1M5IA

Crystal structure of the coiled coil region 129-250 of the tumor suppressor gene product apc
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
110
structure length
105
Chain Sequence
STGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords APC protein
publication title The coiled coil region (amino acids 129-250) of the tumor suppressor protein adenomatous polyposis coli (APC). Its structure and its interaction with chromosome maintenance region 1 (Crm-1).
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 105
sequence length 110
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11414 Suppressor_APC Adenomatous polyposis coli tumour suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1m5iA00
2R9AA 1KU9A 2QM4A 1M5IA 3SR2C 3RWRD
chains in the Genus database with same CATH superfamily
1URFA 3AG2B 3H01A 5GTHZ 1PNMA 4LR3A 1VF6A 3HKBB 3K5OA 1R3IC 2DN9A 2RN9A 5J2TB 2UUBB 2IJHA 3BAAA 3CCSV 4X62O 5L3BA 1BQ0A 4FLYA 1MABG 1AR4A 3H1IH 1WAZA 2R9RB 3IGAC 4MTFA 2JS5A 3DC5A 4DRXB 3L74H 5KHIA 2B1GA 3ABUA 3AG1C 1EM1A 4CH5A 4X66O 1Q6UA 3JAKA 3BABA 2JS3A 4YJ2A 4AQYB 2E3CA 4Z1VA 5JWPA 3RVZA 1BT8A 1L0LH 4DR6B 2PY5A 1BGYH 1QCEA 2RDCA 3CWBH 1Y66A 2HKOA 5EC2C 2LP7A 5LHGA 1IBLO 4KL1A 2CE4A 4X65O 3D3QA 4QJFB 3P32A 1R6NA 1VF6C 2F95B 4JI3O 3ABMC 1K9MW 2QE7G 4AHCA 4X1KB 3K0DA 4GKJO 4EFBA 1V54B 1WLEA 3CEIA 1WP7A 2HEPA 4DV3O 3K5NA 3ZHRA 2XAFA 3E89A 2DOSA 2WLLB 1EFRG 5CA3A 3RYIA 2CTWA 2Z0AA 2NR5A 4JASA 3O9OA 1ROPA 3STLC 3LDCA 1A32A 1N36B 2P06A 1RP3B 1JJ2U 1PL0A 4JI5B 1BQZA 2Q7EA 4FVMA 2QWQB 4QE9A 4DV6B 5D5QA 4BIZA 4P9PA 1Q3EA 3H1JH 2PI4A 1H2MA 2QWOB 3UM7A 3RYHB 4JI2O 2YC0A 1HNXB 3P3NA 3SJQC 1YI2V 4OPAA 3CMEV 1DTOA 1K5QA 1P4RA 1NJIW 2WSSG 3RVYA 1AI6A 1H2KA 3A2FA 4X1IB 3SPGA 2BSKB 1NS1A 5ITZB 1NTKH 3HKEA 1VQOV 1Y74A 1TGOA 2AHYA 3OEEG 1JQ0A 2ZE7A 4OXSA 2E75B 4K0KB 4X20A 5LA6A 1ZX3A 2NN4A 4PA9A 1KD1W 4LBEC 4FFBB 4LFAB 1YITV 1HDJA 4U7OA 3CC7V 4CBCA 2YIAA 2DQ3A 3LDEA 2UUAB 3VQXA 4RQEA 2EBOA 1MZEA 2PYJA 4O2BA 4DR6O 4FIPC 2JGUA 1UJWB 3T4DA 5BY1A 2VWJA 2UUCB 1V55B 2HR3A 3A8TA 3AG7A 1EN5A 3ASOB 3JD4A 4IIJB 1HW7A 4DV2B 4Z1MG 4WBNA 5CA0A 4B3MB 3QVNA 2OWOA 2HG5C 1KC8W 1M56C 4Q6GA 1JJOA 3W7XA 1AP5A 4F6RB 5A2QN 4MVOA 1L1FA 2FB5A 5JVDA 1YIJV 4DR4O 2QWNB 4I9QA 3D36C 4DR5B 4K3AA 3OUSA 1N36O 4TV9A 3ZMZA 4MTOA 4JI5O 3AG3C 1Z5VA 1TAEA 3LNNA 2YIBA 2ZDIA 3M7MX 2Y69C 5TISZ 1VQKV 3RGBA 3N2KB 2PZSA 1MSDA 3X2QB 1YJNV 3TETA 2PUSA 2QWRB 4MVMA 3VOUA 2QKAA 4JAVA 4NXNB 4NTYA 2VRZA 3W7SA 4PDMA 2B1IA 2MK3A 2Q0AA 4G2KA 4YJ2B 2ZXWB 4AILC 1HNZO 3B40A 4IGGA 4U3FH 5BMVA 4FPPA 2RCVA 4UCOA 4MVSA 1RFYA 1H2NA 3IFXA 3SPJA 3ZBHA 4K0KO 4O4HA 2MW2B 3DSQA 2HP8A 4B3TO 1QHTA 4LFAO 4CH3A 2JEXA 2UUAO 1I0HA 2WLHA 2YIBD 1RSOA 3OM3B 1OCOC 2VS0A 2ZDIC 4DUYO 4GX5A 2UUCO 1XL6A 4HBNA 2IW5A 3CPWU 4FLXA 1X4TA 4DV1B 3LNMB 1XI1A 5EIBD 2UXBB 2QGNA 2QR4A 4DV2O 3JARB 1SS3A 5L3GA 1N4CA 4YIOA 1DK1A 2A3QA 1J5EO 1EN4A 2P6JA 1LNQA 4L87A 2D3OW 4B7EA 2GSMB 5IT9N 3MAQA 5LHIA 5BZBA 4GYCB 3MHSC 3G6BA 1GK9A 3ICXA 3CX5F 1D2DA 1Q82W 1DF5A 1NH2D 2EINB 1GMGA 4XDJA 1VQ8V 3G80A 2V7QG 1GN6A 1R6KA 1W0KG 3JD0A 3BPZA 5IYBO 2XUMA 1KBHA 4LCUC 3SPHA 3DC6A 1Y74B 1P7GA 3B2EE 1VEWA 4XBFA 2F4VB 4X20B 5LA6B 4DK0A 1T5EA 2N05A 3QF7A 4NXNO 3KG2A 3QTCA 4JYYA 3L71H 4R50A 2X6CA 5LL6Y 2DQ0A 3E86A 1UPGA 3ZRVA 3N27A 1XBLA 1KP2A 1ZSPA 2YDEA 3TCUA 4IHJA 4FM0A 4O2BB 2ZNIA 2DWEC 2GTAA 4JI6O 4JF3A 5B1BC 1SKVA 1SC5B 4J10A 1MSWD 1Z5WA 1EZVH 2EILB 1B3QA 4HZ3A 2F93B 1TUBA 3FX7A 4HNAA 3AK3A 1QLEB 4DUZB 4WBNB 4RWUA 3L70H 3IC9A 1FKAO 3CCLV 1TA8A 3KKYA 1HR0B 4ZOLA 3CRQA 1U97A 1B6QA 5C93A 4X88A 2EX3A 4I0XA 1VARA 3C3TA 1HNWB 1BL8A 4DV1O 5JVDB 1AI4A 2UXBO 3B8NA 4JI8B 3LSQA 2YI8A 4ICGA 5LOVA 1XNQB 3ZX6A 1GN4A 3RYCA 1M57B 3T4ZA 2Z3YA 1IBKO 2YICA 1NKDA 2Q69A 1TUEB 1MNGA 2JEUA 1AVMA 4D6TH 1XMOO 1GO3F 1VQ7V 4L8JA 2ZR3A 2UXDB 1SQBH 4PDRA 3HKDA 3BHPA 4I4TB 1XUQA 4WFHA 4R6ZA 2LO1A 3OAAG 4J41A 2G38A 1N33O 2JIZG 3R65A 3RYHA 1F4MA 2Q68A 3ZMTA 3CB2A 1R1BA 2CGOA 2ZR2A 5BMVB 4ZI7A 1L8DA 3TK1A 2F23A 4BWAA 1AILA 3E22A 4DW0A 2X6BA 2ZM6B 1V54C 1W0JG 4JV5O 3K03A 4TQDA 1JX9A 4LC1A 3FAVA 4O4HB 5KAIZ 3WG7B 2BE3A 3G67A 4X64B 5EBWC 5LMUO 2JDIG 1NVPD 4PA3A 1MMMA 1NH2B 1XEQA 2JJ1G 2AW9A 1RSOB 4DV5B 4MVQA 1CPYA 2N74A 4O4LA 1WP8A 3G6EV 2M7WA 1I94B 5GONA 4IYHA 2ADQB 1YF2A 2ZE6A 1AJQA 3F5WC 4YIPA 1AJPA 3E8FA 5JJEB 3K79A 3WFVA 4DUZO 3BA9A 2K1EA 4C7UA 1SQXH 3OR7C 3K0GA 2CTQA 2EZOA 3CRRA 3SJBC 1S5LZ 4W4LA 3UO2A 4BIUA 3U11A 2W6IG 4I55B 2LFSA 4BIOA 4B3RO 4TUYA 4JI8O 1ZWIC 2XAJA 1XNQO 3TGUH 4KXRA 1FD9A 3ZN1A 1QR8A 4GUNA 4HAMA 1YJ9V 4K8ZA 1IZ3A 5LGUA 2JGDA 4FLUA 4B7KA 3U0ZA 5B1NA 3J80N 2AXTZ 4X8AA 2CH7A 3LDDA 4NTWA 2ILMA 2CK3G 2P4VA 2UXDO 5CBHA 4GLXA 1O9GA 4IT5A 4U7NA 