1L8DA

Rad50 coiled-coil zn hook
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
103
structure length
103
Chain Sequence
KKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTLAKLIDRKSELERELRRIDMEIKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA double-strand break repair rad50 ATPase
publication title The Rad50 zinc-hook is a structure joining Mre11 complexes in DNA recombination and repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 45
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04423 Rad50_zn_hook Rad50 zinc hook motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.510 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1l8dA00
1L8DA
chains in the Genus database with same CATH superfamily
4ZBMA 2RNBA 4Z2WA 1PKXA 4DV6O 3ZRXA 4FPPA 3CXCU 2XUMA 1NVPD 1GN4A 1VQ9V 4HBNA 4CH3A 4L8JA 3EVKA 2YIBA 4E4EA 4I0XB 1R1BA 2YEVB 1Y76A 4JI6O 1ZX3A 1Z5VA 1ZAUA 2ETNA 1Q6IA 2YSUB 1RM1B 2LFRA 5IJ0A 5JJNB 1N0NA 1AJNA 1M57C 5B1AB 3AG1B 3SDLA 1N4CA 1CPYA 4AI8A 2Q8VA 2VWKA 3LUTB 1FFTB 4IL6Z 1IURA 1WA8B 2ZNIA 4ZKIA 3JAWA 4Q6GA 2D2CB 4RUEA 2ZXWB 3JD4A 3ASNB 1FD9A 2RMKB 1ZL8A 3HKDA 2P6JA 3OTOB 2IH3C 3W7XA 2WLLB 4B08A 4IHJA 2GDSA 3Q4HA 2PI5A 2JDIG 3VQVA 3ZRWA 2N04A 4QPKA 1KBHA 4I9QA 4J9YB 2IH1C 3ZS8C 4FFBA 2Q5ZA 3SYPA 4FLWA 4F6RB 3JCUZ 4JI5B 2DYRC 1OCRB 4LF8B 1VQKV 4JI4B 1KP2A 4PJ0Z 3ZMTA 4YIOA 1MZEA 3D8CA 4QGPA 2WLKA 1SERA 4DR5B 2IJKA 2CUGA 4IGGA 3JASB 1H2GA 5FL7G 5KA5A 1EZJA 2DW4A 1K34A 3ABLC 2EINB 2QM8A 5B1BC 2Q67A 3J81N 2EBOA 3K9SA 1P7BA 1L0LH 3STLC 3K3WA 3N2GA 4CS4A 1FXHA 1S77D 4FLVA 1KUQA 4ZOLB 5LGNA 4PI0A 3HKCA 3ZMSA 4GX2A 4LC1A 4O4JA 2CE4A 4PDLA 1IDSA 1R3KC 3FB7C 4I4TB 2O57A 3T1HO 2WLHA 4G27B 4DV1O 1I5XA 2YI8A 3SYAA 2HVKC 5EZYB 1NQTA 4BW9A 3F5TA 2D3OW 5B1OA 1MABG 3TJTA 3CCQV 4LFCB 1MSDA 2PZSA 2EIJC 5CA1A 5LGTA 4PA9A 3RFRA 2CH7A 1AJPA 3CX5F 2YC0A 1KKDA 3IJ4A 2PY5A 3JARB 3JD3A 3FD9A 4OPHA 2IJJA 3K04A 4LNUA 3B40A 2EIMB 4PDVA 3E22A 5KHGA 2Y0PA 3PN1A 1BT8A 3WG7C 2WLIB 3ETDA 2EULA 3C90A 3H1KH 2VS0A 1V54B 5GTHZ 2VQEO 1SQPH 3K06A 4WFBV 4PA3A 1FFXB 4UV9A 1HNZB 1S76D 2DQ3A 1EN5A 1XHZA 4LR3A 3SPCA 1XMOB 5CMUA 2ZNJA 1VQ6V 2FKXA 4CH5A 2CTRA 4FIPC 4YIPA 2Z5UA 3CCSV 2Y69B 4P9OA 2QWPB 4J80A 1IZ3A 5IE9A 3RYHA 2UUCB 4DV5B 5FNVA 1BSMA 4NR1A 2YI9A 3TCUA 3WFVA 1K33A 3DTUB 5KHJA 1SQFA 5KX5A 3HKBA 4YJ2A 4DRXB 1FXVA 4FFKA 5B66Z 4PA6A 3BCCH 2EIKC 1UFIA 3SPIA 1F23A 2B5UA 3AEIA 1VQMV 1FPOA 3OTFA 4B3TO 4BR6A 5KHKA 1J5EB 1VQPV 3AK1A 5EBMC 4K0KO 4X62O 1P84F 2A06H 3B2EE 3PJSK 4GKKB 1WP8A 1XOUA 3FYIB 1JFFA 4KHPB 4FVMA 4X64B 3L71H 5LMNO 1QLEC 2W6JG 2AGAA 3D3QA 4CH4A 1GTOA 3A0RA 3CRMA 4HAMA 3TXQA 3CRAA 2R9RB 1AI4A 5BXZA 5IT9N 2ZR3A 3CMAV 5IJ9B 3ZHQA 2EZOA 3JAKA 3CCMV 5ITZB 2CAZC 3AG2C 4NTYA 5CN0A 3VQWA 1K4DC 4AHCA 1G6UA 5B3SC 2E5LB 3ZMVA 5LOVB 1XILA 4H33A 5BMVB 3TETA 1OV9A 2Q68A 4YJ3A 5H2FZ 5BR8O 3GB7C 4DV7B 2A0LA 3UO2A 1M56C 4JI8O 1NS1A 2UXDB 3BY6A 4O4LB 1DF5A 3ASOC 1BS3A 2UXNA 3ZMZA 2ADQB 2L6LA 1Q82W 1MNGA 4NYKA 1VQ4V 4WFAV 1N32B 1COWG 1Q81W 1AVMA 2JGDA 3UT5A 4D7SA 4AQYO 2P4KA 1AR1B 4GZRB 2DQ0A 5FPOA 3AK2A 4U7NA 4UCUA 5IY5B 4RO2A 3ZRVA 2WSSG 2CTPA 4EB6B 1FXKC 4LFAO 3C3SA 4K3AA 4I7ZB 5K1XA 3SR2C 2UXBB 5KMGB 1VQ7V 5J2UA 1SZXA 2HHHO 3E89A 2Q7HA 2DE0X 1IBKO 1PNMA 3OT7A 4UCRA 1DTOA 1DF4A 2KSDA 3VQYA 4EFBA 1VF6C 4X65B 1HNXB 1OJHA 4FLXA 3BAAA 4JI1B 2WLMA 4B3SO 1RSOA 5JQGB 1D5NA 4JI7B 1QR9A 3RW0A 1TGOA 3KG2A 3QO8A 1GM7A 3G6BA 3T4ZA 2BE3A 1A32A 3SGIA 5IJ0B 4JI6B 2RN9A 3CP1A 4O4HA 2G38A 3EHBB 1QQCA 3BA8A 2KKWA 1S3JA 5L3CA 4LF5B 3ETEA 3UCSC 4O2AB 1URFA 1FKAO 3JAWB 4LF9O 2JIZG 3E86A 3N27A 3CCLV 2JS3A 4ZI7A 1Z2GA 4LFBO 3H1LH 2ZIOA 4TQDA 1HNWO 3OMAB 1Y67A 3HKDB 4JAUA 1Y74A 3Q4HB 4YY3O 1WLEA 4JI0B 4IIJB 4XDKA 3RT3C 5F2VO 2Y48A 2UUAB 5L3DA 2HKOA 4FFBB 2CTQA 5CB4A 3L73H 1D5AA 4X88A 1US6A 1W59A 3ZHVA 3ABUA 2N74A 2DOSA 4LWSA 2Q69A 2FL4A 1NR1A 3FYEB 3M7MX 1WNSA 1N36B 3FAVB 4JPRA 2EILC 4YHHO 5KAIZ 1S5HC 4X89A 4PHZA 3HR0A 2QE7G 1JR9A 3RBZA 4MVZA 3T1YO 3ZMUA 5LA6A 3N2GB 1PV0A 3IC7A 1N33O 4JI2O 4QPJA 3R65A 3A0BZ 3HKCB 2DYRB 1FYJA 4JZ2A 3G80A 2XNDG 2ILMA 3P30A 4X8AA 3P3PA 2GSMB 5CA0A 3T1HB 4X1IA 4I9WA 5LMUB 1LNQA 1R6TA 2Q4PA 2YXHA 2AXTZ 3ABLB 1U97A 1ENVA 2A9HA 2HR3A 2JJ1G 2KB1A 4W4LA 2CH7B 3RYIB 5B1BB 3OUSA 3LSUA 3A2FA 1N8RW 4DR2O 4MVRA 5EYPA 1SA0A 2Q9LA 1JCHA 1PNKA 2ZE6A 3EXAA 1O9GA 1XMQO 4QJFB 2UXCO 4L87A 3A0HZ 4FMTA 3KKYA 4I50A 3E8GA 2DWEC 1K4CC 2B9ZA 1TAEA 4X1KA 4BIOA 2ZM6O 1MA1A 3CC4V 2P06A 5D5PA 5IYZB 1GRJA 1ZWIC 3H01A 4NXMO 2DYSC 4GX5A 1BHAA 1XHXA 2BOCC 3MD0A 1BMFG 4BWAA 4MTOA 1AROP 2F93B 1SZTA 1YTFB 4P30A 5GONA 5KAFZ 1SQBH 4HNAB 1IBLO 4DR4O 5FNVB 1GM9A 3CCUV 2HG5C 2VWJA 4WFHA 3JATA 3UKMA 4DV2O 1NZ6A 1IBMO 5K1PA 4J11A 1Q8IA 4LF7O 4DR1O 