1L8DA

Rad50 coiled-coil zn hook
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
103
structure length
103
Chain Sequence
KKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTLAKLIDRKSELERELRRIDMEIKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Rad50 zinc-hook is a structure joining Mre11 complexes in DNA recombination and repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords DNA double-strand break repair rad50 ATPase
total genus 45
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04423 Rad50_zn_hook Rad50 zinc hook motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.510 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1l8dA00
1L8DA
chains in the Genus database with same CATH superfamily
2WPDG 1JPXA 4KHPB 1Q81W 1AI6A 3ZS8C 4JZGA 4WBNB 5F2VO 3HKEA 4YY3O 5LBQA 3VBBA 1H38A 4AILC 2HVJC 3LSQA 5L3BA 2R9RB 3RYFB 1OCCC 4E2LA 2JGDA 4J7KA 5H6QA 4XDLA 4ZKIA 1Q6UA 4TT3G 5IJ9A 3N2KB 4NR1A 2Z0AA 1IBLB 3SR2C 2V4DA 2F4VB 3CCMV 4JI3O 1SQXH 2ARHA 1OJHA 3UQ8A 3QO7A 4B3MB 4PJ0Z 3AK3A 3DSQA 4BR6A 2YICA 4PA4A 3N2GB 2GSMB 3OUSA 1N8RW 2O57A 1YTFB 3VQXA 3JAWB 4MW8A 5CA3A 2HJFC 4ICGA 5L3GA 4X20A 3L9DA 3ZBHA 2Q67A 3ASNB 2Y69B 1MOFA 4X62O 5LMNO 3BRCA 3E35A 2GV9A 2AZ0A 3STLC 1WB8A 3HPLC 1YEWA 1JX9A 4PELA 4TQDA 4JI8B 3ZCCA 1XI1A 4CH4A 4B3MO 3HKBB 3W7XA 2L6LA 4X1YA 2PF4E 2ZIMA 1J5EO 2QDOA 4AQYB 2UXDO 3CCEV 4AHCA 1K5QA 2AXTZ 2MW2B 5IY5B 4RUFA 4X66O 4IHJA 5LA6B 4JI1B 1CEZA 2DOSA 4JI6O 1S3JA 3CWBH 4R7CA 3RT3C 3JASB 1MSWD 4JI7O 4DV1O 1DK1A 1KKDA 4X65B 4LF9O 4UUJC 2ETNA 4X64B 1Q82W 1DLBA 2K9PA 1JOYA 1GN3A 1WA8A 3OR6C 4Z1MG 2BSKB 3D8CA 1XBLA 4J10A 2Z3YA 1EN5A 1PP9H 1SQVH 2L35A 2N74A 4I4TB 1K34A 2WLIB 4PA6A 1QU7A 1NZ6A 2BTQA 4JI3B 2IU3A 4I55A 2Q69A 4JI7B 4KL1A 1Y76B 4ZHQA 4DR7B 2WA4A 1R1BA 4WFBV 1ZUQA 2XOKG 4DR2B 2PI5A 2X6BA 3JSLA 5GW7A 1QCEA 2Q0AA 2QWNB 1XMQB 3HKEB 4IYIA 5LOVA 1FYJA 4KUMA 2UU9B 3U11A 1MA1A 1S0VA 4DR1B 5CBGA 2ODMA 1BZKA 4G2KA 2QM4A 3IFXA 2D2CB 3W7SA 3LDEA 3MHSC 1PPJH 1QVGU 3FB5C 1GH6A 1FPOA 2OCHA 3PN1A 4JYYA 2ITCC 4GKJO 2YIBD 3ABKB 2EINB 3OGIB 5LGTA 1EBOA 3CCLV 4UCTA 2YSUB 3G4SV 2PZSA 4XDJA 2DYSB 3JATA 4MVQA 3E8GA 3JARA 5KHJA 1WN7A 4MSWC 4U3JA 4OXSA 4TUYA 4L87A 3ETEA 3TXQA 4NXMO 1QHTA 2P22C 2QE7G 3ZMZA 3ICXA 5KA6A 1V55B 2H8PC 1GK9A 3JCZA 4LF5B 3BAAA 1R6KA 1OHHG 2CE4A 2E5LO 4X1YB 4YJ3B 2ZKOA 4UB8Z 1R3LC 1XNQO 4CBCA 3BEHA 3HR0A 3CX5F 4JTAB 4DXWA 3WB1A 5CB4A 1R3IC 4NKGB 4TV8B 4A5UB 5JWPA 1MNGA 5EZYA 4UVBA 3ZHTA 1HNWB 4FK5C 4DV4O 1HNZO 1BQZA 2B9ZA 2LGWA 3HKCB 1G4YB 3SJCC 4ZBMA 2FKXA 4B7KA 4DV5O 2UUAB 2QTSA 1NKDA 3SPCA 3WB2A 3ABLC 5KLVH 3K0DA 3ABTA 1M90W 3CXHF 1P7GA 4FVMA 4LF6B 5CMUA 4C7UA 2CH7B 2IM9A 4YIOA 4GZRB 1NQTA 2XAQA 4GYCB 5IJ0A 2ZCEA 1KQSU 4JAVA 4X89A 1LR1A 3H1IH 4FZ1A 3C3TA 1B04A 1US6A 4X1KA 4MTGA 4PA9A 2IJKA 3HKCA 3E8FA 5JCOA 5BR8B 2JK5C 4CZZA 1AJNA 3AG1C 5IYCO 4LF8B 2DYRB 1GN2A 4DV5B 5L3EA 4FZ0A 4U7OA 1PKXA 2UUCO 1NS1A 2P06A 1K97A 4O4LA 1VQ6V 4MW3A 2PY5A 1SS3A 4EFEA 4GX1A 3AK1A 4K0KO 1IDSA 1NT2B 1Q3EA 3RFRA 3L74H 3FAVA 4MVMA 3G80A 4X1IB 4IYHA 3ZRSA 1P49A 2OTJV 1FFTB 2P6JA 3I56V 1NU1H 2BE3A 3UO3A 3MHHC 1VARA 3U0ZA 1YSCA 3A0HZ 3ABMC 1N33B 1BQ0A 2UUCB 2QKSA 4P30A 3T1YO 1JFFB 2YC0A 5C93A 3FYIB 1TVKB 4U3JB 1R6TA 2HLDG 4H44B 1THZA 2PI4A 1S5LZ 4GX0A 2KKWA 3A8TA 3EXAA 5EK0A 4UB6Z 4CS2A 5D5PA 3MD0A 4F6EA 3CYOA 3RYIA 2CTPA 3K58A 5LOVB 4YY3B 4UCVA 1DF4A 2ZNJA 2ATKC 4YHHO 5KA5A 4LFAO 4LFBO 3H9VA 4QNHB 5K1XA 3UT5B 1B06A 4WFHA 2QEXV 2NLJC 4I5SA 3A0RA 2F43G 1FXVA 4XBFA 2A7WA 4G27B 3CCQV 5A2QN 1YITV 1LUVA 3JD1A 1COWG 3CSXA 4WCEV 4LF8O 3CRAA 1W0JG 2UU9O 4BW9A 2EINC 4DK0A 3VQVA 1W0KG 2QWOB 3F7YC 2E76B 4X20B 4NTWA 4JYAB 1OCOC 5B5EZ 2OYQA 3IC7A 2H3OA 3EFFK 5LGUA 4FFBB 3AG3C 2EJ7A 4B7EA 3ZRWB 3K5OA 5KHGA 2ZDIC 4DR7O 4HZ3A 3AG4C 5JCOC 1SA0B 4DR2O 4MVZA 3M7MX 4DW0A 3JALA 2R9AA 3FKSG 3MDSA 5J2TB 4R50A 1G6UA 3ABLB 2V7QG 2YEVB 1W59A 4TV8A 2E74B 1NVPD 5LXTA 3J80N 2IH3C 1KB9F 3B09A 3LNNA 1AR5A 4I7ZB 3ZIAG 4H33A 4O4JA 5FLXN 2JGUA 4QE9A 5KMGA 2HG5C 4H13B 5BR8O 1JCHA 5IWAB 4Z2WA 1Y4MA 4D7SA 4HAMA 4PI2A 5ITZB 3AG4B 1F4NA 1HR0O 4ZHQB 4UV8A 3B77A 1RSOB 1VQ9V 1BL8A 5E1AC 3RBZA 2DMXA 1V55C 5EIBC 3KCYA 2HFEC 2UUBO 4PDLA 1V54B 1Y67A 2YIBA 5IWAO 4B3SB 3T1HO 4FM0A 2A0LA 3R65A 2Q7EA 1XHXA 3VQWA 3ZN0A 5AG2A 3CMAV 2IW5A 1RPRA 3CP1A 4X1KB 4D6TH 3RYCB 3RW0A 3GWOA 4PDRA 3IAYA 4CC5A 2KQXA 1T5EA 1I5YA 1XL6A 4X65O 3TJTA 2YI8A 2VWJA 4LC1A 1K5SA 4QGPA 4CC6A 4DV4B 2CTQA 2P90A 4LFCO 3ML0A 4O2AB 2ZINA 2GTAA 1AJPA 4J9ZB 3QG5A 3OE7G 3E8HA 3T4ZA 4J9YB 1JR9A 4GKKO 5H2FZ 4K0KB 1YZBA 2LFRA 2ZNIA 3OMIB 1RM1B 3RYHB 1RP3B 2KG7A 3BABA 3SYOA 2QWPB 2A9HA 3K5LA 4OX9O 4TQFA 3U10A 3HB3B 1N36O 1XEQA 2PTMA 1SA0A 2YUAA 3ZRWA 5CBFA 3LNMB 3JAKA 2ZXWB 1FJGO 