3FYIB 2XTAA 4EKWA 2BOCC 2FKXA 2Q67A 4J11A 5EK0A 1V55C 4XDKA 3N2KA 1B06A 1H38A 1I5XA 3ABKB 1QQCA 4I50A 3ASOC 3E35A 3O65A 5B5EZ 1SZXA 2WA4A 4IHJB 5LMNB 2ZM6O 2X0LA 3UCSC 4UV8A 3CCUV 4NXMB 4X64O 3BRCA 3J81N 1TUBB 4QPJA 4HNAB 1N34B 4MW8A 3U10A 3CC2V 4WF9V 4JI1B 4DV5O 4DV0B 4ZOLB 4LF7O 4K8XA 2OYQA 1I94O 2Y48A 3EFFK 5DM6V 4UCSA 2BCCH 3UO3A 4I0XB 3JALA 1VQ4V 2LW7A 4FZ0A 3E8BA 3GWKC 3A0RA 4I7ZB 5LOVB 1FS0G 3X2QC 1YDXA 4TWKA 3CCVV 4QGPA 1M90W 2WA3A 2DWDC 3W7UA 1CP9A 2ZT9B 3RYCB 1NVPB 2WPDG 3JARA 3JD1A 4JYCA 4X9QA 1GTOA 1DF4A 2ZXWC 3S3WA 3SYQA 3HKDB 2LGWA 4O2AA 1G8MA 1Y76A 1XILA 3E83A 3H1LH 2VQEB 4W4KA 1G1XB 2PGGA 2GHYA 3PJSK 1FJGB 1GN3A 3ZJZA 5B1OA 1AB3A 1R6TA 1FXKB 4G28B 2NLJC 1BS3A 3T1CA 4ZI7B 3TXSA 4B08A 3E22B 2CTRA 3QNEA 2UUBO 3A0HZ 1EN6A 2B9ZA 5CMUA 1B04A 3Q4HB 2WAMA 2Q4PA 3FAVB 3ZRXA 1D5AA 3RYFA 2GBOA 1H8HG 1YSCA 4DV7B 2XAGA 3N2GB 3ZRSA 4LFBB 1IVSA 3MDSA 5LMNO 4GX0A 4O4LB 1R3JC 3L72H 4AQYO 3J7AU 5GONB 2F1MA 3D3IA 1AR5A 3K58A 5L3FA 3OE7G 1M1KW 3CD6V 2EULA 3AK2A 1NR1A 4F4LA 4LFCB 3JAMN 4KP4A 2L6LA 2EINC 4JI1O 2ATKC 4J9ZB 4PDLA 4D7TA 1R3KC 4X1YB 1PNKA 3M8AA 1VQ9V 4B3SB 1KB9F 4DV0O 3OT7A 2UU9B 1VQMV 1PV0A 3HR0A 4LWSA 3ZS8C 2WLKA 1AR1B 3MHHC 2X7RB 2QM4A 3CCRV 1I7FA 5HFMA 3CXHF 5EYPA 4MSWC 3RW0A 3K9AA 4TUYB 4UVBA 3K9SA 3CE2A 2HHHB 1NI8A 4UXNA 2KSDA 5KUKA 1BHAA 2JGDB 5KA5A 3OGIB 5KAFZ 1VIBA 1SF9A 3DTUB 2H8PC 5EBMC 2CH7B 2Q7GA 2DMXA 3IJ4A 4CS2A 2A06H 5FLXN 2JVDA 4DV6O 1OCCB 1PD3A 2B5UA 4QNHB 5KLVH 2YXHA 4MS2A 2VQEO 3EHBB 1P84F 1Q8IA 3SPIA 4DR7B 1PP9H 5LYJA 2EILC 4I4TA 3SGIA 1FJGO 4DYLA 4I50B 1YZBA 3ABLB 1XDCA 1WB8A 1MA1A 1KP3A 2LW1A 5KUMA 4H44B 1HNXO 1FXHA 1QLEC 1SA0A 3JD2A 2WLIA 3FKSG 4NKGB 5IDJA 3B09A 1ENVA 2RNBA 3I55V 4EFEA 2ZKOA 2IU3A 2QEXV 1NR7A 2CUGA 4P9OA 1BZKA 2E74B 1K4DC 4DV7O 2DYSB 5DN6G 5FPOA 3FB8C 3OGCC 4QE7A 3G4SV 3ZHVA 2JK5C 5D5PA 2GUZA 4PDVA 5KMGA 4LFBO 1DLBA 3UKMA 2CAZC 2QKCA 1CEZA 4RO2A 1KMIZ 5BR8B 2GTSA 1FAFA 2EIMB 4BAYA 1M57C 3F5TA 4O4JA 1BSMA 3JALB 5FL7G 4KUMA 5L3CA 4I5SA 3CSXA 3AG4B 4LFCO 2XNDG 2XHBA 1GAXA 5JJNB 5CB4B 4J7KA 5AG2A 4YJ3B 1Q81W 4B3SO 2UU9O 3G71V 2CDYA 5EIBC 5IE9A 4B3MO 3APOA 5CA1A 4GKKB 2NNUA 3SJCC 4WFBV 2BTQA 4O2AB 3I56V 1Y76B 2DE0X 1AP6A 3W7WA 3WG7C 4J9YB 3E8GA 4I55A 1S5JA 1PNLA 3CRCA 4GX1A 3TJTA 3K59A 3QO8A 4DR5O 4DR1B 3STZC 2EIKB 2XOKG 3E8HA 4N23A 1IXMA 3JCZA 2Q5ZA 3CXCU 1GRJA 1VQ5V 2UXNA 2FTKA 2F43G 4JAUA 3BFRA 3T1HB 4DR7O 3RYFB 4ZBMA 3GVMA 1BCCH 5J9PC 1OZ0A 2KQXA 1XOUA 1M9NA 1G4YB 3OTOB 1V9PA 5GTIZ 4G27B 4YHHB 2OTLV 2C2AA 4J7ZA 3OFNG 2LJ2A 4FLTA 3SYOA 4E4EA 1PPJH 5EZYB 4EEQA 3CC4V 3CJHA 1OJHA 3JAWB 5F2VO 2Q9LA 4RQFA 4P2ZA 2ODMA 1WB7A 2P90A 2ETNA 3CCEV 2A0LA 4LWSB 1WPBA 1XL4A 1K92A 4EB6A 4KHPB 1LUVA 1S5HC 1JFFA 2V4DA 3E2EA 1NU1H 4GCZA 5EYPB 4CH6A 1VMGA 4CC5A 3ZRWA 1VQLV 1W59A 2HVKC 1YHQV 4J42A 3JCUZ 4LH7A 2HVJC 1NBMG 2HLDG 4XDLA 5H2FZ 2K9PA 1OHHG 1Q6IA 1MZFA 3BVOA 3ABKC 4HYOA 2OIEA 1QLNA 3JSLA 3CCQV 3H1HH 1UFIA 1NTZH 4GKKO 2E76B 1RM1B 1K4CC 2YSUB 4CH4A 3OMAB 2XAHA 3T1YB 2WLNA 3ETDA 1WN7A 5LYJB 1Y67A 2XT9A 3H9VA 2QA4V 4PA7A 2Y4UA 4CS3A 1O9HA 2QKSA 1OCZB 1BE3H 5K1PA 5LGNA 4DR1O 4R7CA 1SA0B 2ZD9A 1COWG 4DV4B 2QM7A 4DXWA 5IY5B 2WLIB 2ADPA 2XASA 3CRMA 4JYAB 3VQWA 1FXKA 4O4IB 4LF4B 3FB5C 2RMKB 3I5DA 3T1HO 4IL6Z 1W2BU 4LF5B 3MD0A 3PN1A 2QJ1A 3CCJV 4PJ0Z 3Q4HA 2F4VO 1EBOA 2GUZB 5KMGB 3A0BZ 2CGNA 3OTOO 2GDSA 3GB7C 4YHHO 3SPCA 4LF6B 2QDOA 1SQFA 4PHZA 3K08A 3QG5A 3N2GA 4LP8A 2A9HA 3K04A 4BW9A 4O4JB 5BXZA 1QVGU 4TQFA 1M4UA 1Z2GA 2EJRA 2YS8A 1KKDA 1GKFA 1XHXA 1NTMH 2ITDC 2JRIA 4IYIA 2ZIOA 3OMIB 2KB1A 1WA8A 4FFKA 4PELA 1IBLB 1H2GA 1KECA 4KHPO 1CXZB 4UV9A 4JI3B 1FXKC 4X1YA 3LUTB 4PI0A 4RAIA 2FYUH 1HR0O 4QIWF 1GM9A 5CA1B 3K3WA 3AEIA 2R70A 4DW1A 5B66Z 3CCMV 2BTQB 2Q7HA 2V1DA 2YEVB 1S0VA 2PYLA 2H3OA 3K06A 4NYKA 3H1KH 5K1XA 1XREA 4KFMA 4FLZA 1RPRA 1HNWO 3OR6C 2R72A 4ASUG 3ZMVA 3C90A 3D8CA 2EJ7A 4JI0B 4F6EA 1N8RW 3L73H 2Q0OC 2X6AA 2VQFB 2EIJB 4TT3G 4JAAA 2OCCB 1FYJA 4DO2A 4H0LB 3WB1A 1M5IA 3T1YO 2PF4E 1JVMA 3CRAA 1HP8A 3VQYA 2P5OA 2DW4A 3NR7A 3TXQA 1IX9A 2IH1C 4NR1A 3K5LA 3ZIAG 2ZCEA 1IDSA 1K8AW 5IJ0A 2ZE5A 4U3JA 1KKCA 1F23A 4JYAO 5FNVA 1GM8A 4LF4O 3CJHB 3JATB 4JI4B 3VBBA 4LF5O 5IYZA 3SYPA 1JPXA 4PI2A 3B8MA 4JPRA 3CHXA 1QNMA 1K5SA 2EZPA 4LF6O 3K5MA 4EB6B 1IXBA 5B3SB 1JFFB 3F7VC 3OEHG 1SETA 4MVUA 4OX9B 3C3SA 4ZKIA 3ZRWB 2KKWA 3OTFA 2LGQA 4H33A 1OCCC 4BW5A 5B1AB 1S76D 1XMQB 4MW3A 4MTXA 3JD3A 1FFTB 3AK1A 5J2UA 1M93A 1SZTA 2ARHA 3ABLC 4JZGA 1K97A 3L75H 3S3XA 4LF9B 5CB4A 2WLMA 4YJ3A 4FLWA 2YXYA 4WFEA 2R9AA 3IAYA 1ZTEA 1QVFU 4ZHQA 1NT2B 4N21A 4PA6A 3FFQA 1JCHA 2Q6AA 3K57A 3APQA 2Y0IA 5CBFA 5L3DA 4LH6A 5LP6B 1ZAUA 2IH3C 3KCYA 2DYSC 4TV8A 1S72V 4DR4B 4UFZA 2BOBC 2DJVA 4JI0O 1QBZA 1EZJA 3HPLC 2ZIMA 2VQFO 