2FMLA 1QCEA 4UFZA 4YJ2B 3WG7B 3UQ8A 3JAMN 1EBOA 5HFMA 5A2QN 1YCIA 3DSQA 2W0FC 4BIZA 2GBOA 5EIBD 3K9AA 4EFEA 3I5DA 3F7YC 1R6NA 1GH6A 4FLYA 1NTZH 3OMIB 2XOKG 2X7RB 3ZHUA 1RFYA 1GKFA 5L3BA 4FM2A 3RN4A 4JYAO 2RCVA 2UU9O 2IM9A 5LHIA 3VOUA 1QBZA 1Z5WA 4UVCA 4FLZA 2HFEC 3M8AA 4TUYA 1XDCA 3K58A 3OUFA 1GAXA 2XAQA 4LF4B 4JF3A 3JD0A 2Y4TA 4OXSA 1NH2D 1P4RA 3RWRD 2XAHA 1HR0B 5LMNB 2EIKB 4O4IB 3CS5A 2A3QA 3OMNB 4DW1A 3B77A 4TSFG 2BSKB 4NXNO 1I94O 3JAKB 1VF7A 1K97A 2PYLA 2QWQB 3P3NA 4IYHA 4H13B 4MT8A 3SYCA 2YIDA 1NTMH 1XUQA 4MVSA 2EX3A 1JPXA 2HJDA 1SETA 4KFMA 2QKAA 3CC7V 2JGUA 4H44B 2CDYA 1QLEB 3OAAG 1TVKA 5IYDO 4MSWC 4LBEC 1E1RG 5EBLC 1D2DA 4JI3B 2QJ1A 2A79B 4ZHQA 1WN7A 5H6QA 4HYOA 3QF7A 5B1NA 5B5EZ 4JI8B 1VARA 3JYCA 5L3FA 3IC9A 4DV4O 3CYOA 5JVDB 4J41A 3RYFA 1VQ8V 3F5WC 3AG2B 2QGNA 4JV5B 3ZN1A 1H38A 1ZUQA 5B3SB 3L70H 4CZZA 1RPRA 3B8MA 3K5MA 4LF6O 1H2SB 2ODMA 5LP6A 4AQYB 3ABTA 3APQA 3AG7A 5J2TB 1JQ0A 4B3RO 1N34O 1M56B 3RYCA 5JH7B 2P5OA 1QNMA 1K5SA 2VQFO 5J2UB 4N23A 4DUYB 4FZ0A 5KHHA 1TUBA 1V9PA 3ASOB 4QE7A 3ML0A 4DK1A 1ORQC 1T5EA 4IYIA 1AR5A 2HHHB 1AI5A 1OCOB 4G2KA 3MAQA 1XEQA 4E2LA 4PDRA 2GUZB 1RSOB 3L72H 2ZE5A 2L35A 3DXRB 1MG1A 2AHYA 3TK1A 1WP7A 4JYBA 2V7QG 1ZSPA 1BZKA 1FXKB 4PI2A 3ABMC 4PDMA 4TV8A 5FLXN 2Q7EA 4O4HB 3G6EV 4P2ZA 2NR5A 2CGNA 2YEVA 3W7WA 4FLUA 1SC5B 3M99B 4QIWF 3ZEDA 1XI1A 4U3FH 2KG7A 1V55B 3ETGA 3FFQA 1KP3A 3BEHA 4ZI7B 4HZ3A 4TWKA 3K5NA 4LF9B 1SKVA 3ABKC 5JWPA 1OCRC 2NN4A 4MTGA 4LFBB 4PA4A 3BVOA 1LUWA 1QU7A 1BQ0A 4N21A 3SJAC 3OD4A 3QNEA 4OPAA 3FX7A 1YIJV 4DR3B 1WPBA 2F1MA 4ASUG 2R70A 2UXXA 1Q7YW 2FTKA 3AG3C 2JVDA 4U7OA 4W4KA 4DUZB 2EINC 1WPXA 5LYJB 3JALB 3W7SA 2E76B 3I56V 3L75H 4CH6A 2QTOA 3LNNA 3G4SV 4F6RA 2BCCH 3H1HH 3UO3A 1AB3A 1AI7A 1GN2A 1OCZB 2P22C 1AP6A 3WU2Z 4D7TA 5KLVH 3FB6C 2H3OA 2LW7A 1KYOF 1M93A 2E3CA 1LUVA 5LA6B 4YHHB 3QO7A 4A5UB 3SJCC 1Q43A 3JASA 4DV3B 3O65A 3T1YB 1EFRG 2EJ7A 2FYUH 4NTWA 1Y4MA 4OX9O 1N33B 2HJFC 2LFSA 3W7TA 1YTFD 2E75B 3CMEV 1GO3F 4X1YB 2V1DA 4B7KA 1XREA 2Q7GA 1NH2B 5CA0B 4ZOLA 4I55A 1CXZB 3ZCCA 2IU0A 2EILB 1V54C 3J80N 4B3MO 3KCYA 1EN4A 4JASA 4AILC 5LHGA 4WCEV 1XNQB 2P90A 1AR4A 4KL1A 4LFCO 5EZYA 5EYPB 1PPJH 3LDCA 3K0DA 2C2AA 4KP4A 2KQXA 4WFEA 2Y69C 4X20B 1HWYA 3DC5A 2OYQA 4I50B 3APOA 5IWAB 1XMQB 3CE2A 1H8HG 1GM8A 3JARA 3LNMB 3K03A 1SQGA 1MMMA 4JAVA 3SPJA 3DGEA 2OCHA 1IX9A 2V4DA 5D5QA 2ZIMA 3LDDA 1NKDA 4DV6B 1BL8A 2LJ2A 2IU3A 1L1FA 2WLIA 4UXNA 1E1QG 2XTAA 4NXMB 2Q0OC 1Y76B 4JZGA 5IYCO 1YXBA 2K1EA 1W0KG 3O9OA 5GONB 2F4VO 1FFXA 2BTOA 2LP7A 1H2MA 4FM1A 2P67A 2UUCO 4DV5O 2OCCC 3ZJZA 5L3EA 1QVFU 4G28B 2F23A 3ICXA 4UVBA 1NR7A 4X66O 2YXLA 2ZR2A 4MW8A 2F43G 1KQSU 4DR1B 3G71V 2R9IA 3MHHC 3HKEA 1FAFA 3CHXA 3QVNA 1M90W 2IW5A 2DYSB 2ITDC 5CA3A 1B04A 4QNHB 1YSCA 2Z0AA 4JYYA 5C93A 3CRQA 1YJ9V 1OCCC 1ZL8B 4DRXA 1BGYH 4IHJB 4EEQA 1GMGA 4UCTA 2ZCEA 3I55V 4UCOA 3ZRWB 1H2KA 3CCJV 3H9VA 4JYAB 2HVJC 1KMIZ 1YI2V 2UU9B 2F66C 2DMXA 4LP8A 1M57B 3K57A 4QE9A 4O2BA 3ETQA 4KHPO 4LH7A 5DECA 4X64O 2K9PA 2YS8A 4WBNA 1DGSA 1XL4A 3CSXA 2VRZA 2UUBO 3GVMA 3HB3B 1JOYA 4ZIBA 2BOBC 1W0JG 3ZX6A 5BZBA 3CCRV 4U3JA 2WPDG 1SS3A 4GUNA 2Z3YA 2ZD9A 4X9QA 4NXNB 3RVZA 1BE3H 1R3LC 4JYCA 2LQTA 5E1AC 1XNRO 3CWBH 3FB5C 2LGQA 2E5LO 5ITZA 4DR7O 5C8YA 4RQFA 1NI8A 1B06A 2OT5A 4TV9A 2BTQA 4O4JB 1K92A 4ZHQB 1EN6A 1X4TA 5HFLA 2Y4UA 4DV7O 5BMVA 3CC2V 2UXDO 3SJQC 1JMKC 1ZLZA 5LBQA 2ARHA 3SJBC 4UCVA 1B3QA 1KU9A 4XDLA 4DV1B 2CTWA 3STZC 4TQFA 3OW2U 4J9ZB 5CA1B 1N0JA 3AG4C 4O4LA 4LH6A 1SF9A 4GX1A 2H94A 1K5QA 1Q6UA 3BRCA 1N32O 2OIGA 3L9DA 2GTSA 2QM4A 3ZHTA 4LNUB 1UPGA 3E22B 3RYCB 3CJHA 2DN9A 4B3RB 4DW0A 1MOFA 2P7TC 2UXBO 1YZBA 1TUBB 2VQFB 4EB6A 2IBZH 4GCZA 3G67A 1IXMA 1PL4A 2X6CA 2VQEB 1AILA 1VF5B 1R3JC 4GX0A 2OTLV 1I08A 3IFXA 3RVYA 3AK3A 1H2NA 2EIJB 1U96A 2EJRA 1JA8A 4P9PA 1MSWD 1HNXO 1W2BU 3RYHB 4Z1VA 4JI1O 2JRIA 2AZ0A 4JI7O 1SQQH 2OTJV 2AHZA 4K8ZA 1M4UA 4TV8B 3CEIA 3L74H 5JQGA 5KX5B 5CBFA 5LHHA 3HKBB 2QWNB 2HP8A 3JD2A 1L0NH 2IJHA 2FB5A 2AW9A 3WB0A 1OHHG 2KG7B 1VMGA 2YICA 1M1KW 4DK0A 4NKGB 4NVPA 4DV0O 1K73W 4LF5O 3ZBHA 2QKSA 3CPWU 1KD1W 4EKWA 4J7KA 3BHPA 4GLXA 2ADPA 2W6IG 4O2AA 4FM0A 4WF9V 4B3TB 3H1IH 4CC6A 1I7FA 5GTIZ 2RDCA 4K0KB 1JFFB 4X62B 3FKSG 2XT9A 4DR6O 3N2KA 1PD3A 3ABMB 2Q73A 4PV1B 4R8CA 2QM7A 1IVSA 4ICGA 1Y66A 4JTCB 4KXRA 4JI0O 3BABA 2PGGA 1SQVH 3X2QC 5JJEB 1YDXA 4Q20A 3KCXA 5BY1A 2UUAO 1KB9F 3KZIZ 5KUKA 1PNLA 4IIJA 2CK3G 4UV8A 3S3XA 1VEWA 3GWKC 4RUFA 1QLNA 2B1IA 1KECA 1JX9A 3ABKB 4JTAB 1PP9H 1SQXH 2WAMA 4D6TH 1NJIW 1VP7A 4CS3A 1ZTEA 2Y0IA 1HDJA 1H8EG 1N36O 3K5OA 4I5SA 5CBHA 5LP6C 1EM1A 2ZT9B 4UB8Z 1S5LZ 4H37A 4YJ3B 2M7WA 1F4NA 3AG3B 1X59A 5EBWC 2XASA 3FAVA 1F51A 5H6RA 2MW2B 2YIBD 2AZ2A 4GKJO 2X6BA 3CCVV 5BR8B 4XBFA 1QR8A 1NU1H 