 1OE3A 3UABA 2IDTA 4UAHA 3BVDB 3D12B 1PNDA 3TASA 3S8FB 1GS6X 1GY1A 1GY2A 1SFDA 2VSKB 1EHKB 2WO2B 3ABKB 1ASOA 1OCCB 1EZLA 1UATA 4YVUA 3GXUB 4HCIA 2DY2A 1ZPUA 3EH3B 4ZK8A 1JXDA 4GY4A 2YAPA 4KO6A 4DP0X 1PAZA 5D4JA 3FT0A 5B1BB 2IDSA 3TU6A 5D4IA 1PMYA 1NICA 5I5MA 1BQRA 3KW8A 1AZBA 1NDTA 2VW6A 2BHFA 1J9RA 1TEGA 4KO7A 2BWDA 1PCSA 4YSTA 1W6WA 4GP8B 3SQRA 2PP9A 2XV0A 1ID2A 3OD3A 2B3IA 1PLCA 1PY0A 3CZUB 3FQ1A 1SDDB 2FWLB 1KV7A 1PLAA 1E65A 1NIFA 3T9WA 4E9SA 4F2EA 1RCYA 2PCFA 2EILB 2XLLA 1M57B 2EIJB 2P80D 6PCYA 3DIVA 4P5SA 5PCYA 4A2EA 7PAZA 2MTAA 1JVLA 4WTQA 3MX0B 3C75A 1OE2A 1CYWA 5PAZA 1MG3C 1KYAA 2Y1AA 4A68A 3H56A 4KNTA 2UX6A 1BEXA 3MBWB 5B1JC 2CALA 2B08A 3CVCA 2CUAA 4HHGA 1JZFA 4GXFA 3QPKA 4BXVA 1ADWA 4A66A 2J56A 5I6NA 1OOWA 4BWUA 2XWZA 1ET5A 1MZYA 2VM3A 2JKWA 2PPAA 2FQGA 5B3SB 5AFAA 2OJ1A 1AS8A 2VW4A 3ZIYA 1A3ZA 4YSAA 4AZUA 1B3IA 1J5CA 2YAHA 3NJNA 4G7QB 4DP5X 2QPDB 1L9RA 1PNCA 1WS8A 1V10A 1ET7A 3PLYA 2YAQA 4DP4X 4X4KA 3N2JA 3X1FA 1BQ5A 2CBPA 1BYOA 3BQVA 4CSZA 2GIMA 2GI0A 1PZBA 1BXAA 2YARA 3CDZB 3FU7A 4K9JA 1I53A 3OMIB 1TU2A 3H4HA 1CUOA 1HAWA 3HEIB 2PP7A 3NJGA 2ZONA 1AZUA 3CVBA 1NIEA 2VW7A 5TK2A 4DPCX 1GW0A 4NB7A 3EH5B 3DTUB 3QJVB 2ZXWB 4A2DA 5D4HA 1SHXA 2AVFA 2UX7A 3PAVA 2DV6A 4KNUA 1W8EA 1ET8A 2QPEB 5I6OA 2NRDA 3UADA 1E5ZA 4AX3A 1ZV2A 1RZQA 4GP4B 3PAUA 1AQ8A 3V9EA 1FWXA 3TA4D 1JZEA 2R7EA 1FFTB 4G71B 2VM4A 1SF5A 3X1EA 4DP7X 2FQDA 2OV0A 1GS8A 2YAOA 3NJKA 2JXMA 1NZRA 3ERXA 3PPSA 3ZX1A 2BZCA 2XV2A 2VMJA 1JZJA 4F7KA 1NPNA 1GYCA 4YL4A 4BDVB 4E9QA 5LDUA 1AACA 1IKOP 5I6LA 1JVOA 2PPFA 2W88A 4HZ1A 9PCYA 3AG1B 4W9ZA 4HCGA 4HCFA 1F56A 2A3TA 2YQBA 2ZWNA 1XMEB 2HRGA 5I6MA 4N8UA 1GS7A 1NIAA
chains in the Genus database with same CATH superfamily
4PS8A 2MEJB 2PTVA 4PGDB 3TTYA 3ULUF 5D55A 2QPFA 2I07B 3MOBL 4FM0A 2A1WL 2GB2A 2Q69A 2QSVA 2YAFA 3WKML 1OOAA 4IU3B 1DJZA 3IDYB 3SKMB 1NLDH 2KT6A 1P9MC 5F0LB 4XVSL 2EIJC 4CW1A 3VQLA 4ES9A 1G8MA 2IH1A 1SM3H 1OAYL 1JF1B 1WIPA 4HZLA 2WXIA 3Q8BA 5EC2C 2O5ZL 2WAQA 3RRQA 2DMCA 1A2YA 5ACLA 4XMWA 2LW1A 5F0JB 4MS2A 3A2FA 5BCAA 4JAMA 1WTGT 1ASQA 2R69A 4MKMA 1ZEAL 5DK2B 4HKZB 2X9YA 4BELD 1RPQA 4DR4B 3IGLA 1DBJL 1T4KB 4OPAA 1VACB 5F7EL 3CHOA 3O4LB 3K74B 2FNBA 4ZFOL 2KDYA 1S5HB 1YEEL 3O41B 5EO9A 3ZDWA 2XIIA 2A9NH 5K9JH 4FKHA 3OUSA 4DW0A 4MT8A 4XMUA 1MRFH 3BKJH 3DX2A 1WAZA 5F1NB 2GUYA 3TN0B 5B8CB 4KRNA 5JR1L 2R4RH 1WBZA 5GZOD 3GWJA 4M93B 5DU7A 1T66D 3ZE0B 1SUHA 1U8PB 2BSED 1ZOXA 5TF1L 4LNVA 1J05B 1GZPB 3ZO9A 3SJVA 5J9PC 1GHFL 1R5WA 2F43G 2A7WA 5FGRA 3V4PA 1BD2A 1CDJA 3WNMA 1AGDB 5B7EA 1QSEA 2FJHA 5GGSB 4DH2A 1OF2B 4HU2A 3WTXA 4NWUL 4WI9A 4JAVA 3G7TA 1J9CT 4WWKD 1KGCD 4IU2B 4ZUSA 2WNWA 4DP2X 2D31A 2DMGA 4ZOBA 5F9JA 4YS4A 2EEBA 2Q7GA 4M8UA 3TV3H 3M88A 1KBPA 4POYA 2WM0A 5KW9L 2LVEA 4XH2A 3VB8A 4UCSA 4IOSD 3S36H 4FFWC 2UXTA 3TA3C 3BKML 2NY3B 4QE7A 5FKAB 1GM9A 3CGTA 1ESOA 2R69L 3CZEA 4LOUD 5DD5L 3W7SA 2PNDA 4NM8L 3MLSH 2X4PB 4H8QA 1EN4A 1T1YA 3PCYA 3BP5A 5GHWL 2P44B 4BR6A 1UZ6E 1ZSDB 2BOBA 4NYLB 3E6HB 3SO3C 4BE5A 4EAEA 5I2IB 2Y1VA 4YSDA 3PWNA 3C8KB 4WI0A 2XWDA 2FHFA 3D07A 4N4YB 4JL2A 4N0YH 4XCCH 3UBXA 1RUMH 3WCYA 2VXUL 3ZT5A 3HZKA 1R3KB 4DN4H 2FGWL 4HC1L 5MERB 3NIDB 3P2DA 1WZKA 2QQLL 2VDPH 3BP7A 4I9QA 1JHLL 3AK1A 2IANE 1RU9L 4LXFA 3PYCA 5EU3B 4KRPB 4OAWB 1A5FH 1BSIA 2DLIA 1BAFH 4WWOA 2UXDB 4DR6B 4CS3A 1FV1B 3UIYA 1MNNA 1H6TA 3FSVA 2H41A 3EYUL 3G6JF 3RVUD 5I0XA 4M5TA 3D39E 3EDKA 5E08L 2R2EB 1XF5A 1HJCA 1B2YA 2OBGA 3QZWG 4LHUA 5BY1A 1WPBA 4LCCB 4URKA 1PD0A 1UUNA 4JFDD 2ADJA 1T20A 5IQLA 2PXYC 3TNNA 2HZHA 2PETA 3L9BA 1B6QA 1BQLL 3NCBB 3NFSL 1RM1C 5F0MB 4HAKA 1FA4A 4E2LA 3UAJD 5IR1B 3CFNA 3NACL 3TYGH 1BQKA 3AREA 2AQ3A 3K0YA 2LTQC 2UU9B 4PG2C 3V5HA 1CWVA 1FFQA 5EZOL 4TQEL 3W37A 4KI5D 1QO3A 5DEGA 4I48B 2ZJSL 3TJTA 2AHZA 4UT9A 3EYSH 1P5UC 5DJ2B 1IV8A 1B3JA 5HI4C 3UP1A 3T0AA 2GTZB 4PUBH 1BM7A 3GJEB 3OZKA 4XVUC 3VSUA 4N8CL 4GQRA 5GZNA 3WIIL 1MWOA 1WP6A 2WCSA 1EHLH 2XXFA 3QCVL 5DVLA 5KHKA 5IJVB 5JHDB 2WGXA 1NMAH 3DUUB 2HKHL 3EF7A 2W1NA 5D1XB 1B4JH 1JZ7A 3ULVC 3MAWA 4YE4H 5IVZA 4RAUB 2YOAA 4E9TA 4LLWB 5GISL 1QLFA 3KLAB 3WNJA 3O8XA 1D5MA 1T7WA 1LQSR 3O3DB 1OTUD 2MNUA 1JV5B 4H1LH 4NQUA 1IC4H 4WTZG 2IPTH 3EJYD 3IJ7A 4MA3A 5D1ZA 4G43A 1MHPH 4CSTA 4IYIA 1F00I 4D9RD 4JAAA 3ARVA 1E4XH 1JTTA 4G6FD 4IKIA 1BEYL 3UZEA 5DJ0B 4WF7A 1K4DB 1UFUA 4QTHB 2JIZG 4TVSa 1DDHB 2IAMB 5HDWA 1DF4A 4DGYH 1TG8A 2G2NA 2VT0A 3AC0A 2PR4L 4WCYH 43CAB 4PGEB 3WJJA 4G9FB 1H3TA 1XSIA 2BP3A 3TCLB 3NJLA 4CSSA 3DHUA 4PRPB 2H8PC 5KZCB 3VJ6B 1NEZA 4QRTB 1BFVH 1HKLH 4OD1H 2H45A 5EZIH 1IT9H 2KZBA 3WFDH 1S3JA 3GMPA 3UGEA 5D93C 5DTFA 4PP2A 3ZHDA 1SXAA 1KCRH 4JPIB 4EF3A 3HPJB 3QNYB 