3ASNB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asnB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asnB02
1JVLA 1NDTA 1R1CA 3WNJA 2N0MA 3ZIYA 1HFUA 4AKPA 4HCIA 4G70B 2PLTA 3QJVB 4HAKA 5AZUA 5PCYA 2EIKB 4A2GA 3NJLA 2VMJA 2BP0A 4NERA 3BQVA 2OCCB 3GYRA 1KDIA 2Q9OA 2IDQA 2ZWNA 3ZBMA 2DYRB 1IKOP 4W9ZA 4UANA 1A8ZA 1GS8A 3CZUB 4PAZA 5B1KA 1BYPA 3ABGA 2B3IA 1L9PA 2XXFA 3FYIB 5D4JA 5E9NA 3TBBA 3OQRA 3UAAA 1SJMA 1FA4A 4BWWA 2BWIA 1DYZA 4ENZA 1KBWA 2CCWA 3X1GA 2R7EA 3H4HA 1PZAA 1IBZA 2XX1A 4DP5X 1AACA 3PAVA 2GC4C 3EHBB 1AS7A 2GC7C 1JXDA 4QKTA 3AG3B 4CSZA 2FNWA 1NPNA 1URIA 3L45A 1KYAA 3FT0A 1GS7A 1ASQA 4A2HA 2PPAA 2I85A 1BXUA 1A4BA 4NAJA 1W8EA 1BQKA 2GB2A 4GXFA 1HAWA 3X2QB 3AZUA 3QJQB 3FQ1A 1CUOA 2HLEB 2UXGA 1SHXA 3N55A 2YAOA 3EF4A 1ZIBA 3AG2B 4E9SA 3UGEA 2EIJB 4JKNA 1PF3A 3FQYA 4AKQA 3TA4D 1PZBA 3NYKA 3OMIB 4DP6X 3ABKB 2GI0A 2EINB 2DWSA 5I26A 1NIFA 1DZ0A 4E9RA 3UABA 1J9RA 3QQXA 2FQDA 2FTAA 4E9YA 3QPKA 1ZIAA 2PP8A 3G5WA 1JXFA 2B08A 3FU7A 3CDZA 1AZCA 3FSWA 4E9QA 1J5CA 4G71B 4DP2X 3ERXA 2WSDA 4BXVA 4YSEA 1YLBB 1IBYA 4KNTA 1AAJA 2XX0A 2HX7A 4DP0X 3WIAA 3CVBA 3EH4B 1KDJA 4DP7X 3S3CB 4WKXA 1OE2A 2PPDA 3PXLA 5I28A 5TK2A 2VM4A 1EHKB 1A3ZA 2IH8A 1JZGA 2FQGA 2YAMA 3FSZA 1N68A 3EH3B 3PPSA 1MZZA 2IDUA 2EILB 4GYBA 3V9EA 2HXAA 2XLLA 5B1JC 2QPDB 2YEVB 4HCFA 1JERA 3DIVA 1JVOA 5F7BA 2XV3A 2H47C 1J9SA 1NIBA 3OM3B 5I6MA 2EIMB 1AG6A 2BP0B 4BDVA 3DTUB 1GY2A 5AKRA 3FU8A 4QLWA 1CURA 2H5UA 2J55A 1AZBA 1W6WA 4YSAA 2W88A 5B7MA 1AOZA 3ASNB 4N4YB 5B1AB 1ET7A 4YSCA 1L9SA 4BWUA 1L9QA 3KW7A 3UACA 5TK4A 2HX9A 4AKOA 1CC3A 1SF3A 2RACA 1SDDB 4YSPA 3T6WA 1BQ5A 1ZV2A 2R7EB 3NJMA 3NSYA 4E9WA 3TASA 2XWZA 3NJGA 2PCYA 3IE9A 1ADWA 1ID2A 3D12B 4A2DA 1TEGA 3NJKA 3HEIB 1L9OA 2X88A 1OV8A 1NZRA 2YXVA 2CBPA 3FQ2A 3AG1B 4W1TA 4YSTA 3X1FA 1WAEA 1XMEB 4KOBA 2VSKB 3WI9A 3SBQA 1OCCB 1JZFA 1OF0A 4YVUA 4JHVA 2HRGA 1OCRB 3FPXA 1AZUA 4DP1X 3NT0A 1KGYE 1PAZA 7PCYA 2IDTA 5F7AA 3GDCA 1J5DA 1ILUA 1MG2C 3IN0A 1XB6A 3TBCA 3RYMA 1F56A 4L0PB 1JZJA 4AX3A 1PCSA 2YQBA 2AZUA 5B1JA 4FAAB 3PAUA 2UX6A 3NSDA 1GY1A 2QT6A 4HHWA 4YSQA 1BQRA 1AANA 1NIDA 1PY0A 4RH4A 4P5SA 2IAAC 2CJ3A 4NB7A 3FPYA 2MTAA 2XU9A 1XB3A 3NJNA 1WA0X 4GP4B 3X1EA 1A65A 4A67A 1SFDA 1L9TA 1TU2A 2BP8A 1ZPUA 2VM3A 4TXVB 1X9UA 1BAWA 5B1BB 1PLBA 2QDVA 4HHGA 4KO7A 3S8FB 3T9WA 1RCYA 1FFTB 4HALA 2NRDA 4M3HA 2OV0A 4DPCX 1CYXA 3ABMB 1E5YA 1OOWA 3NJHA 2VW7A 2WO2B 5ANHA 4A66A 1NIEA 1SFHA 3FU7B 3CDZB 4G7RB 4KO9A 4F2EA 3NSFA 1QLEB 2I7OA 3AW5A 2XVBA 3PAZA 3QJUB 2PP9A 4HIPA 5I5JA 2X87A 3SBPA 2GBAA 2UXFA 1PNCA 1RKRA 4A2EA 4F7KA 1KCBA 5AFAA 2Y69B 3AY2A 2OJ1A 1OCZB 1M56B 2XUWA 1NIAA 3WG7B 2Q5BA 3DKHA 2VW6A 2AVFA 2JKWA 1TEFA 2I7SA 5I6PA 1NICA 2YAQA 5D4HA 2AANA 3FS9A 3JTBA 3SQRA 1M9WA 2LLNA 3FYEB 2FJSA 2BW4A 1IUZA 1WS7A 3UAEA 2YARA 2BW5A 4Q89A 2XXGA 2FWLB 1IC0A 1V10A 2TSBA 3IBOA 4BDVB 1MDAA 1MZYA 4E9XA 4YSDA 2QDWA 2FT6A 2XYBA 5I5IA 2IWEA 4JHUA 1GS6X 1V54B 2CAKA 2FQEA 2PP7A 5B7FA 3AG4B 1N70A 1WA2X 4KOCA 1PNDA 2QPEB 1ZDQA 4KO5A 3BVDB 4E9VA 4KO6A 2AFNA 2HZHA 1OE1A 3OMNB 1BXVA 1NTDA 1E30A 1RZQA 3T71A 2AZAA 1CYWA 3S3DB 1AG0A 2ZXWB 4G7SB 1FWXA 3WKQA 1EZLA 4BWTA 2PPCA 2YAEA 2WO3B 3MX0B 3IEAA 1T5KA 4UF7C 1NPJA 3CVCA 2PCFA 3NJJA 3NJFA 3QJSB 5I5MA 3CVDA 4YSUA 2TSAA 1PMYA 1JOIA 2BO0A 1XB8A 1TKWA 1ZDSA 5D4IA 3ZDWA 5I6NA 4BXSV 1AQ8A 6PAZA 5A7EA 2YAFA 5I6LA 1PZCA 1AZRA 1ETJA 2E86A 4DP4X 4WTQA 3X1BA 3S3BB 2GHZA 2IDSA 1A4CA 4AI7A 3KW8A 4YL4A 1BEXA 2J56A 3X1NA 3C75A 1PLCA 1W6LA 3H4FA 3PCYA 1OE3A 1JZIA 3GXUB 2IDFA 1VLXA 1M57B 4GP5B 1ASPA 2ZOOA 3T6XA 1E5ZA 4G7QB 2BP8B 4KNSA 2XV2A 4HZ1A 2PPEA 2BZ7A 1J9QA 1KBVA 9PCYA 1JZHA 1V55B 1SF5A 2A3TA 4KNUA 1AS6A 2Y1AA 2CALA 4PCYA 8PAZA 2J57A 4E9TA 4YSOA 5B7EA 1SDDA 3ABLB 2FT7A 4HCGA 2DV6A 3T6ZA 1E65A 2MRYA 2P80A 2ZONA 3ZX1A 4ZK8A 4DP9X 4G72B 2YXWA 1AIZA 4AZUA 4M4RB 4DPBX 1BYOA 1GR7A 3NP3A 3SBRA 1GYCA 2BZCA 3OD3A 1OCOB 2GIMA 1SHWA 5PAZA 2YAHA 4BK5C 1WS8A 1UATA 1JZEA 4GP8B 1KCWA 1AS8A 2VN3A 1GSKA 2VSMB 3WNIA 5EHFA 1AR1B 4A2FA 1HAUA 2FT8A 2H3XC 3T6VA 4MFHA 1NWOA 1BXAA 3H56A 4EF3A 1MG3C 4CSPA 1ET8A 1GW0A 1L9RA 2XV0A 4GY4A 3NJIA 4X4KA 5I6OA 1WA1X 1NWPA 3HB3B 1B3IA 2HX8A 5I6KA 4UAHA 3QJTB 4YSSA 1SNRA 1E67A 7PAZA 2CUAA 2IH9A 3MBWB 2P80D 2YAPA 2J5WA 2HRHA 5FC9A 1AZNA 3V9CA 1X9RA 3IN2A 1ILSA 1PLAA 2DYSB 3NP4A 3FSAA 1A4AA 1JXGA 2IWFA 3S8GB 2UX7A 2IWKA 6PCYA 2UXVA 4K9JA 4P5RA 4DP8X 5LDUA 2BHFA 2UXTA 4FA7B 3QJRB 2JFCA 3ASOB 3FSVA 1I53A 2JXMA 2VW4A 2FQFA 3N2JA 3U25A 4F2FA 3PLYA 3EH5B 4N8UA 4DPAX 3FU9A 4A68A 2DY2A 5B3SB 2W8CA 1ASOA 3CG8A 5IY5B 1J9TA 2DWTA 4YSRA 1QNIA 3TU6A 3NSCA 1QHQA 2BWDA 3WKPA 3JT2A 1RZPA 2GSMB 2PPFA 4Q8BA 1ET5A 1KV7A 4YVNA 1NINA 3UADA 3OMAB
chains in the Genus database with same CATH superfamily
