4W4LA

Crystal structure of espg5 in complex with pe25 and ppe41 from the esx-5 type vii secretion system of m. tuberculosis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
84
structure length
84
Chain Sequence
NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords PE family protein PE25
publication title Structure of a PE-PPE-EspG complex from Mycobacterium tuberculosis reveals molecular specificity of ESX protein secretion.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 36
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4w4lA00
2G38A 4J41A 4J7JA 4W4LA 2GTSA 4J10A 4J11A 4J42A 4IYIA 4J7KA 3FX7A 4IYHA 4KXRA 4W4KA
chains in the Genus database with same CATH superfamily
3DXRB 1JMKC 4K3AA 3UO2A 1IZ3A 3ZRSA 4JZGA 3QO8A 1SA0A 1SC5B 5D5PA 3FB6C 2GUZB 4EKWA 3SYOA 4ZOLA 3SJBC 1Q8IA 1BMFG 1ZUQA 5EBMC 2X6CA 4FFBA 4AI8A 4OXSA 2KSDA 1K7DA 2P6JA 3JALA 1VF7A 1SQPH 2CDYA 1IXBA 4FZ1A 3NXSA 1N32O 4IGGA 4I7ZB 1ZLZA 2H3OA 4RWUA 1NTZH 3HKBA 3RYHA 4U3FH 5CN0A 1OCOB 3LSSA 2VWKA 2V1DA 1MZFA 3CXHF 3PN1A 4X20A 1HDJA 4BIOA 4DR2B 3G71V 1JJ2U 3HKCB 5EZYA 1R73A 4DW1A 1T5EA 1M57C 3AG1B 4MVZA 3ABKB 3ZMSA 1NTKH 1AB3A 1B3QA 2IU3A 1FS0G 1MSWD 1R6TA 2YUAA 1D5NA 3HB3B 2DYSB 4FLUA 1SA0B 2M7WA 1YJWV 1EZVH 4DK1A 4DV2O 4CS2A 1GKFA 1Y67A 5EC2C 1SQVH 3BPZA 3G6EV 1UFIA 4FFBB 1KMIZ 5L3DA 1CPYA 2F1MA 3JCUZ 3JARA 1XBLA 2EIKB 2E74B 3ZN1A 2OTJV 3LUTB 4H13B 5F2VO 5KHIA 4K8ZA 2PGGA 5IY5C 3HKBB 1KB9F 1Q5OA 3RYHB 1R1BA 2AHYA 3AK3A 1I5XA 4Q20A 5TISZ 1VMGA 4IHJA 4IL6Z 4X20B 3LSUA 3CSXA 4PDRA 5BZBA 3I5DA 2E5LB 4AILC 3JD0A 4X64O 1QBZA 2WWWA 2DJVA 1QLNA 2X0LA 3KCXA 3RT3C 2JJ2G 5KMGB 3GVMA 3STZC 3CPWU 4R7CA 4FLZA 4OX9B 2P7TC 1JJOA 5FNVB 4DV2B 1YCIA 4I5SA 5KHJA 2DYRC 1DF5A 3T1HO 4QNHB 5J2TA 2F66C 2ILMA 5KX5A 3BEHA 3ETEA 5BXZA 1OCZB 3JARB 3DC5A 2N05A 4TUYA 2MW2B 2Z5UA 2IJIA 4JF3A 3B77A 1XL4A 4E2LA 4TT3G 5IJ9A 4JI5O 1NBMG 3K03A 3D36A 4DXWA 3CJHB 2UUAO 5LA6A 3FB7C 4JAVA 1LUVA 3W7SA 3E89A 3CCVV 4X65O 4DV0O 4B3TB 1EN4A 4RO2A 4X1YB 3RN4A 2ARHA 2PYJA 4GKJO 1U96A 4WCEV 2JGUA 1XNQO 1Q81W 3ML0A 4QE7A 2ZXWB 4NYKA 4FFKA 2EJRA 5JH7B 1IURA 3ASNB 2QWOB 3WG7C 1H38A 1WN7A 3CB2A 5J2TB 2Q7HA 1RSOB 3N27A 3VQXA 3W7TA 2VS0A 3RYFB 2WLIB 1G4YB 1K4CC 3JAWA 2YIBD 1MMMA 4JGSA 4LNUA 2YXLA 1PL0A 2VWJA 2CTQA 1FXHA 1YF2A 4MVSA 3A0BZ 4JI1B 3THOA 5IJ9B 4MSWC 2L6LA 1TAEA 2ITDC 4JI2B 1SKVA 1JFFA 2JGDA 2R9AA 4LC1A 3ZN0A 2UUAB 5J9PC 3RYIA 4NXMO 1PL4A 2CGNA 4B08A 4DV6B 4DV0B 1YDXA 3ZIAG 4O4HB 1PM9A 1IVSA 1GN2A 3K0GA 5H6RA 1H2LA 2XAGA 1KU9A 4GKJB 1GO3F 2QWPB 3F7YC 4LBEC 3JASA 2QA4V 3X2QB 2XASA 4DR7O 2ZE6A 2ZE5A 3TCUA 1AROP 4JI8B 1BQZA 4RAIA 2ZNIA 3LDCA 3E22A 2UXNA 3T2MA 1BE3H 1ZX3A 5J2UA 3CD6V 2HP8A 2YI8A 2RDCA 4LNUB 4PA9A 3ZCCA 3SPCA 1EN5A 4MVRA 5H5NA 4DR4O 3JD1A 2AW9A 2ZE8A 4DV3B 4R50A 1P4RA 1N34O 4JYAO 4FM1A 4YY3B 3RFRA 3O9OA 4YJ3B 2GSMB 4AHCA 2PZSA 4JPRA 1HNXB 1S5HC 1VIBA 2CK3G 4I0XA 4XBFA 2DWEC 2HFEC 4DR1O 5BMVA 1URFA 3MAQA 3H1JH 2NR5A 1FXKC 4QPJA 4U3JA 2Q73A 4UVAA 1RM1B 4Z2WA 3C3SA 2HJFC 2KB1A 3E35A 1SQFA 2XAQA 1QVGU 4PD4F 1H2SB 2QTSA 2QKAA 3L70H 3FYEB 4B3RO 2ZIOA 3E22B 5J2UB 1I94O 1BHBA 3K59A 4PHZA 3BA8A 1SETA 2Q0AA 5B1AC 5LXTA 3E2EA 1SS3A 2GBOA 3CRMA 1L0NH 4WFHA 4TV9A 5D5QA 2QTOA 4GX0A 3N2KB 4WF9V 1N34B 5JVDA 3K58A 1GMGA 5LHHA 3I55V 4I0XB 2P22C 3J81N 3ZX6A 4ASUG 2ADQB 1FD9A 1YIJV 1FXVA 2XHBA 5CBGA 2ZE7A 3W7XA 2Q9LA 1K3EA 1THZA 4B7KA 1XI1A 1NQTA 1Y4MA 5EYPB 1K5QA 1TA8A 1YHQV 3T4DA 4PDMA 1OHHG 2HHHO 2UUCO 3ZRWA 4HYOA 2D3OW 1I94B 2UXDO 5LP6A 2H8PC 2JDIG 1HWYA 1HNZB 5DN6G 3E8HA 4JI6B 3HKDB 1XDCA 1HNWO 1V55C 1SQBH 4UCTA 3TXQA 1OV9A 4UCOA 3JAKB 1U97A 3BVOA 2Q68A 3OE7G 4PA4A 4DV4O 4DR3B 4WFFA 4GKKO 4F6RB 2AXTZ 3K9AA 1KP3A 4WBNA 5CB4A 3G80A 2CH7A 2LJ2A 3JD3A 1YI2V 2OIGA 3OR6C 3ZHUA 4GX1A 1AI5A 3L74H 2ZM6O 2G38A 4RQEA 