4PDMA 4BW5A 2XASA 1E1QG 3MAQA 3ZMVA 4BIUA 4I9WA 2UXBO 1CXZB 2RCVA 1FAFA 4UCRA 4ZI7A 2Y4UA 4LCUC 3HKDB 1SQGA 1TA8A 4B08A 1WPBA 3ZRXA 2CUGA 3JATB 4FLVA 1Y6XA 1VQ7V 4CS4A 1RM1C 1RPOA 4FMTA 4P9PA 4H0LB 2DW4A 3JAKB 1ROPA 4YXWG 2HEPA 4UCUA 3AG3B 1HDJA 1GTOA 3A2FA 4R8CA 2YS8A 4JTCB 4WFAV 3JAWA 2BTQB 2W6IG 2OCCC 3Q4HB 4UCOA 2ZT9B 3BA8A 3D3QA 4MTOA 5JQGB 2DN9A 3E89A 5CA1A 3CD6V 1E1RG 2VS0A 3SPHA 1SRYA 4TSFG 4DR5O 4UCSA 1QVFU 1NH2B 3H1LH 5CA1B 2QM8A 2KB1A 4K35A 4WFGA 2QKCA 1N34B 4MVSA 1VF7A 3SYAA 1GKFA 3C90A 5LP6C 1SC5B 4JAAA 1VMGA 2UXNA 4DV7O 3BFRA 5EIBD 4X64O 2X6CA 2Q8VA 5KAIZ 3DXRA 3ZX6A 1GM7A 4N21A 3K9SA 4E4EA 1VEWA 2JJ1G 4DYLA 4JI4B 2R70A 2BCCH 4I50B 2B5UA 4DR4B 2QKAA 2HP8A 4O2AA 1B6QA 4ZOLB 1UPGA 1D5NA 1TVKA 4KHPO 1IXBA 5JH7B 1SQQH 4QE7A 1QLNA 3H01A 2H94A 2Q7HA 2AW9A 2FTKA 3CCJV 3T1YB 2N04A 4F4LA 1N4CA 1Q6IA 2WLJA 4ABMA 2P7TC 4HNAA 4DK1A 4P2ZA 5KMGB 2GDSA 3CJHB 5LMUO 2P67A 1MG1A 2QJ1A 5EC2C 1PL0A 4B3RO 1XOUA 4H37A 2Q9LA 2RNBA 1HNXO 2RQ6A 2P5OA 2WLLB 5KHIA 1PV0A 1OV9A 3E22A 3ZHQA 5HFMA 1M56C 1GN6A 1U96A 4NTYA 1IBMO 4IGGA 5BZBA 3WFVA 4AI8A 3WG7B 2JS5A 4Q6GA 2QSAA 1N0JA 4O4HA 5IDJA 2IJIA 1IBKB 4LNUA 1KP3A 2IH1C 4X66B 5H6RA 1VQMV 3B40A 1W2BU 3ZMSA 4JI6B 2PYLA 1QR9A 4JPRA 2JRIA 2ZE8A 3L72H 2AHZA 3G6EV 3SDLA 3RWRD 4UFZA 1FFXA 5CA0A 1AR1B 3D3IA 1URFA 2EULA 2AZ2A 1LUWA 1H2SB 2F1MA 2UUBB 3CRQA 1YDXA 3ZHUA 1I0HA 5E79Z 4PI0A 2YEVA 2ZE6A 4GT1A 1OCZC 4DW1A 1NTMH 2P4KA 1HW7A 2LJ2A 4DR3B 2GBOA 4U7NA 3FB7C 1NI8A 3RVZA 3TK1A 4HYOA 2OT5A 3WG7C 4EB6A 2OIGA 1SKVA 2F93B 4W4LA 3FB8C 3JARB 5C8YB 3K03A 1QLEC 3ASOB 1H8EG 3L70H 4PD4F 4JI2B 3ETGA 1BMFG 1YXBA 1AP5A 3JALB 1N34O 3LDDA 2NR5A 3ZRVA 1K73W 3UM7A 3QTCA 1H2LA 2QR4A 1QNMA 2EIKC 4IIJB 5JQGA 1OCOB 4NYKA 1SESA 2UXCB 5EBLC 3WU2Z 1KYOF 2R9IA 1FXKA 1EN4A 1EM1A 3AG7A 1N36B 1IBKO 2BOCC 3ZHVA 1MMMA 1IXMA 4FPPA 4W4KA 1I94O 1JVMA 3RYIB 5H5NA 2UXXA 1XQ8A 5FNVA 3OR7C 3BVOA 1QBZA 3JD4A 5LXTB 2QWQB 4OPAA 1R73A 3AG2B 1NR1A 1WAZA 2KSDA 3DC5A 1Z5WA 3QO8A 3LDCA 3JD3A 4JI5O 1TUBA 2PYJA 4PA7A 1YHQV 3D36C 3STZC 3JSNA 1N33O 2XNDG 2Y4TA 2CGNA 4EKWA 4DUYB 3B8MA 2OWOA 1OCZB 2E5LB 1S5JA 3K9AA 3TCUA 1YTFD 4KP4A 4CH6A 2EBOA 3E22B 5IJ0B 1VF6A 4DV7B 1B3QA 1R6NA 3SPJA 5ITZA 1FD9A 2FYUH 4NTXA 2V1DA 5EBWC 1Q86W 1BGYH 3CC2V 2ZM6O 4DV0B 2VQFO 2EJRA 4MVUA 1QQCA 1KBHA 1AP6A 2OCCB 1K8AW 2ZE7A 1K4DC 4MTXA 1IBLO 2JJ2G 4GKKB 1L8DA 2PUSA 2WLKA 3E83A 2CDYA 2Y0PA 5IYZB 1P7BA 4MVOA 3A0BZ 1Z2GA 4DR5B 3AG2C 1VQKV 2E3CA 3K04A 5IYZA 4B3TO 3G6BA 5B1BC 1N0NA 5CB4B 1S76D 5J2UA 4GKJB 3FAVB 4HBNA 1Y76A 2P4VA 2VWKA 3CC4V 3H1JH 5EC1C 4JTDB 3RN4A 5DM6V 2FB5A 4I4TA 2FMLA 4FLTA 2VQEB 2XAGA 1I94B 3DC6A 4DR1O 4QIWF 4DR6O 1EFRG 4TWKA 1M93A 2DWDC 3LSUA 1BE3H 4L8JA 1SQPH 4AQYO 2OIEA 1K33A 1VQLV 1JFFA 1L0LH 2X7RB 2Q4PA 1K9MW 4LFAB 1NVPB 3SGIA 1P4RA 3FFQA 4GCZA 1Q5OA 3ETDA 2ITDC 1UJWB 4I50A 3K57A 1WP8A 2BSKA 1U97A 2GHYA 2JEUA 3VOUA 2Q73A 1HNWO 2YXLA 4QPKA 4U3FH 5IYBO 3RVYA 4B3RB 2IJHA 1HWYA 4FLWA 5FL7G 5LL6Y 3CRMA 4LFCB 4UV9A 2UXDB 1AB3A 1R3JC 4CH5A 5EYPB 5LHGA 2RDCA 4I0XA 3J7AU 2Y0IA 5LHIA 4YJ3A 1AI5A 2M6YA 2F4VO 4G28B 3UCSC 4LFBB 2HR3A 3RGBA 3GB7C 5EYPA 2QTOA 1D2DA 3SPGA 4DUZB 4MVRA 5GTIZ 3SYCA 1S77D 2CTWA 3UKMA 1OZ0A 4O2BA 4CH3A 2ZR3A 3JAMN 4J42A 3CC7V 4RWUA 2ADPA 2LGQA 3CCUV 3CPWU 1F23A 2ZXWC 5J2TA 3GWKC 2Y69C 3DTUB 3JD0A 4DRXB 5JJEB 5LYJB 5KAFZ 5J2UB 4HNAB 3THOA 3UT5A 2LP7A 5KUMA 3RYFA 3G67A 4DV2B 1ZWIC 5BMVA 1H2NA 3TETA 5FNVB 1LNQA 4FFKA 3TGUH 4Z1VA 1Y66A 3K06A 2VQFB 1XHZA 3VQYA 1MZFA 2F66C 3H1HH 2ZE5A 1BHBA 4X62B 1QR8A 1IBMB 1Q90D 5IJ9B 2HJDA 1WB7A 2CAZC 2QGNA 4DV3O 1G1XB 4LWSA 1Z5VA 1MZEA 3ABUA 2EIJB 5BMVB 1WLEA 1J5EB 2FL4A 3B4SA 3BCCH 3L75H 4O2BB 4FM2A 3L71H 4J11A 3EVKA 1M57C 1BT8A 4F6RB 2EIKB 1JA8A 5CBHA 2NNUA 1S5HC 4JI1O 3BY6A 1KECA 1QLEB 1V9PA 1KD1W 1KUQA 2ZDIA 1X59A 1AI7A 1DTOA 2Q0OC 1FXKC 1YCIA 4DUZO 3SYQA 4LF7O 4LF4O 4O4JB 2XT9A 3P30A 3R66A 3K5NA 1I5XA 2RJZA 2WLMA 5B1BB 1NBMG 1H2MA 3CRRA 3N2GA 1A32A 4K8XA 1GRJA 1SZXA 4RO2A 1AROP 5B1NA 4J7JA 3ZMUA 4JI5B 3ZHSA 4QJFB 5LA6A 4YHHB 1KC8W 2XAFA 1Y74B 1JQ0A 1VQ5V 4LWSB 3JYCA 1JJ2U 4K3AA 2R72A 5KHHA 1XDCA 3ASOC 3ZMTA 1ZX3A 3HKBA 3OAAG 1M5IA 2A06H 1JMKC 5IY5C 3JD2A 3K08A 1XILA 2XAHA 2C2AA 3DGEA 5DEDA 2XHBA 1NTZH 4WBNA 1R3KC 2WA3A 3S3XA 2IJJA 2XTAA 3E2EA 2AGAA 4NVPA 2X0LA 1CPYA 5B66Z 5L3DA 3OEEG 5IT9N 2EIMC 2JGDB 3FB6C 4K8ZA 1F4MA 4FIPC 1AJQA 3BA9A 3F5WC 4O4LB 2WSSG 4LBEC 3IJ4A 1D5AA 4N23A 2F95B 1EZJA 5JVDA 3LUTB 1FXHA 4MT8A 2G38A 3J81N 2E75B 4GX5A 4DO2A 1EZVH 1VQOV 3G71V 3FX7A 4DV1B 2JS3A 2JVDA 3F7VC 3I5DA 1ZSPA 3S3WA 2RMKB 2GTSA 1FJGB 3C3SA 1KMIZ 3ETQA 3SJQC 4R6ZA 4B3SO 1SQBH 3T1HB 3K79A 4JYCA 4TV9B 1RSOA 1FKAO 3OD4A 1SZTA 4LH7A 2LW1A 5JVDB 1Q8IA 3QO5A 1Q6HA 1XUQA 2A3QA 3PJSK 4LH6A 1VF6C 4FLXA 5LMNB 5A9GA 2HHHO 1PNMA 3W7TA 5D5QA 3UO2A 3ZN1A 1HNXB 5KUKA 4BWAA 2UUAO 2JEXA 1TUEB 4EEQA 4ZI7B 5B3SC 3T1CA 3FYEB 2QWRB 1MABG 4KFMA 1YJNV 1YIJV 4JI4O 4DR4O 5JH7A 1YJ9V 2ZD9A 2CGOA 3B2EE 4DUYO 1H2KA 4GUNA 4NB5A 5KHKA 3I55V 1NTKH 5IYDO 4YJ2A 4LF4B 4RAIA 4X1IA 3N27A 1GAXA 4UVCA 3M99B 4F6RA 4DRXA 4PDVA 2QM7A 1ZL8B 3OTOO 2WLLA 2DE0X 3QNEA 1SF9A 5BY1A 2UXCO 3CHXA 3ZEDA 2QA4V 3CJHA 4JV5O 3P32A 3KG2A 3WB0A 4O4IA 5JJNB 3P3NA 1AI4A 5B3SB 4RQEA 1FXKB 3JCUZ 3OFNG 1VIBA 2WAMA 4CS3A 4JAUA 3KCXA 4JYBA 1WPXA 3M8AA 3ZHRA 3LSSA 3Q4HA 4MS2A 5BXZA 1XREA 4ASUG 1IVSA 1GO3F 3OMAB 1H8HG 1XNRB 3OUFA 5KX5A 4OX9B 2ADQB 2X6AA 3OT7A 1GMGA 4DV6O 3SPIA 4IT5A 4JI0O 2W0FC 1X4TA 1E79G 2RN9A 2CTRA 2DYRC 3NR7A 2XUMA 1TUBB 3O65A 5DN6G 4JI8O 2UXBB 3RYHA 1L1FA 4KXRA 3CRCA 1EN6A 1N32B 5LYJA 4FLZA 4EFBA 3E86A 4DV6B 5EBMC 4EB6B 2ZIOA 1PM9A 2EZPA 5HFLA 5DECA 1OCRC 4TOIA 2YIDA 2EIJC 5FPRA 4J7ZA 3W7WA 1UFIA 4GX2A 4XDKA 4PHZA 4IIJA 1ENVA 1PL4A 1M4UA 1N32O 2LQTA 3X2QB 2Q68A 4ZIBA 1KKCA 5J9PC 3OMNB 3AEIA 2CK3G 3SJAC 1M56B 3K0GA 1YJWV 1BCCH 1YI2V 2VQEO 4O4HB 3DXRB 1Q7YW 1MSDA 2DYSC 2ZR2A 2DJVA 1NJIW 4PV1B 5LGNA 5LP6A 4LNUB 1K3EA 3EHBB 2EILB 3IC9A 2DQ0A 1VQPV 4YJ2B 1TAEA 1ZLZA 2W6JG 2EX3A 4J80A 4O4IB 3CXCU 2CH7A 4UXNA 3CCSV 1BHAA 2M7WA 5GTHZ 2LO1A 2KG7B 5LHHA 5LMUB 3QF7A 4JZ2A 3AK2A 3ASNC 1I7FA 4JF3A 4X9QA 1VF5B 5H9CA 1M57B 1NR7A 4DV2O 1M1KW 2OTLV 1GN4A 2WWWA 4J41A 2LW7A 1RFYA 3CMEV 1PNKA 3CCRV 4NXNO 5LP6B 1NH2D 1GM8A 2IBZH 1L0NH 1XL4A 2B1IA 2N05A 4YIPA 5C8YA 1J95A 1HR0B 5TISZ 2XAJA 2W0XA 1XNQB 4JI2O 5EZYB 2AHYA 4WFEA 2YXHA 3CEIA 1AR4A 4LF7B 2BOBC 1O9HA 1WJZA 2NN4A 3NXSA 1XNRO 4DV3B 3RYCA 2HKOA 4DR6B 2VRZA 4JGSA 5KX5B 3D36A 4I0XB 1HNZB 5GONA 2GUZA 3K3WA 1SQFA 3E8BA 3K5MA 1BS3A 4I9QA 1DGSA 1CP9A 1VQNV 2GUZB 2IU0A 2A79B 2D3OW 1WP7A 5L3FA 1PD3A 3F5TA 4NXMB 4FJCC 1IURA 3IGAC 1BSMA 5L3CA 5CN0A 3OW2U 4TUYB 2Q7GA 3OTFA 1H2GA 2YXYA 2Z5UA 1Y74A 3ABKC 3KZIZ 1F51A 1AILA 2MK3A 4OPHA 5GONB 5B1AC 4WF9V 3OGCC 2Q6AA 1XMOO 4ZOLA 4FM1A 1K92A 3QVNA 4TV9A 3W7UA 1I08A 1KP2A 3FD9A 1ZTEA 2B1GA 2BTOA 4PA3A 1WNSA 2JIZG 1KU9A 1WA8B 3APOA 4Q20A 3T2MA 4BAYA 4QPJA 2YIAA 1F7YA 5K1PA 1FS0G 1K7DA 1ORQC 1DF5A 1V54C 1YF2A 4D7TA 2F23A 4FLYA 2DWEC 1M9NA 4NXNB 2YI9A 4B3TB 3HKDA 3B8NA 2WLHA 5IE9A 2K1EA 4RUEA 4UVAA 1JJOA 3L73H 1TGOA 3OM3B 3X2QC 4JYAO 4JI0B 5B1AB 3SYPA 4LF6O 2EZOA 2WLIA 3BHPA 1K4CC 2ZQMA 3CE2A 4OGQB 2HHHB 3OEHG 3GVMA 3APQA 4IHJB 4X8AA 3CB2A 2JDIG 2LFSA 1OCRB 4LF5O 1VQ4V 1AVMA 2Y48A 3CS5A 3ZJZA 1S72V 1ZAUA 2WLNA 1Q43A 2EIMB 1YVWA 4MTFA 4GLXA 4LR3A 4IL6Z 4X88A 3JASA 2ILMA 2HVKC 4LP8A 1PNLA 4BIOA 1O9GA 3K59A 3P3PA 4LF9B 1IZ3A 4FLUA 1VQ8V 3ABMB 1GM9A 4BIZA 5JJJB 4JASA 1SERA 1OCCB 3T4DA 3KKYA 2ZM6B 4DV0O 5CA0B 5FPOA 3SJBC 1SETA 2PGGA 3TXSA 1ZL8A 2EILC 1VP7A 4I55B 3AG1B 3BPZA 1XMOB 3OTOB 4WFFA 5B1OA 3N2KA 3CCVV 2Q5ZA 2YDEA 1XMQO 2DQ3A 1G8MA 4DR3O 4FFBA 4P9OA 4RQFA 1IX9A 1HP8A 1FFXB 4JV5B 3H1KH 3O9OA 1P84F
chains in the Genus database with same CATH topology
4FLXA 5LMNB 4KHPB 5JCOC 1SA0B 3ZS8C 3M7MX 4WBNB 5D5QA 3JALA 3HKEA 2R9AA 1N36B 4AILC 5J2TB 1G6UA 1HNXB 4BWAA 3RYFB 3RYIB 4TV8A 4EEQA 1XQ8A 5IJ9A 5FNVA 3N2KB 5LXTA 1IBLB 3LNNA 4ZI7B 3SR2C 5LXTB 2V4DA 2F4VB 4O4JA 1Z5WA 2JGUA 5KMGA 5JH7A 1TUBA 2PYJA 3UQ8A 3B2EE 3JSNA 5IWAB 4B3MB 5KHKA 4D7SA 3DSQA 4DUYB 2OWOA 4YJ2A 4LF4B 4X1IA 1S5JA 3N2GB 2E5LB 3VQXA 4F6RA 3JAWB 4CH6A 4DRXA 3E22B 4PI2A 5IJ0B 5ITZB 4DV7B 4X20A 5ITZA 4ZHQB 4DV0B 1QQCA 3CHXA 5KHGA 3BRCA 5EIBC 2GV9A 3ZEDA 1YEWA 3WB0A 4TQDA 4JI8B 4GKKB 1L8DA 2PUSA 2YIBA 1XI1A 4CH4A 4O4IA 5JJNB 3HKBB 4B3SB 5IYZB 4X1YA 4FM0A 2ZIMA 2Q7EA 1XHXA 4DR5B 4AQYB 4CS3A 2E3CA 4AHCA 3VQWA 5IYZA 5CB4B 4X1KB 4IHJA 5J2UA 4GKJB 5LA6B 3RYCB 4HBNA 4JI1B 4CC5A 3IAYA 1T5EA 1XNRB 4OX9B 5KX5A 3JASB 2VWKA 2YI8A 2VWJA 4X65B 4CC6A 4DV4B 1X4TA 4X64B 4I4TA 4FLTA 2VQEB 4O2AB 2ZINA 1I94B 3QG5A 1TUBB 1M93A 4I4TB 4K0KB 2UXBB 3RYHA 4L8JA 1N32B 2BTQA 5LYJA 4JI3B 2ZNIA 4I55A 4FLZA 1JFFA 4EFBA 3RYHB 3BABA 4DV6B 4JI7B 4KL1A 4LFAB 3K5LA 4EB6B 2ZIOA 4ZHQA 4DR7B 3SGIA 4DR2B 3FFQA 4TQFA 1Q5OA 4TOIA 3U10A 3JSLA 5FPRA 4I50A 2PTMA 1SA0A 3K57A 2Q0AA 1XMQB 3HKEB 5LOVA 4PHZA 3JAKA 2UU9B 4IIJA 3U11A 2YXLA 4DR1B 1M4UA 4B3RB 2QM4A 3MAQA 4ZIBA 4FLWA 3SJAC 4UCRA 4ZI7A 4LFCB 3HKDB 4O4HB 2UXDB 3PN1A 4CH5A 1SQGA 1TA8A 5EYPB 2YIBD 4B08A 4YJ3A 5LP6A 4LNUB 1WPBA 4FLVA 3JATB 4LFBB 4UCTA 3RGBA 2PZSA 4CS4A 5EYPA 3JATA 4DUZB 4YJ2B 1TAEA 3JAKB 4O2BA 2HEPA 3JARA 4CH3A 5KHJA 1WN7A 4U3JA 2EX3A 4O4IB 4UCUA 4TUYA 3A2FA 5LMUB 1QHTA 3QF7A 2P22C 1I7FA 5J2TA 3JAWA 3ICXA 4DRXB 5JJEB 2BTQB 5LYJB 5J2UB 4UCOA 3BA8A 4HNAB 3THOA 3UT5A 5JQGB 5CA1A 3RYFA 4DV2B 4LF5B 5BMVA 3BAAA 4UCSA 5FNVB 4X1YB 4YJ3B 5LP6B 5CA1B 2VQFB 1N34B 1VF7A 1XHZA 3VQYA 2F66C 5LP6C 