2ZWKA 3ZIYA 2W07A 5SX4H 1OSYA 4M8VA 4OLUH 4NP4H 3C09C 1A6VL 2YFOA 4ZFOA 4GI9A 4G8FB 1BECA 2X0UA 4XXDB 3VA2C 1QI3A 3S36X 4Z1PA 4ZFFA 1OW0A 4A5UB 1TLMA 2VMJA 4OZHF 3V0VA 4P5MA 3LRLA 3L72H 5EF0A 5FGCE 3BZ4B 1U6AL 3SKUD 4Z76B 1ZGLM 4UTBL 5L8LB 1JYWA 2YIBA 1A0QL 1TJXA 2ZM6B 3DX7A 5DC2A 1J12A 5EU4A 3TJHC 3ZTEA 3CMOL 5FCSH 2AEQH 1IM3D 1FE8L 2B3IA 3BP7A 2AJZB 1S7QB 2DYPA 4L4TD 2PABA 4HZLB 5DT1H 3B2EE 1BF2A 4D94A 3KXFB 2EAEA 3K6FA 3TH2T 3B1TA 4Q9RH 1Y7VA 2DOCA 4D0BA 4UCFA 2A74B 5DJ8A 1VFBA 5L3GA 2KERA 4HPOH 4BK4A 3TNNB 1K97A 1OP3K 3SDDD 3S88H 3GI9H 2X9ZA 5IGXH 3LSSA 1H0DB 4R50A 2F1BA 5F8QC 5J13C 2BFVH 3AXLB 4P23C 4GAAA 1E3ZA 4NN5B 5DYOA 2R0ZH 1LDPL 4R4FH 3OPZH 5IDJA 2AEIT 3ZHUA 1KF9B 2Y5EA 2G3NA 4XCCL 1SLWA 3VXSA 3CK0H 5DLMH 3PWNB 4NKQB 3PNWA 5E08L 4NTXA 2YPLE 2LU7A 4GXFA 3ZTNL 3CFDB 4BWAA 4D0CA 3H1KH 4L0YA 3AZUA 4OJYA 3K5NA 1CXKA 4ENEC 1F42A 5I1CH 5E4IA 4MQSB 3L7EB 5E5MB 1HZHH 4D7BA 3L71H 1P84K 1ACCA 3Q0HA 2KQMA 4S1RH 2GTSA 3RKDD 2EIJB 3MLTB 4U6VL 1HJBC 1AR4A 3QZWG 3U0PB 3OKKA 5I5RA 5GONA 5DQDH 3OMIB 5HJBA 1BX2A 1XDCA 4PGBB 2F93B 1ZHLA 2NDGA 4E41A 1ZS8B 2EZPA 1KGCD 3U4BH 3DUSB 3THML 5E6IB 4AQEB 2G3XA 3CFJB 3KJ6L 4JDTH 5L3BA 4B3SB 3ZPDA 1IGTA 4E9YA 5DJCB 1JFHA 1FJGO 2AKRA 4FQJH 4IBWA 1GYAA 4DV7B 5KSAD 2NY3C 1JXFA 4ZFZA 3T65A 4IGGA 5GW7A 1Z6JT 1MAJA 2HJFB 3TCXA 4EKJA 5CR1A 1ZLSL 4HPYL 3UH8A 3ARGC 4XXWA 43C9A 1AGCA 4W4KA 1VF5B 4IDJH 1XCQB 4BXVA 1OHZA 4N0UE 3P30H 2YUVA 1IGYA 1M4KA 4JGSA 4HUMB 5A1AA 3C08H 3T8XB 5B4MD 4DP0X 3CXFA 3JUYA 4QXGH 1OLZA 3KMDA 3ROOA 4APXA 5BVPH 1C5CH 1A4KB 1A47A 1H19A 3MDSA 4JY6B 1HNZB 3O4LD 3BO8A 3W0WB 1DFBH 2XWBB 1QCEA 3FQRB 2IANB 1QTPA 2XLLA 4QRRD 1FRGH 5DMKB 2QSTA 3J27A 3KYNA 3QXUA 5EIIA 4KQ4H 2BC4B 5A6LA 1B90A 2H47C 5H4YA 1PNMA 4LSUL 1MW1A 4JPRA 1UXSA 4UIKL 3NFNB 3PUUA 3RBZA 5JXED 4HYOA 1E5CA 4Y8AA 2RCVA 1LK2A 4UBDC 4P2RD 5B21A 1QASA 1IE4A 3GJFA 2GHYA 4PRIA 3WEAA 3S37X 4JO8A 5B7MA 4QRBA 4PA4A 5DD5L 1OZUA 3OAUH 2HVJC 2NXZB 3HFFA 2Y4SA 2N0KA 5SX5H 4DW0A 4HS8L 3B2MA 3OUSA 1FVDB 5HHVL 1FPTH 2RCSH 1MA1A 2WNKA 2ARJQ 3S8WA 4JRXA 3ASWA 4DR2B 3B8YA 3CVHH 5HVFB 3HHRB 2E4TA 5GHWH 3UACA 3W9DB 4DK5A 2BOBA 2X70B 3V10A 4LCWA 3ZKMD 4YSPA 5F1OB 3VGEA 4MX7B 3K58A 5B1OA 2Z65C 3QZLA 4Z0BL 3VE0B 4LSRH 2X10A 2Z4TA 2XOKG 1X5MA 2OJZH 3DTDA 4GCZA 1KCUH 2XZAH 3V52H 4B3VA 5EV7A 4LGPB 1FLRH 1LNQA 3GSQB 5GISL 2ADPA 2WBKA 2Y3NA 4OQ1A 3ZOAA 4AEEA 1YI2V 4X5RA 2UUCO 5IKCA 4K3AA 2ZX6A 3VD9A 3SBQA 4IBLT 4P46B 4OJFH 3HBQA 4HQQH 1D7CA 4XNMA 3VI4B 5F2VO 5C6TH 1HHGA 1JNNL 4XMVA 3WS6C 3IMVA 4N23A 1OB1B 2CRZA 1PD6A 3IRPX 1IC4H 2CLZB 3CHPA 2Z9TA 3D34A 2E5EA 2WMPA 4HU2A 4L37A 4C83B 5ADOL 1KPRA 2YD4A 4G7VH 1AJNA 4M1GL 3W37A 3TBCA 1ZANH 1P5VA 5MI0C 2OIGA 1JZJA 4DUVA 1TQCC 4MKMA 4J3OG 1RSFA 2X3AA 5B1JA 1B0GB 1B2YA 3IGAC 1RJCA 2QWPB 1WFMA 3MV8D 3PABB 4AQAA 2WVSA 4YJZL 5C0GB 2YQGA 3MGTA 2C4FU 3C6EA 3BN9C 4AV0A 4N3TA 2YI8A 3CJJA 5ITBL 2GTZA 4J3XA 3FX7A 4PRPB 4I85A 1JZ8A 1EEYB 2E74C 2Z0BA 4DVBA 3CN3A 4MA8H 2IBGA 1AHKA 2CK3G 3GHEL 1OAQH 1S9VB 4JHAH 4TSAL 1HHKA 3MRRA 5KSUA 1WAZA 4F8PA 4NR1A 4M3HA 1IEAA 2CA3A 1IAOA 2F74A 4OGYL 3ABMB 4F7PB 3ELQA 3NJHA 4WEBL 2BNQE 3DURB 4KO9A 3MRIB 4ALAL 4F2EA 3PP3K 2GT9A 3QJHA 3OR7B 1BAFH 2YIHA 3OAWA 1WZAA 4I0XB 3RY6C 2QADD 4I88A 2LU4A 1RKRA 3L9RA 1UQSA 5SX4I 3V2AR 3FUDA 5H6QA 1TZHA 5K1VA 1TZAA 2Y69B 4DXWA 5FYKH 1HHIB 4I9WA 1WH0A 2NY2C 3PS6A 1A6ZB 3MRBB 4MT8A 2NZ9C 2P24B 3U46A 5IREA 2X9WA 3B2XA 4UVAA 2ZWZA 1BLIA 4G1MA 2OS7A 3HE7A 3JWOL 5EZJA 5FGCB 4HF5H 3H9HB 4JDVA 5DK3A 3SDLA 1FG2A 1OIOA 3JTBA 5D5MB 3GSNA 3JYBA 4MVSA 4ZNEE 3CU1A 3EOAA 2Q9LA 4FHKA 4O9HL 3OKNB 4XNUL 3OGCB 3TTYA 2KDGA 3BH4A 1WB8A 4XX1G 4ZQKB 4HA1A 1H6EA 2JE8A 1BFVH 3SJAC 4GXUM 4AIXA 5C0EA 3V5DB 2L4OA 4E9XA 3K5RA 2EVJA 1TFPA 2CGRH 3DMMD 5I8CA 2LAAA 5G5DB 2J21A 1VENA 4DO2A 4FF9A 1T83C 4NDMA 3IXAB 3QZOA 3MXVL 1HH9B 2FQEA 3QWOA 2YKLH 3C5JA 5EBWB 3AG4B 1FFNA 2NLJC 2ADJA 5GRVL 1FO0L 1D2PA 3ZDXF 5IVXB 3UTOA 2WZ0A 2BIPA 3ZYJA 5JIHA 2E8ZA 1S9YB 3C6LB 2P8PA 1S9KC 3F7QA 1FNEB 3S36L 3VB9A 3DTXA 3U1SL 3ARED 3CSBA 2WO3B 5BO1H 5FYKU 3SQBB 4I7ZB 1OAJA 2BHYA 1M3JA 2YPLB 3EAKA 1OAXL 3WIIH 2BNRB 2EC8A 4TSBH 3NJJA 3FT2A 4HWEH 4OM0L 4BBWA 4YSUA 5A2QN 3HS9A 3NZUA 4FXGC 4GI8A 4NC1C 4JB9H 3ENEA 2A9DA 5A7EA 4POYA 5I6LA 3AUWB 1LNUA 2JIXD 4GKKO 5I18H 5IEHB 3BKML 1U21A 3N43F 4IHJA 4LP4A 3LB6D 1B4JL 4J41A 1EXUB 4ODUA 4TULL 1GHFL 3B5GA 3AG3C 3ML9A 1JTPA 4PHXA 2Q7HA 1YEDA 3SPGA 2W65B 5JA9A 4X1YB 4PV8B 4TNWK 1UT9A 3IRZA 4LQFL 1M1XA 3BIAX 1KGXA 1X44A 2OTWA 4XBGB 3TO4B 4UXNA 4LBEA 2N04A 1J1XH 2NY1B 1UKQA 2A6DA 5I6XB 4X20A 2FEDD 1VJSA 2P28B 3P4NA 1FN4B 5T5FH 3ZRSA 4N0UB 4YAQA 1VCAA 5AVXB 2ZX7A 1PQZB 1V55B 3QJOA 3RVZA 3RLSA 4DUWA 4KNUA 4S10A 3U6XS 4ZRGA 3UG3A 2VC2H 1SQFA 1TLKA 1N64L 1RIHL 2WWMC 3JD0A 1A3LH 1G0DA 4UOJA 2IPTH 3IBEA 4JPKH 5ESVA 4FQXA 4YSOA 2HWZL 4GRMA 4U1SB 5DVNA 5IESH 3KNBA 2YS4A 4NN6B 2CAZC 4LCUA 2XPGA 2AXHA 3DYOA 1UM4H 3QO1A 1X5GA 3IKCA 4ZSOB 1YMHA 1OP3H 5IW1B 3CCVV 3FCTB 5ALBL 4QY8A 2YXWA 1DQJA 3BWZA 5ABAA 3BISA 3QUHA 2F9BT 1U96A 1A3RL 3F7YA 4MZ3A 5F9WC 5BV7L 1JWMB 2BZCA 3A24A 4FFZL 5KVGH 1CDJA 4HIXL 4B9JA 4GMTH 4BK5C 2ISDA 2P5WD 2CRMA 4OF0A 4HEMA 1SZXA 3CX2A 1HH6A 3K4ZA 3NZHL 3Q1EA 5EO9B 2OMXA 4YXHL 5LNEA 4Z23A 4MNQA 1KD1W 4EEQA 4MA1C 4UDTB 3CHRA 3WFBH 2UXCB 4WGKA 4I4TA 3Q2CA 4LARL 3RYHB 4J2XA 4CBPA 