3CP1A 4ABMA 2X7RB 1Q43A 1VQ9V 3R65A 1M93A 2D2CB 3BRCA 1AR4A 2E76B 5B3SB 4JV5O 3EVKA 2RN9A 4TWKA 3CMAV 3ZHVA 2QGNA 1ZWIC 1I0HA 2CGOA 4JI7O 2BE3A 3CCEV 2BSKB 4WFAV 1NI8A 4E4EA 2UUCB 4DV5O 2DWDC 3ZHSA 4FLTA 4LF6O 4NKGB 2CTWA 5LP6B 1PV0A 4J7ZA 4CBCA 4LCUC 5IYZA 1HNWB 3U10A 4PI2A 3RW0A 2PI5A 1NTMH 5IYDO 3AG4B 2Q4PA 3FD9A 5JCOA 4UCUA 3WB2A 3CEIA 4DV7B 5FPOA 1M1KW 3E86A 2CH7B 1Z5WA 2ZM6B 1S5JA 1QU7A 2A3QA 2EILB 1SQXH 4O4JB 5KLVH 1Y76B 2P06A 2KG7A 2WLKA 3JSLA 2E75B 1KKDA 1XMOB 3SJQC 3FX7A 5JJNB 4K0KB 2B5UA 3WB1A 4DV5B 1K97A 2QKSA 2WA4A 1XREA 2QKCA 3AG2B 2A79B 3LNNA 1JPXA 4FM0A 4LP8A 3ZS8C 1VEWA 1SZTA 3BABA 2RQ6A 3CC7V 1BQ0A 4TSFG 5E79Z 3GWKC 2DN9A 4WFEA 3CC4V 4CC6A 4LFCO 2FTKA 3SPGA 3AG1C 3ABKC 1S76D 3K3WA 4I50B 3LDEA 1R6KA 1PNLA 3SJCC 5KAIZ 2QWQB 3VBBA 2KG7B 5JQGA 4BWAA 2O57A 1S0VA 1TGOA 5ITZB 2YIAA 4BW5A 2QDOA 3OUFA 4ZI7A 3AK2A 1EZJA 1ZTEA 2C2AA 5JWPA 3ETDA 2ETNA 2HKOA 1R3KC 2IJKA 1COWG 2R9IA 4XDKA 2EIKC 3ASOC 4JTAB 3OW2U 3L9DA 4MT8A 4LR3A 3O65A 2E5LO 4O4IA 5A9GA 1VF5B 4EFBA 3CCUV 1M56B 2JK5C 4UUJC 3ZMVA 2QEXV 4J42A 4O4LA 2Y0PA 2QWRB 1X4TA 3ABLB 1QCEA 2EZOA 4LFCB 3K5LA 4OX9O 1TUBA 2GV9A 5EC1C 4B3SO 1XQ8A 3UCSC 2YXYA 4ZOLB 4EFEA 3GWOA 5JJEB 5CMUA 2XAHA 2K1EA 5KUKA 5LMUO 2XUMA 2Y69B 3K57A 2YICA 1LR1A 3H1IH 2WAMA 5B1BB 4GX2A 5L3CA 3JALB 2ZCEA 3QTCA 1X59A 3T4ZA 1VQKV 1YZBA 2VRZA 1GM9A 1XL6A 1OCZC 1M4UA 2NNUA 1AI4A 1RP3B 4I9WA 2OCHA 3FYIB 3A0RA 1FFTB 4B3TO 5EZYB 3P30A 2K9PA 2BCCH 1D2DA 1P7GA 4LFAB 4IYHA 2FL4A 3OGCC 3OEHG 3RBZA 5K1XA 1W0KG 1NU1H 2EZPA 2RJZA 4B3SB 1W59A 1TUBB 3ZJZA 1N8RW 1XNRB 1K92A 1IBKO 3JYCA 3ZMUA 5LMNB 2UU9O 5LMUB 2OYQA 1P49A 2EX3A 2BTQA 3A2FA 4LF7B 4EB6A 2UXCB 5GTIZ 1F7YA 3ASNC 4Q6GA 3C90A 4C7UA 1WP7A 1Q82W 2Z0AA 3M8AA 4X1IA 2PTMA 1FJGB 3SR2C 1F23A 3SYPA 4JI1O 2AHZA 2W0FC 2FKXA 2AGAA 4JI2O 3ETGA 2JS5A 3H1KH 1NVPB 4P30A 4IHJB 2EIJC 4H0LB 4HBNA 2HR3A 4DV6O 2IH1C 4JYCA 2ITCC 1BHAA 3ABUA 4P2ZA 1GH6A 3PJSK 2WLJA 2V7QG 3K5MA 2GTAA 3ZBHA 3CCLV 1IBKB 4JI8O 2UU9B 2CE4A 2R72A 3ABMB 3QNEA 4NXNB 3SDLA 3STLC 4KUMA 3P3NA 3X2QC 5KA6A 1V54B 1B6QA 5KX5B 1SQQH 2DYRB 1OCCB 4EB6B 3LSQA 5LGNA 1BL8A 5FLXN 2F4VB 2BOBC 2A06H 1IDSA 1G1XB 4GT1A 4TUYB 5IT9N 3TETA 4X1IB 4KHPO 4FLWA 3D8CA 2VQFB 2PI4A 1MNGA 1KP2A 2DOSA 3B09A 4DV3O 1GN6A 1BCCH 1KECA 2EINB 1KYOF 4YY3O 3J7AU 2OCCC 3E83A 3SJAC 4NTWA 1HNXO 5LA6B 3WFVA 3F5WC 1KKCA 1MA1A 1IBMB 4BIZA 1VF6C 4FLYA 2B1IA 4CZZA 3VQWA 2MK3A 1EFRG 3L71H 4CH4A 2ZDIC 4J7KA 5LHIA 2UXBB 5LYJA 1VARA 3K9SA 1FFXA 2RNBA 2KQXA 1K33A 5K1PA 1GAXA 5KHHA 3UT5A 4GX5A 3OMIB 1YJNV 5CA1A 3JAMN 4MTXA 3WG7B 5IYBO 4RQFA 1Z5VA 3RYCA 4YJ2A 1HR0B 1H8EG 5KHGA 1ENVA 1W2BU 3AEIA 4HNAA 3JAWB 2EIMC 4XDLA 1Q86W 4RUFA 2XAJA 3CCQV 2ZKOA 5GONA 1DK1A 2ODMA 4KHPB 3K79A 4PA6A 4LF5O 2YIDA 1AILA 3OUSA 5B1OA 2GDSA 2LW7A 1JFFB 2JGDB 5LBQA 5GTHZ 4ZHQA 3RYIB 2QJ1A 2OT5A 2W6IG 1SESA 4MVQA 1GM8A 1VQ6V 3TGUH 2EJ7A 5KAFZ 3J80N 1D5AA 2ZR2A 4YIOA 4CS4A 2CAZC 5DM6V 3OT7A 4NB5A 3JASB 1FXKA 4J11A 4LF8B 3B40A 3OD4A 3TJTA 3LDDA 4IIJA 2AZ0A 4GLXA 4BW9A 4TQFA 1NZ6A 1YXBA 3ETQA 4U7NA 5FL7G 2DE0X 5CA0A 2QWNB 4YJ2B 4FJCC 3G4SV 4QJFB 1R3IC 3OTFA 3WU2Z 1HP8A 2IM9A 1HNZO 4LWSA 4JI6O 4NR1A 4QE9A 5GONB 2YDEA 4LF5B 2HVJC 3CRQA 1AR1B 3CYOA 2ZNJA 2WLHA 4PELA 3BCCH 1RFYA 2ATKC 2DQ0A 3CCRV 2F43G 3UO3A 3W7WA 4DR3O 1EN6A 2CTPA 3AK1A 3AG3B 3CRAA 4DUYO 3CCMV 2N04A 3EFFK 3G67A 2BOCC 1YITV 5BMVB 3FAVA 3TXSA 3M99B 1XMQB 3ZRVA 4U3JB 3K04A 1AP6A 1GK9A 3A0HZ 4LFBB 4PV1B 1F4NA 5EIBD 2YS8A 4P9PA 2HG5C 1GN4A 1OCRC 2XTAA 3VOUA 1QNMA 4X66B 4FK5C 1LNQA 4PJ0Z 3HR0A 4DRXA 2LO1A 5CA0B 1QVFU 4DR6O 4X89A 4NTXA 4FVMA 2CUGA 1JA8A 4LWSB 1SRYA 5LXTB 5L3GA 2N74A 1WLEA 4D7SA 4JTCB 4CC5A 4TV9B 4IYIA 2UUBO 1VQPV 1QLEB 5JVDB 4UCSA 4DV7O 1AI7A 3E8BA 3T1YB 4DUYB 2XT9A 4FM2A 5LOVA 2M6YA 3NR7A 2E3CA 4G28B 1XHZA 1NR1A 1WNSA 2IJJA 