5C8YA 3WB1A 1HR0B 1XNQB 5CB4A 5EZYB 4TV8B 5EIBD 4LF7B 4X62B 5EZYA 1O9HA 4DV3B 1IBMB 1HNWB 5IJ9B 3RYCA 4DR6B 2CAZC 3HKCB 5KX5B 1HNZB 1Z5VA 3SJCC 4JI4B 2R70A 5BMVB 5GONA 4I50B 2UUAB 4DR4B 1SQFA 1J5EB 3K5MA 4O2AA 4I9QA 4O2BB 4FM2A 3WB2A 4ZOLB 1DGSA 1TVKA 4F6RB 5JH7B 4FVMA 4LF6B 2IM9A 4GYCB 5IJ0A 4NXMB 1V9PA 2Q7HA 2ZCEA 4TUYB 3T1YB 1B04A 4X1KA 3HKCA 5JCOA 2Q7GA 5BR8B 3OTFA 4HNAA 4LF8B 4DK1A 4DV5B 5KMGB 5GONB 4O4JB 3K5NA 4ZOLA 4O4LA 2QJ1A 2RJZA 4FM1A 4TV9A 3N2GA 4K8XA 2PY5A 2BTOA 1WNSA 4EFEA 2RQ6A 1KU9A 2P5OA 1NT2B 2YIAA 1Q3EA 5KHIA 3E22A 5K1PA 4JI5B 3RFRA 5LA6A 4YHHB 4X1IB 4D7TA 4FLYA 1P49A 2JS5A 2R72A 4Q6GA 5KHHA 4NXNB 3U0ZA 2YI9A 4B3TB 3HKDA 4O4HA 1N33B 1IBKB 4LNUA 2UUCB 4X66B 3HKBA 1JJOA 1M5IA 1JFFB 1TGOA 1JMKC 2PYLA 4JI6B 2UXCB 1TVKB 4U3JB 4JI0B 2XHBA 4WBNA 3RWRD 4UFZA 3BHPA 1FFXA 5CA0A 4NVPA 1H2SB 2KKWA 4CS2A 2F1MA 2UUBB 2HHHB 5D5PA 4IHJB 4PI0A 3RYIA 3CB2A 3K58A 5LOVB 4YY3B 4UCVA 2ZNJA 4K8ZA 1HW7A 1ZAUA 4DR3B 3BA9A 1Q43A 4O4LB 5K1XA 4GLXA 4LR3A 3UT5B 3JASA 4EB6A 1D5AA 2F95B 1SKVA 2F93B 1O9GA 3K59A 5JVDA 4LF9B 3JARB 4FLUA 5C8YB 3CSXA 5JJJB 2ZM6B 5CA0B 5FPOA 3SJBC 4JI2B 4BW9A 4DV1B 2JVDA 2PGGA 4I55B 4DK0A 3VQVA 3BPZA 1XMOB 3OTOB 3N2KA 3JALB 4X20B 1FJGB 1KMIZ 4JYAB 3ETQA 2OYQA 4FFBB 3T1HB 3QTCA 4TV9B 1RSOA 4FFBA 4LH7A 1FFXB 5JVDB 4JV5B 5JQGA 1Q8IA 4IIJB 4LH6A 3K5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8D A; 
#chains in the Genus database with same CATH topology
 2WPD G;  1JPX A;  4KHP B;  1Q81 W;  1AI6 A;  3ZS8 C;  4JZG A;  4WBN B;  5F2V O;  3HKE A;  4YY3 O;  5LBQ A;  3VBB A;  1H38 A;  4AIL C;  2HVJ C;  3LSQ A;  5L3B A;  2R9R B;  3RYF B;  1OCC C;  4E2L A;  2JGD A;  4J7K A;  5H6Q A;  4XDL A;  4ZKI A;  1Q6U A;  4TT3 G;  5IJ9 A;  3N2K B;  4NR1 A;  2Z0A A;  1IBL B;  3SR2 C;  2V4D A;  2F4V B;  3CCM V;  4JI3 O;  1SQX H;  2ARH A;  1OJH A;  3UQ8 A;  3QO7 A;  4B3M B;  4PJ0 Z;  3AK3 A;  3DSQ A;  4BR6 A;  2YIC A;  4PA4 A;  3N2G B;  2GSM B;  3OUS A;  1N8R W;  2O57 A;  1YTF B;  3VQX A;  3JAW B;  4MW8 A;  5CA3 A;  2HJF C;  4ICG A;  5L3G A;  4X20 A;  3L9D A;  3ZBH A;  2Q67 A;  3ASN B;  2Y69 B;  1MOF A;  4X62 O;  5LMN O;  3BRC A;  3E35 A;  2GV9 A;  2AZ0 A;  3STL C;  1WB8 A;  3HPL C;  1YEW A;  1JX9 A;  4PEL A;  4TQD A;  4JI8 B;  3ZCC A;  1XI1 A;  4CH4 A;  4B3M O;  3HKB B;  3W7X A;  2L6L A;  4X1Y A;  2PF4 E;  2ZIM A;  1J5E O;  2QDO A;  4AQY B;  2UXD O;  3CCE V;  4AHC A;  1K5Q A;  2AXT Z;  2MW2 B;  5IY5 B;  4RUF A;  4X66 O;  4IHJ A;  5LA6 B;  4JI1 B;  1CEZ A;  2DOS A;  4JI6 O;  1S3J A;  3CWB H;  4R7C A;  3RT3 C;  3JAS B;  1MSW D;  4JI7 O;  4DV1 O;  1DK1 A;  1KKD A;  4X65 B;  4LF9 O;  4UUJ C;  2ETN A;  4X64 B;  1Q82 W;  1DLB A;  2K9P A;  1JOY A;  1GN3 A;  1WA8 A;  3OR6 C;  4Z1M G;  2BSK B;  3D8C A;  1XBL A;  4J10 A;  2Z3Y A;  1EN5 A;  1PP9 H;  1SQV H;  2L35 A;  2N74 A;  4I4T B;  1K34 A;  2WLI B;  4PA6 A;  1QU7 A;  1NZ6 A;  2BTQ A;  4JI3 B;  2IU3 A;  4I55 A;  2Q69 A;  4JI7 B;  4KL1 A;  1Y76 B;  4ZHQ A;  4DR7 B;  2WA4 A;  1R1B A;  4WFB V;  1ZUQ A;  2XOK G;  4DR2 B;  2PI5 A;  2X6B A;  3JSL A;  5GW7 A;  1QCE A;  2Q0A A;  2QWN B;  1XMQ B;  3HKE B;  4IYI A;  5LOV A;  1FYJ A;  4KUM A;  2UU9 B;  3U11 A;  1MA1 A;  1S0V A;  4DR1 B;  5CBG A;  2ODM A;  1BZK A;  4G2K A;  2QM4 A;  3IFX A;  2D2C B;  3W7S A;  3LDE A;  3MHS C;  1PPJ H;  1QVG U;  3FB5 C;  1GH6 A;  1FPO A;  2OCH A;  3PN1 A;  4JYY A;  2ITC C;  4GKJ O;  2YIB D;  3ABK B;  2EIN B;  3OGI B;  5LGT A;  1EBO A;  3CCL V;  4UCT A;  2YSU B;  3G4S V;  2PZS A;  4XDJ A;  2DYS B;  3JAT A;  4MVQ A;  3E8G A;  3JAR A;  5KHJ A;  1WN7 A;  4MSW C;  4U3J A;  4OXS A;  4TUY A;  4L87 A;  3ETE A;  3TXQ A;  4NXM O;  1QHT A;  2P22 C;  2QE7 G;  3ZMZ A;  3ICX A;  5KA6 A;  1V55 B;  2H8P C;  1GK9 A;  3JCZ A;  4LF5 B;  3BAA A;  1R6K A;  1OHH G;  2CE4 A;  2E5L O;  4X1Y B;  4YJ3 B;  2ZKO A;  4UB8 Z;  1R3L C;  1XNQ O;  4CBC A;  3BEH A;  3HR0 A;  3CX5 F;  4JTA B;  4DXW A;  3WB1 A;  5CB4 A;  1R3I C;  4NKG B;  4TV8 B;  4A5U B;  5JWP A;  1MNG A;  5EZY A;  4UVB A;  3ZHT A;  1HNW B;  4FK5 C;  4DV4 O;  1HNZ O;  1BQZ A;  2B9Z A;  2LGW A;  3HKC B;  1G4Y B;  3SJC C;  4ZBM A;  2FKX A;  4B7K A;  4DV5 O;  2UUA B;  2QTS A;  1NKD A;  3SPC A;  3WB2 A;  3ABL C;  5KLV H;  3K0D A;  3ABT A;  1M90 W;  3CXH F;  1P7G A;  4FVM A;  4LF6 B;  5CMU A;  4C7U A;  2CH7 B;  2IM9 A;  4YIO A;  4GZR B;  1NQT A;  2XAQ A;  4GYC B;  5IJ0 A;  2ZCE A;  1KQS U;  4JAV A;  4X89 A;  1LR1 A;  3H1I H;  4FZ1 A;  3C3T A;  1B04 A;  1US6 A;  4X1K A;  4MTG A;  4PA9 A;  2IJK A;  3HKC A;  3E8F A;  5JCO A;  5BR8 B;  2JK5 C;  4CZZ A;  1AJN A;  3AG1 C;  5IYC O;  4LF8 B;  2DYR B;  1GN2 A;  4DV5 B;  5L3E A;  4FZ0 A;  4U7O A;  1PKX A;  2UUC O;  1NS1 A;  2P06 