2VDNL 4NHUB 4NQDE 1MPAL 2AQ1A 1E8WA 3AG7A 3ZHVA 4BFGA 3DROB 3LXAA 5LCVH 1OP5K 1V54C 3KPQA 4LRIC 3FB6B 1G4RA 3DXAD 1BXAA 4RGOL 3NCJH 4RAIA 2MHAB 4OF5A 3ISYA 4X5WB 1L7IH 4WV1C 4WWPA 5B39A 4G9FE 3GZPA 2G9KA 4HDIB 1DSFH 1T04A 5E00B 4ZXBB 1QU7A 3MBED 3T8VA 2D0GA 1BEYL 4JFYB 2DQHL 4Q4IA 3SCMB 2Y24A 2EYRA 4ZMVA 3DVNB 1I8IB 3QIWA 4EIZC 5IFJA 2CJTA 1WSST 2WXRA 4MD0B 5ETUB 1KLGB 2YZ8A 3ETBJ 3UJTH 4HIJA 3SPIA 4HK0A 3DPBB 1MHHB 3T4AB 4WEEA 3OT7A 3Q6GL 1AE6H 3STLC 1TUEB 4NQEE 1FC2D 1ZCRA 2WBWB 3L95B 3VDCA 1R3HB 4NZRH 1A7NL 3O81A 5CCGE 4XBEL 2XJKA 4U3FH 3MNMA 4JI1O 2IWKA 3W38A 2Z7UA 2GSIB 1Q9LB 2EKSB 5JQHC 1JNLH 2ITCB 3QE5A 4MSWA 5CWSA 3UAJD 2XFXB 5AAWA 2G2PA 1BJ8A 3CN0A 3U7YL 5E03A 1DEEB 4L4TA 4OAWB 4X8CA 5JIMA 5FYLE 3C12A 1RUPH 3DBSA 5DJ2A 5LO7A 5IZ7A 1IC7H 1SQQH 2JKXA 1HCZA 1PKQA 1QNIA 4TNVF 4JO3L 3E80A 5JO5B 1QHQA 2BWDA 3DK0A 2AHIA 3SDDA 2BNQB 2V2WB 4B9FA 1S8DB 2VDQB 1M2VA 3CZKA 3L9BA 4BK8A 1P5UB 2YGVA 4YHLH 4YBHA 2OR9L 3QZPA 4AGOA 3BJLA 2HUHA 3W2DH 2G60H 3KYOA 4I8DA 1AYRA 3KLQA 1KB9K 4K0OA 3HN3A 4WI5A 3GLEA 4G6AC 4RA3A 4XO9A 5KBMA 4D9QE 5E2WL 3N85H 4IIQB 4M6NL 4ANXA 5AZUA 3TJEL 3QARA 5J2UA 1NAKH 4N1EA 4JLRA 5HGGS 4UU9B 3BAKA 4NPYA 2BP0A 3KH4A 3CDYA 4YK4C 5F9JB 4NZUH 3OC8A 2OCCB 1KDIA 2VR7A 2GBVA 3N3EA 3P30A 2PF4E 5D7JB 1YNKL 3JATB 3IDNA 4APQD 4MMXA 1MJUL 1FFXA 1DQLH 2WXGA 1AHWA 3BP5B 2ADIB 4M43H 4Y2DB 3VGAC 3FFCE 4ABQA 1KP3A 3CWBH 1ODUA 1Z9SA 2AXGB 1D7DA 4K8RL 5JPMB 5C0AE 5E0QA 3VGGA 1DYZA 4K3HA 2NTFA 1XREA 1MJ7H 2EXTA 4OGQC 5KSAA 4ODVL 3LRSA 3S35X 1J95A 4B50A 5CN1A 1FFRA 4QKTA 2C3VA 3UO3A 4NKOA 2AV1A 3KAAA 4JFDD 3V95A 5EEXA 4I5SA 3L45A 1E6JL 1F6AB 2PYED 3I3DA 1QVGU 4CSSA 3QZMA 3X13A 3B9DA 4BR6A 3PQYD 2VN6A 4LHUB 4JTDB 3HKBA 5DR5L 4NAJA 4WFFE 2OMTB 1IKNA 4IIZA 2XG5B 3CVHA 1EAOA 3O4LA 3CCUV 1N18A 3FT1A 3LQAH 3OMZA 4Y5XB 2WLHA 5FO7A 3TCLA 4QRRA 1YVLA 1UUNA 2A99A 4LFBB 3FQ1A 4P07A 3DC6A 1DVUA 5T3XL 3PDOB 5K9JL 2AERT 3OF6D 3CFEB 3CPUA 5JXEA 4MDJB 1UENA 2CUIA 5IJKC 1XFPA 3NCWA 2HEPA 4JNXA 3TA4D 1KCKA 3WY3A 3KG2A 4V2BA 2LTQC 5I2IB 5KYYB 3JD4A 2FD6L 4H0GA 1WLEA 3MV9B 4BCZA 2BVTA 1NIFA 2H0JA 1MRCL 1N5AB 1HNFA 2UVFA 3NUKA 4B7KA 1KC8W 3UABA 1Q0YL 3SOTA 4ETYA 1JVKA 1CP9A 2CXGA 1MIMH 1UB5B 1ZIAA 1TZIA 2QVKA 4RVBA 4WO4B 5GZOA 4JI8B 2DQTL 4TUKH 5H2BA 4H20L 1D9KC 5BS0A 3UP1A 3MRLB 1J87A 4S1DC 2MQ3A 1KN4H 3HS0B 4BGLA 3LDCA 3EDFA 1ZKAA 4FFBA 2HFEA 2ITFA 1FXKB 4FG0A 3FB7A 3S3XA 1YJDH 3I50L 5CINL 3WY1A 3RVXC 1C16A 4BH8A 2Z3YA 2DQEH 3UBXI 1R3LC 3MUGB 5E8NA 5CUSH 2F8OA 1UD2A 2EO9A 1V3LA 3GB7B 5GGQH 2PPDA 1ZSDB 1M42A 5I28A 5T3ZD 4EQ3A 4ZG1A 4MQXD 2VAAB 3TBTB 2WWKO 1C12B 4TQHA 2BVYA 4D9LL 1NCBH 3B6SB 1L0NH 2N7BA 1KXVC 3MLWL 4W9DC 2I69A 5D71L 1CFVH 5KANG 1TTRA 4FL4C 3T0EE 1EHAA 1CD1B 4Q14A 3MLRL 4I55B 3UOAB 1BHBA 2DMKA 3ATEA 1EWHA 3DTUB 5LBSL 2OP4H 3MV8A 4UT7L 3QQ4B 1XTMA 2XNDG 3VJ6A 2G0LA 5D6CA 3HE6D 1I1FA 4PWHA 3B40A 1T2JA 4JM2B 3K5MA 4KDWA 3SKMA 3X11B 4EO5A 1YEIL 1VACA 4NQDB 3QUXB 5CD5D 1YUHA 3KVDD 4C56D 4Y9BA 2YK1L 5IYBO 4JKKA 4YDVA 5IFHL 5TK4A 4ZW3A 1GVIA 1CC3A 1E5UI 4M1CC 5CJOL 4L8DA 1YEFH 1JV5A 2E7BA 3EBIA 4JAAA 3ILPB 4G9FB 4DAGH 3QORC 3W57A 2JGDA 3K2UL 1OTSC 1A1MA 5DJZB 2VN5A 2FYYA 3QJFB 1CBJA 1ID2A 2QFRA 1TEGA 2ZE8A 4PG9A 4JTCB 1L9OA 2UY7B 3IJHB 4NAQA 3PF2A 2YXHA 3HNVH 3ARFD 3UAJC 4Z7QE 2OL3A 1HNYA 2F2HA 3WFCL 1JZ3A 1VGEH 2F19L 2PTMA 4NNPL 4YVUA 4HGMA 5D96C 4HMEA 3HTLX 1XF3A 4NQEB 4P2OD 4B6ZA 5H37H 2HJLB 2HPTA 3IF1A 1Y18B 2BCMA 2ITDA 2EJ7A 4H0LC 2AQRA 2DPKA 3OLDA 1KB5H 1JZ7A 1MI5E 3ZRXA 1Z9NA 1MFNA 5J9PB 4R4NC 3JTSB 4Z78A 4WHCA 5FHBL 2MNWA 5F6IC 2DM4A 2EXWC 5GGSA 4HUUA 3QNZB 1FL6B 3EUDA 1OSZB 3L5WB 2V2TB 1MCWW 2BSCA 5DUMH 2MQGA 3QIUB 4AQ8A 4GQRA 2ED6A 2NOYA 3DMMA 2DF3A 5LGTA 2MTAA 4DGWC 3PWPD 4PW3A 2FX8H 4ZO6A 5FO9A 1GAFL 1QEWB 4RA0C 1UM6L 3ROLB 4OCXH 4XP1H 43CAA 2Z91B 1PZ3A 4L1DA 3RVWD 4BFKA 2DWEB 4KROD 5I66A 4O00A 2LU3A 2OV0A 1QFPA 3B83A 5ERWA 1OQXA 4AVJA 4HKBB 4HKJA 3GS7A 1K4DC 2YDEA 3RB7A 1GM7A 3L4UA 5KUMA 4GSQA 1XR9B 5JHDA 1RERA 1L0QA 3HKCA 4X6BA 2ZR3A 3UPAA 1WPXA 3AREA 1V7NH 3NA9H 3N5AA 4Y4FC 1KCBA 1PZ5A 1KEMH 4KZDH 1IX2A 2CDYA 3L6FA 4HCRH 2KKQA 3GD1C 4YFLI 5JDSB 2AJ3A 2EECA 4OH2A 3LX9A 1K3ZA 5D7LE 1YN6A 3W56A 5A2FA 5I0YA 5ALCL 5ESQB 3ISRA 4MTGA 2J1WA 1MHPH 3MNZB 3UDWC 3HMWH 1BLNB 4KMTH 2XTJE 3D85D 4WNSA 1ZVNA 2YPVL 1I8KA 3I9GH 4X0KA 4K3GA 3MNVB 4XCNB 1NAMB 2O6PA 5KN5A 1YA5A 1N12A 1WS7A 1SJXA 2X2UA 2JIXA 3WBDA 4ZUWA 2PW1A 2BW5A 1S9WB 4UTAL 5DURB 1BVNT 3IK2A 4NPKA 5CR8A 2EYTB 3UBXA 3FFCB 3N42B 3FO1B 4FXKB 1VQMV 5C0AB 2B4CL 3MV7E 6CGTA 1O0VA 5G55A 4RO2A 4RGMB 1IGFL 2AP2A 2V37A 3MJ9H 5CD3A 3D0LB 4LSPH 1PJWA 3LN4B 1QATA 1YY9D 1MCHA 2DH2A 1Z5LB 4EZLA 3B3IA 4M7JH 5DS8B 1T7YA 2VXQH 1I3VA 1VPOL 2GVYA 2NY6D 4B9KC 4NJAH 1BVLA 4G6JL 2X7RB 4O58H 2X4QB 3PWLB 4DZBB 1DQTA 4WF9V 1AIFB 3CZSA 4FFTA 2AZAA 4HJTA 1BOGB 3DJ9A 4IBYA 3WKQA 4CBCA 1EZLA 1XWVA 5GRWA 1E79G 2DQUH 3MX0B 3ZHFA 2GY5A 2W0PA 4ZTOL 1IAKB 4PRHA 4MTOA 3O9WD 1I7UB 1OD7A 3UJIH 5GJTL 1K3IA 1OM9A 5LCVA 1JDCA 1XHZA 4Q6YA 1JFQH 1K34A 1AMYA 1P7KA 