5KAFZ

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kafZ00
4PJ0Z 5E79Z 5H2FZ 5TISZ 5GTIZ 5GTHZ 4UB8Z 3WU2Z 3JCUZ 5KAFZ 4UB6Z 3KZIZ 1S5LZ 2AXTZ 5KAIZ 5B66Z 3A0BZ 4IL6Z 5B5EZ 3A0HZ
chains in the Genus database with same CATH superfamily
4Q6GA 4JYAO 1PNKA 5JCOC 1HNZO 3BFRA 3RW0A 4DR5B 4FM2A 2DE0X 2GBOA 2LFSA 3HKDA 3I55V 1H2MA 1TGOA 2VQFB 4I55B 4AQYO 2LW1A 1CP9A 4YHHB 3RYIA 1SESA 1WJZA 2EILC 5KLVH 3ZN0A 1FYJA 1BQ0A 3ETQA 1YZBA 1YI2V 4JAUA 1BT8A 4B3MB 2YI9A 1JJOA 4H13B 4PHZA 3BRCA 5KUKA 5IWAB 4OX9B 2CUGA 3LDEA 2IJKA 1W0KG 1VQ5V 1JMKC 4JYCA 3STZC 1NKDA 1GTOA 2GTSA 4JI6B 1KD1W 4B3TB 4WBNA 3QO5A 2CE4A 3RT3C 3NXSA 4I7ZB 2NN4A 4LF6B 1N33O 2UU9B 4KL1A 4QE7A 4BWAA 2HLDG 5B1OA 2GUZB 1TAEA 4UCTA 4EFBA 4NXMO 1W0JG 1BE3H 4UV8A 4MTFA 1JX9A 3ASNC 4DR7B 1YTFB 3MHSC 5KUMA 4PA9A 4JI3O 1TUBA 5KAIZ 3TXQA 2H94A 2UXXA 1E1RG 4DK1A 3WB1A 4QPKA 4XDJA 1BHAA 4QJFB 1PL4A 1K8AW 3P3NA 3ABLB 3QO7A 1H38A 4GT1A 4FLVA 1MOFA 5CB4B 4TSFG 3EVKA 3ABMB 1OCOB 3QG5A 4ZKIA 2HEPA 3K03A 1YITV 1TA8A 4YHHO 1AR4A 3H1KH 4PA6A 1YIJV 1XNQB 2ZR2A 5B3SB 2WLKA 4P9OA 4LFAO 2DYSB 2EULA 4I0XB 4U3JB 3BCCH 5IYZB 4IHJB 4ZHQB 2UXCO 2QSAA 3E8BA 2B1IA 1EN6A 1Y76B 2XAJA 1O9GA 1IBLO 2P22C 4F6RA 3L73H 5LGTA 4RQEA 3G6BA 1WAZA 4YJ3B 5EIBD 2ZXWC 4HNAA 4DUZB 2EIJB 1NBMG 3RBZA 4TQFA 3ZEDA 4C7UA 2AXTZ 3CCQV 2XT9A 5JQGB 3CS5A 3E2EA 4B3TO 1YTFD 3OM3B 3FYEB 1RP3B 4RQFA 3ZX6A 3ABKC 5GW7A 2PTMA 4RWUA 3BAAA 1I94O 2AHYA 3G4SV 2F66C 4EKWA 2X7RB 4DO2A 1V54B 3A0HZ 3U11A 4CS3A 2JS3A 1R3IC 4JV5B 2DW4A 4CC6A 1E79G 1N32B 1L0NH 4CH5A 3JAWB 1SQXH 2AZ2A 3W7TA 3ZRWB 2KSDA 4DR4O 5LXTA 1OZ0A 4JI7O 3NR7A 1XEQA 2JGDB 1M57C 5DM6V 5DN6G 4DK0A 1IBLB 1FFXA 1THZA 3BA8A 2Q7GA 3G80A 5LP6B 4X65B 1XI1A 1BCCH 3AK1A 1DF5A 2B1GA 3ML0A 1VQ7V 4X1YB 2BCCH 3K3WA 2EZPA 2OIGA 3D36C 2EIMC 3D8CA 3U10A 4KP4A 1WP8A 3CXCU 4FLZA 3CYOA 3ZMSA 5TISZ 5H6RA 5CBHA 4K3AA 1QBZA 2EIJC 1Q6UA 2LO1A 2Q0OC 2CTQA 4BW9A 1D5AA 4PI2A 1SA0B 1VF7A 1URFA 1NTMH 4J7KA 1BQZA 3JARA 5B66Z 4I4TA 2LFRA 2YDEA 3BVOA 3E35A 3OGIB 2KQXA 1R3LC 5L3BA 5LYJA 1WPXA 1FFTB 1QNMA 3IGAC 2EJRA 3ZMZA 1GH6A 2BTQA 1ZTEA 2PZSA 3UO2A 2WLIA 4HBNA 4O4JA 3H01A 2HVJC 5HFLA 2GV9A 4GX2A 4DV5O 4UB6Z 4E4EA 2A06H 4BIZA 4JI5O 1XOUA 2Q7HA 3VQYA 4XBFA 2W0FC 2OTJV 3L70H 4PA3A 4J7JA 1MABG 4DV3B 3B4SA 5CBGA 1SQBH 1YEWA 3CJHA 4FK5C 2ITCC 3UM7A 1W59A 3LNNA 5LYJB 2KB1A 1UPGA 4UCOA 5A2QN 1JA8A 3CWBH 4J41A 4B08A 4JI4O 4TV8B 1DLBA 4MVUA 3CD6V 4MTGA 1XNRB 3OGCC 5LBQA 3JAKB 4DV0B 3K5OA 3SJAC 1K4CC 5KX5B 4YY3O 4H33A 2Y4TA 3WFVA 2QM7A 2Q7EA 2QE7G 3FB8C 1GM7A 2EZOA 4FPPA 1OCCC 3JCZA 3B8MA 4NXNB 4YXWG 2DN9A 5B1BB 3L71H 3GWKC 2NR5A 4JI0O 3C90A 3ZCCA 3ETDA 2ITDC 4FM0A 4H0LB 3ETGA 3ZMVA 1MA1A 4X1YA 2LP7A 4X9QA 4DR1B 3BEHA 3RN4A 1Q81W 1DTOA 3OMIB 2QDOA 2XAGA 1FFXB 4TQDA 1F51A 5EIBC 4UUJC 4LBEC 4UXNA 3UCSC 5IWAO 4OX9O 4WFEA 1S77D 3OR6C 5EBWC 4IT5A 3TCUA 1XL6A 2DOSA 3R65A 2PUSA 4QPJA 2ZDIC 4FZ1A 1HNXB 2EX3A 5EYPB 1OCRC 4J42A 4X20B 1AILA 1XBLA 3FAVA 3KCYA 4X62O 3CCMV 3AK3A 3TJTA 2CH7B 3SPGA 4P30A 2RDCA 3E89A 3AEIA 3LSUA 4NXMB 3RYHA 3N2KB 3B2EE 5CA0B 4MVZA 1MNGA 1Q90D 1O9HA 3AG2C 1I94B 2VS0A 3OE7G 1EZVH 2XAFA 4X1KA 4R6ZA 4TOIA 5LMNB 1P7BA 2HG5C 2JVDA 3BABA 1JOYA 3CCLV 1VEWA 5IDJA 4HNAB 2X6AA 4YJ3A 4IIJA 3SPJA 5JJEB 3MHHC 3ZHVA 1NU1H 5H9CA 4JYAB 4OXSA 5IYCO 4JI3B 3FB5C 3JD3A 3K9AA 5K1PA 4K8XA 1XMQO 3UT5A 2YEVB 3SDLA 4FIPC 2X6CA 4AHCA 1RSOA 2F23A 4U3JA 5IYZA 2UUAB 1US6A 1AR1B 1QLEC 3K9SA 2ZR3A 4Z1MG 1B3QA 2H3OA 1I08A 1K73W 4O2AB 1UFIA 4E2LA 1JVMA 1SQPH 1QVFU 1S3JA 2QTOA 1EBOA 1NT2B 4J11A 4DUYB 2EJ7A 1M93A 5E1AC 4UCVA 5KAFZ 1FPOA 4UV9A 4JGSA 1S5HC 3OTFA 5KA5A 3VQWA 4GKJO 1J5EB 3JATA 5KHHA 2BSKA 2QJ1A 3EXAA 4ABMA 1NR7A 4LF9B 1HDJA 4CS2A 1VIBA 1P84F 2WLJA 1FJGB 1ZX3A 1GKFA 2UXCB 3SYPA 2XOKG 4J9YB 