5KAFZ

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kafZ00
3A0HZ 4IL6Z 4PJ0Z 5GTIZ 2AXTZ 5KAFZ 4UB8Z 3JCUZ 5TISZ 1S5LZ 4UB6Z 5GTHZ 3KZIZ 5H2FZ 5KAIZ 5B66Z 5B5EZ 5E79Z 3WU2Z 3A0BZ
chains in the Genus database with same CATH superfamily
4JV5B 2QKCA 4BIUA 4U3FH 4QGPA 3K0DA 4LH6A 4DV5O 3WB0A 5L3CA 5H6RA 3ZMTA 1FXKA 2ITDC 4FZ1A 5IYZA 2QM8A 3SDLA 3ZMZA 5LGNA 3RYHA 2CTWA 4LF5B 4O2BA 4P2ZA 5EBMC 2F1MA 4WCEV 4JI1B 1LUVA 1Q90D 4NB5A 3AG7A 4BR6A 3IGAC 1GN4A 4GKKO 5JQGB 2NR5A 2ZIMA 1BZKA 1AJPA 1ZX3A 4O2AA 2P7TC 3CCRV 3K59A 4MVMA 1FXKB 3DC5A 4C7UA 2XOKG 4E4EA 4YIPA 4IIJA 3J80N 3ZHRA 1GTOA 1EBOA 5IWAO 1CXZB 1LUWA 3GWKC 3M7MX 2BOBC 4JI3B 4X89A 1SQBH 1WA8A 4B7EA 3HB3B 3H1KH 5CA1B 1ORQC 2DQ0A 2FTKA 1BHBA 2XAFA 1VF7A 4QPJA 4W4LA 2JEXA 1WJZA 1P4RA 1IDSA 3AG3B 2UU9B 3BVOA 4I55A 4JI8O 4DV2O 1QVFU 4KXRA 1BMFG 3D3IA 1IBMB 1XEQA 3OE7G 1Q6HA 3OR7C 4XDLA 2ZE8A 5L3EA 1V55B 5CBHA 4FLZA 3JSNA 4O4IA 1NQTA 1DGSA 3S3XA 3FKSG 4OGQB 1GN3A 1QLNA 5C93A 2XAHA 4JI6B 1OCZC 1N33B 2IJKA 1M90W 1R6NA 3MDSA 1E1QG 1W0KG 1HP8A 2CH7A 5KUKA 4D6TH 1NTMH 3ABLC 3BCCH 1YITV 2UXBB 4H13B 1SESA 5LHHA 2A06H 2VQFO 1K8AW 4J9ZB 3H1HH 4B7KA 4DW0A 3ZRWB 4RUEA 3E22B 1FXVA 3G6BA 4F6RA 1P7BA 1KKCA 2EJ7A 1V54B 2Q73A 1I08A 1XL6A 3APQA 1L0LH 4L8JA 4ZI7B 4DV5B 2FYUH 3CC7V 2AZ0A 3QNEA 2W0XA 3DXRB 1GK9A 1Y4MA 3Q4HB 1MA1A 2PGGA 4O4LB 4I4TA 4I50B 1M57C 1YDXA 2YEVA 1NTKH 3HKBB 4LFAB 2PYLA 3AG1C 4IYIA 3ASOC 2V1DA 1IXBA 3HR0A 3ETQA 3TXSA 4YJ3A 1Y76A 1P84F 3SJBC 4BW5A 3D36A 3QG5A 4WBNB 3CD6V 1O9HA 3JARB 3TXQA 4EB6A 3K03A 3SPHA 3GVMA 3N27A 4MSWC 3ASOB 3SPGA 3CRQA 2ADQB 3FFQA 5LOVA 1S76D 1PPJH 1HR0O 4ASUG 1W59A 2JS3A 4DR6O 1N34B 3B8NA 3W7SA 3E8HA 4LH7A 1I5YA 2AHZA 4ICGA 4JTAB 3RYHB 1XQ8A 2Y0IA 3CE2A 3UT5B 4DV7O 1FS0G 4G27B 2G38A 3A8TA 3LSQA 4TQDA 5EZYB 2C2AA 1YEWA 2MW2B 2F23A 5B1NA 1TVKA 2WA4A 4I0XB 5DM6V 1MOFA 4K0KO 1GN2A 3ABMB 4DR2O 1YTFB 4AI8A 1SETA 1GKFA 1KC8W 3T2MA 2F43G 2ZNJA 1EZJA 5IYCO 2GBOA 4NTWA 4FM2A 4JI5O 2RCVA 3B40A 4LWSA 3E2EA 1PM9A 5JCOA 2OT5A 5BMVB 2DJVA 2IH3C 4NTYA 1SA0B 4MT8A 4IGGA 3UT5A 5GONA 3A0HZ 3D36C 1PP9H 4D7SA 2IM9A 2Q68A 2QM4A 5LMUB 4DO2A 1BQZA 1WPBA 1JVMA 5ITZB 2V4DA 2R9RB 5JJNB 3FB7C 3ZHVA 3AEIA 5KMGB 4X88A 2QA4V 1DTOA 5EIBD 1GN6A 3K3WA 3W7UA 3LNMB 1Y66A 1MSWD 2VWJA 2JIZG 4EB6B 3JARA 3JD2A 4GYCB 2V7QG 1YSCA 4B3RB 3K5LA 3K04A 5FPRA 5IY5B 2OTJV 4J41A 2XAGA 4RAIA 1DF5A 2YIDA 1SS3A 1K73W 1JFFA 3QVNA 1ZL8B 3CRAA 4I50A 3G4SV 2ZE7A 1OHHG 3OUSA 4B3SO 5KAFZ 4LFCO 3IC7A 1YXBA 5JWPA 2E5LB 4NXNO 1SC5B 4DRXB 1JR9A 2QTSA 4W4KA 3HKDB 4WBNA 2QSAA 1XOUA 3ASNB 4X1YA 3CB2A 1KD1W 3RYFA 1VQPV 4MVRA 4NR1A 1ENVA 2GDSA 4CH3A 4DV6B 4X1YB 2WLNA 2YEVB 4BIZA 2YDEA 4P9PA 2YUAA 4I4TB 4J7ZA 2WA3A 4DR5O 2JJ1G 4H0LB 4O4JA 2AW9A 3LSSA 1GO3F 3ABLB 3G80A 3BABA 2UUBO 3K0GA 3KCYA 3OM3B 5L3BA 2LGWA 3WB1A 4UVAA 1Y67A 2Y69B 4MVUA 3JAMN 4FLXA 2P67A 1SQGA 2BSKA 2PTMA 1N8RW 2PY5A 2WWWA 2AGAA 5E1AC 4QNHB 3FD9A 2LJ2A 4E2LA 4RQEA 3L75H 4LF7B 3JCZA 2YI9A 2PI4A 2EIJB 4DXWA 2L35A 2R9IA 4PA7A 4MW3A 2NN4A 2WLJA 2Q5ZA 4I9WA 4PJ0Z 4JYAB 1DLBA 4FIPC 4X66O 4LFBB 1XREA 2QKAA 1S72V 2DQ3A 4LFBO 2WAMA 4DR7O 4QPKA 1QLEB 2W6IG 4DR7B 2CE4A 1PL0A 4JI5B 2Q67A 4BWAA 1KMIZ 5BR8O 1THZA 2GTAA 2QTOA 1RSOA 1W0JG 1TVKB 3ML0A 2DN9A 4NVPA 3L72H 2BOCC 4U7OA 2P06A 5LMUO 2VQEO 5EZYA 2O57A 2N04A 3M99B 1R6KA 3MAQA 1AI6A 3CCQV 3KKYA 2QM7A 1G8MA 4IL6Z 3N2GB 3FYIB 4X8AA 4X20A 1NS1A 1M5IA 3C3SA 4DRXA 4B3RO 2DWDC 2NLJC 2IW5A 5LOVB 3H1LH 3JAKB 4DUZB 2XHBA 1IX9A 5BY1A 2QJ1A 2ATKC 2BTQA 1JFFB 4DV1B 4Z1VA 4K8XA 4MVQA 2X0LA 4DW1A 4JAAA 2HHHO 2ADPA 1KUQA 3FAVA 2HFEC 2AHYA 4DR4B 4B3MB 4O2AB 3NXSA 1QQCA 1IVSA 3L9DA 1QVGU 5ITZA 4WFFA 5E79Z 1BE3H 2JDIG 3N2KA 4DR5B 4HBNA 4ZI7A 3LSUA 4MVSA 4CH4A 2FMLA 3F5WC 4GKKB 1X4TA 1AILA 2EZPA 2UXXA 