5KAFZ

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kafZ00
5B5EZ 5KAFZ 3A0HZ 5TISZ 3JCUZ 3A0BZ 3KZIZ 5B66Z 4UB8Z 2AXTZ 1S5LZ 3WU2Z 5KAIZ 4IL6Z 5H2FZ 5GTHZ 5GTIZ 4UB6Z 5E79Z 4PJ0Z
chains in the Genus database with same CATH superfamily
1YTFD 4ZOLA 4JI4O 4JI4B 3M99B 1SF9A 2EIMB 5FL7G 3UT5A 3WFVA 1ENVA 3RYFB 4MVOA 2HG5C 4DV3B 2KB1A 4FM0A 3SJBC 2W6IG 2VQEO 2UUBO 2VQEB 2UUBB 3CCJV 1SQBH 1K5QA 3CC4V 2Q7EA 3ZHVA 2XTAA 1O9HA 2ZNIA 1KQSU 1KYOF 2Z5UA 4O4LA 4I5SA 4K8XA 3LDDA 1AP5A 5FPRA 3SDLA 2JS3A 5HFLA 1R1BA 4JYYA 2RQ6A 3WB1A 3N2KA 2DJVA 2EJRA 3L70H 5KHKA 4K3AA 4GCZA 3K58A 1M93A 1BL8A 4UVAA 1Z5WA 4YJ2A 4NKGB 3X2QB 1SA0B 2WLIA 1GN3A 4LF8B 4DR2O 4LF8O 4DR2B 5IT9N 4FMTA 2AHZA 3E8FA 1YXBA 2P7TC 2Q7HA 2W0XA 3ASNC 1JCHA 3M7MX 4P2ZA 4UCSA 1PNLA 4LFCO 4LFCB 4LFAO 4LFAB 3B2EE 3P3PA 3QTCA 4TQFA 3CCVV 1JX9A 2Q69A 3CRAA 3SPHA 2IJIA 4EEQA 4FPPA 3ZMTA 2E5LO 2E5LB 2Q0AA 3U10A 2OYQA 5CMUA 2YI8A 2NNUA 3M8AA 3D36C 4A5UB 2PYJA 5JWPA 4FLWA 1YJNV 2XAGA 4B3TO 4B3TB 4DYLA 3QO8A 2X7RB 4MVRA 3JD0A 4RUFA 1TAEA 5H6RA 5IWAO 3OMAB 5IWAB 5B3SB 3QNEA 2QR4A 1IBMO 1IBMB 5LGTA 2CK3G 3SPGA 3AK2A 2WA3A 3K0GA 1SS3A 3R65A 3CMAV 4X20B 3L72H 4FLUA 3MD0A 2BTQA 5B66Z 4WCEV 3VBBA 3SYQA 4B08A 5IE9A 1XBLA 2YEVB 3U11A 1GN2A 5KHHA 1H8HG 3OW2U 2HKOA 5IJ0B 3K06A 5B1OA 5L3CA 2P4KA 2L6LA 2GUZA 4FLVA 1HW7A 1LUWA 4RO2A 5B1AB 2BE3A 3DXRB 1SERA 1R3KC 4YJ3A 4UVCA 5IY5B 4UCUA 4Q6GA 4DW0A 4I4TB 2ZD9A 3ZHUA 1S77D 1K92A 3B40A 4ZHQB 2WPDG 2BSKB 3E8BA 1YHQV 1I5XA 4DV4O 4DV4B 3OTOO 3OTOB 1Q82W 4MVMA 4I7ZB 1SQGA 3FYIB 3G4SV 4QPJA 3ZRXA 4DV5O 4DV5B 1N4CA 2OCCB 3AG1C 3JATB 1V54C 3H1JH 1OCCB 3JCUZ 2Q6AA 5KLVH 1AP6A 1NBMG 3UO2A 2IM9A 4PD4F 4PDVA 2VWKA 1Q90D 4B3MO 4B3MB 4IL6Z 5IYZB 4PI0A 3BVOA 1L0LH 3OR6C 1OCZB 4KFMA 4ZOLB 3JAKA 1XHXA 2CE4A 1ZAUA 3UT5B 3N27A 5CN0A 3ZN1A 2QE7G 4PDRA 3T4DA 2IJKA 4GX1A 3JAWA 1TUBA 4CH6A 2VRZA 4B3SO 5B1BC 4B3SB 1SQFA 2WLKA 3OUFA 2VQFO 2VQFB 3H1IH 4ABMA 1VF6C 3CWBH 3E8GA 2OT5A 1SQPH 2LGWA 1MOFA 2NR5A 4O4HA 2N04A 4X1KB 3BFRA 1VQLV 1VQPV 3CCSV 3JD3A 2H3OA 3N2KB 4LF5O 4LF5B 1BSMA 1VARA 2ZR3A 1HR0O 1HR0B 4QGPA 2E76B 3UCSC 4X62B 4YJ2B 2WLIB 3K03A 5HFMA 5BZBA 1AJPA 2EIJB 1H2MA 3QG5A 4N23A 4MTGA 1NR1A 4DW1A 1BE3H 3HB3B 1BQZA 2Q4PA 2XASA 1FFXB 1Y66A 4HNAA 4GLXA 1WPBA 2WWWA 3A0RA 3F7YC 4NTWA 1QR9A 1E1RG 4DR6O 2ZR2A 4DR6B 4GKJO 1XMOO 4GKJB 1PL0A 1XMOB 3JSLA 1FXVA 1EZVH 1CP9A 5KHGA 1VQNV 4UB6Z 1QU7A 4DV1O 1KC8W 4DV1B 3LUTB 4NTXA 2YXYA 1NTZH 1DK1A 5LXTA 2ITCC 2WLMA 2ADQB 1QQCA 5K1XA 1XI1A 1F4NA 3WU2Z 1H2KA 5EIBD 1MNGA 3ABLB 4YIOA 1VQ8V 4I9WA 3T1CA 2P06A 2ZE5A 2P4VA 1HNXO 1HNXB 3SPJA 1YTFB 1K33A 3ZRSA 2AGAA 2BTQB 1L0NH 5FLXN 3B77A 3TETA 3AG3C 3B8MA 3H1HH 1FAFA 4U7NA 2HJDA 3G6BA 4TUYA 1XILA 1FFTB 2FTKA 1YSCA 1EN4A 2QKAA 2GUZB 5JJNB 2N05A 3JAMN 2QWOB 5JCOC 3F5TA 1N34O 1N34B 4YJ3B 1Z2GA 3E2EA 4WFEA 3SR2C 2R72A 2ODMA 5GTHZ 1VQOV 3ZCCA 3E22A 4I50A 1JJ2U 1N8RW 3LDCA 3TXQA 2KQXA 3H9VA 5DM6V 3ZEDA 4FLYA 3BA9A 4Q20A 1Q81W 1COWG 5DECA 2MK3A 3FYEB 4ZI7A 2JRIA 1K4DC 4LWSA 3UQ8A 5LA6A 1HP8A 2V1DA 1ZX3A 1AILA 3OGIB 3AG2C 2IU0A 1B3QA 2RMKB 2LFSA 2ZXWC 1WLEA 3ZS8C 3K59A 2EZOA 1I94O 1I94B 1S0VA 1PKXA 4DR4O 4DR4B 1RP3B 1N36O 1N36B 2UXCO 2UXCB 3CCLV 3ETQA 2CTRA 1JPXA 2EULA 2EIMC 3JAKB 4TQDA 3T1HO 5BR8B 2HEPA 4WFAV 3T1HB 3OE7G 1WP8A 4XBFA 1OV9A 1M5IA 5H9CA 5E79Z 4X88A 4U3JA 4JI6O 4JI6B 5C93A 2B5UA 4KXRA 4CBCA 3ETDA 3JAWB 2W6JG 5ITZA 5K1PA 1HWYA 1EBOA 3LSSA 3EFFK 3K3WA 5H5NA 4DV6O 4DV6B 4JI3O 4JI3B 1DGSA 2PZSA 2QWQB 4B7EA 4D7SA 4JAUA 3T4ZA 4AI8A 2XAFA 5J2UA 1KU9A 1SZTA 2W0FC 4O4HB 3TXSA 1VEWA 4KP4A 4JI7O 4JI7B 3K5NA 2ZIOA 3K57A 1CXZB 4J9YB 4LR3A 2IW5A 5BXZA 3IFXA 2AXTZ 3TGUH 2A7WA 2RCVA 2QKSA 3X2QC 1FPOA 4QNHB 1VQ4V 2ZE6A 3MHHC 4YIPA 2HR3A 3APOA 1P7GA 1Q7YW 5EK0A 4R7CA 4HNAB 