1ORQC 2V4DA 4OGQB 4LF4O 3DXRB 2R70A 2UXDB 2QM4A 3M99B 5B5EZ 1H2KA 1K4DC 3FFQA 5JWPA 4DV7O 4LF7B 3K5NA 3RYFB 1ZWIC 4QE9A 2QWNB 2L35A 2YEVA 3E8FA 4BAYA 1NH2D 3UT5B 3SYQA 4NXNO 3T1CA 4DV3O 4MVOA 4IYHA 1NH2B 5IT9N 1VMGA 4WFHA 5LGNA 2O57A 4I50B 1BZKA 4LFCO 1N36O 3W7XA 3G71V 4DRXB 1DF4A 3JASB 2OIEA 4TT3G 5CA1B 4WFGA 2ZNIA 4X1KB 1YSCA 4ICGA 2RN9A 1S5LZ 2JEXA 3O9OA 3AG1C 1VQ6V 3KZIZ 1XNQO 2DQ3A 5CA0A 4X1IB 2ZE6A 2AGAA 1N36B 3RYHB 1XQ8A 1AI4A 3GB7C 4NKGB 2UU9O 3K06A 3OMNB 2CH7A 3CCVV 1Y66A 1GN3A 2LW7A 1HNWO 2IJIA 4GX5A 1HP8A 4CC5A 2HHHO 1D5NA 2Z5UA 1K97A 5EYPA 5J2UB 4J80A 1NVPD 1ZL8B 1GRJA 5JJNB 4JI2O 2IJHA 4TV9A 1Z5WA 1SKVA 3SJCC 3FX7A 2IW5A 4O4IA 4TV9B 1RPOA 1RFYA 2JRIA 1ZL8A 1A32A 1WNSA 2ZT9B 3ABKB 4X66O 2UXDO 4MVSA 1LR1A 5L3GA 1IBKB 5GONB 2DYSC 3WG7C 1YF2A 3ZJZA 4ZIBA 1W2BU 3F7VC 1VF5B 2YXHA 1N8RW 3MD0A 2QWPB 2XNDG 5BY1A 3L72H 1F4NA 3ZIAG 2CTWA 3X2QC 5B1BC 3JASA 2IU0A 5F2VO 3HKBA 1PP9H 3CRAA 1S72V 4I50A 2HP8A 4DW1A 5BR8O 4FLXA 3HR0A 2QKAA 4MSWC 4DR3B 1BHBA 4MTOA 4O2BA 1KU9A 3CHXA 2GTAA 2YXYA 2Y0PA 3RYFA 1XMOO 1AI5A 2Q8VA 5FNVA 1IDSA 1SC5B 2OCCB 1ENVA 3AG4C 1LNQA 3WB2A 3K57A 3N2GA 4BW5A 1U96A 2W6IG 1Y74A 3DXRA 3KG2A 5KMGA 3FB7C 4D7TA 5EZYB 2LJ2A 4DV2B 3CC7V 2E75B 4B3RO 1NR1A 4LR3A 4MVMA 5LL6Y 1WN7A 3SGIA 2JS5A 1M57B 2AW9A 4HYOA 2BSKB 1NS1A 1IXBA 2YIBA 1KQSU 3AK2A 4DV5B 1I0HA 2A3QA 1X4TA 1PKXA 5BMVB 1YVWA 1JCHA 4I4TB 1FXKA 3APOA 3FKSG 3CX5F 4YIPA 2XHBA 4QNHB 1WPBA 1HW7A 5KHIA 1K9MW 5LP6C 3HPLC 3JD2A 1WP7A 3JALB 1XREA 2K9PA 5C8YA 4ZOLA 1H8HG 3ZHUA 4JTAB 4O2AA 3OTOB 5GTHZ 2QR4A 4PDVA 2ODMA 1YJWV 2E76B 3E22B 4KHPO 3JYCA 1FS0G 1S76D 2V7QG 4DV2O 4JYBA 2ZCEA 1HNWB 1GN2A 4FLWA 1IXMA 2Z0AA 1L1FA 2KG7A 4DV4B 1OJHA 5ITZB 1Q6IA 1Q43A 1IBMB 2UXBB 2P4KA 3GVMA 4LFAB 3W7SA 4X64B 2AZ0A 3IJ4A 3U0ZA 2WLLB 4IIJB 3K79A 5LP6A 4JI8O 2Y69C 4JI4B 1N34O 3JD4A 2ILMA 1BGYH 1FD9A 1FXKC 4LH7A 5GTIZ 4GKKO 1VQMV 4AI8A 4F6EA 4X66B 1G6UA 2XUMA 5LXTB 3E86A 1MZEA 3G67A 3ZRWA 1VQ8V 4JI7B 2B5UA 2DQ0A 4B3SB 2WAMA 3W7UA 1P4RA 2Q0AA 2YC0A 4FM1A 4EB6B 1KECA 2UUBO 4KUMA 2R9IA 4N21A 1N32O 3N2KA 3OW2U 3ASNB 1B04A 1FXHA 1H2SB 3Q4HB 2IM9A 4MS2A 2PYLA 3B40A 3OEHG 5BZBA 1H2NA 5JCOA 3X2QB 3I56V 3FAVB 3Q4HA 1K7DA 4X20A 2F93B 4H44B 4EB6A 2GDSA 5KHKA 4PELA 3CRQA 4CH4A 1R3JC 1ROPA 1QU7A 5CBFA 5IJ0A 4LF8B 1AB3A 2R72A 5FPRA 2XAHA 4JI1B 4K0KO 4RAIA 1G1XB 2CDYA 2H8PC 1VQ4V 4DV6O 4LFBB 2QA4V 3A2FA 3DTUB 2OYQA 3WG7B 1IBKO 1H8EG 2IU3A 3J80N 4DUZO 1OCCB 1IX9A 1AROP 3SPHA 5ITZA 1CXZB 3ZMTA 2LGWA 4G2KA 2YXLA 5FLXN 1ZAUA 2E3CA 2N74A 3JAMN 4I0XA 3OUSA 2HKOA 1QCEA 4D6TH 3E22A 2HVKC 1NVPB 1V55B 2JJ2G 2DWDC 2HJDA 5LHGA 3F5WC 4I9QA 5KA6A 1KP3A 4LF4B 3HKCA 5C8YB 4BIUA 4PA7A 3HB3B 3ABLC 3CRMA 4DR5O 1YCIA 4LFCB 1H2GA 4JI0B 1SETA 3C3TA 3SPIA 5BMVA 2ZQMA 1TUBB 4UVAA 1QLEB 4LP8A 1AP5A 1DGSA 4UCUA 2FTKA 1G8MA 4DW0A 4FLUA 4UCSA 2NLJC 1S0VA 2V1DA 2Y0IA 4B3RB 3ZS8C 3TETA 3TXSA 1MG1A 2ARHA 2XTAA 3ASOB 2ZINA 2GUZA 3P3PA 4DV7B 3K5LA 1SQFA 2M6YA 5B3SC 2VRZA 4JYYA 2YIAA 2BOBC 2K1EA 3P30A 2IBZH 2ZM6O 2YIDA 4U3FH 4O4JB 5KMGB 5CMUA 4DUYO 1Y74B 5JH7A 3M8AA 1S5JA 2BTQB 4FLTA 5EC2C 3N2GB 4K8ZA 3OT7A 1KC8W 4DR4B 1ZLZA 2JIZG 5FNVB 4JZ2A 1R6NA 2VQEO 1YJNV 2Q68A 2ZXWB 2ADPA 2KKWA 5EBMC 3JARB 4X88A 5IY5B 4P2ZA 4B3MO 5AG2A 3H1IH 4Z2WA 4J9ZB 1Q8IA 2WSSG 4JTDB 1SA0A 3DC5A 4GYCB 1F4MA 2CTRA 4DV1B 2PY5A 2FB5A 2X6BA 4FZ0A 1R3KC 1VQOV 3OTOO 4JAAA 2W0XA 3K04A 1FAFA 3LSSA 2E5LO 1OHHG 2A79B 5CA3A 2WLHA 1N33B 1SZXA 4HZ3A 1YXBA 1M90W 3QVNA 2Q4PA 1L0LH 5BXZA 3H9VA 2A7WA 4YJ2B 2YS8A 2MK3A 5LOVB 4PD4F 2UUAO 1QR8A 5GONA 2ZD9A 5LMUO 4P9PA 1NQTA 1RM1C 4X89A 1OCZB 5IJ9A 1WB7A 3ASOC 4O4LB 2JEUA 3SYOA 3IC9A 4UVCA 1R1BA 1UJWB 2VQEB 5C93A 3SYAA 4MTXA 1SERA 4KFMA 3CEIA 3FD9A 2FMLA 1I5YA 5J2UA 4UVBA 4NVPA 5L3EA 4GUNA 4W4LA 1WA8A 