2M6YA 3JSNA 1YVWA 5LXTA 1YJNV 4MTXA 4OX9B 4ABMA 3ZRSA 3LDEA 4MS2A 1EZVH 4I55B 2ITCC 1I0HA 3B09A 1FJGO 1F7YA 3E2EA 2JGDB 3UT5B 2JS5A 3QTCA 4GYCB 1G4YB 1YF2A 5LMUO 2YIAA 1Q5OA 2N05A 4UCSA 4B3MB 4DXWA 3C3TA 4UUJC 1GN3A 3MDSA 2R72A 3OFNG 5KUMA 4R50A 4LCUC 2JEXA 4H0LB 2X0LA 2ZE7A 3SYQA 3MHSC 3VQXA 1JJ2U 1P7GA 1E79G 2WLNA 4LFAB 4K8XA 3RYIA 4F6EA 5DM6V 3DC6A 1KC8W 4NB5A 1NBMG 1RM1C 2DJVA 2Q0AA 1IBKB 3TXSA 2JK5C 5B1AC 2WWWA 3AG1C 3JSLA 4NTXA 4KUMA 3E8BA 3SPHA 4DO2A 4B3SB 2YXYA 1G8MA 2QWRB 3E83A 5IYZA 4J42A 2XHBA 3CXHF 2ZXWC 4FJCC 3ASNC 2GV9A 3JCZA 3F7VC 3T2MA 2F4VB 3S3WA 2QTSA 4FZ1A 4I0XA 1P49A 1AP5A 3E35A 1B6QA 4HNAA 1KKCA 2X6AA 1S5JA 1HW7A 3OM3B 4GT1A 1YHQV 3ZHSA 1BQZA 5JCOC 2QSAA 4X66B 3HKEB 3BFRA 5DN6G 2PYJA 2ZKOA 2ZDIC 2LGWA 2NLJC 1Y74B 2HLDG 1CP9A 1WA8A 1L8DA 5KA6A 1HNWB 1QVGU 1UJWB 3OTOO 1S0VA 4J7JA 3CB2A 1ROPA 2GHYA 4YY3B 3BPZA 3UM7A 1F4MA 2OCCB 2WLLA 4O2BB 5CB4B 3CD6V 1Q3EA 1SESA 1AJQA 4WBNB 4RQEA 3VBBA 3OEEG 4LF4O 1TA8A 5A9GA 1NVPB 2IJIA 5JCOA 3D36C 4JI5O 1HR0O 1HP8A 4LF8O 2WA4A 4JI4O 2UUBB 3IAYA 2ZDIA 3CRRA 2E74B 4U3JB 3E8HA 4LWSB 1OCCB 1PL0A 2GTAA 2A7WA 1XQ8A 4DR5O 1K9MW 2RQ6A 4O4IA 1VQOV 3TGUH 1R73A 5IYBO 4JGSA 2BSKA 1WAZA 1LR1A 1R6KA 4YXWG 3A8TA 4PELA 4UVAA 5C8YB 1BCCH 1VQLV 1XNRB 4TV9B 2BTQB 2DWDC 4MVMA 4RAIA 3W7UA 3U10A 2XAFA 4DR7B 4JI2B 3D36A 4JI3O 5L3GA 3U11A 4DYLA 2EIMC 3T4DA 4XDJA 3J7AU 4X1IB 3RGBA 1YEWA 3NXSA 1AI6A 2JJ2G 4I4TA 1JVMA 2QEXV 1RPOA 5J9PC 3K59A 4CBCA 4JV5O 1GN6A 1SA0B 1OCOC 1VQNV 5H9CA 2Q6AA 5JVDA 2P4VA 5EC2C 1Q6HA 5DEDA 5TISZ 4DR2B 3SYOA 3CJHB 1WB8A 4JTDB 1IXBA 1XL6A 2JEUA 4PD4F 2QA4V 2UXCB 4X1KB 1NT2B 4J7ZA 4C7UA 5JJJB 3OEHG 2YUAA 3OE7G 4RWUA 1MZFA 5J2TA 4DUYO 1CEZA 2ATKC 4PA7A 5JH7A 2ZM6B 2RJZA 3K5LA 3P32A 4MVQA 4WFFA 1HNZO 5H5NA 4B7EA 3AG4B 3U0ZA 4Z1MG 5CBGA 1XMOO 4MVOA 1JJOA 1V55C 2CGOA 1K7DA 1THZA 3JATB 2QR4A 4DR4B 2MK3A 1IBLB 3K0GA 2GUZA 3WB2A 4FLTA 1G1XB 3DXRA 4DV2B 3R66A 1IBMB 3ZHRA 4MTFA 1BHBA 1Q90D 4LF7B 2WA3A 4TT3G 3K79A 3EFFK 5KHIA 3OR6C 1H2LA 1FXKA 2XAGA 2PF4E 4BW5A 1GK9A 4DV0B 3BA9A 1YJWV 2QKCA 1VIBA 1I5YA 3ZIAG 1J5EO 4TUYB 4UB6Z 4K35A 2H8PC 1VF6A 2QDOA 2PUSA 2QWOB 4GKKO 3N2KB 4TOIA 5GW7A 4WFGA 1M9NA 3QG5A 4CS2A 1OCZC 4DR6B 1VQ5V 4DR3O 5EIBC 1TUEB 3JD1A 5LGUA 4FK5C 1S72V 1QHTA 3NR7A 2F95B 4DUZO 4R6ZA 2W0XA 4F4LA 5EC1C 2PI4A 1WB7A 3CRCA 3QO5A 2EZPA 3E8FA 1DK1A 5LYJA 2R9AA 1I94B 3JALA 5EK0A 2NNUA 1WJZA 4IT5A 3D3IA 1O9HA 5IJ9A 3FB8C 4J10A 5IDJA 1RP3B 3OGIB 2ZINA 1TVKB 1M5IA 5FPRA 3X2QB 1FS0G 2OIEA 3GWOA 3SPGA 1YITV 3H1JH 5IY5C 4OGQB 3THOA 4DV3O 5LOVA 1K8AW 4JAAA 1J95A 3ZN0A 3CCEV 5LXTB 2OWOA 3OGCC 3OR7C 4GKJB 5E79Z 3IGAC 1XBLA 2ZQMA 3HPLC 3RYFB 1DLBA 2WLJA 1OZ0A 4DV4B 2YDEA 1Y6XA 2LW1A 3T1CA 4MVUA 4X1YA 3K08A 2HEPA 1FJGB 1NTKH 4R7CA 5LP6B 1Q86W 1R3IC 4MW3A 1K3EA 2XAJA 1XNQO 2LO1A 4LF6B 3LSQA 2B1GA 1N34B 2ZE8A 5AG2A 3B4SA 1SRYA 5LL6Y 2PTMA 5IWAO 1PM9A 5KMGA 3LSSA 4BAYA 3B8NA 4X20A 3WB1A 4BIUA 4CC5A 4X65O
chains in the Genus database with same CATH topology
3LNNA 4ZI7A 4F6RA 3UT5B 2JS5A 2ZIOA 3QTCA 4TQDA 4GYCB 2P22C 4D7TA 2YIAA 3HKDB 1Q5OA 4HBNA 4CH3A 4UCSA 4L8JA 4B3MB 2YIBA 1M93A 2R72A 2E3CA 5LA6B 4YHHB 3SJCC 1Q43A 1Z5VA 4JI0B 1ZAUA 3VQXA 3JASA 4LFAB 4IIJB 4DV3B 4K8XA 3T1YB 2UUAB 3RYIA 5IJ0A 5JJNB 4FFBB 5CB4A 1N33B 2Q0AA 1IBKB 1D5AA 4X1YB 2VWKA 2Q7GA 3JSLA 5CA0B 4ZOLA 2ZNIA 4I55A 3JAWA 4Q6GA 3M7MX 4B3SB 4AILC 1WNSA 1N36B 5IYZA 1XNQB 2XHBA 3HKDA 4KL1A 3OTOB 2GV9A 4PHZA 5EZYA 5EYPB 4B08A 2F4VB 4IHJA 3VQVA 5LA6A 1P49A 3N2GB 4X20B 4I9QA 4HNAA 2OYQA 4I50B 1S5JA 1HW7A 5IWAB 1XMQB 3HKCB 5JCOC 3ZS8C 3JARA 4FFBA 4FLWA 4F6RB 1SQGA 3HKEB 4X66B 2PYJA 4JI5B 2V4DA 5D5QA 4LF8B 4JI4B 2ZIMA 4DV6B 5CA0A 3T1HB 1L8DA 1HNWB 4X1IA 4DR5B 4NXMB 5LMUB 3CB2A 3JASB 5GONB 1FFXA 2BTOA 3RYIB 4FM1A 4YY3B 3A2FA 3BPZA 4O2BB 5EYPA 5CB4B 1SA0A 1Q3EA 4WBNB 1O9GA 4CS4A 3N2GA 1TA8A 3ICXA 2YXLA 5JCOA 4I50A 4DR1B 4FLVA 4ZOLB 4PI0A 3HKCA 2UUBB 3IAYA 4O4JA 1TAEA 4U3JB 4X1KA 3HKEA 3CHXA 4I4TB 1B04A 5D5PA 5IYZB 1XQ8A 4DRXA 2RQ6A 2YI8A 4O4IA 5EZYB 1XHXA 4BW9A 4IHJB 4EEQA 4UCTA 2ZCEA 4BWAA 4UCOA 2F93B 4LFCB 2PZSA 5CA1A 4JYAB 5GONA 1KMIZ 4HNAB 2UU9B 2F66C 5FNVB 5C8YB 3RFRA 2VWJA 3JATA 1XNRB 4TV9B 2BTQB 3JARB 3K57A 2PY5A 4O2BA 3ETQA 3U10A 5K1PA 4DR7B 1Q8IA 4LH7A 4JI2B 4WBNA 1DGSA 4LNUA 4UFZA 4YJ2B 3UQ8A 3CSXA 3E22A 5KHGA 3PN1A 3U11A 3DSQA 5EIBD 4ZIBA 4EFEA 4X1IB 3RGBA 1YEWA 4U3JA 4I4TA 4FLYA 1FFXB 1HNZB 1XHZA 4NXNB 4LR3A 3K59A 1XMOB 2ZNJA 4FM2A 1SA0B 4CH5A 2IM9A 5JVDA 1Z5WA 4FLZA 4TUYA 4DR2B 3K58A 3RYHA 2UUCB 5ITZA 4DV5B 5FNVA 5C8YA 2YI9A 4LF4B 4TV9A 2BTQA 4O4JB 2UXCB 4X1KB 1NT2B 3RWRD 4ZHQB 5JJJB 1X4TA 5KHJA 1SQFA 5KX5A 5J2TA 3HKBA 1HR0B 4YJ2A 5LMNB 5BMVA 4DRXB 1JMKC 4O4IB 5JH7A 2ZM6B 2RJZA 3SJBC 4UCVA 3K5LA 1KU9A 