1M5IA

Crystal structure of the coiled coil region 129-250 of the tumor suppressor gene product apc
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
110
structure length
105
Chain Sequence
STGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The coiled coil region (amino acids 129-250) of the tumor suppressor protein adenomatous polyposis coli (APC). Its structure and its interaction with chromosome maintenance region 1 (Crm-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords APC protein
total genus 46
structure length 105
sequence length 110
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11414 Suppressor_APC Adenomatous polyposis coli tumour suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m5iA00
2R9AA 2QM4A 3RWRD 3SR2C 1M5IA 1KU9A
chains in the Genus database with same CATH superfamily
1VF7A 5DM6V 1QLNA 3L72H 3CCMV 3OUSA 3CXCU 4K3AA 4PA3A 3ZN0A 1OJHA 2QWNB 5K1XA 4DR3B 2ZM6B 1BHAA 3ICXA 3JASA 4D7TA 2RNBA 2ZNJA 4LBEC 3CMEV 1OHHG 3CE2A 1I7FA 2EJ7A 4OGQB 1OCZC 1M57B 3UQ8A 2UUBO 4CC5A 5CB4A 3ABKC 4OX9O 3AG3B 2DW4A 3CCJV 1JX9A 1KP3A 4LNUA 5CMUA 4E4EA 3CC4V 2F66C 1TAEA 3A0HZ 4JZGA 3JD2A 2ZIOA 1YEWA 1CPYA 2BOCC 3OTOB 2DWEC 4PA6A 3S3WA 3ZRXA 3ZHQA 5KX5B 4O4LB 4AQYO 4I55B 2X0LA 1SQFA 3UKMA 3ZHRA 2WLJA 3G6EV 3I56V 3EFFK 4WF9V 1K92A 4DV4B 1B3QA 4DW0A 2DOSA 3CC7V 2F1MA 5GTHZ 2YXYA 3E8HA 2YEVB 1VQNV 1JR9A 2HLDG 4JI8B 4JI7O 3IFXA 5E1AC 3J81N 2B5UA 4GKJO 1IBMB 2Q67A 4FZ0A 1BL8A 3R66A 3JAKA 2WPDG 5H6RA 1X59A 4B3TO 1SS3A 1YIJV 4KXRA 4GKKO 1Y4MA 3H1KH 2WLHA 1SZXA 2QWQB 1U97A 3DTUB 4JI1B 1AP6A 2E75B 1BSMA 3W7XA 1KMIZ 1DGSA 5IYCO 3ABMC 2XAQA 3TXQA 3HB3B 4LH6A 3T1YO 3AG3C 2RN9A 1N36O 3ABKB 1M56B 1XMOB 1PKXA 3B77A 4PELA 5KUKA 4JI2B 1S0VA 4FJCC 4IHJB 4L87A 4FLTA 5KUMA 5B1AC 1Q6IA 1CP9A 3J7AU 4P9PA 4JI5O 3FX7A 1JCHA 3C3SA 3I5DA 3BAAA 4LWSB 3N2GB 1N34O 3MDSA 3MHSC 3QF7A 1SERA 2EINB 3SYQA 4QE9A 1N0NA 2ZDIA 5B1BB 2ARHA 3SYCA 1Q82W 2HKOA 1TA8A 3EXAA 1F7YA 1SF9A 2XOKG 4DR5O 2KG7A 2IW5A 4H37A 3WU2Z 2X6CA 1KYOF 4CH3A 3UO2A 1K3EA 2CTWA 4P9OA 5EYPA 4LP8A 3IJ4A 4KUMA 4F6EA 3FAVB 4J80A 3CRAA 3EVKA 1PNKA 4J10A 4YHHO 1IURA 4Z1MG 4NXNO 4X66O 1ORQC 4JYBA 1CXZB 1NS1A 1QVGU 1NH2B 1WPXA 5B3SC 1K97A 4FVMA 3HPLC 3RYCB 1G8MA 2WLIB 5IE9A 2YICA 1S76D 3MHHC 1N32B 2CH7B 4X65O 2ADPA 3PJSK 1BS3A 2EINC 1XNRO 2E5LO 1T5EA 5DN6G 1O9HA 3OT7A 5BZBA 1NVPD 1PNLA 4K8XA 1EN4A 4H33A 4J11A 1GM9A 4X1IA 4YJ2A 4LF6B 3ZHUA 4B7KA 4UCRA 4X66B 5LMNB 1XBLA 1ZTEA 2JS3A 3CPWU 1NR7A 4Q6GA 3RW0A 4GKKB 1N4CA 4DR7O 2Q0OC 3L9DA 4TV8B 3JAMN 4NTWA 1XQ8A 3CSXA 4PJ0Z 5JQGA 2ITDC 3SGIA 2JIZG 3MAQA 1EBOA 2A0LA 4DR7B 5FNVA 1J5EB 3VQVA 2JRIA 4D7SA 3LNNA 2ZINA 4LNUB 3BABA 4CH4A 4FM1A 3D36A 1JFFA 3E22A 4MS2A 3FB7C 3GB7C 2LQTA 2UXNA 4NVPA 2RCVA 1XHXA 2F43G 1HDJA 3OFNG 4LFAO 1CEZA 4U7OA 5DECA 1EZJA 3OW2U 2H94A 2L35A 3LSSA 1Q3EA 2VQEB 1GK9A 1PL4A 2LGQA 3K03A 2WLMA 4O4HA 1BT8A 4PDRA 1AJPA 4JI3O 4DUYO 4U7NA 5JJNB 4DXWA 1H8EG 3TGUH 3FFQA 3H1HH 1H2KA 1TUBA 2PTMA 4FLYA 4UCVA 4I55A 2QM4A 3G71V 2VRZA 3CP1A 3B8NA 3CRRA 3RYHA 5CA0B 4B3RO 3STZC 1SC5B 2OCHA 3UCSC 4R50A 3RVYA 2B9ZA 4O4IA 4DO2A 3RYIA 1JQ0A 4IHJA 1I08A 1H38A 4UXNA 4JV5O 1L0NH 3ZBHA 2UUAB 4AHCA 5JJEB 3W7UA 1WB8A 1OCZB 2P7TC 4ZIBA 1VQ5V 3B4SA 4LFCO 1OZ0A 3F5TA 2IU0A 3QNEA 4JAVA 4JYYA 2KKWA 1BMFG 2IM9A 4RWUA 4QIWF 4O2AB 1Q6HA 1Q7YW 1ZWIC 4TUYB 3E86A 2PZSA 1VQKV 3JAKB 2QKAA 5J9PC 2FTKA 3JCUZ 3JD4A 3CC2V 4YIPA 2P6JA 2P90A 1M4UA 1G4YB 4FIPC 2JJ1G 4ZHQA 4EB6A 2Q4PA 1I94O 3GVMA 1W59A 5L3GA 3UO3A 1HP8A 4YJ3B 3A2FA 3A0BZ 5LHIA 2QJ1A 3LDDA 3STLC 1J95A 4JI4B 5KA6A 2YUAA 4LFBB 5JWPA 4ASUG 3OM3B 3E22B 4DV2B 2P5OA 2G38A 4MVRA 1YJNV 2Z5UA 3VQXA 5LHGA 2XAJA 1Z5VA 4B3SO 4P2ZA 2XT9A 1A32A 3D36C 2UXXA 3ETQA 2GUZB 2GV9A 5IYDO 3ASOC 2FYUH 3E83A 4FLVA 1YXBA 3JAWB 2ZKOA 2JGDA 3VQWA 2WAMA 1ZX3A 2UUCO 1V54C 4UB6Z 1BHBA 1E79G 2P4KA 1AROP 5EZYB 2PF4E 2UUCB 3CS5A 2NLJC 4UFZA 3ABUA 1MZFA 3HKCB 3CEIA 1NJIW 4JI2O 2EZPA 1WAZA 4RUFA 5A2QN 1GMGA 1KBHA 1G1XB 1XNRB 2FB5A 1W0JG 1YTFD 1DF4A 2Z0AA 1SQVH 5J2TA 1WNSA 3M7MX 2ZT9B 1XNQB 2Y4UA 3CWBH 2UXDO 1S3JA 3WB2A 2H8PC 4OX9B 4JI3B 3ABLB 4DV1O 2LFSA 3JD3A 3FB5C 2PY5A 2OT5A 3VBBA 1XUQA 5GONA 4FLXA 1OCRB 2EILC 1SQQH 1L8DA 2X6AA 1BE3H 2HFEC 4X64B 4TQFA 3E8GA 2CTRA 4G28B 3U11A 1KKCA 3FAVA 1W2BU 2YIBA 3ABMB 4JGSA 3ZEDA 4X1KA 4F6RB 5KAIZ 3ZX6A 3T1YB 4NXMB 4WBNA 4UCTA 5D5PA 3E89A 1RP3B 2D2CB 1H2NA 4JV5B 2ZR3A 1P7BA 2JGUA 2ODMA 4GZRB 3WG7B 3VOUA 2OCCC 1Y6XA 5FL7G 2ZR2A 3RT3C 5L3CA 2FKXA 4L8JA 4H0LB 1IX9A 4GKJB 2EJRA 3H9VA 2ZQMA 4TOIA 1THZA 3D3IA 2BCCH 4I9WA 4B3SB 3JSNA 2JEXA 3CRCA 3G80A 3QO8A 3P32A 1R6NA 4H13B 1BQ0A 3AG1B 2IBZH 1MMMA 4XDJA 1N33O 2CE4A 4X1YA 1NVPB 1SQPH 1XNQO 1JVMA 4O4LA 4WFHA 4FFBA 1V9PA 3BVOA 4DR6O 4HNAB 4WFAV 