3CCJV 1Q5OA 1EM1A 4JZGA 1M1KW 3TGUH 4L87A 2WLMA 4BR6A 4PA4A 1FJGO 3RVZA 1QHTA 1K92A 3SJQC 4X1IA 1GAXA 2ZDIA 3LSQA 2P67A 3I5DA 3FYIB 1AVMA 3AG3B 3THOA 4B7KA 4B7EA 2A0LA 4FFBB 1F7YA 1QR9A 1HNZB 5JQGA 3A0RA 1XILA 3S3XA 5L3FA 1CEZA 5CA1A 4DRXA 1Z5VA 1Q3EA 2IH3C 2Y4UA 2N05A 2R9RB 2RQ6A 5FL7G 1SQGA 5LMUB 2QKCA 5IY5C 2HR3A 3CE2A 2ADQB 1EN4A 3IAYA 4F6RB 4U7NA 1M4UA 1PD3A 4NTWA 4LF7O 4I5SA 1JFFA 1P7GA 4X8AA 1GM9A 2CGNA 2NNUA 1AI7A 1HWYA 2P7TC 5JVDB 2E74B 5K1XA 1XNRO 3OD4A 3K58A 3EHBB 4YIOA 1QVGU 3B77A 4R7CA 1M56C 5B1AB 4K35A 5LHHA 3E83A 2EIKB 3VBBA 2IH1C 1AJNA 4PDRA 1BS3A 1I7FA 4GZRB 3ZMUA 4WCEV 2VWJA 5D5PA 4GX0A 1VF6A 3BA9A 4PJ0Z 3JD1A 5CB4A 1V55C 3APQA 5D5QA 1R6TA 2R9AA 1X59A 1I5XA 2GSMB 3GWOA 4MT8A 1XDCA 4YY3B 4DXWA 3K5MA 2QWQB 2Y48A 3JATB 1Q82W 4LH6A 3SJBC 3QNEA 5H6QA 4LFBO 3AG4B 1BMFG 3CP1A 1K3EA 3ICXA 5HFMA 3IC7A 1KUQA 4LC1A 1PV0A 3OFNG 1NTZH 1TVKA 1BL8A 1ZUQA 5JVDA 3CCSV 2EIMB 4TUYB 1VQKV 1WB8A 1JFFB 4AQYB 2JDIG 5EK0A 3VQXA 3T1HB 2QTSA 2Q6AA 4LF5B 1B06A 1EN5A 5LMNO 2FKXA 2Z3YA 2ATKC 1U97A 1E1QG 4WBNB 1KBHA 1KP2A 3RYCA 3L75H 5IYBO 1AJPA 2EILB 1K5SA 3FB6C 4NYKA 4MVQA 4FFBA 3CRCA 5J2TB 4JASA 2WWWA 2DYRB 4EFEA 1RSOB 3E8GA 1Z2GA 1WLEA 4JTCB 1RM1B 2X0LA 4WFFA 2ZKOA 4ASUG 3T1YB 1Y67A 3WU2Z 3T1HO 4B3SO 1HR0O 1V9PA 4JI1O 4K0KB 3RYIB 3OEEG 2BE3A 1WA8B 4RUFA 2F4VB 2JGUA 4I55A 1MSWD 4O4HB 2CTPA 3R66A 4CZZA 4O4LA 3OMAB 4LF9O 1LUWA 2L6LA 4NTXA 4QIWF 2WA4A 3D3QA 2JK5C 1VF6C 3HKEA 2VWKA 5LOVA 2D3OW 1F23A 2P06A 3ZHQA 1HNXO 2G38A 3CC2V 1XMQB 3J7AU 4Q20A 3CRRA 2QEXV 3OAAG 5LHIA 1NI8A 4KXRA 2EINB 3SR2C 1YHQV 2N04A 4GLXA 1OCOC 3B09A 3ETEA 2HJFC 4WFAV 3JSNA 3OUFA 4QGPA 4DR2O 2OWOA 2AHZA 4MW8A 1AI6A 2PF4E 4DR3O 3LUTB 4X65O 5H5NA 1H2LA 5H2FZ 3SPCA 2Q69A 1EFRG 3EFFK 1BSMA 2EIKC 3WB0A 3CB2A 1GN4A 5FPOA 1GO3F 3UKMA 4XDKA 2D2CB 1M9NA 1KYOF 4JI2B 4CH3A 2ZNJA 5JH7B 3AG1B 1GN6A 2CAZC 3K0DA 3F7YC 1N0JA 3KCXA 4JAVA 1XMOB 5KX5A 4DV0O 1MSDA 4CBCA 4LF8O 4G28B 3E8HA 2UXBO 2LQTA 3VQVA 2ETNA 3ZN1A 3JAKA 5CN0A 3CMEV 4DR6O 1V54C 4OPAA 2C2AA 2WLNA 4J7ZA 1N34B 5IYDO 4EEQA 4TV8A 2RNBA 4FJCC 2W6JG 1N0NA 5E79Z 4LNUB 2MW2B 2YIBD 3CJHB 4LNUA 4BIOA 5JJJB 2Q9LA 1Q7YW 1GMGA 3OR7C 1NJIW 3N27A 4N23A 1LUVA 2BOCC 4H37A 3PN1A 1OCRB 5EC1C 3ZRVA 4MW3A 2PYJA 4RO2A 4JI5B 3W7WA 1KKDA 3BY6A 1G4YB 4UCRA 3HKCB 3UO3A 2F4VO 1K33A 4NB5A 5B1NA 4F4LA 4JF3A 5DECA 1SS3A 2GHYA 2WLIB 1J95A 3AG2B 2CK3G 3ABMC 2EBOA 4LWSA 2YI8A 5IE9A 3A8TA 3QF7A 1PNLA 2XASA 1AR5A 3RGBA 1JQ0A 3H1HH 2QWRB 3RWRD 4WF9V 2ZE8A 1VP7A 2IJJA 4DYLA 1FXVA 2Q5ZA 3CC4V 1B6QA 4FVMA 1RPRA 3M7MX 4XDLA 1IVSA 4NR1A 1D2DA 3RFRA 2ZE7A 1GK9A 2HFEC 1M5IA 2DWEC 4GKJB 1PM9A 1OV9A 3TK1A 2RMKB 4GCZA 4DV6B 2UUCO 1DK1A 3C3SA 3UQ8A 4LF5O 5LA6A 5IJ0B 1AJQA 4UB8Z 3ZHSA 1KMIZ 4PV1B 3ZHTA 2ZM6B 1VQLV 1N4CA 1KKCA 5A9GA 4IL6Z 3T1YO 1COWG 1SQVH 3P32A 3K0GA 1NZ6A 2Q73A 3HKEB 2DYRC 3IFXA 3PJSK 4DR1O 1T5EA 2QWOB 1MZFA 3ZBHA 4JI6O 2QGNA 3CMAV 4DV4O 3ZHRA 2JGDA 3K59A 2OCHA 4ZI7B 2WPDG 4HAMA 1XHXA 4ZBMA 4ZI7A 4IGGA 1L8DA 4KHPB 3JAWA 1R6KA 3ZRXA 3STLC 1VQ9V 2QM8A 3D3IA 3DSQA 4O4HA 1VQPV 4CS4A 2A9HA 4GKKB 2LGQA 4FFKA 2WLLA 3SYCA 5KHJA 3AG3C 2FYUH 3KKYA 4DR6B 1OCZC 3CCEV 4DR2B 2ZIMA 1Q86W 5L3DA 2F43G 2KG7B 2UUCB 2E5LB 4J10A 5J2TA 1XUQA 4AILC 2UXNA 1SQQH 5LA6B 3H1LH 3RYCB 2YUAA 2XAQA 1XHZA 4NTYA 3JSLA 1ZSPA 4I9WA 2BTOA 4A5UB 4CH6A 4ZOLB 1P49A 1VARA 2ZE5A 4R8CA 3JALA 2YSUB 3T4ZA 4L8JA 3QO8A 1JJ2U 1Q6HA 2F1MA 5LGUA 2FL4A 3O65A 4D7SA 2Y69B 3MDSA 1SZTA 1Y76A 2VQFO 1M56B 5B1AC 4IYIA 1FXKB 1YDXA 1NTKH 4TUYA 3CCRV 3D36A 4IHJA 4ZHQA 1TVKB 3H1JH 3B8NA 1FKAO 1XL4A 1QLNA 4LWSB 3J81N 3JCUZ 1Y6XA 3MAQA 2DJVA 1PPJH 5BR8B 2RJZA 4W4KA 5EBLC 4PDLA 2PGGA 3RVYA 5L3CA 1PNMA 1IZ3A 2B9ZA 3JD0A 5EZYA 3BPZA 1AP6A 3G6EV 3S3WA 3CCUV 3LNMB 2EINC 4FMTA 2P90A 4MVRA 1QQCA 