2R69L 2NYYD 3D7PA 3OWEA 3NSXA 2VRKA 1FZMB 1DL7H 5CLYA 4BZ2H 1ZJBA 3BEVA 2C34A 1R9FA 2XOTA 1CG9A 1MFBL 4EN3D 4RNRB 1RIUL 4JZJB 1H2SB 2GHZA 3ECWA 5DHVA 3QA3A 3S35L 2WJ7A 4M9PA 1E4WH 2NNXA 2ZP0T 3L3DB 2P4AB 3BPCB 3X1NA 4CMMB 2PI4A 1NC2B 3JWNC 4S0SD 3FB5B 3NRFA 3ZKXB 2DQGH 1JJOA 1KJMB 1U3HC 3TVMD 4GRWH 3VXNA 3X3GL 1M57B 4WCEV 1CLZH 2EADA 4B3MB 1R47A 4OCYH 3DXAA 4JO4H 2C3XA 2WA4A 1T66C 2ESVB 4KNSA 3WKMH 4K9EH 1RZ8A 3ZDXE 5JWPA 1CFSB 1R75A 1U8JA 5TQ0L 1JZHA 4AMXA 3G9VA 3K2MC 1I9EA 4LCCC 3RWGB 1B9ZA 4Y16C 2VL5B 4LHUG 1T89A 3P11H 1IU1A 2R2CA 4LCYA 1XDTT 1R5WB 1EA9C 1N9PA 1PD0A 4KI5C 3JZ7A 3ABLB 3F6LA 1MFDL 3AAZB 3GSXA 1PP9H 2I9LB 3V6ZA 2ZOLA 4O2CB 5AENA 1OT4A 2IQAB 2ZONA 4FA8A 2DQCH 3T0EB 1IAIM 1QBML 1JK9B 4FABH 1ONQB 4N2BA 3ZTJH 4DR7O 1WBXA 5HDLA 4JANB 4FFYL 3H6JA 2Y36H 1SYSB 2VLRE 1AJQA 3DXRA 2ARJA 2GIMA 1KFAL 4V1DB 2FHBA 5I30H 5JQGA 3BDYL 3I6SA 4FYSA 1UATA 2TAAA 1TYRA 3QO8A 2F4VO 1VQOV 4HWUA 4BA0A 2XAGA 3APMA 1DZBA 4K3DL 3G71V 4B97A 4EMZA 3MACL 4KVCL 3BI9X 3KEHA 1DSWA 2DMGA 4LK4A 4P5TC 1WWBX 3D2TA 2JKJA 3BCFA 3H3PL 4N8CL 3RIAK 2A9HA 1MG1A 4LKCB 1YMME 3IU4L 4L8CA 1WZMA 3QISA 1ZGLA 3QULA 3VFUA 4U6HB 4JL2A 4CNIB 2QSCL 2VJ8A 1DEDA 2R0LL 5TF1L 4Y2NA 3SE4A 4LSSL 4NQVB 4YIPA 2HKFL 5FFLA 3UYOD 1DLHA 5I6OA 1CF8L 4FZ0A 3TNMA 2HHHB 1X5YA 1NWPA 3HB3B 4Z7QB 1CL7H 1OW0C 2B59A 2H9GB 1OAKH 3HMXH 1TDQA 1FL5A 1NCNA 5IJBC 4LL1A 2A79B 1OCWH 2ARWA 4DFHA 1OP4A 4OZIE 2LQTA 3FH5A 1S0VA 4LAQL 3AT8A 5FR3A 3MJGX 4GSRA 4HOZA 5T5NG 2Y7QB 4WTZG 4PTTB 1RMFL 3WENA 1MI5B 1ACXA 1AZNA 1SBBA 4JG5A 4MLSA 3N6YA 3CC5B 4B9IA 4I3RL 4UT6H 5KYWA 1E4XH 4G2AA 4APQA 5LDUA 4Y7MA 3KXFD 1EJFA 1CT8A 2JFCA 2BTQB 5CZXD 1ZLVH 2R23A 5CAYB 6FABL 2FO4A 2VUKA 3I02A 1O6SB 5CP7A 2Q6AA 2QM4A 1EXGA 2R9HC 1AGDB 1UXWA 2QGDA 1ZY9A 5EULV 4BSVB 1RJYA 3QJXA 1E43A 4FXTA 4GKZA 1XH2A 2CDEA 1E4KA 3B2DC 2E5LO 2UUAO 1YY8A 5GZND 5FB8A 3AGWA 2ZUXA 2E6QA 5F7NC 4JFDA 4LF4B 3GS4A 4L4VB 4BA8A 1RUKL 3RDTB 2PYEA 1OP9A 5DFTA 1CFQA 2PYFA 1UEMA 3PQYA 1NCWL 2HLDG 3UADA 3RNQA 3PL6B 4X6CA 2CH7A 3IM1A 2LGNA 2G5RA 1CDBA 5D7LB 5ES4B 1KYOJ 2B1OA 5D4QA 3RB5A 1CB4A 3VD1A 3CMGA 2PN5A 1HEHC 3ZX6A 5GGRA 3U6XA 2XTJB 3BQVA 3IDUA 5LYJB 4L9LB 3SGKC 3SR2C 1SYVB 3IETA 2CR3A 3N1PC 2IDQA 3OF6A 4X9IA 1CQKA 3I55V 1NGQL 3J80N 2JJTA 4JI4B 1IXMA 4PJHF 3QEHA 3W3BA 4W4LA 4LWSB 4K2UL 4JK0D 5BUAA 2Z5UA 2GTAA 4IS6B 5E6ID 4GAYB 5C07B 1CGVA 3KJ4B 4PJXB 4OF6A 1YYMH 5KSVA 4JI6B 1XGTA 3TWYA 5ICZB 1WWWX 4S1SL 3BKCL 2VH5H 4HLJA 4NQXA 1A9BA 2IFFL 4U6YA 3DSFL 3ULUL 3I6LE 1QYGL 2F58L 1FL3A 4XXWC 1ZXKA 1MCNA 3FBKA 3OG6B 3AQYA 4ZAKB 1UJ3B 3BSHA 2GAZA 1K7DA 3T09A 4LHJB 1P4BH 4URKA 3RYFB 4XO8A 1LWRA 2VR9A 1IC5H 4RSYA 2EZ0D 1HS6A 2YD8A 1JNJA 1OAYL 3DK2A 4MAYA 2F5AL 1OHHG 1CGSL 2RMKB 3FFDA 1XX9C 4EFBA 4FQ1L 4KRPC 1KYAA 3R7RA 3W0WD 3A4FA 3KGUA 4I5BA 4A2HA 5JW5A 2IAND 3INUH 3MO1A 1T5WB 3WL9A 1QKZH 3O3BB 3V4VL 4DV4B 2BIQA 4HC1A 4G59C 3CZEA 3FQUB 5F89A 4MQTB 2WTRA 3FAVA 4FLZA 1HCYA 2YEZA 4I4WB 4P4KB 5EUOF 5IVZB 1UGKA 2H2PC 1G7IB 3U48A 2ODIA 2ZT9C 2ZPKL 4JO1L 1UOWA 1P4IL 2NXZD 2W9EL 5E6ZA 5E2TH 2FR4B 3FQYA 4UDUA 4AKQA 4F8NA 1GL4B 1PZBA 3LPPA 1KBHA 4NO2A 1G9NL 4BFIB 1ZUQA 2BOBC 3X12B 5AW6B 4XC3L 4K3JH 1ZA3A 1UACH 4A6YL 3NIGE 1JD9A 5GSVB 5LGHL 2GCYA 5DZOA 4DV1B 4C56A 1WPCA 5H37A 4PJEA 3QNYA 3OLIA 5HHOB 1FYHB 5LA6B 1PX8A 5AALA 3JD1A 3TCTA 1Q9KB 4YHKL 4MVQA 3CCJV 4UFZA 4QF1B 3VFWA 4H33A 5KS9E 2V4DA 1A6AA 1I94O 2Q0OC 1TF4A 2ZX9A 5IQLA 1HDMB 4R4BA 3RURA 4ZOLA 4G71B 4DV6O 2ED9A 3VG9B 2K8MA 4KI5F 1BD2D 1S4IA 4LPWA 4YSEA 1IBYA 3DVFA 4P46D 1JHKH 2VJXA 2CCVA 2XN9A 2YD9A 1XIWB 2XRAH 4GW4A 3KDMA 1DUZB 3VXRE 1KMGA 5TE7H 3CLFL 3ARFA 2FLBT 4AY0A 4G8EB 5TK2A 3WXWH 1GGCL 3CWGA 4KKCC 5ESAA 1MVUA 1ED3B 3SYPA 5IVOA 3GTNA 5ISZA 1CTNA 4NRYA 5B1JC 5FECB 3UO1H 5HD8C 5LUMA 3HHSB 1JN6B 3H9SD 2KH2B 3QZWA 1UWXK 25C8H 1MJJB 4CILA 2VLRB 3P54A 4BDVA 4AMKL 3IXTA 2WIIB 1AQDA 4JREC 3EO0A 4DTGL 5DMIH 2J1XA 2UYLA 3VQLA 1VADA 5JR1H 4PJGA 4X7CC 3HRZC 4AQ1A 1HYSC 5GRJL 2X1QA 2YPKA 2XKSA 3F12B 2P47B 1HHJA 4HCRA 1DBMH 4I48B 1I3RB 3BAIA 4WSJA 5DD1L 4DW2H 3PWPA 4DUXA 5E94A 5AW2B 4XP9L 1EGJA 1YMMB 1ZT7B 3UYPA 1KUQA 1UT1A 1RHHA 3AU1B 3P2TA 4DHLA 4LOUD 3O11A 5DUBA 3IMWA 3MKGA 2Y0SA 3ZTCC 2PCYA 4KUZH 5EU6E 1CL7I 1BQLH 5CCKH 4MVBC 3B2UC 3HUJF 5IJ9A 1GGBH 4PRAA 3HE7C 4U6TA 3H54A 4W1TA 3GZOA 2GUOA 3IPFA 1C9SA 1NI8A 3EYSH 4NCC1 3ZHQA 5L9DL 5B38G 4OZIB 1ZSPA 3Q8EA 3MJ9A 5LG6A 4HS6A 3QI9B 3OLEA 3NT0A 4NZFA 5DZ9A 4K7PH 5L2KE 4AEHH 4YHPB 5JORB 5F7AA 4NUMA 4KJQC 3A0HZ 2X0WA 1QFUH 1JPGB 3U9PH 3TC9A 3D85A 5MEPA 2OI9C 3QR0A 1E4XI 5DVOA 2HAZA 1L5GB 4FM1A 2Q7EA 1JGVH 1LO0L 1NSNL 1FI8C 2B39A 3WUWG 2RR3A 2X28A 1FO0B 2QT6A 1P7HL 5IROD 4A2LA 1B0RB 1PY0A 2WVVA 3EFDH 4P5SA 4RH4A 4EOWH 1K8DA 3U7WL 3GXDA 3CFUA 3OKOA 4NZTL 3C6LD 4LEXH 1XR8A 1NFIA 4HOXA 1BAWA 4HYTB 3CVIL 4X7TA 3D8CA 2MOQA 2FBJL 4OKVA 4DR5B 4B9YA 2BSSB 3NACH 5ACMA 4U4IA 2DBJA 3QZBA 3RPBA 1MJ8L 5JPNA 5FA4B 4G80B 5F97E 1AO7E 2YPLD 1QHPA 4LPYA 4O02L 2GJRA 3L75H 5A9GA 3W7SA 4XTRC 3TGXA 4ORGB 3JAKA 1FV1B 2VLJE 2OJ1A 5I1EH 