2YRBA 3D50A 4IRJB 4H2AA 1QFUH 2VLRD 1EJOH 2Y0PA 3EYQC 1J8SA 1UACL 1S9WA 1UH4A 2XRAH 5F7AA 2WTOA 1A6WH 5KTEL 4KL1A 3U6XS 4AJ0A 2DDQL 3QUYC 5E9DE 1IBGH 3IGAA 1FZOA 5E6IA 2OJZH 3EDFA 5CZXC 5IMKB 4GO6B 4FQXC 8FABA 1W72H 3MNVA 4KK5D 1W0VA 2E7DA 3D69B 4PRDB 1GMGA 2BTQB 1CGSH 2P3YA 3CVHB 3UTSA 1FH5H 4X98B 4G1MA 5A2AA 4XVOA 2VRKA 4XN9A 5AG2A 4P5MB 2XFGB 2P43B 1J18A 2BZ7A 2DW5A 4YXKH 1NVPD 3REVA 4A6YH 4Z76B 2IXQB 1PNKA 4GYCB 4AC2A 3G6AB 1NC2A 4PV9B 5L88L 1Z9LA 4LRIC 4Z95H 5AYTA 4RNRB 1UYWH 1MCWM 3PN1A 4BFOA 1BJMA 2MTPA 3T0EB 3GTTA 3T77A 4ZNEA 3O11A 4LLVA 1F8TL 5FO7B 2ZKHL 4GG6E 2CPUA 2Z31D 3FRPA 2PI5A 3MRRA 4XNMB 3WU1A 3PWJB 4MCMA 3G04B 4DTGH 1KTDA 1NGPL 2WK2A 4G7SB 4KY1L 3L4YA 1VB9A 1TGOA 4GZRB 2ZE7A 2VLJB 3QSKB 2NR6C 4NBXB 1ZS2A 4RQQB 1F4NA 3RGVB 3GHBH 3LRMA 4YBQD 3EF4A 3NPSB 1OAUL 1XD1A 4W1TA 1SXBA 1COWG 4RH4A 5KA6A 5B3NA 1XT5A 5AD0A 2BPBA 1Q3EA 2QKCA 1H8EG 2X7LA 4Y4HA 3LKSA 1YNKL 4TT3G 3K9SA 5I8KL 3WLBB 2HRPH 1NLBH 2WBWB 4X6BB 5EZLB 3TZVB 2JK5B 3NT0A 1TLMA 2D03L 5DMKA 3SDCD 2BVQB 4XNZB 1KXQA 1RZKH 5EIVA 1G9EA 3ZE0F 4WLCA 2GBAA 3JAWB 1XTLA 2YLKA 4PGZA 2P5WB 8PAZA 3ULVE 4XDKA 5ISZB 5J2TA 4NP4L 3QIUB 4UM9A 4HLEA 3WFEH 1FORL 1E8ZA 4O2AB 5DZNA 3UFIA 1K72A 2FEEI 3BAEH 5EA0H 3CCVV 3FT4B 1GY1A 3CU7A 3CN4A 4YJ3B 5ALCH 3FB5A 4JFFB 3RDTA 2MK3A 4PRHD 3KWUA 3RP1A 2QSQA 1BBDL 1XMQB 4CS2A 1A6VL 4HS3B 1P6FA 2DOCA 4UUJB 4DR3O 1T0OA 2AJSH 3M17A 1N0LA 4PTUA 4QYOB 1JGIA 5B1BB 4XRCB 2E76C 3T0XA 3B2EE 3L3OA 4ZODA 3AS3A 3B2UD 4XZUB 1ZHBB 1S5IH 4JG0L 4WW2A 3MCKB 2FBJH 1G7QB 4PDLA 3MYZA 5DC2A 1PKQE 4FADA 3ETDA 5BRZE 1NM4A 1A8JH 1IKNC 1S7SB 4HSAC 4CN1A 1S7RA 1ID2A 2YD7A 1PLCA 4QRRE 5AOIA 5I66A 1VQ7V 3NFNB 3PXJA 1KB5A 4OD3H 1QNZL 4LNRA 4ZX4A 2Y1ZA 1ZAGA 3T9WA 2HP8A 1E9OB 4EKXA 3BGMB 3NIDF 3FTZA 4X62O 1I7UA 4YLCA 2C1PA 1B0RB 1KIQA 1ORQC 2BC4B 4WFHA 4KKBC 4LVHC 3PJSA 4HUKB 5PCYA 4QIWF 4IKLA 1XX9C 2YXYA 5EFIA 2JI1A 4NQCB 3C75A 3O4LA 4MMZA 4MS6A 4P23B 1BXXA 1IU1A 4XTRD 2XASA 1KN4L 3CFEA 4HYOA 1FYTA 1FZKA 3GRWH 1OP4A 2LAAA 5B1JC 1V7MH 3K6OA 1QRNB 4BZ1H 3C5ZD 2EIDA 4NPKA 1EHXA 4BXVA 3BISA 3V4UL 2KLRA 1VQKV 4HW6A 4J4PA 4CBPA 4DO2A 5SX5K 4ACTA 1KLUA 5I5RA 2HT3C 3U6XA 4B3MO 1I94B 4LVOC 5JIKA 3SE9H 3BKYL 1JMXA 2A9HA 3DWTA 4P2ZA 5AL8A 3FQRA 1J0KA 4F5CA 1TSHA 1LO3H 2JLPA 2QKIA 1AQDB 1BQSA 1T5XB 4TUJB 4X7TA 3BPNB 5HPMA 3BIAX 4PFEA 3TV8A 1SDYA 3HR6A 1A0QH 2AJUL 5AAMA 1Z9OA 3CE2A 2L8AA 3KPRE 4KPHL 4OLYH 5INCB 3FCTA 4ALAC 4J3OF 3PLYA 3QZOA 4AJYV 1KB5L 3FNKA 3MRNB 3ULAB 1YMHB 2GI0A 4OCWL 1G7LB 4MVQA 3RVZA 3JV6A 3ZRXA 3T2NL 4P4KD 1R46A 2GK0B 2UV3A 4AVHA 4FNSA 3WS6C 4IRZA 4ODTL 4P4RA 4P8QA 4FLOA 4MW3A 5LP6B 2D3OW 4H0HB 3I3DA 4LEXH 3RWJA 4Q2ZA 1MQ8A 2IG2L 3QNEA 3FCSB 2HJLB 1ZSDA 4NYLA 3ZTCC 3V4VH 3BO8A 3U0WH 2ZSWB 4K23L 4DYLA 1AVAA 5E1AC 4PGBA 3V5KB 2DQHH 3BRGC 1MHEB 3LKQA 2E6JA 1GGIH 5FYLD 4YO0A 2YD0A 1HHJA 4D7PA 2NSMA 4F1SA 3F01A 4S1QH 5K59F 4D0DB 3NQKA 3O6KL 1Z0MA 1HOCA 5EV7A 2CD0A 1SGKA 3ARGB 4FMFA 1B90A 3IK2A 1T7XA 2VDLH 3RPKA 2P4KA 4CJ0A 2R2EA 1H8SA 3ZTDC 4Z8FH 3CSXA 5E2WL 5T5FH 4ERSL 1J12A 4HFWA 2G9HB 4O5LH 4OGZA 2BJML 3CX2A 3EGXA 4BE6A 1KGIA 3O6ML 3PIQA 2IH1C 3BDBA 2E75C 4UCOA 2YD9A 4LQ1A 3GJFB 5DVOA 1R73A 3BGAA 2CH7A 4FXGB 4YDMA 5ELIA 3RTQD 5IJ0A 4AQYB 1Z32X 3LNIA 3LNFA 3NCEB 3HN5A 1TZGL 1E4WL 2WWKO 5MENA 4QRQA 3E9TA 2J71A 5DT1L 5DFTA 1UOVA 1EX0A 5DMIL 1IZ3A 4O02A 2G3MA 2YN5A 5AAWA 4X9QA 1XGUB 4JCWA 4LSSL 4LB8A 1WBXA 3VXUA 5LXVA 1F56A 3HFFA 4CRPA 4OQTH 3D52A 1XGZA 5T3ZH 4C56D 4J6IA 5GSRA 1FL5A 4QDGA 4QRPB 4P9HH 2QQKH 2DYPA 4L4VB 3U10A 3KLLA 1JXFA 4TTDC 2EVIA 4R83A 5D7IA 4G9DB 5C0RH 2DQIH 3P3UA 1JF6A 4J6RH 3RHWF 1HSBA 5TE7H 3WEBA 3DUUA 4K7FA 4KHPO 1FVEB 2G75B 3KPQA 3GNML 4N26A 4NN5C 3QPXH 2ISDA 3ARBA 4WK0B 3GSNL 1MCPH 1DQKA 3DRTB 4YVNA 1LD9B 1IURA 4X6DB 3IKCA 2Y7OA 4JI4B 4FEIA 2IFFL 2AABL 4UTBA 4F8TA 1NBZA 5EC2B 4WW1B 5JHLH 2Z7YA 5E0QA 3OWRA 4LCVA 3HMXH 1T2JA 1WO2A 3NSFA 3RIFK 1I4FA 2Y06L 5BRPA 4B9GA 1S9KC 3JXAA 4E2OA 4FAAB 4IRSA 2NQCA 5I1DB 5HYEA 1F1DA 1JXKA 5FV1L 1CLOH 2VN6A 4PJ5A 5E00A 1F58L 1I8KB 4L8JA 3GMRA 5AYUH 3DXAE 1FHGA 2BM3A 3HE6C 4Z7VF 2DQ6A 3W0WB 2ZOOA 1CK0H 4K9EL 4P2AA 4L1DA 1ZVNA 1NFDE 1IE4A 3OZ9L 4KVNL 3HI1B 1IM3B 5IYDO 1KY7A 3TH3T 5K9KA 4UU9B 2B1IA 5B1NA 2XZQH 3VFUB 2ICWB 2E9IA 4IRJA 5ID1B 2CXGA 3MLUH 2YRPA 3SDAA 3BCCH 3ZRWB 5J9PB 1ZD6A 3WO3B 1MIML 3L75H 2UUCB 4PJBE 4JPWH 5ESAB 3Q0HA 4YDNA 1J0IA 4Y0GA 2YC1A 2OMZB 5GS0H 1SM3L 1PZSA 2NDGA 1RJZB 1V55B 1KEMH 3MLTB 2EJRA 4DRXA 4PJAA 4J7ZA 4U3XA 3VFGH 4A2FA 4L4TD 5H8DA 2AJ3A 4M00A 4XPFH 2A0LA 3FTUA 3BVVA 2HH0H 1I85A 3KGTA 1DN0B 1BFSA 1CDUA 1L6PA 4P5MA 3CSYB 4Z23A 3MRFB 3ESOA 3TO4A 3UG3A 3VFOB 1W15A 1NH2D 2JKNA 