1PL0A 1NBMG 2F23A 4UUJC 3ZIAG 4CZZA 1GH6A 1P49A 2WLLA 1JJ2U 2HP8A 2ZNIA 1WPBA 3SPJA 2QE7G 1HNZO 1M57C 1NTZH 3P3PA 2HHHB 1LNQA 3LDEA 4FM2A 1Q43A 1YSCA 3ASNB 5EC1C 3SPGA 1BGYH 2LW1A 3Q4HB 3T4ZA 3JALB 4DW1A 1B6QA 4UCSA 5BXZA 2E74B 2PI5A 2E3CA 2LO1A 3SPHA 4I5SA 3APQA 2AZ2A 4P30A 2HVJC 1KC8W 1KKDA 1YDXA 5H9CA 3APOA 3ML0A 1EN6A 4DUZB 1MSWD 3CRQA 1SETA 4DV3B 2AZ0A 4LF5O 5IJ0B 5LGUA 3SYPA 5JVDA 2DN9A 2Q7HA 3OD4A 2GTSA 3FD9A 4DV3O 1SKVA 4JASA 1US6A 2R72A 3WB0A 2UU9B 1SQGA 2OIGA 1NTKH 2IH1C 2VS0A 4EKWA 2DJVA 3JARB 4KL1A 3FYEB 2RQ6A 1FKAO 4CS3A 4JAUA 2DYSC 2IJIA 2XAFA 4NTXA 1N32O 3X2QB 2LP7A 1NTMH 3L70H 4DR2O 3ZCCA 1M93A 3L71H 4DR1B 5CA1B 3LNMB 5H5NA 4I7ZB 1HNXB 3GWKC 1VQ8V 3I55V 2LFRA 2ZD9A 4YY3O 3DC5A 4HAMA 3TJTA 5IY5C 3W7TA 3HKDA 1IBKO 5JQGB 1HWYA 4RAIA 3ZRSA 1Y67A 1FXKC 4PA4A 2H3OA 3K59A 1GN6A 1JPXA 1TGOA 3ZHTA 1F23A 1X4TA 3AK2A 4O2BB 5JCOA 4I50A 4F4LA 1QBZA 4B3MO 5CA3A 1VQPV 1Y66A 3F7VC 1K4DC 1XL6A 3OE7G 2LW7A 1COWG 1OCCC 5TISZ 3SPIA 3E8BA 3W7WA 2IJJA 1KQSU 1GN3A 1I5XA 4DR2B 1N36B 1SQBH 2YDEA 2QWOB 4NYKA 4DR6B 5AG2A 4QJFB 3JCZA 4DV2O 2Y4TA 1FXVA 4ZOLB 1H2SB 1AJNA 3FB6C 4J9ZB 3L73H 1YI2V 4DV5O 3HKEB 2CH7A 1OCOC 4I4TA 5LGTA 2CDYA 1EZVH 2Z3YA 1K7DA 1PD3A 1FJGO 1R1BA 4H44B 5GONB 5IJ0A 2WLNA 1QLEB 1N0JA 4DV7O 5CB4B 3CCEV 5EYPB 4GYCB 1S77D 2LGWA 3THOA 1S5LZ 3Q4HA 2PYLA 2UUBB 3E35A 1IBKB 1V55C 5LYJA 1FS0G 3IC7A 4GX5A 4X62B 3HKCA 4JI7B 3L74H 4UCOA 4XDLA 1TVKB 2BSKB 2HG5C 1I0HA 5J2UB 4X64O 1J5EO 3RBZA 3H1JH 3ZS8C 1NKDA 4GCZA 4LF7B 3AK1A 1ZUQA 1QLEC 3ZHVA 4O4JB 3ZMVA 1VQ9V 2JEUA 1IXBA 3BHPA 2ZE8A 5IT9N 2Q68A 2VQFB 2EIMB 5LXTB 3JATA 5DEDA 5K1PA 1Q6UA 3ZMUA 2N05A 5CA1A 3ZJZA 3HKEA 3KCXA 3BEHA 1MNGA 1MZEA 4YIOA 1U96A 3LSQA 4GX1A 1IVSA 1ZAUA 1NR1A 2AGAA 2QEXV 2QM8A 4MVOA 3AG4C 5JJJB 2E5LB 1SZTA 2EIKB 2X6BA 2DYRB 1VEWA 2OIEA 5LGNA 4LFAB 5LP6C 3IGAC 1L1FA 5C8YB 5LP6A 2EX3A 1LR1A 2ZE6A 1SA0B 3SPCA 2P22C 4DUZO 4DV1B 5CBFA 5KMGA 2EBOA 1HR0O 2IU3A 2A9HA 2K1EA 4DR1O 1Z2GA 2ZM6O 3QVNA 5IY5B 1JMKC 5LYJB 3NR7A 1PP9H 2HR3A 5HFMA 3ZN1A 2L6LA 1HNWO 3G4SV 1YITV 2QWPB 5GW7A 4B7EA 4HYOA 2C2AA 1GO3F 1Q8IA 4LH7A 3C90A 3RGBA 4LR3A 4IIJB 2V4DA 1VQ7V 4DV0O 4MVZA 3JARA 5LOVB 4FPPA 1UPGA 2QR4A 1K33A 3DXRB 4OXSA 4X9QA 5H6QA 5B1NA 4LF6O 2YIDA 1WA8B 4YXWG 3BFRA 3MD0A 4LF8B 4JPRA 2NN4A 3K0GA 1NZ6A 2N74A 1WJZA 2Q0AA 2GDSA 1W0KG 1DF5A 4GX2A 1MG1A 1WB7A 2ZE7A 5F2VO 2AXTZ 1PNMA 4JTCB 2Y69C 2WSSG 3OTFA 4HZ3A 3JASB 2B1GA 3OAAG 1BQZA 1BZKA 5EIBC 4DV5B 1KD1W 4KHPO 5LBQA 4NR1A 4QPJA 1QNMA 2JK5C 3K04A 4I0XA 1XHZA 2IJKA 3ZMZA 4X20A 2Q5ZA 1RSOA 3JAWA 1IXMA 3K06A 4CBCA 2KSDA 4PV1B 1VQMV 1Y74A 4DR3O 4PDVA 1FPOA 1K8AW 3AG2B 1H2MA 1ZSPA 1F51A 4GX0A 5D5QA 3JSLA 4B3MB 1JA8A 4TWKA 2R9AA 3F5WC 3JD1A 1G6UA 3T4DA 1JJOA 1WA8A 3M8AA 4C7UA 1UJWB 2XASA 2BE3A 2IJHA 2BTOA 4TV8A 1GKFA 1DTOA 5LOVA 2UUAO 5BR8B 3O9OA 4AQYB 1XILA 1D2DA 2CTPA 4WFEA 4U3JB 2A3QA 3BCCH 2EIJC 4LF4O 3ZRWB 4X1IB 2BTQB 1FXKA 1ZL8A 5CBHA 1AVMA 4FLWA 1D5AA 3OUFA 3ETDA 2ZE5A 3CCRV 4JYAO 2ZXWC 2OCCB 4MSWC 2P67A 3WG7C 3QO5A 3HKDB 5LA6B 2UXDB 4KFMA 2HEPA 1RM1C 3WFVA 1AR4A 2F95B 3HR0A 2YI8A 4WCEV 4O2AA 5CN0A 1AB3A 2EIJB 4WBNB 5L3EA 2HVKC 1IBMO 2E76B 2WLIA 2LJ2A 4X1KB 4F6RA 3SYOA 4EFBA 4DR5B 4JI8O 2ILMA 1GTOA 1LUVA 4CS4A 5IYBO 5EBWC 3R65A 4FM0A 1PPJH 2QGNA 5KAFZ 1XEQA 1N34B 4QNHB 3LUTB 4WFFA 4MTXA 4PDLA 4HNAA 3AG7A 1AI5A 5CA0A 2JDIG 3D3QA 2WA4A 2F4VO 1OCOB 4UV8A 1GN4A 2YSUB 1HNZB 1I5YA 4FK5C 5IJ9A 3ABLC 1K5SA 3SJAC 1HNXO 3RYFB 3N2KA 4JI6O 4PHZA 4UCUA 1FAFA 4DV6B 4DV6O 1VMGA 1UFIA 5EBLC 1F4MA 4PDMA 3ZMSA 4LF4B 1FFXB 4Q20A 4XBFA 3CB2A 4NB5A 4J41A 4WFBV 1VF6C 3T1HO 1OCCB 3U10A 3PN1A 5KMGB 4K0KO 2DQ0A 4B08A 3KKYA 1N33B 2HJDA 2GTAA 3ABTA 4J7ZA 1XDCA 2Y69B 3SJBC 2VQFO 1H8HG 5EC2C 1I94B 3TETA 3DC6A 5KHGA 3D8CA 4GUNA 3N2KB 3WB1A 1TUEB 5IYZB 1NH2D 1XREA 3CCVV 2A7WA 1YCIA 4MTOA 1GM7A 2GUZA 3RFRA 1FD9A 4LC1A 4DV0B 3ZMTA 3TCUA 3OGCC 2D3OW 2BTQA 3CD6V 3OR6C 4B3RB 1SRYA 2QTOA 1K9MW 1WP7A 2JS5A 4LFBO 4IGGA 4U3JA 4PA9A 1XI1A 4FLUA 2IH3C 3VQYA 2HHHO 3UT5B 5EIBD 4BIOA 2ADQB 4QE7A 3ZRVA 5L3BA 1F4NA 2VWJA 1B06A 2RJZA 2AHYA 4YJ3A 1H2GA 1PV0A 1KUQA 1MSDA 1QR9A 4DR4O 3CJHB 2QWRB 3RYHB 2FMLA 2V1DA 2Q69A 1Y74B 4CH6A 3U0ZA 5E79Z 3K08A 1FXHA 2BSKA 3CCLV 1ROPA 4BWAA 1FFTB 3JALA 5FPOA 3K79A 4I50B 1AR1B 4AI8A 5BY1A 3H01A 1VQ6V 5C8YA 2GHYA 5LP6B 2BOBC 1KU9A 1QHTA 1WP8A 3ASNC 2CK3G 3T1HB 2EZOA 3K5NA 1FFXA 4ZBMA 2XTAA 1AP5A 3AG4B 3UT5A 2WLLB 1VQ4V 1AJQA 1SESA 1MABG 2A06H 2Y0PA 2ZCEA 2Q9LA 5B1OA 2QM7A 1VIBA 5B66Z 1IBLB 4LCUC 4WFGA 2PGGA 5KHKA 3K0DA 1YZBA 3JATB 2EIMC 3RN4A 4JYCA 4NTYA 1GAXA 4JI1O 5HFLA 5LHHA 2JJ2G 4LFCB 4ZOLA 2MK3A 5JVDB 1QCEA 2DMXA 2QDOA 3DXRA 1R3IC 3FKSG 4DK1A 2Q73A 4JI5B 4XDKA 5KHIA 1E1RG 3JD0A 1VF6A 1XMQB 3F7YC 5BMVA 5JH7A 4IT5A 1GRJA 2R9RB 4K8ZA 