4DV1B 3U0ZA 4TQFA 3JAKB 5CA1B 1VF7A 1JJOA 4O4LA 2PYLA 3OTFA 4LH6A 3JATB 5KHKA 1J5EB 3BRCA 2EX3A 2QM4A 4DR4B 1IBLB 3B2EE 4GKKB 3WB2A 4FLTA 2JGUA 4LNUB 4DV2B 3E22B 1IBMB 3RYCB 1JFFA 4KHPB 4FVMA 4X64B 1TVKA 4LF7B 5KHIA 4B3RB 4JI3B 2QJ1A 1TUBB 4ZHQA 2VQFB 4EB6A 1WN7A 4CH4A 3QF7A 4JI8B 4DV0B 2VQEB 3BA9A 5JVDB 3RYFA 5IJ9B 4JV5B 4TUYB 3JAKA 3RYHB 5ITZB 2PUSA 2CAZC 3N2KB 4TOIA 3VQWA 4AHCA 4K8ZA 1M4UA 1G6UA 3QG5A 3K5MA 4CS2A 2E5LB 1H2SB 4TV8B 4DR6B 5LP6A 4AQYB 5JQGA 5KX5B 5EIBC 5J2TB 5LOVB 3HKBB 5BMVB 3RYCA 5JH7B 2P5OA 4YJ3A 1QHTA 3WB0A 5J2UB 4DV7B 2F95B 4DUYB 2UXDB 4DK0A 5KHHA 4NVPA 1TUBA 1V9PA 4DK1A 1T5EA 4O4LB 2HHHB 3BHPA 5LYJA 3MAQA 2R9AA 4GLXA 1I94B 3JALA 4O2AA 4FM0A 4B3TB 1O9HA 4CC6A 5IJ9A 1I7FA 1N32B 4K0KB 1JFFB 4X62B 2ZINA 3UT5A 4D7SA 1TVKB 3N2KA 1M5IA 5FPRA 5FPOA 4UCUA 4PI2A 4TV8A 3BABA 2PGGA 2Q7EA 4O4HB 4EB6B 5JJEB 3THOA 5LOVA 5K1XA 3SR2C 4FLUA 2UXBB 5KMGB 5LXTB 2OWOA 4GKJB 3ZEDA 1XI1A 5J2UA 4IIJA 2Q7HA 3RYFB 3FFQA 4DV4B 4ZI7B 4UCRA 3VQYA 4EFBA 3K5NA 4X65B 4LF9B 1SKVA 4X1YA 1HNXB 2HEPA 1FJGB 4FLXA 3BAAA 4CS3A 4LFBB 4JI1B 5LP6B 1RSOA 5JQGB 4JI7B 3K5OA 5LP6C 4LF6B 1TGOA 4YJ3B 3SJAC 4DR3B 1WPBA 2F1MA 2R70A 1N34B 3SGIA 5IJ0B 4JI6B 2YIBD 2JVDA 4O4HA 5BR8B 1QQCA 4DUZB 3BA8A 2PTMA 2KKWA 3JSNA 5LYJB 5KMGA 5LXTA 3JALB 4LF5B 4X20A 4OX9B 4O2AB 3WB1A 4I55B 4CC5A 4CH6A 3JAWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8D A; 
#chains in the Genus database with same CATH topology
 4ZBM A;  2RNB A;  4Z2W A;  1PKX A;  4DV6 O;  3ZRX A;  4FPP A;  3CXC U;  2XUM A;  1NVP D;  1GN4 A;  1VQ9 V;  4HBN A;  4CH3 A;  4L8J A;  3EVK A;  2YIB A;  4E4E A;  4I0X B;  1R1B A;  2YEV B;  1Y76 A;  4JI6 O;  1ZX3 A;  1Z5V A;  1ZAU A;  2ETN A;  1Q6I A;  2YSU B;  1RM1 B;  2LFR A;  5IJ0 A;  5JJN B;  1N0N A;  1AJN A;  1M57 C;  5B1A B;  3AG1 B;  3SDL A;  1N4C A;  1CPY A;  4AI8 A;  2Q8V A;  2VWK A;  3LUT B;  1FFT B;  4IL6 Z;  1IUR A;  1WA8 B;  2ZNI A;  4ZKI A;  3JAW A;  4Q6G A;  2D2C B;  4RUE A;  2ZXW B;  3JD4 A;  3ASN B;  1FD9 A;  2RMK B;  1ZL8 A;  3HKD A;  2P6J A;  3OTO B;  2IH3 C;  3W7X A;  2WLL B;  4B08 A;  4IHJ A;  2GDS A;  3Q4H A;  2PI5 A;  2JDI G;  3VQV A;  3ZRW A;  2N04 A;  4QPK A;  1KBH A;  4I9Q A;  4J9Y B;  2IH1 C;  3ZS8 C;  4FFB A;  2Q5Z A;  3SYP A;  4FLW A;  4F6R B;  3JCU Z;  4JI5 B;  2DYR C;  1OCR B;  4LF8 B;  1VQK V;  4JI4 B;  1KP2 A;  4PJ0 Z;  3ZMT A;  4YIO A;  1MZE A;  3D8C A;  4QGP A;  2WLK A;  1SER A;  4DR5 B;  2IJK A;  2CUG A;  4IGG A;  3JAS B;  1H2G A;  5FL7 G;  5KA5 A;  1EZJ A;  2DW4 A;  1K34 A;  3ABL C;  2EIN B;  2QM8 A;  5B1B C;  2Q67 A;  3J81 N;  2EBO A;  3K9S A;  1P7B A;  1L0L H;  3STL C;  3K3W A;  3N2G A;  4CS4 A;  1FXH A;  1S77 D;  4FLV A;  1KUQ A;  4ZOL B;  5LGN A;  4PI0 A;  3HKC A;  3ZMS A;  4GX2 A;  4LC1 A;  4O4J A;  2CE4 A;  4PDL A;  1IDS A;  1R3K C;  3FB7 C;  4I4T B;  2O57 A;  3T1H O;  2WLH A;  4G27 B;  4DV1 O;  1I5X A;  2YI8 A;  3SYA A;  2HVK C;  5EZY B;  1NQT A;  4BW9 A;  3F5T A;  2D3O W;  5B1O A;  1MAB G;  3TJT A;  3CCQ V;  4LFC B;  1MSD A;  2PZS A;  2EIJ C;  5CA1 A;  5LGT A;  4PA9 A;  3RFR A;  2CH7 A;  1AJP A;  3CX5 F;  2YC0 A;  1KKD A;  3IJ4 A;  2PY5 A;  3JAR B;  3JD3 A;  3FD9 A;  4OPH A;  2IJJ A;  3K04 A;  4LNU A;  3B40 A;  2EIM B;  4PDV A;  3E22 A;  5KHG A;  2Y0P A;  3PN1 A;  1BT8 A;  3WG7 C;  2WLI B;  3ETD A;  2EUL A;  3C90 A;  3H1K H;  2VS0 A;  1V54 B;  5GTH Z;  2VQE O;  1SQP H;  3K06 A;  4WFB V;  4PA3 A;  1FFX B;  4UV9 A;  1HNZ B;  1S76 D;  2DQ3 A;  1EN5 A;  1XHZ A;  4LR3 A;  3SPC A;  1XMO B;  5CMU A;  2ZNJ A;  1VQ6 V;  2FKX A;  4CH5 A;  2CTR A;  4FIP C;  4YIP A;  2Z5U A;  3CCS V;  2Y69 B;  4P9O A;  2QWP B;  4J80 A;  1IZ3 A;  5IE9 A;  3RYH A;  2UUC B;  4DV5 B;  5FNV A;  1BSM A;  4NR1 A;  2YI9 A;  3TCU A;  3WFV A;  1K33 A;  3DTU B;  5KHJ A;  1SQF A;  5KX5 A;  3HKB A;  4YJ2 A;  4DRX B;  1FXV A;  4FFK A;  5B66 Z;  4PA6 A;  3BCC H;  2EIK C;  1UFI A;  3SPI A;  1F23 A;  2B5U A;  3AEI A;  1VQM V;  1FPO A;  3OTF A;  4B3T O;  4BR6 A;  5KHK A;  1J5E B;  1VQP V;  3AK1 A;  5EBM C;  4K0K O;  4X62 O;  1P84 F;  2A06 H;  3B2E E;  3PJS K;  4GKK B;  1WP8 A;  1XOU A;  3FYI B;  1JFF A;  4KHP B;  4FVM A;  4X64 B;  3L71 H;  5LMN O;  1QLE C;  2W6J G;  2AGA A;  3D3Q A;  4CH4 A;  1GTO A;  3A0R A;  3CRM A;  4HAM A;  3TXQ A;  3CRA A;  2R9R B;  1AI4 A;  5BXZ A;  5IT9 N;  2ZR3 A;  3CMA V;  5IJ9 B;  3ZHQ A;  2EZO A;  3JAK A;  3CCM V;  5ITZ B;  2CAZ C;  3AG2 C;  4NTY A;  5CN0 A;  3VQW A;  1K4D C;  4AHC A;  1G6U A;  5B3S C;  2E5L B;  3ZMV A;  5LOV B;  1XIL A;  4H33 A;  5BMV B;  3TET A;  1OV9 A;  2Q68 A;  4YJ3 A;  5H2F Z;  5BR8 O;  3GB7 C;  4DV7 B;  2A0L A;  3UO2 A;  1M56 C;  4JI8 O;  1NS1 A;  2UXD B;  3BY6 A;  4O4L B;  1DF5 A;  3ASO