3Q4HA 1KD1W 4L87A 4U7OA 1XMOO 4TV8A 3KG2A 2EILC 4ZBMA 4K0KO 3RVYA 1YVWA 1CXZB 4I55A 5B1NA 3ZRWB 2A0LA 2RMKB 2Q7EA 5C93A 1WPBA 4DR6B 1PNMA 1L0LH 2LFSA 4JAAA 4TOIA 1AR5A 3DGEA 3AG2C 4LH6A 5BR8B 1N0NA 1JX9A 3OM3B 1V55B 3FB8C 1ZAUA 2UUBB 2LGQA 1S72V 2QE7G 5DEDA 5KA5A 2Q5ZA 2YSUB 1NT2B 4MW3A 2PY5A 2Y48A 4ICGA 4MTFA 4O2BA 5LL6Y 1RPOA 3MHSC 2A9HA 2BTOA 1P84F 2DMXA 3K5OA 4WBNB 2NN4A 5CB4B 4QIWF 4YXWG 2EBOA 3KZIZ 3DXRA 4BAYA 2JIZG 2AZ2A 4DV1B 1FYJA 1PNKA 4GZRB 4LF4B 2F93B 2GUZA 3ZMTA 1NJIW 4JI3B 1FKAO 4MVOA 2YC0A 1XEQA 4YHHB 3SGIA 3BHPA 3QF7A 1NH2B 2EULA 3IC9A 4I55B 5B5EZ 4W4LA 1FPOA 2Z3YA 3U11A 4R6ZA 2WLLA 3ZHQA 3LNMB 1BS3A 4JI0B 4J80A 2HVKC 2KKWA 3S3XA 5IYZB 1KBHA 1H2KA 4UFZA 1AJNA 1OCOC 2ZINA 1I5YA 3GB7C 2PF4E 3HKCA 4DUZO 4WFGA 1KUQA 5IWAO 3ABLC 4LF9B 1MSDA 1NVPD 2DYSC 1N0JA 3UKMA 1S5LZ 1N36B 3H1HH 4UCVA 1VQLV 1EBOA 2Y69C 3MD0A 1XHXA 1L8DA 4F6EA 3CHXA 3IJ4A 1YSCA 5B1BC 3OTOB 2F23A 1Q3EA 1K73W 3JATA 3OFNG 1US6A 1Y74A 4F4LA 3P3PA 3JD2A 1I08A 2OWOA 5H9CA 1H2NA 4JZ2A 2WLLB 3I56V 4UVBA 3CWBH 4X62B 4LFAO 3RWRD 3AG7A 3APQA 1GTOA 1NR7A 4ZIBA 1UJWB 5KUMA 1XNRO 2WSSG 2QM7A 3QG5A 3B2EE 4DUZB 4J9ZB 4CH5A 5IYCO 5LMNO 4PDLA 1Y6XA 5IWAB 2IW5A 4LF7O 1UPGA 2Q7GA 2UXCO 1DF4A 5JQGB 1K4DC 5KMGA 3EXAA 5IE9A 2WPDG 4X9QA 4ZI7B 5FNVA 3KKYA 1Q6HA 2JJ1G 1FJGO 4JYYA 2ZT9B 3HPLC 4UXNA 1Q90D 4AQYO 3JATB 1Y74B 2B9ZA 2LP7A 2LW1A 1VQMV 3ASOB 3ICXA 1ZSPA 4O4IB 1W0JG 2WA3A 1N32B 4OPHA 4X88A 4H33A 2XOKG 2IH3C 2QM8A 4QGPA 1R3LC 1M57B 1SZXA 3CS5A 4O4LB 3IFXA 5FPRA 3CJHA 4MS2A 5EBLC 1R6NA 3JCZA 4GYCB 3VQYA 1JVMA 4DK0A 1F51A 4K35A 5A2QN 1GN3A 4L8JA 1M5IA 2JRIA 4X1YA 3CCSV 2ZXWC 4NXNO 3K5NA 3E8GA 2XAFA 5LGTA 1PPJH 4KP4A 4N23A 3B8MA 3UM7A 2F4VO 5JH7A 3RGBA 4H37A 3ABMC 2B1GA 2PUSA 1V54C 3UQ8A 2VQFO 1OCCC 1ZL8A 1Y66A 1N4CA 1RSOA 3MDSA 3RYFA 2WLIA 4AQYB 1VQ8V 1M90W 4EEQA 3H1LH 5IY5B 2Y4UA 1S77D 4UCRA 1YTFD 1IBMO 4FLVA 2EINC 3CE2A 3K06A 3D36C 1AP5A 4PA3A 4TQDA 4PI0A 5CBFA 3ZHRA 2UXBO 4DO2A 4I9QA 1TUEB 1JOYA 5H6QA 2QSAA 3H01A 2OTLV 4D7TA 4O4HA 4HAMA 2LQTA 4X64B 2X6AA 2IU0A 4MVUA 1HR0O 1K9MW 2BTQB 4XDJA 4UVCA 4FMTA 5LGUA 2Y4TA 2GTSA 1N33O 2P5OA 1WB8A 1LUWA 5B66Z 4OGQB 3K0DA 1L1FA 4MVMA 3T1HB 4JTDB 1WP8A 4UV9A 1ZL8B 4ZKIA 2CTRA 2QM4A 4J10A 4RUEA 3SYQA 1SQGA 2DW4A 1I7FA 1H2GA 3FFQA 2WLMA 1E1QG 4O2AA 5LHGA 1JQ0A 1YEWA 1JR9A 2EIJB 3CCJV 1BSMA 1WA8A 1XILA 1J95A 4JI5B 1VF6A 4WFBV 2PYLA 1Q6IA 4YJ3A 2ZDIA 1DTOA 4LF8O 5BY1A 1S3JA 1JCHA 1VP7A 4JI4O 3HKEA 4QPKA 4X65B 4KFMA 1RM1C 1RPRA 3SPIA 1XNQB 3D3IA 1KC8W 2P90A 5E1AC 1AI6A 1N33B 3ZEDA 4DR5O 4DYLA 3FB5C 4J41A 2ZIMA 5L3EA 2Q6AA 3G6BA 1YJ9V 4B3MO 4MTOA 1PP9H 1SF9A 4Z1VA 4BIUA 5AG2A 1ORQC 3CRRA 2A7WA 3DTUB 1B06A 3OMNB 2IJHA 1M9NA 1F4MA 4O2AB 2OCCB 4J9YB 3T1CA 2VQEO 1P7BA 4X1KA 1DGSA 1FAFA 5C8YA 1HW7A 1VQ5V 3DSQA 3ZMZA 5CBHA 1WA8B 2HJDA 4MW8A 1KQSU 2Y0IA 1IXMA 3N2KA 4PDVA 1XMQO 4A5UB 3AG3C 5EBWC 1Z2GA 2RCVA 5LYJB 1NKDA 1FFXB 2JEXA 4LFBO 2X6BA 2Q67A 2ZR3A 4NXMB 4FPPA 1K8AW 4JI4B 2YIBA 3HKEB 2Q69A 3UT5B 3BAAA 5L3FA 1E1RG 5CA1B 2ADPA 2YI9A 4X66O 1YTFB 1VQ7V 4P9OA 3RYCB 2FMLA 4W4KA 3F7VC 3ZHTA 3QO7A 4HNAB 4FIPC 2GHYA 5EYPA 1CP9A 1BZKA 4DR7B 1QR8A 2DQ3A 5IJ0A 4DR5B 1CEZA 2EIMB 4B3MB 3CXCU 1WPXA 3SPJA 1PD3A 3CC2V 3L75H 4NTYA 4ZHQB 3T1YO 2R70A 1NH2D 1XOUA 3HKDA 2VQEB 5HFMA 3KCYA 4X1KB 1QLEC 5C8YB 4DR4B 2NLJC 2FYUH 3JAKA 2R9RB 3CX5F 4KL1A 4D6TH 4JYAB 1EM1A 2WLNA 4F6RA 1FXKB 3IGAC 4FZ0A 1IX9A 2L35A 4IIJB 4GUNA 4UV8A 3OR7C 1SERA 4UB6Z 2QR4A 5JJJB 2V4DA 3QVNA 3F5TA 4DR1B 3W7UA 4CS3A 5B3SC 3D3QA 5IDJA 3FKSG 2YEVA 2LFRA 2P4KA 4G2KA 5IJ0B 1IBLO 5GW7A 1VQ4V 4CH3A 5BR8O 5L3BA 2BSKA 3MHHC 5B1AB 4G27B 4B3RB 5LP6C 4NVPA 4HZ3A 3CRCA 1TVKA 3ZRXA 1VQNV 1Q6UA 3APOA 2OIEA 4I4TA 1MZEA 4CH6A 3B8NA 3QO5A 3JSNA 3AG4C 1MABG 4K8XA 4MTGA 1H2MA 3U0ZA 4DV1O 2W0XA 4OPAA 3IAYA 3FAVB 3TK1A 4KXRA 3OGIB 4JAUA 4LF4O 2UXXA 2FB5A 4JI3O 4Z1MG 2JEUA 1GRJA 2W6JG 2JS3A 4B7EA 3N2GA 4YHHO 4DW0A 4O4JA 1Y76A 1VQOV 1BT8A 3P32A 4DRXB 3DC6A 1OCRB 3B4SA 2HEPA 4IT5A 5HFLA 2Q8VA 1BGYH 1V9PA 3OEEG 2YEVB 1GM7A 4UB8Z 2JVDA 1E79G 4JI0O 3IC7A 5H2FZ 1IBLB 4R8CA 4YIPA 4LH7A 3SYCA 2P4VA 3BA9A 2HHHB 3L72H 1K5SA 1MOFA 2UXDB 1TVKB 1H8HG 1AJQA 1AVMA 3CMEV 3A8TA 1J5EO 1ROPA 3EHBB 4I4TB 2F95B 1XUQA 1WB7A 5EIBC 1QR9A 3K08A 5DECA 5CA3A 3BY6A 5LOVB 4LF9O 5JCOC 3R66A 3ABTA 1K34A 4N21A 2IBZH 3Q4HB 1N36O 4DV4B 2YXHA 2P67A 2Q0OC 4GKKB 5EK0A 4PA7A 3BFRA 4TV8B 3WB0A 1DLBA 4I50A 3SYAA 1B04A 3N2GB 3C3TA 1O9GA 1R3JC 1QQCA 4J7JA 2XNDG 4GCZA 3OTOO 4JASA 4BR6A 4JYBA 4X8AA 1MG1A 3VQVA 1OZ0A 5ITZA 1AJPA 1PKXA 3OAAG 2ZQMA 3RVZA 4JV5B 2ZD9A 1NS1A 3H9VA 3L73H 4X62O 1WJZA 3SPHA 4JI7B 1A32A 2HLDG 2LGWA 3E8FA 4H44B 4FLXA 4LF6B 1Q7YW 1WAZA 1OJHA 3S3WA 1J5EB 1O9HA 2H94A 1QHTA 1M56C 4O2BB 4DR2O 5KHKA 1G8MA 3OMAB 1G6UA 3JD4A 3M7MX
chains in the Genus database with same CATH topology
2G38A 4J41A 4J7JA 4W4LA 2GTSA 4J10A 4J11A 4J42A 4IYIA 4J7KA 3FX7A 4IYHA 4KXRA 4W4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G38 A;  4J41 A;  4J7J A;  4W4L A;  2GTS A;  4J10 A;  4J11 A;  4J42 A;  4IYI A;  4J7K A;  3FX7 A;  4IYH A;  4KXR A;  4W4K A; 
#chains in the Genus database with same CATH topology
 3DXR B;  1JMK C;  4K3A A;  3UO2 A;  1IZ3 A;  3ZRS A;  4JZG A;  3QO8 A;  1SA0 A;  1SC5 B;  5D5P A;  3FB6 C;  2GUZ B;  4EKW A;  3SYO A;  4ZOL A;  3SJB C;  1Q8I A;  1BMF G;  1ZUQ A;  5EBM C;  2X6C A;  4FFB A;  4AI8 A;  4OXS A;  2KSD A;  1K7D A;  2P6J A;  3JAL A;  1VF7 A;  1SQP H;  2CDY A;  1IXB A;  4FZ1 A;  3NXS A;  1N32 O;  4IGG A;  4I7Z B;  1ZLZ A;  2H3O A;  4RWU A;  1NTZ H;  3HKB A;  3RYH A;  4U3F H;  5CN0 A;  1OCO B;  3LSS A;  2VWK A;  2V1D A;  1MZF A;  3CXH F;  3PN1 A;  4X20 A;  1HDJ A;  4BIO A;  4DR2 B;  3G71 V;  1JJ2 U;  3HKC B;  5EZY A;  1R73 A;  4DW1 A;  1T5E A;  1M57 C;  3AG1 B;  4MVZ A;  3ABK B;  3ZMS A;  1NTK H;  1AB3 A;  1B3Q A;  2IU3 A;  1FS0 G;  1MSW D;  1R6T A;  2YUA A;  1D5N A;  3HB3 B;  2DYS B;  4FLU A;  1SA0 B;  2M7W A;  1YJW V;  1EZV H;  4DK1 A;  4DV2 O;  4CS2 A;  1GKF A;  1Y67 A;  5EC2 C;  1SQV H;  3BPZ A;  3G6E V;  1UFI A;  4FFB B;  1KMI Z;  5L3D A;  1CPY A;  2F1M A;  3JCU Z;  3JAR A;  1XBL A;  2EIK B;  2E74 B;  3ZN1 A;  2OTJ V;  3LUT B;  4H13 B;  5F2V O;  5KHI A;  4K8Z A;  2PGG A;  5IY5 C;  3HKB B;  1KB9 F;  1Q5O A;  3RYH B;  1R1B A;  2AHY A;  3AK3 A;  1I5X A;  4Q20 A;  5TIS Z;  1VMG A;  4IHJ A;  4IL6 Z;  4X20 B;  3LSU A;  3CSX A;  4PDR A;  5BZB A;  3I5D A;  2E5L B;  4AIL C;  3JD0 A;  4X64 O;  1QBZ A;  2WWW A;  2DJV A;  1QLN A;  2X0L A;  3KCX A;  3RT3 C;  2JJ2 G;  5KMG B;  3GVM A;  3STZ C;  3CPW U;  4R7C A;  4FLZ A;  4OX9 B;  2P7T C;  1JJO A;  5FNV B;  4DV2 B;  1YCI A;  4I5S A;  5KHJ A;  2DYR C;  1DF5 A;  3T1H O;  4QNH B;  5J2T A;  2F66 C;  2ILM A;  5KX5 A;  3BEH A;  3ETE A;  5BXZ A;  1OCZ B;  3JAR B;  3DC5 A;  2N05 A;  4TUY A;  2MW2 B;  2Z5U A;  2IJI A;  4JF3 A;  3B77 A;  1XL4 A;  4E2L A;  4TT3 G;  5IJ9 A;  4JI5 O;  1NBM G;  3K03 A;  3D36 A;  4DXW A;  3CJH B;  2UUA O;  5LA6 A;  3FB7 C;  4JAV A;  1LUV A;  3W7S A;  3E89 A;  3CCV V;  4X65 O;  4DV0 O;  4B3T B;  1EN4 A;  4RO2 A;  4X1Y B;  3RN4 A;  2ARH A;  2PYJ A;  4GKJ O;  1U96 A;  4WCE V;  2JGU A;  1XNQ O;  1Q81 W;  3ML0 A;  4QE7 A;  2ZXW B;  4NYK A;  4FFK A;  2EJR A;  5JH7 B;  1IUR A;  3ASN B;  2QWO B;  3WG7 C;  1H38 A;  1WN7 A;  3CB2 A;  5J2T B;  2Q7H A;  1RSO B;  3N27 A;  3VQX A;  3W7T A;  2VS0 A;  3RYF B;  2WLI B;  1G4Y B;  1K4C C;  3JAW A;  2YIB D;  1MMM A;  4JGS A;  4LNU A;  2YXL A;  1PL0 A;  2VWJ A;  2CTQ A;  1FXH A;  1YF2 A;  4MVS A;  3A0B Z;  4JI1 B;  3THO A;  5IJ9 B;  4MSW C;  2L6L A;  1TAE A;  2ITD C;  4JI2 B;  1SKV A;  