5LMNO 4W4LA 4DK0A 2Y0IA 3E8FA 3OMNB 4PD4F 1AI4A 1ZLZA 2ITCC 2XNDG 5B5EZ 1RM1B 3KZIZ 2ZXWB 4U3FH 2PYJA 3BY6A 2QKSA 5IWAO 4RO2A 3M99B 5IWAB 3K5OA 5L3FA 3K5LA 5LMUO 1E1QG 5EBMC 1LUWA 4J42A 3CJHA 3ZRWA 2W6JG 4OPAA 2P06A 1DLBA 4ZI7A 4MVMA 2Q7GA 3S3XA 3CXHF 1NU1H 1SQXH 3SR2C 2Q7EA 2ETNA 1R3LC 3T2MA 2OTLV 3CMAV 4ZKIA 5GTIZ 5BR8O 4IIJA 4IL6Z 4BW9A 3B8MA 4CH5A 2F4VB 5FPRA 2W0XA 3AG2C 2EILB 4YJ2B 3A8TA 4DV4O 3CHXA 2R70A 1RPOA 4FMTA 4JI0B 4JYAB 4MW8A 4AILC 4Z1VA 4X65B 3H1IH 3SYAA 4O2BA 1XOUA 2ZIMA 3L75H 1SA0A 4MW3A 4MVSA 5KX5A 2O57A 2W0FC 4EFEA 5KHHA 4JI4O 4UB8Z 3SJQC 4N21A 2K9PA 2OTJV 4JZ2A 1OV9A 3AK3A 5BMVB 1AR5A 2YS8A 4KHPB 2Q6AA 2CUGA 5B3SB 4DRXB 2UXBB 4PA7A 1HW7A 2WWWA 4J7KA 3X2QC 1K4CC 1NI8A 3T1CA 1P84F 2RMKB 4IYIA 1DK1A 1YHQV 2DYSB 1YF2A 3O65A 4R8CA 1WN7A 3ASOB 5IJ9B 1GM8A 4EEQA 2YI9A 4E2LA 4JF3A 3B09A 3B40A 4K35A 4RQFA 4NKGB 4FFKA 1TUBB 1K34A 1RSOB 2P4VA 3K58A 3GWOA 4X89A 1VF5B 1O9GA 4B3TB 5B1BC 1IZ3A 5L3DA 3RVZA 4PI0A 4I0XB 4K0KB 3N2GA 1K73W 1TVKA 4HBNA 4GLXA 5KA5A 2CAZC 4BIUA 1NT2B 5B1AB 4CS2A 3FB8C 1XMOO 4ZHQB 2NR5A 1URFA 3RWRD 3SJCC 2AW9A 5FLXN 1WLEA 3IC9A 3DGEA 1JFFB 4MVUA 1M56C 1S5JA 4TUYA 1D5NA 1Q5OA 2UXBO 3HKBA 1H2LA 4J9YB 1MA1A 2JGDB 3ETEA 3BA9A 3EHBB 4UVAA 1AI6A 2PI4A 4LF5B 2DYRC 1VQOV 1IDSA 2EIKC 4A5UB 2XUMA 4X8AA 4FFBB 3CCUV 1M90W 4JI0O 4MTFA 4X1YB 1RFYA 1Q90D 4ABMA 3AG1C 1QU7A 2CGOA 4BIZA 3CX5F 3JYCA 2F93B 1R6TA 4DR4B 3G67A 3OMAB 1S72V 1PM9A 2HJFC 4IYHA 2W6IG 3W7SA 1KECA 3SDLA 1KP2A 3K9SA 1HR0B 4NXNB 4FZ1A 2RDCA 1ENVA 5IYZA 4DV7B 5EK0A 1R3JC 5J2TB 2UXCO 4J7JA 1N8RW 1IBLO 5JCOC 1R3KC 2ZDIC 2CTQA 2QA4V 2M7WA 2YC0A 1GN2A 4TV9B 2VWKA 3ZHSA 1HNWB 2YXHA 4BAYA 1Q81W 4N23A 2MW2B 4LWSA 5IDJA 3RYCA 1L0LH 1YVWA 2QKCA 2YIAA 3UM7A 2V7QG 4R7CA 2QSAA 2UXCB 1V55B 3B2EE 2FL4A 4X62O 4LF9B 5LMUB 1QQCA 2CGNA 3NXSA 2XAGA 4PI2A 4UVBA 4MTGA 3RYFA 3LDCA 4Z2WA 1B04A 3KCYA 1MOFA 3QO7A 4MT8A 3AEIA 3IAYA 3K5MA 1VARA 3BA8A 4JTDB 2VQEO 4LF9O 1K5QA 1JOYA 1XL4A 5ITZA 2Q8VA 2EULA 1M1KW 1OCRC 4DRXA 4MVQA 2XHBA 5FNVB 1YTFB 2YXLA 4LF7O 1QR8A 3DSQA 3QTCA 3FYIB 3P30A 2OYQA 3K57A 1VP7A 1YJWV 3OR7C 2PUSA 2XAHA 4TV9A 5J2UA 1EM1A 1Y76B 4ICGA 4YHHB 1R73A 4W4KA 4FLZA 2KQXA 2GBOA 1M9NA 5KHJA 3OEHG 1FYJA 3A0RA 1BCCH 4I9QA 4OPHA 4EB6B 2M6YA 3K3WA 4O4HB 3OMIB 3OGIB 3KG2A 4JTAB 3G6BA 4CC6A 4G2KA 2Y48A 3BRCA 2ATKC 3E2EA 3OEEG 4QGPA 2QTSA 2X7RB 2GSMB 5LA6A 3H1LH 5A9GA 5EZYA 1R6KA 2DE0X 4TT3G 5CBGA 2R9IA 1Q86W 1V54B 5LL6Y 1NQTA 3TK1A 1M5IA 1Y76A 2UU9O 1FXKB 1ZL8B 3ETGA 5C93A 1VQLV 4DUYB 4LF8O 2DQ3A 1P7GA 2YIBD 3K9AA 4RUEA 1P4RA 4QPKA 4UVCA 2B1IA 4I4TB 4RQEA 3TXSA 2WA3A 4ZI7B 3CCQV 1Z5WA 2KB1A 3BPZA 3QG5A 1RPRA 5ITZB 4YY3B 2WLKA 3N27A 3LSUA 3RYIB 1AI7A 1XMQO 1S5HC 3C3TA 4O4IB 4TQDA 4X88A 2JVDA 3HKBB 4R6ZA 4D6TH 5H2FZ 1QVFU 2OWOA 4KP4A 2YEVA 4GT1A 4DYLA 1EN5A 3OTOO 3P3NA 5KLVH 1KB9F 1FJGB 3CRMA 4BW5A 3CYOA 4JI6B 2N04A 5LXTA 2KG7B 4UV9A 2NNUA 1EFRG 3CCSV 2AHZA 4BR6A 2DWDC 4TSFG 2A79B 4X20B 1AILA 5JH7B 4G27B 1YJ9V 4O4JA 4NXMO 4JAAA 3J80N
chains in the Genus database with same CATH topology
5JVDB 1VF7A 4LFBB 1ZAUA 3E22B 4DV2B 2P5OA 3VQXA 4DK1A 5JJJB 4JI5B 2E5LB 5KHIA 1Z5VA 5K1XA 4DR3B 1XMQB 2ZM6B 5BMVA 5JH7A 3ICXA 3JASA 4D7TA 4K8ZA 4LFAB 2ZNJA 4DK0A 3ETQA 5LP6C 1I7FA 2GV9A 5C8YB 5LP6A 2EX3A 3UQ8A 4FLVA 3JAWB 1SA0B 4CC5A 3VQWA 5CB4A 2P22C 2PYJA 4DV1B 5KMGA 4LNUA 5IWAB 3K5OA 2F66C 3K5LA 5EZYB 2UUCB 1TAEA 4UFZA 3HKCB 2ZIOA 1YEWA 1JMKC 5LYJB 4ZI7A 3OTOB 2Q7GA 1XNRB 1Q8IA 5KX5B 4O4LB 4LH7A 4I55B 3RGBA 4LR3A 3SR2C 2Q7EA 4IIJB 2V4DA 5J2TA 1SQFA 1WNSA 3JARA 3M7MX 5LOVB 1XNQB 4IIJA 3WB2A 4BW9A 4OX9B 4JI3B 4CH5A 2F4VB 5FPRA 4DV4B 2F1MA 2PY5A 4YJ2B 4LF8B 5GONA 4FLXA 3CHXA 2R70A 2Q0AA 1L8DA 4JI8B 4JI0B 4JYAB 4X64B 4TQFA 3U11A 4AILC 4X65B 1IBMB 2YIBA 4O2BA 3ZEDA 2ZIMA 1SA0A 5KX5A 4X1KA 4F6RB 3JAKA 4EFEA 5KHHA 3OTFA 3T1YB 4NXMB 4WBNA 4UCTA 3JASB 5D5PA 5BMVB 5EIBC 4KHPB 4DRXB 4JI1B 2UXBB 4JV5B 4DV5B 1HW7A 1KMIZ 1DGSA 2JGUA 1XHZA 4LH6A 4X20A 1XMOB 1RSOA 4L8JA 4JI2B 3JAWA 1WN7A 4GKJB 5IJ9B 4IHJB 4EEQA 2YI9A 4TOIA 4FLTA 4B3SB 3JSNA 1TUBB 5D5QA 3BAAA 3JSLA 4B3MB 3K58A 2R9AA 1O9GA 4B3TB 3N2GB 1G6UA 1JJOA 4PI0A 3QF7A 4K0KB 3N2GA 2BTOA 4TV8A 4X1YA 1TVKA 4HBNA 5LOVA 4GLXA 2CAZC 5BR8B 4O4LA 1TA8A 4AQYB 4FFBA 1NT2B 1V9PA 4U3JB 4CS2A 4CH3A 4HNAB 4ZHQB 4X1IB 2BTQB 3RWRD 4FLWA 5EYPA 1D5AA 3SJCC 1JFFB 1S5JA 1P49A 4TUYA 2ZNIA 1Q5OA 1WPBA 3HKBA 3HKDB 5LA6B 2UXDB 2HEPA 2F95B 2YI8A 4O2AA 2HHHB 4FM2A 1Q43A 3BA9A 4FVMA 4WBNB 3RYCB 4LF5B 1N32B 4X1KB 4F6RA 4FFBB 3JALB 4EFBA 4DR5B 4UCSA 2E3CA 4X1YB 4CS4A 4FM0A 4DUZB 1T5EA 4DV3B 1O9HA 2F93B 5IJ0B 4DR4B 1N34B 5JVDA 4K8XA 2Q7HA 4HNAA 5CA0A 4X1IA 4YJ2A 4LF6B 1SKVA 2R72A 3WB0A 2UU9B 4UCRA 1HR0B 4X66B 5LMNB 1SQGA 1HNZB 4NXNB 5IJ9A 5IYZA 4DV7B 5J2TB 4Q6GA 3SJAC 