2P6JA 2DMXA 1YJ9V 1GM8A 2QKSA 4U7OA 4OPHA 4O2BB 1K5QA 3AG7A 1PL0A 1IBMO 3K08A 4X64O 1R73A 4FLYA 2OT5A 3HKBB 2P4VA 1EZJA 1TUEB 2PI4A 2CGOA 1JR9A 2RCVA 2M7WA 4X62B 1MMMA 3BHPA 3LDCA 4RUEA 4WFBV 1SRYA 4PDMA 3T2MA 5DEDA 1KB9F 2F95B 2YICA 1HR0B 2JJ1G 1IURA 4UFZA 3CXHF 3A0BZ 3QTCA 3T4DA 3HKDB 3DGEA 3ZRSA 4LCUC 2Q67A 4PI0A 3ABTA 4Z1VA 2OCCC 4LF6O 4O4IB 4JI8B 5J9PC 4DV1O 2WA3A 2OTLV 3L9DA 2ZIOA 1SF9A 4G27B 1J5EO 4R50A 5IJ9B 4TWKA 1CPYA 3CSXA 3LDDA 3CPWU 1VQNV 3F5TA 4JV5O 2P5OA 4JPRA 4DR7O 1K34A 5KHGA 3VOUA 3L74H 1JPXA 2PI5A 3DC6A 2UUBB 4YJ2A 3ABUA 4GX1A 2HHHB 1Y4MA
chains in the Genus database with same CATH topology
4PJ0Z 5E79Z 5H2FZ 5TISZ 5GTIZ 5GTHZ 4UB8Z 3WU2Z 3JCUZ 5KAFZ 4UB6Z 3KZIZ 1S5LZ 2AXTZ 5KAIZ 5B66Z 3A0BZ 4IL6Z 5B5EZ 3A0HZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 Z;  5E79 Z;  5H2F Z;  5TIS Z;  5GTI Z;  5GTH Z;  4UB8 Z;  3WU2 Z;  3JCU Z;  5KAF Z;  4UB6 Z;  3KZI Z;  1S5L Z;  2AXT Z;  5KAI Z;  5B66 Z;  3A0B Z;  4IL6 Z;  5B5E Z;  3A0H Z; 
#chains in the Genus database with same CATH topology
 4Q6G A;  4JYA O;  1PNK A;  5JCO C;  1HNZ O;  3BFR A;  3RW0 A;  4DR5 B;  4FM2 A;  2DE0 X;  2GBO A;  2LFS A;  3HKD A;  3I55 V;  1H2M A;  1TGO A;  2VQF B;  4I55 B;  4AQY O;  2LW1 A;  1CP9 A;  4YHH B;  3RYI A;  1SES A;  1WJZ A;  2EIL C;  5KLV H;  3ZN0 A;  1FYJ A;  1BQ0 A;  3ETQ A;  1YZB A;  1YI2 V;  4JAU A;  1BT8 A;  4B3M B;  2YI9 A;  1JJO A;  4H13 B;  4PHZ A;  3BRC A;  5KUK A;  5IWA B;  4OX9 B;  2CUG A;  3LDE A;  2IJK A;  1W0K G;  1VQ5 V;  1JMK C;  4JYC A;  3STZ C;  1NKD A;  1GTO A;  2GTS A;  4JI6 B;  1KD1 W;  4B3T B;  4WBN A;  3QO5 A;  2CE4 A;  3RT3 C;  3NXS A;  4I7Z B;  2NN4 A;  4LF6 B;  1N33 O;  2UU9 B;  4KL1 A;  4QE7 A;  4BWA A;  2HLD G;  5B1O A;  2GUZ B;  1TAE A;  4UCT A;  4EFB A;  4NXM O;  1W0J G;  1BE3 H;  4UV8 A;  4MTF A;  1JX9 A;  3ASN C;  4DR7 B;  1YTF B;  3MHS C;  5KUM A;  4PA9 A;  4JI3 O;  1TUB A;  5KAI Z;  3TXQ A;  2H94 A;  2UXX A;  1E1R G;  4DK1 A;  3WB1 A;  4QPK A;  4XDJ A;  1BHA A;  4QJF B;  1PL4 A;  1K8A W;  3P3N A;  3ABL B;  3QO7 A;  1H38 A;  4GT1 A;  4FLV A;  1MOF A;  5CB4 B;  4TSF G;  3EVK A;  3ABM B;  1OCO B;  3QG5 A;  4ZKI A;  2HEP A;  3K03 A;  1YIT V;  1TA8 A;  4YHH O;  1AR4 A;  3H1K H;  4PA6 A;  1YIJ V;  1XNQ B;  2ZR2 A;  5B3S B;  2WLK A;  4P9O A;  4LFA O;  2DYS B;  2EUL A;  4I0X B;  4U3J B;  3BCC H;  5IYZ B;  4IHJ B;  4ZHQ B;  2UXC O;  2QSA A;  3E8B A;  2B1I A;  1EN6 A;  1Y76 B;  2XAJ A;  1O9G A;  1IBL O;  2P22 C;  4F6R A;  3L73 H;  5LGT A;  4RQE A;  3G6B A;  1WAZ A;  4YJ3 B;  5EIB D;  2ZXW C;  4HNA A;  4DUZ B;  2EIJ B;  1NBM G;  3RBZ A;  4TQF A;  3ZED A;  4C7U A;  2AXT Z;  3CCQ V;  2XT9 A;  5JQG B;  3CS5 A;  3E2E A;  4B3T O;  1YTF D;  3OM3 B;  3FYE B;  1RP3 B;  4RQF A;  3ZX6 A;  3ABK C;  5GW7 A;  2PTM A;  4RWU A;  3BAA A;  1I94 O;  2AHY A;  3G4S V;  2F66 C;  4EKW A;  2X7R B;  4DO2 A;  1V54 B;  3A0H Z;  3U11 A;  4CS3 A;  2JS3 A;  1R3I C;  4JV5 B;  2DW4 A;  4CC6 A;  1E79 G;  1N32 B;  1L0N H;  4CH5 A;  3JAW B;  1SQX H;  2AZ2 A;  3W7T A;  3ZRW B;  2KSD A;  4DR4 O;  5LXT A;  1OZ0 A;  4JI7 O;  3NR7 A;  1XEQ A;  2JGD B;  1M57 C;  5DM6 V;  5DN6 G;  4DK0 A;  1IBL B;  1FFX A;  1THZ A;  3BA8 A;  2Q7G A;  3G80 A;  5LP6 B;  4X65 B;  1XI1 A;  1BCC H;  3AK1 A;  1DF5 A;  2B1G A;  3ML0 A;  1VQ7 V;  4X1Y B;  2BCC H;  3K3W A;  2EZP A;  2OIG A;  3D36 C;  2EIM C;  3D8C A;  3U10 A;  4KP4 A;  1WP8 A;  3CXC U;  4FLZ A;  3CYO A;  3ZMS A;  5TIS Z;  5H6R A;  5CBH A;  4K3A A;  1QBZ A;  2EIJ C;  1Q6U A;  2LO1 A;  2Q0O C;  2CTQ A;  4BW9 A;  1D5A A;  4PI2 A;  1SA0 B;  1VF7 A;  1URF A;  1NTM H;  4J7K A;  1BQZ A;  3JAR A;  5B66 Z;  4I4T A;  2LFR A;  2YDE A;  3BVO A;  3E35 A;  3OGI B;  2KQX A;  1R3L C;  5L3B A;  5LYJ A;  1WPX A;  1FFT B;  1QNM A;  3IGA C;  2EJR A;  3ZMZ A;  1GH6 A;  2BTQ A;  1ZTE A;  2PZS A;  3UO2 A;  2WLI A;  4HBN A;  4O4J A;  3H01 A;  2HVJ C;  5HFL A;  2GV9 A;  4GX2 A;  4DV5 O;  4UB6 Z;  4E4E A;  2A06 H;  4BIZ A;  4JI5 O;  1XOU A;  2Q7H A;  3VQY A;  4XBF A;  2W0F C;  2OTJ V;  3L70 H;  4PA3 A;  4J7J A;  1MAB G;  4DV3 B;  3B4S A;  5CBG A;  1SQB H;  1YEW A;  3CJH A;  4FK5 C;  2ITC C;  3UM7 A;  1W59 A;  3LNN A;  5LYJ B;  2KB1 A;  1UPG A;  4UCO A;  5A2Q N;  1JA8 A;  3CWB H;  4J41 A;  4B08 A;  4JI4 O;  4TV8 B;  1DLB A;  4MVU A;  3CD6 V;  4MTG A;  1XNR B;  3OGC C;  5LBQ A;  3JAK B;  4DV0 B;  3K5O A;  3SJA C;  1K4C C;  5KX5 B;  4YY3 O;  4H33 A;  2Y4T A;  3WFV A;  2QM7 A;  2Q7E A;  2QE7 G;  3FB8 C;  1GM7 A;  2EZO A;  4FPP A;  1OCC C;  3JCZ A;  3B8M A;  4NXN B;  4YXW G;  2DN9 A;  5B1B B;  3L71 H;  3GWK C;  2NR5 A;  4JI0 O;  3C90 A;  3ZCC A;  3ETD A;  2ITD C;  4FM0 A;  4H0L B;  3ETG A;  3ZMV A;  1MA1 A;  4X1Y A;  2LP7 A;  4X9Q A;  4DR1 B;  3BEH A;  3RN4 A;  1Q81 W;  1DTO A;  3OMI B;  2QDO A;  2XAG A;  1FFX B;  4TQD A;  1F51 A;  5EIB C;  4UUJ C;  4LBE C;  4UXN A;  3UCS C;  5IWA O;  4OX9 O;  4WFE A;  1S77 D;  3OR6 C;  5EBW C;  4IT5 A;  3TCU A;  1XL6 A;  2DOS A;  3R65 A;  2PUS A;  4QPJ A;  2ZDI C;  4FZ1 A;  1HNX B;  2EX3 A;  5EYP B;  1OCR C;  4J42 A;  4X20 B;  1AIL A;  1XBL A;  3FAV A;  3KCY A;  4X62 O;  3CCM V;  3AK3 A;  3TJT A;  2CH7 B;  3SPG A;  4P30 A;  2RDC A;  3E89 A;  3AEI A;  3LSU A;  4NXM B;  3RYH A;  3N2K B;  3B2E E;  5CA0 B;  4MVZ A;  1MNG A;  1Q90 D;  1O9H A;  3AG2 C;  1I94 B;  2VS0 A;  3OE7 G;  1EZV H;  2XAF A;  4X1K A;  4R6Z A;  4TOI A;  5LMN B;  1P7B A;  2HG5 C;  2JVD A;  3BAB A;  1JOY A;  3CCL V;  1VEW A;  5IDJ A;  4HNA B;  2X6A A;  4YJ3 A;  4IIJ A;  3SPJ A;  5JJE B;  3MHH C;  3ZHV A;  1NU1 H;  5H9C A;  4JYA B;  4OXS A;  5IYC O;  4JI3 B;  3FB5 C;  3JD3 A;  3K9A A;  5K1P A;  4K8X A;  1XMQ O;  3UT5 A;  2YEV B;  3SDL A;  4FIP C;  2X6C A;  4AHC A;  1RSO A;  2F23 A;  4U3J A;  5IYZ A;  2UUA B;  1US6 A;  1AR1 B;  1QLE C;  3K9S A;  2ZR3 A;  4Z1M G;  1B3Q A;  2H3O A;  1I08 A;  1K73 W;  4O2A B;  1UFI A;  4E2L A;  1JVM A;  1SQP H;  1QVF U;  1S3J A;  2QTO A;  1EBO A;  1NT2 B;  4J11 A;  4DUY B;  2EJ7 A;  1M93 A;  5E1A C;  4UCV A;  5KAF Z;  1FPO A;  4UV9 A;  4JGS A;  1S5H C;  3OTF A;  5KA5 A;  3VQW A;  4GKJ O;  1J5E B;  3JAT A;  5KHH A;  2BSK A;  2QJ1 A;  3EXA A;  4ABM A;  1NR7 A;  4LF9 B;  1HDJ A;  4CS2 A;  1VIB A;  1P84 F;  2WLJ A;  1FJG B;  1ZX3 A;  1GKF A;  2UXC B;  3SYP A;  2XOK G;  4J9Y B;  1ORQ C;  2V4D A;  4OGQ B;  4LF4 O;  3DXR B;  2R70 A;  2UXD B;  2QM4 A;  3M99 B;  5B5E Z;  1H2K A;  1K4D C;  3FFQ A;  5JWP A;  4DV7 O;  4LF7 B;  3K5N A;  3RYF B;  1ZWI C;  4QE9 A;  2QWN B;  2L35 A;  2YEV A;  3E8F A;  4BAY A;  1NH2 D;  3UT5 B;  3SYQ A;  4NXN O;  3T1C A;  4DV3 O;  4MVO A;  4IYH A;  1NH2 B;  5IT9 N;  1VMG A;  4WFH A;  5LGN A;  2O57 A;  4I50 B;  1BZK A;  4LFC O;  1N36 O;  3W7X A;  3G71 V;  4DRX B;  1DF4 A;  3JAS B;  2OIE A;  4TT3 G;  5CA1 B;  4WFG A;  2ZNI A;  4X1K B;  1YSC A;  4ICG A;  2RN9 A;  1S5L Z;  2JEX A;  3O9O A;  3AG1 C;  1VQ6 V;  3KZI Z;  1XNQ O;  2DQ3 A;  5CA0 A;  4X1I B;  2ZE6 A;  2AGA A;  1N36 B;  3RYH B;  1XQ8 A;  1AI4 A;  3GB7 C;  4NKG B;  2UU9 O;  3K06 A;  3OMN B;  2CH7 A;  3CCV V;  1Y66 A;  1GN3 A;  2LW7 A;  1HNW O;  2IJI A;  4GX5 A;  1HP8 A;  4CC5 A;  2HHH O;  1D5N A;  2Z5U A;  1K97 A;  5EYP A;  5J2U B;  4J80 A;  1NVP D;  1ZL8 B;  1GRJ A;  5JJN B;  4JI2 O;  2IJH A;  4TV9 A;  1Z5W A;  1SKV A;  3SJC C;  3FX7 A;  2IW5 A;  4O4I A;  4TV9 B;  1RPO A;  1RFY A;  2JRI A;  1ZL8 A;  1A32 A;  1WNS A;  2ZT9 B;  3ABK B;  4X66 O;  2UXD O;  4MVS A;  1LR1 A;  5L3G A;  1IBK B;  5GON B;  2DYS C;  3WG7 C;  