3K79A 3HKEA 3K9SA 5LGUA 2V4DA 2O57A 1AI7A 3KKYA 1QBZA 1M56B 4JTAB 1I0HA 5KHJA 1XNQO 1XNQB 1D5AA 1AVMA 3CE2A 2DN9A 1M4UA 3D8CA 4DR7O 5BMVB 4DR7B 5L3EA 5LXTB 4MVSA 3JD4A 5LOVA 1F51A 1X4TA 2WLLA 2IBZH 5B3SC 3OR7C 1AR1B 3CCQV 1GH6A 3A2FA 4TV9A 4QPKA 1ROPA 5H2FZ 2D2CB 3ZMVA 1V55B 2UXBB 2UXBO 2PI5A 4BR6A 4J41A 5L3GA 4PHZA 4LBEC 4LF6O 4LF6B 3EVKA 2UUCO 2UUCB 1QNMA 1Y74A 4FZ1A 1XMQB 2K9PA 1S72V 5EZYA 2HHHO 4ICGA 2HHHB 3OMIB 4TUYB 1XNRO 2DE0X 2X6BA 1XNRB 2KG7A 4CH5A 4FZ0A 5B1AC 4BIOA 1BT8A 4LF9O 4LF9B 3CEIA 3N2GA 1R3IC 1WA8B 5IY5C 2CH7A 3ML0A 4FFKA 2F23A 3E22B 4X9QA 1WNSA 1OJHA 3ZIAG 3CXHF 3STZC 1YVWA 5JVDA 1NI8A 4X1IA 3ZHRA 3S3WA 4L87A 4HZ3A 4ZI7B 4BIUA 2HLDG 3U0ZA 2QTSA 4DV7O 4DV7B 1SETA 4LWSB 3CRQA 5LA6B 2ZKOA 4FLZA 3BA8A 1JJOA 1P7BA 3G67A 1GK9A 1OCCC 1F7YA 2YS8A 4PDLA 2DYSB 4O4IA 4IT5A 3WG7B 1H2LA 4JZ2A 2XHBA 3ABKB 2EBOA 1OCZC 3GWKC 2OWOA 4UB8Z 5KUMA 5JJEB 4I55A 5JH7A 4DK1A 4GX2A 3LSUA 3JASA 4U3JB 1VIBA 4GX0A 1PD3A 1SQXH 4JTDB 5IJ9A 3RYCA 4B3RO 5ITZB 2A06H 3CX5F 4B3RB 2HP8A 3E86A 1Y76A 3JARA 1FXKA 1K5SA 1M1KW 1JOYA 3CCUV 1AJNA 1RSOB 4XDLA 1URFA 2YI9A 3LDEA 3SPCA 3HKBB 4FIPC 5J2UB 1UFIA 3W7TA 1Q86W 3DTUB 2C2AA 4EB6A 4IHJA 3QO7A 3THOA 1H2SB 2VS0A 4OGQB 5JJJB 2FMLA 1Q43A 1SESA 2KSDA 1K97A 1OCOB 5EC1C 4P9OA 5KMGB 4LH7A 3CJHA 3IGAC 2EIJC 1LUVA 3TJTA 4ZIBA 1WPXA 2Y4TA 4NB5A 2VWJA 2JGDA 4LNUA 4UVBA 2ITDC 1IX9A 2PF4E 4JGSA 3HKEB 4OPAA 1NTMH 3D3IA 3KCYA 5AG2A 1D2DA 3C3SA 5J2TA 5CBFA 2M7WA 1QVGU 5A9GA 1NVPD 1Q3EA 4H13B 3HPLC 1KP2A 4R8CA 4MSWC 3CRCA 3CS5A 3GB7C 4J10A 5KX5A 5LOVB 3OAAG 4J9ZB 1ORQC 3VQXA 1J95A 1I5YA 1BHBA 4CH3A 2CTWA 2LW7A 4X66O 4LP8A 4X66B 2LFRA 3E89A 1NU1H 2CAZC 4TV9B 3KZIZ 3WB2A 3OD4A 3RYIA 3SJAC 4I0XA 2EINB 4P9PA 1RM1C 1K73W 1AI5A 3G71V 1Y74B 3ZHSA 2WLHA 3KG2A 1P84F 4QJFB 3I56V 4N21A 3B09A 3H01A 3SJCC 1D5NA 2UU9O 2UU9B 2ZE7A 1QCEA 4X89A 1E79G 2EIKB 4MTFA 1L1FA 2XUMA 4O2AA 2CUGA 3QVNA 4DRXA 3N2GB 1Q8IA 2UXDO 2WSSG 2UXDB 5A2QN 2CH7B 3ASOB 3A8TA 2QKCA 4J7KA 1R6KA 3ABMB 3NR7A 2Y48A 4E4EA 5JVDB 1N0NA 4MVUA 1Q6IA 3O65A 4X1IB 2Q9LA 1GTOA 4O4LB 1NZ6A 5EBMC 1XUQA 1S3JA 3FKSG 2HVKC 1YF2A 2YSUB 1BS3A 2Q5ZA 2NLJC 3BABA 5L3BA 4X65O 4X65B 4G27B 1THZA 3HKCA 2Q7GA 3GWOA 3ZX6A 2X6AA 4JI8O 4JI8B 3H1KH 1Y67A 4ZKIA 1GMGA 2Q67A 4O4IB 4OPHA 4EFBA 2YXLA 2P22C 3ZRWA 4PELA 3IJ4A 4I55B 5JH7B 2LO1A 1RPRA 3AK1A 4D6TH 3JASB 1PNMA 3CYOA 1VQMV 3R66A 2YC0A 3RW0A 5IJ9B 4KUMA 1OCRB 3RYCB 4AHCA 4PJ0Z 1Y76B 3JARB 2PY5A 1FXKB 3OTFA 4D7TA 2XAQA 3ABUA 2P67A 4DR1O 2WAMA 4DR1B 3A0BZ 1YITV 4NYKA 3SJQC 5B1NA 1QLEB 2CGNA 3SPIA 1ZL8A 2HFEC 3VQWA 2CTPA 3JALA 2QTOA 4EB6B 4IHJB 3IAYA 1H2GA 1XQ8A 4BW5A 4MTXA 1W0JG 2Y0PA 5GONA 4UUJC 3CJHB 2QA4V 2LP7A 2NN4A 5E1AC 2PGGA 4KL1A 2Y69B 5CA1A 2R9RB 1BMFG 3GVMA 3AG7A 5CBHA 2JGDB 4LNUB 4O4JA 4UXNA 2YIBD 1OZ0A 1K7DA 3AG4B 2EILC 2QWPB 4J42A 5D5PA 1R6NA 1M56C 5J2TB 2A79B 3FAVA 4NXMO 4NXMB 3B4SA 3P32A 3RVZA 4FLTA 3ETEA 4KHPO 4KHPB 4FK5C 5LP6A 5KX5B 1NT2B 3ZRVA 2P6JA 3QF7A 3UM7A 2ZQMA 1E1QG 2K1EA 5EC2C 3CCEV 1V55C 4BW9A 3FB6C 3RYIB 2BOBC 1T5EA 3RYFA 4I0XB 1Q5OA 4K0KO 4K0KB 1AROP 3OUSA 1RFYA 1XDCA 1FJGO 1FJGB 1KMIZ 3D3QA 4NVPA 1MSDA 1N32O 1N32B 4U7OA 3DC6A 2N74A 3CRMA 2IH3C 1UPGA 3LSQA 1NQTA 4LC1A 3NXSA 1WB8A 5JQGA 2EX3A 1XREA 1ZUQA 1K8AW 5LYJA 3K5LA 3O9OA 1M90W 4DRXB 4MS2A 5C8YA 2V7QG 4ZBMA 3FB7C 1TUBB 4H33A 4PA4A 3W7UA 2PYLA 4OX9O 4OX9B 3T1YO 3QO5A 3T1YB 3RYHA 1VQ7V 3VOUA 2JDIG 4JI5O 2JIZG 4JI5B 3CHXA 1R3LC 1R3JC 5FNVA 2GTSA 2R9AA 4CH4A 3PN1A 2YIBA 4PA9A 1BGYH 1KB9F 5IYCO 2HJFC 2PTMA 3VQYA 2GV9A 2ZT9B 3JSNA 4JYAO 2LGQA 4JYAB 1VF5B 4MVZA 1YEWA 2DYSC 2ZM6O 2ZM6B 5KAIZ 5CA0A 3WG7C 4CZZA 1Q6UA 3ABKC 1JQ0A 5FPOA 1S5JA 3OT7A 3ZRWB 1NJIW 2DWEC 1VQ5V 2ZDIA 3OGCC 4DV2O 4DV2B 2GTAA 1IZ3A 1VQKV 2ZIMA 5KA5A 4MW8A 4RAIA 4LF4O 