5KX5A 3ZEDA 2EIMC 2ZQMA 1BMFG 2QTOA 1LR1A 4FM2A 1YXBA 2M6YA 2PTMA 1K73W 1SQPH 1WJZA 3RWRD 4LNUB 3AG4C 5EBLC 5KHKA 2Q8VA 1FPOA 1R3LC 3HKCA 2BTOA 1GM7A 1IBMB 3ZMUA 2KG7A 2IBZH 1DGSA 4UCUA 3OMNB 3SYCA 3BEHA 4R8CA 1MOFA 2E5LB 1ZL8A 1HNZB 4DK1A 4JI4O 4TOIA 1OCRB 5DEDA 1S77D 2PI5A 2ITCC 5EZYA 3JYCA 2P4KA 3ZHUA 2ZE8A 4NXMO 5CBGA 3JAWA 4FMTA 1WA8B 1JOYA 1PM9A 3OW2U 2Y0PA 4PA4A 4H37A 1N34O 4B3TB 3SDLA 1ZLZA 4D7SA 3D36A 3RT3C 1BHBA 2EIKC 1VF5B 4PV1B 4H13B 1HWYA 4OX9O 3SYAA 4DR3B 3T2MA 4DUYB 1XQ8A 1SERA 4CZZA 1XHZA 1SQVH 2OT5A 4OPHA 3OD4A 4FLVA 1XMQO 4RUEA 5LGTA 1JMKC 1NZ6A 4LF9O 2Z5UA 3EXAA 3AG1B 1FXVA 3JASB 3CMAV 1IURA 1J5EB 1Q43A 5DECA 4FM1A 1D5NA 1H2LA 3FYEB 5IYCO 4QPKA 3ETGA 2HJFC 2AZ0A 4UCVA 3WB2A 3NXSA 1YEWA 3DXRB 4I9WA 2WLJA 5IJ0B 4U3JB 1XNRB 3DGEA 5FNVB 1H2SB 5C8YA 1Q7YW 3ABMB 4PD4F 1SQQH 1Y4MA 5HFLA 1AI7A 2CTPA 1AI5A 4LF8B 1L0NH 3SJAC 3ML0A 1Q86W 1SRYA 2YXLA 4O4IA 5IYZB 1F7YA 3BA8A 2RQ6A 1KYOF 1E1QG 1R73A 3M99B 4WFAV 3P30A 5CN0A 2GV9A 1JA8A 1VQPV 4GX2A 3BY6A 1F51A 1S3JA 1IBMO 3ZHQA 5A9GA 5JQGA 4MVZA 3OUFA 4P30A 3JAKB 1GN2A 1H8EG 4YXWG 2Y4TA 4J7JA 5JCOA 2E5LO 3ZCCA 2DYRC 3L9DA 5LXTA 2IM9A 2LQTA 5IWAB 1RM1C 1J95A 3B77A 2AZ2A 5H6RA 4JI6B 4OGQB 1LUWA 5J2UB 1YCIA 5LBQA 1OCZC 1THZA 5IY5C 4UCRA 1I5YA 4ZHQB 3R66A 4DR3O 1I08A 5JH7A 3FD9A 4JTAB 3UT5A 4DV4O 2UXCB 4NTXA 1Y6XA 2YEVA 2HHHO 2P22C 4NVPA 4TV8B 1KUQA 3SR2C 3JSNA 3RYIB 5IJ9A 2YI9A 2OCHA 5JCOC 3WB0A 2YUAA 5KX5B 3P3PA 4UB8Z 4DR2B 1IBKB 1PL4A 1XMOB 1K34A 2ZINA 1P7BA 5E79Z 5LHHA 1KU9A 3ZHSA 1FFXA 1PKXA 4AI8A 1E1RG 2L35A 1XNRO 3HKCB 1TVKA 1N33B 2KG7B 4Z2WA 3ASNC 2IJIA 1WNSA 4X89A 1QU7A 4JYBA 4LF8O 1ZL8B 3ETQA 1M56B 3HKBA 3LSUA 3HKEB 5J2TA 1NQTA 4JV5B 2HFEC 3JATA 2VWKA 1YTFD 3BCCH 5LMUB 3EVKA 4DRXA 2W0XA 2R9IA 4FK5C 1VF7A 2RJZA 1N32B 5BR8O 1U96A 1X59A 3UQ8A 3THOA 5IWAO 2O57A 2EIJC 4JI7B 5H6QA 2OCCC 3AG3B 3ZN0A 4ZIBA 4FZ1A 4YY3B 2Y69B 1N0JA 4A5UB 4GT1A 4UVAA 4JZ2A 2OTJV 4MT8A 5CA0B 3CS5A 3AG2C 2QWPB 4JGSA 3ABTA 2DYRB 4X1KA 2UXCO 1YVWA 4JTCB 4J80A 4RUFA 2QTSA 3CYOA 2Q73A 4UCTA 2LFRA 4MTGA 4B3RB 4UB6Z 1VP7A 1K3EA 5LP6A 3HB3B 3FB6C 2WLLA 1VQNV 5C8YB 4TV9B 2H94A 1ORQC 4Q20A 1SESA 4DR2O 2HJDA 5H5NA 1AJNA 2W0FC 5FPRA 1OCOB 5B3SC 5KHJA 2W6JG 5EC1C 2P7TC 4WFFA 1N0NA 1JR9A 1US6A 1SQGA 2AGAA 5E1AC 4X62B 5KA6A 1Q90D 5KHHA 5B1AC 3RFRA 2WWWA 2AHZA 1K7DA 2A7WA 4LNUA 3ZHTA 3B4SA 5JQGB 2QSAA 4GZRB 2N04A 3IC7A 1ZUQA 1KQSU 5LXTB 4ABMA 3W7TA 4X66B 1YJWV 4JTDB 3FB7C 5KHGA 3QO7A 3VQVA 4X1IA 2BSKA 5ITZA 2P67A 4WCEV 2YIDA 3WU2Z 5LP6C 2IJKA 4BR6A 1E79G 1N32O 3KCXA 4CC6A 2XAQA 4TSFG 3ASNB 4X65B 3LSSA 4FFBA 3ETEA 4JI7O 4LF7B 5JH7B 3UT5B 4YY3O 2F66C 1G6UA 2A79B 4FJCC 5IYDO 1F4NA 4GKJB 4UVCA 5L3EA 3GWOA 1Q5OA 4DV3B 4UUJC 2FL4A 3RN4A 4E2LA 1VQ6V 2QM8A 3ZMSA 3F7YC 5IJ9B 2FMLA 1WPXA 1P49A 1YTFB 2D2CB 1QR9A 3CP1A 2UXXA 4IIJA 1K33A 5H9CA 5GW7A 2IJJA 4WFGA 3KZIZ 3JASA 1AROP 1GH6A 5JJJB 4MVRA 4K35A 1OCRC 2JJ2G 5B1BB 1FFXB 1OV9A 4F6RA 4CS4A 2IU0A 3RBZA 1TVKB 2ZNJA 3QO5A 1RPOA 1Q6HA 4JI2B 1MG1A 3DXRA 2OIGA 4NB5A
chains in the Genus database with same CATH topology
4DK1A 4JI8B 2YI8A 3CSXA 5LOVA 4TOIA 1XNQB 4LR3A 2XHBA 3HKBB 5JJNB 5EZYA 3K5OA 5J2TB 2UUBB 3RYCA 5CB4B 3BAAA 4YJ3B 3JAWA 5EIBC 4FLYA 4B3TB 4L8JA 2UXDB 4D7SA 2JS5A 3HKDA 4DRXB 3BHPA 5KHIA 5CA1A 4I4TB 4GKKB 3SJCC 2BTQA 4O2AB 4CH5A 4DR3B 4DUYB 3JAKA 1XQ8A 3BABA 4I55A 3RYHA 4YJ2A 4AQYB 1S5JA 1XHZA 2E3CA 4FLVA 3CB2A 5BMVB 3K59A 4ZI7A 1L8DA 1JMKC 4DR1B 4DR6B 4BWAA 2PY5A 3E22A 2ZM6B 4TQDA 3JASB 4KL1A 4O4HB 1J5EB 1Q43A 4FM1A 4X64B 3T1HB 2F95B 3RYFB 4AHCA 4X1KB 4EFBA 4UCVA 4DV5B 3OTOB 1V9PA 3WB2A 1YEWA 2HEPA 4O4LA 4YHHB 3K5NA 5IJ0B 4U3JB 1I94B 1XNRB 5GONA 4FLTA 5FNVB 1H2SB 5C8YA 5EZYB 4EEQA 3RYIA 5JJEB 4LF8B 3JAWB 3SJAC 1N36B 2YXLA 4O4IA 5IYZB 3BA8A 3BA9A 2RQ6A 4JI5B 2GV9A 2Q7EA 4FVMA 4DV6B 5D5QA 1WPBA 4EB6A 4KHPB 1Q3EA 3SJBC 5JQGA 1JFFA 2V4DA 3JAKB 5JCOA 3U11A 4I55B 3RYHB 5LXTA 4TUYA 2IM9A 5EYPB 1HNXB 4CH6A 5IWAB 4CC5A 4JI6B 4K8ZA 4LH7A 3A2FA 4FLUA 4X1IB 3U0ZA 5ITZB 5J2UB 3HKEA 1TGOA 3JSLA 4GLXA 1O9GA 4K0KB 4X20A 5LA6A 4UCRA 4CH4A 4ZHQB 4FFBB 3T1YB 4LFAB 5JH7A 3N2KA 2YIAA 1WN7A 1QQCA 3UT5A 5LYJB 2UXCB 4I50A 2UUAB 3VQXA 4CS3A 1O9HA 2PYJA 4O2BA 5K1PA 2P22C 1SA0B 4NVPA 4TV8B 2JGUA 4DV4B 4IHJB 3SR2C 3JSNA 3RYIB 5LMNB 5IJ9A 4JYAB 2YI9A 2VWJA 3VQWA 5JCOC 2UUCB 4O4IB 3WB0A 5KX5B 4LF4B 4NXMB 4DR2B 3BRCA 4IIJB 1IBKB 1HW7A 4LF5B 1TUBB 4DV2B 3PN1A 4WBNA 1XMOB 2QJ1A 4HNAB 1N34B 5CA0A 3U10A 2ZINA 4JI1B 4B3MB 2OWOA 1KU9A 4Q6GA 1FFXA 5KMGB 4DV0B 1JJOA 4ZOLB 4K8XA 4LF6B 4F6RB 1SQFA 2OYQA 4PHZA 3QG5A 3HKCB 3N2GA 1TVKA 4UCSA 1N33B 4BW9A 4O4JB 3JALA 4TQFA 5JVDA 1WNSA 1M4UA 1XHXA 3ETQA 4I9QA 4DR5B 3HKBA 5LOVB 3HKEB 2ZIOA 5J2TA 4TV9A 4JV5B 3JATA 3RYCB 1IBLB 2VWKA 3JARA 1Z5VA 