A;  1K97 A;  4O4L A;  1VQ6 V;  4MW3 A;  2PY5 A;  1SS3 A;  4EFE A;  4GX1 A;  3AK1 A;  4K0K O;  1IDS A;  1NT2 B;  1Q3E A;  3RFR A;  3L74 H;  3FAV A;  4MVM A;  3G80 A;  4X1I B;  4IYH A;  3ZRS A;  1P49 A;  2OTJ V;  1FFT B;  2P6J A;  3I56 V;  1NU1 H;  2BE3 A;  3UO3 A;  3MHH C;  1VAR A;  3U0Z A;  1YSC A;  3A0H Z;  3ABM C;  1N33 B;  1BQ0 A;  2UUC B;  2QKS A;  4P30 A;  3T1Y O;  1JFF B;  2YC0 A;  5C93 A;  3FYI B;  1TVK B;  4U3J B;  1R6T A;  2HLD G;  4H44 B;  1THZ A;  2PI4 A;  1S5L Z;  4GX0 A;  2KKW A;  3A8T A;  3EXA A;  5EK0 A;  4UB6 Z;  4CS2 A;  5D5P A;  3MD0 A;  4F6E A;  3CYO A;  3RYI A;  2CTP A;  3K58 A;  5LOV B;  4YY3 B;  4UCV A;  1DF4 A;  2ZNJ A;  2ATK C;  4YHH O;  5KA5 A;  4LFA O;  4LFB O;  3H9V A;  4QNH B;  5K1X A;  3UT5 B;  1B06 A;  4WFH A;  2QEX V;  2NLJ C;  4I5S A;  3A0R A;  2F43 G;  1FXV A;  4XBF A;  2A7W A;  4G27 B;  3CCQ V;  5A2Q N;  1YIT V;  1LUV A;  3JD1 A;  1COW G;  3CSX A;  4WCE V;  4LF8 O;  3CRA A;  1W0J G;  2UU9 O;  4BW9 A;  2EIN C;  4DK0 A;  3VQV A;  1W0K G;  2QWO B;  3F7Y C;  2E76 B;  4X20 B;  4NTW A;  4JYA B;  1OCO C;  5B5E Z;  2OYQ A;  3IC7 A;  2H3O A;  3EFF K;  5LGU A;  4FFB B;  3AG3 C;  2EJ7 A;  4B7E A;  3ZRW B;  3K5O A;  5KHG A;  2ZDI C;  4DR7 O;  4HZ3 A;  3AG4 C;  5JCO C;  1SA0 B;  4DR2 O;  4MVZ A;  3M7M X;  4DW0 A;  3JAL A;  2R9A A;  3FKS G;  3MDS A;  5J2T B;  4R50 A;  1G6U A;  3ABL B;  2V7Q G;  2YEV B;  1W59 A;  4TV8 A;  2E74 B;  1NVP D;  5LXT A;  3J80 N;  2IH3 C;  1KB9 F;  3B09 A;  3LNN A;  1AR5 A;  4I7Z B;  3ZIA G;  4H33 A;  4O4J A;  5FLX N;  2JGU A;  4QE9 A;  5KMG A;  2HG5 C;  4H13 B;  5BR8 O;  1JCH A;  5IWA B;  4Z2W A;  1Y4M A;  4D7S A;  4HAM A;  4PI2 A;  5ITZ B;  3AG4 B;  1F4N A;  1HR0 O;  4ZHQ B;  4UV8 A;  3B77 A;  1RSO B;  1VQ9 V;  1BL8 A;  5E1A C;  3RBZ A;  2DMX A;  1V55 C;  5EIB C;  3KCY A;  2HFE C;  2UUB O;  4PDL A;  1V54 B;  1Y67 A;  2YIB A;  5IWA O;  4B3S B;  3T1H O;  4FM0 A;  2A0L A;  3R65 A;  2Q7E A;  1XHX A;  3VQW A;  3ZN0 A;  5AG2 A;  3CMA V;  2IW5 A;  1RPR A;  3CP1 A;  4X1K B;  4D6T H;  3RYC B;  3RW0 A;  3GWO A;  4PDR A;  3IAY A;  4CC5 A;  2KQX A;  1T5E A;  1I5Y A;  1XL6 A;  4X65 O;  3TJT A;  2YI8 A;  2VWJ A;  4LC1 A;  1K5S A;  4QGP A;  4CC6 A;  4DV4 B;  2CTQ A;  2P90 A;  4LFC O;  3ML0 A;  4O2A B;  2ZIN A;  2GTA A;  1AJP A;  4J9Z B;  3QG5 A;  3OE7 G;  3E8H A;  3T4Z A;  4J9Y B;  1JR9 A;  4GKK O;  5H2F Z;  4K0K B;  1YZB A;  2LFR A;  2ZNI A;  3OMI B;  1RM1 B;  3RYH B;  1RP3 B;  2KG7 A;  3BAB A;  3SYO A;  2QWP B;  2A9H A;  3K5L A;  4OX9 O;  4TQF A;  3U10 A;  3HB3 B;  1N36 O;  1XEQ A;  2PTM A;  1SA0 A;  2YUA A;  3ZRW A;  5CBF A;  3LNM B;  3JAK A;  2ZXW B;  1FJG O;  4PDM A;  4BW5 A;  2XAS A;  1E1Q G;  3MAQ A;  3ZMV A;  4BIU A;  4I9W A;  2UXB O;  1CXZ B;  2RCV A;  1FAF A;  4UCR A;  4ZI7 A;  2Y4U A;  4LCU C;  3HKD B;  1SQG A;  1TA8 A;  4B08 A;  1WPB A;  3ZRX A;  2CUG A;  3JAT B;  4FLV A;  1Y6X A;  1VQ7 V;  4CS4 A;  1RM1 C;  1RPO A;  4FMT A;  4P9P A;  4H0L B;  2DW4 A;  3JAK B;  1ROP A;  4YXW G;  2HEP A;  4UCU A;  3AG3 B;  1HDJ A;  1GTO A;  3A2F A;  4R8C A;  2YS8 A;  4JTC B;  4WFA V;  3JAW A;  2BTQ B;  2W6I G;  2OCC C;  3Q4H B;  4UCO A;  2ZT9 B;  3BA8 A;  3D3Q A;  4MTO A;  5JQG B;  2DN9 A;  3E89 A;  5CA1 A;  3CD6 V;  1E1R G;  2VS0 A;  3SPH A;  1SRY A;  4TSF G;  4DR5 O;  4UCS A;  1QVF U;  1NH2 B;  3H1L H;  5CA1 B;  2QM8 A;  2KB1 A;  4K35 A;  4WFG A;  2QKC A;  1N34 B;  4MVS A;  1VF7 A;  3SYA A;  1GKF A;  3C90 A;  5LP6 C;  1SC5 B;  4JAA A;  1VMG A;  2UXN A;  4DV7 O;  3BFR A;  5EIB D;  4X64 O;  2X6C A;  2Q8V A;  5KAI Z;  3DXR A;  3ZX6 A;  1GM7 A;  4N21 A;  3K9S A;  4E4E A;  1VEW A;  2JJ1 G;  4DYL A;  4JI4 B;  2R70 A;  2BCC H;  4I50 B;  2B5U A;  4DR4 B;  2QKA A;  2HP8 A;  4O2A A;  1B6Q A;  4ZOL B;  1UPG A;  1D5N A;  1TVK A;  4KHP O;  1IXB A;  5JH7 B;  1SQQ H;  4QE7 A;  1QLN A;  3H01 A;  2H94 A;  2Q7H A;  2AW9 A;  2FTK A;  3CCJ V;  3T1Y B;  2N04 A;  4F4L A;  1N4C A;  1Q6I A;  2WLJ A;  4ABM A;  2P7T C;  4HNA A;  4DK1 A;  4P2Z A;  5KMG B;  2GDS A;  3CJH B;  5LMU O;  2P67 A;  1MG1 A;  2QJ1 A;  5EC2 C;  1PL0 A;  4B3R O;  1XOU A;  4H37 A;  2Q9L A;  2RNB A;  1HNX O;  2RQ6 A;  2P5O A;  2WLL B;  5KHI A;  1PV0 A;  1OV9 A;  3E22 A;  3ZHQ A;  5HFM A;  1M56 C;  1GN6 A;  1U96 A;  4NTY A;  1IBM O;  4IGG A;  5BZB A;  3WFV A;  4AI8 A;  3WG7 B;  2JS5 A;  4Q6G A;  2QSA A;  1N0J A;  4O4H A;  5IDJ A;  2IJI A;  1IBK B;  4LNU A;  1KP3 A;  2IH1 C;  4X66 B;  5H6R A;  1VQM V;  3B40 A;  1W2B U;  3ZMS A;  4JI6 B;  2PYL A;  1QR9 A;  4JPR A;  2JRI A;  2ZE8 A;  3L72 H;  2AHZ A;  3G6E V;  3SDL A;  3RWR D;  4UFZ A;  1FFX A;  5CA0 A;  1AR1 B;  3D3I A;  1URF A;  2EUL A;  2AZ2 A;  1LUW A;  1H2S B;  2F1M A;  2UUB B;  