2E75B 4LF4B 2A0LA 4X20A 1S5LZ 1IBLO 1IBLB 1JA8A 4C7UA 1AR5A 3TCUA 1M57B 1B06A 4G2KA 5IYDO 4RUEA 1OHHG 2JS5A 1H8EG 1S5HC 3CCMV 1YDXA 2PUSA 5D5QA 3CCRV 2OTJV 4YY3O 2DQ3A 4X1YA 3AEIA 5CA3A 3CMEV 1G1XB 4RWUA 3JALB 4HAMA 3G80A 1OCOC 4MT8A 1KD1W 2WLJA 5GONB 4L8JA 4JAAA 4TT3G 4I4TA 1AI6A 2ATKC 1M9NA 1N0JA 4IYIA 4UCOA 3OM3B 3ZMZA 1SKVA 4O4JB 1LNQA 3K5OA 4JASA 1HNWO 1HNWB 1KUQA 1N33O 1N33B 1GO3F 2LJ2A 3ZMSA 1DF4A 3FAVB 4W4KA 3FB8C 3RWRD 3BRCA 2Q68A 4WFBV 2JEUA 1KBHA 5L3FA 4PA6A 5LP6B 5LGNA 4IIJA 2BOCC 5EBLC 3BHPA 4I50B 3BY6A 3DC5A 2GDSA 2Z3YA 4WFFA 4JTCB 2KKWA 3OMNB 1JFFA 1IXBA 1PPJH 3JCZA 4DR3O 1P49A 4DR3B 4QE7A 4DK0A 3BEHA 4PDMA 1WAZA 2EINC 3LNNA 1MSWD 4DV3O 2QDOA 4BWAA 1XL6A 1QHTA 1HDJA 2JJ1G 1Y4MA 3B8NA 2AHYA 2F95B 3E8HA 3RVYA 2OCCC 5DN6G 2GBOA 3ZMUA 3D36A 2FYUH 2FL4A 4R50A 1ZSPA 4R6ZA 2GSMB 3L74H 1G8MA 3MHSC 2EIKC 4CS2A 3CC7V 5JQGB 2G38A 4J11A 4X1KA 3CP1A 4DXWA 1EN6A 2QSAA 1PNKA 5LYJB 2EZPA 5C8YB 4UV9A 3ASOC 4UFZA 2ZCEA 4YHHO 4YHHB 4XDKA 2YICA 3ZN0A 3ABMC 2IJJA 1SQQH 3A0HZ 4P30A 2R70A 3RYHB 2XT9A 3I5DA 4NR1A 4K8ZA 1FFXA 2E74B 2BCCH 4Z2WA 2OIGA 4PI2A 1WJZA 5IYBO 5FNVB 4FFBA 4G28B 1J5EO 1J5EB 3W7WA 1VQ6V 1XOUA 1BQ0A 2UUAO 2QEXV 2UUAB 1G4YB 1KKDA 1NR7A 1FKAO 1AJQA 1W59A 4OXSA 4WF9V 3SYOA 4K35A 5CA0B 1V9PA 4QIWF 4LH6A 4F6RA 1TA8A 4UCVA 1IDSA 1TGOA 4F6EA 2B1IA 1LR1A 3UO3A 1EZJA 3HR0A 5LHHA 3T2MA 1IBKO 1IBKB 3K0DA 3FX7A 5TISZ 4AILC 1OCRC 1W2BU 3HKDA 2ZE8A 4FVMA 1HNZO 1Y6XA 4WFGA 1HNZB 4JI1O 4JI1B 3L71H 2QM7A 1QVFU 2OCHA 3STLC 1AI4A 1XHZA 2DYRB 1FYJA 1FXKC 2AW9A 1A32A 2CGOA 3L9DA 1SC5B 2ILMA 2YIAA 2EJ7A 2QGNA 1QLEC 4X1YB 2WLLB 4CC5A 2P5OA 1X59A 3CD6V 2FB5A 1XEQA 3J80N 4DV0O 4DV0B 3ABLC 2RDCA 2A3QA 3RFRA 5KHIA 3JYCA 2RNBA 2YIDA 1R6TA 3Q4HA 4LF7O 4LF7B 3L75H 1KP3A 3J7AU 3W7XA 5EYPA 4JF3A 4B7KA 5L3DA 2UXNA 4TOIA 3CC2V 1NTKH 2Y69C 1AR4A 1TVKA 5DEDA 3P30A 5GW7A 1KECA 3F5WC 1PP9H 3FD9A 2Q73A 5EZYB 3AG4C 1MZFA 3JD2A 4IYHA 3CPWU 2ADPA 1VF6A 4H0LB 2UXXA 3K04A 3RT3C 1YJWV 2KG7B 3RGBA 1K9MW 1ZLZA 1FD9A 2WA4A 1P4RA 1NH2D 3IC9A 4BIZA 3L73H 2QM4A 4IIJB 1PV0A 4H37A 2L35A 1FS0G 3SYAA 1JFFB 1G6UA 5LBQA 2GHYA 1BCCH 3ASNB 2H94A 4J7ZA 1FXHA 4O2BA 4MVQA 3FB5C 2F43G 2Y4UA 5J9PC 1IVSA 1GM8A 1Z5VA 4J80A 2ZNJA 1SZXA 4BAYA 1DLBA 4GT1A 2D3OW 2F93B 1GM7A 4I9QA 3BPZA 4JI2O 4JI2B 1PL4A 3CSXA 3ZHTA 2ETNA 1YI2V 3DGEA 4FLXA 2DMXA 2YDEA 3RN4A 4RQFA 4X62O 2IH1C 4MTOA 1XL4A 2Q8VA 4RQEA 2JK5C 1GKFA 2LQTA 3G6EV 3ZJZA 3VQVA 1CEZA 5KAFZ 4PA7A 3C90A 1S76D 1R73A 3C3TA 1MA1A 4CC6A 4Z1MG 4FFBB 1MZEA 4EKWA 3BCCH 4GX5A 1H2NA 1WP7A 3K08A 1L8DA 2WLNA 1GRJA 3FFQA 5JCOA 5BMVA 2A9HA 4FJCC 2JJ2G 3ZBHA 3JD1A 4F6RB 2ARHA 2Y0IA 1I7FA 4XDJA 5CB4A 3EHBB 4WBNA 1QLNA 4TSFG 4TV8A 1RPOA 2CTQA 1UJWB 3HKDB 4GZRB 1M57C 1VF7A 1RM1B 1GM9A 2XOKG 4DUYO 4DUYB 1JMKC 3KCXA 3P3NA 4DUZO 2AZ0A 4DUZB 1PM9A 2OIEA 1YIJV 3MDSA 3CB2A 3AG1B 3SYPA 3ICXA 1GN4A 1V54B 2B1GA 4UCTA 2BTOA 5B5EZ 3DSQA 1NKDA 2R9IA 4PV1B 2JGUA 1H38A 2QWRB 5LHGA 2Q0OC 3EXAA 2E3CA 3Q4HB 2X6CA 1DTOA 4X8AA 1EN5A 1WA8A 2YUAA 5EYPB 1B04A 2P90A 5CBGA 1YJ9V 4GUNA 1K3EA 2F4VO 2F4VB 1TVKB 1K34A 3J81N 1WB7A 5B1BB 4LCUC 4UV8A 1Q6HA 5KA6A 2QM8A 4HBNA 1TUEB 2JEXA 4JPRA 1DF5A 2YXHA 2H8PC 3H1LH 3F7VC 5EBWC 3ZHQA 3OFNG 5LHIA 1YZBA 3TK1A 4J7JA 1KKCA 5IDJA 4O2AB 4UCRA 1U97A 1MG1A 5LP6C 3W7SA 1GAXA 2FKXA 4HYOA 1YCIA 4EFEA 1EM1A 3K9AA 4QE9A 5LMUO 5LMUB 4TWKA 1SA0A 1ZTEA 4IGGA 4PA3A 1F4MA 1NS1A 5BR8O 2JVDA 1GN6A 4O2BB 2M6YA 2XAJA 2XAHA 4GYCB 4FM2A 4FM1A 3OEHG 4JAVA 1K4CC 1U96A 4MW3A 1BHAA 4JYCA 4AQYO 3HKCB 4AQYB 2QJ1A 4YXWG 3I55V 2F66C 2F1MA 1VMGA 3LNMB 1RSOA 2HVJC 4WFHA 1NVPB 2CDYA 4CS3A 5KUKA 1ZWIC 2MW2B 3HKBA 1VQ9V 1SQVH 2AZ2A 2IU3A 4E2LA 3SGIA 2LW1A 1QR8A 5EIBC 4X64O 4X64B 2DOSA 3ABTA 1US6A 5KMGA 2Z0AA 4Z1VA 5LL6Y 1MABG 4DO2A 4CS4A 2DQ0A 