1TAEA 3LNNA 2YIBA 3M7MX 5LMUB 4JI3B 4DRXA 3RGBA 4X1YA 4PI0A 3HKDB 1VF7A 3N2KB 2PZSA 2RJZA 1N32B 4O2AA 5CA1B 2R70A 2PUSA 2BTQB 2Q7HA 3UQ8A 3THOA 2PYLA 4JI7B 2VQEB 5K1XA 4NXNB 4ZIBA 4FLZA 2PGGA 4YY3B 1FJGB 4YJ2B 2Q0AA 4AILC 5BMVA 2R72A 4UCOA 4ZI7B 4B08A 3E22B 4JI0B 2VQFB 4O4HA 5CA0B 3DSQA 1B04A 1D5AA 3WB1A 1M5IA 1QHTA 3RYFA 4CH3A 4X1KA 4DV7B 3VQYA 3N2GB 2P5OA 2YIBD 1RSOA 4LFBB 4UCTA 3K5LA 2ZCEA 4B3RB 5IJ0A 4U3JA 4O4LB 5LP6A 5FNVA 5GONB 4HBNA 2F1MA 3K58A 4FLXA 5C8YB 4TV9B 1X4TA 4DV1B 1XI1A 5EIBD 2UXBB 3JATB 4JI4B 4LFCB 3JARB 5FPRA 5IYZA 5KHJA 4PI2A 4D7TA 1SQGA 4X1YB 4B3SB 4X62B 2UU9B 3CHXA 5KHHA 3ZS8C 3RFRA 3MAQA 4LNUA 3K5MA 4GYCB 4EB6B 3ICXA 2QM4A 5JQGB 1JFFB 1I7FA 5EYPA 5LXTB 4OX9B 4TUYB 2HHHB 4X66B 2KKWA 3OTFA 5KHGA 3BPZA 3VQVA 4X1IA 1XMQB 5ITZA 5J2UA 1M93A 5LP6C 2Q7GA 4LF9B 5CB4A 4YJ3A 4FLWA 4CS2A 3B2EE 2R9AA 4CC6A 3IAYA 2F4VB 2JVDA 4X20B 5LA6B 4X65B 4ZHQA 4DK0A 4FFBA 1NT2B 1T5EA 3QF7A 1Q8IA 4DR7B 4LF7B 5LYJA 3FFQA 3SGIA 4I4TA 3QTCA 5JH7B 3UT5B 3K57A 2F66C 1G6UA 4I50B 4LH6A 5LP6B 4GKJB 1ZAUA 1SA0A 4TV8A 4IHJA 4DR4B 4FM0A 4O2BB 1Q5OA 4UFZA 4DV3B 2ZNIA 1SKVA 4EFEA 5IJ9B 2ZIMA 1P49A 1Z5WA 5KX5A 3ZEDA 4FM2A 4IIJA 2F93B 1TUBA 2PTMA 4HNAA 3JASA 4DUZB 4WBNB 5FPOA 5JJJB 3RWRD 4LNUB 5D5PA 5KMGA 1TA8A 1HR0B 5KHKA 2CAZC 4ZOLA 1FFXB 1KMIZ 4F6RA 5BR8B 3HKCA 2EX3A 4CS4A 2BTOA 1IBMB 1TVKB 4O4JA 2ZNJA 1DGSA 1HNWB 4UCUA 3JALB 4JI2B 5JVDB 2E5LB 1HNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9A A;  1KU9 A;  2QM4 A;  1M5I A;  3SR2 C;  3RWR D; 
#chains in the Genus database with same CATH topology
 1URF A;  3AG2 B;  3H01 A;  5GTH Z;  1PNM A;  4LR3 A;  1VF6 A;  3HKB B;  3K5O A;  1R3I C;  2DN9 A;  2RN9 A;  5J2T B;  2UUB B;  2IJH A;  3BAA A;  3CCS V;  4X62 O;  5L3B A;  1BQ0 A;  4FLY A;  1MAB G;  1AR4 A;  3H1I H;  1WAZ A;  2R9R B;  3IGA C;  4MTF A;  2JS5 A;  3DC5 A;  4DRX B;  3L74 H;  5KHI A;  2B1G A;  3ABU A;  3AG1 C;  1EM1 A;  4CH5 A;  4X66 O;  1Q6U A;  3JAK A;  3BAB A;  2JS3 A;  4YJ2 A;  4AQY B;  2E3C A;  4Z1V A;  5JWP A;  3RVZ A;  1BT8 A;  1L0L H;  4DR6 B;  2PY5 A;  1BGY H;  1QCE A;  2RDC A;  3CWB H;  1Y66 A;  2HKO A;  5EC2 C;  2LP7 A;  5LHG A;  1IBL O;  4KL1 A;  2CE4 A;  4X65 O;  3D3Q A;  4QJF B;  3P32 A;  1R6N A;  1VF6 C;  2F95 B;  4JI3 O;  3ABM C;  1K9M W;  2QE7 G;  4AHC A;  4X1K B;  3K0D A;  4GKJ O;  4EFB A;  1V54 B;  1WLE A;  3CEI A;  1WP7 A;  2HEP A;  4DV3 O;  3K5N A;  3ZHR A;  2XAF A;  3E89 A;  2DOS A;  2WLL B;  1EFR G;  5CA3 A;  3RYI A;  2CTW A;  2Z0A A;  2NR5 A;  4JAS A;  3O9O A;  1ROP A;  3STL C;  3LDC A;  1A32 A;  1N36 B;  2P06 A;  1RP3 B;  1JJ2 U;  1PL0 A;  4JI5 B;  1BQZ A;  2Q7E A;  4FVM A;  2QWQ B;  4QE9 A;  4DV6 B;  5D5Q A;  4BIZ A;  4P9P A;  1Q3E A;  3H1J H;  2PI4 A;  1H2M A;  2QWO B;  3UM7 A;  3RYH B;  4JI2 O;  2YC0 A;  1HNX B;  3P3N A;  3SJQ C;  1YI2 V;  4OPA A;  3CME V;  1DTO A;  1K5Q A;  1P4R A;  1NJI W;  2WSS G;  3RVY A;  1AI6 A;  1H2K A;  3A2F A;  4X1I B;  3SPG A;  2BSK B;  1NS1 A;  5ITZ B;  1NTK H;  3HKE A;  1VQO V;  1Y74 A;  1TGO A;  2AHY A;  3OEE G;  1JQ0 A;  2ZE7 A;  4OXS A;  2E75 B;  4K0K B;  4X20 A;  5LA6 A;  1ZX3 A;  2NN4 A;  4PA9 A;  1KD1 W;  4LBE C;  4FFB B;  4LFA B;  1YIT V;  1HDJ A;  4U7O A;  3CC7 V;  4CBC A;  2YIA A;  2DQ3 A;  3LDE A;  2UUA B;  3VQX A;  4RQE A;  2EBO A;  1MZE A;  2PYJ A;  4O2B A;  4DR6 O;  4FIP C;  2JGU A;  1UJW B;  3T4D A;  5BY1 A;  2VWJ A;  2UUC B;  1V55 B;  2HR3 A;  3A8T A;  3AG7 A;  1EN5 A;  3ASO B;  3JD4 A;  4IIJ B;  1HW7 A;  4DV2 B;  4Z1M G;  4WBN A;  5CA0 A;  4B3M B;  3QVN A;  2OWO A;  2HG5 C;  1KC8 W;  1M56 C;  4Q6G A;  1JJO A;  3W7X A;  1AP5 A;  4F6R B;  5A2Q N;  4MVO A;  1L1F A;  2FB5 A;  5JVD A;  1YIJ V;  4DR4 O;  2QWN B;  4I9Q A;  3D36 C;  4DR5 B;  4K3A A;  3OUS A;  1N36 O;  4TV9 A;  3ZMZ A;  4MTO A;  4JI5 O;  3AG3 C;  1Z5V A;  1TAE A;  3LNN A;  2YIB A;  2ZDI A;  3M7M X;  2Y69 C;  5TIS Z;  1VQK V;  3RGB A;  3N2K B;  2PZS A;  1MSD A;  3X2Q B;  1YJN V;  3TET A;  2PUS A;  2QWR B;  4MVM A;  3VOU A;  2QKA A;  4JAV A;  4NXN B;  4NTY A;  2VRZ A;  3W7S A;  4PDM A;  2B1I A;  2MK3 A;  2Q0A A;  4G2K A;  4YJ2 B;  2ZXW B;  4AIL C;  1HNZ O;  3B40 A;  4IGG A;  4U3F H;  5BMV A;  4FPP A;  2RCV A;  4UCO A;  4MVS A;  1RFY A;  1H2N A;  3IFX A;  3SPJ A;  3ZBH A;  4K0K O;  4O4H A;  2MW2 B;  3DSQ A;  2HP8 A;  4B3T O;  1QHT A;  4LFA O;  4CH3 A;  2JEX A;  2UUA O;  1I0H A;  2WLH A;  2YIB D;  1RSO A;  3OM3 B;  1OCO C;  2VS0 A;  2ZDI C;  4DUY O;  4GX5 A;  2UUC O;  1XL6 A;  4HBN A;  2IW5 A;  3CPW U;  4FLX A;  1X4T A;  4DV1 B;  3LNM B;  1XI1 A;  5EIB D;  2UXB B;  2QGN A;  2QR4 A;  4DV2 O;  3JAR B;  1SS3 A;  5L3G A;  1N4C A;  4YIO A;  1DK1 A;  2A3Q A;  1J5E O;  1EN4 A;  2P6J A;  1LNQ A;  4L87 A;  2D3O W;  4B7E A;  2GSM B;  5IT9 N;  3MAQ A;  5LHI A;  5BZB A;  4GYC B;  3MHS C;  3G6B A;  1GK9 A;  3ICX A;  3CX5 F;  1D2D A;  1Q82 W;  1DF5 A;  1NH2 D;  2EIN B;  1GMG A;  4XDJ A;  1VQ8 V;  3G80 A;  2V7Q G;  1GN6 A;  1R6K A;  1W0K G;  3JD0 A;  3BPZ A;  5IYB O;  2XUM A;  1KBH A;  4LCU C;  3SPH A;  3DC6 A;  1Y74 B;  1P7G A;  3B2E E;  1VEW A;  4XBF A;  2F4V B;  4X20 B;  5LA6 B;  4DK0 A;  1T5E A;  2N05 A;  3QF7 A;  4NXN O;  3KG2 A;  3QTC A;  4JYY A;  3L71 H;  4R50 A;  2X6C A;  5LL6 Y;  2DQ0 A;  3E86 A;  1UPG A;  3ZRV A;  3N27 A;  1XBL A;  1KP2 A;  1ZSP A;  2YDE A;  3TCU A;  4IHJ A;  4FM0 A;  4O2B B;  2ZNI A;  2DWE C;  2GTA A;  4JI6 O;  4JF3 A;  5B1B C;  1SKV A;  1SC5 B;  4J10 A;  1MSW D;  1Z5W A;  1EZV H;  2EIL B;  1B3Q A;  4HZ3 A;  2F93 B;  1TUB A;  3FX7 A;  4HNA A;  3AK3 A;  1QLE B;  4DUZ B;  4WBN B;  4RWU A;  3L70 H;  3IC9 A;  1FKA O;  3CCL V;  1TA8 A;  3KKY A;  1HR0 B;  4ZOL A;  3CRQ A;  1U97 A;  1B6Q A;  5C93 A;  4X88 A;  2EX3 A;  4I0X A;  1VAR A;  3C3T A;  1HNW B;  1BL8 A;  4DV1 O;  5JVD B;  1AI4 A;  2UXB O;  3B8N A;  4JI8 B;  3LSQ A;  2YI8 A;  4ICG A;  5LOV A;  1XNQ B;  3ZX6 A;  1GN4 A;  3RYC A;  1M57 B;  3T4Z A;  2Z3Y A;  1IBK O;  2YIC A;  1NKD A;  2Q69 A;  1TUE B;  1MNG A;  2JEU A;  1AVM A;  4D6T H;  1XMO O;  1GO3 F;  1VQ7 V;  4L8J A;  2ZR3 A;  2UXD B;  1SQB H;  4PDR A;  3HKD A;  3BHP A;  4I4T B;  1XUQ A;  4WFH A;  4R6Z A;  2LO1 A;  3OAA G;  4J41 A;  2G38 A;  1N33 O;  2JIZ G;  3R65 A;  3RYH A;  1F4M A;  2Q68 A;  3ZMT A;  3CB2 A;  1R1B A;  2CGO A;  2ZR2 A;  5BMV B;  4ZI7 A;  1L8D A;  3TK1 A;  2F23 A;  4BWA A;  1AIL A;  3E22 A;  4DW0 A;  2X6B A;  2ZM6 B;  1V54 C;  1W0J G;  4JV5 O;  3K03 A;  4TQD A;  1JX9 A;  4LC1 A;  3FAV A;  4O4H B;  5KAI Z;  3WG7 B;  2BE3 A;  3G67 A;  4X64 B;  5EBW C;  5LMU O;  2JDI G;  1NVP D;  4PA3 A;  1MMM A;  1NH2 B;  1XEQ A;  2JJ1 G;  2AW9 A;  1RSO B;  4DV5 B;  4MVQ A;  1CPY A;  2N74 A;  4O4L A;  1WP8 A;  3G6E V;  2M7W A;  1I94 B;  5GON A;  4IYH A;  2ADQ B;  1YF2 A;  2ZE6 A;  1AJQ A;  3F5W C;  4YIP A;  1AJP A;  3E8F A;  5JJE B;  3K79 A;  3WFV A;  4DUZ O;  3BA9 A;  2K1E A;  4C7U A;  1SQX H;  3OR7 C;  3K0G A;  2CTQ A;  2EZO A;  3CRR A;  3SJB C;  1S5L Z;  4W4L A;  3UO2 A;  4BIU A;  3U11 A;  2W6I G;  4I55 B;  2LFS A;  4BIO A;  4B3R O;  4TUY A;  4JI8 O;  1ZWI C;  2XAJ A;  1XNQ O;  3TGU H;  4KXR A;  1FD9 A;  3ZN1 A;  1QR8 A;  4GUN A;  4HAM A;  1YJ9 V;  4K8Z A;  1IZ3 A;  5LGU A;  2JGD A;  4FLU A;  4B7K A;  3U0Z A;  5B1N A;  3J80 N;  2AXT Z;  4X8A A;  2CH7 A;  3LDD A;  4NTW A;  2ILM A;  2CK3 G;  2P4V A;  2UXD O;  5CBH A;  4GLX A;  1O9G A;  4IT5 A;  4U7N A;  3FYI B;  2XTA A;  4EKW A;  2BOC C;  2FKX A;  2Q67 A;  4J11 A;  5EK0 A;  1V55 C;  4XDK A;  3N2K A;  1B06 A;  1H38 A;  1I5X A;  3ABK B;  1QQC A;  4I50 A;  3ASO C;  3E35 A;  3O65 A;  5B5E Z;  1SZX A;  2WA4 A;  4IHJ B;  5LMN B;  2ZM6 O;  2X0L A;  3UCS C;  4UV8 A;  3CCU V;  4NXM B;  4X64 O;  3BRC A;  3J81 N;  1TUB B;  4QPJ A;  4HNA B;  1N34 B;  4MW8 A;  3U10 A;  3CC2 V;  4WF9 V;  4JI1 B;  4DV5 O;  4DV0 B;  4ZOL B;  4LF7 O;  4K8X A;  2OYQ A;  1I94 O;  2Y48 A;  3EFF K;  5DM6 V;  4UCS A;  2BCC H;  3UO3 A;  4I0X B;  3JAL A;  1VQ4 V;  2LW7 A;  4FZ0 A;  3E8B A;  3GWK C;  3A0R A;  4I7Z B;  5LOV B;  1FS0 G;  3X2Q C;  1YDX A;  4TWK A;  3CCV V;  4QGP A;  1M90 W;  2WA3 A;  2DWD C;  3W7U A;  1CP9 A;  2ZT9 B;  3RYC B;  1NVP B;  2WPD G;  3JAR A;  3JD1 A;  4JYC A;  4X9Q A;  1GTO A;  1DF4 A;  2ZXW C;  3S3W A;  3SYQ A;  3HKD B;  2LGW A;  4O2A A;  1G8M A;  1Y76 A;  1XIL A;  3E83 A;  3H1L H;  2VQE B;  4W4K A;  1G1X B;  2PGG A;  2GHY A;  3PJS K;  1FJG B;  1GN3 A;  3ZJZ A;  5B1O A;  1AB3 A;  1R6T A;  1FXK B;  4G28 B;  2NLJ C;  1BS3 A;  3T1C A;  4ZI7 B;  3TXS A;  4B08 A;  3E22 B;  2CTR A;  3QNE A;  2UUB O;  3A0H Z;  1EN6 A;  2B9Z A;  5CMU A;  1B04 A;  3Q4H B;  2WAM A;  2Q4P A;  3FAV B;  3ZRX A;  1D5A A;  3RYF A;  2GBO A;  1H8H G;  1YSC A;  4DV7 B;  2XAG A;  3N2G B;  3ZRS A;  4LFB B;  1IVS A;  3MDS A;  5LMN O;  4GX0 A;  4O4L B;  1R3J C;  3L72 H;  4AQY O;  3J7A U;  5GON B;  2F1M A;  3D3I A;  1AR5 A;  3K58 A;  5L3F A;  3OE7 G;  1M1K W;  3CD6 V;  2EUL A;  3AK2 A;  1NR1 A;  4F4L A;  4LFC B;  3JAM N;  4KP4 A;  2L6L A;  2EIN C;  4JI1 O;  2ATK C;  4J9Z B;  4PDL A;  4D7T A;  1R3K C;  4X1Y B;  1PNK A;  3M8A A;  1VQ9 V;  4B3S B;  1KB9 F;  4DV0 O;  3OT7 A;  2UU9 B;  1VQM V;  1PV0 A;  3HR0 A;  4LWS A;  3ZS8 C;  2WLK A;  1AR1 B;  3MHH C;  2X7R B;  2QM4 A;  3CCR V;  1I7F A;  5HFM A;  3CXH F;  5EYP A;  4MSW C;  3RW0 A;  3K9A A;  4TUY B;  4UVB A;  3K9S A;  3CE2 A;  2HHH B;  1NI8 A;  4UXN A;  2KSD A;  5KUK A;  1BHA A;  2JGD B;  5KA5 A;  3OGI B;  5KAF Z;  1VIB A;  