5KAFZ

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 22
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kafZ00
2AXTZ 4UB8Z 5GTIZ 5TISZ 3A0BZ 5KAFZ 3A0HZ 3KZIZ 5GTHZ 5H2FZ 5E79Z 3JCUZ 4IL6Z 4UB6Z 5KAIZ 5B5EZ 3WU2Z 1S5LZ 5B66Z 4PJ0Z
chains in the Genus database with same CATH superfamily
1M93A 4FPPA 5GTIZ 4JF3A 3DXRB 3SYAA 1VEWA 2HFEC 4J41A 4DR4B 4PHZA 4CC5A 2QSAA 3EXAA 1AI4A 3N2KB 1F51A 4X62B 1OJHA 4CH6A 4JV5O 1R73A 1WB7A 2K9PA 4MW8A 4DV6O 4DR7B 1CP9A 1Z5VA 1ORQC 4YJ3B 2QKCA 5FLXN 5CB4A 3VQVA 1M57B 2FYUH 4GKKB 3AK2A 2IU3A 2ZE6A 4F4LA 1GN4A 3ZRWB 1Q7YW 3D3IA 2QWOB 4DK0A 2WPDG 2ZNJA 3ZHTA 5DM6V 2PI5A 2QTOA 1YDXA 1OCCC 2EINC 2JEUA 3UT5A 4DR5B 2IBZH 3CC7V 2HJDA 4J11A 1K4DC 1AVMA 3HKDA 3JARA 4GX5A 5CA3A 3ZRXA 4DV5O 4U3JB 5KHGA 3E8BA 1Q5OA 1AP6A 1MMMA 2CUGA 4U3FH 1EBOA 2ZKOA 3CC4V 3ASOC 2HP8A 5BMVA 3X2QB 2E3CA 5F2VO 2Q0OC 5EK0A 3AG7A 1FXKC 4LF7B 3BABA 4QIWF 4L87A 2WAMA 2ILMA 5B1BB 1N4CA 3B40A 3CD6V 3BAAA 2UUCB 2JGUA 1NR7A 1SZTA 4JTCB 1VF5B 4LP8A 1I5YA 4WFGA 5JVDA 3CPWU 2W6IG 4AQYO 1JFFB 3QG5A 4JTAB 1J5EB 5JH7B 1GM9A 3BPZA 2Q7GA 1JMKC 1Y74B 1H2GA 3DC5A 2OTJV 2ZM6O 1K4CC 2CTQA 5EIBD 3VBBA 1V55C 1RM1B 5B66Z 2QKAA 1SESA 2ZIMA 2ZE8A 1L1FA 1OCZC 4O4JA 1IBKO 3WB0A 1QVFU 1JQ0A 3BHPA 3L73H 5KHKA 5EYPA 2YUAA 2R9AA 3BA9A 2LJ2A 4FJCC 2QWQB 4TV9A 4JI4B 4DW1A 5KMGA 3CRCA 4ZHQA 1IXMA 2ADPA 4FLXA 3JSNA 1Y76B 1IBLO 1O9GA 1HW7A 2UXBO 4DV4B 3D3QA 5K1PA 1LR1A 4I50A 5AG2A 1I5XA 4N21A 5LYJB 2IH1C 4YHHO 2VQFB 5IE9A 4B3RB 5IT9N 3OTOO 4K0KO 1H8HG 3RN4A 4KHPO 2KKWA 3KKYA 2YXYA 5IDJA 1I08A 1SQVH 2ZXWC 3SYCA 4JZ2A 1BS3A 3ZIAG 3AEIA 2QWRB 2F23A 1PD3A 3OEHG 2OWOA 4MTXA 2K1EA 3RVZA 3ZMSA 2YEVB 3JAWA 5DECA 1TUEB 2QEXV 4WCEV 3LSUA 1QBZA 4DV2O 4CH5A 3OFNG 2Y69C 3Q4HA 5GONA 4NTYA 3DTUB 4BWAA 1NT2B 3H1HH 4X20A 3F5WC 3I55V 4LBEC 3SPIA 5EC2C 2EZPA 3AK1A 5IYZB 4ABMA 3A8TA 3JD3A 3ZJZA 4FFBB 3ZN1A 1IBMO 3DSQA 4L8JA 5B1AC 4G28B 2OIGA 2BSKB 4LNUA 1GAXA 2L6LA 2R9RB 2EILC 4D6TH 4WFEA 2H3OA 4ZIBA 2ZDIC 4WBNB 3K0DA 3APQA 1M56B 2M6YA 3JCUZ 1VQOV 4TWKA 1P7BA 4H13B 5KA6A 1VF7A 4FM0A 2Q7HA 4TQFA 1PNKA 3KCYA 1YVWA 2AXTZ 4Q20A 2Q73A 4H37A 1MABG 2EIJB 2UXNA 1AR1B 4JV5B 2DW4A 5BXZA 1PNMA 4PDLA 4DV6B 2KQXA 2R70A 1K73W 5C93A 5H6QA 2Q68A 3H01A 4MTGA 4BIOA 1BHAA 4LF9O 2VWKA 1S5LZ 4FLZA 1B6QA 1P84F 3OMIB 2XTAA 2QR4A 3CX5F 2P67A 1ZL8B 2VRZA 4Z1MG 4RWUA 2BE3A 1HDJA 1EN6A 4DXWA 4PELA 1SQBH 4JTDB 3GB7C 2Y4UA 3F7YC 3H9VA 4DV1O 3K03A 3G4SV 1Q3EA 1VARA 4DV5B 3K59A 4UCTA 2ZR2A 3FB7C 1K97A 4U7NA 3ZHQA 4Z1VA 1B04A 2FB5A 2CH7B 1NH2B 1H8EG 4R8CA 2CE4A 5HFLA 3TK1A 3RYCA 3OAAG 3B8MA 3BFRA 3AG1C 4X8AA 3OMNB 1XEQA 3IJ4A 1XI1A 5L3CA 2VQEO 4X65O 2JVDA 3H1LH 3P32A 3JAMN 3CCRV 2NN4A 1TAEA 1N0NA 1S5HC 2XASA 1NKDA 4X1YB 3HPLC 1U96A 4DR3O 4AQYB 4LC1A 3T4DA 4O2AA 2E74B 1TVKB 2YXLA 3ASNC 3N2GA 3W7UA 2UUAO 4QPJA 2Q0AA 5IY5B 4MVSA 2ZM6B 1RSOB 1VQMV 1VQ4V 1KKDA 2OCCB 1IXBA 1US6A 3U10A 4J42A 2RCVA 5JJJB 3BA8A 5EC1C 5LGTA 2V1DA 2WSSG 1AROP 4F6RB 4I0XA 4QNHB 4NXNO 1JA8A 1YXBA 5LGUA 1YJWV 1COWG 3K5NA 3J7AU 1IBKB 3ZEDA 3D8CA 5CBGA 2XAGA 5LP6A 1I7FA 3OEEG 4UV9A 3FYEB 1T5EA 2WWWA 1YCIA 1KC8W 3HKCA 1P49A 3SPJA 4U7OA 4GT1A 5TISZ 4H0LB 1KMIZ 3OMAB 5LP6C 1NR1A 3FAVB 4JGSA 2ZINA 2N05A 1IBLB 2H94A 3RYIA 4LF4O 2WLLB 5IJ9A 5JQGA 5B5EZ 3ABLC 5DEDA 4JI8O 5L3GA 2GBOA 3SPGA 2P6JA 1KUQA 4YHHB 2V4DA 1DLBA 3OTOB 4K0KB 4DW0A 3K5MA 1GM7A 4JI6O 1D5AA 4KHPB 1FAFA 3R65A 2WLHA 3EHBB 5CN0A 4I5SA 4E2LA 1MNGA 2RQ6A 2A9HA 3JATA 5FNVA 4DRXB 5LGNA 3ICXA 2QJ1A 4X88A 4UXNA 2WLMA 3TXQA 1QLNA 5FPOA 1HWYA 3B4SA 3HKBB 3QO8A 1OZ0A 2E76B 1Q8IA 3E22A 2E5LO 3U11A 3ZBHA 4XDJA 1G8MA 3IAYA 1NS1A 4P9OA 1W2BU 4FZ0A 2QM8A 1R1BA 2UUBO 3CC2V 2LQTA 1MSDA 1OV9A 1GH6A 1LNQA 3T2MA 5J2TA 5L3DA 4DUZO 1NH2D 2MK3A 2Y0PA 2AW9A 4TT3G 2PF4E 2EJRA 4DV7O 