3VG9C 4YJZL 1AH1A 2DE0X 3SDXF 4DN3H 3BEWA 1V05A 2QWQB 5F7YC 2BIIA 3FB6B 4POUB 2A9NL 2GJRA 4PJ8A 5E5MB 1MRFL 1RZGB 3BKJL 4GH7B 1HWYA 2F8IA 2XWJB 4A7GF 3I6GB 4A2MA 1QBAA 3PWJA 5E9DB 1UZ8A 2XAJA 4J11A 3OX8B 4DV4O 4FJ6A 4M6OH 5GGRY 4APQC 3LRSA 3T4YA 1XF2A 4D3CH 5I5JA 5E0FA 1T03L 2E59A 2YBRA 4J80A 1W0JG 5GZNC 3BN9D 2ARJQ 5JH7B 3KW7A 2JVDA 1X7TA 5IB3A 3VRIB 4ORGA 2CBMA 2VSDA 4L1TA 3SPVB 1ZUQA 3JALA 3LDDA 3O9WA 4AQOA 2ZWSA 4AMKH 5IB2A 1KELH 1S76D 3NH7H 4N2MA 5DJ6A 4AGLA 5I71C 2R9IA 1SY6H 2RB8A 2YPLA 2JK5A 1PX3A 3ZHTA 3DX6A 4GS7C 4GG6B 3S36L 4BH7B 4FF9A 4LDEB 4J3OG 5D1ZC 5AW0B 3TBBA 3GMQA 4JO3L 4S1SH 3QHFL 4RAIA 5HHOD 2V5RA 3ABMC 5ACZB 4QOKA 1RM1B 3SJVE 1CMOA 3QIUA 3TLRA 3RZCA 3UZEC 2QGEA 1UGKA 1X9RA 4LBEA 5EO0A 3RY5A 3MLSL 4BCZA 9CGTA 2X6AA 1NZ6A 2VDKB 1THCA 2LFSA 1NBYB 3T1YO 3HRZA 3ABLC 2CDEB 4DR7B 4HD9A 1U92B 3WJJC 1B88A 1E9QA 3Q8EA 3B2DC 1RVFH 2H4EA 3GMOA 4CN4A 5C0JA 4N0YL 5LAPA 25C8H 4CC1A 1MCJA 1P5UB 1RUML 4X7SH 3O81A 3TBSA 5K1XA 5A2CA 3VXRB 3TF7C 3K0DA 3HBZA 3TEWA 1AGEB 1Z3GH 5ICYB 4X1IA 2VDPL 4KK8D 4QEGA 2EDWA 2F4VB 3IB4A 3PXLA 3ATFA 4DIXA 1A5FL 3KPSA 1BAFL 4K8XA 3CMOH 3KXFD 4GB9A 5I82A 1UWFA 2LR4A 3MCKA 1W6LA 3LPFA 3HUJA 2IDFA 3MBEA 2CCWA 1M93A 2J72A 2ZXQA 4LSUH 5F9WC 3RIAK 3S8WA 4FQQB 5CZKA 2OYMA 1YJWV 1FF5A 1HEZB 3RB5A 1OZUA 5L6YH 3ZKNC 4JHAH 3UZVA 2Y24A 1F5WA 5C07A 4GRMB 1GN2A 1GK9A 4GKNB 3TYGL 1U8KA 4PTTB 1F3RB 1VZGA 2WQWA 4YGVB 5HI3C 1HSAB 3QUZD 3X1NA 2EIMC 2H8PB 3WNIA 1IGMH 2V2XB 5EUKA 4ATTA 3N3EA 4NKMB 3EYSL 2Y23A 2P4AB 3IJSB 3TN0D 2WN3A 3X12A 1NDMA 3JTSA 1OSZA 4XMVA 5D93B 1EZJA 5BRZB 5D7JC 1QRNA 4RFEB 1EHLL 3IXTB 1UZ6F 2YUAA 4QRRB 5D70H 3GSUA 5GGQH 2A6DB 4ZOLB 4NFBA 4B7IA 1B4JL 1UJ3B 3ATAA 4GSDH 4FI8A 4YE4L 2R70A 2FH8A 4UIMA 1AKJB 1S4IA 1SJXA 1OF0A 2L04A 5BOJA 2A9ML 1IC4L 2IPTL 1IAKA 1EZSA 1MHPL 3LDCA 1DQVA 3VFSB 4FQXB 4NQDE 1AQDA 4F8LA 3QUXA 1E4XL 2SEBA 3HNVH 3W38A 3LIUA 4BFGA 1IJNA 1TEYA 2AI0L 1FZJB 3OKEA 5INCA 4AENA 1T0PB 4U3HA 4DGYL 4WCYL 2MRYA 5IY5C 1GGYA 2NZ9D 4J2XA 2NY3D 1M7IB 2UUBO 2QGBA 4C47A 3DROB 5I1AA 1PNMA 3WG7C 1VSCA 1X7QB 4F8OA 2BINA 1JZDC 3FMGH 4B0MB 3IAGC 1H2NA 2YI9A 1HKLL 4OD1L 4OFDA 4Z7UB 5EZIL 4LH7A 1FO0H 2VN3A 4GIPD 3MRKB 4OGQC 5SX5H 1KCRL 3QWRA 4LPYA 4M8RA 1SA0A 5D7KE 1QFUL 2W91A 2NUTB 2IW5A 3AY4A 5TK4A 1OD7A 2ZUXA 4TV9A 4DZBB 7TAAA 3CDFA 2XRAL 1NTDA 5CSGA 1A6WL 1KACB 2YQ2A 3AWEA 3D9AH 4WEEA 3V5KA 4B3SB 4KRPD 3D36C 3AFLA 2P28B 4BH8B 2OJZL 1JV2A 1PZ3A 1J1OH 3L3OC 1W72L 2AANA 1MRCH 1ZT7B 5FO2A 1WICA 1CGSL 4BQ6A 5BMFL 1KB9F 1FH5L 5LA6B 2DQMA 3O3BA 4X9YA 2R9AA 5B1KA 4JG9A 3VWKA 3UO8B 2V2TA 2UYLB 3FSOA 4BSVB 2XACC 1IILE 2YXWA 5L2KA 3CLEL 4FGMA 2Y7SA 1X5XA 3P4OA 3DECA 3ME0A 3F2LA 2BSTA 4L9LC 4Z95L 4XP4L 1UYWL 3K3QA 5KYUB 2L7JA 2HUEA 1D2DA 1EZLA 4XOBA 3VXOA 4HCIA 1MCQA 3U7YH 2H2PC 3H1ZA 1Q0XH 4GY4A 4XO4A 5DGQA 2EADA 5KBLA 4DTGL 3L70H 1I5XA 3QFDB 4U1SA 3WTYA 2HKOA 3FU3A 4UTAA 4RAVB 1OWWA 3TWCH 1NDTA 4RMWA 4X65O 2O5YL 4FE9A 3GHBL 1CCZA 4J3OD 3B40A 1XF3B 3NAAH 1CIUA 1N12A 2IPUG 2E76B 3RWDB 3WS3B 4X7DC 1KD1W 4QPJA 1JK9A 1MHCB 5LQBH 3QNXA 1C08B 2CCVA 2HRPL 4JE4B 1NLBL 4X6CB 3RWFB 4IBUA 1I8UA 1BT8A 1ZTXH 1AYOA 2R0KH 1PDKB 1Z5YD 3DRTA 3RKPA 1Q9WA 5EBMB 2N05A 3LN9A 1RZKL 1ZA6A 4DK6A 4EVNA 3GLDA 2P80D 3NTCH 5DHEA 2H26A 3MREA 3K2MC 3VFMA 5DMJB 5D1QC 5B38A 4JRWA 3STLC 3IPBA 3QDMB 1TVHA 1XAKA 2IAMD 5H2BB 4MVBD 2VXVH 5IHZB 3U1SH 2WNKA 3UTPE 4A7SA 2J3SA 3BAEL 2BNRB 1ORQB 2X38A 3ARXA 5EA0L 2H32H 3BPCA 4AWJC 1P5VA 4MQ7A 1JPTH 4WRLA 5G5DB 3RPBA 5KZCD 1NAKH 3ZMNA 2DWEA 4Z3JA 1M71A 2R0WH 2VN5A 1I7FA 3NDYE 3U2SB 1U8IA 1M5IA 2PO6D 3H01A 2YA2A 4YHHB 1R3HB 3FHAA 4QMEA 3GB7A 5AYQA 2AJSL 1QPKA 4GG6F 1KXQE 5KWYC 1XL6A 3EZ8A 4GUPA 3HI1A 3BQUC 3T1HB 2QKSA 1S5IL 5LGNA 5IJ9B 4IS6A 4Z3IA 2FBJL 1CZ8H 2VN4A 3SE6A 4CVZA 5C09A 2IPKB 3B6SB 4U1MB 4LVOB 5FWQA 3LPGA 3UM7A 1K2DB 4CADB 4WGWB 1R5IA 1TUEB 1FRGH 2A38A 4DR5O 2XQYG 3U6RB 1V10A 4DV3O 1ZT1B 1N3NB 4GBXD 5SWQB 4AQ8C 4OD3L 1OQOA 3QTCA 5MHSE 3ML8A 3MRQB 3S5ZA 2HVBA 1N4XH 5C0GB 5IMMA 1A66A 3V55A 1RIVH 2MWCA 5D6CB 4I4WB 1BXAA 4HEMA 1S7TA 3H4HA 5KYWB 1KPRB 2XPGB 1FAFA 4CH6A 3HZMA 3GSVB 4YHKH 4F7EB 1JA8A 3CSYA 2ZONA 5FHAH 3JUYA 3MRFA 3R8QA 3T1FB 1V8HA 4ZW5A 5DHVH 3KYNB 1NFDB 2OMWB 4MLIA 3ABUA 1HH6A 5CMAB 1WFUA 2AQRA 3TFKD 8CGTA 3GRWL 2MCG1 5E5MA 4ZFOB 2FH6A 4M7JH 2V9UA 3N44B 3MACL 4AIEA 1XOUA 4BZ1L 5G4MA 4PJBB 5C0DB 4K9EC 3GXPA 3I6GA 1E3FA 2V7NA 3T3ME 2EYTB 4I18A 2VLJD 5GS1C 3OX8A 5E1AB 3UJJL 4RGNC 3AEIA 1S3KH 4XCNB 1LK2A 4ZQKA 1LO0H 2ZPKL 3GBMH 3A0BZ 4Q20A 4PLJC 5CD3A 1AIFA 5D7HA 1OJHA 4Z3FA 5FECA 1LO3L 1U8LB 5T5FA 5E4EC 5CJXC 2N0KA 3FTSA 3VRIA 2XWRA 3NJKA 1A0QL 1UH3A 5DO2D 3TZVD 5HYFA 