1SF9 A;  3DTU B;  2H8P C;  5EBM C;  2CH7 B;  2Q7G A;  2DMX A;  3IJ4 A;  4CS2 A;  2A06 H;  5FLX N;  2JVD A;  4DV6 O;  1OCC B;  1PD3 A;  2B5U A;  4QNH B;  5KLV H;  2YXH A;  4MS2 A;  2VQE O;  3EHB B;  1P84 F;  1Q8I A;  3SPI A;  4DR7 B;  1PP9 H;  5LYJ A;  2EIL C;  4I4T A;  3SGI A;  1FJG O;  4DYL A;  4I50 B;  1YZB A;  3ABL B;  1XDC A;  1WB8 A;  1MA1 A;  1KP3 A;  2LW1 A;  5KUM A;  4H44 B;  1HNX O;  1FXH A;  1QLE C;  1SA0 A;  3JD2 A;  2WLI A;  3FKS G;  4NKG B;  5IDJ A;  3B09 A;  1ENV A;  2RNB A;  3I55 V;  4EFE A;  2ZKO A;  2IU3 A;  2QEX V;  1NR7 A;  2CUG A;  4P9O A;  1BZK A;  2E74 B;  1K4D C;  4DV7 O;  2DYS B;  5DN6 G;  5FPO A;  3FB8 C;  3OGC C;  4QE7 A;  3G4S V;  3ZHV A;  2JK5 C;  5D5P A;  2GUZ A;  4PDV A;  5KMG A;  4LFB O;  1DLB A;  3UKM A;  2CAZ C;  2QKC A;  1CEZ A;  4RO2 A;  1KMI Z;  5BR8 B;  2GTS A;  1FAF A;  2EIM B;  4BAY A;  1M57 C;  3F5T A;  4O4J A;  1BSM A;  3JAL B;  5FL7 G;  4KUM A;  5L3C A;  4I5S A;  3CSX A;  3AG4 B;  4LFC O;  2XND G;  2XHB A;  1GAX A;  5JJN B;  5CB4 B;  4J7K A;  5AG2 A;  4YJ3 B;  1Q81 W;  4B3S O;  2UU9 O;  3G71 V;  2CDY A;  5EIB C;  5IE9 A;  4B3M O;  3APO A;  5CA1 A;  4GKK B;  2NNU A;  3SJC C;  4WFB V;  2BTQ A;  4O2A B;  3I56 V;  1Y76 B;  2DE0 X;  1AP6 A;  3W7W A;  3WG7 C;  4J9Y B;  3E8G A;  4I55 A;  1S5J A;  1PNL A;  3CRC A;  4GX1 A;  3TJT A;  3K59 A;  3QO8 A;  4DR5 O;  4DR1 B;  3STZ C;  2EIK B;  2XOK G;  3E8H A;  4N23 A;  1IXM A;  3JCZ A;  2Q5Z A;  3CXC U;  1GRJ A;  1VQ5 V;  2UXN A;  2FTK A;  2F43 G;  4JAU A;  3BFR A;  3T1H B;  4DR7 O;  3RYF B;  4ZBM A;  3GVM A;  1BCC H;  5J9P C;  1OZ0 A;  2KQX A;  1XOU A;  1M9N A;  1G4Y B;  3OTO B;  1V9P A;  5GTI Z;  4G27 B;  4YHH B;  2OTL V;  2C2A A;  4J7Z A;  3OFN G;  2LJ2 A;  4FLT A;  3SYO A;  4E4E A;  1PPJ H;  5EZY B;  4EEQ A;  3CC4 V;  3CJH A;  1OJH A;  3JAW B;  5F2V O;  2Q9L A;  4RQF A;  4P2Z A;  2ODM A;  1WB7 A;  2P90 A;  2ETN A;  3CCE V;  2A0L A;  4LWS B;  1WPB A;  1XL4 A;  1K92 A;  4EB6 A;  4KHP B;  1LUV A;  1S5H C;  1JFF A;  2V4D A;  3E2E A;  1NU1 H;  4GCZ A;  5EYP B;  4CH6 A;  1VMG A;  4CC5 A;  3ZRW A;  1VQL V;  1W59 A;  2HVK C;  1YHQ V;  4J42 A;  3JCU Z;  4LH7 A;  2HVJ C;  1NBM G;  2HLD G;  4XDL A;  5H2F Z;  2K9P A;  1OHH G;  1Q6I A;  1MZF A;  3BVO A;  3ABK C;  4HYO A;  2OIE A;  1QLN A;  3JSL A;  3CCQ V;  3H1H H;  1UFI A;  1NTZ H;  4GKK O;  2E76 B;  1RM1 B;  1K4C C;  2YSU B;  4CH4 A;  3OMA B;  2XAH A;  3T1Y B;  2WLN A;  3ETD A;  1WN7 A;  5LYJ B;  1Y67 A;  2XT9 A;  3H9V A;  2QA4 V;  4PA7 A;  2Y4U A;  4CS3 A;  1O9H A;  2QKS A;  1OCZ B;  1BE3 H;  5K1P A;  5LGN A;  4DR1 O;  4R7C A;  1SA0 B;  2ZD9 A;  1COW G;  4DV4 B;  2QM7 A;  4DXW A;  5IY5 B;  2WLI B;  2ADP A;  2XAS A;  3CRM A;  4JYA B;  3VQW A;  1FXK A;  4O4I B;  4LF4 B;  3FB5 C;  2RMK B;  3I5D A;  3T1H O;  4IL6 Z;  1W2B U;  4LF5 B;  3MD0 A;  3PN1 A;  2QJ1 A;  3CCJ V;  4PJ0 Z;  3Q4H A;  2F4V O;  1EBO A;  2GUZ B;  5KMG B;  3A0B Z;  2CGN A;  3OTO O;  2GDS A;  3GB7 C;  4YHH O;  3SPC A;  4LF6 B;  2QDO A;  1SQF A;  4PHZ A;  3K08 A;  3QG5 A;  3N2G A;  4LP8 A;  2A9H A;  3K04 A;  4BW9 A;  4O4J B;  5BXZ A;  1QVG U;  4TQF A;  1M4U A;  1Z2G A;  2EJR A;  2YS8 A;  1KKD A;  1GKF A;  1XHX A;  1NTM H;  2ITD C;  2JRI A;  4IYI A;  2ZIO A;  3OMI B;  2KB1 A;  1WA8 A;  4FFK A;  4PEL A;  1IBL B;  1H2G A;  1KEC A;  4KHP O;  1CXZ B;  4UV9 A;  4JI3 B;  1FXK C;  4X1Y A;  3LUT B;  4PI0 A;  4RAI A;  2FYU H;  1HR0 O;  4QIW F;  1GM9 A;  5CA1 B;  3K3W A;  3AEI A;  2R70 A;  4DW1 A;  5B66 Z;  3CCM V;  2BTQ B;  2Q7H A;  2V1D A;  2YEV B;  1S0V A;  2PYL A;  2H3O A;  3K06 A;  4NYK A;  3H1K H;  5K1X A;  1XRE A;  4KFM A;  4FLZ A;  1RPR A;  1HNW O;  3OR6 C;  2R72 A;  4ASU G;  3ZMV A;  3C90 A;  3D8C A;  2EJ7 A;  4JI0 B;  4F6E A;  1N8R W;  3L73 H;  2Q0O C;  2X6A A;  2VQF B;  2EIJ B;  4TT3 G;  4JAA A;  2OCC B;  1FYJ A;  4DO2 A;  4H0L B;  3WB1 A;  1M5I A;  3T1Y O;  2PF4 E;  1JVM A;  3CRA A;  1HP8 A;  3VQY A;  2P5O A;  2DW4 A;  3NR7 A;  3TXQ A;  1IX9 A;  2IH1 C;  4NR1 A;  3K5L A;  3ZIA G;  2ZCE A;  1IDS A;  1K8A W;  5IJ0 A;  2ZE5 A;  4U3J A;  1KKC A;  1F23 A;  4JYA O;  5FNV A;  1GM8 A;  4LF4 O;  3CJH B;  3JAT B;  4JI4 B;  3VBB A;  4LF5 O;  5IYZ A;  3SYP A;  1JPX A;  4PI2 A;  3B8M A;  4JPR A;  3CHX A;  1QNM A;  1K5S A;  2EZP A;  4LF6 O;  3K5M A;  4EB6 B;  1IXB A;  5B3S B;  1JFF B;  3F7V C;  3OEH G;  1SET A;  4MVU A;  4OX9 B;  3C3S A;  4ZKI A;  3ZRW B;  2KKW A;  3OTF A;  2LGQ A;  4H33 A;  1OCC C;  4BW5 A;  5B1A B;  1S76 D;  1XMQ B;  4MW3 A;  4MTX A;  3JD3 A;  1FFT B;  3AK1 A;  5J2U A;  1M93 A;  1SZT A;  2ARH A;  3ABL C;  4JZG A;  1K97 A;  3L75 H;  3S3X A;  4LF9 B;  5CB4 A;  2WLM A;  4YJ3 A;  4FLW A;  2YXY A;  4WFE A;  2R9A A;  3IAY A;  