1YF2 A;  3ZJZ A;  4ZIB A;  1W2B U;  3F7V C;  1VF5 B;  2YXH A;  1N8R W;  3MD0 A;  2QWP B;  2XND G;  5BY1 A;  3L72 H;  1F4N A;  3ZIA G;  2CTW A;  3X2Q C;  5B1B C;  3JAS A;  2IU0 A;  5F2V O;  3HKB A;  1PP9 H;  3CRA A;  1S72 V;  4I50 A;  2HP8 A;  4DW1 A;  5BR8 O;  4FLX A;  3HR0 A;  2QKA A;  4MSW C;  4DR3 B;  1BHB A;  4MTO A;  4O2B A;  1KU9 A;  3CHX A;  2GTA A;  2YXY A;  2Y0P A;  3RYF A;  1XMO O;  1AI5 A;  2Q8V A;  5FNV A;  1IDS A;  1SC5 B;  2OCC B;  1ENV A;  3AG4 C;  1LNQ A;  3WB2 A;  3K57 A;  3N2G A;  4BW5 A;  1U96 A;  2W6I G;  1Y74 A;  3DXR A;  3KG2 A;  5KMG A;  3FB7 C;  4D7T A;  5EZY B;  2LJ2 A;  4DV2 B;  3CC7 V;  2E75 B;  4B3R O;  1NR1 A;  4LR3 A;  4MVM A;  5LL6 Y;  1WN7 A;  3SGI A;  2JS5 A;  1M57 B;  2AW9 A;  4HYO A;  2BSK B;  1NS1 A;  1IXB A;  2YIB A;  1KQS U;  3AK2 A;  4DV5 B;  1I0H A;  2A3Q A;  1X4T A;  1PKX A;  5BMV B;  1YVW A;  1JCH A;  4I4T B;  1FXK A;  3APO A;  3FKS G;  3CX5 F;  4YIP A;  2XHB A;  4QNH B;  1WPB A;  1HW7 A;  5KHI A;  1K9M W;  5LP6 C;  3HPL C;  3JD2 A;  1WP7 A;  3JAL B;  1XRE A;  2K9P A;  5C8Y A;  4ZOL A;  1H8H G;  3ZHU A;  4JTA B;  4O2A A;  3OTO B;  5GTH Z;  2QR4 A;  4PDV A;  2ODM A;  1YJW V;  2E76 B;  3E22 B;  4KHP O;  3JYC A;  1FS0 G;  1S76 D;  2V7Q G;  4DV2 O;  4JYB A;  2ZCE A;  1HNW B;  1GN2 A;  4FLW A;  1IXM A;  2Z0A A;  1L1F A;  2KG7 A;  4DV4 B;  1OJH A;  5ITZ B;  1Q6I A;  1Q43 A;  1IBM B;  2UXB B;  2P4K A;  3GVM A;  4LFA B;  3W7S A;  4X64 B;  2AZ0 A;  3IJ4 A;  3U0Z A;  2WLL B;  4IIJ B;  3K79 A;  5LP6 A;  4JI8 O;  2Y69 C;  4JI4 B;  1N34 O;  3JD4 A;  2ILM A;  1BGY H;  1FD9 A;  1FXK C;  4LH7 A;  5GTI Z;  4GKK O;  1VQM V;  4AI8 A;  4F6E A;  4X66 B;  1G6U A;  2XUM A;  5LXT B;  3E86 A;  1MZE A;  3G67 A;  3ZRW A;  1VQ8 V;  4JI7 B;  2B5U A;  2DQ0 A;  4B3S B;  2WAM A;  3W7U A;  1P4R A;  2Q0A A;  2YC0 A;  4FM1 A;  4EB6 B;  1KEC A;  2UUB O;  4KUM A;  2R9I A;  4N21 A;  1N32 O;  3N2K A;  3OW2 U;  3ASN B;  1B04 A;  1FXH A;  1H2S B;  3Q4H B;  2IM9 A;  4MS2 A;  2PYL A;  3B40 A;  3OEH G;  5BZB A;  1H2N A;  5JCO A;  3X2Q B;  3I56 V;  3FAV B;  3Q4H A;  1K7D A;  4X20 A;  2F93 B;  4H44 B;  4EB6 A;  2GDS A;  5KHK A;  4PEL A;  3CRQ A;  4CH4 A;  1R3J C;  1ROP A;  1QU7 A;  5CBF A;  5IJ0 A;  4LF8 B;  1AB3 A;  2R72 A;  5FPR A;  2XAH A;  4JI1 B;  4K0K O;  4RAI A;  1G1X B;  2CDY A;  2H8P C;  1VQ4 V;  4DV6 O;  4LFB B;  2QA4 V;  3A2F A;  3DTU B;  2OYQ A;  3WG7 B;  1IBK O;  1H8E G;  2IU3 A;  3J80 N;  4DUZ O;  1OCC B;  1IX9 A;  1ARO P;  3SPH A;  5ITZ A;  1CXZ B;  3ZMT A;  2LGW A;  4G2K A;  2YXL A;  5FLX N;  1ZAU A;  2E3C A;  2N74 A;  3JAM N;  4I0X A;  3OUS A;  2HKO A;  1QCE A;  4D6T H;  3E22 A;  2HVK C;  1NVP B;  1V55 B;  2JJ2 G;  2DWD C;  2HJD A;  5LHG A;  3F5W C;  4I9Q A;  5KA6 A;  1KP3 A;  4LF4 B;  3HKC A;  5C8Y B;  4BIU A;  4PA7 A;  3HB3 B;  3ABL C;  3CRM A;  4DR5 O;  1YCI A;  4LFC B;  1H2G A;  4JI0 B;  1SET A;  3C3T A;  3SPI A;  5BMV A;  2ZQM A;  1TUB B;  4UVA A;  1QLE B;  4LP8 A;  1AP5 A;  1DGS A;  4UCU A;  2FTK A;  1G8M A;  4DW0 A;  4FLU A;  4UCS A;  2NLJ C;  1S0V A;  2V1D A;  2Y0I A;  4B3R B;  3ZS8 C;  3TET A;  3TXS A;  1MG1 A;  2ARH A;  2XTA A;  3ASO B;  2ZIN A;  2GUZ A;  3P3P A;  4DV7 B;  3K5L A;  1SQF A;  2M6Y A;  5B3S C;  2VRZ A;  4JYY A;  2YIA A;  2BOB C;  2K1E A;  3P30 A;  2IBZ H;  2ZM6 O;  2YID A;  4U3F H;  4O4J B;  5KMG B;  5CMU A;  4DUY O;  1Y74 B;  5JH7 A;  3M8A A;  1S5J A;  2BTQ B;  4FLT A;  5EC2 C;  3N2G B;  4K8Z A;  3OT7 A;  1KC8 W;  4DR4 B;  1ZLZ A;  2JIZ G;  5FNV B;  4JZ2 A;  1R6N A;  2VQE O;  1YJN V;  2Q68 A;  2ZXW B;  2ADP A;  2KKW A;  5EBM C;  3JAR B;  4X88 A;  5IY5 B;  4P2Z A;  4B3M O;  5AG2 A;  3H1I H;  4Z2W A;  4J9Z B;  1Q8I A;  2WSS G;  4JTD B;  1SA0 A;  3DC5 A;  4GYC B;  1F4M