2O5NA 1RUAL 3RB7A 3Q1SH 5DC9B 3TIDA 2AZ0A 1UFIA 4BSJA 4WHYH 4E9QA 5IKCB 3CCLV 3LEYH 4HMDA 1VERA 2Z64C 2P5WD 1BLNB 2XG4A 2PPFA 3D05A 4BH7A 4P30A 5ISZD 2E75B 5KX5B 1LUVA 5CSZB 2X9WA 4ZTPL 4HF5H 3QULA 3VI4E 2B0SL 4K55A 1KCWA 2JQMA 3BVNB 3EGDB 4LEXL 3S4SB 4A38A 1QD0A 2FO8A 4UQBA 3D3VA 3BUTA 4NRXB 4YHMH 1XSOA 1JHTB 1SF9A 4JFFD 3GMLB 5D1QE 5BNXD 2GAZA 5K5YA 3V4VL 3JV4A 3CC4V 4OGYH 4DVBA 4JI2O 2QTEA 2X88A 2JRIA 3BZEB 3JZ7A 2VQ4A 4NRZA 2DJMA 2DQHL 3F00A 1W0YT 5C3LD 4UCRA 5LMNB 1VDGA 4H26A 1GGIL 4JYAB 1OAZH 1WIOA 2DQFA 3KWTA 4C58B 2NW3B 4S1QL 2PTTA 1MSPA 3R4RA 4PJHA 1CD8A 5EWIL 2B2XH 1BJ1J 4QCIA 4AKQA 3IFPB 4NVPA 2BIMA 4NN5B 1XGPA 1AP2A 1AZVA 4Z8FL 2JCCE 5T5FL 2Z35B 2F1BA 5E4IA 2QVKA 3HMXA 4ZXBC 3L3KB 4O5LL 4ORZC 1JWSB 3DLQR 2BVOA 3P54A 3B4NA 5C0CE 3N27A 4JZOB 4Y7OC 4XB7A 1MHHB 2WWMD 3WAJA 3P3SA 4I9WE 4IHJB 4GRMA 2P5ED 3WNOA 1UPGA 3VFVA 1BG1A 3BH4A 3X17A 5GGTH 1X3DA 1XIWB 4TL4A 1FUNA 4PS3A 5B4MD 2E7LC 4NQCD 2JIXB 3JAMN 3ETEA 3OKKA 4RVBA 5DD0L 4P23D 4E9YA 1HSAA 4L1SA 3D0VB 4OF8A 4PCSA 1QUNA 4ASUG 4FA8A 3HE6B 4NKMA 3KLHC 2W5PA 4U1KA 2HVKC 5T3ZL 3SDDA 3WHXB 5EEYA 1EAOA 2IWFA 3EH4B 2BFVL 2QQKL 3MV9A 4PJ8C 3ZDYB 3PWLB 4DV1O 5JW3H 4Y1AA 5CEXB 1F4HA 3I6KA 3W81A 1E9PA 5C0RL 5I16B 1CLVA 5KAQF 1XNQB 4J6RL 2KLTA 4KXZI 5D7EA 1RJLB 3NCYS 2IFGA 3K71B 4ZOLA 5EK0A 1UJ3A 4PJXB 1M3JA 5HD8D 5MENE 1IBHA 3MJ9A 1U97A 2E4TA 3LQZB 3QPXL 4X1YA 5K9OB 3RYFA 1XBLA 1MCPL 1UXLA 1W8NA 1OANA 5BR8B 2UZYB 4NKGB 4DZ8B 4MDIB 1VESA 2X6BA 2CG9X 1MCWW 4CUCA 1AD0A 3FZUD 3BSGA 4RGNE 5JHLL 1J0YA 3VWJA 2JKRM 3C3TA 4JDVB 2EC9T 5DJZB 3O9WC 3RL1A 3QJTB 2BH0A 3HMXL 1FZJA 5AW9B 3TWYA 1A6ZA 4DK1A 2AVGA 3M46A 3FKSG 1B4TA 2OXHB 3T6WA 3LN5A 3VG9B 3BT2L 2Y7NA 2B1HH 4NHCL 3JV5A 4PPTA 2P6JA 4YSOA 5AYUL 4JI0O 4Z7NE 2AS5M 1IM9D 1QQDB 1P84F 1WNSA 3AAZA 3ZU8A 4Z7UA 4FXTA 2XKUA 1U36A 4GW4B 1CK0L 4L9DA 5F7MC 4LBEC 2ZWYA 3FAWA 4F93B 3BDYL 1JGEB 2HA1A 5A3IC 3HRZC 3IJ4A 4MZ2A 1OTTD 1CDIA 3ZZQA 2XZQL 4KFZC 1WAAA 2NUTA 3UH8A 1AR1C 4NQDB 4HULB 4QGTA 5CA0B 4CC4C 2QSTA 3HFMH 4JPWL 2I27N 2D2CC 1JK8B 1MFMA 1SY6A 4PJ5E 4A2HA 5GS0L 1RK1A 4Z7AA 1GJWA 3MLYH 1KEML 3ARGD 5IQOA 4OZIA 3WSQH 3QQ4A 1KG0A 1HK6A 4O4IA 5KBKA 4XPFL 1L0LH 2IDQA 5I71B 2HH0L 4X66B 5H37G 3MBEC 2NXYB 3BGFC 4FNRA 5EZPA 4BSVA 2COQA 4QHMB 4U6YA 2CRZA 1UXWA 4P57B 3S48A 1P49A 3S5LB 4DN3L 5JDJA 5DI8B 2PPDA 3ABMB 4AG4H 5I19H 4YPGA 1WB7A 1NAMA 3RJQB 3SBRA 4EBQH 1L0QA 3FUJA 5LLIC 2X7RB 1SQMA 2BCKB 3EO0B 4NO3B 1A7QH 2JJSA 3PF2A 4EN2A 2IAND 2O93L 2I69A 2EYSA 1RJCA 4PJAE 4WEBH 1HDMB 2EJ1A 3U0ZA 2NY1C 3FCGA 3QT2A 1KTLA 3FH8A 4ODXB 4D3CL 5E5UB 1RXLA 3IGKA 5HHPA 4NQVB 3ARFA 1NFDF 4JI7B 2D3LA 4QHNB 3EBGA 1AZCA 2L4OA 2WXFA 1JSYA 5F1KC 3SE4C 5HVWA 2XFXB 4AMKL 1KELL 3NH7L 4X6CA 3N44F 4N87A 1SY6L 1E90A 3QBTB 3RY6A 4F58H 4WO0A 4PJBF 4KXAA 1PDKA 5LVEA 1XR9A 2CDFA 2GT9B 3OGCB 2ZD0A 1H19A 1CT8B 4B9FA 2VJ0A 5I9QC 3QUXC 1G7IB 1DEEA 3ZTNH 5DJAB 2HEPA 1MJJB 3ETSA 3QDMA 3NGBC 2DIAA 2UY7A 3T0VA 4I13B 4LDCA 1SOQA 2XWCA 3WD5H 1GH7A 1JMZA 2GEEA 4LDOB 2BNRA 3UERA 2BLFA 3EUDA 2C3WA 3K6DA 2YEZB 3DIFB 2EIMB 1MFVA 2AXJA 3E6FB 3GM0A 4I85A 5AW4B 3W0WD 3PWPA 3OKOA 2HTKC 4X7SL 4LFCB 2W0XA 1GPOH 5HXMA 1I8AA 2BZDA 3CVDA 3SKOB 4HIPA 1Z3GL 4LSQH 1IM3D 5DQDH 3GTNA 3WU2Z 5D7JB 4I1NB 3F6IA 5GRVL 4WEUD 3CMOL 1ROCA 4QOKE 1D7CA 5IJ9A 2LV4A 5DDHA 3WY4A 2V3FA 3TEZA 3ZMUA 4N90D 5HY9B 4U1MA 2HG0A 4LSUL 2P4VA 1WGOA 1VFMA 4P06A 3W9DB 1K2DA 2XQBH 3CDGB 4N5UA 2WXOA 1ZT1A 3AUVA 2C34A 1Y7VA 2KZ1B 5E5RB 4JHAL 1J8RA 3MRQA 3OKNA 3ABZA 1RZKC 1L0YA 4G70B 3IVKA 1H2LA 2EDXA 1FNSL 1EWHA 3N91A 2BP0A 2DTSA 2XPGA 4FFWD 2V3EA 3KPSE 5I1KH 3GSVA 1M4UA 3QO8A 5IY5B 3E80A 3LZRA 3TA3D 5IFAH 2ZIMA 3T1FA 4J28A 3SY0A 4FN0A 3WG7B 3MRLB 1I8IB 5ILTH 1XNRB 2C7UB 2FYYA 4FABH 1JX9A 3HUJE 2A83B 3L5XH 4N20A 2R7EB 3SO5A 2R23B 4PR5A 3H3PH 4N8VB 2ITDC 3AXHA 4OGQB 2CUGA 2AF2A 4JKLA 1P7QA 5E9DD 4UNVA 1BJ1H 5D70L 2PI4A 1M6UA 1HHGA 3CRCA 4GSDL 4RDBA 5KAQG 5KJRH 2P7TC 2DIJA 4ZOEA 3HB3B 1N8OE 2NZ1A 3D0LB 1PU0A 2K7QA 3VD9A 4NQXB 1CGWA 3VQMA 2ZP8A 3HIZA 3BD3A 2EDRA 3NZ8A 3R4DA 1E3XA 1JR9A 1J9QA 1QA9B 3OXRA 4GW1B 2ZUVA 2XV6B 3F85A 3SD2A 4G27B 5KAFZ 4HETA 4HHWA 4WI8A 1XF4A 3HNVL 3CLWA 3KBEA 5FOJA 3BVDB 4G2AA 3EVKA 2VR9A 3DV4B 1TITA 2KPNA 4Y2DC 3L5WB 4KMTH 2CA3A 2UWEE 4LGPB 4F7MA 3QS2A 1EIBA 4RMVA 3RYCB 2ETWA 3U46A 2PKDA 2PXYD 1K5NB 3MZGB 3EH3B 3V0WH 1BLNA 3GXDA 5ADOH 1QR1A 3FMGL 1XI1A 5KX5A 2NY6B 4L9LB 4PJEA 1JXDA 5EO1B 3B5GA 1RQ5A 3WDIA 1GGTA 1FO0L 4QJ4B 4RQEA 2EC8A 2E7BA 4UBDC 2ERJB 3ZDZB 1DQTA 1UWXH 2OMXB 1N34O 4FL4C 1CICA 2EH7H 2GJ6B 1JHTA 4OCSH 2DWEC 1JPSH 4XO3A 1HL5A 2IGLA 2OW6A 4BFBD 5HI4D 2EIBA 4FFVC 5BZXA 3VXRD 1M90W 4P2CG 3UPRB 4XVUD 