C;  1BS3 A;  2UXN A;  3ZMZ A;  2ADQ B;  2L6L A;  1Q82 W;  1MNG A;  4NYK A;  1VQ4 V;  4WFA V;  1N32 B;  1COW G;  1Q81 W;  1AVM A;  2JGD A;  3UT5 A;  4D7S A;  4AQY O;  2P4K A;  1AR1 B;  4GZR B;  2DQ0 A;  5FPO A;  3AK2 A;  4U7N A;  4UCU A;  5IY5 B;  4RO2 A;  3ZRV A;  2WSS G;  2CTP A;  4EB6 B;  1FXK C;  4LFA O;  3C3S A;  4K3A A;  4I7Z B;  5K1X A;  3SR2 C;  2UXB B;  5KMG B;  1VQ7 V;  5J2U A;  1SZX A;  2HHH O;  3E89 A;  2Q7H A;  2DE0 X;  1IBK O;  1PNM A;  3OT7 A;  4UCR A;  1DTO A;  1DF4 A;  2KSD A;  3VQY A;  4EFB A;  1VF6 C;  4X65 B;  1HNX B;  1OJH A;  4FLX A;  3BAA A;  4JI1 B;  2WLM A;  4B3S O;  1RSO A;  5JQG B;  1D5N A;  4JI7 B;  1QR9 A;  3RW0 A;  1TGO A;  3KG2 A;  3QO8 A;  1GM7 A;  3G6B A;  3T4Z A;  2BE3 A;  1A32 A;  3SGI A;  5IJ0 B;  4JI6 B;  2RN9 A;  3CP1 A;  4O4H A;  2G38 A;  3EHB B;  1QQC A;  3BA8 A;  2KKW A;  1S3J A;  5L3C A;  4LF5 B;  3ETE A;  3UCS C;  4O2A B;  1URF A;  1FKA O;  3JAW B;  4LF9 O;  2JIZ G;  3E86 A;  3N27 A;  3CCL V;  2JS3 A;  4ZI7 A;  1Z2G A;  4LFB O;  3H1L H;  2ZIO A;  4TQD A;  1HNW O;  3OMA B;  1Y67 A;  3HKD B;  4JAU A;  1Y74 A;  3Q4H B;  4YY3 O;  1WLE A;  4JI0 B;  4IIJ B;  4XDK A;  3RT3 C;  5F2V O;  2Y48 A;  2UUA B;  5L3D A;  2HKO A;  4FFB B;  2CTQ A;  5CB4 A;  3L73 H;  1D5A A;  4X88 A;  1US6 A;  1W59 A;  3ZHV A;  3ABU A;  2N74 A;  2DOS A;  4LWS A;  2Q69 A;  2FL4 A;  1NR1 A;  3FYE B;  3M7M X;  1WNS A;  1N36 B;  3FAV B;  4JPR A;  2EIL C;  4YHH O;  5KAI Z;  1S5H C;  4X89 A;  4PHZ A;  3HR0 A;  2QE7 G;  1JR9 A;  3RBZ A;  4MVZ A;  3T1Y O;  3ZMU A;  5LA6 A;  3N2G B;  1PV0 A;  3IC7 A;  1N33 O;  4JI2 O;  4QPJ A;  3R65 A;  3A0B Z;  3HKC B;  2DYR B;  1FYJ A;  4JZ2 A;  3G80 A;  2XND G;  2ILM A;  3P30 A;  4X8A A;  3P3P A;  2GSM B;  5CA0 A;  3T1H B;  4X1I A;  4I9W A;  5LMU B;  1LNQ A;  1R6T A;  2Q4P A;  2YXH A;  2AXT Z;  3ABL B;  1U97 A;  1ENV A;  2A9H A;  2HR3 A;  2JJ1 G;  2KB1 A;  4W4L A;  2CH7 B;  3RYI B;  5B1B B;  3OUS A;  3LSU A;  3A2F A;  1N8R W;  4DR2 O;  4MVR A;  5EYP A;  1SA0 A;  2Q9L A;  1JCH A;  1PNK A;  2ZE6 A;  3EXA A;  1O9G A;  1XMQ O;  4QJF B;  2UXC O;  4L87 A;  3A0H Z;  4FMT A;  3KKY A;  4I50 A;  3E8G A;  2DWE C;  1K4C C;  2B9Z A;  1TAE A;  4X1K A;  4BIO A;  2ZM6 O;  1MA1 A;  3CC4 V;  2P06 A;  5D5P A;  5IYZ B;  1GRJ A;  1ZWI C;  3H01 A;  4NXM O;  2DYS C;  4GX5 A;  1BHA A;  1XHX A;  2BOC C;  3MD0 A;  1BMF G;  4BWA A;  4MTO A;  1ARO P;  2F93 B;  1SZT A;  1YTF B;  4P30 A;  5GON A;  5KAF Z;  1SQB H;  4HNA B;  1IBL O;  4DR4 O;  5FNV B;  1GM9 A;  3CCU V;  2HG5 C;  2VWJ A;  4WFH A;  3JAT A;  3UKM A;  4DV2 O;  1NZ6 A;  1IBM O;  5K1P A;  4J11 A;  1Q8I A;  4LF7 O;  4DR1 O;  2FML A;  1QCE A;  4UFZ A;  4YJ2 B;  3WG7 B;  3UQ8 A;  3JAM N;  1EBO A;  5HFM A;  5A2Q N;  1YCI A;  3DSQ A;  2W0F C;  4BIZ A;  2GBO A;  5EIB D;  3K9A A;  4EFE A;  3I5D A;  3F7Y C;  1R6N A;  1GH6 A;  4FLY A;  1NTZ H;  3OMI B;  2XOK G;  2X7R B;  3ZHU A;  1RFY A;  1GKF A;  5L3B A;  4FM2 A;  3RN4 A;  4JYA O;  2RCV A;  2UU9 O;  2IM9 A;  5LHI A;  3VOU A;  1QBZ A;  1Z5W A;  4UVC A;  4FLZ A;  2HFE C;  3M8A A;  4TUY A;  1XDC A;  3K58 A;  3OUF A;  1GAX A;  2XAQ A;  4LF4 B;  4JF3 A;  3JD0 A;  2Y4T A;  4OXS A;  1NH2 D;  1P4R A;  3RWR D;  2XAH A;  1HR0 B;  5LMN B;  2EIK B;  4O4I B;  3CS5 A;  2A3Q A;  3OMN B;  4DW1 A;  3B77 A;  4TSF G;  2BSK B;  4NXN O;  1I94 O;  3JAK B;  1VF7 A;  1K97 A;  2PYL A;  2QWQ B;  3P3N A;  4IYH A;  4H13 B;  4MT8 A;  3SYC A;  2YID A;  1NTM H;  1XUQ A;  4MVS A;  2EX3 A;  1JPX A;  2HJD A;  1SET A;  4KFM A;  2QKA A;  3CC7 V;  2JGU A;  4H44 B;  2CDY A;  1QLE B;  3OAA G;  1TVK A;  5IYD O;  4MSW C;  4LBE C;  1E1R G;  5EBL C;  1D2D A;  4JI3 B;  2QJ1 A;  2A79 B;  4ZHQ A;  1WN7 A;  5H6Q A;  4HYO A;  3QF7 A;  5B1N A;  5B5E Z;  4JI8 B;  1VAR A;  3JYC A;  5L3F A;  3IC9 A;  4DV4 O;  3CYO A;  5JVD B;  4J41 A;  3RYF A;  1VQ8 V;  3F5W C;  3AG2 B;  2QGN A;  4JV5 B;  3ZN1 A;  1H38 A;  1ZUQ A;  5B3S B;  3L70 H;  4CZZ A;  1RPR A;  3B8M A;  3K5M A;  4LF6 O;  1H2S B;  2ODM A;  5LP6 A;  4AQY B;  3ABT A;  3APQ A;  3AG7 A;  5J2T B;  1JQ0 A;  4B3R O;  1N34 O;  1M56 B;  3RYC A;  5JH7 B;  2P5O A;  1QNM A;  1K5S A;  2VQF O;  5J2U B;  4N23 A;  4DUY B;  4FZ0 A;  5KHH A;  1TUB A;  1V9P A;  3ASO B;  4QE7 A;  3ML0 A;  4DK1 A;  1ORQ C;  1T5E A;  4IYI A;  1AR5 A;  2HHH B;  1AI5 A;  1OCO B;  4G2K A;  3MAQ A;  1XEQ A;  4E2L A;  4PDR A;  2GUZ B;  1RSO B;  3L72 H;  2ZE5 A;  2L35 A;  3DXR B;  1MG1 A;  2AHY A;  3TK1 A;  1WP7 A;  4JYB A;  2V7Q G;  1ZSP A;  1BZK A;  1FXK B;  4PI2 A;  3ABM C;  4PDM A;  4TV8 A;  5FLX N;  2Q7E A;  4O4H B;  3G6E V;  4P2Z A;  2NR5 A;  2CGN A;  2YEV A;  3W7W A;  4FLU A;  1SC5 B;  3M99 B;  4QIW F;  3ZED A;  1XI1 A;  4U3F H;  