3CRQ A;  1YDX A;  3ZHU A;  1I0H A;  5E79 Z;  4PI0 A;  2YEV A;  2ZE6 A;  4GT1 A;  1OCZ C;  4DW1 A;  1NTM H;  2P4K A;  1HW7 A;  2LJ2 A;  4DR3 B;  2GBO A;  4U7N A;  3FB7 C;  1NI8 A;  3RVZ A;  3TK1 A;  4HYO A;  2OT5 A;  3WG7 C;  4EB6 A;  2OIG A;  1SKV A;  2F93 B;  4W4L A;  3FB8 C;  3JAR B;  5C8Y B;  3K03 A;  1QLE C;  3ASO B;  1H8E G;  3L70 H;  4PD4 F;  4JI2 B;  3ETG A;  1BMF G;  1YXB A;  1AP5 A;  3JAL B;  1N34 O;  3LDD A;  2NR5 A;  3ZRV A;  1K73 W;  3UM7 A;  3QTC A;  1H2L A;  2QR4 A;  1QNM A;  2EIK C;  4IIJ B;  5JQG A;  1OCO B;  4NYK A;  1SES A;  2UXC B;  5EBL C;  3WU2 Z;  1KYO F;  2R9I A;  1FXK A;  1EN4 A;  1EM1 A;  3AG7 A;  1N36 B;  1IBK O;  2BOC C;  3ZHV A;  1MMM A;  1IXM A;  4FPP A;  4W4K A;  1I94 O;  1JVM A;  3RYI B;  5H5N A;  2UXX A;  1XQ8 A;  5FNV A;  3OR7 C;  3BVO A;  1QBZ A;  3JD4 A;  5LXT B;  2QWQ B;  4OPA A;  1R73 A;  3AG2 B;  1NR1 A;  1WAZ A;  2KSD A;  3DC5 A;  1Z5W A;  3QO8 A;  3LDC A;  3JD3 A;  4JI5 O;  1TUB A;  2PYJ A;  4PA7 A;  1YHQ V;  3D36 C;  3STZ C;  3JSN A;  1N33 O;  2XND G;  2Y4T A;  2CGN A;  4EKW A;  4DUY B;  3B8M A;  2OWO A;  1OCZ B;  2E5L B;  1S5J A;  3K9A A;  3TCU A;  1YTF D;  4KP4 A;  4CH6 A;  2EBO A;  3E22 B;  5IJ0 B;  1VF6 A;  4DV7 B;  1B3Q A;  1R6N A;  3SPJ A;  5ITZ A;  1FD9 A;  2FYU H;  4NTX A;  2V1D A;  5EBW C;  1Q86 W;  1BGY H;  3CC2 V;  2ZM6 O;  4DV0 B;  2VQF O;  2EJR A;  4MVU A;  1QQC A;  1KBH A;  1AP6 A;  2OCC B;  1K8A W;  2ZE7 A;  1K4D C;  4MTX A;  1IBL O;  2JJ2 G;  4GKK B;  1L8D A;  2PUS A;  2WLK A;  3E83 A;  2CDY A;  2Y0P A;  5IYZ B;  1P7B A;  4MVO A;  3A0B Z;  1Z2G A;  4DR5 B;  3AG2 C;  1VQK V;  2E3C A;  3K04 A;  5IYZ A;  4B3T O;  3G6B A;  5B1B C;  1N0N A;  5CB4 B;  1S76 D;  5J2U A;  4GKJ B;  3FAV B;  4HBN A;  1Y76 A;  2P4V A;  2VWK A;  3CC4 V;  3H1J H;  5EC1 C;  4JTD B;  3RN4 A;  5DM6 V;  2FB5 A;  4I4T A;  2FML A;  4FLT A;  2VQE B;  2XAG A;  1I94 B;  3DC6 A;  4DR1 O;  4QIW F;  4DR6 O;  1EFR G;  4TWK A;  1M93 A;  2DWD C;  3LSU A;  1BE3 H;  4L8J A;  1SQP H;  4AQY O;  2OIE A;  1K33 A;  1VQL V;  1JFF A;  1L0L H;  2X7R B;  2Q4P A;  1K9M W;  4LFA B;  1NVP B;  3SGI A;  1P4R A;  3FFQ A;  4GCZ A;  1Q5O A;  3ETD A;  2ITD C;  1UJW B;  4I50 A;  3K57 A;  1WP8 A;  2BSK A;  1U97 A;  2GHY A;  2JEU A;  3VOU A;  2Q73 A;  1HNW O;  2YXL A;  4QPK A;  4U3F H;  5IYB O;  3RVY A;  4B3R B;  2IJH A;  1HWY A;  4FLW A;  5FL7 G;  5LL6 Y;  3CRM A;  4LFC B;  4UV9 A;  2UXD B;  1AB3 A;  1R3J C;  4CH5 A;  5EYP B;  5LHG A;  2RDC A;  4I0X A;  3J7A U;  2Y0I A;  5LHI A;  4YJ3 A;  1AI5 A;  2M6Y A;  2F4V O;  4G28 B;  3UCS C;  4LFB B;  2HR3 A;  3RGB A;  3GB7 C;  5EYP A;  2QTO A;  1D2D A;  3SPG A;  4DUZ B;  4MVR A;  5GTI Z;  3SYC A;  1S77 D;  2CTW A;  3UKM A;  1OZ0 A;  4O2B A;  4CH3 A;  2ZR3 A;  3JAM N;  4J42 A;  3CC7 V;  4RWU A;  2ADP A;  2LGQ A;  3CCU V;  3CPW U;  1F23 A;  2ZXW C;  5J2T A;  3GWK C;  2Y69 C;  3DTU B;  3JD0 A;  4DRX B;  5JJE B;  5LYJ B;  5KAF Z;  5J2U B;  4HNA B;  3THO A;  3UT5 A;  2LP7 A;  5KUM A;  3RYF A;  3G67 A;  4DV2 B;  1ZWI C;  5BMV A;  1H2N A;  3TET A;  5FNV B;  1LNQ A;  4FFK A;  3TGU H;  4Z1V A;  1Y66 A;  3K06 A;  2VQF B;  1XHZ A;  3VQY A;  1MZF A;  2F66 C;  3H1H H;  2ZE5 A;  1BHB A;  4X62 B;  1QR8 A;  1IBM B;  1Q90 D;  5IJ9 B;  2HJD A;  1WB7 A;  2CAZ C;  2QGN A;  4DV3 O;  1G1X B;  4LWS A;  1Z5V A;  1MZE A;  3ABU A;  2EIJ B;  5BMV B;  1WLE A;  1J5E B;  2FL4 A;  3B4S A;  3BCC H;  3L75 H;  4O2B B;  4FM2 A;  3L71 H;  4J11 A;  3EVK A;  1M57 C;  1BT8 A;  4F6R B;  2EIK B;  1JA8 A;  5CBH A;  2NNU A;  1S5H C;  4JI1 O;  3BY6 A;  1KEC A;  1QLE B;  1V9P A;  1KD1 W;  1KUQ A;  2ZDI A;  1X59 A;  1AI7 A;  1DTO A;  2Q0O C;  1FXK C;  1YCI A;  4DUZ O;  3SYQ A;  4LF7 O;  4LF4 O;  4O4J B;  2XT9 A;  3P30 A;  3R66 A;  3K5N A;  1I5X A;  2RJZ A;  2WLM A;  5B1B B;  1NBM G;  1H2M A;  3CRR A;  3N2G A;  1A32 A;  4K8X A;  1GRJ A;  1SZX A;  4RO2 A;  1ARO P;  5B1N A;  4J7J A;  3ZMU A;  4JI5 B;  3ZHS A;  4QJF B;  5LA6 A;  4YHH B;  1KC8 W;  2XAF A;  1Y74 B;  1JQ0 A;  1VQ5 V;  4LWS B;  3JYC A;  1JJ2 U;  4K3A A;  2R72 A;  5KHH A;  1XDC A;  3ASO C;  3ZMT A;  1ZX3 A;  3HKB A;  3OAA G;  1M5I A;  2A06 H;  1JMK C;  5IY5 C;  3JD2 A;  3K08 A;  1XIL A;  2XAH A;  2C2A A;  3DGE A;  5DED A;  2XHB A;  1NTZ H;  4WBN A;  1R3K C;  2WA3 A;  3S3X A;  2IJJ A;  2XTA A;  3E2E A;  2AGA A;  4NVP A;  2X0L A;  1CPY A;  5B66 Z;  5L3D A;  3OEE G;  5IT9 N;  2EIM C;  2JGD B;  3FB6 C;  4K8Z A;  1F4M A;  4FIP C;  1AJQ A;  3BA9 A;  3F5W C;  4O4L B;  2WSS G;  4LBE C;  3IJ4 A;  1D5A A;  4N23 A;  2F95 B;  1EZJ A;  5JVD A;  3LUT B;  1FXH A;  4MT8 A;  2G38 A;  3J81 N;  2E75 B;  4GX5 A;  4DO2 A;  1EZV H;  1VQO V;  3G71 V;  3FX7 A;  4DV1 B;  2JS3 A;  2JVD