1Q82W 3S3XA 2DQ3A 3ZN0A 4DV2B 2IJJA 3RWRD 1NZ6A 4DR2O 2HG5C 4UVCA 3FD9A 3ZRSA 1K9MW 1V9PA 1IDSA 3JD1A 5C8YB 1S3JA 1VIBA 3M99B 3K9AA 1IBMB 1AB3A 3H1JH 1YF2A 3I5DA 5LMUO 3G67A 2JJ2G 3VOUA 1OCCB 5CB4B 2EINB 2X6CA 5H2FZ 2KG7B 4FFKA 1I0HA 1SQPH 4GCZA 3RYFA 1HNZO 1HR0O 1E79G 1XHXA 4O4IB 1M90W 3FX7A 2JGDA 3JALA 1EZJA 4I55A 3W7WA 4XDKA 2EBOA 4CBCA 4B3MO 2GV9A 3CWBH 5CBHA 3ASOB 4YJ2A 4DUYO 3JASB 5FL7G 2Y4TA 1JJ2U 5EZYA 1ZTEA 2GSMB 3WB1A 1FXKB 4JI1B 3TGUH 1WB8A 1GKFA 4LH6A 4FVMA 2F66C 4LF9B 3CRQA 5BMVB 4BIZA 3LDDA 2IJIA 3MAQA 1PPJH 1S77D 2QM7A 2P4VA 1K7DA 3W7TA 3CCMV 1W0KG 1FFXB 4DV1B 3SR2C 4GX0A 1GO3F 1V55B 4RUFA 5E1AC 3CXHF 5JVDB 3RFRA 1DK1A 3TJTA 2XAHA 1OCRC 5KUMA 3SJQC 2N74A 4B3SO 4X1KA 3OUFA 1RPRA 3WB2A 3MHSC 1BQ0A 1OCZB 3NXSA 1N8RW 3E2EA 1CXZB 3IGAC 3P3NA 1DGSA 4EKWA 3ZHSA 2WLIA 3QO7A 2QKSA 1H2LA 1GN6A 1TUBB 4CS3A 5HFMA 2VQEB 1HNXO 1K3EA 1KB9F 4X65B 4O4JB 3FB8C 5EIBC 1WA8A 3VQYA 3CCEV 4DR3B 5EBLC 3QNEA 2YICA 3AG2C 1H2MA 1KQSU 4TV9B 2W6JG 4ASUG 4IL6Z 2UUAB 2OTLV 1FPOA 1XBLA 5KMGB 3K5LA 3WU2Z 3K0GA 1R6TA 2H8PC 4MSWC 1UJWB 3N27A 4UB8Z 3STZC 4UCRA 1XL4A 4NXNB 4I50B 3PN1A 1SA0A 1NJIW 3APOA 3ZMUA 4RUEA 3DXRA 4D7SA 1BZKA 3K04A 4NVPA 1QQCA 3AG3C 1WNSA 4HZ3A 1JVMA 1YITV 2ZXWB 3N2KA 4HNAB 1Y66A 2GUZA 3C3TA 3SPCA 4YJ3A 4J9YB 1PV0A 4TUYB 3VQXA 1R3JC 4RQFA 3ZMTA 3ZRWA 2KSDA 2BOCC 1WP8A 4LF4B 1XNRO 5DN6G 1XHZA 1FYJA 3CP1A 2A06H 3O9OA 2CTWA 5D5PA 3M8AA 3U0ZA 3CB2A 3LNMB 4IIJB 3CYOA 3QO5A 1Q43A 2GHYA 2X6AA 3O65A 1JR9A 4JI6B 2YSUB 2PI4A 2Q9LA 3CJHB 4O2BB 2QTSA 3PJSK 1MZEA 1TA8A 3FKSG 3Q4HB 5IYBO 4IYIA 5B1AB 1IVSA 1LUVA 3W7XA 3JD0A 2A79B 5L3EA 4UVAA 2E5LB 2IH3C 2EILB 4J7KA 1KBHA 2LW1A 4YXWG 3G80A 1F4MA 2UUBB 4PV1B 1SRYA 2BTOA 1NU1H 2Q69A 3C90A 2AHYA 4LWSA 5JH7A 1Q81W 1QR8A 1BMFG 2YI9A 2C2AA 4DUZB 1Y74A 1N34O 2ODMA 3ML0A 4UV8A 3SYQA 4DV7B 3KCXA 3FYIB 4J80A 2OYQA 4TV8A 5EBWC 1FD9A 1NTKH 3B2EE 4DR2B 4K8XA 1EZVH 1XUQA 1K34A 1VP7A 4NKGB 5KAIZ 1VF6A 1AR5A 2OIEA 2BOBC 3OR7C 3GWKC 2GTSA 1S72V 5LMUB 1W59A 2F95B 1MZFA 3GVMA 4LF8O 1VF6C 4LCUC 4D7TA 4MVRA 2HLDG 1FKAO 1HNZB 1HR0B 3UQ8A 3LDEA 1JPXA 2GTAA 4JASA 4CH4A 1RP3B 3L74H 4B3MB 1HNWO 2YI8A 5A2QN 4KFMA 4DUYB 3T1YO 3ETGA 2YXHA 5B1NA 5GTHZ 3WG7C 2Z5UA 3AG1B 2DJVA 1PNLA 3ABMC 1L8DA 4PDMA 3CMEV 1AJPA 5GW7A 3RYCB 3EFFK 4DR6O 4CH3A 1GTOA 4J7ZA 1XL6A 4KP4A 2HJFC 4DYLA 3KZIZ 4X1IB 5JJNB 3LNNA 2X0LA 4IT5A 1R6KA 5E79Z 3RYHA 4LFBO 5LHHA 2JRIA 3ASNB 3KG2A 4CZZA 4PA6A 1N32O 2LO1A 3UM7A 4KL1A 1I94O 4O2AB 4J9ZB 5CA1A 3SGIA 1QR9A 5LHIA 4B3SB 5ITZB 3A0BZ 3N2GB 1Z5WA 1GN2A 3ZRVA 1BE3H 2UU9O 4J7JA 5LXTA 3T1CA 4NXMO 4MVZA 3E89A 4FIPC 1HNXB 5B3SC 4PJ0Z 4ZKIA 1OCOB 1TGOA 1KECA 5LP6B 1Z2GA 5J9PC 2PYLA 3R66A 3UKMA 3HKCB 4KUMA 3STLC 5H9CA 2XHBA 4J10A 5KA5A 1SC5B 2FL4A 4PA7A 1V54C 2F43G 3ABLB 4WBNA 3J81N 4JYYA 2Z0AA 3RYIB 5JCOA 2BTQB 1X4TA 2P06A 3A0HZ 1Q86W 2X7RB 4UCSA 2RDCA 3L72H 5JQGB 4FK5C 5CA0A 5KHHA 4X64O 3L71H 5JCOC 3MHHC 1XDCA 1UFIA 3RVYA 3J80N 5D5QA 4H33A 4P2ZA 4UCVA 5KHJA 4X66O 1SZXA 3JATB 5KX5B 2FMLA 1XNQO 2JDIG 2QWNB 4G27B 4I4TB 2F4VO 4QGPA 1XNRB 3JSLA 3SYOA 4E4EA 4O4HB 1ZL8A 4Q6GA 3E8HA 3TXSA 1YI2V 1VQ5V 2DWEC 5FPRA 4JI5O 2YC0A 4JZGA 1BL8A 4FLTA 3OT7A 4B3TO 5J2TB 4LF6O 1QLEC 2UXBB 3T1HO 4JYBA 1J95A 2LP7A 2ZIOA 3UO3A 5JWPA 5L3FA 1BHBA 4XDLA 4JI3O 4EB6A 4IHJB 2DE0X 3M7MX 3TCUA 1H38A 1CEZA 4FLWA 2EULA 4X89A 1GRJA 5B1OA 4B08A 4X1YA 3CXCU 1H2NA 3HKEB 4DR1O 4O4LA 2EIMC 1TVKA 4HYOA 4ZOLA 1AILA 5LOVB 1N34B 3ETQA 5H5NA 1HP8A 2HEPA 4I9WA 1RSOA 1UPGA 4R7CA 5LMNO 3CRRA 3BEHA 5BR8O 2DYSC 4LF5O 1G4YB 1H2KA 4ZI7A 1K92A 4F6RA 4NYKA 4DV0O 2IJKA 3OGCC 4BR6A 1W0JG 5IY5C 4YJ2B 2ZR3A 4I7ZB 2WA4A 5EZYB 5IWAO 1WPXA 4B3RO 1M9NA 2ITCC 3CMAV 1K5QA 4JYAO 5KAFZ 3BVOA 2B1IA 5IJ0A 4LF8B 4GYCB 2AZ0A 3CCSV 4PI2A 5A9GA 1KYOF 3C3SA 1U97A 