3ZE2E 5I19H 1HWGB 3DX1A 2IH1B 4XH2A 3D05A 1ES0A 3DKHA 3ZHSA 3GSRA 4PJIA 1EEQA 5DC0A 3O9WA 4PWEA 3KGTA 32C2A 5F88B 1YVWA 3VXTA 1M9SA 2ILMA 2OT5A 2GV9A 3PUCA 5CSGA 4IYHA 1UCBH 4R5VA 3Q48A 3GMRB 2ZUVA 1KV3A 2R1XB 1A9EA 5F2FA 4ZS7L 2JJVA 4JZNA 4PWFA 2VQFB 3FCBA 3HAEB 1P2CB 2XZQH 1XMOO 2VABA 4KDVA 4N68A 4RFOH 3IBOA 4BQ8A 4LBEC 4WW1B 1QR8A 5CBFA 4X4YB 2QDWA 4XN1A 1RZJC 2P49B 3OKDB 1ZVYA 4R9HA 2RA1A 3HBPA 4IU2B 2QKIA 4M93B 5SWZA 3U79A 2VQ1A 2F61A 2OWOA 2HTLD 1MY7A 3TVMA 4M5YH 2WWWA 5E1AB 3F05A 2CBOA 3ZDYE 3JAWA 2UXXA 2CLVA 2E6PA 4YDIL 3KCYA 2UU9B 4FXLA 4NHCL 2B5IB 4FQXC 5DJ6A 1RK1A 3HNTH 4LCUC 3LJ3A 3W5MA 1N0NA 3FCGA 1OZ0A 1CYWA 1YDPB 1NEZB 4PV1B 1RUQL 3S0PA 4OD1L 3RDJA 5BZWA 5BV7B 5DSCB 5IR1A 1QSZA 4TL5A 5IG7A 3KVPA 2I9TA 1IM9B 3A3YB 4F7CB 1DJGA 1CYGA 3BWUC 3FRUA 3F7YC 5IBTH 4OPHA 4J6RL 4MNGB 4Z7WA 1OCCC 3INOA 3TT1L 2TSAA 1QLEL 3A4AA 3S5ZA 3A6BL 1HHHB 2FB4H 2VR5A 2YD2A 4G43B 5DEGB 4DZ8B 2CIIB 5JNYB 4FX5A 5DHDA 3H9VA 2VDNB 1S7VA 4DGUA 1G8MA 2AGJH 1F1GA 1S7WB 3VDAA 4BQCA 2VDRL 4N9OB 5ID0B 2VT0A 4YXKH 3NIGB 2AVGA 5IMKA 4GRLB 1F5WA 4LOFA 4DIXA 5IHZA 2VUOA 2X05A 3GSWA 4FQHA 4MHHG 2WJ5A 2XG4B 1HQRB 1VEPA 2ZNJA 1Q0XH 3Q5OA 2BY2A 1R0AH 4YX2H 2ZAIA 5KS9B 4ZXBD 1S3KH 1CIUA 3Q4HA 1Y0LB 3FU6A 3EO1B 3QIWC 4IRZH 4N0YH 4NTWA 1VIWA 1FH5L 1YEJL 5KJRH 4UT6A 3WHE1 4A38A 1TCRB 35C8H 1L1FA 1U2HA 3H53A 1Z3GL 3B9KD 1ETB1 5IT2H 1R46A 2PO6D 2WWNA 9PCYA 1MCFA 1XGZA 1YSCA 2O5ZH 1L8DA 4NN7C 1BSIA 3ELAT 4G8FA 5IQNA 4CJ1A 4ZO7A 3TV3H 5DVLA 1R3JB 2ODMA 2WAHA 4X66B 4QHMB 2MTPA 4E9TA 4N0FA 4TUOB 1F1AA 2C4FT 3EBGA 4LVOC 5KVEL 3BZ4A 3GF8A 4Y5YB 5GGTL 4Z76A 5FF6B 5JQIB 3HI5H 4I0PB 4MSWC 1BZ8A 2RAMA 5E6SB 4PY8I 5AAWC 1KG0B 2HR3A 2GIXA 3RU8H 4EE2A 4TUUA 4JI5O 1G9MH 4MJ4A 3II2A 2GEQA 2AJZA 1S7QA 2LFRA 4Y4KB 4A2MA 4BKLB 5DCCA 4HZLA 4ZPVB 5F21B 1XF2A 2QSVA 3NG5A 2Y1YA 3VH8G 5ABZA 3KXFA 4L87A 3CE1A 4YHIB 5DK0B 3V0AC 4HOMA 1K9MW 3R0NA 4PJ8B 5C2BL 1IO4C 4KU1A 1OF2B 5DGQA 5FUOL 1MAMH 3FAXA 3V6OE 2YXYA 5BNXD 3K6SB 3LSUA 3SDDC 2MPVA 1H3UA 4XC1H 3LNDA 4FTVA 3OQ3B 1LO5B 2BNQD 2VO5A 1OGAE 3WO3B 3E8UL 3BAEH 3GRWH 3K59A 1LP9F 3B8MA 1H0DA 1OLLA 4W9LC 1MNUH 4YBQD 1PEWA 2V5SA 1QR1B 2D2CB 4N2IA 1CTMA 3FL7A 3WOVA 5GZNA 2VWEC 3RZCB 3K46A 3KPRE 3ZHNA 1MN4A 2HPOA 5FOBB 1PS3A 3DIDA 3BVUA 5JMRA 3BRFA 3PWNA 1TETL 4ONOA 1WUNT 3CFDA 1CPYA 1NH2B 3NRPA 4OD3H 3IAPA 4NVPA 3SDCD 7PAZA 3L7EA 5E5MA 5E2JA 2ZUUA 3MLPA 1LLAA 2VUYA 4JUSA 2G9HB 1BCCH 3RKDC 2V9UA 1HU8A 5L3CA 1YYLH 4R97C 5T8IA 4O4JB 2VDQH 2BH0A 4LIQL 3MLTA 2D7MA 4MMXC 2L7EA 3QHFH 2EDMA 4KJWD 3U0PA 3N1MC 3NPZB 3NFSH 4F8OA 4PGBA 1A4AA 4Y2DD 1ZS8A 3WUZA 1EMTL 3P2DA 2X2YA 3MD0A 2X38A 5KAFZ 1YEHL 3DUSA 5E6IA 3B1UA 3MFFB 2APFA 3QAZC 3N91A 3CFJA 5FO8B 4LSDA 4OLUL 5KSAC 2LR4A 2L35A 1VHPA 2GBUA 1LUWA 1SXNA 1UCTA 1BIIB 1AGFA 3FU9A 4NO5B 2HJFA 4Y9CA 2YJQA 5LQBL 5KYXB 1VCBC 2QDOA 1XCQA 5LDSA 5B4MC 1UWEH 1WZLA 2ZOKB 4JGJA 3T8XA 3WKPA 2YA0A 4GUCA 2PCXA 2ZIOA 1FNAA 2Q5ZA 1EBAA 3LAFA 4LHUD 3T2OA 1AO7B 1UWYA 1IKNC 1A4KA 1KBKA 1TQBC 1YEGH 2ICCA 2ZOUA 4RBPH 1M2OA 3DGDA 4JY6A 4N8VG 5CLZA 3VYPA 5HPMB 1QSEE 1T0MB 4W4OC 1ZHNB 4NWTH 3W0WA 2RBLA 5DT1L 3ULVL 1N33O 2XWBA 3LXCA 2A7WA 2UUBO 1TNMA 1U2YA 2IANA 3PE9A 2HT2D 5TFSL 3ZE2B 4X62B 1SMOA 4P3CH 5E95B 2JKNA 5GS0L 3N2KB 2A4ZA 5DMKA 3WEBA 3FQ4A 4HAKA 3SE3A 3A67H 2BC4A 3IWUA 2FWUA 5JXEC 5J6SA 2XAFA 3BY6A 3HVNA 3NFNA 4ZX6A 3PJSB 2K6WA 3S88L 1D5MA 3GI9L 3GMMA 3PY9A 4KY1H 5AYUL 5IGXL 4AIZA 1PNKA 3UZVB 4MKTA 2BFVL 3RUGE 1JZ6A 4EN2A 4F7MA 3FUFA 4N9GB 1BYPA 4DV0O 3UPCA 4WWOA 2D2OA 4WTXA 3IYLW 1W8NA 3AUVA 5DLML 5GTIZ 4WO4D 3WELA 3W9DA 4BH7B 3VWJD 3VD3A 3RX7A 3BAAA 3TBBA 3ZKMC 3PREA 5DWPA 4Z3JA 4FNQA 3KPSE 1Y6KR 3MBXL 5I1CL 4PS7A 2BRQA 1RZIB 4QRQA 3I3BA 2HFEC 1PZAA 2VQUA 3FN0H 4P9HC 4PI2A 3OPUA 4K5MA 3ZDYB 1QBZA 1EPFA 1JPTH 3GSQA 1ZE3H 3RGVD 2F7IA 5C0BE 5IHLB 3GWKC 2EIDA 2GITB 4AENB 4CSZA 1ADQH 5CZVH 4M6AA 5DQDL 1DQDH 1J8KA 3PGCB 4P46A 4NO0B 2EDBA 2OXGA 3MUY1 1SEQL 3VI4A 3WJLA 5EORH 2BK8A 3U4BL 2Y7NA 1BXUA 2J4WL 4JDTL 4I18C 3WIFB 2N1KA 4C83A 3CSYB 3VM7A 1JPSL 1NBZA 4FJ6A 2VN7A 4LFCB 2DWYA 2B1IA 2V7HB 4FQJL 4XP5L 3O8XD 1A64A 3LEXB 1I85A 5HBBA 3X2QB 1CICB 3RBGA 2CIKB 2A6JB 1DDHB 3H9SA 1SHXA 4S11A 3PABA 5C0GA 4TRPL 3SB3A 1TUBB 3SYAA 2YGPA 3P3SA 5DJ0A 4ZUVB 3C08L 4HX1B 3MRNB 2ZYSA 4PWKA 4QXGL 4AMWA 1M71B 4PVBA 1EK3A 3HAEG 4Z3IA 2D73A 2OMZA 5E24E 4NQDD 1YEKL 5BVPL 1C5CL 4UQ2B 4WHYH 1SVZA 2GJ6D 1U97A 3C5ZB 1S9VA 4ODSH 4HIHA 1DFBL 3B7SA 5E9DB 4CU6A 3ASOC 5AVZB 2YICA 3HC4H 3O3DA 4Y4HD 1FRGL 3QQXA 4GSDH 4G9FD 4F7PA 3ARWA 3ALXA 5BZDA 4LAJH 3L5XH 2O5YH 4E36A 3BXNB 4KQ4L 3DURA 4FE9A 3CJHB 3MRIA 3FSWA 3FTWA 2ADYA 4WFGE 2YC0A 1NBQA 3OR7A 2QADC 1A1NB 4PG2C 4I0XA 3APNA 3D25B 4HXBH 3FF7A 4NXKA 5I75C 3OKEB 5D7IE 2DBLH 3QS2A 1HE8A 2IXQB 4ORZC 4L1TA 1HHIA 4UMSA 1LR1A 4A7QA 1J5EB 1I9RH 1A6ZA 2JJWA 3MRBA 2HX7A 1I7RB 3RIKA 1BQUA 2P24A 4NQED 4QYOB 1HQ4B 2EIEA 2ITDC 3VFRA 3CVHL 4LHQB 2Q3ZA 1JCKA 3KGSA 1I5YA 5D5MA 5HVHB 3R1GH 3ZGHA 1QP1A 1XGQB 2P45B 1DQVA 5FHAH 3CPWU 4XBPB 5KBLA 2P8LB 3GLDA 3OKNA 3JWDC 