1RPRA 2IBZH 4JI4B 3JD0A 2A79B 2H94A 1Y74B 1R3LC 1Y74A 2HR3A 1EN6A 3AG2B 4R50A 2WLLA 5LGTA 5LMNB 5GONB 1IBLB 5B1BB 2IU0A 4ZBMA 1QR9A 5IWAB 4PD4F 1H2NA 3ZEDA 1AJQA 3J81N 1PKXA 1XHZA 2FKXA 3EXAA 4OPAA 5D5QA 4JI3O 1OCRC 4OXSA 2OCCC 5JH7A 4CH6A 1US6A 1AR5A 1HNXB 1WP8A 3CWBH 2F4VB 4IT5A 4YHHO 3CCUV 1EM1A 1JPXA 2KSDA 3T1YO 2Q4PA 4X65O 2PF4E 1DK1A 1WAZA 1FYJA 5EBLC 4DV2B 1K9MW 1OV9A 3JAWA 4DR1O 1IBMO 4NTXA 5IJ9A 4LF9B 3FAVB 3OT7A 2QKSA 1GRJA 1NU1H 3B2EE 1ROPA 1VEWA 4ZKIA 2ZR3A 1E79G 4PI2A 3JAWB 3JD4A 3DC6A 5BR8B 4JF3A 1IURA 1R1BA 3RW0A 3ZMVA 2P5OA 2BTQB 4OPHA 1QLEC 4JI6O 2UUCB 3B4SA 3NR7A 3G67A 3A0BZ 1EFRG 3JALB 2AZ2A 3HKCA 2XASA 3RYCA 5LXTA 1BHAA 5CA0A 5FL7G 2HKOA 1PNMA 4I9QA 1Z2GA 5LP6B 3K79A 3CCLV 1WLEA 4AQYB 4TV9B 3CRMA 4AILC 1SKVA 4H33A 1F4MA 3Q4HA 1EN4A 1Q3EA 3R65A 2ZCEA 4DV1O 4KFMA 2D2CB 5H9CA 4JASA 4PDLA 1TA8A 1OCZB 4JAVA 4HNAB 2XNDG 1G1XB 1DF4A 1SQFA 4YIOA 4B08A 5B1OA 4B3MO 2WLHA 1BSMA 2KG7B 3E22A 5B3SC 4UVBA 3OTFA 3E8BA 3QO8A 3ZRWA 3IAYA 3K06A 4FM1A 4PDVA 2CGOA 1OCRB 1RP3B 1Q8IA 3OMNB 4UB8Z 1VQ9V 5B66Z 4EFEA 3T1HB 2RNBA 3AG2C 4I0XA 3ZN0A 3SGIA 4WF9V 3ZX6A 2P4VA 5IYBO 1FPOA 3JAKA 3U11A 1NH2B 2Y69C 1N4CA 3OEHG 2EIMB 3E89A 3ZRXA 3FYEB 1VIBA 5DEDA 2ITCC 4J7KA 1NR7A 2UXDO 1K34A 1H2GA 3BPZA 4YHHB 2UXDB 3SPCA 4I55B 1BGYH 3X2QC 2UU9O 2LW7A 4JI8B 2YS8A 4HAMA 4JPRA 1JA8A 2DE0X 3CSXA 1V9PA 4R6ZA 2Q0OC 4YJ3B 2EILB 3E35A 4IHJB 5JH7B 4LC1A 3W7WA 4GX5A 1JQ0A 1VQMV 5KUMA 4LNUA 1Q7YW 2DOSA 5A2QN 2JVDA 3CCSV 2KG7A 1KB9F 3ZCCA 1Q5OA 3HPLC 1JCHA 1XNRO 1F23A 5CBFA 4YJ2B 1WNSA 5HFLA 3ZMUA 1XNRB 2DYRC 1H8EG 2P6JA 4HNAA 5HFMA 3BFRA 2UXBO 3ETDA 1H38A 3OUFA 1VQ6V 3K9AA 4UCOA 4N23A 1XI1A 4PA6A 2GUZB 1BL8A 2WPDG 1R6TA 1XDCA 1XNQO 3BA9A 4FJCC 1D5AA 2Z5UA 5CA0B 4B3SB 4CC6A 2QWOB 4GX1A 1JMKC 3CCMV 5CMUA 4DV3O 3ZIAG 4NXNB 2CTPA 4PV1B 2LO1A 5B3SB 4UXNA 4FM0A 2JRIA 3P3PA 2ILMA 4YY3O 5KX5A 1WPXA 1I5XA 1KP3A 3RFRA 1CP9A 2YSUB 2R72A 3OR6C 4FFBA 1H8HG 2B1GA 2ZR2A 1K7DA 4FK5C 5K1XA 4YXWG 3CC4V 1AVMA 3N2GA 5H5NA 2ZDIA 4RWUA 3T1HO 2BE3A 4X9QA 1QU7A 1LR1A 4X62B 2YIAA 2UUBB 2JGDA 3AG4B 3ABUA 3IC9A 4FPPA 1N36B 4X62O 4DK1A 2H3OA 4JZGA 2YXLA 1N36O 2L6LA 3JD1A 4MTXA 5KLVH 3W7XA 1KYOF 3G6EV 3JASB 4O4HB 1HR0B 2CUGA 3A2FA 4EKWA 2EJRA 4RUFA 5DN6G 4DR6B 4TQFA 5H6QA 3WB2A 3AG4C 1IXMA 3VQWA 1IZ3A 5K1PA 1VQNV 3IJ4A 4QJFB 5KMGA 1AI4A 1AI5A 4B3TO 2OYQA 1S5LZ 4X1IB 2FL4A 3THOA 4J11A 2UUAB 2R70A 2HJDA 3K58A 4KUMA 2UUAO 1GH6A 4K0KB 1YI2V 1Q81W 1PV0A 2ZINA 4JYAO 3ZBHA 1K92A 3JATB 1SZXA 4DV0B 4PA3A 3RBZA 2Y0PA 1TUBB 1RM1B 4J42A 2JGUA 4XDKA 1VP7A 2AXTZ 3BAAA 1ZUQA 3LDCA 4GX0A 1M1KW 2WLIA 3SYCA 3ZHTA 4KHPB 1QNMA 4TUYA 1W2BU 4KHPO 2EINB 3RWRD 4PDMA 2P4KA 5EK0A 2YIBA 4FFKA 3ABKC 1KECA 1NKDA 2QWRB 3L71H 2RDCA 4DR3O 1S77D 3I5DA 1AP5A 4XDJA 1VQLV 4LBEC 3OFNG 4J9YB 5EC2C 3C90A 4LR3A 4H37A 1M9NA 3QO7A 4O4JB 3CCJV 2Q7GA 1AP6A 4LNUB 1RPOA 3CX5F 1Z5VA 3CXCU 4PA9A 3H9VA 1KP2A 2BTOA 3JYCA 4JI2B 2IH1C 4WFGA 3CS5A 2GSMB 4LF8O 3HKEB 1MZFA 2YI8A 1SRYA 1XNQB 1MNGA 2NNUA 5LGUA 3FX7A 3PJSK 1H2SB 3A0RA 3E86A 4LFCB 3UO2A 1UJWB 1VARA 3CMAV 4K8ZA 1E1RG 2Y4TA 1N0NA 4EFBA 2EILC 2XAJA 3FB6C 2HJFC 1R3JC 3L74H 2YXHA 4WFHA 5KHKA 2JJ2G 1S3JA 3OMAB 3LDDA 4I5SA 2ZXWB 3CCVV 5IDJA 1HNZO 1HNZB 4GZRB 1K4DC 3VQYA 1K3EA 4CC5A 2CGNA 2DYRB 5J9PC 3K5NA 5CB4A 4F6RB 2GTSA 2PYJA 4Z1MG 4GX2A 1AJNA 1Y6XA 3KCXA 4L87A 2EX3A 3JSLA 2ZKOA 1GM9A 4JI4O 2N05A 1PL4A 3LDEA 4TSFG 5IY5C 1M93A 5LMNO 3KZIZ 5KAIZ 1KKDA 5FPOA 3H1IH 3F5TA 1AI7A 5IYDO 2WLMA 4A5UB 3ZHQA 1HW7A 1R3KC 3U0ZA 4JV5O 2ZE5A 2PI5A 4KL1A 1K33A 2E76B 1UFIA 1SF9A 1ZSPA 1X59A 2ZIOA 1SQQH 4Q20A 1B04A 1XMOB 1R3IC 5IYZB 2R9AA 5EYPA 3CRRA 1KQSU 2JEUA 4JYYA 1VQOV 4O4HA 3ZRSA 1JJ2U 3JASA 2EIMC 1B3QA 5C8YA 5F2VO 3AK2A 2WLKA 4LF9O 1HWYA 1Q43A 4TUYB 2YXYA 4LP8A 3P30A 