4DV3O 3DGEA 2PYJA 2X6BA 3K06A 3K58A 2XOKG 3FAVA 3K79A 3G6EV 2B1GA 1VQ9V 2HHHO 2MW2B 1O9HA 4UUJC 2WLLA 1OCRB 3B09A 1ZLZA 2DN9A 2OCHA 2ZE5A 3L75H 1HNWB 3WFVA 2W0FC 3T1YB 2F1MA 1YSCA 4MT8A 4P9PA 1GK9A 2ATKC 2DWDC 1NTMH 1WN7A 4X1KB 3F5TA 3JAKA 3E35A 4DR6B 1KP2A 1WLEA 4OPAA 2Q7EA 4DRXA 2AZ2A 3UT5B 4QE7A 2UXDO 2RJZA 3HKDB 3JARB 3AG2B 4FLVA 1JOYA 2D3OW 4GZRB 3AG4C 4LFBB 4GLXA 1OHHG 1WA8B 3BCCH 1N32B 4R50A 4B7KA 2PZSA 1BT8A 1MOFA 3THOA 1I94B 1M1KW 1SERA 3UCSC 2YDEA 5JJEB 4GX1A 5LHGA 2UU9B 2VS0A 3AG3B 3CRAA 4NXMB 3OW2U 2EJ7A 1QU7A 3FFQA 4CC6A 4OX9O 1DF4A 1DTOA 4YIOA 2R72A 1XREA 2V7QG 1N33O 5J2UA 1JX9A 2EIKC 5C8YA 2IU0A 3ZS8C 1ZUQA 3K5OA 4W4LA 4PDRA 5K1XA 2ZD9A 3QF7A 1L0LH 4JI7O 2GUZB 3IC7A 2XAFA 1KKCA 5KUKA 1PP9H 4C7UA 2KG7A 3A0RA 3OR6C 1F23A 2CTPA 3ETDA 4K35A 4O4IA 4PA4A 3K9SA 1M5IA 2ZE7A 1Q90D 4F6EA 1QNMA 2XAQA 5EYPB 2YIBD 1R3IC 3JASA 4X64B 1VQLV 5LA6A 1FXKA 3G71V 4ZHQB 1GM8A 3B8NA 3HR0A 3CCJV 3CE2A 2IW5A 3SJBC 1MG1A 4X66B 3ABKC 4IYHA 4H44B 1XNQB 2WLJA 4FM1A 1YHQV 2F4VB 1SF9A 4YIPA 4AILC 3IC9A 3SDLA 3CHXA 2DYRC 4MTOA 4PA3A 4KXRA 4BW9A 1XMOO 4JAVA 4MTFA 1FFXA 4FMTA 2EX3A 3G6BA 4LFAO 4TOIA 4JI5B 3ETEA 3NR7A 1Q6HA 3ZHRA 1Q6UA 2M7WA 4B3TB 4FZ1A 1WPBA 1FJGO 4LWSB 4LF6B 3B77A 1N0JA 4GKJO 3JD2A 1CPYA 3T1HB 4RAIA 3I56V 4UB6Z 1AI7A 2XAJA 5LL6Y 1M57C 4MS2A 2AHZA 4TV8B 1P7GA 2ZCEA 4WFAV 1VQPV 4JI8B 2UXCO 2DOSA 1TUBA 4PD4F 4JI3B 4U3JA 2Y69B 4N23A 4TQDA 3ABTA 3JAWB 1Y6XA 2FKXA 1DF5A 1E1RG 3OE7G 2HR3A 3CS5A 4YY3O 1FS0G 1WJZA 1FXHA 4DR1B 3E8FA 3MDSA 1SQGA 1BCCH 4JI2O 2PUSA 1N36O 1Y4MA 1EN5A 5GONB 2N04A 4CS4A 4X20B 2RNBA 5LMNB 3UO2A 1MA1A 1PKXA 3SJAC 1AJNA 3X2QC 5BR8B 4K8ZA 4LF5B 3WG7B 3H1IH 3ABUA 1XMQO 4DV0B 3ABMB 1XILA 4LH7A 2QGNA 1JFFA 3BY6A 4LNUB 2RN9A 5B1BC 1YZBA 2R9IA 1BGYH 2Q6AA 2FTKA 1ZAUA 2P5OA 4HNAA 5IWAB 2ZT9B 1THZA 4JYAB 1A32A 1SQXH 4PA9A 2WA3A 4DO2A 4TUYA 4HBNA 2YIDA 2NR5A 2QM4A 4WF9V 1G1XB 4DV3B 3QVNA 2CDYA 3RT3C 5BY1A 2DQ0A 3RBZA 2JIZG 1RM1C 2HVJC 4JAAA 2HHHB 2EZOA 4NTWA 3JCZA 1VQKV 3K57A 1EM1A 3RYHB 2F93B 4MVQA 4IIJA 3QTCA 5IYCO 3K3WA 3OUSA 4XBFA 5CA1B 1GMGA 4LR3A 1Q6IA 1Y76A 4Z2WA 5B3SB 3LSSA 3CJHA 1FXVA 4O2BA 5LXTB 2UXDB 4PI0A 5LYJA 1BQZA 2VWJA 2PGGA 4HAMA 2Q4PA 5H6RA 1NVPB 1NQTA 1URFA 2CTRA 1AR4A 1V54B 1VQNV 2ZDIA 3CCQV 1IX9A 4MVOA 1B06A 3CCVV 4NTXA 1VMGA 4JYCA 4UVBA 2BCCH 5IYDO 1D2DA 4QPKA 4FM2A 1P4RA 3LSQA 4G2KA 2P7TC 4OX9B 3TETA 4JI0O 2JS5A 4K3AA 1IURA 4RQEA 2P90A 1N33B 1FFTB 2Y48A 1MSWD 2YEVA 5CA0B 2LFSA 4OGQB 1XQ8A 4JI7B 3E83A 4JI1O 5CBFA 2JS3A 4LFCO 4MW3A 1SQQH 2QA4V 2B9ZA 3L9DA 1R3LC 4I0XB 1L0NH 1AP5A 3A2FA 4UCUA 2YS8A 4EFEA 5IYZA 3JD4A 5EBMC 2QE7G 4DR4O 4FFBA 2PTMA 1JCHA 1E1QG 1SETA 4DK1A 4X62O 1PM9A 1ROPA 2BSKA 4MVUA 1QLEB 2XNDG 4P30A 4DR7O 2YIAA 2NLJC 2JK5C 4GKKO 1RPOA 5L3BA 4TSFG 2WLKA 2LGQA 3OTFA 1PL4A 2HKOA 3FB6C 3SPHA 4NR1A 2ZNIA 2JEXA 3JYCA 5IJ9B 4WFFA 3ZMZA 3OM3B 2Z3YA 3EVKA 4PDVA 2IJHA 4DR5O 4ZBMA 1SS3A 1WP7A 3K08A 2L35A 1M56C 2EIMB 4EB6B 1QCEA 4X1IA 1K5SA 1XMOB 1YTFB 1ZSPA 3CCUV 4BW5A 2ZQMA 4LFAB 2A7WA 1JJOA 3CCLV 3T4ZA 2OT5A 1IZ3A 1VQ6V 2EIJC 2DYSB 4O4LB 4B7EA 5FNVB 1FJGB 1ZWIC 4ZOLB 1KD1W 5CMUA 5ITZA 4QJFB 4GKJB 4LF7O 4CS2A 1ENVA 2QDOA 4UCOA 2CK3G 4RO2A 1KU9A 3E22B 2E75B 1NI8A 2UUCO 2UXCB 2IM9A 1EN4A 1LUWA 2O57A 4ZI7B 1NBMG 3CRMA 5KLVH 4NB5A 2HVKC 2GDSA 1J5EO 1NVPD 1QVGU 3ZCCA 2CH7A 4YY3B 1YIJV 3HB3B 3VQWA 4JI2B 1N36B 3OD4A 5IJ0B 1Y67A 2P4KA 1SKVA 1OCOC 4UFZA 3CEIA 4IGGA 3W7SA 1AI5A 1GN3A 1H2SB 2CGNA 3BRCA 4ICGA 1XMQB 4I9QA 2LW7A 2BTQA 1R3KC 1F4NA 3MD0A 3LUTB 3SYPA 1ZX3A 2Q8VA 1WAZA 3GWOA 1F7YA 2P22C 4QE9A 3L70H 2Q67A 2ADQB 4JI4O 2KB1A 1YJNV 3D36A 3RYFB 3RGBA 3P3PA 2JGDB 3JALB 2WLNA 1RFYA 3AG4B 4DV4O 1G6UA 3JAKB 4I55B 5KX5A 4A5UB 2RMKB 1S5JA 4I4TA 4EFBA 1B3QA 2XUMA 3ZHUA 1AI6A 4GX2A 4O4HA 2OCCC 