4GKKB 3JARB 4KL1A 3RYFB 5JCOC 2RQ6A 4CS3A 3N2KA 4PHZA 4TV8B 4UCUA 4TV9B 2VWKA 4DV6B 1XQ8A 3CSXA 5JQGA 1HNWB 3SGIA 3MAQA 4DR7B 5FNVA 1M93A 4LF4B 1J5EB 3RYCA 1FFXB 3VQVA 2YIAA 4DR1B 5CA1B 3CB2A 1HNXB 4D7SA 2UXCB 3B2EE 3LNNA 4LF9B 2ZINA 1QQCA 4LNUB 5LMUB 3U10A 3PN1A 5KMGB 3BABA 3HKDA 4B08A 1N33B 4CH4A 5JQGB 4FM1A 4PI2A 3SJBC 1JFFA 3E22A 1I94B 3K59A 3RYFA 5KHGA 1TGOA 1B04A 1X4TA 4NVPA 4O2BB 1XHXA 5JCOA 4I50A 3N2KB 3WB1A 3IAYA 5IYZB 3K5MA 3BA8A 3RFRA 4DV0B 1Q3EA 5ITZA 2VQEB 4DRXA 2BTQA 4B3RB 2XHBA 5FNVB 4DR2B 1N36B 2YXLA 4DR6B 2JS5A 3DSQA 3QTCA 4U3JA 4O4HA 2OYQA 3K57A 4ZOLB 1XI1A 4FLUA 1H2SB 2PUSA 4TV9A 3VQYA 5J2UA 3UT5B 5JJNB 4YHHB 5EIBD 4FLZA 3FFQA 3HKEB 1TUBA 2PTMA 4FLYA 4UCVA 5KHJA 4I55A 2VWJA 2RJZA 4YJ3A 2QM4A 4I4TA 4I9QA 4EB6B 4O4HB 3RYHA 4CC6A 5CA0B 3BRCA 3RYHB 5GONB 5IJ0A 5LA6A 4CH6A 3U0ZA 4O4IA 5EZYA 3RYIA 4IHJA 5CB4B 4BWAA 1M5IA 3JALA 5EYPB 4GYCB 2UUAB 4AHCA 5FPOA 5JJEB 3THOA 4DUYB 4I50B 2PYLA 4ZIBA 2YIBD 5C8YA 5LP6B 2UUBB 1IBKB 1KU9A 2KKWA 4I4TB 5LYJA 1QHTA 4ZI7B 1Z5WA 3BPZA 2IM9A 3QG5A 4O2AB 5ITZB 4YY3B 4X62B 3T1HB 3HKCA 3K5NA 1FFXA 4JI7B 4UCOA 1TVKB 3RYIB 3UT5A 4TUYB 5J2UB 4O4IB 4TQDA 2PZSA 2JVDA 3JAKB 3HKBB 3ZS8C 2OWOA 4LF7B 2ZCEA 1M4UA 4O4JB 4ZHQA 1IBLB 1FJGB 3BHPA 4EB6A 4JI6B 2VQFB 2PGGA 5LXTA 5KHKA 3JATB 5LXTB 3JATA 4YJ3B 5K1PA 3A2FA 5CA1A 3HKEA 4X20B 2QJ1A 5JH7B 4O4JA 4JI4B 4LFCB 4ZOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9A A;  2QM4 A;  3RWR D;  3SR2 C;  1M5I A;  1KU9 A; 
#chains in the Genus database with same CATH topology
 1VF7 A;  5DM6 V;  1QLN A;  3L72 H;  3CCM V;  3OUS A;  3CXC U;  4K3A A;  4PA3 A;  3ZN0 A;  1OJH A;  2QWN B;  5K1X A;  4DR3 B;  2ZM6 B;  1BHA A;  3ICX A;  3JAS A;  4D7T A;  2RNB A;  2ZNJ A;  4LBE C;  3CME V;  1OHH G;  3CE2 A;  1I7F A;  2EJ7 A;  4OGQ B;  1OCZ C;  1M57 B;  3UQ8 A;  2UUB O;  4CC5 A;  5CB4 A;  3ABK C;  4OX9 O;  3AG3 B;  2DW4 A;  3CCJ V;  1JX9 A;  1KP3 A;  4LNU A;  5CMU A;  4E4E A;  3CC4 V;  2F66 C;  1TAE A;  3A0H Z;  4JZG A;  3JD2 A;  2ZIO A;  1YEW A;  1CPY A;  2BOC C;  3OTO B;  2DWE C;  4PA6 A;  3S3W A;  3ZRX A;  3ZHQ A;  5KX5 B;  4O4L B;  4AQY O;  4I55 B;  2X0L A;  1SQF A;  3UKM A;  3ZHR A;  2WLJ A;  3G6E V;  3I56 V;  3EFF K;  4WF9 V;  1K92 A;  4DV4 B;  1B3Q A;  4DW0 A;  2DOS A;  3CC7 V;  2F1M A;  5GTH Z;  2YXY A;  3E8H A;  2YEV B;  1VQN V;  1JR9 A;  2HLD G;  4JI8 B;  4JI7 O;  3IFX A;  5E1A C;  3J81 N;  2B5U A;  4GKJ O;  1IBM B;  2Q67 A;  4FZ0 A;  1BL8 A;  3R66 A;  3JAK A;  2WPD G;  5H6R A;  1X59 A;  4B3T O;  1SS3 A;  1YIJ V;  4KXR A;  4GKK O;  1Y4M A;  3H1K H;  2WLH A;  1SZX A;  2QWQ B;  1U97 A;  3DTU B;  4JI1 B;  1AP6 A;  2E75 B;  1BSM A;  3W7X A;  1KMI Z;  1DGS A;  5IYC O;  3ABM C;  2XAQ A;  3TXQ A;  3HB3 B;  4LH6 A;  3T1Y O;  3AG3 C;  2RN9 A;  1N36 O;  3ABK B;  1M56 B;  1XMO B;  1PKX A;  3B77 A;  4PEL A;  5KUK A;  4JI2 B;  1S0V A;  4FJC C;  4IHJ B;  4L87 A;  4FLT A;  5KUM A;  5B1A C;  1Q6I A;  1CP9 A;  3J7A U;  4P9P A;  4JI5 O;  3FX7 A;  1JCH A;  3C3S A;  3I5D A;  3BAA A;  4LWS B;  3N2G B;  1N34 O;  3MDS A;  3MHS C;  3QF7 A;  1SER A;  2EIN B;  3SYQ A;  4QE9 A;  1N0N A;  2ZDI A;  5B1B B;  2ARH A;  3SYC A;  1Q82 W;  2HKO A;  1TA8 A;  3EXA A;  1F7Y A;  1SF9 A;  2XOK G;  4DR5 O;  2KG7 A;  2IW5 A;  4H37 A;  3WU2 Z;  2X6C A;  1KYO F;  4CH3 A;  3UO2 A;  1K3E A;  2CTW A;  4P9O A;  5EYP A;  4LP8 A;  3IJ4 A;  4KUM A;  4F6E A;  3FAV B;  4J80 A;  3CRA A;  3EVK A;  1PNK A;  4J10 A;  4YHH O;  1IUR A;  4Z1M G;  4NXN O;  4X66 O;  1ORQ C;  4JYB A;  1CXZ B;  1NS1 A;  1QVG U;  1NH2 B;  1WPX A;  5B3S C;  1K97 A;  4FVM A;  3HPL C;  3RYC B;  1G8M A;  2WLI B;  5IE9 A;  2YIC A;  1S76 D;  3MHH C;  1N32 B;  2CH7 B;  4X65 O;  2ADP A;  3PJS K;  1BS3 A;  2EIN C;  1XNR O;  2E5L O;  1T5E A;  5DN6 G;  1O9H A;  3OT7 A;  5BZB A;  1NVP D;  1PNL A;  4K8X A;  1EN4 A;  4H33 A;  4J11 A;  1GM9 A;  4X1I A;  4YJ2 A;  4LF6 B;  3ZHU A;  4B7K A;  4UCR A;  4X66 B;  5LMN B;  1XBL A;  1ZTE A;  2JS3 A;  3CPW U;  1NR7 A;  4Q6G A;  3RW0 A;  4GKK B;  1N4C A;  4DR7 O;  2Q0O C;  3L9D A;  4TV8 B;  3JAM N;  4NTW A;  1XQ8 A;  3CSX A;  4PJ0 Z;  5JQG A;  2ITD C;  3SGI A;  2JIZ G;  3MAQ A;  1EBO A;  2A0L A;  4DR7 B;  5FNV A;  1J5E B;  3VQV A;  2JRI A;  4D7S A;  3LNN A;  2ZIN A;  4LNU B;  3BAB A;  4CH4 A;  4FM1 A;  3D36 A;  1JFF A;  3E22 A;  4MS2 A;  3FB7 C;  3GB7 C;  2LQT A;  2UXN A;  4NVP A;  2RCV A;  1XHX A;  2F43 G;  1HDJ A;  3OFN G;  4LFA O;  1CEZ A;  4U7O A;  5DEC A;  1EZJ A;  3OW2 U;  2H94 A;  2L35 A;  3LSS A;  1Q3E A;  2VQE B;  1GK9 A;  1PL4 A;  2LGQ A;  3K03 A;  2WLM A;  4O4H A;  1BT8 A;  4PDR A;  1AJP A;  4JI3 O;  4DUY O;  4U7N A;  5JJN B;  4DXW A;  1H8E G;  3TGU H;  3FFQ A;  3H1H H;  1H2K A;  1TUB A;  