1HNWO 1XMQB 4QIWF 2Z0AA 1J5EB 2RJZA 2YICA 3ZJZA 1VF6A 1J5EO 3MD0A 4K3AA 4TV8A 2EIJC 3UO3A 2VQEB 3BY6A 3O9OA 3OEEG 2ZNIA 4JI7O 5L3DA 3CRCA 5CA1A 4U7NA 1Y76B 2XTAA 3G71V 2GHYA 3X2QB 1SQVH 1KU9A 1BCCH 4NXMB 3PN1A 4P9OA 1AROP 4PHZA 3P32A 5J2TA 3RYIB 1OCCB 3OAAG 4JI2O 5LHGA 4X64B 2EIKB 1VQKV 5EYPB 1K5SA 1FJGB 1D2DA 1N32B 4TOIA 4CS4A 2A9HA 4JYBA 2HHHB 5H2FZ 4D7TA 1N32O 2MK3A 5LYJA 2HG5C 5EIBC 2F66C 4HZ3A 4DV4B 1FXHA 1KBHA 5CBGA 1FFXA 4JYCA 3SYPA 1S0VA 3SPJA 4OX9O 4FFBB 2XUMA 2K9PA 1G6UA 2LP7A 2ZE6A 1D5NA 3CMEV 2WLLB 1MMMA 3L73H 1OCOC 3E83A 2E75B 2VQFB 3T4DA 2XAQA 3K5OA 5GW7A 2QR4A 3M8AA 3U10A 5BMVA 1L1FA 3RVYA 1XBLA 2B5UA 4JTCB 1Z5WA 1JOYA 1K4CC 3K57A 4X1KB 2ZD9A 3TCUA 4CBCA 4FLUA 1F7YA 2QGNA 1F4NA 3KG2A 1XILA 1QBZA 2LFRA 2IJIA 1AR1B 2Y4UA 1HNXO 2F4VO 3CPWU 4N21A 2Q9LA 5BZBA 1VQ5V 5CN0A 5AG2A 5LP6C 4FMTA 4DYLA 3T1YB 1B6QA 4R7CA 2M7WA 4Q6GA 2VWKA 2Q69A 1S5JA 5J2UA 1XMOO 4YJ2A 3ZHUA 3SR2C 3F7VC 2LGQA 3HKEA 5LL6Y 1SERA 4UCSA 2XT9A 4EEQA 1J95A 2Q7EA 1YF2A 4WFAV 5GTHZ 2DW4A 4G28B 4CH5A 3F7YC 4JGSA 5KHHA 2ZM6B 5LA6A 2HVJC 4CS3A 1VQ7V 4DUYB 1FAFA 1XMQO 4ZIBA 5JCOC 3QF7A 4F6EA 2QWQB 3ABMC 3BA8A 2JS5A 3H1JH 1YTFD 4FVMA 3UQ8A 1GM8A 3DXRA 5KA5A 3STZC 5A9GA 2IJHA 2ZQMA 4JI7B 1SQPH 1MSDA 1Q6UA 4JZ2A 1RFYA 2YC0A 5J2UB 5LA6B 1N34O 3H01A 4ZOLA 4MTFA 1BS3A 4BW9A 2H8PC 1YHQV 4GKJB 3L70H 3ETGA 1L0NH 2ETNA 3IFXA 1ZWIC 4DV7B 4GKJO 1Q6IA 4NXMO 2Q6AA 4UCTA 3ZRVA 2F95B 3LNNA 1VMGA 1P49A 3C3TA 2EINC 5B1AC 3E8GA 4O2BB 3K9SA 1PD3A 1CPYA 3SJQC 5FLXN 1YIJV 3T4ZA 2OTLV 4MS2A 1NTZH 5TISZ 4P30A 1JX9A 1NZ6A 3SYOA 3CJHB 4LWSB 2E74B 3J7AU 1R73A 1NJIW 3VBBA 1I7FA 4UUJC 1M56B 1MG1A 5KHGA 2EIKC 4CZZA 4X1IA 5LP6A 1BT8A 5JJJB 2ARHA 3OW2U 3FB8C 4F4LA 2X7RB 1TUBA 2WSSG 1OCOB 4OX9B 1CEZA 3B09A 1FFXB 3RYCB 2A3QA 4O4IB 4ABMA 4J10A 1COWG 4KP4A 2KKWA 4U3JB 2BSKB 1URFA 2B9ZA 2FB5A 2JGDB 5L3FA 3OD4A 4IYHA 1M4UA 3P3NA 4Z2WA 3BEHA 2P90A 4LF6O 4FLYA 4ZHQB 3DGEA 3I55V 4LF6B 1VQ8V 4LCUC 2IJJA 1NR1A 1V54C 2DYSB 2E5LO 1WA8B 2QE7G 1FXKC 3ICXA 3RT3C 2OWOA 3CYOA 2M6YA 4G2KA 3GB7C 3ABTA 2N74A 4J7JA 3CP1A 3S3WA 3RYIA 3JD3A 4DV6O 4LFAO 2DYSC 4UCVA 1WN7A 2HLDG 4DV0O 2GUZA 3JALA 1NVPB 2OCCB 4RQFA 5D5PA 2PZSA 2CTQA 4PI0A 1QHTA 2ZM6O 3AG3C 4K35A 2ZDIC 4DUYO 5B1BC 3ZS8C 1YZBA 2UXCB 3DTUB 1NI8A 1YJNV 2RMKB 3STLC 1SZTA 1UPGA 5KA6A 4UV8A 2CTRA 2QWNB 4CS2A 1GAXA 4FLVA 5JJEB 1OZ0A 3BRCA 5B1AB 1TUEB 1QCEA 3FB5C 4GCZA 3APOA 1XHXA 4MVOA 1I0HA 1Q86W 4MVZA 1K5QA 1YCIA 2Z3YA 2CK3G 4QE9A 1MABG 1H2MA 3BHPA 3RGBA 1IBKO 2KQXA 5FNVA 1IBKB 1M56C 3EFFK 3RVZA 3AK3A 1WP7A 4DR2B 2Q7HA 2BCCH 1B06A 4X66B 3UCSC 1PNKA 4H44B 5JVDA 5LHIA 3OTOO 3QO5A 1N0JA 4LF8B 3EVKA 2X6CA 3DSQA 3GWOA 3OGCC 5IJ0B 3MHHC 3O65A 3QTCA 5IE9A 1H2LA 4DV3B 1NT2B 2Q0AA 2CDYA 2EBOA 3CXHF 1FD9A 4X20B 4YY3B 2K1EA 1TGOA 2IU3A 3VQXA 4RO2A 2OIGA 3OMIB 1TAEA 4DK0A 3ABKB 1O9GA 1YJWV 2VS0A 1K97A 2KB1A 1A32A 2RN9A 2OIEA 3VQVA 5LBQA 4BAYA 3R66A 1S5HC 1RSOB 4GLXA 1OJHA 5GTIZ 2ODMA 3ASNC 1U96A 4XBFA 3TGUH 3E8FA 3D3QA 1FKAO 2ZT9B 2VRZA 5J2TB 4DUZO 4PDRA 5EC1C 4IIJB 4UCRA 2DMXA 3D8CA 1NH2D 4O4LA 1ZLZA 1I94B 4UB6Z 3TK1A 3UKMA 4NKGB 2EZOA 1I94O 4JI0O 5JQGA 4B3TB 3OGIB 4JI0B 1F51A 3UM7A 5L3GA 4DR4O 4UCUA 1VF5B 3B8MA 2OCHA 4JTDB 4LF5O 1U97A 5KX5B 5DECA 4JI1O 2GV9A 4NYKA 5EBWC 1H2KA 3HKBA 2LQTA 4UV9A 1GM7A 2HP8A 5C8YB 4MW8A 1YJ9V 3RN4A 3CJHA 2HEPA 3CHXA 2Q8VA 2PUSA 2X6BA 5IT9N 1PNLA 3B77A 2UXCO 2LFSA 1M57B 3ZMSA 2QDOA 1HNWB 2RQ6A 3AK1A 1VQ4V 3CC2V 2W6JG 2LW1A 2P22C 3TJTA 4FLWA 3K08A 4DR3B 3ZHSA 1IBLO 2Y48A 4LF7O 3SPIA 3JATA 2YIBD 3TETA 3WG7B 1LNQA 3WG7C 3LUTB 2WLIB 3SYAA 1WB7A 4ZOLB 3CCEV 4FLTA 3RYFB 5KHJA 4TV9A 5BXZA 1EN5A 5CA3A 1JJOA 3K5MA 4QE7A 1P7GA 2A0LA 2ZXWC 4UVCA 3WU2Z 2D3OW 4UFZA 4X65B 1XUQA 1NVPD 3MHSC 3CEIA 4HYOA 2F93B 1RM1C 5LXTB 1ZTEA 