3D36C 2ETNA 1EFRG 2UXXA 4JAUA 2VQFO 1NTZH 4MVMA 2CAZC 3DC6A 2Y0IA 3CSXA 2JJ1G 3LDCA 3E86A 2PY5A 4W4KA 1VQ7V 2CGOA 4WFBV 4R6ZA 2XT9A 1S76D 4AHCA 3SJCC 1YEWA 2EIKB 2A0LA 1R6NA 3F7VC 5KHIA 3OGIB 1X59A 1AJQA 4BIUA 4IHJA 5LBQA 1M4UA 3RW0A 2DMXA 1YTFD 5J2UB 4EEQA 3H1KH 1PL0A 3E8GA 4WFHA 1S0VA 2D2CB 3HKEA 1KP3A 4OPHA 3S3WA 2WLIB 5LOVA 2QWPB 3HKBA 3IFXA 2W0XA 4BAYA 1XOUA 2AGAA 4AI8A 2ITDC 3ZX6A 4JI0B 1D5NA 2LGWA 2LFRA 3FB5C 4FLYA 3ZMVA 1SQFA 4X9QA 2YIBA 3AK3A 1YJ9V 2NNUA 3ABKB 4OXSA 4GUNA 2Q5ZA 2B5UA 5LA6B 1K8AW 4FLUA 1QHTA 1BSMA 2DYRB 3P30A 5BZBA 4LFCB 3ZHVA 4JPRA 2ARHA 1SA0B 1VQ8V 1K33A 2G38A 2A3QA
chains in the Genus database with same CATH topology
2AXTZ 4UB8Z 5GTIZ 5TISZ 3A0BZ 5KAFZ 3A0HZ 3KZIZ 5GTHZ 5H2FZ 5E79Z 3JCUZ 4IL6Z 4UB6Z 5KAIZ 5B5EZ 3WU2Z 1S5LZ 5B66Z 4PJ0Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT Z;  4UB8 Z;  5GTI Z;  5TIS Z;  3A0B Z;  5KAF Z;  3A0H Z;  3KZI Z;  5GTH Z;  5H2F Z;  5E79 Z;  3JCU Z;  4IL6 Z;  4UB6 Z;  5KAI Z;  5B5E Z;  3WU2 Z;  1S5L Z;  5B66 Z;  4PJ0 Z; 
#chains in the Genus database with same CATH topology
 1M93 A;  4FPP A;  5GTI Z;  4JF3 A;  3DXR B;  3SYA A;  1VEW A;  2HFE C;  4J41 A;  4DR4 B;  4PHZ A;  4CC5 A;  2QSA A;  3EXA A;  1AI4 A;  3N2K B;  1F51 A;  4X62 B;  1OJH A;  4CH6 A;  4JV5 O;  1R73 A;  1WB7 A;  2K9P A;  4MW8 A;  4DV6 O;  4DR7 B;  1CP9 A;  1Z5V A;  1ORQ C;  4YJ3 B;  2QKC A;  5FLX N;  5CB4 A;  3VQV A;  1M57 B;  2FYU H;  4GKK B;  3AK2 A;  2IU3 A;  2ZE6 A;  4F4L A;  1GN4 A;  3ZRW B;  1Q7Y W;  3D3I A;  2QWO B;  4DK0 A;  2WPD G;  2ZNJ A;  3ZHT A;  5DM6 V;  2PI5 A;  2QTO A;  1YDX A;  1OCC C;  2EIN C;  2JEU A;  3UT5 A;  4DR5 B;  2IBZ H;  3CC7 V;  2HJD A;  4J11 A;  1K4D C;  1AVM A;  3HKD A;  3JAR A;  4GX5 A;  5CA3 A;  3ZRX A;  4DV5 O;  4U3J B;  5KHG A;  3E8B A;  1Q5O A;  1AP6 A;  1MMM A;  2CUG A;  4U3F H;  1EBO A;  2ZKO A;  3CC4 V;  3ASO C;  2HP8 A;  5BMV A;  3X2Q B;  2E3C A;  5F2V O;  2Q0O C;  5EK0 A;  3AG7 A;  1FXK C;  4LF7 B;  3BAB A;  4QIW F;  4L87 A;  2WAM A;  2ILM A;  5B1B B;  1N4C A;  3B40 A;  3CD6 V;  3BAA A;  2UUC B;  2JGU A;  1NR7 A;  1SZT A;  4JTC B;  1VF5 B;  4LP8 A;  1I5Y A;  4WFG A;  5JVD A;  3CPW U;  2W6I G;  4AQY O;  1JFF B;  3QG5 A;  4JTA B;  1J5E B;  5JH7 B;  1GM9 A;  3BPZ A;  2Q7G A;  1JMK C;  1Y74 B;  1H2G A;  3DC5 A;  2OTJ V;  2ZM6 O;  1K4C C;  2CTQ A;  5EIB D;  3VBB A;  1V55 C;  1RM1 B;  5B66 Z;  2QKA A;  1SES A;  2ZIM A;  2ZE8 A;  1L1F A;  1OCZ C;  4O4J A;  1IBK O;  3WB0 A;  1QVF U;  1JQ0 A;  3BHP A;  3L73 H;  5KHK A;  5EYP A;  2YUA A;  2R9A A;  3BA9 A;  2LJ2 A;  4FJC C;  2QWQ B;  4TV9 A;  4JI4 B;  4DW1 A;  5KMG A;  3CRC A;  4ZHQ A;  1IXM A;  2ADP A;  4FLX A;  3JSN A;  1Y76 B;  1IBL O;  1O9G A;  1HW7 A;  2UXB O;  4DV4 B;  3D3Q A;  5K1P A;  1LR1 A;  4I50 A;  5AG2 A;  1I5X A;  4N21 A;  5LYJ B;  2IH1 C;  4YHH O;  2VQF B;  5IE9 A;  4B3R B;  5IT9 N;  3OTO O;  4K0K O;  1H8H G;  3RN4 A;  4KHP O;  2KKW A;  3KKY A;  2YXY A;  5IDJ A;  1I08 A;  1SQV H;  2ZXW C;  3SYC A;  4JZ2 A;  1BS3 A;  3ZIA G;  3AEI A;  2QWR B;  2F23 A;  1PD3 A;  3OEH G;  2OWO A;  4MTX A;  2K1E A;  3RVZ A;  3ZMS A;  2YEV B;  3JAW A;  5DEC A;  1TUE B;  2QEX V;  4WCE V;  3LSU A;  1QBZ A;  4DV2 O;  4CH5 A;  3OFN G;  2Y69 C;  3Q4H A;  5GON A;  4NTY A;  3DTU B;  4BWA A;  1NT2 B;  3H1H H;  4X20 A;  3F5W C;  3I55 V;  4LBE C;  3SPI A;  5EC2 C;  2EZP A;  3AK1 A;  5IYZ B;  4ABM A;  3A8T A;  3JD3 A;  3ZJZ A;  4FFB B;  3ZN1 A;  1IBM O;  3DSQ A;  4L8J A;  5B1A C;  4G28 B;  2OIG A;  2BSK B;  4LNU A;  1GAX A;  2L6L A;  2R9R B;  2EIL C;  4D6T H;  4WFE A;  2H3O A;  4ZIB A;  2ZDI C;  4WBN B;  3K0D A;  3APQ A;  1M56 B;  2M6Y A;  3JCU Z;  1VQO V;  4TWK A;  1P7B A;  4H13 B;  5KA6 A;  1VF7 A;  4FM0 A;  2Q7H A;  