2PTM A;  4FLY A;  4UCV A;  4I55 A;  2QM4 A;  3G71 V;  2VRZ A;  3CP1 A;  3B8N A;  3CRR A;  3RYH A;  5CA0 B;  4B3R O;  3STZ C;  1SC5 B;  2OCH A;  3UCS C;  4R50 A;  3RVY A;  2B9Z A;  4O4I A;  4DO2 A;  3RYI A;  1JQ0 A;  4IHJ A;  1I08 A;  1H38 A;  4UXN A;  4JV5 O;  1L0N H;  3ZBH A;  2UUA B;  4AHC A;  5JJE B;  3W7U A;  1WB8 A;  1OCZ B;  2P7T C;  4ZIB A;  1VQ5 V;  3B4S A;  4LFC O;  1OZ0 A;  3F5T A;  2IU0 A;  3QNE A;  4JAV A;  4JYY A;  2KKW A;  1BMF G;  2IM9 A;  4RWU A;  4QIW F;  4O2A B;  1Q6H A;  1Q7Y W;  1ZWI C;  4TUY B;  3E86 A;  2PZS A;  1VQK V;  3JAK B;  2QKA A;  5J9P C;  2FTK A;  3JCU Z;  3JD4 A;  3CC2 V;  4YIP A;  2P6J A;  2P90 A;  1M4U A;  1G4Y B;  4FIP C;  2JJ1 G;  4ZHQ A;  4EB6 A;  2Q4P A;  1I94 O;  3GVM A;  1W59 A;  5L3G A;  3UO3 A;  1HP8 A;  4YJ3 B;  3A2F A;  3A0B Z;  5LHI A;  2QJ1 A;  3LDD A;  3STL C;  1J95 A;  4JI4 B;  5KA6 A;  2YUA A;  4LFB B;  5JWP A;  4ASU G;  3OM3 B;  3E22 B;  4DV2 B;  2P5O A;  2G38 A;  4MVR A;  1YJN V;  2Z5U A;  3VQX A;  5LHG A;  2XAJ A;  1Z5V A;  4B3S O;  4P2Z A;  2XT9 A;  1A32 A;  3D36 C;  2UXX A;  3ETQ A;  2GUZ B;  2GV9 A;  5IYD O;  3ASO C;  2FYU H;  3E83 A;  4FLV A;  1YXB A;  3JAW B;  2ZKO A;  2JGD A;  3VQW A;  2WAM A;  1ZX3 A;  2UUC O;  1V54 C;  4UB6 Z;  1BHB A;  1E79 G;  2P4K A;  1ARO P;  5EZY B;  2PF4 E;  2UUC B;  3CS5 A;  2NLJ C;  4UFZ A;  3ABU A;  1MZF A;  3HKC B;  3CEI A;  1NJI W;  4JI2 O;  2EZP A;  1WAZ A;  4RUF A;  5A2Q N;  1GMG A;  1KBH A;  1G1X B;  1XNR B;  2FB5 A;  1W0J G;  1YTF D;  1DF4 A;  2Z0A A;  1SQV H;  5J2T A;  1WNS A;  3M7M X;  2ZT9 B;  1XNQ B;  2Y4U A;  3CWB H;  2UXD O;  1S3J A;  3WB2 A;  2H8P C;  4OX9 B;  4JI3 B;  3ABL B;  4DV1 O;  2LFS A;  3JD3 A;  3FB5 C;  2PY5 A;  2OT5 A;  3VBB A;  1XUQ A;  5GON A;  4FLX A;  1OCR B;  2EIL C;  1SQQ H;  1L8D A;  2X6A A;  1BE3 H;  2HFE C;  4X64 B;  4TQF A;  3E8G A;  2CTR A;  4G28 B;  3U11 A;  1KKC A;  3FAV A;  1W2B U;  2YIB A;  3ABM B;  4JGS A;  3ZED A;  4X1K A;  4F6R B;  5KAI Z;  3ZX6 A;  3T1Y B;  4NXM B;  4WBN A;  4UCT A;  5D5P A;  3E89 A;  1RP3 B;  2D2C B;  1H2N A;  4JV5 B;  2ZR3 A;  1P7B A;  2JGU A;  2ODM A;  4GZR B;  3WG7 B;  3VOU A;  2OCC C;  1Y6X A;  5FL7 G;  2ZR2 A;  3RT3 C;  5L3C A;  2FKX A;  4L8J A;  4H0L B;  1IX9 A;  4GKJ B;  2EJR A;  3H9V A;  2ZQM A;  4TOI A;  1THZ A;  3D3I A;  2BCC H;  4I9W A;  4B3S B;  3JSN A;  2JEX A;  3CRC A;  3G80 A;  3QO8 A;  3P32 A;  1R6N A;  4H13 B;  1BQ0 A;  3AG1 B;  2IBZ H;  1MMM A;  4XDJ A;  1N33 O;  2CE4 A;  4X1Y A;  1NVP B;  1SQP H;  1XNQ O;  1JVM A;  4O4L A;  4WFH A;  4FFB A;  1V9P A;  3BVO A;  4DR6 O;  4HNA B;  4WFA V;  1PL0 A;  1NBM G;  2F23 A;  4UUJ C;  3ZIA G;  4CZZ A;  1GH6 A;  1P49 A;  2WLL A;  1JJ2 U;  2HP8 A;  2ZNI A;  1WPB A;  3SPJ A;  2QE7 G;  1HNZ O;  1M57 C;  1NTZ H;  3P3P A;  2HHH B;  1LNQ A;  3LDE A;  4FM2 A;  1Q43 A;  1YSC A;  3ASN B;  5EC1 C;  3SPG A;  1BGY H;  2LW1 A;  3Q4H B;  3T4Z A;  3JAL B;  4DW1 A;  1B6Q A;  4UCS A;  5BXZ A;  2E74 B;  2PI5 A;  2E3C A;  2LO1 A;  3SPH A;  4I5S A;  3APQ A;  2AZ2 A;  4P30 A;  2HVJ C;  1KC8 W;  1KKD A;  1YDX A;  5H9C A;  3APO A;  3ML0 A;  1EN6 A;  4DUZ B;  1MSW D;  3CRQ A;  1SET A;  4DV3 B;  2AZ0 A;  4LF5 O;  5IJ0 B;  5LGU A;  3SYP A;  5JVD A;  2DN9 A;  2Q7H A;  3OD4 A;  2GTS A;  3FD9 A;  4DV3 O;  1SKV A;  4JAS A;  1US6 A;  2R72 A;  3WB0 A;  2UU9 B;  1SQG A;  2OIG A;  1NTK H;  2IH1 C;  2VS0 A;  4EKW A;  2DJV A;  3JAR B;  4KL1 A;  3FYE B;  2RQ6 A;  1FKA O;  4CS3 A;  4JAU A;  2DYS C;  2IJI A;  2XAF A;  4NTX A;  1N32 O;  3X2Q B;  2LP7 A;  1NTM H;  3L70 H;  4DR2 O;  3ZCC A;  1M93 A;  3L71 H;  4DR1 B;  5CA1 B;  3LNM B;  5H5N A;  4I7Z B;  1HNX B;  3GWK C;  1VQ8 V;  3I55 V;  2LFR A;  2ZD9 A;  4YY3 O;  3DC5 A;  4HAM A;  3TJT A;  5IY5 C;  3W7T A;  3HKD A;  1IBK O;  5JQG B;  1HWY A;  4RAI A;  3ZRS A;  1Y67 A;  1FXK C;  4PA4 A;  2H3O A;  3K59 A;  1GN6 A;  1JPX A;  1TGO A;  3ZHT A;  1F23 A;  1X4T A;  3AK2 A;  4O2B B;  5JCO A;  4I50 A;  4F4L A;  1QBZ A;  4B3M O;  5CA3 A;  1VQP V;  1Y66 A;  3F7V C;  1K4D C;  1XL6 A;  3OE7 G;  2LW7 A;  1COW G;  1OCC C;  5TIS Z;  3SPI A;  3E8B A;  3W7W A;  2IJJ A;  1KQS U;  1GN3 A;  1I5X A;  4DR2 B;  1N36 B;  1SQB H;  2YDE A;  2QWO B;  4NYK A;  4DR6 B;  5AG2 A;  4QJF B;  3JCZ A;  4DV2 O;  2Y4T A;  1FXV A;  4ZOL B;  1H2S B;  1AJN A;  3FB6 C;  4J9Z B;  3L73 H;  1YI2 V;  4DV5 O;  3HKE B;  2CH7 A;  1OCO C;  4I4T A;  5LGT A;  2CDY A;  1EZV H;  2Z3Y A;  1K7D A;  1PD3 A;  1FJG O;  1R1B A;  4H44 B;  5GON B;  5IJ0 A;  2WLN A;  1QLE B;  1N0J A;  4DV7 O;  5CB4 B;  3CCE V;  5EYP B;  4GYC B;  1S77 D;  2LGW A;  3THO A;  1S5L Z;  3Q4H A;  2PYL A;  2UUB B;  3E35 A;  1IBK B;  1V55 C;  5LYJ A;  1FS0 G;  3IC7 A;  4GX5 A;  4X62 B;  3HKC A;  4JI7 