1G4YB 2CH7B 3SJAC 3ETEA 3W7TA 4X64O 3OTOB 1HDJA 3EHBB 3HKCB 4DR1B 5CB4B 4IHJA 1FJGO 1FFTB 2CAZC 1L8DA 3JCUZ 4JAUA 5LYJB 2JK5C 2HVKC 2QWPB 2UXNA 1OCCC 2B1IA 5B5EZ 1V55C 4BIOA 4LF4B 2W0FC 1N33O 2QEXV 4LF4O 4DV4O 4ZHQA 4GT1A 2UUCO 5IJ9B 4MTOA 1MZEA 1VF6C 3I56V 1EZVH 5KHIA 3SYQA 3AG1B 1BQ0A 1Q82W 4U3JA 4R8CA 1SQXH 4FZ0A 2E3CA 5IJ0A 1AB3A 2EULA 1ZAUA 4PELA 1NBMG 4X1KA 1GMGA 4GUNA 2DWEC 1T5EA 1QR8A 3HKDA 1SA0A 3T1CA 4J80A 3ZN1A 4TWKA 4AQYO 1WB8A 1YVWA 4MTGA 3SJCC 4WFEA 1AR4A 4TV8B 2X6AA 5FNVB 4AHCA 3N2KB 1XL4A 1ZL8A 4I7ZB 3VOUA 5JVDB 4TT3G 4WFBV 4PA4A 2A7WA 3WFVA
chains in the Genus database with same CATH topology
3A0HZ 4IL6Z 4PJ0Z 5GTIZ 2AXTZ 5KAFZ 4UB8Z 3JCUZ 5TISZ 1S5LZ 4UB6Z 5GTHZ 3KZIZ 5H2FZ 5KAIZ 5B66Z 5B5EZ 5E79Z 3WU2Z 3A0BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H Z;  4IL6 Z;  4PJ0 Z;  5GTI Z;  2AXT Z;  5KAF Z;  4UB8 Z;  3JCU Z;  5TIS Z;  1S5L Z;  4UB6 Z;  5GTH Z;  3KZI Z;  5H2F Z;  5KAI Z;  5B66 Z;  5B5E Z;  5E79 Z;  3WU2 Z;  3A0B Z; 
#chains in the Genus database with same CATH topology
 4JV5 B;  2QKC A;  4BIU A;  4U3F H;  4QGP A;  3K0D A;  4LH6 A;  4DV5 O;  3WB0 A;  5L3C A;  5H6R A;  3ZMT A;  1FXK A;  2ITD C;  4FZ1 A;  5IYZ A;  2QM8 A;  3SDL A;  3ZMZ A;  5LGN A;  3RYH A;  2CTW A;  4LF5 B;  4O2B A;  4P2Z A;  5EBM C;  2F1M A;  4WCE V;  4JI1 B;  1LUV A;  1Q90 D;  4NB5 A;  3AG7 A;  4BR6 A;  3IGA C;  1GN4 A;  4GKK O;  5JQG B;  2NR5 A;  2ZIM A;  1BZK A;  1AJP A;  1ZX3 A;  4O2A A;  2P7T C;  3CCR V;  3K59 A;  4MVM A;  1FXK B;  3DC5 A;  4C7U A;  2XOK G;  4E4E A;  4YIP A;  4IIJ A;  3J80 N;  3ZHR A;  1GTO A;  1EBO A;  5IWA O;  1CXZ B;  1LUW A;  3GWK C;  3M7M X;  2BOB C;  4JI3 B;  4X89 A;  1SQB H;  1WA8 A;  4B7E A;  3HB3 B;  3H1K H;  5CA1 B;  1ORQ C;  2DQ0 A;  2FTK A;  1BHB A;  2XAF A;  1VF7 A;  4QPJ A;  4W4L A;  2JEX A;  1WJZ A;  1P4R A;  1IDS A;  3AG3 B;  2UU9 B;  3BVO A;  4I55 A;  4JI8 O;  4DV2 O;  1QVF U;  4KXR A;  1BMF G;  3D3I A;  1IBM B;  1XEQ A;  3OE7 G;  1Q6H A;  3OR7 C;  4XDL A;  2ZE8 A;  5L3E A;  1V55 B;  5CBH A;  4FLZ A;  3JSN A;  4O4I A;  1NQT A;  1DGS A;  3S3X A;  3FKS G;  4OGQ B;  1GN3 A;  1QLN A;  5C93 A;  2XAH A;  4JI6 B;  1OCZ C;  1N33 B;  2IJK A;  1M90 W;  1R6N A;  3MDS A;  1E1Q G;  1W0K G;  1HP8 A;  2CH7 A;  5KUK A;  4D6T H;  1NTM H;  3ABL C;  3BCC H;  1YIT V;  2UXB B;  4H13 B;  1SES A;  5LHH A;  2A06 H;  2VQF O;  1K8A W;  4J9Z B;  3H1H H;  4B7K A;  4DW0 A;  3ZRW B;  4RUE A;  3E22 B;  1FXV A;  3G6B A;  4F6R A;  1P7B A;  1KKC A;  2EJ7 A;  1V54 B;  2Q73 A;  1I08 A;  1XL6 A;  3APQ A;  1L0L H;  4L8J A;  4ZI7 B;  4DV5 B;  2FYU H;  3CC7 V;  2AZ0 A;  3QNE A;  2W0X A;  3DXR B;  1GK9 A;  1Y4M A;  3Q4H B;  1MA1 A;  2PGG A;  4O4L B;  4I4T A;  4I50 B;  1M57 C;  1YDX A;  2YEV A;  1NTK H;  3HKB B;  4LFA B;  2PYL A;  3AG1 C;  4IYI A;  3ASO C;  2V1D A;  1IXB A;  3HR0 A;  3ETQ A;  3TXS A;  4YJ3 A;  1Y76 A;  1P84 F;  3SJB C;  4BW5 A;  3D36 A;  3QG5 A;  4WBN B;  3CD6 V;  1O9H A;  3JAR B;  3TXQ A;  4EB6 A;  3K03 A;  3SPH A;  3GVM A;  3N27 A;  4MSW C;  3ASO B;  3SPG A;  3CRQ A;  2ADQ B;  3FFQ A;  5LOV A;  1S76 D;  1PPJ H;  1HR0 O;  4ASU G;  1W59 A;  2JS3 A;  4DR6 O;  1N34 B;  3B8N A;  3W7S A;  3E8H A;  4LH7 A;  1I5Y A;  2AHZ A;  4ICG A;  4JTA B;  3RYH B;  1XQ8 A;  2Y0I A;  3CE2 A;  3UT5 B;  4DV7 O;  1FS0 G;  4G27 B;  2G38 A;  3A8T A;  3LSQ A;  4TQD A;  5EZY B;  2C2A A;  1YEW A;  2MW2 B;  2F23 A;  5B1N A;  1TVK A;  2WA4 A;  4I0X B;  5DM6 V;  1MOF A;  4K0K O;  1GN2 A;  3ABM B;  4DR2 O;  1YTF B;  4AI8 A;  1SET A;  1GKF A;  1KC8 W;  3T2M A;  2F43 G;  2ZNJ A;  1EZJ A;  5IYC O;  2GBO A;  4NTW A;  4FM2 A;  4JI5 O;  2RCV A;  3B40 A;  4LWS A;  3E2E A;  1PM9 A;  5JCO A;  2OT5 A;  5BMV B;  2DJV A;  2IH3 C;  4NTY