4M5SA 4UTCA 2EEDA 2G30A 2OJZL 3OGCA 1KCUL 1N34O 4ZQKA 3V52L 4AQ8C 3IGLA 1OOAA 1FLRL 3QIUD 5SV3A 1DF4A 4AM0B 5I1IH 3V5DA 5LAXB 4DKAA 1S76D 1CVSC 1QSFB 2W60B 2Y3AA 3DMMC 3GO1H 5FYLD 5G5DA 3O0RH 2OYKA 5CGBA 2DQ0A 1AOZA 1KELL 4KX9A 3IXAA 4OJFL 3VRLE 1ENVA 1HH9A 3GPEA 1QWHA 5C6TL 5EBWA 2PTUA 2Z93A 5AZEL 2XBDA 3L3IB 4BRVA 1TEYA 5F9AC 1MVFA 3OKMB 1IC4L 1OGAB 4GW1B 1SY6L 3ES6A 3ZJAA 1PYWB 4MS2A 1S9YA 3C6LA 4Z7VB 2CA4A 1YITV 3MSPA 2I07B 1ZANL 5KA6A 1I1AB 1FNEA 3AREC 5CA1B 1OGSA 3KPRB 1A02N 5GPRA 2V17L 4D9QD 3M99B 4IEFB 4U1NB 3WKNA 5FYLH 5FUCE 3SBWA 3SQBA 2YPLA 1ZLUK 3TJPA 3ZHDA 3GBDA 3LIZH 2AXWA 1SJHB 4PPTA 2QGNA 3OKLB 4JI0B 4HNAB 1RH8A 1DO5A 4RMQA 4M29A 2P1YA 5JA8B 1J8SA 1JZFA 1KCLA 2E4FA 4UQIM 3QG5A 2JB5H 4O5LH 3S96A 1MFVA 4JM0A 2AAVA 2J71A 1IIKA 1G6UA 3LKPA 1PAZA 4AUJA 5A2CA 1DQIA 1KPUA 5IEHA 3LB6C 3T1HO 3TO2B 5DURD 1EXUA 3ULUE 2V8MA 3O41B 2QPSA 3BUBA 3FFCD 5TD4A 2DJVA 1AQKL 5IHBA 2AZUA 5M7QA 4WDIA 5HHPB 2W65A 4PV8A 4XZ4A 1WTGT 5FYKL 1FIEA 4U3SB 4F5CE 3QR2A 1BQRA 1AANA 1XAKA 4XBGA 3WIHL 4PUBH 3UZEA 2FEDC 4GQPH 4L3EE 2EINC 1Q94B 4JMXA 1FN4A 2J7LA 3A6OA 2BHUA 2CHNA 1U8KB 3BP6B 3FQWA 4LASH 2VR3A 4N0UA 4OVUA 9CGTA 2Q76A 1NAMH 4H7VA 1XGYH 2VZ1A 4F6EA 1PQZA 4AVHA 4AZ8B 4HALA 3ETEA 4LF8O 4HG4J 4QLRA 3HLKA 1F41A 4Q0XL 4XMTA 5IEKB 4WFFD 4DR4B 3CDZB 1XUQA 4LF7B 1EZVX 2I7OA 3CFTA 2XVBA 4IKIA 1QSEB 4OZ4B 3V6FB 1I9IH 2R29A 1N2RB 1OK8A 1VZIA 1YG9A 5FYJL 2MEJB 3LZPA 4MCMA 3ZJZA 1NCDH 3K9SA 1UA6H 3P73B 5G4OA 3H1JH 3V55A 1M56B 5IW1A 1NIAA 3HUJE 2X53A 2ENPA 4KK6D 5E6RB 2YKLL 1P0SE 2FJHB 3SDAB 5BJTB 4XN4A 4OFIA 2JKWA 4YE4H 1TEFA 3QYCA 4NP9A 5JQ6H 1JWMA 4MWFB 3N27A 4IRZA 1NMAL 2X1WL 4L8JA 5DRZB 4AVKA 2JEUA 2Q69A 4HISA 1UYWH 2BW4A 5JHLA 1OANA 5JJEB 4XOAA 3KBPA 4DR1B 4JDEB 4QNPF 5TDNB 4U49A 2X5PA 4GMSH 2O6DA 3ZIAG 2FWLB 1KJ2L 5CIPB 3RYHA 3D51A 2X1OA 1Q90D 5DJAB 4NHUA 2D0HA 2HH0H 3BABA 2CGZA 4Z18A 5BO1L 5L4IA 3WIIL 3WDJA 5IOPB 1ROWA 2EDWA 4LEEA 1KJ3H 3DROA 2VNCA 1YCIA 3KPSB 4HD9A 4HUNB 4TSBL 2YD6A 3FB6A 1PU0A 4E0RA 2MHAA 1V3MA 4JFOB 4ANWA 1F3RB 1BPLB 2HN7B 4HDIA 4KVNH 3MBEC 4JB9L 3P4MA 2WLIB 5E00A 4ZXBA 4WRLA 4J3TA 5C0BB 1K85A 4EKWA 3SCMA 1T89C 3DVNA 1I8IA 3IE4A 3MROB 1XCTA 3DI3B 5JIDA 3B9KA 3OL2A 3ECBB 4DRXB 4FLTA 4P5KB 1K8IB 3G5VB 3G5XB 4MD0A 3O9OA 5ETUA 3U30C 3WCYA 1EAJA 1MCPH 3AQZA 2AHZA 3NJXA 2ZXWB 1MHHA 4G7SB 3T4AA 4L2YA 3T4YB 3QPXL 4XPAH 2ZXQA 1GOFA 3L95A 4BHUI 4NKIH 1R3HA 2CKBA 1N4XL 2QTSA 3GRWA 4UT9L 1J1XL 1DBAH 1SN0A 4W9CC 2IEPA 5I1GL 3BFQG 2GSIA 4PMEA 1Q9LA 2WPGA 2Y7SA 3DV6B 4PJ9B 5T5FL 4PWGA 1ZDSA 2ITCA 1BS3A 3VX0A 1KTBA 2XFXA 1AQ8A 4J28A 3GBLA 5FO2A 1DEEA 5FKAB 2YAFA 3TEZA 5GRVK 3BGMB 4OAWA 5DJXB 3UM7A 3CXCU 3ZE1F 4AL8L 4S0HA 2IPTL 4JPKL 4KUCF 3FTUA 3TYGH 5IESL 1IB5A 1CGYA 5AW3B 2XI9A 5CP3A 3F00A 3ZMVA 1UM4L 5JO5A 1HYRC 1QI4A 4FDWA 2GUYA 1WYJA 2EE3A 3H4FA 3I74A 5EC2B 4PELA 2E75C 5I73C 1JZIA 2BNQA 3VYNA 4PGEA 2W0FC 1AR2A 3GMPB 1S8DA 4FCHA 1L3WA 4GUOA 4IMLB 4KMLB 2XBTA 1P5UA 3C2SA 3EJPA 1UZ8B 1W9XA 4OGXH 5AB9A 5D7IB 4G9DB 3HB3D 3U1PA 4GMTL 2Y07H 3T8MA 3QIBD 3QDME 4X1IB 3MXWH 4IIQA 4JL1A 4HJEA 5L0QC 2A3TA 3CSPA 2FCBA 3K6OA 2KG7B 2QQQA 4MJ6B 4CS4A 2CALA 3WFBL 2XWEA 3UBFA 4LF6B 1KYOK 3BD4A 4KHXH 5F9JA 4XP6L 3SDCA 5EOQH 1MI5D 2R4SH 3D1MC 4N3UA 5B7EA 4ZNEA 4DK0A 1W0YT 4CA4A 2OZ4A 1A6VH 1QUNB 4XRCB 1BJ1J 4UV7L 1CLYH 3STBA 1FAKT 3E7JA 4PYGA 1IBLB 4N1HB 3NCJL 5D7JA 5DI8B 4APQC 5C7XL 5IB1B 1F58L 3JATA 5DK2B 1DSFL 5FW7A 2CUGA 3BP5A 2ADIA 4MQ7B 4Y2DA 3OD3A 1WCBB 1A0QH 3UEZA 2AXGA 5JPMA 1BG9A 3LQAC 4N5ED 2Y9RT 4ZX5A 3M17A 2FGWH 4GSUA 1PY9A 3CMOH 1WDAA 3UJTL 2CRYA 4CVUA 1UZ6F 1KCWA 1E4KC 1LYQA 1MCDA 1PD1A 1Z2KA 3D48R 1EEUA 5GSRA 4UQCA 4NZRL 2N1TE 3L08A 4GQZA 1CDIA 2GQHA 1F6AA 4GZRB 1O9VA 2Y1ZA 4OF3A 3B43A 4OFKA 5H6RA 1N0JA 3REWB 3L4ZA 2VDOH 3AS2A 4X6DF 4LHUA 1I7TB 3PL6D 2OW7A 4DV5B 4WI8A 4X4KA 4UOZA 5D7LD 2XAQA 2OMTA 1K73W 2XG5A 4Y5XA 4Z7NE 1RUPL 5C09B 1USQA 4ILDA 3T3PF 1UUSA 3F7VB 4OI9A 1IC7L 5FM8A 4AYGA 4XCCH 5H9CA 3PDOA 1MMMA 1HESA 3CFEA 4PJ5E 1G7PB 3ZTNH 1MCBA 2P80D 3EKCA 2NY0B 4FVMA 5J2TB 3K79A 2HG5B 1IRAY 3V9CA 4CSTA 1IAMA 1AXSB 5I2IA 3MV7D 4YHLL 5KYYA 3V8OA 3BRDA 5IQ9B 3MJ7B 4H8WC 4UIMB 4C54A 2C3WA 2CXKA 2G60L 1N5AA 4GO8A 2CHZA 4ELKB 1CPUA 2XETA 1ML0A 2CO7B 3KYMA 1A7PH 4PYHA 4EZKA 1ZL8B 4PY7B 1BQHG 1UB5A 3N85L 3WD5H 4WO4A 4GX1A 2ZKMX 3K3WA 1KNOB 3VWJA 4ZAKD 4OJDH 3BLKA 2WXKA 4L3EB 1NAKL 4BHUA 3HC3H 4W4NA 2PXYB 2XAJA 3HZVB 1LJMA 4NUJB 3THMH 3JD2A 2Z8SA 5B3SB 4NZUL 4Q20A 2QLYA 1NCCH 3ARBB 3HS0A 4N6RB 2H6OA 5KZCB 5CHNA 2XZCH 4XNQB 2I25N 4OFVA 1FXKA 1P84F 2JEXA 3V4VB 3G6BA 3P3PA 3JSNA 3RGVA 1LP9E 4K94L 3QDJE 3MUGA 3UTSB 4CMHC 1O75A 1T5XB 3IPEA 1ZLSH 4HPYH 1MNNA 1A14L 1CE6B 3GB7A 3ULAB 1ZSDA 1I31A 4MQXC 3FO9B 4M43L 2VAAA 1F86A 1LDSA 2GJPA 3TBTA 3JTTA 1C12A 3W1ZA 2NUPB 4ODHH 1Q8IA 2VXVH 1MWAL 3WLWD 3FT9A 5JDJA 3AADB 2YOCA 5FPRA 1GSMA 2WINB 3WJMB 3OB0K 3K5LA 1C08B 1CD1A 4UQAA 4I55A 3NCCB 3O8XA 3D36A 1OARL 3LHPH 3UMNA 1CU4L 4YXWG 1OKEA 5LN8A 2D9QB 5GRXG 3QQ4A 2GJZB 3ZBMA 2DYRB 4MVUA 3HE6C 3U1QA 2CM5A 