B;  3L74 H;  4UCO A;  4XDL A;  1TVK B;  2BSK B;  2HG5 C;  1I0H A;  5J2U B;  4X64 O;  1J5E O;  3RBZ A;  3H1J H;  3ZS8 C;  1NKD A;  4GCZ A;  4LF7 B;  3AK1 A;  1ZUQ A;  1QLE C;  3ZHV A;  4O4J B;  3ZMV A;  1VQ9 V;  2JEU A;  1IXB A;  3BHP A;  2ZE8 A;  5IT9 N;  2Q68 A;  2VQF B;  2EIM B;  5LXT B;  3JAT A;  5DED A;  5K1P A;  1Q6U A;  3ZMU A;  2N05 A;  5CA1 A;  3ZJZ A;  3HKE A;  3KCX A;  3BEH A;  1MNG A;  1MZE A;  4YIO A;  1U96 A;  3LSQ A;  4GX1 A;  1IVS A;  1ZAU A;  1NR1 A;  2AGA A;  2QEX V;  2QM8 A;  4MVO A;  3AG4 C;  5JJJ B;  2E5L B;  1SZT A;  2EIK B;  2X6B A;  2DYR B;  1VEW A;  2OIE A;  5LGN A;  4LFA B;  5LP6 C;  3IGA C;  1L1F A;  5C8Y B;  5LP6 A;  2EX3 A;  1LR1 A;  2ZE6 A;  1SA0 B;  3SPC A;  2P22 C;  4DUZ O;  4DV1 B;  5CBF A;  5KMG A;  2EBO A;  1HR0 O;  2IU3 A;  2A9H A;  2K1E A;  4DR1 O;  1Z2G A;  2ZM6 O;  3QVN A;  5IY5 B;  1JMK C;  5LYJ B;  3NR7 A;  1PP9 H;  2HR3 A;  5HFM A;  3ZN1 A;  2L6L A;  1HNW O;  3G4S V;  1YIT V;  2QWP B;  5GW7 A;  4B7E A;  4HYO A;  2C2A A;  1GO3 F;  1Q8I A;  4LH7 A;  3C90 A;  3RGB A;  4LR3 A;  4IIJ B;  2V4D A;  1VQ7 V;  4DV0 O;  4MVZ A;  3JAR A;  5LOV B;  4FPP A;  1UPG A;  2QR4 A;  1K33 A;  3DXR B;  4OXS A;  4X9Q A;  5H6Q A;  5B1N A;  4LF6 O;  2YID A;  1WA8 B;  4YXW G;  3BFR A;  3MD0 A;  4LF8 B;  4JPR A;  2NN4 A;  3K0G A;  1NZ6 A;  2N74 A;  1WJZ A;  2Q0A A;  2GDS A;  1W0K G;  1DF5 A;  4GX2 A;  1MG1 A;  1WB7 A;  2ZE7 A;  5F2V O;  2AXT Z;  1PNM A;  4JTC B;  2Y69 C;  2WSS G;  3OTF A;  4HZ3 A;  3JAS B;  2B1G A;  3OAA G;  1BQZ A;  1BZK A;  5EIB C;  4DV5 B;  1KD1 W;  4KHP O;  5LBQ A;  4NR1 A;  4QPJ A;  1QNM A;  2JK5 C;  3K04 A;  4I0X A;  1XHZ A;  2IJK A;  3ZMZ A;  4X20 A;  2Q5Z A;  1RSO A;  3JAW A;  1IXM A;  3K06 A;  4CBC A;  2KSD A;  4PV1 B;  1VQM V;  1Y74 A;  4DR3 O;  4PDV A;  1FPO A;  1K8A W;  3AG2 B;  1H2M A;  1ZSP A;  1F51 A;  4GX0 A;  5D5Q A;  3JSL A;  4B3M B;  1JA8 A;  4TWK A;  2R9A A;  3F5W C;  3JD1 A;  1G6U A;  3T4D A;  1JJO A;  1WA8 A;  3M8A A;  4C7U A;  1UJW B;  2XAS A;  2BE3 A;  2IJH A;  2BTO A;  4TV8 A;  1GKF A;  1DTO A;  5LOV A;  2UUA O;  5BR8 B;  3O9O A;  4AQY B;  1XIL A;  1D2D A;  2CTP A;  4WFE A;  4U3J B;  2A3Q A;  3BCC H;  2EIJ C;  4LF4 O;  3ZRW B;  4X1I B;  2BTQ B;  1FXK A;  1ZL8 A;  5CBH A;  1AVM A;  4FLW A;  1D5A A;  3OUF A;  3ETD A;  2ZE5 A;  3CCR V;  4JYA O;  2ZXW C;  2OCC B;  4MSW C;  2P67 A;  3WG7 C;  3QO5 A;  3HKD B;  5LA6 B;  2UXD B;  4KFM A;  2HEP A;  1RM1 C;  3WFV A;  1AR4 A;  2F95 B;  3HR0 A;  2YI8 A;  4WCE V;  4O2A A;  5CN0 A;  1AB3 A;  2EIJ B;  4WBN B;  5L3E A;  2HVK C;  1IBM O;  2E76 B;  2WLI A;  2LJ2 A;  4X1K B;  4F6R A;  3SYO A;  4EFB A;  4DR5 B;  4JI8 O;  2ILM A;  1GTO A;  1LUV A;  4CS4 A;  5IYB O;  5EBW C;  3R65 A;  4FM0 A;  1PPJ H;  2QGN A;  5KAF Z;  1XEQ A;  1N34 B;  4QNH B;  3LUT B;  4WFF A;  4MTX A;  4PDL A;  4HNA A;  3AG7 A;  1AI5 A;  5CA0 A;  2JDI G;  3D3Q A;  2WA4 A;  2F4V O;  1OCO B;  4UV8 A;  1GN4 A;  2YSU B;  1HNZ B;  1I5Y A;  4FK5 C;  5IJ9 A;  3ABL C;  1K5S A;  3SJA C;  1HNX O;  3RYF B;  3N2K A;  4JI6 O;  4PHZ A;  4UCU A;  1FAF A;  4DV6 B;  4DV6 O;  1VMG A;  1UFI A;  5EBL C;  1F4M A;  4PDM A;  3ZMS A;  4LF4 B;  1FFX B;  4Q20 A;  4XBF A;  3CB2 A;  4NB5 A;  4J41 A;  4WFB V;  1VF6 C;  3T1H O;  1OCC B;  3U10 A;  3PN1 A;  5KMG B;  4K0K O;  2DQ0 A;  4B08 A;  3KKY A;  1N33 B;  2HJD A;  2GTA A;  3ABT A;  4J7Z A;  1XDC A;  2Y69 B;  3SJB C;  2VQF O;  1H8H G;  5EC2 C;  1I94 B;  3TET A;  3DC6 A;  5KHG A;  3D8C A;  4GUN A;  3N2K B;  3WB1 A;  1TUE B;  5IYZ B;  1NH2 D;  1XRE A;  3CCV V;  2A7W A;  1YCI A;  4MTO A;  1GM7 A;  2GUZ A;  3RFR A;  1FD9 A;  4LC1 A;  4DV0 B;  3ZMT A;  3TCU A;  3OGC C;  2D3O W;  2BTQ A;  3CD6 V;  3OR6 C;  4B3R B;  1SRY A;  2QTO A;  1K9M W;  1WP7 A;  2JS5 A;  4LFB O;  4IGG A;  4U3J A;  4PA9 A;  1XI1 A;  4FLU A;  2IH3 C;  3VQY A;  2HHH O;  3UT5 B;  5EIB D;  4BIO A;  2ADQ B;  4QE7 A;  3ZRV A;  5L3B A;  1F4N A;  2VWJ A;  1B06 A;  2RJZ A;  2AHY A;  4YJ3 A;  1H2G A;  1PV0 A;  1KUQ A;  1MSD A;  1QR9 A;  4DR4 O;  3CJH B;  2QWR B;  3RYH B;  2FML A;  2V1D A;  2Q69 A;  1Y74 B;  4CH6 A;  3U0Z A;  5E79 Z;  3K08 A;  1FXH A;  2BSK A;  3CCL V;  1ROP A;  4BWA A;  1FFT B;  3JAL A;  5FPO A;  3K79 A;  4I50 B;  1AR1 B;  4AI8 A;  5BY1 A;  3H01 A;  1VQ6 V;  5C8Y A;  2GHY A;  5LP6 B;  2BOB C;  1KU9 A;  1QHT A;  1WP8 A;  3ASN C;  2CK3 G;  3T1H B;  2EZO A;  3K5N A;  1FFX A;  4ZBM A;  2XTA A;  1AP5 A;  3AG4 B;  3UT5 A;  2WLL B;  1VQ4 V;  1AJQ A;  1SES A;  1MAB G;  2A06 H;  2Y0P A;  2ZCE A;  2Q9L A;  5B1O A;  2QM7 A;  1VIB A;  5B66 Z;  1IBL B;  4LCU C;  4WFG A;  2PGG A;  5KHK A;  3K0D A;  1YZB A;  3JAT B;  2EIM C;  3RN4 A;  4JYC A;  4NTY A;  1GAX A;  4JI1 O;  5HFL A;  5LHH A;  