A;  3F7V C;  3I5D A;  1ZSP A;  3S3W A;  2RMK B;  2GTS A;  1FJG B;  3C3S A;  1KMI Z;  3ETQ A;  3SJQ C;  4R6Z A;  4B3S O;  1SQB H;  3T1H B;  3K79 A;  4JYC A;  4TV9 B;  1RSO A;  1FKA O;  3OD4 A;  1SZT A;  4LH7 A;  2LW1 A;  5JVD B;  1Q8I A;  3QO5 A;  1Q6H A;  1XUQ A;  2A3Q A;  3PJS K;  4LH6 A;  1VF6 C;  4FLX A;  5LMN B;  5A9G A;  2HHH O;  1PNM A;  3W7T A;  5D5Q A;  3UO2 A;  3ZN1 A;  1HNX B;  5KUK A;  4BWA A;  2UUA O;  2JEX A;  1TUE B;  4EEQ A;  4ZI7 B;  5B3S C;  3T1C A;  3FYE B;  2QWR B;  1MAB G;  4KFM A;  1YJN V;  1YIJ V;  4JI4 O;  4DR4 O;  5JH7 A;  1YJ9 V;  2ZD9 A;  2CGO A;  3B2E E;  4DUY O;  1H2K A;  4GUN A;  4NB5 A;  5KHK A;  3I55 V;  1NTK H;  5IYD O;  4YJ2 A;  4LF4 B;  4RAI A;  4X1I A;  3N27 A;  1GAX A;  4UVC A;  3M99 B;  4F6R A;  4DRX A;  4PDV A;  2QM7 A;  1ZL8 B;  3OTO O;  2WLL A;  2DE0 X;  3QNE A;  1SF9 A;  5BY1 A;  2UXC O;  3CHX A;  3ZED A;  2QA4 V;  3CJH A;  4JV5 O;  3P32 A;  3KG2 A;  3WB0 A;  4O4I A;  5JJN B;  3P3N A;  1AI4 A;  5B3S B;  4RQE A;  1FXK B;  3JCU Z;  3OFN G;  1VIB A;  2WAM A;  4CS3 A;  4JAU A;  3KCX A;  4JYB A;  1WPX A;  3M8A A;  3ZHR A;  3LSS A;  3Q4H A;  4MS2 A;  5BXZ A;  1XRE A;  4ASU G;  1IVS A;  1GO3 F;  3OMA B;  1H8H G;  1XNR B;  3OUF A;  5KX5 A;  4OX9 B;  2ADQ B;  2X6A A;  3OT7 A;  1GMG A;  4DV6 O;  3SPI A;  4IT5 A;  4JI0 O;  2W0F C;  1X4T A;  1E79 G;  2RN9 A;  2CTR A;  2DYR C;  3NR7 A;  2XUM A;  1TUB B;  3O65 A;  5DN6 G;  4JI8 O;  2UXB B;  3RYH A;  1L1F A;  4KXR A;  3CRC A;  1EN6 A;  1N32 B;  5LYJ A;  4FLZ A;  4EFB A;  3E86 A;  4DV6 B;  5EBM C;  4EB6 B;  2ZIO A;  1PM9 A;  2EZP A;  5HFL A;  5DEC A;  1OCR C;  4TOI A;  2YID A;  2EIJ C;  5FPR A;  4J7Z A;  3W7W A;  1UFI A;  4GX2 A;  4XDK A;  4PHZ A;  4IIJ A;  1ENV A;  1PL4 A;  1M4U A;  1N32 O;  2LQT A;  3X2Q B;  2Q68 A;  4ZIB A;  1KKC A;  5J9P C;  3OMN B;  3AEI A;  2CK3 G;  3SJA C;  1M56 B;  3K0G A;  1YJW V;  1BCC H;  1YI2 V;  2VQE O;  4O4H B;  3DXR B;  1Q7Y W;  1MSD A;  2DYS C;  2ZR2 A;  2DJV A;  1NJI W;  4PV1 B;  5LGN A;  5LP6 A;  4LNU B;  1K3E A;  3EHB B;  2EIL B;  3IC9 A;  2DQ0 A;  1VQP V;  4YJ2 B;  1TAE A;  1ZLZ A;  2W6J G;  2EX3 A;  4J80 A;  4O4I B;  3CXC U;  2CH7 A;  4UXN A;  3CCS V;  1BHA A;  2M7W A;  5GTH Z;  2LO1 A;  2KG7 B;  5LHH A;  5LMU B;  3QF7 A;  4JZ2 A;  3AK2 A;  3ASN C;  1I7F A;  4JF3 A;  4X9Q A;  1VF5 B;  5H9C A;  1M57 B;  1NR7 A;  4DV2 O;  1M1K W;  2OTL V;  1GN4 A;  2WWW A;  4J41 A;  2LW7 A;  1RFY A;  3CME V;  1PNK A;  3CCR V;  4NXN O;  5LP6 B;  1NH2 D;  1GM8 A;  2IBZ H;  1L0N H;  1XL4 A;  2B1I A;  2N05 A;  4YIP A;  5C8Y A;  1J95 A;  1HR0 B;  5TIS Z;  2XAJ A;  2W0X A;  1XNQ B;  4JI2 O;  5EZY B;  2AHY A;  4WFE A;  2YXH A;  3CEI A;  1AR4 A;  4LF7 B;  2BOB C;  1O9H A;  1WJZ A;  2NN4 A;  3NXS A;  1XNR O;  4DV3 B;  3RYC A;  2HKO A;  4DR6 B;  2VRZ A;  4JGS A;  5KX5 B;  3D36 A;  4I0X B;  1HNZ B;  5GON A;  2GUZ A;  3K3W A;  1SQF A;  3E8B A;  3K5M A;  1BS3 A;  4I9Q A;  1DGS A;  1CP9 A;  1VQN V;  2GUZ B;  2IU0 A;  2A79 B;  2D3O W;  1WP7 A;  5L3F A;  1PD3 A;  3F5T A;  4NXM B;  4FJC C;  1IUR A;  3IGA C;  1BSM A;  5L3C A;  5CN0 A;  3OW2 U;  4TUY B;  2Q7G A;  3OTF A;  1H2G A;  2YXY A;  2Z5U A;  1Y74 A;  3ABK C;  3KZI Z;  1F51 A;  1AIL A;  2MK3 A;  4OPH A;  5GON B;  5B1A C;  4WF9 V;  3OGC C;  2Q6A A;  1XMO O;  4ZOL A;  4FM1 A;  1K92 A;  3QVN A;  4TV9 A;  3W7U A;  1I08 A;  1KP2 A;  3FD9 A;  1ZTE A;  2B1G A;  2BTO A;  4PA3 A;  1WNS A;  2JIZ G;  1KU9 A;  1WA8 B;  3APO A;  4Q20 A;  3T2M A;  4BAY A;  4QPJ A;  2YIA A;  1F7Y A;  5K1P A;  1FS0 G;  1K7D A;  1ORQ C;  1DF5 A;  1V54 C;  1YF2 A;  4D7T A;  2F23 A;  4FLY A;  2DWE C;  1M9N A;  4NXN B;  2YI9 A;  4B3T B;  3HKD A;  3B8N A;  2WLH A;  5IE9 A;  2K1E A;  4RUE A;  4UVA A;  1JJO A;  3L73 H;  1TGO A;  3OM3 B;  3X2Q C;  4JYA O;  4JI0 B;  5B1A B;  3SYP A;  4LF6 O;  2EZO A;  2WLI A;  3BHP A;  1K4C C;  2ZQM A;  3CE2 A;  4OGQ B;  2HHH B;  3OEH G;  3GVM A;  3APQ A;  4IHJ B;  4X8A A;  3CB2 A;  2JDI G;  2LFS A;  1OCR B;  4LF5 O;  1VQ4 V;  1AVM A;  2Y48 A;  3CS5 A;  3ZJZ A;  1S72 V;  1ZAU A;  2WLN A;  1Q43 A;  2EIM B;  1YVW A;  4MTF A;  4GLX A;  4LR3 A;  4IL6 Z;  4X88 A;  3JAS A;  2ILM A;  2HVK C;  4LP8 A;  1PNL A;  4BIO A;  1O9G A;  3K59 A;  3P3P A;  4LF9 B;  1IZ3 A;  4FLU A;  1VQ8 V;  3ABM B;  1GM9 A;  4BIZ A;  5JJJ B;  4JAS A;  1SER A;  1OCC B;  3T4D A;  3KKY A;  2ZM6 B;  4DV0 O;  5CA0 B;  5FPO A;  3SJB C;  1SET A;  2PGG A;  3TXS A;  1ZL8 A;  2EIL C;  1VP7 A;  4I55 B;  3AG1 B;  3BPZ A;  1XMO B;  3OTO B;  4WFF A;  5B1O A;  3N2K A;  3CCV V;  2Q5Z A;  2YDE A;  1XMQ O;  2DQ3 A;  1G8M A;  4DR3 O;  4FFB A;  4P9O A;  4RQF A;  1IX9 A;  1HP8 A;  1FFX B;  4JV5 B;  3H1K H;  3O9O A;  1P84 F; 