A;  2CTR A;  4DV1 B;  2PY5 A;  2FB5 A;  2X6B A;  4FZ0 A;  1R3K C;  1VQO V;  3OTO O;  4JAA A;  2W0X A;  3K04 A;  1FAF A;  3LSS A;  2E5L O;  1OHH G;  2A79 B;  5CA3 A;  2WLH A;  1N33 B;  1SZX A;  4HZ3 A;  1YXB A;  1M90 W;  3QVN A;  2Q4P A;  1L0L H;  5BXZ A;  3H9V A;  2A7W A;  4YJ2 B;  2YS8 A;  2MK3 A;  5LOV B;  4PD4 F;  2UUA O;  1QR8 A;  5GON A;  2ZD9 A;  5LMU O;  4P9P A;  1NQT A;  1RM1 C;  4X89 A;  1OCZ B;  5IJ9 A;  1WB7 A;  3ASO C;  4O4L B;  2JEU A;  3SYO A;  3IC9 A;  4UVC A;  1R1B A;  1UJW B;  2VQE B;  5C93 A;  3SYA A;  4MTX A;  1SER A;  4KFM A;  3CEI A;  3FD9 A;  2FML A;  1I5Y A;  5J2U A;  4UVB A;  4NVP A;  5L3E A;  4GUN A;  4W4L A;  1WA8 A;  3CCJ V;  1Q5O A;  1EM1 A;  4JZG A;  1M1K W;  3TGU H;  4L87 A;  2WLM A;  4BR6 A;  4PA4 A;  1FJG O;  3RVZ A;  1QHT A;  1K92 A;  3SJQ C;  4X1I A;  1GAX A;  2ZDI A;  3LSQ A;  2P67 A;  3I5D A;  3FYI B;  1AVM A;  3AG3 B;  3THO A;  4B7K A;  4B7E A;  2A0L A;  4FFB B;  1F7Y A;  1QR9 A;  1HNZ B;  5JQG A;  3A0R A;  1XIL A;  3S3X A;  5L3F A;  1CEZ A;  5CA1 A;  4DRX A;  1Z5V A;  1Q3E A;  2IH3 C;  2Y4U A;  2N05 A;  2R9R B;  2RQ6 A;  5FL7 G;  1SQG A;  5LMU B;  2QKC A;  5IY5 C;  2HR3 A;  3CE2 A;  2ADQ B;  1EN4 A;  3IAY A;  4F6R B;  4U7N A;  1M4U A;  1PD3 A;  4NTW A;  4LF7 O;  4I5S A;  1JFF A;  1P7G A;  4X8A A;  1GM9 A;  2CGN A;  2NNU A;  1AI7 A;  1HWY A;  2P7T C;  5JVD B;  2E74 B;  5K1X A;  1XNR O;  3OD4 A;  3K58 A;  3EHB B;  4YIO A;  1QVG U;  3B77 A;  4R7C A;  1M56 C;  5B1A B;  4K35 A;  5LHH A;  3E83 A;  2EIK B;  3VBB A;  2IH1 C;  1AJN A;  4PDR A;  1BS3 A;  1I7F A;  4GZR B;  3ZMU A;  4WCE V;  2VWJ A;  5D5P A;  4GX0 A;  1VF6 A;  3BA9 A;  4PJ0 Z;  3JD1 A;  5CB4 A;  1V55 C;  3APQ A;  5D5Q A;  1R6T A;  2R9A A;  1X59 A;  1I5X A;  2GSM B;  3GWO A;  4MT8 A;  1XDC A;  4YY3 B;  4DXW A;  3K5M A;  2QWQ B;  2Y48 A;  3JAT B;  1Q82 W;  4LH6 A;  3SJB C;  3QNE A;  5H6Q A;  4LFB O;  3AG4 B;  1BMF G;  3CP1 A;  1K3E A;  3ICX A;  5HFM A;  3IC7 A;  1KUQ A;  4LC1 A;  1PV0 A;  3OFN G;  1NTZ H;  1TVK A;  1BL8 A;  1ZUQ A;  5JVD A;  3CCS V;  2EIM B;  4TUY B;  1VQK V;  1WB8 A;  1JFF B;  4AQY B;  2JDI G;  5EK0 A;  3VQX A;  3T1H B;  2QTS A;  2Q6A A;  4LF5 B;  1B06 A;  1EN5 A;  5LMN O;  2FKX A;  2Z3Y A;  2ATK C;  1U97 A;  1E1Q G;  4WBN B;  1KBH A;  1KP2 A;  3RYC A;  3L75 H;  5IYB O;  1AJP A;  2EIL B;  1K5S A;  3FB6 C;  4NYK A;  4MVQ A;  4FFB A;  3CRC A;  5J2T B;  4JAS A;  2WWW A;  2DYR B;  4EFE A;  1RSO B;  3E8G A;  1Z2G A;  1WLE A;  4JTC B;  1RM1 B;  2X0L A;  4WFF A;  2ZKO A;  4ASU G;  3T1Y B;  1Y67 A;  3WU2 Z;  3T1H O;  4B3S O;  1HR0 O;  1V9P A;  4JI1 O;  4K0K B;  3RYI B;  3OEE G;  2BE3 A;  1WA8 B;  4RUF A;  2F4V B;  2JGU A;  4I55 A;  1MSW D;  4O4H B;  2CTP A;  3R66 A;  4CZZ A;  4O4L A;  3OMA B;  4LF9 O;  1LUW A;  2L6L A;  4NTX A;  4QIW F;  2WA4 A;  3D3Q A;  2JK5 C;  1VF6 C;  3HKE A;  2VWK A;  5LOV A;  2D3O W;  1F23 A;  2P06 A;  3ZHQ A;  1HNX O;  2G38 A;  3CC2 V;  1XMQ B;  3J7A U;  4Q20 A;  3CRR A;  2QEX V;  3OAA G;  5LHI A;  1NI8 A;  4KXR A;  2EIN B;  3SR2 C;  1YHQ V;  2N04 A;  4GLX A;  1OCO C;  3B09 A;  3ETE A;  2HJF C;  4WFA V;  3JSN A;  3OUF A;  4QGP A;  4DR2 O;  2OWO A;  2AHZ A;  4MW8 A;  1AI6 A;  2PF4 E;  4DR3 O;  3LUT B;  4X65 O;  5H5N A;  1H2L A;  5H2F Z;  3SPC A;  2Q69 A;  1EFR G;  3EFF K;  1BSM A;  2EIK C;  3WB0 A;  3CB2 A;  1GN4 A;  5FPO A;  1GO3 F;  3UKM A;  4XDK A;  2D2C B;  1M9N A;  1KYO F;  4JI2 B;  4CH3 A;  2ZNJ A;  5JH7 B;  3AG1 B;  1GN6 A;  2CAZ C;  3K0D A;  3F7Y C;  1N0J A;  3KCX A;  4JAV A;  1XMO B;  5KX5 A;  4DV0 O;  1MSD A;  4CBC A;  4LF8 O;  4G28 B;  3E8H A;  2UXB O;  2LQT A;  3VQV A;  2ETN A;  3ZN1 A;  3JAK A;  5CN0 A;  3CME V;  4DR6 O;  1V54 C;  4OPA A;  2C2A A;  2WLN A;  4J7Z A;  