2QWNB 2YEVA 1I08A 4NXNO 4NXNB 1O9GA 3AG3B 1VP7A 3AK3A 4JZGA 5IJ0A 4YY3B 2DW4A 5H6QA 4DR5O 2EILB 4DR5B 2B9ZA 4U3FH 4JV5O 4JV5B 3UKMA 2X0LA 3IC7A 1ZL8B 2PI4A 4JI0O 4JI0B 3E83A 1EFRG 3CXCU 5GTIZ 1BZKA 3BAAA 3ETGA 3DXRA 1W0KG 5F2VO 1JR9A 1CPYA 3APQA 3WB0A 4GKKO 1F23A 4GKKB 5BY1A 1MMMA 2IJHA 4F4LA 4ASUG 2ZDIC 1NH2B 4ZHQA 2BSKA 5CA1B 5CB4B 2OTLV 2XNDG 4WBNB 1WN7A 3E35A 1JVMA 5LMNO 5LMNB 4W4LA 1SRYA 1IURA 2ZINA 4LFBO 4LFBB 4TV8B 1B6QA 3RBZA 3PJSK 3OEEG 4H44B 2DWDC 3CRRA 2DYRC 3S3XA 1AB3A 3AG2B 4NTYA 1XMQO 3JATA 4JYBA 2ZXWB 3SYCA 3K5MA 1IXMA 3MAQA 2RJZA 5IYZA 2RN9A
chains in the Genus database with same CATH topology
5B5EZ 5KAFZ 3A0HZ 5TISZ 3JCUZ 3A0BZ 3KZIZ 5B66Z 4UB8Z 2AXTZ 1S5LZ 3WU2Z 5KAIZ 4IL6Z 5H2FZ 5GTHZ 5GTIZ 4UB6Z 5E79Z 4PJ0Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E Z;  5KAF Z;  3A0H Z;  5TIS Z;  3JCU Z;  3A0B Z;  3KZI Z;  5B66 Z;  4UB8 Z;  2AXT Z;  1S5L Z;  3WU2 Z;  5KAI Z;  4IL6 Z;  5H2F Z;  5GTH Z;  5GTI Z;  4UB6 Z;  5E79 Z;  4PJ0 Z; 
#chains in the Genus database with same CATH topology
 1YTF D;  4ZOL A;  4JI4 O;  4JI4 B;  3M99 B;  1SF9 A;  2EIM B;  5FL7 G;  3UT5 A;  3WFV A;  1ENV A;  3RYF B;  4MVO A;  2HG5 C;  4DV3 B;  2KB1 A;  4FM0 A;  3SJB C;  2W6I G;  2VQE O;  2UUB O;  2VQE B;  2UUB B;  3CCJ V;  1SQB H;  1K5Q A;  3CC4 V;  2Q7E A;  3ZHV A;  2XTA A;  1O9H A;  2ZNI A;  1KQS U;  1KYO F;  2Z5U A;  4O4L A;  4I5S A;  4K8X A;  3LDD A;  1AP5 A;  5FPR A;  3SDL A;  2JS3 A;  5HFL A;  1R1B A;  4JYY A;  2RQ6 A;  3WB1 A;  3N2K A;  2DJV A;  2EJR A;  3L70 H;  5KHK A;  4K3A A;  4GCZ A;  3K58 A;  1M93 A;  1BL8 A;  4UVA A;  1Z5W A;  4YJ2 A;  4NKG B;  3X2Q B;  1SA0 B;  2WLI A;  1GN3 A;  4LF8 B;  4DR2 O;  4LF8 O;  4DR2 B;  5IT9 N;  4FMT A;  2AHZ A;  3E8F A;  1YXB A;  2P7T C;  2Q7H A;  2W0X A;  3ASN C;  1JCH A;  3M7M X;  4P2Z A;  4UCS A;  1PNL A;  4LFC O;  4LFC B;  4LFA O;  4LFA B;  3B2E E;  3P3P A;  3QTC A;  4TQF A;  3CCV V;  1JX9 A;  2Q69 A;  3CRA A;  3SPH A;  2IJI A;  4EEQ A;  4FPP A;  3ZMT A;  2E5L O;  2E5L B;  2Q0A A;  3U10 A;  2OYQ A;  5CMU A;  2YI8 A;  2NNU A;  3M8A A;  3D36 C;  4A5U B;  2PYJ A;  5JWP A;  4FLW A;  1YJN V;  2XAG A;  4B3T O;  4B3T B;  4DYL A;  3QO8 A;  2X7R B;  4MVR A;  3JD0 A;  4RUF A;  1TAE A;  5H6R A;  5IWA O;  3OMA B;  5IWA B;  5B3S B;  3QNE A;  2QR4 A;  1IBM O;  1IBM B;  5LGT A;  2CK3 G;  3SPG A;  3AK2 A;  2WA3 A;  3K0G A;  1SS3 A;  3R65 A;  3CMA V;  4X20 B;  3L72 H;  4FLU A;  3MD0 A;  2BTQ A;  5B66 Z;  4WCE V;  3VBB A;  3SYQ A;  4B08 A;  5IE9 A;  1XBL A;  2YEV B;  3U11 A;  1GN2 A;  5KHH A;  1H8H G;  3OW2 U;  2HKO A;  5IJ0 B;  3K06 A;  5B1O A;  5L3C A;  2P4K A;  2L6L A;  2GUZ A;  4FLV A;  1HW7 A;  1LUW A;  4RO2 A;  5B1A B;  2BE3 A;  3DXR B;  1SER A;  1R3K C;  4YJ3 A;  4UVC A;  5IY5 B;  4UCU A;  4Q6G A;  4DW0 A;  4I4T B;  2ZD9 A;  3ZHU A;  1S77 D;  1K92 A;  3B40 A;  4ZHQ B;  2WPD G;  2BSK B;  3E8B A;  1YHQ V;  1I5X A;  4DV4 O;  4DV4 B;  3OTO O;  3OTO B;  1Q82 W;  4MVM A;  4I7Z B;  1SQG A;  3FYI B;  3G4S V;  4QPJ A;  3ZRX A;  4DV5 O;  4DV5 B;  1N4C A;  2OCC B;  3AG1 C;  3JAT B;  1V54 C;  3H1J H;  1OCC B;  3JCU Z;  2Q6A A;  5KLV H;  1AP6 A;  1NBM G;  3UO2 A;  2IM9 A;  4PD4 F;  4PDV A;  2VWK A;  1Q90 D;  4B3M O;  4B3M B;  4IL6 Z;  5IYZ B;  4PI0 A;  3BVO A;  1L0L H;  3OR6 C;  1OCZ B;  4KFM A;  4ZOL B;  3JAK A;  1XHX A;  2CE4 A;  1ZAU A;  3UT5 B;  3N27 A;  5CN0 A;  3ZN1 A;  2QE7 G;  4PDR A;  3T4D A;  2IJK A;  4GX1 A;  3JAW A;  1TUB A;  4CH6 A;  2VRZ A;  4B3S O;  5B1B C;  4B3S B;  1SQF A;  2WLK A;  3OUF A;  2VQF O;  2VQF B;  3H1I H;  4ABM A;  1VF6 C;  3CWB H;  3E8G A;  2OT5 A;  1SQP H;  2LGW A;  1MOF A;  2NR5 A;  4O4H A;  2N04 A;  4X1K B;  3BFR A;  1VQL V;  1VQP V;  3CCS V;  3JD3 A;  2H3O