A;  1SA0 B;  4MT8 A;  4IGG A;  3UT5 A;  5GON A;  3A0H Z;  3D36 C;  1PP9 H;  4D7S A;  2IM9 A;  2Q68 A;  2QM4 A;  5LMU B;  4DO2 A;  1BQZ A;  1WPB A;  1JVM A;  5ITZ B;  2V4D A;  2R9R B;  5JJN B;  3FB7 C;  3ZHV A;  3AEI A;  5KMG B;  4X88 A;  2QA4 V;  1DTO A;  5EIB D;  1GN6 A;  3K3W A;  3W7U A;  3LNM B;  1Y66 A;  1MSW D;  2VWJ A;  2JIZ G;  4EB6 B;  3JAR A;  3JD2 A;  4GYC B;  2V7Q G;  1YSC A;  4B3R B;  3K5L A;  3K04 A;  5FPR A;  5IY5 B;  2OTJ V;  4J41 A;  2XAG A;  4RAI A;  1DF5 A;  2YID A;  1SS3 A;  1K73 W;  1JFF A;  3QVN A;  1ZL8 B;  3CRA A;  4I50 A;  3G4S V;  2ZE7 A;  1OHH G;  3OUS A;  4B3S O;  5KAF Z;  4LFC O;  3IC7 A;  1YXB A;  5JWP A;  2E5L B;  4NXN O;  1SC5 B;  4DRX B;  1JR9 A;  2QTS A;  4W4K A;  3HKD B;  4WBN A;  2QSA A;  1XOU A;  3ASN B;  4X1Y A;  3CB2 A;  1KD1 W;  3RYF A;  1VQP V;  4MVR A;  4NR1 A;  1ENV A;  2GDS A;  4CH3 A;  4DV6 B;  4X1Y B;  2WLN A;  2YEV B;  4BIZ A;  2YDE A;  4P9P A;  2YUA A;  4I4T B;  4J7Z A;  2WA3 A;  4DR5 O;  2JJ1 G;  4H0L B;  4O4J A;  2AW9 A;  3LSS A;  1GO3 F;  3ABL B;  3G80 A;  3BAB A;  2UUB O;  3K0G A;  3KCY A;  3OM3 B;  5L3B A;  2LGW A;  3WB1 A;  4UVA A;  1Y67 A;  2Y69 B;  4MVU A;  3JAM N;  4FLX A;  2P67 A;  1SQG A;  2BSK A;  2PTM A;  1N8R W;  2PY5 A;  2WWW A;  2AGA A;  5E1A C;  4QNH B;  3FD9 A;  2LJ2 A;  4E2L A;  4RQE A;  3L75 H;  4LF7 B;  3JCZ A;  2YI9 A;  2PI4 A;  2EIJ B;  4DXW A;  2L35 A;  2R9I A;  4PA7 A;  4MW3 A;  2NN4 A;  2WLJ A;  2Q5Z A;  4I9W A;  4PJ0 Z;  4JYA B;  1DLB A;  4FIP C;  4X66 O;  4LFB B;  1XRE A;  2QKA A;  1S72 V;  2DQ3 A;  4LFB O;  2WAM A;  4DR7 O;  4QPK A;  1QLE B;  2W6I G;  4DR7 B;  2CE4 A;  1PL0 A;  4JI5 B;  2Q67 A;  4BWA A;  1KMI Z;  5BR8 O;  1THZ A;  2GTA A;  2QTO A;  1RSO A;  1W0J G;  1TVK B;  3ML0 A;  2DN9 A;  4NVP A;  3L72 H;  2BOC C;  4U7O A;  2P06 A;  5LMU O;  2VQE O;  5EZY A;  2O57 A;  2N04 A;  3M99 B;  1R6K A;  3MAQ A;  1AI6 A;  3CCQ V;  3KKY A;  2QM7 A;  1G8M A;  4IL6 Z;  3N2G B;  3FYI B;  4X8A A;  4X20 A;  1NS1 A;  1M5I A;  3C3S A;  4DRX A;  4B3R O;  2DWD C;  2NLJ C;  2IW5 A;  5LOV B;  3H1L H;  3JAK B;  4DUZ B;  2XHB A;  1IX9 A;  5BY1 A;  2QJ1 A;  2ATK C;  2BTQ A;  1JFF B;  4DV1 B;  4Z1V A;  4K8X A;  4MVQ A;  2X0L A;  4DW1 A;  4JAA A;  2HHH O;  2ADP A;  1KUQ A;  3FAV A;  2HFE C;  2AHY A;  4DR4 B;  4B3M B;  4O2A B;  3NXS A;  1QQC A;  1IVS A;  3L9D A;  1QVG U;  5ITZ A;  4WFF A;  5E79 Z;  1BE3 H;  2JDI G;  3N2K A;  4DR5 B;  4HBN A;  4ZI7 A;  3LSU A;  4MVS A;  4CH4 A;  2FML A;  3F5W C;  4GKK B;  1X4T A;  1AIL A;  2EZP A;  2UXX A;  1RPR A;  2IBZ H;  4JI4 B;  3JD0 A;  2A79 B;  2H94 A;  1Y74 B;  1R3L C;  1Y74 A;  2HR3 A;  1EN6 A;  3AG2 B;  4R50 A;  2WLL A;  5LGT A;  5LMN B;  5GON B;  1IBL B;  5B1B B;  2IU0 A;  4ZBM A;  1QR9 A;  5IWA B;  4PD4 F;  1H2N A;  3ZED A;  1AJQ A;  3J81 N;  1PKX A;  1XHZ A;  2FKX A;  3EXA A;  4OPA A;  5D5Q A;  4JI3 O;  1OCR C;  4OXS A;  2OCC C;  5JH7 A;  4CH6 A;  1US6 A;  1AR5 A;  1HNX B;  1WP8 A;  3CWB H;  2F4V B;  4IT5 A;  4YHH O;  3CCU V;  1EM1 A;  1JPX A;  2KSD A;  3T1Y O;  2Q4P A;  4X65 O;  2PF4 E;  1DK1 A;  1WAZ A;  1FYJ A;  5EBL C;  4DV2 B;  1K9M W;  1OV9 A;  3JAW A;  4DR1 O;  1IBM O;  4NTX A;  5IJ9 A;  4LF9 B;  3FAV B;  3OT7 A;  2QKS A;  1GRJ A;  1NU1 H;  3B2E E;  1ROP A;  1VEW A;  4ZKI A;  2ZR3 A;  1E79 G;  4PI2 A;  3JAW B;  3JD4 A;  3DC6 A;  5BR8 B;  4JF3 A;  1IUR A;  1R1B A;  3RW0 A;  3ZMV A;  2P5O A;  2BTQ B;  4OPH A;  1QLE C;  4JI6 O;  2UUC B;  3B4S A;  3NR7 A;  3G67 A;  3A0B Z;  1EFR G;  3JAL B;  2AZ2 A;  3HKC A;  2XAS A;  3RYC A;  5LXT A;  1BHA A;  5CA0 A;  5FL7 G;  2HKO A;  1PNM A;  4I9Q A;  1Z2G A;  5LP6 B;  3K79 A;  3CCL V;  1WLE A;  4AQY B;  4TV9 B;  3CRM A;  4AIL C;  1SKV A;  4H33 A;  1F4M A;  3Q4H A;  