2JJ2 G;  4LFC B;  4ZOL A;  2MK3 A;  5JVD B;  1QCE A;  2DMX A;  2QDO A;  3DXR A;  1R3I C;  3FKS G;  4DK1 A;  2Q73 A;  4JI5 B;  4XDK A;  5KHI A;  1E1R G;  3JD0 A;  1VF6 A;  1XMQ B;  3F7Y C;  5BMV A;  5JH7 A;  4IT5 A;  1GRJ A;  2R9R B;  4K8Z A;  5LMN O;  4W4L A;  4DK0 A;  2Y0I A;  3E8F A;  3OMN B;  4PD4 F;  1AI4 A;  1ZLZ A;  2ITC C;  2XND G;  5B5E Z;  1RM1 B;  3KZI Z;  2ZXW B;  4U3F H;  2PYJ A;  3BY6 A;  2QKS A;  5IWA O;  4RO2 A;  3M99 B;  5IWA B;  3K5O A;  5L3F A;  3K5L A;  5LMU O;  1E1Q G;  5EBM C;  1LUW A;  4J42 A;  3CJH A;  3ZRW A;  2W6J G;  4OPA A;  2P06 A;  1DLB A;  4ZI7 A;  4MVM A;  2Q7G A;  3S3X A;  3CXH F;  1NU1 H;  1SQX H;  3SR2 C;  2Q7E A;  2ETN A;  1R3L C;  3T2M A;  2OTL V;  3CMA V;  4ZKI A;  5GTI Z;  5BR8 O;  4IIJ A;  4IL6 Z;  4BW9 A;  3B8M A;  4CH5 A;  2F4V B;  5FPR A;  2W0X A;  3AG2 C;  2EIL B;  4YJ2 B;  3A8T A;  4DV4 O;  3CHX A;  2R70 A;  1RPO A;  4FMT A;  4JI0 B;  4JYA B;  4MW8 A;  4AIL C;  4Z1V A;  4X65 B;  3H1I H;  3SYA A;  4O2B A;  1XOU A;  2ZIM A;  3L75 H;  1SA0 A;  4MW3 A;  4MVS A;  5KX5 A;  2O57 A;  2W0F C;  4EFE A;  5KHH A;  4JI4 O;  4UB8 Z;  3SJQ C;  4N21 A;  2K9P A;  2OTJ V;  4JZ2 A;  1OV9 A;  3AK3 A;  5BMV B;  1AR5 A;  2YS8 A;  4KHP B;  2Q6A A;  2CUG A;  5B3S B;  4DRX B;  2UXB B;  4PA7 A;  1HW7 A;  2WWW A;  4J7K A;  3X2Q C;  1K4C C;  1NI8 A;  3T1C A;  1P84 F;  2RMK B;  4IYI A;  1DK1 A;  1YHQ V;  2DYS B;  1YF2 A;  3O65 A;  4R8C A;  1WN7 A;  3ASO B;  5IJ9 B;  1GM8 A;  4EEQ A;  2YI9 A;  4E2L A;  4JF3 A;  3B09 A;  3B40 A;  4K35 A;  4RQF A;  4NKG B;  4FFK A;  1TUB B;  1K34 A;  1RSO B;  2P4V A;  3K58 A;  3GWO A;  4X89 A;  1VF5 B;  1O9G A;  4B3T B;  5B1B C;  1IZ3 A;  5L3D A;  3RVZ A;  4PI0 A;  4I0X B;  4K0K B;  3N2G A;  1K73 W;  1TVK A;  4HBN A;  4GLX A;  5KA5 A;  2CAZ C;  4BIU A;  1NT2 B;  5B1A B;  4CS2 A;  3FB8 C;  1XMO O;  4ZHQ B;  2NR5 A;  1URF A;  3RWR D;  3SJC C;  2AW9 A;  5FLX N;  1WLE A;  3IC9 A;  3DGE A;  1JFF B;  4MVU A;  1M56 C;  1S5J A;  4TUY A;  1D5N A;  1Q5O A;  2UXB O;  3HKB A;  1H2L A;  4J9Y B;  1MA1 A;  2JGD B;  3ETE A;  3BA9 A;  3EHB B;  4UVA A;  1AI6 A;  2PI4 A;  4LF5 B;  2DYR C;  1VQO V;  1IDS A;  2EIK C;  4A5U B;  2XUM A;  4X8A A;  4FFB B;  3CCU V;  1M90 W;  4JI0 O;  4MTF A;  4X1Y B;  1RFY A;  1Q90 D;  4ABM A;  3AG1 C;  1QU7 A;  2CGO A;  4BIZ A;  3CX5 F;  3JYC A;  2F93 B;  1R6T A;  4DR4 B;  3G67 A;  3OMA B;  1S72 V;  1PM9 A;  2HJF C;  4IYH A;  2W6I G;  3W7S A;  1KEC A;  3SDL A;  1KP2 A;  3K9S A;  1HR0 B;  4NXN B;  4FZ1 A;  2RDC A;  1ENV A;  5IYZ A;  4DV7 B;  5EK0 A;  1R3J C;  5J2T B;  2UXC O;  4J7J A;  1N8R W;  1IBL O;  5JCO C;  1R3K C;  2ZDI C;  2CTQ A;  2QA4 V;  2M7W A;  2YC0 A;  1GN2 A;  4TV9 B;  2VWK A;  3ZHS A;  1HNW B;  2YXH A;  4BAY A;  1Q81 W;  4N23 A;  2MW2 B;  4LWS A;  5IDJ A;  3RYC A;  1L0L H;  1YVW A;  2QKC A;  2YIA A;  3UM7 A;  2V7Q G;  4R7C A;  2QSA A;  2UXC B;  1V55 B;  3B2E E;  2FL4 A;  4X62 O;  4LF9 B;  5LMU B;  1QQC A;  2CGN A;  3NXS A;  2XAG A;  4PI2 A;  4UVB A;  4MTG A;  3RYF A;  3LDC A;  4Z2W A;  1B04 A;  3KCY A;  1MOF A;  3QO7 A;  4MT8 A;  3AEI A;  3IAY A;  3K5M A;  1VAR A;  3BA8 A;  4JTD B;  2VQE O;  4LF9 O;  1K5Q A;  1JOY A;  1XL4 A;  5ITZ A;  2Q8V A;  2EUL A;  1M1K W;  1OCR C;  4DRX A;  4MVQ A;  2XHB A;  5FNV B;  1YTF B;  2YXL A;  4LF7 O;  1QR8 A;  3DSQ A;  3QTC A;  3FYI B;  3P30 A;  2OYQ A;  3K57 A;  1VP7 A;  1YJW V;  3OR7 C;  2PUS A;  2XAH A;  4TV9 A;  5J2U A;  1EM1 A;  1Y76 B;  4ICG A;  4YHH B;  1R73 A;  4W4K A;  4FLZ A;  2KQX A;  2GBO A;  1M9N A;  5KHJ A;  3OEH G;  1FYJ A;  3A0R A;  1BCC H;  4I9Q A;  4OPH A;  4EB6 B;  2M6Y A;  3K3W A;  4O4H B;  3OMI B;  3OGI B;  3KG2 A;  4JTA B;  3G6B A;  4CC6 A;  4G2K A;  2Y48 A;  3BRC A;  2ATK C;  3E2E A;  3OEE G;  4QGP A;  2QTS A;  2X7R B;  2GSM B;  5LA6 A;  3H1L H;  5A9G A;  5EZY A;  1R6K A;  2DE0 X;  4TT3 G;  5CBG A;  2R9I A;  1Q86 W;  1V54 B;  5LL6 Y;  1NQT A;  3TK1 A;  1M5I A;  1Y76 A;  2UU9 O;  1FXK B;  1ZL8 B;  3ETG A;  5C93 A;  1VQL V;  4DUY B;  4LF8 O;  2DQ3 A;  1P7G A;  2YIB D;  3K9A A;  4RUE A;  1P4R A;  4QPK A;  4UVC A;  2B1I A;  4I4T B;  4RQE A;  3TXS A;  2WA3 A;  4ZI7 B;  3CCQ V;  1Z5W A;  2KB1 A;  3BPZ A;  3QG5 A;  1RPR A;  5ITZ B;  4YY3 B;  2WLK A;  3N27 A;  3LSU A;  3RYI B;  1AI7 A;  1XMQ O;  1S5H C;  3C3T A;  4O4I B;  4TQD A;  4X88 A;  2JVD A;  3HKB B;  4R6Z A;  4D6T H;  5H2F Z;  1QVF U;  2OWO A;  4KP4 A;  2YEV A;  4GT1 A;  4DYL A;  1EN5 A;  3OTO O;  3P3N A;  5KLV H;  1KB9 F;  1FJG B;  3CRM A;  4BW5 A;  3CYO A;  4JI6 B;  2N04 A;  5LXT A;  2KG7 B;  4UV9 A;  2NNU A;  1EFR G;  3CCS V;  2AHZ A;  4BR6 A;  2DWD C;  4TSF G;  2A79 B;  4X20 B;  1AIL A;  5JH7 B;  4G27 B;  1YJ9 V;  4O4J A;  4NXM O;  4JAA A;  3J80 N; 