3I9IA 2DM7A 5GRYA 3CZUB 3KEDA 4EIGB 2FWLB 4CGTA 2P8LA 5IB4A 1J95A 4ZUWB 5EULV 1E65A 1NIFA 3P4NA 1J1OL 3U4EA 5IBLC 4Y2LA 1XXFC 4I3SL 3UL4A 2KSDA 4CMMB 1MRCL 3MLWH 2XETA 1EZUA 5KBPA 2QVMA 4G8EA 5LWYH 3UIZA 3ULVD 2VJ8A 1UT9A 1YUKB 3LVTA 1N2RB 2WA3A 3DJ9A 3QC6X 4LSVH 1Z7JA 3W9EB 5C1MB 4CU8A 1U8QA 1YCSA 3VI4B 3U9UB 1A4JB 5GTIZ 1MJ7H 4GRLA 4HFUL 4N25A 4YHNA 1I1CA 1KYAA 3L9EA 4HT1H 5IHLB 4GUQA 2GDSA 2F61A 2WQ8A 3MCLH 4N0CC 5CILH 5D1QB 3CPUA 3PDOB 3QO5A 2YWYA 3STLB 2XWXA 3V6ZB 2I9TB 3QDGA 3U7YL 3FAVB 2O57A 1Q0XL 2J56A 1MW1A 2Q7HA 4YDVB 2E9GA 3MHSC 4Q58C 3C87A 2K8MA 3CX5F 3OAYK 4AEIH 1SZXA 4K7PX 4AK1A 5AFAA 2XNAB 3LSOB 1YCIA 5IMOB 1AS8A 4LFHG 3TWCL 2VW4A 1ZWIA 5IHWA 4JY5H 4IGBC 1IEHA 5BRZD 1FNEB 2E46A 1H0DA 4U7KA 3OAAG 1A3ZA 2R2CA 4ANVA 3NAAL 2Q68A 5L2KE 4LHQB 4IEFA 2O1AA 4I9XA 1WBYA 2W0FA 4QRRD 2JCCB 4GX1A 3BQUB 4MVOA 3EYQD 4GLRH 3NOIA 2QPDB 3CUPA 4AYID 5I6XB 1ML0A 2CKBH 4O2CA 2FO4A 5LQBL 2K4WA 2WWNA 2C3GA 1AKJD 2VERN 4JDEA 3HLKA 4PREA 2V4LA 3AG4C 4B41A 3QI9B 2ADFH 1ZTXL 3QUYD 1FLTX 5K9OA 5CZXD 2DLFH 4FQXD 1I53A 5CIPB 3HRPA 2I5YH 4JKKA 3NTCL 3KPMB 1P7BA 3BI9X 1OM9A 3GSNB 1IGYB 2ZF9A 3QUKA 2R0LH 3C5JA 3L9RA 4NYKA 4E41A 4L5FH 4AQAB 2VW7A 5D4QA 4JDVA 4LLDA 1KT2A 4MX7A 2VXVL 1UWEH 3OQ3B 4X4XB 3U1SL 3CSBA 1D5BB 1SYVA 1JPTL 4EI6A 5IJBC 1NAKL 2HUHA 5B39G 1CL7H 5I1EH 3EBIA 1AHKA 3U0PB 3F64A 4MGXA 4BINA 4XN8A 1HQ4A 1F4AA 3QEQE 2OXGB 1TUPA 1IEAA 1S7XA 3WIHH 2AQ1A 2HLAA 2WUCL 4LKXB 5LKNA 1PZUB 1R9FA 1OSYA 1QOKA 4F7PB 2UZXA 3KE0A 1UB5B 4E68A 3MRIA 4P9HC 2ARJB 1G6RA 1FFTB 1CZ8L 3V0HA 5GS1B 2NR6D 5L4MA 3BABA 2FQDA 3MZTA 4RGNB 4U1LA 3SZKC 3KPRD 3ZDXE 5CA0A 2QMJA 3TT1H 4ATWA 1U8JB 4DW1A 4OVUA 1FRGL 4PRIA 1JK8A 2XV2A 3APQA 3O2WH 1Z9PA 4IOIA 4D8PB 1TO5A 3SOBH 3LY6A 5E4EB 1N4XL 4O2EB 2ZCHH 4X4MA 1JVOA 1RIVL 1Q9KB 4K5PA 3NCMA 2LW3A 3K8MA 4TLSA 5K1NA 1LEKB 3MNMA 1IDSA 5KHGA 5FDWA 4YHKL 3BT0A 2N1KA 4UQCA 3K58A 5BQDA 2ZWNA 3K81A 2ZE6A 2YXMA 3N55A 4N8UA 3WL9B 4Z77B 4OD2A 3AU0A 3NJIA 5IEHA 5E6YA 1V3MA 5C09E 4HH8A 4MJ6A 2WVSA 3KYKH 1MELA 4M7JL 1ZS8B 3P9MA 5FNVA 2BCKA 2EDDA 3HHSB 4P5KB 4QAMB 2XT9A 5FV2A 5JIHA 3HTLX 4F57H 2FQFA 2NSXA 2NY5L 2PR9A 3ILEA 4I0XA 3HS0C 1W2KT 1FNAA 2BO0A 1NC4D 4LRNH 4MNQE 4R96A 4Q97A 4NRYA 1ZGLM 3BH9A 2J5LC 4KVPA 1S3KL 5KEZA 1CD1B 3ORJA 4J8RB 1LO0L 3BAJA 3N40F 2B8OT 3GBML 3K8KA 1N32B 2OSXA 1EDQA 4Y9GA 2YGVA 1VCAA 3FX7A 3I6SA 2OAAA 2Y7QA 3EXJA 3HKFA 2QGCA 1JZHA 2VIRA 4HLZH 4PIBA 3ZHLA 3Q7JA 4C59B 5GS0C 3VX0A 5E9AA 5LGUA 3IJYB 4S0HA 3Q1SL 1BZ9B 3FL7A 3DGGA 1CLZH 1DBAH 4PJ9A 5TDOB 1E27B 1JZGA 3LEYL 5GGTA 4ZXBB 3DX9B 5BZWB 4ISVA 3Q4HA 3H7BB 5ITBH 2FJFB 2VJXA 4N1HB 4IJ3B 3EIFA 4EN3B 1MJJA 4KK6C 1OGAB 3MLRH 4KKBD 2YAEA 5MEQB 3VQ2C 2EZOA 2ED8A 1A65A 3FT3A 3MV7A 4BEIA 3N2GA 4YHML 3ZHUA 2H0EA 5IB1A 4ZMNA 5J11C 3RN4A 2EIZA 2KDGA 4MW8A 1SXNA 3GK8H 1TEFA 3B9KA 4OGYL 4WW2F 3F7VA 1A8ZA 5HJGA 5HJBA 4J1UB 3SCMC 2J88H 1MABG 4DP8X 2VUOA 3CJHA 3GI8H 2FBRA 3FU9A 1C16B 1BZEA 3O6LH 1OAZL 2DKMA 5JO5A 5DHMC 3AT0A 1Z5HA 4G6JH 3DDGA 3QVAA 5JIIA 2CR3A 2L6LA 2VDPB 4LHUG 4OZGA 3T3MF 3MFFB 4FHKA 5FOBA 3WFBH 2HT3D 2OMYB 3L7FB 2GY7B 3PP4H 4Q9BA 1AS7A 3S35H 3TBYB 2LP7A 3CFJB 1D5RA 4TUKL 2QFRA 2VE6B 5T3ZE 4RWUA 3QRFM 4X0NA 1E42A 2YK1H 2VISB 5C9KA 3ROOA 2ZF8A 4Y8DC 4JPKH 3DXAD 3PWUB 3WIFB 5GS2H 3PL6B 4QO1A 3RJOA 5AWNH 4FLXA 3U4BH 2DS4A 5JQHC 3LUTB 5GGTL 2O4EA 5LDSA 2P06A 3E0GA 2IV9A 4BIOA 4JUSA 3DOSB 5DA4A 12E8H 4ZO6A 3ULUH 2VR4A 2V7HB 2GK2A 5JNYB 4MJIB 4PG9B 2HMIC 4R3SA 4X9IA 4GFTB 1CFTB 3VI4F 4ZW3A 1CBVL 5DFWH 4G7VH 4DUXA 4PJIA 3IU4H 3GUTB 1LEIB 1AP6A 3D2UA 3GMMB 3MYJA 4ZMPA 2JS3A 2AEIT 2OP4H 4XPBH 3MJ8B 3JCUZ 3AG1C 4IIQA 3S96B 4K94H 3MDJA 4PVBA 3C6LA 1AR1B 3TBTB 5AB0A 1KLGA 2Z3YA 5I0YA 4OM1L 2OTWB 4PJDA 3ARYA 4QHKJ 3K2UH 3P4MA 4CH5A 3PQYE 4TNVF 1PCXA 3E22B 2EBOA 2F5AH 3Q5OA 4JY6A 1QA9A 4Y5YC 2O6FA 1NCHA 2YGPA 3BFWA 3BIBX 4GW1A 4Z5RB 3VYOA 4JYCA 4H1LB 5LB1A 2JWYA 3N2KA 3HVNA 3CFIC 4O2FA 2MOGA 1MZFA 2ALAA 1JD7A 4RA0C 3H53A 1K5WA 3GDCA 2H3XC 4Y1AE 3BGFB 3KDMA 4PRNA 4YK4B 3D48R 3N41B 4BDVA 4M8VA 3SZ6A 2PCPB 2D7NA 3FT9A 3UAEA 4B0MM 4OB5H 1K5NA 4ZMTA 2B1HL 3X3GH 1B06A 2JE8A 5EO1A 3KH4A 1WCBB 2EDNA 2F53A 1MWAA 4JFOB 1CD9B 1IC5H 3MUGA 3WUWB 2OI9C 4GAYB 1Q9OA 2GJ6A 2WXNA 2ZYSA 1K33A 1CGXA 3I02A 3EFDH 5TD4A 4YHPB 5AKSA 4F3FB 2NY1B 3C12A 3COOA 1JGLL 3Q3GB 4PVLA 3VGHA 4GW5A 3CB2A 2ZT9C 2ENQA 5AW5B 3PXHA 4AYMC 2AK4B 3HFML 1F51A 4YXLH 2Z93B 4TTDD 4YXWG 3ARPA 3GIZL 2P49B 4NHUA 1J8KA 1LK3L 4TQIA 2UWEB 3WXVH 4JY4B 3L3HA 3MLYL 2NSQA 1BXVA 1F86A 1A1NA 4JHUA 4CMMA 2X0UA 4GAGH 3OJDB 3WSQL 3C2SA 3CQPA 3E9UA 3Q6GH 1W72B 2PPCA 3U4KA 1ZE3H 1OO2A 5EBWA 4FM2A 1HWHB 4H8UA 4YDJB 2OULB 1EO5A 4PD4K 