1EN4 A;  1Q3E A;  3R65 A;  2ZCE A;  4DV1 O;  4KFM A;  2D2C B;  5H9C A;  4JAS A;  4PDL A;  1TA8 A;  1OCZ B;  4JAV A;  4HNA B;  2XND G;  1G1X B;  1DF4 A;  1SQF A;  4YIO A;  4B08 A;  5B1O A;  4B3M O;  2WLH A;  1BSM A;  2KG7 B;  3E22 A;  5B3S C;  4UVB A;  3OTF A;  3E8B A;  3QO8 A;  3ZRW A;  3IAY A;  3K06 A;  4FM1 A;  4PDV A;  2CGO A;  1OCR B;  1RP3 B;  1Q8I A;  3OMN B;  4UB8 Z;  1VQ9 V;  5B66 Z;  4EFE A;  3T1H B;  2RNB A;  3AG2 C;  4I0X A;  3ZN0 A;  3SGI A;  4WF9 V;  3ZX6 A;  2P4V A;  5IYB O;  1FPO A;  3JAK A;  3U11 A;  1NH2 B;  2Y69 C;  1N4C A;  3OEH G;  2EIM B;  3E89 A;  3ZRX A;  3FYE B;  1VIB A;  5DED A;  2ITC C;  4J7K A;  1NR7 A;  2UXD O;  1K34 A;  1H2G A;  3BPZ A;  4YHH B;  2UXD B;  3SPC A;  4I55 B;  1BGY H;  3X2Q C;  2UU9 O;  2LW7 A;  4JI8 B;  2YS8 A;  4HAM A;  4JPR A;  1JA8 A;  2DE0 X;  3CSX A;  1V9P A;  4R6Z A;  2Q0O C;  4YJ3 B;  2EIL B;  3E35 A;  4IHJ B;  5JH7 B;  4LC1 A;  3W7W A;  4GX5 A;  1JQ0 A;  1VQM V;  5KUM A;  4LNU A;  1Q7Y W;  2DOS A;  5A2Q N;  2JVD A;  3CCS V;  2KG7 A;  1KB9 F;  3ZCC A;  1Q5O A;  3HPL C;  1JCH A;  1XNR O;  1F23 A;  5CBF A;  4YJ2 B;  1WNS A;  5HFL A;  3ZMU A;  1XNR B;  2DYR C;  1H8E G;  2P6J A;  4HNA A;  5HFM A;  3BFR A;  2UXB O;  3ETD A;  1H38 A;  3OUF A;  1VQ6 V;  3K9A A;  4UCO A;  4N23 A;  1XI1 A;  4PA6 A;  2GUZ B;  1BL8 A;  2WPD G;  1R6T A;  1XDC A;  1XNQ O;  3BA9 A;  4FJC C;  1D5A A;  2Z5U A;  5CA0 B;  4B3S B;  4CC6 A;  2QWO B;  4GX1 A;  1JMK C;  3CCM V;  5CMU A;  4DV3 O;  3ZIA G;  4NXN B;  2CTP A;  4PV1 B;  2LO1 A;  5B3S B;  4UXN A;  4FM0 A;  2JRI A;  3P3P A;  2ILM A;  4YY3 O;  5KX5 A;  1WPX A;  1I5X A;  1KP3 A;  3RFR A;  1CP9 A;  2YSU B;  2R72 A;  3OR6 C;  4FFB A;  1H8H G;  2B1G A;  2ZR2 A;  1K7D A;  4FK5 C;  5K1X A;  4YXW G;  3CC4 V;  1AVM A;  3N2G A;  5H5N A;  2ZDI A;  4RWU A;  3T1H O;  2BE3 A;  4X9Q A;  1QU7 A;  1LR1 A;  4X62 B;  2YIA A;  2UUB B;  2JGD A;  3AG4 B;  3ABU A;  3IC9 A;  4FPP A;  1N36 B;  4X62 O;  4DK1 A;  2H3O A;  4JZG A;  2YXL A;  1N36 O;  2L6L A;  3JD1 A;  4MTX A;  5KLV H;  3W7X A;  1KYO F;  3G6E V;  3JAS B;  4O4H B;  1HR0 B;  2CUG A;  3A2F A;  4EKW A;  2EJR A;  4RUF A;  5DN6 G;  4DR6 B;  4TQF A;  5H6Q A;  3WB2 A;  3AG4 C;  1IXM A;  3VQW A;  1IZ3 A;  5K1P A;  1VQN V;  3IJ4 A;  4QJF B;  5KMG A;  1AI4 A;  1AI5 A;  4B3T O;  2OYQ A;  1S5L Z;  4X1I B;  2FL4 A;  3THO A;  4J11 A;  2UUA B;  2R70 A;  2HJD A;  3K58 A;  4KUM A;  2UUA O;  1GH6 A;  4K0K B;  1YI2 V;  1Q81 W;  1PV0 A;  2ZIN A;  4JYA O;  3ZBH A;  1K92 A;  3JAT B;  1SZX A;  4DV0 B;  4PA3 A;  3RBZ A;  2Y0P A;  1TUB B;  1RM1 B;  4J42 A;  2JGU A;  4XDK A;  1VP7 A;  2AXT Z;  3BAA A;  1ZUQ A;  3LDC A;  4GX0 A;  1M1K W;  2WLI A;  3SYC A;  3ZHT A;  4KHP B;  1QNM A;  4TUY A;  1W2B U;  4KHP O;  2EIN B;  3RWR D;  4PDM A;  2P4K A;  5EK0 A;  2YIB A;  4FFK A;  3ABK C;  1KEC A;  1NKD A;  2QWR B;  3L71 H;  2RDC A;  4DR3 O;  1S77 D;  3I5D A;  1AP5 A;  4XDJ A;  1VQL V;  4LBE C;  3OFN G;  4J9Y B;  5EC2 C;  3C90 A;  4LR3 A;  4H37 A;  1M9N A;  3QO7 A;  4O4J B;  3CCJ V;  2Q7G A;  1AP6 A;  4LNU B;  1RPO A;  3CX5 F;  1Z5V A;  3CXC U;  4PA9 A;  3H9V A;  1KP2 A;  2BTO A;  3JYC A;  4JI2 B;  2IH1 C;  4WFG A;  3CS5 A;  2GSM B;  4LF8 O;  3HKE B;  1MZF A;  2YI8 A;  1SRY A;  1XNQ B;  1MNG A;  2NNU A;  5LGU A;  3FX7 A;  3PJS K;  1H2S B;  3A0R A;  3E86 A;  4LFC B;  3UO2 A;  1UJW B;  1VAR A;  3CMA V;  4K8Z A;  1E1R G;  2Y4T A;  1N0N A;  4EFB A;  2EIL C;  2XAJ A;  3FB6 C;  2HJF C;  1R3J C;  3L74 H;  2YXH A;  4WFH A;  5KHK A;  2JJ2 G;  1S3J A;  3OMA B;  3LDD A;  4I5S A;  2ZXW B;  3CCV V;  5IDJ A;  1HNZ O;  1HNZ B;  4GZR B;  1K4D C;  3VQY A;  1K3E A;  4CC5 A;  2CGN A;  2DYR B;  5J9P C;  3K5N A;  5CB4 A;  4F6R B;  2GTS A;  2PYJ A;  4Z1M