4NRXB 2LLGA 4LSUH 3X11A 1EJ6A 4NXNO 3LKSB 2M1KA 5CD5C 1KU9A 1HI6B 3R8BB 4NQDA 3QUXA 4DN4H 4Z7OF 2IU3A 3E1ZA 1XH1A 4JYBA 5DD5H 5D4JA 2L6LA 5LMUB 4LDEB 2AZ0A 2IGFH 3TF4A 2JJSA 3K8MA 2NW2B 4Y4HA 5HHVH 1PDKB 4NM8H 4G9FA 1O5DT 4ENZA 1KBWA 4E5XG 5CBGA 5F3HB 4TUJB 3JSSA 2N3JA 5DJZA 3PAVA 3QJFA 3II3A 4RIRB 2ADGB 1YPZF 3DHUA 2X41A 2UY7A 3IJHA 1NDMB 5KVEE 3ARFC 5G4NA 4LBAA 2JTYA 2EVGA 1RZ7H 4H25A 2EJRA 4P2OC 4M5TA 3SO5A 1MOFA 3QEUB 4N0CD 4F9PA 4NQEA 2YJLA 1SZTA 2HJLA 4ZOEA 2Q87A 5BZZA 5EBMC 1MIML 1IBKO 1RHFA 5BRQA 5D70H 4LKXB 3ME0B 4U1MB 4YFLF 1KLUB 1J8RA 3JTSA 2LOEA 5EIQA 2MK3A 3QNZA 1KN4L 1FL6A 5ADOH 2VKWA 2O93L 3G04A 1OSZA 5TE6H 3L5WA 2V2TA 4AQ1C 2D7QA 3ESPA 5CGYD 4JY5H 3QIUA 3AG2B 1YJDL 1Y74B 2VXUL 2X4PB 1A1OA 2NY3D 1Q0EA 1D2OA 1PF3A 2DQEL 1AY1H 4IDLA 2K7QA 2Z64C 5CUSL 5GS1B 3LIZA 5C0DB 5IW6B 4IBSA 1HNXB 3IDMB 3OR6B 3ABKB 2K4AA 4PFEA 1WFUA 1XV8A 2OTLV 5E4OA 1YMMD 3RVWC 4MDRA 5DUPH 4KROC 2Z91A 3RWJA 5ITBH 2DWEA 3K4AA 4KZEL 4HV8B 1NCBL 5AZ2L 4NZDA 4QE7A 5HI4D 3AU0A 4M03A 3ZL2A 5JTWA 1MHEB 1XR9A 3KKYA 5GGUB 2XJLA 2LE9A 1QPPA 4B53A 4M7KH 1S72V 3QDMB 4MGXA 3NEXA 3N1GC 2NN4A 3J7AU 5JDSA 4Q6GA 3K6DA 4YL9A 3B34A 3QI9D 3FT4B 4P59H 4F8LA 4PD4F 1KBBA 3KS0J 4ECNA 3UIYA 2VXTH 3EJUA 3MNZA 5CNHA 4JM4L 5JW4M 1BLNA 1EHKB 4DV3O 2A9BA 3VQWA 2FQGA 1R6NA 4K71C 2JKTM 4YDKH 3Q9QA 2BLFA 2EILB 3E1F1 2ZKYA 1YEFL 1SVCP 3MNVA 4B5ZA 1NAMA 3K2KA 3S4SG 4CMMA 4LSVL 5A2BA 3JWOH 4ZOCA 4HLZH 1S9WA 1QRNE 3JZYA 1AI1L 2PUQT 1NIBA 1LL1A 3LN9A 2EYTA 2CRIA 2QV4A 3ARTA 3FFCA 4YR6B 3FO1A 4Z95H 4FXKA 5C0AA 4UQBA 2VLLB 4PDVA 2ATKA 2F5BH 2ZD0A 2H5UA 4QLWA 3HNVL 1CURA 3BGFC 3D33A 4XNUH 2LHAA 1EANA 4Y5VC 4AQYB 3OXRB 1AI4A 1VGEL 3D0LA 5EU5B 1YY9C 3LN4A 1IZKA 3KEDA 2Q8BH 4W9EC 3LNEA 2PTVA 1Z5LA 4X6CF 3FUEA 5JOFB 1JJ2U 1E7VA 3WXVH 5IYDO 1KB5L 2NY6C 5DS8A 5AW4B 5JPNC 4M1DL 3MXVH 1PM9A 3ULVE 2Q7AA 5T1MB 1U8NB 3NPSB 2X4QA 3PWLA 2I27N 1X7SA 1AIFA 1FO0H 4U3JB 2ZX5A 3BVXA 1BOGA 1G5AA 3NOIA 4WFFA 1JCVA 3MX0A 1MVYA 4GUNA 2ROYA 5HJGA 3EGSB 4OV5A 3N2GB 1T3FB 3O9WC 1AR1D 3AG1B 2BSED 3S36H 4Z7NB 4YSTA 1I7UA 3SKOA 1X5KA 2X6MA 3PHQB 2FX8L 2DH3A 4YJ2A 3QWNA 4TOIA 2W6IG 5EG6C 2HRGA 2NYYC 4XP1L 4K9EC 1OAXH 1EHLL 1FZMA 4HKXB 1KGYE 1K4CB 3IT8D 4OM0H 4EN3C 1XNQO 1ILUA 1NFKA 1BZ9A 1JNHB 4RNRA 1F56A 1CD8A 4AX3A 4YS4A 5CEZE 3BLPX 4AK2A 4FI6A 4XP4H 3L3DA 4K8ZA 1KZYA 2CK0H 3JWNG 3PAUA 4MCYB 2QKIC 3BPCA 2A5UA 1V7NL 1NC2A 4J80A 3MOQA 3BZFB 4ICGA 1QSVA 3BKMH 2E47A 3E2EA 4RUFA 1KEML 3OJ2C 3FB5A 1Q90A 4HCRL 3TVMC 4ZW8A 1NIDA 1ZA6B 1HEJC 5C0CB 4NB7A 2YUZA 1WFNA 1E9QB 4J4PD 1T1ZB 1A65A 5JVDA 3HMWL 5E2UH 2V5MA 4UINL 4LQFH 4KMTL 4C58B 4D8PA 2VM3A 1N67A 1A7RH 4J3SA 1CFSA 4HK3J 2EVFA 1EEZB 3QHZH 3R18A 2XWCA 3I9GL 5EF3A 3QDJB 3T9WA 3DGGA 3E3QC 4WKZA 3RWGA 1U8HA 4JF3A 2VL5A 2EQDA 4MA7L 1QLEB 2X3CA 3AW5A 5I1DB 1IM9D 3QJUB 4HIPA 4NYLB 3JV0A 2DYSC 1BDYA 5B38A 3AAZA 3AM8A 2R56H 3DX3A 2I9LA 3H55A 1E5AA 4O2CA 4EXKA 3NR7A 1FH2A 1Q6HA 2VWKA 2W94A 2IQAA 3HC0B 1N64H 1OCZB 4TNWF 3MJ9L 5BVJB 4LSPL 3SYOA 3T0EA 1JK9A 3SPJA 3GK8H 2HWZH 1IGJB 1YJ9V 3LRGA 1OSPH 4JANA 3L4XA 4DETA 1UHVA 1X7QA 3B9AA 2L7QA 3HPJB 5GS3A 2OSXA 3VSQA 4IGBD 4PJEF 2PYLA 3ZMZA 3Q9PA 2A6KB 2AEWA 2VXQL 3UO2A 1L7TH 5ALBH 1MFCL 4XODA 4NUPA 2LLNA 5E23A 3ETTA 3UC0H 1IKFH 2H6UA 4O58L 1A3RH 1VFAB 2G2RB 1QLRB 4XCEB 4YHNB 1SA0B 4KJPD 5BV7H 4QTIH 4TVPH 4FFZH 1CCZA 2R2BB 4UM9B 1SOSA 5DD3H 2UVEA 2AQSA 2YWYA 3KD4A 3LRKA 4U33A 4XHQA 2WW8A 5DEFB 5HHNB 4PH8A 3VU2A 5KYNA 2XWTB 1KGUA 4NENB 4YSDA 4ATTA 2R1YB 4LKCA 3NZHH 4YXHH 3UJIL 3QXDB 1NR7A 1Y66A 4JN2B 1WD8A 1IVTA 2IOMA 4IYIA 2Q0AA 3SO3B 5TPWL 4LARH 4B7EA 2VDNH 1JFQL 5B7FA 2HT4D 3O4OB 4NQVA 5EEWA 2XZZA 3MJWA 3T2NH 4M8RA 4BZ2L 5FLUA 3VXRD 4M7ZC 3FCSB 3MLVL 2M8XA 2HJKB 4UTBA 5A2IH 2H9GA 3PRZA 3CQQA 2WK2A 3STZC 4MMZA 3QIBA 2UXBB 2QEJA 1OE1A 1WITA 1Z0MA 4F33B 4FADA 2CBMA 3T71A 1E4WL 4U7SA 2DQHH 1SDYA 3TEYA 1G1YA 2PPCA 4I0PD 2H0FA 4PJGF 4Y9GA 5K93A 4PTTA 1KCSH 1MI5A 2CDFB 3NAAH 3U36B 1KSRA 2JRIA 2YD5A 4UM8B 1NGWB 3ESNA 1XMQB 3CC5A 2X89D 1CLZL 1NDGB 3QF7A 4G3YH 4Y4KD 3Q6GH 4JO4L 3BAYA 3B77A 5HSFA 4TPRH 4QAMB 4OLWL 5DD6B 1T0NA 4M7LT 1RD6A 3WKML 4RAUB 3S37H 5CZXC 3N44B 4PJ8D 2BTQA 3DJZA 3OG4B 3MRFB 1GPOL 4AHCA 1YNTB 2AV7B 1OT2A 3P9WB 1JL8A 3VXUE 2F53E 3P11L 2WYIA 5CS7A 2PETA 2GG1A 2BHZA 5KBPA 1AGDA 3E0GA 3OB0H 3DOHA 3K0YA 4NN5C 3U9UA 1URZA 4MTFA 2SEBB 1FXHA 4QHUB 5GZNC 3NBNA 4DR6B 3FFOA 3Q3GB 4FABL 4TV3A 1VSCA 3DJSA 1B04A 2X9XA 4NO3B 2G75B 2VZTA 5EU6D 1VLXA 1MCOL 1AFVH 2Y36L 5ACZB 4JO3H 3KLAB 5I1GH 1TU2B 5A40E 5I30L 2QGCA 5ENWB 3PL6A 2PPEA 2DWXA 4BM7A 4YJ3A 5D7LA 5BCAA 1S5IL 1WIOA 2EIJC 5L2KD 2MNUA 4TTDD 3ULSB 4LF3A 2IC2A 4H1LB 4MXVF 5I9QB 3C60B 4ZHQB 3QG7H 4K8RD 4L9LA 1GN3A 3TJEH 4UOW1 2XICA 3F6JA 1G0XA 1QWNA 4JEGB 4WFAV 4WWNA 5D7SH 2P80A 5FYKE 5E6IC 4BZ1L 3JYCA 4LWSA 1QRNB 4TVSa 3DVGB 4GAYA 5BY1A 1F02I 4AZUA 4M4RB 3RWHA 2ZP9A 4HP5A 1W8OA 4AEIL 3DSQA 3FH8A 4V33A 3MV7A 4XPHH 2HJFC 1A6UH 1CL7L 2IGTA 1OAKL 3MRJB 3HMXL 4G82A 1MJUH 1KB9F 1KYDA 4J23A 4TLSA 1OCWL 4ZAKA 1EAQA 4PA3A 2ZUSA 4FTDA 