2KG7 A;  1V55 B;  3ETG A;  3FFQ A;  1KP3 A;  3BEH A;  4ZI7 B;  4HZ3 A;  4TWK A;  3K5N A;  4LF9 B;  1SKV A;  3ABK C;  5JWP A;  1OCR C;  2NN4 A;  4MTG A;  4LFB B;  4PA4 A;  3BVO A;  1LUW A;  1QU7 A;  1BQ0 A;  4N21 A;  3SJA C;  3OD4 A;  3QNE A;  4OPA A;  3FX7 A;  1YIJ V;  4DR3 B;  1WPB A;  2F1M A;  4ASU G;  2R70 A;  2UXX A;  1Q7Y W;  2FTK A;  3AG3 C;  2JVD A;  4U7O A;  4W4K A;  4DUZ B;  2EIN C;  1WPX A;  5LYJ B;  3JAL B;  3W7S A;  2E76 B;  3I56 V;  3L75 H;  4CH6 A;  2QTO A;  3LNN A;  3G4S V;  4F6R A;  2BCC H;  3H1H H;  3UO3 A;  1AB3 A;  1AI7 A;  1GN2 A;  1OCZ B;  2P22 C;  1AP6 A;  3WU2 Z;  4D7T A;  5KLV H;  3FB6 C;  2H3O A;  2LW7 A;  1KYO F;  1M93 A;  2E3C A;  1LUV A;  5LA6 B;  4YHH B;  3QO7 A;  4A5U B;  3SJC C;  1Q43 A;  3JAS A;  4DV3 B;  3O65 A;  3T1Y B;  1EFR G;  2EJ7 A;  2FYU H;  4NTW A;  1Y4M A;  4OX9 O;  1N33 B;  2HJF C;  2LFS A;  3W7T A;  1YTF D;  2E75 B;  3CME V;  1GO3 F;  4X1Y B;  2V1D A;  4B7K A;  1XRE A;  2Q7G A;  1NH2 B;  5CA0 B;  4ZOL A;  4I55 A;  1CXZ B;  3ZCC A;  2IU0 A;  2EIL B;  1V54 C;  3J80 N;  4B3M O;  3KCY A;  1EN4 A;  4JAS A;  4AIL C;  5LHG A;  4WCE V;  1XNQ B;  2P90 A;  1AR4 A;  4KL1 A;  4LFC O;  5EZY A;  5EYP B;  1PPJ H;  3LDC A;  3K0D A;  2C2A A;  4KP4 A;  2KQX A;  4WFE A;  2Y69 C;  4X20 B;  1HWY A;  3DC5 A;  2OYQ A;  4I50 B;  3APO A;  5IWA B;  1XMQ B;  3CE2 A;  1H8H G;  1GM8 A;  3JAR A;  3LNM B;  3K03 A;  1SQG A;  1MMM A;  4JAV A;  3SPJ A;  3DGE A;  2OCH A;  1IX9 A;  2V4D A;  5D5Q A;  2ZIM A;  3LDD A;  1NKD A;  4DV6 B;  1BL8 A;  2LJ2 A;  2IU3 A;  1L1F A;  2WLI A;  4UXN A;  1E1Q G;  2XTA A;  4NXM B;  2Q0O C;  1Y76 B;  4JZG A;  5IYC O;  1YXB A;  2K1E A;  1W0K G;  3O9O A;  5GON B;  2F4V O;  1FFX A;  2BTO A;  2LP7 A;  1H2M A;  4FM1 A;  2P67 A;  2UUC O;  4DV5 O;  2OCC C;  3ZJZ A;  5L3E A;  1QVF U;  4G28 B;  2F23 A;  3ICX A;  4UVB A;  1NR7 A;  4X66 O;  2YXL A;  2ZR2 A;  4MW8 A;  2F43 G;  1KQS U;  4DR1 B;  3G71 V;  2R9I A;  3MHH C;  3HKE A;  1FAF A;  3CHX A;  3QVN A;  1M90 W;  2IW5 A;  2DYS B;  2ITD C;  5CA3 A;  1B04 A;  4QNH B;  1YSC A;  2Z0A A;  4JYY A;  5C93 A;  3CRQ A;  1YJ9 V;  1OCC C;  1ZL8 B;  4DRX A;  1BGY H;  4IHJ B;  4EEQ A;  1GMG A;  4UCT A;  2ZCE A;  3I55 V;  4UCO A;  3ZRW B;  1H2K A;  3CCJ V;  3H9V A;  4JYA B;  2HVJ C;  1KMI Z;  1YI2 V;  2UU9 B;  2F66 C;  2DMX A;  4LP8 A;  1M57 B;  3K57 A;  4QE9 A;  4O2B A;  3ETQ A;  4KHP O;  4LH7 A;  5DEC A;  4X64 O;  2K9P A;  2YS8 A;  4WBN A;  1DGS A;  1XL4 A;  3CSX A;  2VRZ A;  2UUB O;  3GVM A;  3HB3 B;  1JOY A;  4ZIB A;  2BOB C;  1W0J G;  3ZX6 A;  5BZB A;  3CCR V;  4U3J A;  2WPD G;  1SS3 A;  4GUN A;  2Z3Y A;  2ZD9 A;  4X9Q A;  4NXN B;  3RVZ A;  1BE3 H;  1R3L C;  4JYC A;  2LQT A;  5E1A C;  1XNR O;  3CWB H;  3FB5 C;  2LGQ A;  2E5L O;  5ITZ A;  4DR7 O;  5C8Y A;  4RQF A;  1NI8 A;  1B06 A;  2OT5 A;  4TV9 A;  2BTQ A;  4O4J B;  1K92 A;  4ZHQ B;  1EN6 A;  1X4T A;  5HFL A;  2Y4U A;  4DV7 O;  5BMV A;  3CC2 V;  2UXD O;  3SJQ C;  1JMK C;  1ZLZ A;  5LBQ A;  2ARH A;  3SJB C;  4UCV A;  1B3Q A;  1KU9 A;  4XDL A;  4DV1 B;  2CTW A;  3STZ C;  4TQF A;  3OW2 U;  4J9Z B;  5CA1 B;  1N0J A;  3AG4 C;  4O4L A;  4LH6 A;  1SF9 A;  4GX1 A;  2H94 A;  1K5Q A;  1Q6U A;  3BRC A;  1N32 O;  2OIG A;  3L9D A;  2GTS A;  2QM4 A;  3ZHT A;  4LNU B;  1UPG A;  3E22 B;  3RYC B;  3CJH A;  2DN9 A;  4B3R B;  4DW0 A;  1MOF A;  2P7T C;  2UXB O;  1YZB A;  1TUB B;  2VQF B;  4EB6 A;  2IBZ H;  4GCZ A;  3G67 A;  1IXM A;  1PL4 A;  2X6C A;  2VQE B;  1AIL A;  1VF5 B;  1R3J C;  4GX0 A;  2OTL V;  1I08 A;  3IFX A;  3RVY A;  3AK3 A;  1H2N A;  2EIJ B;  1U96 A;  2EJR A;  1JA8 A;  4P9P A;  1MSW D;  1HNX O;  1W2B U;  3RYH B;  4Z1V A;  4JI1 O;  2JRI A;  2AZ0 A;  4JI7 O;  1SQQ H;  2OTJ V;  2AHZ A;  4K8Z A;  1M4U A;  4TV8 B;  3CEI A;  3L74 H;  5JQG A;  5KX5 B;  5CBF A;  5LHH A;  3HKB B;  2QWN B;  2HP8 A;  3JD2 A;  1L0N H;  2IJH A;  2FB5 A;  2AW9 A;  3WB0 A;  1OHH G;  2KG7 B;  1VMG A;  2YIC A;  1M1K W;  4DK0 A;  4NKG B;  4NVP A;  4DV0 O;  1K73 W;  4LF5 O;  3ZBH A;  2QKS A;  3CPW U;  1KD1 W;  4EKW A;  4J7K A;  3BHP A;  4GLX A;  2ADP A;  2W6I G;  4O2A A;  4FM0 A;  4WF9 V;  4B3T B;  3H1I H;  4CC6 A;  1I7F A;  5GTI Z;  2RDC A;  4K0K B;  1JFF B;  4X62 B;  3FKS G;  2XT9 A;  4DR6 O;  3N2K A;  1PD3 A;  3ABM B;  2Q73 A;  4PV1 B;  4R8C A;  2QM7 A;  1IVS A;  4ICG A;  1Y66 A;  4JTC B;  4KXR A;  4JI0 O;  3BAB A;  2PGG A;  1SQV H;  3X2Q C;  5JJE B;  1YDX A;  4Q20 A;  3KCX A;  5BY1 A;  2UUA O;  1KB9 F;  3KZI Z;  5KUK A;  1PNL A;  4IIJ A;  2CK3 G;  4UV8 A;  3S3X A;  1VEW A;  3GWK C;  4RUF A;  1QLN A;  2B1I A;  1KEC A;  1JX9 A;  3ABK B;  4JTA B;  1PP9 H;  1SQX H;  2WAM A;  4D6T H;  1NJI W;  1VP7 A;  4CS3 A;  1ZTE A;  2Y0I