G;  4GX2 A;  1AJN A;  1Y6X A;  3KCX A;  4L87 A;  2EX3 A;  3JSL A;  2ZKO A;  1GM9 A;  4JI4 O;  2N05 A;  1PL4 A;  3LDE A;  4TSF G;  5IY5 C;  1M93 A;  5LMN O;  3KZI Z;  5KAI Z;  1KKD A;  5FPO A;  3H1I H;  3F5T A;  1AI7 A;  5IYD O;  2WLM A;  4A5U B;  3ZHQ A;  1HW7 A;  1R3K C;  3U0Z A;  4JV5 O;  2ZE5 A;  2PI5 A;  4KL1 A;  1K33 A;  2E76 B;  1UFI A;  1SF9 A;  1ZSP A;  1X59 A;  2ZIO A;  1SQQ H;  4Q20 A;  1B04 A;  1XMO B;  1R3I C;  5IYZ B;  2R9A A;  5EYP A;  3CRR A;  1KQS U;  2JEU A;  4JYY A;  1VQO V;  4O4H A;  3ZRS A;  1JJ2 U;  3JAS A;  2EIM C;  1B3Q A;  5C8Y A;  5F2V O;  3AK2 A;  2WLK A;  4LF9 O;  1HWY A;  1Q43 A;  4TUY B;  2YXY A;  4LP8 A;  3P30 A;  1HNW O;  1XMQ B;  4QIW F;  2Z0A A;  1J5E B;  2RJZ A;  2YIC A;  3ZJZ A;  1VF6 A;  1J5E O;  3MD0 A;  4K3A A;  4TV8 A;  2EIJ C;  3UO3 A;  2VQE B;  3BY6 A;  3O9O A;  3OEE G;  2ZNI A;  4JI7 O;  5L3D A;  3CRC A;  5CA1 A;  4U7N A;  1Y76 B;  2XTA A;  3G71 V;  2GHY A;  3X2Q B;  1SQV H;  1KU9 A;  1BCC H;  4NXM B;  3PN1 A;  4P9O A;  1ARO P;  4PHZ A;  3P32 A;  5J2T A;  3RYI B;  1OCC B;  3OAA G;  4JI2 O;  5LHG A;  4X64 B;  2EIK B;  1VQK V;  5EYP B;  1K5S A;  1FJG B;  1D2D A;  1N32 B;  4TOI A;  4CS4 A;  2A9H A;  4JYB A;  2HHH B;  5H2F Z;  4D7T A;  1N32 O;  2MK3 A;  5LYJ A;  2HG5 C;  5EIB C;  2F66 C;  4HZ3 A;  4DV4 B;  1FXH A;  1KBH A;  5CBG A;  1FFX A;  4JYC A;  3SYP A;  1S0V A;  3SPJ A;  4OX9 O;  4FFB B;  2XUM A;  2K9P A;  1G6U A;  2LP7 A;  2ZE6 A;  1D5N A;  3CME V;  2WLL B;  1MMM A;  3L73 H;  1OCO C;  3E83 A;  2E75 B;  2VQF B;  3T4D A;  2XAQ A;  3K5O A;  5GW7 A;  2QR4 A;  3M8A A;  3U10 A;  5BMV A;  1L1F A;  3RVY A;  1XBL A;  2B5U A;  4JTC B;  1Z5W A;  1JOY A;  1K4C C;  3K57 A;  4X1K B;  2ZD9 A;  3TCU A;  4CBC A;  4FLU A;  1F7Y A;  2QGN A;  1F4N A;  3KG2 A;  1XIL A;  1QBZ A;  2LFR A;  2IJI A;  1AR1 B;  2Y4U A;  1HNX O;  2F4V O;  3CPW U;  4N21 A;  2Q9L A;  5BZB A;  1VQ5 V;  5CN0 A;  5AG2 A;  5LP6 C;  4FMT A;  4DYL A;  3T1Y B;  1B6Q A;  4R7C A;  2M7W A;  4Q6G A;  2VWK A;  2Q69 A;  1S5J A;  5J2U A;  1XMO O;  4YJ2 A;  3ZHU A;  3SR2 C;  3F7V C;  2LGQ A;  3HKE A;  5LL6 Y;  1SER A;  4UCS A;  2XT9 A;  4EEQ A;  1J95 A;  2Q7E A;  1YF2 A;  4WFA V;  5GTH Z;  2DW4 A;  4G28 B;  4CH5 A;  3F7Y C;  4JGS A;  5KHH A;  2ZM6 B;  5LA6 A;  2HVJ C;  4CS3 A;  1VQ7 V;  4DUY B;  1FAF A;  1XMQ O;  4ZIB A;  5JCO C;  3QF7 A;  4F6E A;  2QWQ B;  3ABM C;  3BA8 A;  2JS5 A;  3H1J H;  1YTF D;  4FVM A;  3UQ8 A;  1GM8 A;  3DXR A;  5KA5 A;  3STZ C;  5A9G A;  2IJH A;  2ZQM A;  4JI7 B;  1SQP H;  1MSD A;  1Q6U A;  4JZ2 A;  1RFY A;  2YC0 A;  5J2U B;  5LA6 B;  1N34 O;  3H01 A;  4ZOL A;  4MTF A;  1BS3 A;  4BW9 A;  2H8P C;  1YHQ V;  4GKJ B;  3L70 H;  3ETG A;  1L0N H;  2ETN A;  3IFX A;  1ZWI C;  4DV7 B;  4GKJ O;  1Q6I A;  4NXM O;  2Q6A A;  4UCT A;  3ZRV A;  2F95 B;  3LNN A;  1VMG A;  1P49 A;  3C3T A;  2EIN C;  5B1A C;  3E8G A;  4O2B B;  3K9S A;  1PD3 A;  1CPY A;  3SJQ C;  5FLX N;  1YIJ V;  3T4Z A;  2OTL V;  4MS2 A;  1NTZ H;  5TIS Z;  4P30 A;  1JX9 A;  1NZ6 A;  3SYO A;  3CJH B;  4LWS B;  2E74 B;  3J7A U;  1R73 A;  1NJI W;  3VBB A;  1I7F A;  4UUJ C;  1M56 B;  1MG1 A;  5KHG A;  2EIK C;  4CZZ A;  4X1I A;  5LP6 A;  1BT8 A;  5JJJ B;  2ARH A;  3OW2 U;  3FB8 C;  4F4L A;  2X7R B;  1TUB A;  2WSS G;  1OCO B;  4OX9 B;  1CEZ A;  3B09 A;  1FFX B;  3RYC B;  2A3Q A;  4O4I B;  4ABM A;  4J10 A;  1COW G;  4KP4 A;  2KKW A;  4U3J B;  2BSK B;  1URF A;  2B9Z A;  2FB5 A;  2JGD B;  5L3F A;  3OD4 A;  4IYH A;  1M4U A;  3P3N A;  4Z2W A;  3BEH A;  2P90 A;  4LF6 O;  4FLY A;  4ZHQ B;  3DGE A;  3I55 V;  4LF6 B;  1VQ8 V;  4LCU C;  2IJJ A;  1NR1 A;  1V54 C;  2DYS B;  2E5L O;  1WA8 B;  2QE7 G;  1FXK C;  3ICX A;  3RT3 C;  2OWO A;  3CYO A;  2M6Y A;  4G2K A;  