#chains in the Genus database with same CATH homology
 5JVD B;  1VF7 A;  4LFB B;  1ZAU A;  3E22 B;  4DV2 B;  2P5O A;  3VQX A;  4DK1 A;  5JJJ B;  4JI5 B;  2E5L B;  5KHI A;  1Z5V A;  5K1X A;  4DR3 B;  1XMQ B;  2ZM6 B;  5BMV A;  5JH7 A;  3ICX A;  3JAS A;  4D7T A;  4K8Z A;  4LFA B;  2ZNJ A;  4DK0 A;  3ETQ A;  5LP6 C;  1I7F A;  2GV9 A;  5C8Y B;  5LP6 A;  2EX3 A;  3UQ8 A;  4FLV A;  3JAW B;  1SA0 B;  4CC5 A;  3VQW A;  5CB4 A;  2P22 C;  2PYJ A;  4DV1 B;  5KMG A;  4LNU A;  5IWA B;  3K5O A;  2F66 C;  3K5L A;  5EZY B;  2UUC B;  1TAE A;  4UFZ A;  3HKC B;  2ZIO A;  1YEW A;  1JMK C;  5LYJ B;  4ZI7 A;  3OTO B;  2Q7G A;  1XNR B;  1Q8I A;  5KX5 B;  4O4L B;  4LH7 A;  4I55 B;  3RGB A;  4LR3 A;  3SR2 C;  2Q7E A;  4IIJ B;  2V4D A;  5J2T A;  1SQF A;  1WNS A;  3JAR A;  3M7M X;  5LOV B;  1XNQ B;  4IIJ A;  3WB2 A;  4BW9 A;  4OX9 B;  4JI3 B;  4CH5 A;  2F4V B;  5FPR A;  4DV4 B;  2F1M A;  2PY5 A;  4YJ2 B;  4LF8 B;  5GON A;  4FLX A;  3CHX A;  2R70 A;  2Q0A A;  1L8D A;  4JI8 B;  4JI0 B;  4JYA B;  4X64 B;  4TQF A;  3U11 A;  4AIL C;  4X65 B;  1IBM B;  2YIB A;  4O2B A;  3ZED A;  2ZIM A;  1SA0 A;  5KX5 A;  4X1K A;  4F6R B;  3JAK A;  4EFE A;  5KHH A;  3OTF A;  3T1Y B;  4NXM B;  4WBN A;  4UCT A;  3JAS B;  5D5P A;  5BMV B;  5EIB C;  4KHP B;  4DRX B;  4JI1 B;  2UXB B;  4JV5 B;  4DV5 B;  1HW7 A;  1KMI Z;  1DGS A;  2JGU A;  1XHZ A;  4LH6 A;  4X20 A;  1XMO B;  1RSO A;  4L8J A;  4JI2 B;  3JAW A;  1WN7 A;  4GKJ B;  5IJ9 B;  4IHJ B;  4EEQ A;  2YI9 A;  4TOI A;  4FLT A;  4B3S B;  3JSN A;  1TUB B;  5D5Q A;  3BAA A;  3JSL A;  4B3M B;  3K58 A;  2R9A A;  1O9G A;  4B3T B;  3N2G B;  1G6U A;  1JJO A;  4PI0 A;  3QF7 A;  4K0K B;  3N2G A;  2BTO A;  4TV8 A;  4X1Y A;  1TVK A;  4HBN A;  5LOV A;  4GLX A;  2CAZ C;  5BR8 B;  4O4L A;  1TA8 A;  4AQY B;  4FFB A;  1NT2 B;  1V9P A;  4U3J B;  4CS2 A;  4CH3 A;  4HNA B;  4ZHQ B;  4X1I B;  2BTQ B;  3RWR D;  4FLW A;  5EYP A;  1D5A A;  3SJC C;  1JFF B;  1S5J A;  1P49 A;  4TUY A;  2ZNI A;  1Q5O A;  1WPB A;  3HKB A;  3HKD B;  5LA6 B;  2UXD B;  2HEP A;  2F95 B;  2YI8 A;  4O2A A;  2HHH B;  4FM2 A;  1Q43 A;  3BA9 A;  4FVM A;  4WBN B;  3RYC B;  4LF5 B;  1N32 B;  4X1K B;  4F6R A;  4FFB B;  3JAL B;  4EFB A;  4DR5 B;  4UCS A;  2E3C A;  4X1Y B;  4CS4 A;  4FM0 A;  4DUZ B;  1T5E A;  4DV3 B;  1O9H A;  2F93 B;  5IJ0 B;  4DR4 B;  1N34 B;  5JVD A;  4K8X A;  2Q7H A;  4HNA A;  5CA0 A;  4X1I A;  4YJ2 A;  4LF6 B;  1SKV A;  2R72 A;  3WB0 A;  2UU9 B;  4UCR A;  1HR0 B;  4X66 B;  5LMN B;  1SQG A;  1HNZ B;  4NXN B;  5IJ9 A;  5IYZ A;  4DV7 B;  5J2T B;  4Q6G A;  3SJA C;  4GKK B;  3JAR B;  4KL1 A;  3RYF B;  5JCO C;  2RQ6 A;  4CS3 A;  3N2K A;  4PHZ A;  4TV8 B;  4UCU A;  4TV9 B;  2VWK A;  4DV6 B;  1XQ8 A;  3CSX A;  5JQG A;  1HNW B;  3SGI A;  3MAQ A;  4DR7 B;  5FNV A;  1M93 A;  4LF4 B;  1J5E B;  3RYC A;  1FFX B;  3VQV A;  2YIA A;  4DR1 B;  5CA1 B;  3CB2 A;  1HNX B;  4D7S A;  2UXC B;  3B2E E;  3LNN A;  4LF9 B;  2ZIN A;  1QQC A;  4LNU B;  5LMU B;  3U10 A;  3PN1 A;  5KMG B;  3BAB A;  3HKD A;  4B08 A;  1N33 B;  4CH4 A;  5JQG B;  4FM1 A;  4PI2 A;  3SJB C;  1JFF A;  3E22 A;  1I94 B;  3K59 A;  3RYF A;  5KHG A;  1TGO A;  1B04 A;  1X4T A;  4NVP A;  4O2B B;  1XHX A;  5JCO A;  4I50 A;  3N2K B;  3WB1 A;  3IAY A;  5IYZ B;  3K5M A;  3BA8 A;  3RFR A;  4DV0 B;  1Q3E A;  5ITZ A;  2VQE B;  4DRX A;  2BTQ A;  4B3R B;  2XHB A;  5FNV B;  4DR2 B;  1N36 B;  2YXL A;  4DR6 B;  2JS5 A;  3DSQ A;  3QTC A;  4U3J A;  4O4H A;  2OYQ A;  3K57 A;  4ZOL B;  1XI1 A;  4FLU A;  1H2S B;  2PUS A;  4TV9 A;  3VQY A;  5J2U A;  3UT5 B;  5JJN B;  4YHH B;  5EIB D;  4FLZ A;  3FFQ A;  3HKE B;  1TUB A;  2PTM A;  4FLY A;  4UCV A;  5KHJ A;  4I55 A;  2VWJ A;  2RJZ A;  4YJ3 A;  2QM4 A;  4I4T A;  4I9Q A;  4EB6 B;  4O4H B;  3RYH A;  4CC6 A;  5CA0 B;  3BRC A;  3RYH B;  5GON B;  5IJ0 A;  5LA6 A;  4CH6 A;  3U0Z A;  4O4I A;  5EZY A;  3RYI A;  4IHJ A;  5CB4 B;  4BWA A;  1M5I A;  3JAL A;  5EYP B;  4GYC B;  2UUA B;  4AHC A;  5FPO A;  5JJE B;  3THO A;  4DUY B;  4I50 B;  2PYL A;  4ZIB A;  2YIB D;  5C8Y A;  5LP6 B;  2UUB B;  1IBK B;  1KU9 A;  2KKW A;  4I4T B;  5LYJ A;  1QHT A;  4ZI7 B;  1Z5W A;  3BPZ A;  2IM9 A;  3QG5 A;  4O2A B;  5ITZ B;  4YY3 B;  4X62 B;  3T1H B;  3HKC A;  3K5N A;  1FFX A;  4JI7 B;  4UCO A;  1TVK B;  3RYI B;  3UT5 A;  4TUY B;  5J2U B;  4O4I B;  4TQD A;  2PZS A;  2JVD A;  3JAK B;  3HKB B;  3ZS8 C;  2OWO A;  4LF7 B;  2ZCE A;  1M4U A;  4O4J B;  4ZHQ A;  1IBL B;  1FJG B;  3BHP A;  4EB6 A;  4JI6 B;  2VQF B;  2PGG A;  5LXT A;  5KHK A;  3JAT B;  5LXT B;  3JAT A;  4YJ3 B;  5K1P A;  3A2F A;  5CA1 A;  3HKE A;  4X20 B;  2QJ1 A;  5JH7 B;  4O4J A;  4JI4 B;  4LFC B;  4ZOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...