1JFF A;  2JGD A;  2R9A A;  4LC1 A;  3ZN0 A;  2UUA B;  5J9P C;  3RYI A;  4NXM O;  1PL4 A;  2CGN A;  4B08 A;  4DV6 B;  4DV0 B;  1YDX A;  3ZIA G;  4O4H B;  1PM9 A;  1IVS A;  1GN2 A;  3K0G A;  5H6R A;  1H2L A;  2XAG A;  1KU9 A;  4GKJ B;  1GO3 F;  2QWP B;  3F7Y C;  4LBE C;  3JAS A;  2QA4 V;  3X2Q B;  2XAS A;  4DR7 O;  2ZE6 A;  2ZE5 A;  3TCU A;  1ARO P;  4JI8 B;  1BQZ A;  4RAI A;  2ZNI A;  3LDC A;  3E22 A;  2UXN A;  3T2M A;  1BE3 H;  1ZX3 A;  5J2U A;  3CD6 V;  2HP8 A;  2YI8 A;  2RDC A;  4LNU B;  4PA9 A;  3ZCC A;  3SPC A;  1EN5 A;  4MVR A;  5H5N A;  4DR4 O;  3JD1 A;  2AW9 A;  2ZE8 A;  4DV3 B;  4R50 A;  1P4R A;  1N34 O;  4JYA O;  4FM1 A;  4YY3 B;  3RFR A;  3O9O A;  4YJ3 B;  2GSM B;  4AHC A;  2PZS A;  4JPR A;  1HNX B;  1S5H C;  1VIB A;  2CK3 G;  4I0X A;  4XBF A;  2DWE C;  2HFE C;  4DR1 O;  5BMV A;  1URF A;  3MAQ A;  3H1J H;  2NR5 A;  1FXK C;  4QPJ A;  4U3J A;  2Q73 A;  4UVA A;  1RM1 B;  4Z2W A;  3C3S A;  2HJF C;  2KB1 A;  3E35 A;  1SQF A;  2XAQ A;  1QVG U;  4PD4 F;  1H2S B;  2QTS A;  2QKA A;  3L70 H;  3FYE B;  4B3R O;  2ZIO A;  3E22 B;  5J2U B;  1I94 O;  1BHB A;  3K59 A;  4PHZ A;  3BA8 A;  1SET A;  2Q0A A;  5B1A C;  5LXT A;  3E2E A;  1SS3 A;  2GBO A;  3CRM A;  1L0N H;  4WFH A;  4TV9 A;  5D5Q A;  2QTO A;  4GX0 A;  3N2K B;  4WF9 V;  1N34 B;  5JVD A;  3K58 A;  1GMG A;  5LHH A;  3I55 V;  4I0X B;  2P22 C;  3J81 N;  3ZX6 A;  4ASU G;  2ADQ B;  1FD9 A;  1YIJ V;  1FXV A;  2XHB A;  5CBG A;  2ZE7 A;  3W7X A;  2Q9L A;  1K3E A;  1THZ A;  4B7K A;  1XI1 A;  1NQT A;  1Y4M A;  5EYP B;  1K5Q A;  1TA8 A;  1YHQ V;  3T4D A;  4PDM A;  1OHH G;  2HHH O;  2UUC O;  3ZRW A;  4HYO A;  2D3O W;  1I94 B;  2UXD O;  5LP6 A;  2H8P C;  2JDI G;  1HWY A;  1HNZ B;  5DN6 G;  3E8H A;  4JI6 B;  3HKD B;  1XDC A;  1HNW O;  1V55 C;  1SQB H;  4UCT A;  3TXQ A;  1OV9 A;  4UCO A;  3JAK B;  1U97 A;  3BVO A;  2Q68 A;  3OE7 G;  4PA4 A;  4DV4 O;  4DR3 B;  4WFF A;  4GKK O;  4F6R B;  2AXT Z;  3K9A A;  1KP3 A;  4WBN A;  5CB4 A;  3G80 A;  2CH7 A;  2LJ2 A;  3JD3 A;  1YI2 V;  2OIG A;  3OR6 C;  3ZHU A;  4GX1 A;  1AI5 A;  3L74 H;  2ZM6 O;  2G38 A;  4RQE A;  3CP1 A;  4ABM A;  2X7R B;  1Q43 A;  1VQ9 V;  3R65 A;  1M93 A;  2D2C B;  3BRC A;  1AR4 A;  2E76 B;  5B3S B;  4JV5 O;  3EVK A;  2RN9 A;  4TWK A;  3CMA V;  3ZHV A;  2QGN A;  1ZWI C;  1I0H A;  2CGO A;  4JI7 O;  2BE3 A;  3CCE V;  2BSK B;  4WFA V;  1NI8 A;  4E4E A;  2UUC B;  4DV5 O;  2DWD C;  3ZHS A;  4FLT A;  4LF6 O;  4NKG B;  2CTW A;  5LP6 B;  1PV0 A;  4J7Z A;  4CBC A;  4LCU C;  5IYZ A;  1HNW B;  3U10 A;  4PI2 A;  3RW0 A;  2PI5 A;  1NTM H;  5IYD O;  3AG4 B;  2Q4P A;  3FD9 A;  5JCO A;  4UCU A;  3WB2 A;  3CEI A;  4DV7 B;  5FPO A;  1M1K W;  3E86 A;  2CH7 B;  1Z5W A;  2ZM6 B;  1S5J A;  1QU7 A;  2A3Q A;  2EIL B;  1SQX H;  4O4J B;  5KLV H;  1Y76 B;  2P06 A;  2KG7 A;  2WLK A;  3JSL A;  2E75 B;  1KKD A;  1XMO B;  3SJQ C;  3FX7 A;  5JJN B;  4K0K B;  2B5U A;  3WB1 A;  4DV5 B;  1K97 A;  2QKS A;  2WA4 A;  1XRE A;  2QKC A;  3AG2 B;  2A79 B;  3LNN A;  1JPX A;  4FM0 A;  4LP8 A;  3ZS8 C;  1VEW A;  1SZT A;  3BAB A;  2RQ6 A;  3CC7 V;  1BQ0 A;  4TSF G;  5E79 Z;  3GWK C;  2DN9 A;  4WFE A;  3CC4 V;  4CC6 A;  4LFC O;  2FTK A;  3SPG A;  3AG1 C;  3ABK C;  1S76 D;  3K3W A;  4I50 B;  3LDE A;  1R6K A;  1PNL A;  3SJC C;  5KAI Z;  2QWQ B;  3VBB A;  2KG7 B;  5JQG A;  4BWA A;  2O57 A;  1S0V A;  1TGO A;  5ITZ B;  2YIA A;  4BW5 A;  2QDO A;  3OUF A;  4ZI7 A;  3AK2 A;  1EZJ A;  1ZTE A;  2C2A A;  5JWP A;  3ETD A;  2ETN A;  2HKO A;  1R3K C;  2IJK A;  1COW G;  2R9I A;  4XDK A;  2EIK C;  3ASO C;  4JTA B;  3OW2 U;  3L9D A;  4MT8 A;  4LR3 A;  3O65 A;  2E5L O;  4O4I A;  5A9G A;  1VF5 B;  4EFB A;  3CCU V;  1M56 B;  2JK5 C;  4UUJ C;  3ZMV A;  2QEX V;  4J42 A;  4O4L A;  2Y0P A;  2QWR B;  1X4T A;  3ABL B;  