A;  1HDJ A;  1H8E G;  1N36 O;  3K5O A;  4I5S A;  5CBH A;  5LP6 C;  1EM1 A;  2ZT9 B;  4UB8 Z;  1S5L Z;  4H37 A;  4YJ3 B;  2M7W A;  1F4N A;  3AG3 B;  1X59 A;  5EBW C;  2XAS A;  3FAV A;  1F51 A;  5H6R A;  2MW2 B;  2YIB D;  2AZ2 A;  4GKJ O;  2X6B A;  3CCV V;  5BR8 B;  4XBF A;  1QR8 A;  1NU1 H;  2M6Y A;  3JSN A;  1YVW A;  5LXT A;  1YJN V;  4MTX A;  4OX9 B;  4ABM A;  3ZRS A;  3LDE A;  4MS2 A;  1EZV H;  4I55 B;  2ITC C;  1I0H A;  3B09 A;  1FJG O;  1F7Y A;  3E2E A;  2JGD B;  3UT5 B;  2JS5 A;  3QTC A;  4GYC B;  1G4Y B;  1YF2 A;  5LMU O;  2YIA A;  1Q5O A;  2N05 A;  4UCS A;  4B3M B;  4DXW A;  3C3T A;  4UUJ C;  1GN3 A;  3MDS A;  2R72 A;  3OFN G;  5KUM A;  4R50 A;  4LCU C;  2JEX A;  4H0L B;  2X0L A;  2ZE7 A;  3SYQ A;  3MHS C;  3VQX A;  1JJ2 U;  1P7G A;  1E79 G;  2WLN A;  4LFA B;  4K8X A;  3RYI A;  4F6E A;  5DM6 V;  3DC6 A;  1KC8 W;  4NB5 A;  1NBM G;  1RM1 C;  2DJV A;  2Q0A A;  1IBK B;  3TXS A;  2JK5 C;  5B1A C;  2WWW A;  3AG1 C;  3JSL A;  4NTX A;  4KUM A;  3E8B A;  3SPH A;  4DO2 A;  4B3S B;  2YXY A;  1G8M A;  2QWR B;  3E83 A;  5IYZ A;  4J42 A;  2XHB A;  3CXH F;  2ZXW C;  4FJC C;  3ASN C;  2GV9 A;  3JCZ A;  3F7V C;  3T2M A;  2F4V B;  3S3W A;  2QTS A;  4FZ1 A;  4I0X A;  1P49 A;  1AP5 A;  3E35 A;  1B6Q A;  4HNA A;  1KKC A;  2X6A A;  1S5J A;  1HW7 A;  3OM3 B;  4GT1 A;  1YHQ V;  3ZHS A;  1BQZ A;  5JCO C;  2QSA A;  4X66 B;  3HKE B;  3BFR A;  5DN6 G;  2PYJ A;  2ZKO A;  2ZDI C;  2LGW A;  2NLJ C;  1Y74 B;  2HLD G;  1CP9 A;  1WA8 A;  1L8D A;  5KA6 A;  1HNW B;  1QVG U;  1UJW B;  3OTO O;  1S0V A;  4J7J A;  3CB2 A;  1ROP A;  2GHY A;  4YY3 B;  3BPZ A;  3UM7 A;  1F4M A;  2OCC B;  2WLL A;  4O2B B;  5CB4 B;  3CD6 V;  1Q3E A;  1SES A;  1AJQ A;  4WBN B;  4RQE A;  3VBB A;  3OEE G;  4LF4 O;  1TA8 A;  5A9G A;  1NVP B;  2IJI A;  5JCO A;  3D36 C;  4JI5 O;  1HR0 O;  1HP8 A;  4LF8 O;  2WA4 A;  4JI4 O;  2UUB B;  3IAY A;  2ZDI A;  3CRR A;  2E74 B;  4U3J B;  3E8H A;  4LWS B;  1OCC B;  1PL0 A;  2GTA A;  2A7W A;  1XQ8 A;  4DR5 O;  1K9M W;  2RQ6 A;  4O4I A;  1VQO V;  3TGU H;  1R73 A;  5IYB O;  4JGS A;  2BSK A;  1WAZ A;  1LR1 A;  1R6K A;  4YXW G;  3A8T A;  4PEL A;  4UVA A;  5C8Y B;  1BCC H;  1VQL V;  1XNR B;  4TV9 B;  2BTQ B;  2DWD C;  4MVM A;  4RAI A;  3W7U A;  3U10 A;  2XAF A;  4DR7 B;  4JI2 B;  3D36 A;  4JI3 O;  5L3G A;  3U11 A;  4DYL A;  2EIM C;  3T4D A;  4XDJ A;  3J7A U;  4X1I B;  3RGB A;  1YEW A;  3NXS A;  1AI6 A;  2JJ2 G;  4I4T A;  1JVM A;  2QEX V;  1RPO A;  5J9P C;  3K59 A;  4CBC A;  4JV5 O;  1GN6 A;  1SA0 B;  1OCO C;  1VQN V;  5H9C A;  2Q6A A;  5JVD A;  2P4V A;  5EC2 C;  1Q6H A;  5DED A;  5TIS Z;  4DR2 B;  3SYO A;  3CJH B;  1WB8 A;  4JTD B;  1IXB A;  1XL6 A;  2JEU A;  4PD4 F;  2QA4 V;  2UXC B;  4X1K B;  1NT2 B;  4J7Z A;  4C7U A;  5JJJ B;  3OEH G;  2YUA A;  3OE7 G;  4RWU A;  1MZF A;  5J2T A;  4DUY O;  1CEZ A;  2ATK C;  4PA7 A;  5JH7 A;  2ZM6 B;  2RJZ A;  3K5L A;  3P32 A;  4MVQ A;  4WFF A;  1HNZ O;  5H5N A;  4B7E A;  3AG4 B;  3U0Z A;  4Z1M G;  5CBG A;  1XMO O;  4MVO A;  1JJO A;  1V55 C;  2CGO A;  1K7D A;  1THZ A;  3JAT B;  2QR4 A;  4DR4 B;  2MK3 A;  1IBL B;  3K0G A;  2GUZ A;  3WB2 A;  4FLT A;  1G1X B;  3DXR A;  4DV2 B;  3R66 A;  1IBM B;  3ZHR A;  4MTF A;  1BHB A;  1Q90 D;  4LF7 B;  2WA3 A;  4TT3 G;  3K79 A;  3EFF K;  5KHI A;  3OR6 C;  1H2L A;  1FXK A;  2XAG A;  2PF4 E;  4BW5 A;  1GK9 A;  4DV0 B;  3BA9 A;  1YJW V;  2QKC A;  1VIB A;  1I5Y A;  3ZIA G;  1J5E O;  4TUY B;  4UB6 Z;  4K35 A;  2H8P C;  1VF6 A;  2QDO A;  2PUS A;  2QWO B;  4GKK O;  3N2K B;  4TOI A;  5GW7 A;  4WFG A;  1M9N A;  3QG5 A;  4CS2 A;  1OCZ C;  4DR6 B;  1VQ5 V;  4DR3 O;  5EIB C;  1TUE B;  3JD1 A;  5LGU A;  4FK5 C;  1S72 V;  1QHT A;  3NR7 A;  2F95 B;  4DUZ O;  4R6Z A;  2W0X A;  4F4L A;  5EC1 C;  2PI4 A;  1WB7 A;  3CRC A;  3QO5 A;  2EZP A;  3E8F A;  1DK1 A;  5LYJ A;  2R9A A;  1I94 B;  3JAL A;  5EK0 A;  2NNU A;  1WJZ A;  4IT5 A;  3D3I A;  1O9H A;  5IJ9 A;  3FB8 C;  4J10 A;  5IDJ A;  1RP3 B;  3OGI B;  2ZIN A;  1TVK B;  1M5I A;  5FPR A;  3X2Q B;  1FS0 G;  2OIE A;  3GWO A;  3SPG A;  1YIT V;  3H1J H;  5IY5 C;  4OGQ B;  3THO A;  4DV3 O;  5LOV A;  1K8A W;  4JAA A;  1J95 A;  3ZN0 A;  3CCE V;  5LXT B;  2OWO A;  3OGC C;  3OR7 C;  4GKJ B;  5E79 Z;  3IGA C;  1XBL A;  2ZQM A;  3HPL C;  3RYF B;  1DLB A;  2WLJ A;  1OZ0 A;  4DV4 B;  2YDE A;  1Y6X A;  2LW1 A;  3T1C A;  4MVU A;  4X1Y A;  3K08 A;  2HEP A;  1FJG B;  1NTK H;  4R7C A;  5LP6 B;  1Q86 W;  1R3I C;  4MW3 A;  1K3E A;  2XAJ A;  1XNQ O;  2LO1 A;  4LF6 B;  3LSQ A;  2B1G A;  1N34 B;  2ZE8 A;  5AG2 A;  3B4S A;  1SRY A;  5LL6 Y;  2PTM A;  5IWA O;  1PM9 A;  5KMG A;  3LSS A;  4BAY A;  3B8N A;  4X20 A;  3WB1 A;  4BIU A;  4CC5 A;  4X65 O; 