A;  3N2K B;  4LF5 O;  4LF5 B;  1BSM A;  1VAR A;  2ZR3 A;  1HR0 O;  1HR0 B;  4QGP A;  2E76 B;  3UCS C;  4X62 B;  4YJ2 B;  2WLI B;  3K03 A;  5HFM A;  5BZB A;  1AJP A;  2EIJ B;  1H2M A;  3QG5 A;  4N23 A;  4MTG A;  1NR1 A;  4DW1 A;  1BE3 H;  3HB3 B;  1BQZ A;  2Q4P A;  2XAS A;  1FFX B;  1Y66 A;  4HNA A;  4GLX A;  1WPB A;  2WWW A;  3A0R A;  3F7Y C;  4NTW A;  1QR9 A;  1E1R G;  4DR6 O;  2ZR2 A;  4DR6 B;  4GKJ O;  1XMO O;  4GKJ B;  1PL0 A;  1XMO B;  3JSL A;  1FXV A;  1EZV H;  1CP9 A;  5KHG A;  1VQN V;  4UB6 Z;  1QU7 A;  4DV1 O;  1KC8 W;  4DV1 B;  3LUT B;  4NTX A;  2YXY A;  1NTZ H;  1DK1 A;  5LXT A;  2ITC C;  2WLM A;  2ADQ B;  1QQC A;  5K1X A;  1XI1 A;  1F4N A;  3WU2 Z;  1H2K A;  5EIB D;  1MNG A;  3ABL B;  4YIO A;  1VQ8 V;  4I9W A;  3T1C A;  2P06 A;  2ZE5 A;  2P4V A;  1HNX O;  1HNX B;  3SPJ A;  1YTF B;  1K33 A;  3ZRS A;  2AGA A;  2BTQ B;  1L0N H;  5FLX N;  3B77 A;  3TET A;  3AG3 C;  3B8M A;  3H1H H;  1FAF A;  4U7N A;  2HJD A;  3G6B A;  4TUY A;  1XIL A;  1FFT B;  2FTK A;  1YSC A;  1EN4 A;  2QKA A;  2GUZ B;  5JJN B;  2N05 A;  3JAM N;  2QWO B;  5JCO C;  3F5T A;  1N34 O;  1N34 B;  4YJ3 B;  1Z2G A;  3E2E A;  4WFE A;  3SR2 C;  2R72 A;  2ODM A;  5GTH Z;  1VQO V;  3ZCC A;  3E22 A;  4I50 A;  1JJ2 U;  1N8R W;  3LDC A;  3TXQ A;  2KQX A;  3H9V A;  5DM6 V;  3ZED A;  4FLY A;  3BA9 A;  4Q20 A;  1Q81 W;  1COW G;  5DEC A;  2MK3 A;  3FYE B;  4ZI7 A;  2JRI A;  1K4D C;  4LWS A;  3UQ8 A;  5LA6 A;  1HP8 A;  2V1D A;  1ZX3 A;  1AIL A;  3OGI B;  3AG2 C;  2IU0 A;  1B3Q A;  2RMK B;  2LFS A;  2ZXW C;  1WLE A;  3ZS8 C;  3K59 A;  2EZO A;  1I94 O;  1I94 B;  1S0V A;  1PKX A;  4DR4 O;  4DR4 B;  1RP3 B;  1N36 O;  1N36 B;  2UXC O;  2UXC B;  3CCL V;  3ETQ A;  2CTR A;  1JPX A;  2EUL A;  2EIM C;  3JAK B;  4TQD A;  3T1H O;  5BR8 B;  2HEP A;  4WFA V;  3T1H B;  3OE7 G;  1WP8 A;  4XBF A;  1OV9 A;  1M5I A;  5H9C A;  5E79 Z;  4X88 A;  4U3J A;  4JI6 O;  4JI6 B;  5C93 A;  2B5U A;  4KXR A;  4CBC A;  3ETD A;  3JAW B;  2W6J G;  5ITZ A;  5K1P A;  1HWY A;  1EBO A;  3LSS A;  3EFF K;  3K3W A;  5H5N A;  4DV6 O;  4DV6 B;  4JI3 O;  4JI3 B;  1DGS A;  2PZS A;  2QWQ B;  4B7E A;  4D7S A;  4JAU A;  3T4Z A;  4AI8 A;  2XAF A;  5J2U A;  1KU9 A;  1SZT A;  2W0F C;  4O4H B;  3TXS A;  1VEW A;  4KP4 A;  4JI7 O;  4JI7 B;  3K5N A;  2ZIO A;  3K57 A;  1CXZ B;  4J9Y B;  4LR3 A;  2IW5 A;  5BXZ A;  3IFX A;  2AXT Z;  3TGU H;  2A7W A;  2RCV A;  2QKS A;  3X2Q C;  1FPO A;  4QNH B;  1VQ4 V;  2ZE6 A;  3MHH C;  4YIP A;  2HR3 A;  3APO A;  1P7G A;  1Q7Y W;  5EK0 A;  4R7C A;  4HNA B;  3K79 A;  3HKE A;  3K9S A;  5LGU A;  2V4D A;  2O57 A;  1AI7 A;  3KKY A;  1QBZ A;  1M56 B;  4JTA B;  1I0H A;  5KHJ A;  1XNQ O;  1XNQ B;  1D5A A;  1AVM A;  3CE2 A;  2DN9 A;  1M4U A;  3D8C A;  4DR7 O;  5BMV B;  4DR7 B;  5L3E A;  5LXT B;  4MVS A;  3JD4 A;  5LOV A;  1F51 A;  1X4T A;  2WLL A;  2IBZ H;  5B3S C;  3OR7 C;  1AR1 B;  3CCQ V;  1GH6 A;  3A2F A;  4TV9 A;  4QPK A;  1ROP A;  5H2F Z;  2D2C B;  3ZMV A;  1V55 B;  2UXB B;  2UXB O;  2PI5 A;  4BR6 A;  4J41 A;  5L3G A;  4PHZ A;  4LBE C;  4LF6 O;  4LF6 B;  3EVK A;  2UUC O;  2UUC B;  1QNM A;  1Y74 A;  4FZ1 A;  1XMQ B;  2K9P A;  1S72 V;  5EZY A;  2HHH O;  4ICG A;  2HHH B;  3OMI B;  4TUY B;  1XNR O;  2DE0 X;  2X6B A;  1XNR B;  2KG7 A;  4CH5 A;  4FZ0 A;  5B1A C;  4BIO A;  1BT8 A;  4LF9 O;  4LF9 B;  3CEI A;  3N2G A;  1R3I C;  1WA8 B;  5IY5 C;  2CH7 A;  3ML0 A;  4FFK A;  2F23 A;  3E22 B;  4X9Q A;  1WNS A;  1OJH A;  3ZIA G;  3CXH F;  3STZ C;  1YVW A;  5JVD A;  1NI8 A;  4X1I A;  3ZHR A;  3S3W A;  4L87 A;  4HZ3 A;  4ZI7 B;  4BIU A;  2HLD G;  3U0Z A;  2QTS A;  4DV7 O;  4DV7 B;  1SET A;  4LWS B;  3CRQ A;  5LA6 B;  2ZKO A;  4FLZ A;  3BA8 A;  1JJO A;  1P7B A;  3G67 A;  1GK9 A;  1OCC C;  