1QCE A;  2EZO A;  4LFC B;  3K5L A;  4OX9 O;  1TUB A;  2GV9 A;  5EC1 C;  4B3S O;  1XQ8 A;  3UCS C;  2YXY A;  4ZOL B;  4EFE A;  3GWO A;  5JJE B;  5CMU A;  2XAH A;  2K1E A;  5KUK A;  5LMU O;  2XUM A;  2Y69 B;  3K57 A;  2YIC A;  1LR1 A;  3H1I H;  2WAM A;  5B1B B;  4GX2 A;  5L3C A;  3JAL B;  2ZCE A;  3QTC A;  1X59 A;  3T4Z A;  1VQK V;  1YZB A;  2VRZ A;  1GM9 A;  1XL6 A;  1OCZ C;  1M4U A;  2NNU A;  1AI4 A;  1RP3 B;  4I9W A;  2OCH A;  3FYI B;  3A0R A;  1FFT B;  4B3T O;  5EZY B;  3P30 A;  2K9P A;  2BCC H;  1D2D A;  1P7G A;  4LFA B;  4IYH A;  2FL4 A;  3OGC C;  3OEH G;  3RBZ A;  5K1X A;  1W0K G;  1NU1 H;  2EZP A;  2RJZ A;  4B3S B;  1W59 A;  1TUB B;  3ZJZ A;  1N8R W;  1XNR B;  1K92 A;  1IBK O;  3JYC A;  3ZMU A;  5LMN B;  2UU9 O;  5LMU B;  2OYQ A;  1P49 A;  2EX3 A;  2BTQ A;  3A2F A;  4LF7 B;  4EB6 A;  2UXC B;  5GTI Z;  1F7Y A;  3ASN C;  4Q6G A;  3C90 A;  4C7U A;  1WP7 A;  1Q82 W;  2Z0A A;  3M8A A;  4X1I A;  2PTM A;  1FJG B;  3SR2 C;  1F23 A;  3SYP A;  4JI1 O;  2AHZ A;  2W0F C;  2FKX A;  2AGA A;  4JI2 O;  3ETG A;  2JS5 A;  3H1K H;  1NVP B;  4P30 A;  4IHJ B;  2EIJ C;  4H0L B;  4HBN A;  2HR3 A;  4DV6 O;  2IH1 C;  4JYC A;  2ITC C;  1BHA A;  3ABU A;  4P2Z A;  1GH6 A;  3PJS K;  2WLJ A;  2V7Q G;  3K5M A;  2GTA A;  3ZBH A;  3CCL V;  1IBK B;  4JI8 O;  2UU9 B;  2CE4 A;  2R72 A;  3ABM B;  3QNE A;  4NXN B;  3SDL A;  3STL C;  4KUM A;  3P3N A;  3X2Q C;  5KA6 A;  1V54 B;  1B6Q A;  5KX5 B;  1SQQ H;  2DYR B;  1OCC B;  4EB6 B;  3LSQ A;  5LGN A;  1BL8 A;  5FLX N;  2F4V B;  2BOB C;  2A06 H;  1IDS A;  1G1X B;  4GT1 A;  4TUY B;  5IT9 N;  3TET A;  4X1I B;  4KHP O;  4FLW A;  3D8C A;  2VQF B;  2PI4 A;  1MNG A;  1KP2 A;  2DOS A;  3B09 A;  4DV3 O;  1GN6 A;  1BCC H;  1KEC A;  2EIN B;  1KYO F;  4YY3 O;  3J7A U;  2OCC C;  3E83 A;  3SJA C;  4NTW A;  1HNX O;  5LA6 B;  3WFV A;  3F5W C;  1KKC A;  1MA1 A;  1IBM B;  4BIZ A;  1VF6 C;  4FLY A;  2B1I A;  4CZZ A;  3VQW A;  2MK3 A;  1EFR G;  3L71 H;  4CH4 A;  2ZDI C;  4J7K A;  5LHI A;  2UXB B;  5LYJ A;  1VAR A;  3K9S A;  1FFX A;  2RNB A;  2KQX A;  1K33 A;  5K1P A;  1GAX A;  5KHH A;  3UT5 A;  4GX5 A;  3OMI B;  1YJN V;  5CA1 A;  3JAM N;  4MTX A;  3WG7 B;  5IYB O;  4RQF A;  1Z5V A;  3RYC A;  4YJ2 A;  1HR0 B;  1H8E G;  5KHG A;  1ENV A;  1W2B U;  3AEI A;  4HNA A;  3JAW B;  2EIM C;  4XDL A;  1Q86 W;  4RUF A;  2XAJ A;  3CCQ V;  2ZKO A;  5GON A;  1DK1 A;  2ODM A;  4KHP B;  3K79 A;  4PA6 A;  4LF5 O;  2YID A;  1AIL A;  3OUS A;  5B1O A;  2GDS A;  2LW7 A;  1JFF B;  2JGD B;  5LBQ A;  5GTH Z;  4ZHQ A;  3RYI B;  2QJ1 A;  2OT5 A;  2W6I G;  1SES A;  4MVQ A;  1GM8 A;  1VQ6 V;  3TGU H;  2EJ7 A;  5KAF Z;  3J80 N;  1D5A A;  2ZR2 A;  4YIO A;  4CS4 A;  2CAZ C;  5DM6 V;  3OT7 A;  4NB5 A;  3JAS B;  1FXK A;  4J11 A;  4LF8 B;  3B40 A;  3OD4 A;  3TJT A;  3LDD A;  4IIJ A;  2AZ0 A;  4GLX A;  4BW9 A;  4TQF A;  1NZ6 A;  1YXB A;  3ETQ A;  4U7N A;  5FL7 G;  2DE0 X;  5CA0 A;  2QWN B;  4YJ2 B;  4FJC C;  3G4S V;  4QJF B;  1R3I C;  3OTF A;  3WU2 Z;  1HP8 A;  2IM9 A;  1HNZ O;  4LWS A;  4JI6 O;  4NR1 A;  4QE9 A;  5GON B;  2YDE A;  4LF5 B;  2HVJ C;  3CRQ A;  1AR1 B;  3CYO A;  2ZNJ A;  2WLH A;  4PEL A;  3BCC H;  1RFY A;  2ATK C;  2DQ0 A;  3CCR V;  2F43 G;  3UO3 A;  3W7W A;  4DR3 O;  1EN6 A;  2CTP A;  3AK1 A;  3AG3 B;  3CRA A;  4DUY O;  3CCM V;  2N04 A;  3EFF K;  3G67 A;  2BOC C;  1YIT V;  5BMV B;  3FAV A;  3TXS A;  3M99 B;  1XMQ B;  3ZRV A;  4U3J B;  3K04 A;  1AP6 A;  1GK9 A;  3A0H Z;  4LFB B;  4PV1 B;  1F4N A;  5EIB D;  2YS8 A;  4P9P A;  2HG5 C;  1GN4 A;  1OCR C;  2XTA A;  3VOU A;  1QNM A;  4X66 B;  4FK5 C;  1LNQ A;  4PJ0 Z;  3HR0 A;  4DRX A;  2LO1 A;  5CA0 B;  1QVF U;  4DR6 O;  4X89 A;  4NTX A;  4FVM A;  2CUG A;  1JA8 A;  4LWS B;  1SRY A;  5LXT B;  5L3G A;  2N74 A;  1WLE A;  4D7S A;  