4TQF A;  1PNK A;  3KCY A;  1YVW A;  2AXT Z;  4Q20 A;  2Q73 A;  4H37 A;  1MAB G;  2EIJ B;  2UXN A;  1AR1 B;  4JV5 B;  2DW4 A;  5BXZ A;  1PNM A;  4PDL A;  4DV6 B;  2KQX A;  2R70 A;  1K73 W;  5C93 A;  5H6Q A;  2Q68 A;  3H01 A;  4MTG A;  4BIO A;  1BHA A;  4LF9 O;  2VWK A;  1S5L Z;  4FLZ A;  1B6Q A;  1P84 F;  3OMI B;  2XTA A;  2QR4 A;  3CX5 F;  2P67 A;  1ZL8 B;  2VRZ A;  4Z1M G;  4RWU A;  2BE3 A;  1HDJ A;  1EN6 A;  4DXW A;  4PEL A;  1SQB H;  4JTD B;  3GB7 C;  2Y4U A;  3F7Y C;  3H9V A;  4DV1 O;  3K03 A;  3G4S V;  1Q3E A;  1VAR A;  4DV5 B;  3K59 A;  4UCT A;  2ZR2 A;  3FB7 C;  1K97 A;  4U7N A;  3ZHQ A;  4Z1V A;  1B04 A;  2FB5 A;  2CH7 B;  1NH2 B;  1H8E G;  4R8C A;  2CE4 A;  5HFL A;  3TK1 A;  3RYC A;  3OAA G;  3B8M A;  3BFR A;  3AG1 C;  4X8A A;  3OMN B;  1XEQ A;  3IJ4 A;  1XI1 A;  5L3C A;  2VQE O;  4X65 O;  2JVD A;  3H1L H;  3P32 A;  3JAM N;  3CCR V;  2NN4 A;  1TAE A;  1N0N A;  1S5H C;  2XAS A;  1NKD A;  4X1Y B;  3HPL C;  1U96 A;  4DR3 O;  4AQY B;  4LC1 A;  3T4D A;  4O2A A;  2E74 B;  1TVK B;  2YXL A;  3ASN C;  3N2G A;  3W7U A;  2UUA O;  4QPJ A;  2Q0A A;  5IY5 B;  4MVS A;  2ZM6 B;  1RSO B;  1VQM V;  1VQ4 V;  1KKD A;  2OCC B;  1IXB A;  1US6 A;  3U10 A;  4J42 A;  2RCV A;  5JJJ B;  3BA8 A;  5EC1 C;  5LGT A;  2V1D A;  2WSS G;  1ARO P;  4F6R B;  4I0X A;  4QNH B;  4NXN O;  1JA8 A;  1YXB A;  5LGU A;  1YJW V;  1COW G;  3K5N A;  3J7A U;  1IBK B;  3ZED A;  3D8C A;  5CBG A;  2XAG A;  5LP6 A;  1I7F A;  3OEE G;  4UV9 A;  3FYE B;  1T5E A;  2WWW A;  1YCI A;  1KC8 W;  3HKC A;  1P49 A;  3SPJ A;  4U7O A;  4GT1 A;  5TIS Z;  4H0L B;  1KMI Z;  3OMA B;  5LP6 C;  1NR1 A;  3FAV B;  4JGS A;  2ZIN A;  2N05 A;  1IBL B;  2H94 A;  3RYI A;  4LF4 O;  2WLL B;  5IJ9 A;  5JQG A;  5B5E Z;  3ABL C;  5DED A;  4JI8 O;  5L3G A;  2GBO A;  3SPG A;  2P6J A;  1KUQ A;  4YHH B;  2V4D A;  1DLB A;  3OTO B;  4K0K B;  4DW0 A;  3K5M A;  1GM7 A;  4JI6 O;  1D5A A;  4KHP B;  1FAF A;  3R65 A;  2WLH A;  3EHB B;  5CN0 A;  4I5S A;  4E2L A;  1MNG A;  2RQ6 A;  2A9H A;  3JAT A;  5FNV A;  4DRX B;  5LGN A;  3ICX A;  2QJ1 A;  4X88 A;  4UXN A;  2WLM A;  3TXQ A;  1QLN A;  5FPO A;  1HWY A;  3B4S A;  3HKB B;  3QO8 A;  1OZ0 A;  2E76 B;  1Q8I A;  3E22 A;  2E5L O;  3U11 A;  3ZBH A;  4XDJ A;  1G8M A;  3IAY A;  1NS1 A;  4P9O A;  1W2B U;  4FZ0 A;  2QM8 A;  1R1B A;  2UUB O;  3CC2 V;  2LQT A;  1MSD A;  1OV9 A;  1GH6 A;  1LNQ A;  3T2M A;  5J2T A;  5L3D A;  4DUZ O;  1NH2 D;  2MK3 A;  2Y0P A;  2AW9 A;  4TT3 G;  2PF4 E;  2EJR A;  4DV7 O;  1Q82 W;  3S3X A;  2DQ3 A;  3ZN0 A;  4DV2 B;  2IJJ A;  3RWR D;  1NZ6 A;  4DR2 O;  2HG5 C;  4UVC A;  3FD9 A;  3ZRS A;  1K9M W;  1V9P A;  1IDS A;  3JD1 A;  5C8Y B;  1S3J A;  1VIB A;  3M99 B;  3K9A A;  1IBM B;  1AB3 A;  3H1J H;  1YF2 A;  3I5D A;  5LMU O;  3G67 A;  2JJ2 G;  3VOU A;  1OCC B;  5CB4 B;  2EIN B;  2X6C A;  5H2F Z;  2KG7 B;  4FFK A;  1I0H A;  1SQP H;  4GCZ A;  3RYF A;  1HNZ O;  1HR0 O;  1E79 G;  1XHX A;  4O4I B;  1M90 W;  3FX7 A;  2JGD A;  3JAL A;  1EZJ A;  4I55 A;  3W7W A;  4XDK A;  2EBO A;  4CBC A;  4B3M O;  2GV9 A;  3CWB H;  5CBH A;  3ASO B;  4YJ2 A;  4DUY O;  3JAS B;  5FL7 G;  2Y4T A;  1JJ2 U;  5EZY A;  1ZTE A;  2GSM B;  3WB1 A;  1FXK B;  4JI1 B;  3TGU H;  1WB8 A;  1GKF A;  4LH6 A;  4FVM A;  2F66 C;  4LF9 B;  3CRQ A;  5BMV B;  4BIZ A;  3LDD A;  2IJI A;  3MAQ A;  1PPJ H;  1S77 D;  2QM7 A;  2P4V A;  1K7D A;  3W7T A;  3CCM V;  1W0K G;  1FFX B;  4DV1 B;  3SR2 C;  4GX0 A;  1GO3 F;  1V55 B;  4RUF A;  5E1A C;  3CXH F;  5JVD B;  3RFR A;  1DK1 A;  3TJT A;  2XAH A;  1OCR C;  5KUM A;  3SJQ C;  2N74 A;  4B3S O;  4X1K A;  3OUF A;  1RPR A;  3WB2 A;  3MHS C;  1BQ0 A;  1OCZ B;  3NXS A;  1N8R W;  3E2E A;  1CXZ B;  3IGA C;  3P3N A;  1DGS A;  4EKW A;  3ZHS A;  2WLI A;  3QO7 