1F7Y A;  2YS8 A;  4PDL A;  2DYS B;  4O4I A;  4IT5 A;  3WG7 B;  1H2L A;  4JZ2 A;  2XHB A;  3ABK B;  2EBO A;  1OCZ C;  3GWK C;  2OWO A;  4UB8 Z;  5KUM A;  5JJE B;  4I55 A;  5JH7 A;  4DK1 A;  4GX2 A;  3LSU A;  3JAS A;  4U3J B;  1VIB A;  4GX0 A;  1PD3 A;  1SQX H;  4JTD B;  5IJ9 A;  3RYC A;  4B3R O;  5ITZ B;  2A06 H;  3CX5 F;  4B3R B;  2HP8 A;  3E86 A;  1Y76 A;  3JAR A;  1FXK A;  1K5S A;  1M1K W;  1JOY A;  3CCU V;  1AJN A;  1RSO B;  4XDL A;  1URF A;  2YI9 A;  3LDE A;  3SPC A;  3HKB B;  4FIP C;  5J2U B;  1UFI A;  3W7T A;  1Q86 W;  3DTU B;  2C2A A;  4EB6 A;  4IHJ A;  3QO7 A;  3THO A;  1H2S B;  2VS0 A;  4OGQ B;  5JJJ B;  2FML A;  1Q43 A;  1SES A;  2KSD A;  1K97 A;  1OCO B;  5EC1 C;  4P9O A;  5KMG B;  4LH7 A;  3CJH A;  3IGA C;  2EIJ C;  1LUV A;  3TJT A;  4ZIB A;  1WPX A;  2Y4T A;  4NB5 A;  2VWJ A;  2JGD A;  4LNU A;  4UVB A;  2ITD C;  1IX9 A;  2PF4 E;  4JGS A;  3HKE B;  4OPA A;  1NTM H;  3D3I A;  3KCY A;  5AG2 A;  1D2D A;  3C3S A;  5J2T A;  5CBF A;  2M7W A;  1QVG U;  5A9G A;  1NVP D;  1Q3E A;  4H13 B;  3HPL C;  1KP2 A;  4R8C A;  4MSW C;  3CRC A;  3CS5 A;  3GB7 C;  4J10 A;  5KX5 A;  5LOV B;  3OAA G;  4J9Z B;  1ORQ C;  3VQX A;  1J95 A;  1I5Y A;  1BHB A;  4CH3 A;  2CTW A;  2LW7 A;  4X66 O;  4LP8 A;  4X66 B;  2LFR A;  3E89 A;  1NU1 H;  2CAZ C;  4TV9 B;  3KZI Z;  3WB2 A;  3OD4 A;  3RYI A;  3SJA C;  4I0X A;  2EIN B;  4P9P A;  1RM1 C;  1K73 W;  1AI5 A;  3G71 V;  1Y74 B;  3ZHS A;  2WLH A;  3KG2 A;  1P84 F;  4QJF B;  3I56 V;  4N21 A;  3B09 A;  3H01 A;  3SJC C;  1D5N A;  2UU9 O;  2UU9 B;  2ZE7 A;  1QCE A;  4X89 A;  1E79 G;  2EIK B;  4MTF A;  1L1F A;  2XUM A;  4O2A A;  2CUG A;  3QVN A;  4DRX A;  3N2G B;  1Q8I A;  2UXD O;  2WSS G;  2UXD B;  5A2Q N;  2CH7 B;  3ASO B;  3A8T A;  2QKC A;  4J7K A;  1R6K A;  3ABM B;  3NR7 A;  2Y48 A;  4E4E A;  5JVD B;  1N0N A;  4MVU A;  1Q6I A;  3O65 A;  4X1I B;  2Q9L A;  1GTO A;  4O4L B;  1NZ6 A;  5EBM C;  1XUQ A;  1S3J A;  3FKS G;  2HVK C;  1YF2 A;  2YSU B;  1BS3 A;  2Q5Z A;  2NLJ C;  3BAB A;  5L3B A;  4X65 O;  4X65 B;  4G27 B;  1THZ A;  3HKC A;  2Q7G A;  3GWO A;  3ZX6 A;  2X6A A;  4JI8 O;  4JI8 B;  3H1K H;  1Y67 A;  4ZKI A;  1GMG A;  2Q67 A;  4O4I B;  4OPH A;  4EFB A;  2YXL A;  2P22 C;  3ZRW A;  4PEL A;  3IJ4 A;  4I55 B;  5JH7 B;  2LO1 A;  1RPR A;  3AK1 A;  4D6T H;  3JAS B;  1PNM A;  3CYO A;  1VQM V;  3R66 A;  2YC0 A;  3RW0 A;  5IJ9 B;  4KUM A;  1OCR B;  3RYC B;  4AHC A;  4PJ0 Z;  1Y76 B;  3JAR B;  2PY5 A;  1FXK B;  3OTF A;  4D7T A;  2XAQ A;  3ABU A;  2P67 A;  4DR1 O;  2WAM A;  4DR1 B;  3A0B Z;  1YIT V;  4NYK A;  3SJQ C;  5B1N A;  1QLE B;  2CGN A;  3SPI A;  1ZL8 A;  2HFE C;  3VQW A;  2CTP A;  3JAL A;  2QTO A;  4EB6 B;  4IHJ B;  3IAY A;  1H2G A;  1XQ8 A;  4BW5 A;  4MTX A;  1W0J G;  2Y0P A;  5GON A;  4UUJ C;  3CJH B;  2QA4 V;  2LP7 A;  2NN4 A;  5E1A C;  2PGG A;  4KL1 A;  2Y69 B;  5CA1 A;  2R9R B;  1BMF G;  3GVM A;  3AG7 A;  5CBH A;  2JGD B;  4LNU B;  4O4J A;  4UXN A;  2YIB D;  1OZ0 A;  1K7D A;  3AG4 B;  2EIL C;  2QWP B;  4J42 A;  5D5P A;  1R6N A;  1M56 C;  5J2T B;  2A79 B;  3FAV A;  4NXM O;  4NXM B;  3B4S A;  3P32 A;  3RVZ A;  4FLT A;  3ETE A;  4KHP O;  4KHP B;  4FK5 C;  5LP6 A;  5KX5 B;  1NT2 B;  3ZRV A;  2P6J A;  3QF7 A;  3UM7 A;  2ZQM A;  1E1Q G;  2K1E A;  5EC2 C;  3CCE V;  1V55 C;  4BW9 A;  3FB6 C;  3RYI B;  2BOB C;  1T5E A;  3RYF A;  4I0X B;  1Q5O A;  4K0K O;  4K0K B;  1ARO P;  3OUS A;  1RFY A;  1XDC A;  1FJG O;  1FJG B;  1KMI Z;  3D3Q A;  4NVP A;  1MSD A;  1N32 O;  1N32 B;  4U7O A;  3DC6 A;  2N74 A;  3CRM A;  2IH3 C;  1UPG A;  3LSQ A;  1NQT A;  4LC1 A;  3NXS A;  1WB8 A;  5JQG A;  2EX3 A;  1XRE A;  1ZUQ A;  1K8A W;  5LYJ A;  3K5L A;  3O9O A;  1M90 W;  4DRX B;  4MS2 A;  5C8Y A;  2V7Q G;  4ZBM