#chains in the Genus database with same CATH homology
 3LNN A;  4ZI7 A;  4F6R A;  3UT5 B;  2JS5 A;  2ZIO A;  3QTC A;  4TQD A;  4GYC B;  2P22 C;  4D7T A;  2YIA A;  3HKD B;  1Q5O A;  4HBN A;  4CH3 A;  4UCS A;  4L8J A;  4B3M B;  2YIB A;  1M93 A;  2R72 A;  2E3C A;  5LA6 B;  4YHH B;  3SJC C;  1Q43 A;  1Z5V A;  4JI0 B;  1ZAU A;  3VQX A;  3JAS A;  4LFA B;  4IIJ B;  4DV3 B;  4K8X A;  3T1Y B;  2UUA B;  3RYI A;  5IJ0 A;  5JJN B;  4FFB B;  5CB4 A;  1N33 B;  2Q0A A;  1IBK B;  1D5A A;  4X1Y B;  2VWK A;  2Q7G A;  3JSL A;  5CA0 B;  4ZOL A;  2ZNI A;  4I55 A;  3JAW A;  4Q6G A;  3M7M X;  4B3S B;  4AIL C;  1WNS A;  1N36 B;  5IYZ A;  1XNQ B;  2XHB A;  3HKD A;  4KL1 A;  3OTO B;  2GV9 A;  4PHZ A;  5EZY A;  5EYP B;  4B08 A;  2F4V B;  4IHJ A;  3VQV A;  5LA6 A;  1P49 A;  3N2G B;  4X20 B;  4I9Q A;  4HNA A;  2OYQ A;  4I50 B;  1S5J A;  1HW7 A;  5IWA B;  1XMQ B;  3HKC B;  5JCO C;  3ZS8 C;  3JAR A;  4FFB A;  4FLW A;  4F6R B;  1SQG A;  3HKE B;  4X66 B;  2PYJ A;  4JI5 B;  2V4D A;  5D5Q A;  4LF8 B;  4JI4 B;  2ZIM A;  4DV6 B;  5CA0 A;  3T1H B;  1L8D A;  1HNW B;  4X1I A;  4DR5 B;  4NXM B;  5LMU B;  3CB2 A;  3JAS B;  5GON B;  1FFX A;  2BTO A;  3RYI B;  4FM1 A;  4YY3 B;  3A2F A;  3BPZ A;  4O2B B;  5EYP A;  5CB4 B;  1SA0 A;  1Q3E A;  4WBN B;  1O9G A;  4CS4 A;  3N2G A;  1TA8 A;  3ICX A;  2YXL A;  5JCO A;  4I50 A;  4DR1 B;  4FLV A;  4ZOL B;  4PI0 A;  3HKC A;  2UUB B;  3IAY A;  4O4J A;  1TAE A;  4U3J B;  4X1K A;  3HKE A;  3CHX A;  4I4T B;  1B04 A;  5D5P A;  5IYZ B;  1XQ8 A;  4DRX A;  2RQ6 A;  2YI8 A;  4O4I A;  5EZY B;  1XHX A;  4BW9 A;  4IHJ B;  4EEQ A;  4UCT A;  2ZCE A;  4BWA A;  4UCO A;  2F93 B;  4LFC B;  2PZS A;  5CA1 A;  4JYA B;  5GON A;  1KMI Z;  4HNA B;  2UU9 B;  2F66 C;  5FNV B;  5C8Y B;  3RFR A;  2VWJ A;  3JAT A;  1XNR B;  4TV9 B;  2BTQ B;  3JAR B;  3K57 A;  2PY5 A;  4O2B A;  3ETQ A;  3U10 A;  5K1P A;  4DR7 B;  1Q8I A;  4LH7 A;  4JI2 B;  4WBN A;  1DGS A;  4LNU A;  4UFZ A;  4YJ2 B;  3UQ8 A;  3CSX A;  3E22 A;  5KHG A;  3PN1 A;  3U11 A;  3DSQ A;  5EIB D;  4ZIB A;  4EFE A;  4X1I B;  3RGB A;  1YEW A;  4U3J A;  4I4T A;  4FLY A;  1FFX B;  1HNZ B;  1XHZ A;  4NXN B;  4LR3 A;  3K59 A;  1XMO B;  2ZNJ A;  4FM2 A;  1SA0 B;  4CH5 A;  2IM9 A;  5JVD A;  1Z5W A;  4FLZ A;  4TUY A;  4DR2 B;  3K58 A;  3RYH A;  2UUC B;  5ITZ A;  4DV5 B;  5FNV A;  5C8Y A;  2YI9 A;  4LF4 B;  4TV9 A;  2BTQ A;  4O4J B;  2UXC B;  4X1K B;  1NT2 B;  3RWR D;  4ZHQ B;  5JJJ B;  1X4T A;  5KHJ A;  1SQF A;  5KX5 A;  5J2T A;  3HKB A;  1HR0 B;  4YJ2 A;  5LMN B;  5BMV A;  4DRX B;  1JMK C;  4O4I B;  5JH7 A;  2ZM6 B;  2RJZ A;  3SJB C;  4UCV A;  3K5L A;  1KU9 A;  4DV1 B;  3U0Z A;  4TQF A;  3JAK B;  5CA1 B;  1VF7 A;  1JJO A;  4O4L A;  2PYL A;  3OTF A;  4LH6 A;  3JAT B;  5KHK A;  1J5E B;  3BRC A;  2EX3 A;  2QM4 A;  4DR4 B;  1IBL B;  3B2E E;  4GKK B;  3WB2 A;  4FLT A;  2JGU A;  4LNU B;  4DV2 B;  3E22 B;  1IBM B;  3RYC B;  1JFF A;  4KHP B;  4FVM A;  4X64 B;  1TVK A;  4LF7 B;  5KHI A;  4B3R B;  4JI3 B;  2QJ1 A;  1TUB B;  4ZHQ A;  2VQF B;  4EB6 A;  1WN7 A;  4CH4 A;  3QF7 A;  4JI8 B;  4DV0 B;  2VQE B;  3BA9 A;  5JVD B;  3RYF A;  5IJ9 B;  4JV5 B;  4TUY B;  3JAK A;  3RYH B;  5ITZ B;  2PUS A;  2CAZ C;  3N2K B;  4TOI A;  3VQW A;  4AHC A;  4K8Z A;  1M4U A;  1G6U A;  3QG5 A;  3K5M A;  4CS2 A;  2E5L B;  1H2S B;  4TV8 B;  4DR6 B;  5LP6 A;  4AQY B;  5JQG A;  5KX5 B;  5EIB C;  5J2T B;  5LOV B;  3HKB B;  5BMV B;  3RYC A;  5JH7 B;  2P5O A;  4YJ3 A;  1QHT A;  3WB0 A;  5J2U B;  4DV7 B;  2F95 B;  4DUY B;  2UXD B;  4DK0 A;  5KHH A;  4NVP A;  1TUB A;  1V9P A;  4DK1 A;  1T5E A;  4O4L B;  2HHH B;  3BHP A;  5LYJ A;  3MAQ A;  2R9A A;  4GLX A;  1I94 B;  3JAL A;  4O2A A;  4FM0 A;  4B3T B;  1O9H A;  4CC6 A;  5IJ9 A;  1I7F A;  1N32 B;  4K0K B;  1JFF B;  4X62 B;  2ZIN A;  3UT5 A;  4D7S A;  1TVK B;  3N2K A;  1M5I A;  5FPR A;  5FPO A;  4UCU A;  4PI2 A;  4TV8 A;  3BAB A;  2PGG A;  2Q7E A;  4O4H B;  4EB6 B;  5JJE B;  3THO A;  5LOV A;  5K1X A;  3SR2 C;  4FLU A;  2UXB B;  5KMG B;  5LXT B;  2OWO A;  4GKJ B;  3ZED A;  1XI1 A;  5J2U A;  4IIJ A;  2Q7H A;  3RYF B;  3FFQ A;  4DV4 B;  4ZI7 B;  4UCR A;  3VQY A;  4EFB A;  3K5N A;  4X65 B;  4LF9 B;  1SKV A;  4X1Y A;  1HNX B;  2HEP A;  1FJG B;  4FLX A;  3BAA A;  4CS3 A;  4LFB B;  4JI1 B;  5LP6 B;  1RSO A;  5JQG B;  4JI7 B;  3K5O A;  5LP6 C;  4LF6 B;  1TGO A;  4YJ3 B;  3SJA C;  4DR3 B;  1WPB A;  2F1M A;  2R70 A;  1N34 B;  3SGI A;  5IJ0 B;  4JI6 B;  2YIB D;  2JVD A;  4O4H A;  5BR8 B;  1QQC A;  4DUZ B;  3BA8 A;  2PTM A;  2KKW A;  3JSN A;  5LYJ B;  5KMG A;  5LXT A;  3JAL B;  4LF5 B;  4X20 A;  4OX9 B;  4O2A B;  3WB1 A;  4I55 B;  4CC5 A;  4CH6 A;  3JAW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...