4IJ3B 4YHYC 4K8RH 3T1YB 2V1DA 1H8NA 3RYFA 2EZ0C 3JV6B 4A7SA 1CD9B 1O9ZA 5FYJE 4IYKA 4PJIF 3HI1B 2GIYA 1WQVT 1R3IC 3E8VA 4MFHA 4UT6L 5T3XD 1CGTA 1E4XL 4R3SB 3AEIA 4NBZB 3U4EB 2VLJD 3NK3A 1KUMA 1MG3C 2O1AA 1GW0A 2CO1A 1T5WA 2P5EE 4FP8H 1T03L 5GQBA 3O3BA 1H2NA 2IBZX 3TH4T 2PR4L 1HZKA 1E50A 4ZMQA 2AHYA 5T1LD 5IMMB 1B4RA 2EE0A 3FQUA 1HWHB 5LBQA 1MW2A 3B09A 5FM5M 5I71B 1INDH 3WSQH 4I4WA 4LF6O 1FCGA 4P4KA 5CN2A 3T77B 3RJOA 1XBLA 4FTVE 1G7IA 4DR3B 2ERJB 3KL3A 2NXZC 4AYFB 2F18A 3K0WA 4WY7H 1FNFA 2HRHA 2FR4A 5AB2A 1QQDB 1RZFH 4OZFB 3DC5A 1X9RA 4D7TA 5HYJE 3E86A 2V5TA 1PLAA 2AAAA 3MRHB 3P40A 5K9JH 3TFKD 4G8GE 3X12A 2UX7A 4B3TB 3ZYZA 5GSVA 3RX9A 4BKTC 3SJQC 1Z1WA 4TNEA 2VZVA 5HHMB 5CMUA 4JFUA 3N2JA 1BE3H 5LA6A 4Y8DC 1Q9KA 5LNDA 4F6RB 4HJ0D 4P8QA 1BGXL 2F7RA 1SERA 1S46A 3SGJA 1Z0NA 5A6MA 1GRWA 4AITA 1ASOA 1UVQB 3D06A 4P46C 3TU6A 2O30A 4KKLD 1QR9A 1UZGA 2DQTH 3QVNA 1P9MA 4NO0D 4LP8A 1ZWIC 3WJLC 4ADGA 4EI5D 1JSYA 5K1JA 5J8OA 1DUZA 3B7RL 5FPOA 2PTTB 4WWKB 1HCVA 1YYML 1AC0A 1E9OB 2VGLM 4G8EA 4DF9A 4HIIB 4OY9A 1K3EA 2Z7YA 1ED3A 4X6DE 5JJJB 3BPOC 3I50H 1H2KA 4ETQB 3KH3A 2IV8A 1K6QH 5C93A 2N0MA 5FECA 1JPFB 1MABG 1JN6A 4FNSA 5CSZA 2YN3A 2W80C 5D1QE 4JFEE 1F2QA 1MJJA 2VLRA 3BW9A 3P1VA 2WIIA 1Z5HA 3VWKB 5CFHA 5EPMB 2FUTA 1IC5L 5KOMC 4GJTB 2YD3A 4E42B 3NDYE 5D71H 1VKXB 2DS4A 2H3OA 4FNPA 3DUUB 3MLRH 4UANA 1A8ZA 2CH8A 1WFOA 3F12A 3C9NB 4X8XA 4I48A 4KKRA 4YQXH 3VO0A 3INUL 3ABMC 1NL0L 5EDXA 3RE0A 1YMMA 1XF4B 3PG2A 3OR7C 1ZT7A 1A7QH 4LOUC 4WI3A 4DCQB 3AU1A 2JLPA 2JK5A 1GMEA 3X1GA 4R83A 1F6FB 1DBKH 2Y69C 5EU7C 2XX1A 3WAJA 1J5OH 1YDXA 5IFHH 4I2XE 3FDWA 3LY6A 2CPUA 3Q2VA 4RUEA 4ZBMA 4Z7UE 5I1LB 1JXDA 3OHMB 4GW5B 2VDLB 3S3JA 2EUXA 1ZT1B 1URIA 2DN7A 1JTOA 3GXTA 4OB5H 3K2UH 1N59B 4OZIA 1ANUA 4K3JL 3H1ZA 2QR0B 3IJYB 5DO8A 3QI9A 5B1CA 1IARB 4N2CA 4WEMB 2I85A 4QRSB 3AY4A 2FX9L 3OUFA 3OGCC 1DQKA 4YHPA 5JORA 1HR0B 5CXPA 3MLYL 3GQFA 2F19H 3N0AA 4NNPH 4YZFF 2BVPA 2XYCA 4N90E 3IU3B 1HAWA 3ISWA 5MI0B 1L5GA 2C9PA 2R2EB 1TQCB 2UXDO 1AXIB 4FLHA 1B0WA 1ZAUA 1FO0A 2J1YA 3L3KB 5IROC 1Y1UA 2DKMA 3NVQA 1F18A 5EBWC 3AG4C 3CFCH 3VXUB 2F53B 2XRAL 3BWSA 3GBML 1AROP 4Q58C 4XMPL 5TE7L 1OGAD 2E74B 5DHYA 1C5DA 3C6LC 3BVVA 3WXWL 2QWNB 1XSOA 1ZOXA 3FB8A 3ZUNC 4YHHO 1RP9A 4NPJA 2XWRA 2EX3A 1I1AD 3T2LA 3ILDA 1MLCB 1J9RA 3UO1L 2BSSA 25C8L 1AVMA 2EH8H 2WUCL 4I7ZC 4J8RB 3SBWC 3BWAB 4HG4K 1XBRA 4G80A 3UO8B 5AL0A 3B9EA 3OJDB 1YPZE 3NN8B 4ORGA 4JPVL 1NFDB 2NY7H 3U2SA 5C0RL 4JFXB 5FCUL 2XX0A 4XN7A 2BINA 1UD4A 2BSEA 4ODXB 4DP7X 2XQ0A 2X4OB 5EIBD 1XILA 5LP6B 1FXVA 3H3KA 5F88A 2OTJV 4FIPC 1JZGA 3FHAA 5AKTA 3Q7JA 1HCFX 2B5UA 5ALCH 4G7YH 1DLBA 2LW7A 2R1XA 4MXWH 3ZZQA 4JI3O 1JERA 3VYOA 3IVKB 4J39A 3HAEA 1P2CA 4X8AA 5FAAA 4KKQA 4KUZL 4AE1A 1QI5A 5CGMA 4C47A 2V8LA 1OTTD 4WW1A 4X4YA 2YPVH 1BQLL 5AKRA 1IQDA 2CDGB 2UXNA 2KLSA 1GGBL 3E83A 2X1PA 3BKYH 5DO2D 4PV9A 2HA1A 1HL4A 1MCJA 4IU2A 4BSWB 2HTLC 4DUYB 3EYSL 5INDB 3BUDA 2IAMD 2XQYG 4JO2H 1S9XB 1MRDH 3IMBA 4XDLA 4K7PL 1FYTE 1MKFA 2J8OA 2WXQA 4AEHL 3U9PL 1N8ZB 4NN6C 2BCKB 1QSED 4NAMA 5DRXB 4WO0A 3AB0B 5LB1A 2QGEA 1ZTMA 1YDPA 3FU5A 3E38A 5DEDA 4C8XA 1H3VA 3MHZA 2QBWA 1PZDA 5DSCA 4C4BA 4FFZA 4AJVA 1IM9A 4F7CA 4HWNA 3O45B 2CBPA 3L5JA 4G6JH 1PGRB 3EFDL 5JW4R 3QRBA 4EOWL 1XMEB 2DQJH 2A0LD 2VSKB 5IBUB 3L3GB 5DMJB 1DVFB 1HHHA 4FTVB 5JLZB 4G43A 4LEXL 5DEGA 4LF9O 1KXTB 1AZUA 4DZ8A 1GRJA 2CIIA 1KJ2B 1HC1A 2ZX8A 1MCCA 3D39B 5JNYA 4QT5B 3PDGA 4IGBA 3WNLA 5HYJB 3GDCA 4WI4A 3ZMRA 2JVDA 3NACL 4DN3H 1K5SA 2Z1KA 5DMYA 4G8GB 5ID0A 2IH3C 3A6CH 4P05A 3DLQR 1PCSA 2Z34A 2R69H 2F54D 3NABL 2YBGA 1XEQA 3UQ8A 2L0DA 2QSQA 5FL7G 1DF5A 2ZZUT 3CE2A 2YBRA 3KPSD 3FB6C 4AW7A 2JKIS 5B39G 4WI9A 2XG4A 1L9NA 2I26N 4JYAB 4QHLA 5I19L 1JPEA 3VI4F 1SKVA 3HIZA 4ZXBC 5FKPB 2EICA 2L04A 4JQXC 5KS9A 3S35H 3SCMC 5C0BD 2DIJA 1G9MC 3EO1A 2WGXA 1CXZB 3Q1SL 5EWIH 3ESUF 3B9KC 3S5LB 1TCRA 2PO6C 5K9QI 4LFAB 5I74C 4EBQH 1IEBB 1UCBL 3S8FB 1MF2H 5LBVA 3T4AC 3VXRA 2D7NA 5CIPH 5SWQB 2WCPA 1H6TA 5C9KA 4PDMA 3FU7B 1TT6A 4KRNA 2XTLA 2X12A 2XZQL 4RFOL 1SEBB 4TUOA 3LH2H 4JFPB 2TRYA 1XNRO 2R4RH 4I0PA 3GKWH 1CDCA 4PDRA 4PGDB 5D1QB 1O6TA 3FZUD 4JFEB 4AYEC 1KG0A 3L7FB 4RGNE 2JVUA 4M5YL 1I7ZA 4Q9BA 5FPIA 2X89A 1J88A 2WLLB 5DVKA 3J7HA 15C8L 4OCSL 2LU5A 4Y4KA 3RHWF 4B7IA 4BKLA 4W9GC 4ZPVA 3A5VA 3CD4A 1JMXA 5HGAB 4YHIA 2O5XH 1M9WA 4ZMPA 4PJ8A 2FJSA 2QPUA 4ISVB 1OF2A 1IUZA 4X6EB 4U7MA 3NESA 3K6SA 1KFAH 3ZZ1A 2XXGA 4F24A 1NLBH 4Z0XB 3BDYH 3OHXA 1LO5A 3QUMH 1XL4A 2Q6WB 5BRZB 3DV4B 1P5UC 2FT6A 2XYBA 4IU3A 4YBQC 2AEOA 2EDRA 4PIBA 4G1EB 4KKAD 4OLEA 1ZD6A 3P9MB 1V54B 1WT5A 1NC4B 4G27B 2FB4L 5D5MF 4KVCH 5DFWH 2XC8A 4I2XB 2YUXA 5FOBA 3QO7A 4F2ME 4IIQC 5EU6A 4Z7UB 1A4JB 2M6YA 5TDOA 1RK0B 2WQUA 1S7XB 1I8LA 2IMMA 2AGJL 4KO5A 4AGQA 1BZDA 2HT3D 3SDCC 2OCCC 3TXQA 1ZMYA 4Z6AT 1JOYA 4NKMB 4RRPA 2P46B 4ESKA 2HKFH 3OMNB 5J3HD 3RGBA 2HB0A 3RPIB 5L2KA 4O4JA 4MZ2A 4PJ7B 3N06B 4KJWC 3EHBD 1Q0XL 1JMKC 1WZ1H 1YCSA 2DJSA 5F6HI 5FA3B 1NUFA 5CB4B 1R0AL 4Y2DC 3QJSB 1S3KL 2FJFB 5IVXF 4N86A 3RIAF 3D69B 3CVDA