A;  2QKS A;  1H2L A;  1GN6 A;  1TUB B;  4CS3 A;  5HFM A;  2VQE B;  1HNX O;  1K3E A;  1KB9 F;  4X65 B;  4O4J B;  3FB8 C;  5EIB C;  1WA8 A;  3VQY A;  3CCE V;  4DR3 B;  5EBL C;  3QNE A;  2YIC A;  3AG2 C;  1H2M A;  1KQS U;  4TV9 B;  2W6J G;  4ASU G;  4IL6 Z;  2UUA B;  2OTL V;  1FPO A;  1XBL A;  5KMG B;  3K5L A;  3WU2 Z;  3K0G A;  1R6T A;  2H8P C;  4MSW C;  1UJW B;  3N27 A;  4UB8 Z;  3STZ C;  4UCR A;  1XL4 A;  4NXN B;  4I50 B;  3PN1 A;  1SA0 A;  1NJI W;  3APO A;  3ZMU A;  4RUE A;  3DXR A;  4D7S A;  1BZK A;  3K04 A;  4NVP A;  1QQC A;  3AG3 C;  1WNS A;  4HZ3 A;  1JVM A;  1YIT V;  2ZXW B;  3N2K A;  4HNA B;  1Y66 A;  2GUZ A;  3C3T A;  3SPC A;  4YJ3 A;  4J9Y B;  1PV0 A;  4TUY B;  3VQX A;  1R3J C;  4RQF A;  3ZMT A;  3ZRW A;  2KSD A;  2BOC C;  1WP8 A;  4LF4 B;  1XNR O;  5DN6 G;  1XHZ A;  1FYJ A;  3CP1 A;  2A06 H;  3O9O A;  2CTW A;  5D5P A;  3M8A A;  3U0Z A;  3CB2 A;  3LNM B;  4IIJ B;  3CYO A;  3QO5 A;  1Q43 A;  2GHY A;  2X6A A;  3O65 A;  1JR9 A;  4JI6 B;  2YSU B;  2PI4 A;  2Q9L A;  3CJH B;  4O2B B;  2QTS A;  3PJS K;  1MZE A;  1TA8 A;  3FKS G;  3Q4H B;  5IYB O;  4IYI A;  5B1A B;  1IVS A;  1LUV A;  3W7X A;  3JD0 A;  2A79 B;  5L3E A;  4UVA A;  2E5L B;  2IH3 C;  2EIL B;  4J7K A;  1KBH A;  2LW1 A;  4YXW G;  3G80 A;  1F4M A;  2UUB B;  4PV1 B;  1SRY A;  2BTO A;  1NU1 H;  2Q69 A;  3C90 A;  2AHY A;  4LWS A;  5JH7 A;  1Q81 W;  1QR8 A;  1BMF G;  2YI9 A;  2C2A A;  4DUZ B;  1Y74 A;  1N34 O;  2ODM A;  3ML0 A;  4UV8 A;  3SYQ A;  4DV7 B;  3KCX A;  3FYI B;  4J80 A;  2OYQ A;  4TV8 A;  5EBW C;  1FD9 A;  1NTK H;  3B2E E;  4DR2 B;  4K8X A;  1EZV H;  1XUQ A;  1K34 A;  1VP7 A;  4NKG B;  5KAI Z;  1VF6 A;  1AR5 A;  2OIE A;  2BOB C;  3OR7 C;  3GWK C;  2GTS A;  1S72 V;  5LMU B;  1W59 A;  2F95 B;  1MZF A;  3GVM A;  4LF8 O;  1VF6 C;  4LCU C;  4D7T A;  4MVR A;  2HLD G;  1FKA O;  1HNZ B;  1HR0 B;  3UQ8 A;  3LDE A;  1JPX A;  2GTA A;  4JAS A;  4CH4 A;  1RP3 B;  3L74 H;  4B3M B;  1HNW O;  2YI8 A;  5A2Q N;  4KFM A;  4DUY B;  3T1Y O;  3ETG A;  2YXH A;  5B1N A;  5GTH Z;  3WG7 C;  2Z5U A;  3AG1 B;  2DJV A;  1PNL A;  3ABM C;  1L8D A;  4PDM A;  3CME V;  1AJP A;  5GW7 A;  3RYC B;  3EFF K;  4DR6 O;  4CH3 A;  1GTO A;  4J7Z A;  1XL6 A;  4KP4 A;  2HJF C;  4DYL A;  3KZI Z;  4X1I B;  5JJN B;  3LNN A;  2X0L A;  4IT5 A;  1R6K A;  5E79 Z;  3RYH A;  4LFB O;  5LHH A;  2JRI A;  3ASN B;  3KG2 A;  4CZZ A;  4PA6 A;  1N32 O;  2LO1 A;  3UM7 A;  4KL1 A;  1I94 O;  4O2A B;  4J9Z B;  5CA1 A;  3SGI A;  1QR9 A;  5LHI A;  4B3S B;  5ITZ B;  3A0B Z;  3N2G B;  1Z5W A;  1GN2 A;  3ZRV A;  1BE3 H;  2UU9 O;  4J7J A;  5LXT A;  3T1C A;  4NXM O;  4MVZ A;  3E89 A;  4FIP C;  1HNX B;  5B3S C;  4PJ0 Z;  4ZKI A;  1OCO B;  1TGO A;  1KEC A;  5LP6 B;  1Z2G A;  5J9P C;  2PYL A;  3R66 A;  3UKM A;  3HKC B;  4KUM A;  3STL C;  5H9C A;  2XHB A;  4J10 A;  5KA5 A;  1SC5 B;  2FL4 A;  4PA7 A;  1V54 C;  2F43 G;  3ABL B;  4WBN A;  3J81 N;  4JYY A;  2Z0A A;  3RYI B;  5JCO A;  2BTQ B;  1X4T A;  2P06 A;  3A0H Z;  1Q86 W;  2X7R B;  4UCS A;  2RDC A;  3L72 H;  5JQG B;  4FK5 C;  5CA0 A;  5KHH A;  4X64 O;  3L71 H;  5JCO C;  3MHH C;  1XDC A;  1UFI A;  3RVY A;  3J80 N;  5D5Q A;  4H33 A;  4P2Z A;  4UCV A;  5KHJ A;  4X66 O;  1SZX A;  3JAT B;  5KX5 B;  2FML A;  1XNQ O;  2JDI G;  2QWN B;  4G27 B;  4I4T B;  2F4V O;  4QGP A;  1XNR B;  3JSL A;  3SYO A;  4E4E A;  4O4H B;  1ZL8 A;  4Q6G A;  3E8H A;  3TXS A;  1YI2 V;  1VQ5 V;  2DWE C;  5FPR A;  4JI5 O;  2YC0 A;  4JZG A;  1BL8 A;  4FLT A;  3OT7 A;  4B3T O;  5J2T B;  4LF6 O;  1QLE C;  2UXB B;  3T1H O;  4JYB A;  1J95 A;  2LP7 A;  2ZIO A;  3UO3 A;  5JWP A;  5L3F A;  1BHB A;  4XDL A;  4JI3 O;  4EB6 A;  4IHJ B;  2DE0 X;  3M7M X;  3TCU A;  1H38 A;  1CEZ A;  4FLW A;  2EUL A;  4X89 A;  1GRJ A;  