4JTC B;  4CC5 A;  4TV9 B;  4IYI A;  2UUB O;  1VQP V;  1QLE B;  5JVD B;  4UCS A;  4DV7 O;  1AI7 A;  3E8B A;  3T1Y B;  4DUY B;  2XT9 A;  4FM2 A;  5LOV A;  2M6Y A;  3NR7 A;  2E3C A;  4G28 B;  1XHZ A;  1NR1 A;  1WNS A;  2IJJ A;  3Q4H A;  1KD1 W;  4L87 A;  4U7O A;  1XMO O;  4TV8 A;  3KG2 A;  2EIL C;  4ZBM A;  4K0K O;  3RVY A;  1YVW A;  1CXZ B;  4I55 A;  5B1N A;  3ZRW B;  2A0L A;  2RMK B;  2Q7E A;  5C93 A;  1WPB A;  4DR6 B;  1PNM A;  1L0L H;  2LFS A;  4JAA A;  4TOI A;  1AR5 A;  3DGE A;  3AG2 C;  4LH6 A;  5BR8 B;  1N0N A;  1JX9 A;  3OM3 B;  1V55 B;  3FB8 C;  1ZAU A;  2UUB B;  2LGQ A;  1S72 V;  2QE7 G;  5DED A;  5KA5 A;  2Q5Z A;  2YSU B;  1NT2 B;  4MW3 A;  2PY5 A;  2Y48 A;  4ICG A;  4MTF A;  4O2B A;  5LL6 Y;  1RPO A;  3MHS C;  2A9H A;  2BTO A;  1P84 F;  2DMX A;  3K5O A;  4WBN B;  2NN4 A;  5CB4 B;  4QIW F;  4YXW G;  2EBO A;  3KZI Z;  3DXR A;  4BAY A;  2JIZ G;  2AZ2 A;  4DV1 B;  1FYJ A;  1PNK A;  4GZR B;  4LF4 B;  2F93 B;  2GUZ A;  3ZMT A;  1NJI W;  4JI3 B;  1FKA O;  4MVO A;  2YC0 A;  1XEQ A;  4YHH B;  3SGI A;  3BHP A;  3QF7 A;  1NH2 B;  2EUL A;  3IC9 A;  4I55 B;  5B5E Z;  4W4L A;  1FPO A;  2Z3Y A;  3U11 A;  4R6Z A;  2WLL A;  3ZHQ A;  3LNM B;  1BS3 A;  4JI0 B;  4J80 A;  2HVK C;  2KKW A;  3S3X A;  5IYZ B;  1KBH A;  1H2K A;  4UFZ A;  1AJN A;  1OCO C;  2ZIN A;  1I5Y A;  3GB7 C;  2PF4 E;  3HKC A;  4DUZ O;  4WFG A;  1KUQ A;  5IWA O;  3ABL C;  4LF9 B;  1MSD A;  1NVP D;  2DYS C;  1N0J A;  3UKM A;  1S5L Z;  1N36 B;  3H1H H;  4UCV A;  1VQL V;  1EBO A;  2Y69 C;  3MD0 A;  1XHX A;  1L8D A;  4F6E A;  3CHX A;  3IJ4 A;  1YSC A;  5B1B C;  3OTO B;  2F23 A;  1Q3E A;  1K73 W;  3JAT A;  3OFN G;  1US6 A;  1Y74 A;  4F4L A;  3P3P A;  3JD2 A;  1I08 A;  2OWO A;  5H9C A;  1H2N A;  4JZ2 A;  2WLL B;  3I56 V;  4UVB A;  3CWB H;  4X62 B;  4LFA O;  3RWR D;  3AG7 A;  3APQ A;  1GTO A;  1NR7 A;  4ZIB A;  1UJW B;  5KUM A;  1XNR O;  2WSS G;  2QM7 A;  3QG5 A;  3B2E E;  4DUZ B;  4J9Z B;  4CH5 A;  5IYC O;  5LMN O;  4PDL A;  1Y6X A;  5IWA B;  2IW5 A;  4LF7 O;  1UPG A;  2Q7G A;  2UXC O;  1DF4 A;  5JQG B;  1K4D C;  5KMG A;  3EXA A;  5IE9 A;  2WPD G;  4X9Q A;  4ZI7 B;  5FNV A;  3KKY A;  1Q6H A;  2JJ1 G;  1FJG O;  4JYY A;  2ZT9 B;  3HPL C;  4UXN A;  1Q90 D;  4AQY O;  3JAT B;  1Y74 B;  2B9Z A;  2LP7 A;  2LW1 A;  1VQM V;  3ASO B;  3ICX A;  1ZSP A;  4O4I B;  1W0J G;  2WA3 A;  1N32 B;  4OPH A;  4X88 A;  4H33 A;  2XOK G;  2IH3 C;  2QM8 A;  4QGP A;  1R3L C;  1M57 B;  1SZX A;  3CS5 A;  4O4L B;  3IFX A;  5FPR A;  3CJH A;  4MS2 A;  5EBL C;  1R6N A;  3JCZ A;  4GYC B;  3VQY A;  1JVM A;  4DK0 A;  1F51 A;  4K35 A;  5A2Q N;  1GN3 A;  4L8J A;  1M5I A;  2JRI A;  4X1Y A;  3CCS V;  2ZXW C;  4NXN O;  3K5N A;  3E8G A;  2XAF A;  5LGT A;  1PPJ H;  4KP4 A;  4N23 A;  3B8M A;  3UM7 A;  2F4V O;  5JH7 A;  3RGB A;  4H37 A;  3ABM C;  2B1G A;  2PUS A;  1V54 C;  3UQ8 A;  2VQF O;  1OCC C;  1ZL8 A;  1Y66 A;  1N4C A;  1RSO A;  3MDS A;  3RYF A;  2WLI A;  4AQY B;  1VQ8 V;  1M90 W;  4EEQ A;  3H1L H;  5IY5 B;  2Y4U A;  1S77 D;  4UCR A;  1YTF D;  1IBM O;  4FLV A;  2EIN C;  3CE2 A;  3K06 A;  3D36 C;  1AP5 A;  4PA3 A;  4TQD A;  4PI0 A;  5CBF A;  3ZHR A;  2UXB O;  4DO2 A;  4I9Q A;  1TUE B;  1JOY A;  5H6Q A;  2QSA A;  3H01 A;  2OTL V;  4D7T A;  4O4H A;  4HAM A;  2LQT A;  4X64 B;  2X6A A;  2IU0 A;  4MVU A;  1HR0 O;  1K9M W;  2BTQ B;  4XDJ A;  4UVC A;  4FMT A;  5LGU A;  2Y4T A;  2GTS A;  1N33 O;  2P5O A;  1WB8 A;  1LUW A;  5B66 Z;  4OGQ B;  3K0D A;  1L1F A;  4MVM A;  3T1H B;  4JTD B;  1WP8 A;  4UV9 A;  1ZL8 B;  4ZKI A;  2CTR A;  2QM4 A;  4J10 A;  4RUE A;  3SYQ A;  1SQG A;  2DW4 A;  1I7F A;  1H2G A;  3FFQ A;  2WLM A;  1E1Q G;  4O2A A;  5LHG A;  1JQ0 A;  1YEW A;  1JR9 A;  2EIJ B;  3CCJ V;  1BSM A;  1WA8 A;  1XIL A;  1J95 A;  4JI5 B;  1VF6 