3GB7 C;  3ABT A;  2N74 A;  4J7J A;  3CP1 A;  3S3W A;  3RYI A;  3JD3 A;  4DV6 O;  4LFA O;  2DYS C;  4UCV A;  1WN7 A;  2HLD G;  4DV0 O;  2GUZ A;  3JAL A;  1NVP B;  2OCC B;  4RQF A;  5D5P A;  2PZS A;  2CTQ A;  4PI0 A;  1QHT A;  2ZM6 O;  3AG3 C;  4K35 A;  2ZDI C;  4DUY O;  5B1B C;  3ZS8 C;  1YZB A;  2UXC B;  3DTU B;  1NI8 A;  1YJN V;  2RMK B;  3STL C;  1SZT A;  1UPG A;  5KA6 A;  4UV8 A;  2CTR A;  2QWN B;  4CS2 A;  1GAX A;  4FLV A;  5JJE B;  1OZ0 A;  3BRC A;  5B1A B;  1TUE B;  1QCE A;  3FB5 C;  4GCZ A;  3APO A;  1XHX A;  4MVO A;  1I0H A;  1Q86 W;  4MVZ A;  1K5Q A;  1YCI A;  2Z3Y A;  2CK3 G;  4QE9 A;  1MAB G;  1H2M A;  3BHP A;  3RGB A;  1IBK O;  2KQX A;  5FNV A;  1IBK B;  1M56 C;  3EFF K;  3RVZ A;  3AK3 A;  1WP7 A;  4DR2 B;  2Q7H A;  2BCC H;  1B06 A;  4X66 B;  3UCS C;  1PNK A;  4H44 B;  5JVD A;  5LHI A;  3OTO O;  3QO5 A;  1N0J A;  4LF8 B;  3EVK A;  2X6C A;  3DSQ A;  3GWO A;  3OGC C;  5IJ0 B;  3MHH C;  3O65 A;  3QTC A;  5IE9 A;  1H2L A;  4DV3 B;  1NT2 B;  2Q0A A;  2CDY A;  2EBO A;  3CXH F;  1FD9 A;  4X20 B;  4YY3 B;  2K1E A;  1TGO A;  2IU3 A;  3VQX A;  4RO2 A;  2OIG A;  3OMI B;  1TAE A;  4DK0 A;  3ABK B;  1O9G A;  1YJW V;  2VS0 A;  1K97 A;  2KB1 A;  1A32 A;  2RN9 A;  2OIE A;  3VQV A;  5LBQ A;  4BAY A;  3R66 A;  1S5H C;  1RSO B;  4GLX A;  1OJH A;  5GTI Z;  2ODM A;  3ASN C;  1U96 A;  4XBF A;  3TGU H;  3E8F A;  3D3Q A;  1FKA O;  2ZT9 B;  2VRZ A;  5J2T B;  4DUZ O;  4PDR A;  5EC1 C;  4IIJ B;  4UCR A;  2DMX A;  3D8C A;  1NH2 D;  4O4L A;  1ZLZ A;  1I94 B;  4UB6 Z;  3TK1 A;  3UKM A;  4NKG B;  2EZO A;  1I94 O;  4JI0 O;  5JQG A;  4B3T B;  3OGI B;  4JI0 B;  1F51 A;  3UM7 A;  5L3G A;  4DR4 O;  4UCU A;  1VF5 B;  3B8M A;  2OCH A;  4JTD B;  4LF5 O;  1U97 A;  5KX5 B;  5DEC A;  4JI1 O;  2GV9 A;  4NYK A;  5EBW C;  1H2K A;  3HKB A;  2LQT A;  4UV9 A;  1GM7 A;  2HP8 A;  5C8Y B;  4MW8 A;  1YJ9 V;  3RN4 A;  3CJH A;  2HEP A;  3CHX A;  2Q8V A;  2PUS A;  2X6B A;  5IT9 N;  1PNL A;  3B77 A;  2UXC O;  2LFS A;  1M57 B;  3ZMS A;  2QDO A;  1HNW B;  2RQ6 A;  3AK1 A;  1VQ4 V;  3CC2 V;  2W6J G;  2LW1 A;  2P22 C;  3TJT A;  4FLW A;  3K08 A;  4DR3 B;  3ZHS A;  1IBL O;  2Y48 A;  4LF7 O;  3SPI A;  3JAT A;  2YIB D;  3TET A;  3WG7 B;  1LNQ A;  3WG7 C;  3LUT B;  2WLI B;  3SYA A;  1WB7 A;  4ZOL B;  3CCE V;  4FLT A;  3RYF B;  5KHJ A;  4TV9 A;  5BXZ A;  1EN5 A;  5CA3 A;  1JJO A;  3K5M A;  4QE7 A;  1P7G A;  2A0L A;  2ZXW C;  4UVC A;  3WU2 Z;  2D3O W;  4UFZ A;  4X65 B;  1XUQ A;  1NVP D;  3MHS C;  3CEI A;  4HYO A;  2F93 B;  1RM1 C;  5LXT B;  1ZTE A;  1G4Y B;  2CH7 B;  3SJA C;  3ETE A;  3W7T A;  4X64 O;  3OTO B;  1HDJ A;  3EHB B;  3HKC B;  4DR1 B;  5CB4 B;  4IHJ A;  1FJG O;  1FFT B;  2CAZ C;  1L8D A;  3JCU Z;  4JAU A;  5LYJ B;  2JK5 C;  2HVK C;  2QWP B;  2UXN A;  1OCC C;  2B1I A;  5B5E Z;  1V55 C;  4BIO A;  4LF4 B;  2W0F C;  1N33 O;  2QEX V;  4LF4 O;  4DV4 O;  4ZHQ A;  4GT1 A;  2UUC O;  5IJ9 B;  4MTO A;  1MZE A;  1VF6 C;  3I56 V;  1EZV H;  5KHI A;  3SYQ A;  3AG1 B;  1BQ0 A;  1Q82 W;  4U3J A;  4R8C A;  1SQX H;  4FZ0 A;  2E3C A;  5IJ0 A;  1AB3 A;  2EUL A;  1ZAU A;  4PEL A;  1NBM G;  4X1K A;  1GMG A;  4GUN A;  2DWE C;  1T5E A;  1QR8 A;  3HKD A;  1SA0 A;  3T1C A;  4J80 A;  3ZN1 A;  4TWK A;  4AQY O;  1WB8 A;  1YVW A;  4MTG A;  3SJC C;  4WFE A;  1AR4 A;  4TV8 B;  2X6A A;  5FNV B;  4AHC A;  3N2K B;  1XL4 A;  1ZL8 A;  4I7Z B;  3VOU A;  5JVD B;  4TT3 G;  4WFB V;  4PA4 A;  2A7W A;  3WFV A; 
#chains in the Genus database with same CATH homology
 3A0H Z;  4IL6 Z;  4PJ0 Z;  5GTI Z;  2AXT Z;  5KAF Z;  4UB8 Z;  3JCU Z;  5TIS Z;  1S5L Z;  4UB6 Z;  5GTH Z;  3KZI Z;  5H2F Z;  5KAI Z;  5B66 Z;  5B5E Z;  5E79 Z;  3WU2 Z;  3A0B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...