5B1O A;  4B08 A;  4X1Y A;  3CXC U;  1H2N A;  3HKE B;  4DR1 O;  4O4L A;  2EIM C;  1TVK A;  4HYO A;  4ZOL A;  1AIL A;  5LOV B;  1N34 B;  3ETQ A;  5H5N A;  1HP8 A;  2HEP A;  4I9W A;  1RSO A;  1UPG A;  4R7C A;  5LMN O;  3CRR A;  3BEH A;  5BR8 O;  2DYS C;  4LF5 O;  1G4Y B;  1H2K A;  4ZI7 A;  1K92 A;  4F6R A;  4NYK A;  4DV0 O;  2IJK A;  3OGC C;  4BR6 A;  1W0J G;  5IY5 C;  4YJ2 B;  2ZR3 A;  4I7Z B;  2WA4 A;  5EZY B;  5IWA O;  1WPX A;  4B3R O;  1M9N A;  2ITC C;  3CMA V;  1K5Q A;  4JYA O;  5KAF Z;  3BVO A;  2B1I A;  5IJ0 A;  4LF8 B;  4GYC B;  2AZ0 A;  3CCS V;  4PI2 A;  5A9G A;  1KYO F;  3C3S A;  1U97 A;  4DV3 O;  3DGE A;  2PYJ A;  2X6B A;  3K06 A;  3K58 A;  2XOK G;  3FAV A;  3K79 A;  3G6E V;  2B1G A;  1VQ9 V;  2HHH O;  2MW2 B;  1O9H A;  4UUJ C;  2WLL A;  1OCR B;  3B09 A;  1ZLZ A;  2DN9 A;  2OCH A;  2ZE5 A;  3L75 H;  1HNW B;  3WFV A;  2W0F C;  3T1Y B;  2F1M A;  1YSC A;  4MT8 A;  4P9P A;  1GK9 A;  2ATK C;  2DWD C;  1NTM H;  1WN7 A;  4X1K B;  3F5T A;  3JAK A;  3E35 A;  4DR6 B;  1KP2 A;  1WLE A;  4OPA A;  2Q7E A;  4DRX A;  2AZ2 A;  3UT5 B;  4QE7 A;  2UXD O;  2RJZ A;  3HKD B;  3JAR B;  3AG2 B;  4FLV A;  1JOY A;  2D3O W;  4GZR B;  3AG4 C;  4LFB B;  4GLX A;  1OHH G;  1WA8 B;  3BCC H;  1N32 B;  4R50 A;  4B7K A;  2PZS A;  1BT8 A;  1MOF A;  3THO A;  1I94 B;  1M1K W;  1SER A;  3UCS C;  2YDE A;  5JJE B;  4GX1 A;  5LHG A;  2UU9 B;  2VS0 A;  3AG3 B;  3CRA A;  4NXM B;  3OW2 U;  2EJ7 A;  1QU7 A;  3FFQ A;  4CC6 A;  4OX9 O;  1DF4 A;  1DTO A;  4YIO A;  2R72 A;  1XRE A;  2V7Q G;  1N33 O;  5J2U A;  1JX9 A;  2EIK C;  5C8Y A;  2IU0 A;  3ZS8 C;  1ZUQ A;  3K5O A;  4W4L A;  4PDR A;  5K1X A;  2ZD9 A;  3QF7 A;  1L0L H;  4JI7 O;  2GUZ B;  3IC7 A;  2XAF A;  1KKC A;  5KUK A;  1PP9 H;  4C7U A;  2KG7 A;  3A0R A;  3OR6 C;  1F23 A;  2CTP A;  3ETD A;  4K35 A;  4O4I A;  4PA4 A;  3K9S A;  1M5I A;  2ZE7 A;  1Q90 D;  4F6E A;  1QNM A;  2XAQ A;  5EYP B;  2YIB D;  1R3I C;  3JAS A;  4X64 B;  1VQL V;  5LA6 A;  1FXK A;  3G71 V;  4ZHQ B;  1GM8 A;  3B8N A;  3HR0 A;  3CCJ V;  3CE2 A;  2IW5 A;  3SJB C;  1MG1 A;  4X66 B;  3ABK C;  4IYH A;  4H44 B;  1XNQ B;  2WLJ A;  4FM1 A;  1YHQ V;  2F4V B;  1SF9 A;  4YIP A;  4AIL C;  3IC9 A;  3SDL A;  3CHX A;  2DYR C;  4MTO A;  4PA3 A;  4KXR A;  4BW9 A;  1XMO O;  4JAV A;  4MTF A;  1FFX A;  4FMT A;  2EX3 A;  3G6B A;  4LFA O;  4TOI A;  4JI5 B;  3ETE A;  3NR7 A;  1Q6H A;  3ZHR A;  1Q6U A;  2M7W A;  4B3T B;  4FZ1 A;  1WPB A;  1FJG O;  4LWS B;  4LF6 B;  3B77 A;  1N0J A;  4GKJ O;  3JD2 A;  1CPY A;  3T1H B;  4RAI A;  3I56 V;  4UB6 Z;  1AI7 A;  2XAJ A;  5LL6 Y;  1M57 C;  4MS2 A;  2AHZ A;  4TV8 B;  1P7G A;  2ZCE A;  4WFA V;  1VQP V;  4JI8 B;  2UXC O;  2DOS A;  1TUB A;  4PD4 F;  4JI3 B;  4U3J A;  2Y69 B;  4N23 A;  4TQD A;  3ABT A;  3JAW B;  1Y6X A;  2FKX A;  1DF5 A;  1E1R G;  3OE7 G;  2HR3 A;  3CS5 A;  4YY3 O;  1FS0 G;  1WJZ A;  1FXH A;  4DR1 B;  3E8F A;  3MDS A;  1SQG A;  1BCC H;  4JI2 O;  2PUS A;  1N36 O;  1Y4M A;  1EN5 A;  5GON B;  2N04 A;  4CS4 A;  4X20 B;  2RNB A;  5LMN B;  3UO2 A;  1MA1 A;  1PKX A;  3SJA C;  1AJN A;  3X2Q C;  5BR8 B;  4K8Z A;  4LF5 B;  3WG7 B;  3H1I H;  3ABU A;  1XMQ O;  4DV0 B;  3ABM B;  1XIL A;  4LH7 A;  2QGN A;  1JFF A;  3BY6 A;  4LNU B;  2RN9 A;  5B1B C;  1YZB A;  2R9I A;  1BGY H;  2Q6A A;  2FTK A;  1ZAU A;  2P5O A;  4HNA A;  5IWA B;  2ZT9 B;  1THZ A;  4JYA B;  1A32 A;  1SQX H;  4PA9 A;  2WA3 A;  4DO2 A;  4TUY A;  4HBN A;  2YID A;  2NR5 A;  2QM4 A;  4WF9 V;  1G1X B;  4DV3 B;  3QVN A;  2CDY A;  3RT3 C;  5BY1 A;  2DQ0 A;  3RBZ A;  2JIZ G;  1RM1 C;  2HVJ C;  4JAA A;  2HHH B;  2EZO A;  4NTW A;  3JCZ A;  1VQK V;  3K57 A;  1EM1 A;  3RYH B;  2F93 B;  4MVQ A;  4IIJ A;  3QTC A;  5IYC O;  3K3W A;  3OUS A;  4XBF A;  5CA1 B;  1GMG