5CU9A 4W9GC 1KIUB 1KTRL 1F3DH 1Q82W 2ZXGA 5I9QB 3IN2A 4AG4L 5I19L 4FTVE 1Y74B 4IL6Z 4NO2B 4A6YB 4I1RA 4BQ9A 4EBQL 1LGVA 1VIBA 1WZMA 1T1WA 3NGBB 7FABH 1QPXA 3HC4H 1A7QL 2JIXD 3H2QA 1DFXA 4JPQA 3D4GA 1EXUA 5FGBC 2OM5A 1PSKH 1QLRA 2N0MA 1ILSA 2L7EA 2IJKA 3BW9A 3HE6D 4WEBL 4ZUUB 2LABA 4TXVB 3HKBA 5ANHA 3T3PB 2XNAA 4Z7NF 3RVYA 4B7EA 1MWAL 4HIHB 1XCQA 1UA7A 5HYQA 1BWMA 4OM0H 3RHWK 1KFAL 1G4YB 2K1EA 1AOHA 1CB4A 1MJUH 3GBLA 3PHQA 5FKPB 1Q6UA 5FYJH 2WGNB 5ANMA 1C1EH 1QZNA 2XKSA 3KH3A 4KGLA 2GJZB 1H3WM 2KUTA 3T0DA 5CS7A 1EANA 4BCXA 2G4GA 2ZCLH 3MV8E 1BJ8A 1YQVL 4HPYH 3RTLA 4DJMA 4ONHB 5CR8A 5DD1H 4BKSC 3B2PA 1F97A 2F5BH 2MQ0A 3K5RA 1NCTA 1F4YH 4F58L 1HL9A 2RQ8A 2GV9A 3QI9A 4U1GC 4N8VG 3KPLA 3CMEV 2WXMA 3NXSA 1A47A 3S6CA 4N23A 2A79B 5T1KB 2P9RA 2IMMA 2PWHA 3GFUA 5FA4A 3ZTNL 1PPIA 2X1OA 3T0BA 3DVFA 1X5LA 4LNUB 2X4RB 4I88A 3MJGX 3OAYH 5DRXB 3ZGIA 5EF3A 3WD5L 3EXAA 2NUPA 3NRFA 4DR1O 3FAXA 1XVSA 4X4XA 4LHUD 1D5BA 2EVGA 2R2BB 3UGUA 1GJUA 5CN3A 4XC1H 2NZIA 1RLWA 1BGYH 4R7VA 3GO1H 5C08A 4LCIH 3UDWA 5GS3A 1TJHH 2VM9A 1MAJA 4OW6A 2AGAA 1GPOL 3A6OA 3KBHE 5JDSB 4JM2A 5KBDA 1PKOA 1AXSB 3I2CH 2ITDB 2YD8A 4JGUA 4LSQL 3KVDD 5DQDL 4Q56A 2P8MB 2OMUA 1VKXA 5I8EA 2X4QA 5C7ZA 2YPVA 4XX1E 4CVXB 5MEOA 2G3NA 4HS6B 4NQDD 4PJAF 2N59A 4RMSA 4APQD 2GHZA 5FLVA 3DVGB 2X4OB 4RISH 1BECA 3EGSA 2CK2A 2C9QA 3IF1A 4ZMLA 2P7TB 1NGXB 4BRJA 2OZNA 5GZND 4ZFZB 3ETQA 2XQBL 4DGIH 5CZRA 2DLGA 4GLXA 4A63A 2X9ZA 5CKGA 3VXSA 4ELMA 5IEKA 2VDRH 2E47A 4D8PA 4X9GA 1JJ2U 2QTVA 1RUQH 2WB1A 1RIUH 2OR9L 3CCHA 4PD4J 1GMIA 1CDYA 4Y2DB 4MTFA 3QEQB 2G5BA 4KXZH 2DQ3A 1OAQH 1WSST 3FT0A 4YFDB 3RL2B 5D1ZD 2IQAA 1IBLO 2YMXH 4Z77A 1A6TB 4XN1A 5ILTL 5D7KD 2G3XA 1YEDA 2CDGB 1EVTC 2RFXB 2VL5A 4MKTA 4DEUA 3L5XL 4L1BA 4RMTA 4X80H 2G3ZA 4W9IC 4HOXA 1Y18A 4EKWA 3H3PL 1WN7A 5EU5B 3BAAA 4XE5B 3ZDXB 3SYQA 3WEOA 4FFYA 4FKKA 2APFA 2IPUK 5L8JB 1PNLA 1SDDB 2V5SA 5F88A 2E74B 5L3DA 3IDXH 5F1IB 1FVDA 2CLVB 4NX0A 3K03A 5A2LH 1JWMB 1YAZA 3VVWA 5F7DA 2XIBA 1SMOA 4NBYB 1PV0A 3NCXA 1ZWIC 3DSNB 3Q9QA 3BZ4B 4HUUB 4OVVA 2F74B 1L0XA 2P24B 1T04A 1YVLA 3DIVA 1DTOA 4YR6A 1NCUA 5B1AC 4XBEH 5C2UB 2W0FC 5DS8A 4WTQA 2JI2A 1KJVB 2FECI 3DX8B 1L5GA 4NQSA 4U7OA 4N2IA 5TTRA 1GZQB 3LPOA 1BX2A 3K0GA 5E03A 4KMTL 1DUZB 4HUWB 2GUOB 3MBWB 5F3HB 1CF1A 2X2HA 4TLKA 1MI5A 3V0WL 4JFEE 4ZBJA 3ZKND 5ADOL 1E4KA 3H1LH 1QSFE 3E8BA 4OIFA 4JGJA 1RJYB 1OOWA 3LVEA 4BWUA 2F2HA 2XWZA 1ET5A 1KCKA 3NK4A 4YC2C 4MNQB 4X8AA 4NT6B 1OGAA 1KZYA 2BVTA 5EYPA 5T33H 1JGVH 1F11B 5HI3D 2LFGA 3MROA 1HHHA 3QEGH 5DJXA 2EH7L 2H1LM 2HJFA 3WJMA 1SUJA 3NZSA 1SBBA 1JPSL 5HGHB 1QX1A 4DR3B 3BZDA 3ZXAC 3JD3A 3HUJF 1ACXA 4IGBB 3DTXA 3CC1A 4OZ4A 3V4VB 4UQ9A 3O9OA 3GLEA 1CU4H 3MR9A 3N41F 4RMQA 5D7JD 5A2KH 4YLQT 3PP3K 4BHUA 3VFRA 4TV8B 1KIPA 1WHOA 1ZRUA 4FCHA 3VUAA 3PABB 3CDZB 4HUVA 2EDMA 3MLWL 3BP4A 5LWYL 3OMIB 1T83C 3REWB 2XI9A 3ULSA 4KHXL 3R06A 4LSVL 1WDAA 2OX5B 3WNPA 1ZHNA 1R5VB 3UTPD 5D5MA 4ZUVB 2VDLB 4JHZA 4P3DA 4X62B 4HT1L 2HB0A 1XMOO 3MCLL 5CILL 1DLBA 1F3JB 3VMNA 4P5TB 2PW1A 1X5FA 2QR0B 2Q87A 2UWEF 3F7RA 2XAHA 3DVNA 4K4KA 1E5ZA 1ZTXE 2BERA 1QVFU 3T8MA 1F6AA 4MJIA 4PG9A 5D2LE 4U3SA 1YYML 4HG4K 4JY5L 3IDJB 2Z8SA 3I5DA 1Z9SA 4Y9EA 2VM4A 1JS4A 3PG2A 4MAYA 2DW4A 4ONFH 3QIBB 5DQJA 4OF6A 2OMVB 3D18B 4P2OC 3QORC 4HKJB 4B3MB 3RDTD 1XR8A 3QP3A 5MHSD 2CKBL 5IMLA 4XMKL 4JO8A 4L8BA 4ZOAA 1Z5WA 1U4FA 3VGGA 4WUKH 2Y5TB 4RIRA 2OTWA 2ADFL 3WKYA 4GUOA 4F9PA 2BCMA 2DLFL 4J12A 5HYJB 3US9A 1UUSA 1FJ1A 2CGZA 3E22A 3BSZA 2I5YL 4LP4A 2EH8H 4M4RA 2CO7B 4HCFA 5CGYC 3VFWA 3RFRA 2A73B 2F95B 3AQZA 4F7CA 1ZJBA 4ANXA 1IE5A 3H9VA 3DUSB 3FH5A 1TT6A 3FO1A 1BIIA 1NOFA 1UWEL 2WMPA 2V2WB 3RYIB 1UC6A 2PLTA 3TETA 5K93A 1BOGB 1I1YB 4YFLI 3ECBB 3B9EA 1HI6B 5I1EL 3EH2A 2J8UA 1QU7A 1TQWA 3C08L 1I9EA 1QEWB 3AMLA 2BY1A 5I6PA 4E9XA 3GUFA 1Q72H 3LZNA 3BN3B 3TX4A 1LHZA 2QJDA 4YEEA 1O5PA 3WIHL 3LMJH 4WNJA 3DMMC 4KDWA 4UIKH 4MJ2A 3WUWA 1WE5A 4A5UB 4GAYA 4L3EE 2JB6B 1I82A 3PQYB 2YD3A 4PDRA 4PP1C 3O3AB 4Z9KB 3D85A 3MMEB 1KXVA 3VXNA 2VXQH 3F7LA 3E8UH 3RWEA 3F7VC 2PYJA 2J5LB 1MRDH 5ESVA 3TT1L 5T1JA 4H25A 2Z93A 3TO2A 1DQQA 1KB9K 2Q8AL 3RKDC 5DFAA 2CJTA 2LGQA 3VD1A 4LCUC 2H9GB 1AMXA 3O2WL 3SOBL 3CPLB 5F6HJ 2WXQA 2Y36H 2ZCHL 4OI9A 1HZHH 4HJTA 2UUAO 1NFAA 2Y1YA 4QHLB 2N74A 3BCDA 2XXCB 4DP9X 1HNGA 3GGWB 4Y16A 3RU8L 4HUXA 4NUJB 2JQAA 5IF0B 2ESVB 4HJ0C 2RCSH 2VR5A 5D1QD 5KSAB 1GR7A 2Y2YA 1D5NA 4U7MA 5CHNB 2C1OB 2F54B 1SQXH 1LXMA 2ZYRA 4KDTA 3HR5B 4NO2A 3KYKL 4P46C 2E9BA 3N6YA 4GYBA 2EABA 3PJLA 4F57L 3W7TA 3ESMA 3UEQA 2DLEA 4HG4J 2B59A 3PUCA 3QR2A 4YDKH 4MVZA 3LEXB 4KMQA 4X4ME 4N8PA 4QPEA 4D0BB 4LRNL 2YFNA 3L8QA 5EIIA 4HIHA 1UCTA 3ZMTA 