A;  3FB7 C;  1TUB B;  4H33 A;  4PA4 A;  3W7U A;  2PYL A;  4OX9 O;  4OX9 B;  3T1Y O;  3QO5 A;  3T1Y B;  3RYH A;  1VQ7 V;  3VOU A;  2JDI G;  4JI5 O;  2JIZ G;  4JI5 B;  3CHX A;  1R3L C;  1R3J C;  5FNV A;  2GTS A;  2R9A A;  4CH4 A;  3PN1 A;  2YIB A;  4PA9 A;  1BGY H;  1KB9 F;  5IYC O;  2HJF C;  2PTM A;  3VQY A;  2GV9 A;  2ZT9 B;  3JSN A;  4JYA O;  2LGQ A;  4JYA B;  1VF5 B;  4MVZ A;  1YEW A;  2DYS C;  2ZM6 O;  2ZM6 B;  5KAI Z;  5CA0 A;  3WG7 C;  4CZZ A;  1Q6U A;  3ABK C;  1JQ0 A;  5FPO A;  1S5J A;  3OT7 A;  3ZRW B;  1NJI W;  2DWE C;  1VQ5 V;  2ZDI A;  3OGC C;  4DV2 O;  4DV2 B;  2GTA A;  1IZ3 A;  1VQK V;  2ZIM A;  5KA5 A;  4MW8 A;  4RAI A;  4LF4 O;  2E75 B;  4LF4 B;  2A0L A;  4X20 A;  1S5L Z;  1IBL O;  1IBL B;  1JA8 A;  4C7U A;  1AR5 A;  3TCU A;  1M57 B;  1B06 A;  4G2K A;  5IYD O;  4RUE A;  1OHH G;  2JS5 A;  1H8E G;  1S5H C;  3CCM V;  1YDX A;  2PUS A;  5D5Q A;  3CCR V;  2OTJ V;  4YY3 O;  2DQ3 A;  4X1Y A;  3AEI A;  5CA3 A;  3CME V;  1G1X B;  4RWU A;  3JAL B;  4HAM A;  3G80 A;  1OCO C;  4MT8 A;  1KD1 W;  2WLJ A;  5GON B;  4L8J A;  4JAA A;  4TT3 G;  4I4T A;  1AI6 A;  2ATK C;  1M9N A;  1N0J A;  4IYI A;  4UCO A;  3OM3 B;  3ZMZ A;  1SKV A;  4O4J B;  1LNQ A;  3K5O A;  4JAS A;  1HNW O;  1HNW B;  1KUQ A;  1N33 O;  1N33 B;  1GO3 F;  2LJ2 A;  3ZMS A;  1DF4 A;  3FAV B;  4W4K A;  3FB8 C;  3RWR D;  3BRC A;  2Q68 A;  4WFB V;  2JEU A;  1KBH A;  5L3F A;  4PA6 A;  5LP6 B;  5LGN A;  4IIJ A;  2BOC C;  5EBL C;  3BHP A;  4I50 B;  3BY6 A;  3DC5 A;  2GDS A;  2Z3Y A;  4WFF A;  4JTC B;  2KKW A;  3OMN B;  1JFF A;  1IXB A;  1PPJ H;  3JCZ A;  4DR3 O;  1P49 A;  4DR3 B;  4QE7 A;  4DK0 A;  3BEH A;  4PDM A;  1WAZ A;  2EIN C;  3LNN A;  1MSW D;  4DV3 O;  2QDO A;  4BWA A;  1XL6 A;  1QHT A;  1HDJ A;  2JJ1 G;  1Y4M A;  3B8N A;  2AHY A;  2F95 B;  3E8H A;  3RVY A;  2OCC C;  5DN6 G;  2GBO A;  3ZMU A;  3D36 A;  2FYU H;  2FL4 A;  4R50 A;  1ZSP A;  4R6Z A;  2GSM B;  3L74 H;  1G8M A;  3MHS C;  2EIK C;  4CS2 A;  3CC7 V;  5JQG B;  2G38 A;  4J11 A;  4X1K A;  3CP1 A;  4DXW A;  1EN6 A;  2QSA A;  1PNK A;  5LYJ B;  2EZP A;  5C8Y B;  4UV9 A;  3ASO C;  4UFZ A;  2ZCE A;  4YHH O;  4YHH B;  4XDK A;  2YIC A;  3ZN0 A;  3ABM C;  2IJJ A;  1SQQ H;  3A0H Z;  4P30 A;  2R70 A;  3RYH B;  2XT9 A;  3I5D A;  4NR1 A;  4K8Z A;  1FFX A;  2E74 B;  2BCC H;  4Z2W A;  2OIG A;  4PI2 A;  1WJZ A;  5IYB O;  5FNV B;  4FFB A;  4G28 B;  1J5E O;  1J5E B;  3W7W A;  1VQ6 V;  1XOU A;  1BQ0 A;  2UUA O;  2QEX V;  2UUA B;  1G4Y B;  1KKD A;  1NR7 A;  1FKA O;  1AJQ A;  1W59 A;  4OXS A;  4WF9 V;  3SYO A;  4K35 A;  5CA0 B;  1V9P A;  4QIW F;  4LH6 A;  4F6R A;  1TA8 A;  4UCV A;  1IDS A;  1TGO A;  4F6E A;  2B1I A;  1LR1 A;  3UO3 A;  1EZJ A;  3HR0 A;  5LHH A;  3T2M A;  1IBK O;  1IBK B;  3K0D A;  3FX7 A;  5TIS Z;  4AIL C;  1OCR C;  1W2B U;  3HKD A;  2ZE8 A;  4FVM A;  1HNZ O;  1Y6X A;  4WFG A;  1HNZ B;  4JI1 O;  4JI1 B;  3L71 H;  2QM7 A;  1QVF U;  2OCH A;  3STL C;  1AI4 A;  1XHZ A;  2DYR B;  1FYJ A;  1FXK C;  2AW9 A;  1A32 A;  2CGO A;  3L9D A;  1SC5 B;  2ILM A;  2YIA A;  2EJ7 A;  2QGN A;  1QLE C;  4X1Y B;  2WLL B;  4CC5 A;  2P5O A;  1X59 A;  3CD6 V;  2FB5 A;  1XEQ A;  3J80 N;  4DV0 O;  4DV0 B;  3ABL C;  2RDC A;  2A3Q A;  3RFR A;  5KHI A;  3JYC A;  2RNB A;  2YID A;  1R6T A;  3Q4H A;  4LF7 O;  4LF7 B;  3L75 H;  1KP3 A;  3J7A U;  3W7X A;  5EYP A;  4JF3 A;  4B7K A;  5L3D A;  2UXN A;  4TOI A;  3CC2 V;  1NTK H;  2Y69 C;  1AR4 A;  1TVK A;  5DED A;  3P30 A;  5GW7 A;  1KEC A;  3F5W C;  1PP9 H;  3FD9 A;  2Q73 A;  5EZY B;  3AG4 C;  1MZF A;  3JD2 A;  4IYH A;  3CPW U;  2ADP A;  1VF6 A;  4H0L B;  2UXX A;  3K04 A;  3RT3 C;  1YJW V;  2KG7 B;  3RGB A;  1K9M W;  1ZLZ A;  1FD9 A;  2WA4 A;  1P4R A;  1NH2 D;  3IC9 A;  4BIZ A;  