A;  4LR3 A;  1Q6I A;  1Y76 A;  4Z2W A;  5B3S B;  3LSS A;  3CJH A;  1FXV A;  4O2B A;  5LXT B;  2UXD B;  4PI0 A;  5LYJ A;  1BQZ A;  2VWJ A;  2PGG A;  4HAM A;  2Q4P A;  5H6R A;  1NVP B;  1NQT A;  1URF A;  2CTR A;  1AR4 A;  1V54 B;  1VQN V;  2ZDI A;  3CCQ V;  1IX9 A;  4MVO A;  1B06 A;  3CCV V;  4NTX A;  1VMG A;  4JYC A;  4UVB A;  2BCC H;  5IYD O;  1D2D A;  4QPK A;  4FM2 A;  1P4R A;  3LSQ A;  4G2K A;  2P7T C;  4OX9 B;  3TET A;  4JI0 O;  2JS5 A;  4K3A A;  1IUR A;  4RQE A;  2P90 A;  1N33 B;  1FFT B;  2Y48 A;  1MSW D;  2YEV A;  5CA0 B;  2LFS A;  4OGQ B;  1XQ8 A;  4JI7 B;  3E83 A;  4JI1 O;  5CBF A;  2JS3 A;  4LFC O;  4MW3 A;  1SQQ H;  2QA4 V;  2B9Z A;  3L9D A;  1R3L C;  4I0X B;  1L0N H;  1AP5 A;  3A2F A;  4UCU A;  2YS8 A;  4EFE A;  5IYZ A;  3JD4 A;  5EBM C;  2QE7 G;  4DR4 O;  4FFB A;  2PTM A;  1JCH A;  1E1Q G;  1SET A;  4DK1 A;  4X62 O;  1PM9 A;  1ROP A;  2BSK A;  4MVU A;  1QLE B;  2XND G;  4P30 A;  4DR7 O;  2YIA A;  2NLJ C;  2JK5 C;  4GKK O;  1RPO A;  5L3B A;  4TSF G;  2WLK A;  2LGQ A;  3OTF A;  1PL4 A;  2HKO A;  3FB6 C;  3SPH A;  4NR1 A;  2ZNI A;  2JEX A;  3JYC A;  5IJ9 B;  4WFF A;  3ZMZ A;  3OM3 B;  2Z3Y A;  3EVK A;  4PDV A;  2IJH A;  4DR5 O;  4ZBM A;  1SS3 A;  1WP7 A;  3K08 A;  2L35 A;  1M56 C;  2EIM B;  4EB6 B;  1QCE A;  4X1I A;  1K5S A;  1XMO B;  1YTF B;  1ZSP A;  3CCU V;  4BW5 A;  2ZQM A;  4LFA B;  2A7W A;  1JJO A;  3CCL V;  3T4Z A;  2OT5 A;  1IZ3 A;  1VQ6 V;  2EIJ C;  2DYS B;  4O4L B;  4B7E A;  5FNV B;  1FJG B;  1ZWI C;  4ZOL B;  1KD1 W;  5CMU A;  5ITZ A;  4QJF B;  4GKJ B;  4LF7 O;  4CS2 A;  1ENV A;  2QDO A;  4UCO A;  2CK3 G;  4RO2 A;  1KU9 A;  3E22 B;  2E75 B;  1NI8 A;  2UUC O;  2UXC B;  2IM9 A;  1EN4 A;  1LUW A;  2O57 A;  4ZI7 B;  1NBM G;  3CRM A;  5KLV H;  4NB5 A;  2HVK C;  2GDS A;  1J5E O;  1NVP D;  1QVG U;  3ZCC A;  2CH7 A;  4YY3 B;  1YIJ V;  3HB3 B;  3VQW A;  4JI2 B;  1N36 B;  3OD4 A;  5IJ0 B;  1Y67 A;  2P4K A;  1SKV A;  1OCO C;  4UFZ A;  3CEI A;  4IGG A;  3W7S A;  1AI5 A;  1GN3 A;  1H2S B;  2CGN A;  3BRC A;  4ICG A;  1XMQ B;  4I9Q A;  2LW7 A;  2BTQ A;  1R3K C;  1F4N A;  3MD0 A;  3LUT B;  3SYP A;  1ZX3 A;  2Q8V A;  1WAZ A;  3GWO A;  1F7Y A;  2P22 C;  4QE9 A;  3L70 H;  2Q67 A;  2ADQ B;  4JI4 O;  2KB1 A;  1YJN V;  3D36 A;  3RYF B;  3RGB A;  3P3P A;  2JGD B;  3JAL B;  2WLN A;  1RFY A;  3AG4 B;  4DV4 O;  1G6U A;  3JAK B;  4I55 B;  5KX5 A;  4A5U B;  2RMK B;  1S5J A;  4I4T A;  4EFB A;  1B3Q A;  2XUM A;  3ZHU A;  1AI6 A;  4GX2 A;  4O4H A;  2OCC C;  3D36 C;  2ETN A;  1EFR G;  2UXX A;  4JAU A;  2VQF O;  1NTZ H;  4MVM A;  2CAZ C;  3DC6 A;  2Y0I A;  3CSX A;  2JJ1 G;  3LDC A;  3E86 A;  2PY5 A;  4W4K A;  1VQ7 V;  2CGO A;  4WFB V;  4R6Z A;  2XT9 A;  1S76 D;  4AHC A;  3SJC C;  1YEW A;  2EIK B;  2A0L A;  1R6N A;  3F7V C;  5KHI A;  3OGI B;  1X59 A;  1AJQ A;  4BIU A;  4IHJ A;  5LBQ A;  1M4U A;  3RW0 A;  2DMX A;  1YTF D;  5J2U B;  4EEQ A;  3H1K H;  1PL0 A;  3E8G A;  4WFH A;  1S0V A;  2D2C B;  3HKE A;  1KP3 A;  4OPH A;  3S3W A;  2WLI B;  5LOV A;  2QWP B;  3HKB A;  3IFX A;  2W0X A;  4BAY A;  1XOU A;  2AGA A;  4AI8 A;  2ITD C;  3ZX6 A;  4JI0 B;  1D5N A;  2LGW A;  2LFR A;  3FB5 C;  4FLY A;  3ZMV A;  1SQF A;  4X9Q A;  2YIB A;  3AK3 A;  1YJ9 V;  2NNU A;  3ABK B;  4OXS A;  4GUN A;  2Q5Z A;  2B5U A;  5LA6 B;  1K8A W;  4FLU A;  1QHT A;  1BSM A;  2DYR B;  3P30 A;  5BZB A;  4LFC B;  3ZHV A;  4JPR A;  2ARH A;  1SA0 B;  1VQ8 V;  1K33 A;  2G38 A;  2A3Q A; 
#chains in the Genus database with same CATH homology
 2AXT Z;  4UB8 Z;  5GTI Z;  5TIS Z;  3A0B Z;  5KAF Z;  3A0H Z;  3KZI Z;  5GTH Z;  5H2F Z;  5E79 Z;  3JCU Z;  4IL6 Z;  4UB6 Z;  5KAI Z;  5B5E Z;  3WU2 Z;  1S5L Z;  5B66 Z;  4PJ0 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...