1VGKA 3US0A 2ZDIA 1LNUA 5FKPA 2QA4V 3BQUD 1DHKA 4NEHB 4K7PL 4KHPB 2JJTA 1CE6B 2MPVA 5C0CD 1E2WA 4QGPA 1WHPA 1MDAA 4I9WD 3AK2A 4BA0A 3C6LC 5IQMA 5C7XH 4FTVB 1SZTA 1Y66A 3D8CA 5JW5B 3M8OL 1AG0A 1DUYA 1CFNA 1CLZL 3JTTB 3VD7A 2A9BA 2VN7A 3HG4A 4KTEL 4OBRA 4WFGE 2ADGA 3VE0B 3EJCA 3QQ3B 2GC7C 4WKZB 2W9DL 5CWSA 4BJLA 5ITBL 3P3RA 1U95A 3QH3A 3CHSA 3V6OC 4L8DA 2HSIA 2YC0A 1Q4NX 2AEPL 3MRMA 1PLBA 4CJ1A 4XCFH 3FONB 2KL6A 1I3RB 1D7DA 3ARRA 4OZHB 3UC2A 1HXYB 1C8PA 1ETJA 5FWRA 2ZR2A 1T5KA 5EOCL 2TSAA 4YHOH 2R2BA 3GBNL 3ZCCA 4YSCA 4F7TB 3IRZA 3BH8A 1CG9A 2E7CA 3GK8L 3O3EA 2IALB 2OQJA 5ALBH 2J88L 3MV8B 3UTZB 4H1LG 1X5ZA 2NLJC 3UTOA 2FJGB 3GI8L 3A6CH 3ROLB 5MEND 1ADQA 3SODB 1WZLA 4MVRA 2ED7A 2I60H 2X4NB 2W6IG 1IL1B 3HG1B 4ZTEA 5HDLA 3QFJA 3QEHB 3RQ3A 5BVPH 1YMMA 3WFBL 4LMQE 4RGND 3U83A 1EH9A 3T2LA 1KB9J 1PY9A 2DI8A 4PLJD 3S35L 1NGXA 1Q0EA 2ZXEB 4P2RB 4RRPG 3K4DA 4JRXA 4QXTB 3B3IB 3OQRA 3CLFH 5FYLH 1XV8A 2A7BA 4Y5YB 1NGQL 3FBQA 1CGUA 1BXUA 2ICWJ 4R7DA 2VLKE 1CPUA 3ES6B 4Q89A 2VRAA 3PDGA 2QPUA 1WC7B 1FKAO 3C6SB 4LL1A 4PJ7E 5ADPH 3H55A 5IOPA 5AWNL 2A06H 1NOAA 1OM3H 3DPDA 1EN5A 4TLTA 1KU9A 5DJ8A 5K1PA 4O4LB 4YDLC 5EBWC 2PTMA 12E8L 3D4YA 1U9KA 4UAOC 4OCNC 4U33A 4GXUN 2YBGA 3V8OA 3LN4B 2ATKC 2W9EL 2CDGA 2RFXA 3GTVA 4JRYE 3SKUD 2ZAIA 3UBXI 3OUFA 1RSFA 2CSPA 1B0WA 3CCJV 3OF6A 4G7VL 5FPIA 3VU1A 2ZM6O 2O61A 2EEXA 1VF5C 3IU4L 1P6AB 1Z9NA 3CH1A 3QJXA 4MZ3A 4FJCC 2OI9B 3K80A 4K2UL 4PJ5D 4DV4B 5DWUH 2OP4L 4XPBL 5IVXA 5BZBA 4AT6B 3DYMA 1HQRB 4K94L 1BZ7A 4J7JA 4N0FA 4QXGH 1KMGA 2ZT9B 2HFTA 2CTPA 3G6DL 2NNAA 2VDNH 1A6AB 2F5AL 3BAXA 3GBEA 1KEGH 5CA3A 3RWHB 4EUPH 2DQGH 3B4SA 3BFQG 4HGMA 1SKVA 1GIGH 2XBTA 2VC2H 4ODSH 1HHIB 1GZQA 1N8ZA 1H6FA 3KCPB 4NO5B 4MCYA 5AVQB 4ZXBD 3P77B 3LB6C 3VXQB 4AYFB 4C4UA 3RGBA 1P4LB 1KXTA 2I85A 1UCBL 3ZHRA 4BQBA 3I75B 1BM3L 4NKOB 1B9ZA 4OB5L 2V5TA 2VQEO 4L29B 4PLKC 1HL8A 2X70B 3X3GL 4WU7B 2CUMA 1FFOA 2A6KB 4JANB 2A0LD 4EO5A 3T1YB 1MVYA 5ETUA 4PJDE 5IW3A 4MMXC 1UM6H 3WFZA 4N9GA 4EOWH 5F7WC 4BK4A 1IC5L 3IDUA 1QAWA 3RUGA 5JIQA 2K1MA 1FO0B 4AGPA 1ITCA 1BE3H 2XA3A 4P3WA 4WK2B 1HXMB 3V6OE 5I75B 2MCAA 3KPNB 3EFDL 4E0RB 1WAEA 4OFIA 3M8AA 3KLHD 4FQCL 3WDHA 5BMVA 2UY6B 4NZDA 1FAIL 2APWA 1G6UA 1FG2B 4UILH 4Y5XA 5H35B 4PJ8D 4JKWA 4WGKA 1XTMA 3HR0A 4JYYA 3DHJA 4JM2C 3VQXA 5JJJB 4YXLL 4FQIH 2NNFA 3OHXC 2EIKC 2WBJC 3I84A 4ZS7H 4I55A 5LBSA 1SJEB 4X89A 1TZHB 3AS2A 1OCOB 2FL5A 3KHQA 5EBLC 3L1OH 4ZT1A 3U0TB 3V0DA 4JFEB 1NCOA 4U1JB 1QSFB 3OW2U 2OJEA 3D4ZA 3EFOB 3Q6GL 2FUTA 1JNLH 1WA8A 1NUNB 4XPAH 3VH8A 5JA8B 3T65A 1SVCP 3VGAC 5F89B 4FPPA 3HE7A 1QR8A 4DF9A 4ZG1A 3O9WD 5EB9A 5KSBA 1MZZA 2FO1A 3CZKA 7FABL 3HC4L 5E6RB 3MCG1 1SMDA 5K39B 4S2SB 4BZ2H 4LCWA 5DJCB 1VQOV 3NCCB 2C3XA 2C4FT 2FVNA 3QW9A 3RY4A 1PSKL 2OMTB 3M6DA 3VYNA 5E51A 1OARH 3UBGA 4QOKD 1TKWA 1ZT4B 4RFOH 4DUWA 2N4IA 2HLDG 4OM0L 4HS8H 2P48B 1U8NA 2WKLA 5LAXA 3TYFA 1MJUL 5DM6V 2Q3AA 2ZX5A 3WN6A 3ZKXC 5FYJL 5HHNB 5A3ID 1C1EL 1RZFH 1OE3A 1ORSB 2ZICA 1B04A 1AROP 5EUOB 3MXWH 5ICXA 5IK3B 2ZCLL 4HPYL 5CN0A 1AR1D 4X7CC 5KJ4A 1AGBA 1GY2A 3D34A 3MI6A 2ZQKA 1H15A 2WO2B 3ARDC 4JFPA 4V2BA 4YHLH 5C8YA 2F5BL 5DD1L 3GLAA 4YVUA 1F4YL 2Y5TA 3KVPA 2X2UA 4PMFA 1RHHB 3UMTA 3KPSD 4WHTA 2EDEA 2R51A 3LV3B 3VXMA 4PRBA 1UOLA 4WJ5B 2XWBB 4I2XE 5I5MA 1AZBA 1CF8H 3MBED 5JCOA 3ZZSA 3IDIA 2UUBB 4ZW7A 1TTBA 1I5YA 1YAIA 2BWDA 5ANME 4NR1A 1XGYH 4ELKB 5EC1B 1P84K 1HCYA 5CZVH 4U1NA 1NDGA 4XC1L 2FZ3A 1I1YA 4OY9A 3GO1L 2Y2TA 3IC7A 3Q6FB 3VXTB 1HI6A 5FYJU 3FQ1A 1E4KC 1TJHL 2P90A 2H32B 2ZSVA 4JO5A 3CJJA 4M6AA 4QHUB 1INEH 4RZCB 1IIIA 5SX4H 2WZAA 4JO2H 3CFKB 2RN9A 4GIOA 4ABVA 5DEFB 1NGZA 4AQ1B 2F23A 2XHNA 3F8UB 4OKVB 3H3KA 1EFXA 4OPHA 3M7FB 3MPCA 4Y5VB 4C4KO 3W1ZA 5KSUA 3WFHA 2Q67A 2FDBP 2NY1D 1E28B 4U6XB 1M7UA 3OKYA 3MMEA 3M1BB 4RISL 5CBHA 4Z7QE 4JGNA 5GGRB 3IT8D 4NQEA 5TDPB 1BSMA 1T1ZA 4ZS6C 4CNIA 5FF6A 4LEBA 1LE9B 2WSPA 3FHEA 3OLIA 4DGIL 1SQFA 3H56A 1YVWA 2R83A 1KKCA 4Y4KB 5JHBA 2YR3A 1D6EA 2VDRL 4L37A 3WE6B 3EDEA 4XBGA 1RUQL 2OCHA 5FX3A 5IQ9A 1ADWA 5EZYB 4MNGE 4PW9A 1BVZA 2G4EA 5FO9A 2P8PB 5J56B 4BFIA 1OAQL 1MZYA 3U1PA 3DPBB 3LKOA 5FLXN 1MCIA 2FQGA 3WTSA 5IF0A 2ESVA 3KWVA 2YMXL 3QUXD 1DSFL 1DTUA 2WTRB 4MD0A 4W9LC 2YSSA 4ESKA 3G5VB 4ZPVA 4X0KA 5DGRA 4G6AC 2YPKB 4AZUA 3S3WA 5DHVB 2VITB 3HR5A 4YIQA 2OTJV 3UQ8A 3RWCA 2F08A 4XI5C 5EU6E 1DCEA 5E8EA 3QIWB 4NSKA 4PJFA 4BKTC 4M6NH 3UCRA 3IDNB 2BE3A 1FNGB 4J3VA 4X65B 3IDXL 3X1FA 2ZWZA 1Y6MR 2HTKD 1NMCB 3LZOA 3W57A 4NXKA 4GKZB 1U8CA 3IJ8A 1Y6XA 3I9AA 4R6ZA 2ITCB 4LF3A 4KDVA 4MD4B 1F90H 1LWRA 3RFZA 1AO7B 2WLLA 1LWJA 2IBZY 1ZHKA 1YHQV 3FOMA 2Z91B 2APSA 5CFHA 1S7QB 3CVBA 5JIPA 3U9PL 2NXZC 3UJIH 4EMZA 