3L73 H;  2QM4 A;  4IIJ B;  1PV0 A;  4H37 A;  2L35 A;  1FS0 G;  3SYA A;  1JFF B;  1G6U A;  5LBQ A;  2GHY A;  1BCC H;  3ASN B;  2H94 A;  4J7Z A;  1FXH A;  4O2B A;  4MVQ A;  3FB5 C;  2F43 G;  2Y4U A;  5J9P C;  1IVS A;  1GM8 A;  1Z5V A;  4J80 A;  2ZNJ A;  1SZX A;  4BAY A;  1DLB A;  4GT1 A;  2D3O W;  2F93 B;  1GM7 A;  4I9Q A;  3BPZ A;  4JI2 O;  4JI2 B;  1PL4 A;  3CSX A;  3ZHT A;  2ETN A;  1YI2 V;  3DGE A;  4FLX A;  2DMX A;  2YDE A;  3RN4 A;  4RQF A;  4X62 O;  2IH1 C;  4MTO A;  1XL4 A;  2Q8V A;  4RQE A;  2JK5 C;  1GKF A;  2LQT A;  3G6E V;  3ZJZ A;  3VQV A;  1CEZ A;  5KAF Z;  4PA7 A;  3C90 A;  1S76 D;  1R73 A;  3C3T A;  1MA1 A;  4CC6 A;  4Z1M G;  4FFB B;  1MZE A;  4EKW A;  3BCC H;  4GX5 A;  1H2N A;  1WP7 A;  3K08 A;  1L8D A;  2WLN A;  1GRJ A;  3FFQ A;  5JCO A;  5BMV A;  2A9H A;  4FJC C;  2JJ2 G;  3ZBH A;  3JD1 A;  4F6R B;  2ARH A;  2Y0I A;  1I7F A;  4XDJ A;  5CB4 A;  3EHB B;  4WBN A;  1QLN A;  4TSF G;  4TV8 A;  1RPO A;  2CTQ A;  1UJW B;  3HKD B;  4GZR B;  1M57 C;  1VF7 A;  1RM1 B;  1GM9 A;  2XOK G;  4DUY O;  4DUY B;  1JMK C;  3KCX A;  3P3N A;  4DUZ O;  2AZ0 A;  4DUZ B;  1PM9 A;  2OIE A;  1YIJ V;  3MDS A;  3CB2 A;  3AG1 B;  3SYP A;  3ICX A;  1GN4 A;  1V54 B;  2B1G A;  4UCT A;  2BTO A;  5B5E Z;  3DSQ A;  1NKD A;  2R9I A;  4PV1 B;  2JGU A;  1H38 A;  2QWR B;  5LHG A;  2Q0O C;  3EXA A;  2E3C A;  3Q4H B;  2X6C A;  1DTO A;  4X8A A;  1EN5 A;  1WA8 A;  2YUA A;  5EYP B;  1B04 A;  2P90 A;  5CBG A;  1YJ9 V;  4GUN A;  1K3E A;  2F4V O;  2F4V B;  1TVK B;  1K34 A;  3J81 N;  1WB7 A;  5B1B B;  4LCU C;  4UV8 A;  1Q6H A;  5KA6 A;  2QM8 A;  4HBN A;  1TUE B;  2JEX A;  4JPR A;  1DF5 A;  2YXH A;  2H8P C;  3H1L H;  3F7V C;  5EBW C;  3ZHQ A;  3OFN G;  5LHI A;  1YZB A;  3TK1 A;  4J7J A;  1KKC A;  5IDJ A;  4O2A B;  4UCR A;  1U97 A;  1MG1 A;  5LP6 C;  3W7S A;  1GAX A;  2FKX A;  4HYO A;  1YCI A;  4EFE A;  1EM1 A;  3K9A A;  4QE9 A;  5LMU O;  5LMU B;  4TWK A;  1SA0 A;  1ZTE A;  4IGG A;  4PA3 A;  1F4M A;  1NS1 A;  5BR8 O;  2JVD A;  1GN6 A;  4O2B B;  2M6Y A;  2XAJ A;  2XAH A;  4GYC B;  4FM2 A;  4FM1 A;  3OEH G;  4JAV A;  1K4C C;  1U96 A;  4MW3 A;  1BHA A;  4JYC A;  4AQY O;  3HKC B;  4AQY B;  2QJ1 A;  4YXW G;  3I55 V;  2F66 C;  2F1M A;  1VMG A;  3LNM B;  1RSO A;  2HVJ C;  4WFH A;  1NVP B;  2CDY A;  4CS3 A;  5KUK A;  1ZWI C;  2MW2 B;  3HKB A;  1VQ9 V;  1SQV H;  2AZ2 A;  2IU3 A;  4E2L A;  3SGI A;  2LW1 A;  1QR8 A;  5EIB C;  4X64 O;  4X64 B;  2DOS A;  3ABT A;  1US6 A;  5KMG A;  2Z0A A;  4Z1V A;  5LL6 Y;  1MAB G;  4DO2 A;  4CS4 A;  2DQ0 A;  2QWN B;  2YEV A;  1I08 A;  4NXN O;  4NXN B;  1O9G A;  3AG3 B;  1VP7 A;  3AK3 A;  4JZG A;  5IJ0 A;  4YY3 B;  2DW4 A;  5H6Q A;  4DR5 O;  2EIL B;  4DR5 B;  2B9Z A;  4U3F H;  4JV5 O;  4JV5 B;  3UKM A;  2X0L A;  3IC7 A;  1ZL8 B;  2PI4 A;  4JI0 O;  4JI0 B;  3E83 A;  1EFR G;  3CXC U;  5GTI Z;  1BZK A;  3BAA A;  3ETG A;  3DXR A;  1W0K G;  5F2V O;  1JR9 A;  1CPY A;  3APQ A;  3WB0 A;  4GKK O;  1F23 A;  4GKK B;  5BY1 A;  1MMM A;  2IJH A;  4F4L A;  4ASU G;  2ZDI C;  1NH2 B;  4ZHQ A;  2BSK A;  5CA1 B;  5CB4 B;  2OTL V;  2XND G;  4WBN B;  1WN7 A;  3E35 A;  1JVM A;  5LMN O;  5LMN B;  4W4L A;  1SRY A;  1IUR A;  2ZIN A;  4LFB O;  4LFB B;  4TV8 B;  1B6Q A;  3RBZ A;  3PJS K;  3OEE G;  4H44 B;  2DWD C;  3CRR A;  2DYR C;  3S3X A;  1AB3 A;  3AG2 B;  4NTY A;  1XMQ O;  3JAT A;  4JYB A;  2ZXW B;  3SYC A;  3K5M A;  1IXM A;  3MAQ A;  2RJZ A;  5IYZ A;  2RN9 A; 
#chains in the Genus database with same CATH homology
 5B5E Z;  5KAF Z;  3A0H Z;  5TIS Z;  3JCU Z;  3A0B Z;  3KZI Z;  5B66 Z;  4UB8 Z;  2AXT Z;  1S5L Z;  3WU2 Z;  5KAI Z;  4IL6 Z;  5H2F Z;  5GTH Z;  5GTI Z;  4UB6 Z;  5E79 Z;  4PJ0 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...