1ZTE A;  1QVF U;  4ZHQ A;  1NT2 B;  4N21 A;  4PA6 A;  3FFQ A;  1JCH A;  2Q6A A;  3K57 A;  3APQ A;  2Y0I A;  5CBF A;  5L3D A;  4LH6 A;  5LP6 B;  1ZAU A;  2IH3 C;  3KCY A;  2DYS C;  4TV8 A;  1S72 V;  4DR4 B;  4UFZ A;  2BOB C;  2DJV A;  4JI0 O;  1QBZ A;  1EZJ A;  3HPL C;  2ZIM A;  2VQF O;  5KX5 A;  3ZED A;  2EIM C;  2ZQM A;  1BMF G;  2QTO A;  1LR1 A;  4FM2 A;  1YXB A;  2M6Y A;  2PTM A;  1K73 W;  1SQP H;  1WJZ A;  3RWR D;  4LNU B;  3AG4 C;  5EBL C;  5KHK A;  2Q8V A;  1FPO A;  1R3L C;  3HKC A;  2BTO A;  1GM7 A;  1IBM B;  3ZMU A;  2KG7 A;  2IBZ H;  1DGS A;  4UCU A;  3OMN B;  3SYC A;  3BEH A;  4R8C A;  1MOF A;  2E5L B;  1ZL8 A;  1HNZ B;  4DK1 A;  4JI4 O;  4TOI A;  1OCR B;  5DED A;  1S77 D;  2PI5 A;  2ITC C;  5EZY A;  3JYC A;  2P4K A;  3ZHU A;  2ZE8 A;  4NXM O;  5CBG A;  3JAW A;  4FMT A;  1WA8 B;  1JOY A;  1PM9 A;  3OW2 U;  2Y0P A;  4PA4 A;  4H37 A;  1N34 O;  4B3T B;  3SDL A;  1ZLZ A;  4D7S A;  3D36 A;  3RT3 C;  1BHB A;  2EIK C;  1VF5 B;  4PV1 B;  4H13 B;  1HWY A;  4OX9 O;  3SYA A;  4DR3 B;  3T2M A;  4DUY B;  1XQ8 A;  1SER A;  4CZZ A;  1XHZ A;  1SQV H;  2OT5 A;  4OPH A;  3OD4 A;  4FLV A;  1XMQ O;  4RUE A;  5LGT A;  1JMK C;  1NZ6 A;  4LF9 O;  2Z5U A;  3EXA A;  3AG1 B;  1FXV A;  3JAS B;  3CMA V;  1IUR A;  1J5E B;  1Q43 A;  5DEC A;  4FM1 A;  1D5N A;  1H2L A;  3FYE B;  5IYC O;  4QPK A;  3ETG A;  2HJF C;  2AZ0 A;  4UCV A;  3WB2 A;  3NXS A;  1YEW A;  3DXR B;  4I9W A;  2WLJ A;  5IJ0 B;  4U3J B;  1XNR B;  3DGE A;  5FNV B;  1H2S B;  5C8Y A;  1Q7Y W;  3ABM B;  4PD4 F;  1SQQ H;  1Y4M A;  5HFL A;  1AI7 A;  2CTP A;  1AI5 A;  4LF8 B;  1L0N H;  3SJA C;  3ML0 A;  1Q86 W;  1SRY A;  2YXL A;  4O4I A;  5IYZ B;  1F7Y A;  3BA8 A;  2RQ6 A;  1KYO F;  1E1Q G;  1R73 A;  3M99 B;  4WFA V;  3P30 A;  5CN0 A;  2GV9 A;  1JA8 A;  1VQP V;  4GX2 A;  3BY6 A;  1F51 A;  1S3J A;  1IBM O;  3ZHQ A;  5A9G A;  5JQG A;  4MVZ A;  3OUF A;  4P30 A;  3JAK B;  1GN2 A;  1H8E G;  4YXW G;  2Y4T A;  4J7J A;  5JCO A;  2E5L O;  3ZCC A;  2DYR C;  3L9D A;  5LXT A;  2IM9 A;  2LQT A;  5IWA B;  1RM1 C;  1J95 A;  3B77 A;  2AZ2 A;  5H6R A;  4JI6 B;  4OGQ B;  1LUW A;  5J2U B;  1YCI A;  5LBQ A;  1OCZ C;  1THZ A;  5IY5 C;  4UCR A;  1I5Y A;  4ZHQ B;  3R66 A;  4DR3 O;  1I08 A;  5JH7 A;  3FD9 A;  4JTA B;  3UT5 A;  4DV4 O;  2UXC B;  4NTX A;  1Y6X A;  2YEV A;  2HHH O;  2P22 C;  4NVP A;  4TV8 B;  1KUQ A;  3SR2 C;  3JSN A;  3RYI B;  5IJ9 A;  2YI9 A;  2OCH A;  5JCO C;  3WB0 A;  2YUA A;  5KX5 B;  3P3P A;  4UB8 Z;  4DR2 B;  1IBK B;  1PL4 A;  1XMO B;  1K34 A;  2ZIN A;  1P7B A;  5E79 Z;  5LHH A;  1KU9 A;  3ZHS A;  1FFX A;  1PKX A;  4AI8 A;  1E1R G;  2L35 A;  1XNR O;  3HKC B;  1TVK A;  1N33 B;  2KG7 B;  4Z2W A;  3ASN C;  2IJI A;  1WNS A;  4X89 A;  1QU7 A;  4JYB A;  4LF8 O;  1ZL8 B;  3ETQ A;  1M56 B;  3HKB A;  3LSU A;  3HKE B;  5J2T A;  1NQT A;  4JV5 B;  2HFE C;  3JAT A;  2VWK A;  1YTF D;  3BCC H;  5LMU B;  3EVK A;  4DRX A;  2W0X A;  2R9I A;  4FK5 C;  1VF7 A;  2RJZ A;  1N32 B;  5BR8 O;  1U96 A;  1X59 A;  3UQ8 A;  3THO A;  5IWA O;  2O57 A;  2EIJ C;  4JI7 B;  5H6Q A;  2OCC C;  3AG3 B;  3ZN0 A;  4ZIB A;  4FZ1 A;  4YY3 B;  2Y69 B;  1N0J A;  4A5U B;  4GT1 A;  4UVA A;  4JZ2 A;  2OTJ V;  4MT8 A;  5CA0 B;  3CS5 A;  3AG2 C;  2QWP B;  4JGS A;  3ABT A;  2DYR B;  4X1K A;  2UXC O;  1YVW A;  4JTC B;  4J80 A;  4RUF A;  2QTS A;  3CYO A;  2Q73 A;  4UCT A;  2LFR A;  4MTG A;  4B3R B;  4UB6 Z;  1VP7 A;  1K3E A;  5LP6 A;  3HB3 B;  3FB6 C;  2WLL A;  1VQN V;  5C8Y B;  4TV9 B;  2H94 A;  1ORQ C;  4Q20 A;  1SES A;  4DR2 O;  2HJD A;  5H5N A;  1AJN A;  2W0F C;  5FPR A;  1OCO B;  5B3S C;  5KHJ A;  2W6J G;  5EC1 C;  2P7T C;  4WFF A;  1N0N A;  1JR9 A;  1US6 A;  1SQG A;  2AGA A;  5E1A C;  4X62 B;  5KA6 A;  1Q90 D;  5KHH A;  5B1A C;  3RFR A;  2WWW A;  2AHZ A;  1K7D A;  2A7W A;  4LNU A;  3ZHT A;  3B4S A;  5JQG B;  2QSA A;  4GZR B;  2N04 A;  3IC7 A;  1ZUQ A;  1KQS U;  5LXT B;  4ABM A;  3W7T A;  4X66 B;  1YJW V;  4JTD B;  3FB7 C;  5KHG A;  3QO7 A;  3VQV A;  4X1I A;  2BSK A;  5ITZ A;  2P67 A;  4WCE V;  2YID A;  3WU2 Z;  5LP6 C;  2IJK A;  4BR6 A;  1E79 G;  1N32 O;  3KCX A;  4CC6 A;  2XAQ A;  4TSF G;  3ASN B;  4X65 B;  3LSS A;  4FFB A;  3ETE A;  4JI7 O;  4LF7 B;  5JH7 B;  3UT5 B;  4YY3 O;  2F66 C;  1G6U A;  2A79 B;  4FJC C;  5IYD O;  1F4N A;  4GKJ B;  4UVC A;  5L3E A;  3GWO A;  1Q5O A;  4DV3 B;  4UUJ C;  2FL4 A;  3RN4 A;  4E2L A;  1VQ6 V;  2QM8 A;  3ZMS A;  3F7Y C;  5IJ9 B;  2FML A;  1WPX A;  1P49 A;  1YTF B;  2D2C B;  1QR9 A;  3CP1 A;  2UXX A;  4IIJ A;  1K33 A;  5H9C A;  5GW7 A;  2IJJ A;  4WFG A;  3KZI Z;  3JAS A;  1ARO P;  1GH6 A;  5JJJ B;  4MVR A;  4K35 A;  1OCR C;  2JJ2 G;  5B1B B;  1FFX B;  1OV9 A;  4F6R A;  4CS4 A;  2IU0 A;  3RBZ A;  1TVK B;  2ZNJ A;  3QO5 A;  1RPO A;  1Q6H A;  4JI2 B;  1MG1 A;  3DXR A;  2OIG A;  4NB5 A; 