A;  4WFB V;  2PYL A;  1Q6I A;  4YJ3 A;  2ZDI A;  1DTO A;  4LF8 O;  5BY1 A;  1S3J A;  1JCH A;  1VP7 A;  4JI4 O;  3HKE A;  4QPK A;  4X65 B;  4KFM A;  1RM1 C;  1RPR A;  3SPI A;  1XNQ B;  3D3I A;  1KC8 W;  2P90 A;  5E1A C;  1AI6 A;  1N33 B;  3ZED A;  4DR5 O;  4DYL A;  3FB5 C;  4J41 A;  2ZIM A;  5L3E A;  2Q6A A;  3G6B A;  1YJ9 V;  4B3M O;  4MTO A;  1PP9 H;  1SF9 A;  4Z1V A;  4BIU A;  5AG2 A;  1ORQ C;  3CRR A;  2A7W A;  3DTU B;  1B06 A;  3OMN B;  2IJH A;  1M9N A;  1F4M A;  4O2A B;  2OCC B;  4J9Y B;  3T1C A;  2VQE O;  1P7B A;  4X1K A;  1DGS A;  1FAF A;  5C8Y A;  1HW7 A;  1VQ5 V;  3DSQ A;  3ZMZ A;  5CBH A;  1WA8 B;  2HJD A;  4MW8 A;  1KQS U;  2Y0I A;  1IXM A;  3N2K A;  4PDV A;  1XMQ O;  4A5U B;  3AG3 C;  5EBW C;  1Z2G A;  2RCV A;  5LYJ B;  1NKD A;  1FFX B;  2JEX A;  4LFB O;  2X6B A;  2Q67 A;  2ZR3 A;  4NXM B;  4FPP A;  1K8A W;  4JI4 B;  2YIB A;  3HKE B;  2Q69 A;  3UT5 B;  3BAA A;  5L3F A;  1E1R G;  5CA1 B;  2ADP A;  2YI9 A;  4X66 O;  1YTF B;  1VQ7 V;  4P9O A;  3RYC B;  2FML A;  4W4K A;  3F7V C;  3ZHT A;  3QO7 A;  4HNA B;  4FIP C;  2GHY A;  5EYP A;  1CP9 A;  1BZK A;  4DR7 B;  1QR8 A;  2DQ3 A;  5IJ0 A;  4DR5 B;  1CEZ A;  2EIM B;  4B3M B;  3CXC U;  1WPX A;  3SPJ A;  1PD3 A;  3CC2 V;  3L75 H;  4NTY A;  4ZHQ B;  3T1Y O;  2R70 A;  1NH2 D;  1XOU A;  3HKD A;  2VQE B;  5HFM A;  3KCY A;  4X1K B;  1QLE C;  5C8Y B;  4DR4 B;  2NLJ C;  2FYU H;  3JAK A;  2R9R B;  3CX5 F;  4KL1 A;  4D6T H;  4JYA B;  1EM1 A;  2WLN A;  4F6R A;  1FXK B;  3IGA C;  4FZ0 A;  1IX9 A;  2L35 A;  4IIJ B;  4GUN A;  4UV8 A;  3OR7 C;  1SER A;  4UB6 Z;  2QR4 A;  5JJJ B;  2V4D A;  3QVN A;  3F5T A;  4DR1 B;  3W7U A;  4CS3 A;  5B3S C;  3D3Q A;  5IDJ A;  3FKS G;  2YEV A;  2LFR A;  2P4K A;  4G2K A;  5IJ0 B;  1IBL O;  5GW7 A;  1VQ4 V;  4CH3 A;  5BR8 O;  5L3B A;  2BSK A;  3MHH C;  5B1A B;  4G27 B;  4B3R B;  5LP6 C;  4NVP A;  4HZ3 A;  3CRC A;  1TVK A;  3ZRX A;  1VQN V;  1Q6U A;  3APO A;  2OIE A;  4I4T A;  1MZE A;  4CH6 A;  3B8N A;  3QO5 A;  3JSN A;  3AG4 C;  1MAB G;  4K8X A;  4MTG A;  1H2M A;  3U0Z A;  4DV1 O;  2W0X A;  4OPA A;  3IAY A;  3FAV B;  3TK1 A;  4KXR A;  3OGI B;  4JAU A;  4LF4 O;  2UXX A;  2FB5 A;  4JI3 O;  4Z1M G;  2JEU A;  1GRJ A;  2W6J G;  2JS3 A;  4B7E A;  3N2G A;  4YHH O;  4DW0 A;  4O4J A;  1Y76 A;  1VQO V;  1BT8 A;  3P32 A;  4DRX B;  3DC6 A;  1OCR B;  3B4S A;  2HEP A;  4IT5 A;  5HFL A;  2Q8V A;  1BGY H;  1V9P A;  3OEE G;  2YEV B;  1GM7 A;  4UB8 Z;  2JVD A;  1E79 G;  4JI0 O;  3IC7 A;  5H2F Z;  1IBL B;  4R8C A;  4YIP A;  4LH7 A;  3SYC A;  2P4V A;  3BA9 A;  2HHH B;  3L72 H;  1K5S A;  1MOF A;  2UXD B;  1TVK B;  1H8H G;  1AJQ A;  1AVM A;  3CME V;  3A8T A;  1J5E O;  1ROP A;  3EHB B;  4I4T B;  2F95 B;  1XUQ A;  1WB7 A;  5EIB C;  1QR9 A;  3K08 A;  5DEC A;  5CA3 A;  3BY6 A;  5LOV B;  4LF9 O;  5JCO C;  3R66 A;  3ABT A;  1K34 A;  4N21 A;  2IBZ H;  3Q4H B;  1N36 O;  4DV4 B;  2YXH A;  2P67 A;  2Q0O C;  4GKK B;  5EK0 A;  4PA7 A;  3BFR A;  4TV8 B;  3WB0 A;  1DLB A;  4I50 A;  3SYA A;  1B04 A;  3N2G B;  3C3T A;  1O9G A;  1R3J C;  1QQC A;  4J7J A;  2XND G;  4GCZ A;  3OTO O;  4JAS A;  4BR6 A;  4JYB A;  4X8A A;  1MG1 A;  3VQV A;  1OZ0 A;  5ITZ A;  1AJP A;  1PKX A;  3OAA G;  2ZQM A;  3RVZ A;  4JV5 B;  2ZD9 A;  1NS1 A;  3H9V A;  3L73 H;  4X62 O;  1WJZ A;  3SPH A;  4JI7 B;  1A32 A;  2HLD G;  2LGW A;  3E8F A;  4H44 B;  4FLX A;  4LF6 B;  1Q7Y W;  1WAZ A;  1OJH A;  3S3W A;  1J5E B;  1O9H A;  2H94 A;  1QHT A;  1M56 C;  4O2B B;  4DR2 O;  5KHK A;  1G8M A;  3OMA B;  1G6U A;  3JD4 A;  3M7M X; 
#chains in the Genus database with same CATH homology
 2G38 A;  4J41 A;  4J7J A;  4W4L A;  2GTS A;  4J10 A;  4J11 A;  4J42 A;  4IYI A;  4J7K A;  3FX7 A;  4IYH A;  4KXR A;  4W4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...