#chains in the Genus database with same CATH homology
 4FLX A;  5LMN B;  4KHP B;  5JCO C;  1SA0 B;  3ZS8 C;  3M7M X;  4WBN B;  5D5Q A;  3JAL A;  3HKE A;  2R9A A;  1N36 B;  4AIL C;  5J2T B;  1G6U A;  1HNX B;  4BWA A;  3RYF B;  3RYI B;  4TV8 A;  4EEQ A;  1XQ8 A;  5IJ9 A;  5FNV A;  3N2K B;  5LXT A;  1IBL B;  3LNN A;  4ZI7 B;  3SR2 C;  5LXT B;  2V4D A;  2F4V B;  4O4J A;  1Z5W A;  2JGU A;  5KMG A;  5JH7 A;  1TUB A;  2PYJ A;  3UQ8 A;  3B2E E;  3JSN A;  5IWA B;  4B3M B;  5KHK A;  4D7S A;  3DSQ A;  4DUY B;  2OWO A;  4YJ2 A;  4LF4 B;  4X1I A;  1S5J A;  3N2G B;  2E5L B;  3VQX A;  4F6R A;  3JAW B;  4CH6 A;  4DRX A;  3E22 B;  4PI2 A;  5IJ0 B;  5ITZ B;  4DV7 B;  4X20 A;  5ITZ A;  4ZHQ B;  4DV0 B;  1QQC A;  3CHX A;  5KHG A;  3BRC A;  5EIB C;  2GV9 A;  3ZED A;  1YEW A;  3WB0 A;  4TQD A;  4JI8 B;  4GKK B;  1L8D A;  2PUS A;  2YIB A;  1XI1 A;  4CH4 A;  4O4I A;  5JJN B;  3HKB B;  4B3S B;  5IYZ B;  4X1Y A;  4FM0 A;  2ZIM A;  2Q7E A;  1XHX A;  4DR5 B;  4AQY B;  4CS3 A;  2E3C A;  4AHC A;  3VQW A;  5IYZ A;  5CB4 B;  4X1K B;  4IHJ A;  5J2U A;  4GKJ B;  5LA6 B;  3RYC B;  4HBN A;  4JI1 B;  4CC5 A;  3IAY A;  1T5E A;  1XNR B;  4OX9 B;  5KX5 A;  3JAS B;  2VWK A;  2YI8 A;  2VWJ A;  4X65 B;  4CC6 A;  4DV4 B;  1X4T A;  4X64 B;  4I4T A;  4FLT A;  2VQE B;  4O2A B;  2ZIN A;  1I94 B;  3QG5 A;  1TUB B;  1M93 A;  4I4T B;  4K0K B;  2UXB B;  3RYH A;  4L8J A;  1N32 B;  2BTQ A;  5LYJ A;  4JI3 B;  2ZNI A;  4I55 A;  4FLZ A;  1JFF A;  4EFB A;  3RYH B;  3BAB A;  4DV6 B;  4JI7 B;  4KL1 A;  4LFA B;  3K5L A;  4EB6 B;  2ZIO A;  4ZHQ A;  4DR7 B;  3SGI A;  4DR2 B;  3FFQ A;  4TQF A;  1Q5O A;  4TOI A;  3U10 A;  3JSL A;  5FPR A;  4I50 A;  2PTM A;  1SA0 A;  3K57 A;  2Q0A A;  1XMQ B;  3HKE B;  5LOV A;  4PHZ A;  3JAK A;  2UU9 B;  4IIJ A;  3U11 A;  2YXL A;  4DR1 B;  1M4U A;  4B3R B;  2QM4 A;  3MAQ A;  4ZIB A;  4FLW A;  3SJA C;  4UCR A;  4ZI7 A;  4LFC B;  3HKD B;  4O4H B;  2UXD B;  3PN1 A;  4CH5 A;  1SQG A;  1TA8 A;  5EYP B;  2YIB D;  4B08 A;  4YJ3 A;  5LP6 A;  4LNU B;  1WPB A;  4FLV A;  3JAT B;  4LFB B;  4UCT A;  3RGB A;  2PZS A;  4CS4 A;  5EYP A;  3JAT A;  4DUZ B;  4YJ2 B;  1TAE A;  3JAK B;  4O2B A;  2HEP A;  3JAR A;  4CH3 A;  5KHJ A;  1WN7 A;  4U3J A;  2EX3 A;  4O4I B;  4UCU A;  4TUY A;  3A2F A;  5LMU B;  1QHT A;  3QF7 A;  2P22 C;  1I7F A;  5J2T A;  3JAW A;  3ICX A;  4DRX B;  5JJE B;  2BTQ B;  5LYJ B;  5J2U B;  4UCO A;  3BA8 A;  4HNA B;  3THO A;  3UT5 A;  5JQG B;  5CA1 A;  3RYF A;  4DV2 B;  4LF5 B;  5BMV A;  3BAA A;  4UCS A;  5FNV B;  4X1Y B;  4YJ3 B;  5LP6 B;  5CA1 B;  2VQF B;  1N34 B;  1VF7 A;  1XHZ A;  3VQY A;  2F66 C;  5LP6 C;  5C8Y A;  3WB1 A;  1HR0 B;  1XNQ B;  5CB4 A;  5EZY B;  4TV8 B;  5EIB D;  4LF7 B;  4X62 B;  5EZY A;  1O9H A;  4DV3 B;  1IBM B;  1HNW B;  5IJ9 B;  3RYC A;  4DR6 B;  2CAZ C;  3HKC B;  5KX5 B;  1HNZ B;  1Z5V A;  3SJC C;  4JI4 B;  2R70 A;  5BMV B;  5GON A;  4I50 B;  2UUA B;  4DR4 B;  1SQF A;  1J5E B;  3K5M A;  4O2A A;  4I9Q A;  4O2B B;  4FM2 A;  3WB2 A;  4ZOL B;  1DGS A;  1TVK A;  4F6R B;  5JH7 B;  4FVM A;  4LF6 B;  2IM9 A;  4GYC B;  5IJ0 A;  4NXM B;  1V9P A;  2Q7H A;  2ZCE A;  4TUY B;  3T1Y B;  1B04 A;  4X1K A;  3HKC A;  5JCO A;  2Q7G A;  5BR8 B;  3OTF A;  4HNA A;  4LF8 B;  4DK1 A;  4DV5 B;  5KMG B;  5GON B;  4O4J B;  3K5N A;  4ZOL A;  4O4L A;  2QJ1 A;  2RJZ A;  4FM1 A;  4TV9 A;  3N2G A;  4K8X A;  2PY5 A;  2BTO A;  1WNS A;  4EFE A;  2RQ6 A;  1KU9 A;  2P5O A;  1NT2 B;  2YIA A;  1Q3E A;  5KHI A;  3E22 A;  5K1P A;  4JI5 B;  3RFR A;  5LA6 A;  4YHH B;  4X1I B;  4D7T A;  4FLY A;  1P49 A;  2JS5 A;  2R72 A;  4Q6G A;  5KHH A;  4NXN B;  3U0Z A;  2YI9 A;  4B3T B;  3HKD A;  4O4H A;  1N33 B;  1IBK B;  4LNU A;  2UUC B;  4X66 B;  3HKB A;  1JJO A;  1M5I A;  1JFF B;  1TGO A;  1JMK C;  2PYL A;  4JI6 B;  2UXC B;  1TVK B;  4U3J B;  4JI0 B;  2XHB A;  4WBN A;  3RWR D;  4UFZ A;  3BHP A;  1FFX A;  5CA0 A;  4NVP A;  1H2S B;  2KKW A;  4CS2 A;  2F1M A;  2UUB B;  2HHH B;  5D5P A;  4IHJ B;  4PI0 A;  3RYI A;  3CB2 A;  3K58 A;  5LOV B;  4YY3 B;  4UCV A;  2ZNJ A;  4K8Z A;  1HW7 A;  1ZAU A;  4DR3 B;  3BA9 A;  1Q43 A;  4O4L B;  5K1X A;  4GLX A;  4LR3 A;  3UT5 B;  3JAS A;  4EB6 A;  1D5A A;  2F95 B;  1SKV A;  2F93 B;  1O9G A;  3K59 A;  5JVD A;  4LF9 B;  3JAR B;  4FLU A;  5C8Y B;  3CSX A;  5JJJ B;  2ZM6 B;  5CA0 B;  5FPO A;  3SJB C;  4JI2 B;  4BW9 A;  4DV1 B;  2JVD A;  2PGG A;  4I55 B;  4DK0 A;  3VQV A;  3BPZ A;  1XMO B;  3OTO B;  3N2K A;  3JAL B;  4X20 B;  1FJG B;  1KMI Z;  4JYA B;  3ETQ A;  2OYQ A;  4FFB B;  3T1H B;  3QTC A;  4TV9 B;  1RSO A;  4FFB A;  4LH7 A;  1FFX B;  5JVD B;  4JV5 B;  5JQG A;  1Q8I A;  4IIJ B;  4LH6 A;  3K5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...