2FWOB 3ZYIA 4MMYA 1CDBA 3EADA 4U4IA 4XVTH 5D9SA 4MLSA 2I9LB 4QRSB 2X41A 1A1MB 4LVNB 1SHXA 1A3LH 5C8JA 5JW5A 1JPFB 2MOQA 3MRGA 2BIHA 3QJFA 1MSWD 4KNUA 4FQHA 3QHZL 1LEGB 4I0PA 4HCRH 5T1KD 3WJLC 1SERA 3V52L 1OT1A 3QQ3A 3KYOA 3HKDB 4GKOA 1DVFC 4LF4O 1V5JA 4L23A 4W9HC 5IG7B 1CXEA 2VMEA 1MCSA 1ZLSH 3M99B 3DUHA 4XNDA 4PVMA 3L6FA 1P84J 4ZUTB 4G5ZH 3ZUNC 3TEUA 1CLYH 2VKWA 5T33L 5TE6H 1JGVL 3DV6A 5L2KD 1PQZA 3QEGL 1VCBC 1YY8B 1U3ZA 4L3AA 4N2NA 5L2JB 1HU8A 3HS8A 3OR7A 1KJ2H 2XAGA 4ZTOH 1F1AA 3PREA 1K85A 1O6SA 2BZCA 2DAVA 2EDYA 4R5VA 4AQEB 5JMOC 1CU4L 2PW2B 4GRWH 2E3CA 3DRQA 3DC6A 4PVNA 4M61A 1AACA 5DJYA 3X3FH 5I1GH 5ECGA 3MRBA 4EPSA 1PZ5A 2IF7A 4P2OB 5KSVA 3QORB 1KCVH 4XXWC 1MMMA 1QTPA 1M7DB 5IQ7H 5JVDB 1KC5H 1HNWO 4ONOA 4H0GA 4DR5B 2JJ2G 4DV3B 5EU4A 1DLHB 4HK3J 4Z1PA 3BE1H 4M4PA 1M1XB 5KVDH 1BPLB 4P2RA 1BA9A 5KYYA 1RZPA 3GSQA 1IBDA 2NTFA 3T2OA 1J0JA 3BD5A 2PYFA 4L2YA 4OLVH 3ILDA 2KI6A 5KOMC 3T4AC 5F96H 1AE6L 5D96C 3DA0A 3DARA 4Y2DD 1HILB 3QEQD 5TDNA 4R97B 2N01B 1E43A 1TQCB 3R1GL 4XPHH 1SEQH 1WH0A 1A32A 1ND0B 4LPVA 2ADIA 3KJ4C 5BOZG 2R2HB 4MQXC 3RBGA 2WANA 3E35A 3MRCB 3BP6A 3BKCH 1RLBA 4LL4A 4UBDD 3VSTA 2VXQA 2MHAA 4XTRC 1O9GA 4RWYH 4TSAH 1AQHA 2D73A 5D5ME 4ONFL 3DMMB 2YRZA 1EAQA 1RP9A 5KYXA 4Z7WA 1H2KA 1FIGH 4R2GC 3H42H 1AAJA 4FFVD 1A1OA 3ZO0A 3V0VB 3T09A 4DV7O 4AL8H 3FO2A 2VLKB 1WLEA 4GX0A 4QLWA 4HX1A 4PJ7B 3JASB 1BFTA 1I1AC 1OB1A 4ICXA 5CINH 3HCVA 4IDLA 5IBLD 2FTKA 4LCUB 2R59A 2EH8L 4J41A 1FFPB 2JJTC 1U91B 3OB0H 1G94A 5IJCC 5IBTH 4YZFE 5C09D 3BA9A 1D9KA 3VFNA 2G0LA 1W9XA 2XT1B 1LTXA 1HHIA 2LE9A 4JRYB 4LGSB 5AZEL 5I8OH 3KCPA 1I7RB 4FC3E 3VQYA 5CAYB 1ZIBA 4M3HA 1SF3A 3MA7A 3K08A 4YPJA 4AYFA 3G9AB 5FM4A 1OAJA 3UBFA 4N0CD 5CLWA 4HKBB 5GSVA 2FEJA 4XBFA 2CRMA 2IBBA 2WNGA 3AXIA 3VRJB 4Z1VA 4B9JA 4RRPM 3KLQA 4JUTA 4MNQD 3NFPA 4JANA 5JXEC 1AZZC 3ULUC 1Q72L 3FSZA 1UD3A 4G1EA 2WXLA 4P46B 2MQGA 5IROC 4JGMA 1CP9A 3LMJL 3UROR 1K97A 4UIKL 1I8LA 3GINA 3CSTA 3QJUB 3T6VA 4GXVH 2UXVA 2VXQL 4IGBD 4OI8A 3E8UL 5D2LF 4JASA 3UC0H 2WINB 1MZEA 2JSFA 4OZFH 3T5WA 3IDGB 3NSDA 4K94C 1FFNB 1NOLA 1BF5A 5FK9B 2BP8B 4ZRGA 2Y9RT 1JN6B 3PGDB 1QWHA 2D7PA 3FQNB 3UG5A 1L3NA 3NRQA 2E7MA 2GSIB 3IFLH 3LIZH 5E8NB 1HZHL 2QWOB 1XCWA 3F7KA 4U1JA 2R8SH 4EIUA 3KKYA 5IYCO 1FG9C 3VMPA 2E6PA 4AM0Q 3TS8A 4TSCH 2RCSL 4B5EA 3H7LA 1TENA 1G1OA 1I0HA 3DK0A 4JE0A 3QQ9C 1OCWH 4Z0BL 5T1LA 2WQSA 2AGJH 4Q4EA 4XMLH 4XDLA 3MUJA 3CX5K 3W39B 2Z92B 4WV1C 4LCYA 1DFBL 2HPOA 4TQHA 4FNUA 4YDKL 3G5XB 2ADQB 1V3KA 2ICCA 5CA1A 1DSWA 1QBZA 4DV1B 2BSBA 4E4EA 4IMLA 1HT6A 2NLJB 1JNHA 4U0RC 4X8CA 4DPAX 4NAJA 5T3ZD 5HHNA 4HUNB 1UKSA 1BZQK 5EUOA 5E56A 1IUZA 3X14B 2R0ZL 4L48A 3N9GH 5CP7A 3L13A 4K73A 3ZRSA 4Y9CA 2VDQH 5E70A 1T21A 4LEEA 1UKTA 4XX1G 5C7XL 1SXZA 3B9AA 4HIIA 3RVTC 1KNOB 1RAMA 4OJAA 4PAZA 5IESH 3R18A 1KTJA 1BZ8A 1WEJL 2BXYA 1OSPL 1ZE3C 5FXCH 4ZMXA 3V9CA 4WJ5A 2EZPA 1IBZA 4YJ2B 1KIRB 3OL2A 1F13A 3DJTA 3ZZLA 3P30H 2DB8A 4XCFL 1ZDSA 2WP3T 3NJFA 4UOW0 4TSBH 3L3GB 1EAPB 5HJ3B 3V5DB 5HHME 2XX1A 4XWOC 3N04A 1NCWH 2VMCA 2ZYIA 3A47A 4YDLB 3FYEB 4Z18A 3R7RA 4JI0B 4JDTH 4YHOL 5LBQA 1BZKA 4AYDC 5EN2B 2PGGA 5I23A 1C7SA 4H2CA 4UAOB 4MA7H 3C3SA 4I7ZB 3H9YA 2G38A 5ITFA 2BSRB 3QXUA 1M2VB 2B15A 2CIKB 4QLRA 1ZXKA 4EI5A 1BGXH 2COVD 4JLRB 3IMTA 1YN6B 4RUEA 1COBA 2A74A 1VF5B 4AQ1A 2I60L 3PQYD 3KPOA 3AM8C 2NY2C 3PV7A 3AG3B 5BVPL 1N0XH 1E28A 1ZMYA 1MLBA 5LOVA 2WXGA 5BW7C 3QO0B 3ULUE 5LN4A 2DQUH 4NZRL 2IBZH 2VTFA 3T8XB 4I2XB 4ETQB 4Y5XC 3K06A 4BQ8A 1TQSA 2GJPA 4RGOH 5BS0E 3CLFL 2CRIA 2DQJH 3MO1B 1ICTA 1A9EA 1T22B 2HYMA 2OK0H 2VXTH 4YAQB 2XNDG 4Y2OB 4JFHE 3CYOA 3HPLC 1AS6A 1X5KA 1JOIA 3C9NB 5GS0D 4X99B 1J5OL 3QDJA 5ADPL 2BIQA 1OM3L 1UXSB 1A3RH 1MFCH 2R1WB 3DX7A 4FFBB 2P8PA 3BOVA 1WFNA 4I50B 4ZIBA 3W5NA 2J44A 1JZIA 3WBDA 1BYPA 5GJSH 1DBMH 4AI7A 2RAMA 3QFJE 1U8HA 5CJ8A 1BVLB 1SHSA 3FO9B 2ZP0T 2ZOWA 4Z7OE 3CX5J 4KK6D 3CRAA 1JUFB 2AV7B 1SQBH 4H5SB 2Z4TA 3JVGC 4H44C 4MMXB 2RTTA 4Z7QB 4JRXE 1J10A 1ZVYA 5HFMA 3POHA 3QIWA 4JZNA 4MFHA 5HPOA 5DWUL 4HBNA 2YKLH 1L3WA 4DQOH 1GXEA 3B34A 3U79A 2Y0IA 1T1XB 4ODWB 3SCMD 4WCEV 1TUBB 3HC2A 5F9AC 3SOTA 2LFEA 3GSRB 3VM5A 1HKFA 4EXPX 2ITCA 1KY6A 1NSNH 2AKRA 3EFFA 4MD4A 1ED3B 2CQVA 4MNGB 2F15A 2VDNL 4FFZH 3OHXB 2WBJB 4Q9CA 3RWGB 4HWBH 4O51A 1UKQA 2QZQA 2DICA 1F1GA 4BW5A 2JJUA 4XP5H 2DQGL 3I74A 5EBLB 2JH2A 1GIGL 2VC2L 1FH2A 3MOBH 4FTVD 2MNWA 4ODSL 5E24E 3UACA 4XXDA 4KQ4H 3KNBB 2I9LA 1UVQA 2FD6H 2P26A 3GZPA 5CN1A 4OV5A 4X4YB 1UQSB 1MCRA 3IN0A 4XVSH 5EU6B 3RX9A 4DK5A 3VGAB 3PE9A 1OAYH 2JF1A 3FULA 4WSGA 2BOCB 1AI6A 4HSQA 4PJ7F 1QASA 1GYAA 4EOWL 1MXGA 4JZJC 4ZUTA 1WA1X 2GUZA 5JCOC 1I9JH 4RMRA 4FQLH 3UT5B 4O58H