1N34 B;  5IYD O;  4EEQ A;  4TV8 A;  2RNB A;  4FJC C;  2W6J G;  1N0N A;  5E79 Z;  4LNU B;  2MW2 B;  2YIB D;  3CJH B;  4LNU A;  4BIO A;  5JJJ B;  2Q9L A;  1Q7Y W;  1GMG A;  3OR7 C;  1NJI W;  3N27 A;  4N23 A;  1LUV A;  2BOC C;  4H37 A;  3PN1 A;  1OCR B;  5EC1 C;  3ZRV A;  4MW3 A;  2PYJ A;  4RO2 A;  4JI5 B;  3W7W A;  1KKD A;  3BY6 A;  1G4Y B;  4UCR A;  3HKC B;  3UO3 A;  2F4V O;  1K33 A;  4NB5 A;  5B1N A;  4F4L A;  4JF3 A;  5DEC A;  1SS3 A;  2GHY A;  2WLI B;  1J95 A;  3AG2 B;  2CK3 G;  3ABM C;  2EBO A;  4LWS A;  2YI8 A;  5IE9 A;  3A8T A;  3QF7 A;  1PNL A;  2XAS A;  1AR5 A;  3RGB A;  1JQ0 A;  3H1H H;  2QWR B;  3RWR D;  4WF9 V;  2ZE8 A;  1VP7 A;  2IJJ A;  4DYL A;  1FXV A;  2Q5Z A;  3CC4 V;  1B6Q A;  4FVM A;  1RPR A;  3M7M X;  4XDL A;  1IVS A;  4NR1 A;  1D2D A;  3RFR A;  2ZE7 A;  1GK9 A;  2HFE C;  1M5I A;  2DWE C;  4GKJ B;  1PM9 A;  1OV9 A;  3TK1 A;  2RMK B;  4GCZ A;  4DV6 B;  2UUC O;  1DK1 A;  3C3S A;  3UQ8 A;  4LF5 O;  5LA6 A;  5IJ0 B;  1AJQ A;  4UB8 Z;  3ZHS A;  1KMI Z;  4PV1 B;  3ZHT A;  2ZM6 B;  1VQL V;  1N4C A;  1KKC A;  5A9G A;  4IL6 Z;  3T1Y O;  1COW G;  1SQV H;  3P32 A;  3K0G A;  1NZ6 A;  2Q73 A;  3HKE B;  2DYR C;  3IFX A;  3PJS K;  4DR1 O;  1T5E A;  2QWO B;  1MZF A;  3ZBH A;  4JI6 O;  2QGN A;  3CMA V;  4DV4 O;  3ZHR A;  2JGD A;  3K59 A;  2OCH A;  4ZI7 B;  2WPD G;  4HAM A;  1XHX A;  4ZBM A;  4ZI7 A;  4IGG A;  1L8D A;  4KHP B;  3JAW A;  1R6K A;  3ZRX A;  3STL C;  1VQ9 V;  2QM8 A;  3D3I A;  3DSQ A;  4O4H A;  1VQP V;  4CS4 A;  2A9H A;  4GKK B;  2LGQ A;  4FFK A;  2WLL A;  3SYC A;  5KHJ A;  3AG3 C;  2FYU H;  3KKY A;  4DR6 B;  1OCZ C;  3CCE V;  4DR2 B;  2ZIM A;  1Q86 W;  5L3D A;  2F43 G;  2KG7 B;  2UUC B;  2E5L B;  4J10 A;  5J2T A;  1XUQ A;  4AIL C;  2UXN A;  1SQQ H;  5LA6 B;  3H1L H;  3RYC B;  2YUA A;  2XAQ A;  1XHZ A;  4NTY A;  3JSL A;  1ZSP A;  4I9W A;  2BTO A;  4A5U B;  4CH6 A;  4ZOL B;  1P49 A;  1VAR A;  2ZE5 A;  4R8C A;  3JAL A;  2YSU B;  3T4Z A;  4L8J A;  3QO8 A;  1JJ2 U;  1Q6H A;  2F1M A;  5LGU A;  2FL4 A;  3O65 A;  4D7S A;  2Y69 B;  3MDS A;  1SZT A;  1Y76 A;  2VQF O;  1M56 B;  5B1A C;  4IYI A;  1FXK B;  1YDX A;  1NTK H;  4TUY A;  3CCR V;  3D36 A;  4IHJ A;  4ZHQ A;  1TVK B;  3H1J H;  3B8N A;  1FKA O;  1XL4 A;  1QLN A;  4LWS B;  3J81 N;  3JCU Z;  1Y6X A;  3MAQ A;  2DJV A;  1PPJ H;  5BR8 B;  2RJZ A;  4W4K A;  5EBL C;  4PDL A;  2PGG A;  3RVY A;  5L3C A;  1PNM A;  1IZ3 A;  2B9Z A;  3JD0 A;  5EZY A;  3BPZ A;  1AP6 A;  3G6E V;  3S3W A;  3CCU V;  3LNM B;  2EIN C;  4FMT A;  2P90 A;  4MVR A;  1QQC A;  2P6J A;  2DMX A;  1YJ9 V;  1GM8 A;  2QKS A;  4U7O A;  4OPH A;  4O2B B;  1K5Q A;  3AG7 A;  1PL0 A;  1IBM O;  3K08 A;  4X64 O;  1R73 A;  4FLY A;  2OT5 A;  3HKB B;  2P4V A;  1EZJ A;  1TUE B;  2PI4 A;  2CGO A;  1JR9 A;  2RCV A;  2M7W A;  4X62 B;  1MMM A;  3BHP A;  3LDC A;  4RUE A;  4WFB V;  1SRY A;  4PDM A;  3T2M A;  5DED A;  1KB9 F;  2F95 B;  2YIC A;  1HR0 B;  2JJ1 G;  1IUR A;  4UFZ A;  3CXH F;  3A0B Z;  3QTC A;  3T4D A;  3HKD B;  3DGE A;  3ZRS A;  4LCU C;  2Q67 A;  4PI0 A;  3ABT A;  4Z1V A;  2OCC C;  4LF6 O;  4O4I B;  4JI8 B;  5J9P C;  4DV1 O;  2WA3 A;  2OTL V;  3L9D A;  2ZIO A;  1SF9 A;  4G27 B;  1J5E O;  4R50 A;  5IJ9 B;  4TWK A;  1CPY A;  3CSX A;  3LDD A;  3CPW U;  1VQN V;  3F5T A;  4JV5 O;  2P5O A;  4JPR A;  4DR7 O;  1K34 A;  5KHG A;  3VOU A;  3L74 H;  1JPX A;  2PI5 A;  3DC6 A;  2UUB B;  4YJ2 A;  3ABU A;  4GX1 A;  2HHH B;  1Y4M A; 
#chains in the Genus database with same CATH homology
 4PJ0 Z;  5E79 Z;  5H2F Z;  5TIS Z;  5GTI Z;  5GTH Z;  4UB8 Z;  3WU2 Z;  3JCU Z;  5KAF Z;  4UB6 Z;  3KZI Z;  1S5L Z;  2AXT Z;  5KAI Z;  5B66 Z;  3A0B Z;  4IL6 Z;  5B5E Z;  3A0H Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...