#chains in the Genus database with same CATH homology
 4DK1 A;  4JI8 B;  2YI8 A;  3CSX A;  5LOV A;  4TOI A;  1XNQ B;  4LR3 A;  2XHB A;  3HKB B;  5JJN B;  5EZY A;  3K5O A;  5J2T B;  2UUB B;  3RYC A;  5CB4 B;  3BAA A;  4YJ3 B;  3JAW A;  5EIB C;  4FLY A;  4B3T B;  4L8J A;  2UXD B;  4D7S A;  2JS5 A;  3HKD A;  4DRX B;  3BHP A;  5KHI A;  5CA1 A;  4I4T B;  4GKK B;  3SJC C;  2BTQ A;  4O2A B;  4CH5 A;  4DR3 B;  4DUY B;  3JAK A;  1XQ8 A;  3BAB A;  4I55 A;  3RYH A;  4YJ2 A;  4AQY B;  1S5J A;  1XHZ A;  2E3C A;  4FLV A;  3CB2 A;  5BMV B;  3K59 A;  4ZI7 A;  1L8D A;  1JMK C;  4DR1 B;  4DR6 B;  4BWA A;  2PY5 A;  3E22 A;  2ZM6 B;  4TQD A;  3JAS B;  4KL1 A;  4O4H B;  1J5E B;  1Q43 A;  4FM1 A;  4X64 B;  3T1H B;  2F95 B;  3RYF B;  4AHC A;  4X1K B;  4EFB A;  4UCV A;  4DV5 B;  3OTO B;  1V9P A;  3WB2 A;  1YEW A;  2HEP A;  4O4L A;  4YHH B;  3K5N A;  5IJ0 B;  4U3J B;  1I94 B;  1XNR B;  5GON A;  4FLT A;  5FNV B;  1H2S B;  5C8Y A;  5EZY B;  4EEQ A;  3RYI A;  5JJE B;  4LF8 B;  3JAW B;  3SJA C;  1N36 B;  2YXL A;  4O4I A;  5IYZ B;  3BA8 A;  3BA9 A;  2RQ6 A;  4JI5 B;  2GV9 A;  2Q7E A;  4FVM A;  4DV6 B;  5D5Q A;  1WPB A;  4EB6 A;  4KHP B;  1Q3E A;  3SJB C;  5JQG A;  1JFF A;  2V4D A;  3JAK B;  5JCO A;  3U11 A;  4I55 B;  3RYH B;  5LXT A;  4TUY A;  2IM9 A;  5EYP B;  1HNX B;  4CH6 A;  5IWA B;  4CC5 A;  4JI6 B;  4K8Z A;  4LH7 A;  3A2F A;  4FLU A;  4X1I B;  3U0Z A;  5ITZ B;  5J2U B;  3HKE A;  1TGO A;  3JSL A;  4GLX A;  1O9G A;  4K0K B;  4X20 A;  5LA6 A;  4UCR A;  4CH4 A;  4ZHQ B;  4FFB B;  3T1Y B;  4LFA B;  5JH7 A;  3N2K A;  2YIA A;  1WN7 A;  1QQC A;  3UT5 A;  5LYJ B;  2UXC B;  4I50 A;  2UUA B;  3VQX A;  4CS3 A;  1O9H A;  2PYJ A;  4O2B A;  5K1P A;  2P22 C;  1SA0 B;  4NVP A;  4TV8 B;  2JGU A;  4DV4 B;  4IHJ B;  3SR2 C;  3JSN A;  3RYI B;  5LMN B;  5IJ9 A;  4JYA B;  2YI9 A;  2VWJ A;  3VQW A;  5JCO C;  2UUC B;  4O4I B;  3WB0 A;  5KX5 B;  4LF4 B;  4NXM B;  4DR2 B;  3BRC A;  4IIJ B;  1IBK B;  1HW7 A;  4LF5 B;  1TUB B;  4DV2 B;  3PN1 A;  4WBN A;  1XMO B;  2QJ1 A;  4HNA B;  1N34 B;  5CA0 A;  3U10 A;  2ZIN A;  4JI1 B;  4B3M B;  2OWO A;  1KU9 A;  4Q6G A;  1FFX A;  5KMG B;  4DV0 B;  1JJO A;  4ZOL B;  4K8X A;  4LF6 B;  4F6R B;  1SQF A;  2OYQ A;  4PHZ A;  3QG5 A;  3HKC B;  3N2G A;  1TVK A;  4UCS A;  1N33 B;  4BW9 A;  4O4J B;  3JAL A;  4TQF A;  5JVD A;  1WNS A;  1M4U A;  1XHX A;  3ETQ A;  4I9Q A;  4DR5 B;  3HKB A;  5LOV B;  3HKE B;  2ZIO A;  5J2T A;  4TV9 A;  4JV5 B;  3JAT A;  3RYC B;  1IBL B;  2VWK A;  3JAR A;  1Z5V A;  1TAE A;  3LNN A;  2YIB A;  3M7M X;  5LMU B;  4JI3 B;  4DRX A;  3RGB A;  4X1Y A;  4PI0 A;  3HKD B;  1VF7 A;  3N2K B;  2PZS A;  2RJZ A;  1N32 B;  4O2A A;  5CA1 B;  2R70 A;  2PUS A;  2BTQ B;  2Q7H A;  3UQ8 A;  3THO A;  2PYL A;  4JI7 B;  2VQE B;  5K1X A;  4NXN B;  4ZIB A;  4FLZ A;  2PGG A;  4YY3 B;  1FJG B;  4YJ2 B;  2Q0A A;  4AIL C;  5BMV A;  2R72 A;  4UCO A;  4ZI7 B;  4B08 A;  3E22 B;  4JI0 B;  2VQF B;  4O4H A;  5CA0 B;  3DSQ A;  1B04 A;  1D5A A;  3WB1 A;  1M5I A;  1QHT A;  3RYF A;  4CH3 A;  4X1K A;  4DV7 B;  3VQY A;  3N2G B;  2P5O A;  2YIB D;  1RSO A;  4LFB B;  4UCT A;  3K5L A;  2ZCE A;  4B3R B;  5IJ0 A;  4U3J A;  4O4L B;  5LP6 A;  5FNV A;  5GON B;  4HBN A;  2F1M A;  3K58 A;  4FLX A;  5C8Y B;  4TV9 B;  1X4T A;  4DV1 B;  1XI1 A;  5EIB D;  2UXB B;  3JAT B;  4JI4 B;  4LFC B;  3JAR B;  5FPR A;  5IYZ A;  5KHJ A;  4PI2 A;  4D7T A;  1SQG A;  4X1Y B;  4B3S B;  4X62 B;  2UU9 B;  3CHX A;  5KHH A;  3ZS8 C;  3RFR A;  3MAQ A;  4LNU A;  3K5M A;  4GYC B;  4EB6 B;  3ICX A;  2QM4 A;  5JQG B;  1JFF B;  1I7F A;  5EYP A;  5LXT B;  4OX9 B;  4TUY B;  2HHH B;  4X66 B;  2KKW A;  3OTF A;  5KHG A;  3BPZ A;  3VQV A;  4X1I A;  1XMQ B;  5ITZ A;  5J2U A;  1M93 A;  5LP6 C;  2Q7G A;  4LF9 B;  5CB4 A;  4YJ3 A;  4FLW A;  4CS2 A;  3B2E E;  2R9A A;  4CC6 A;  3IAY A;  2F4V B;  2JVD A;  4X20 B;  5LA6 B;  4X65 B;  4ZHQ A;  4DK0 A;  4FFB A;  1NT2 B;  1T5E A;  3QF7 A;  1Q8I A;  4DR7 B;  4LF7 B;  5LYJ A;  3FFQ A;  3SGI A;  4I4T A;  3QTC A;  5JH7 B;  3UT5 B;  3K57 A;  2F66 C;  1G6U A;  4I50 B;  4LH6 A;  5LP6 B;  4GKJ B;  1ZAU A;  1SA0 A;  4TV8 A;  4IHJ A;  4DR4 B;  4FM0 A;  4O2B B;  1Q5O A;  4UFZ A;  4DV3 B;  2ZNI A;  1SKV A;  4EFE A;  5IJ9 B;  2ZIM A;  1P49 A;  1Z5W A;  5KX5 A;  3ZED A;  4FM2 A;  4IIJ A;  2F93 B;  1TUB A;  2PTM A;  4HNA A;  3JAS A;  4DUZ B;  4WBN B;  5FPO A;  5JJJ B;  3RWR D;  4LNU B;  5D5P A;  5KMG A;  1TA8 A;  1HR0 B;  5KHK A;  2CAZ C;  4ZOL A;  1FFX B;  1KMI Z;  4F6R A;  5BR8 B;  3HKC A;  2EX3 A;  4CS4 A;  2BTO A;  1IBM B;  1TVK B;  4O4J A;  2ZNJ A;  1DGS A;  1HNW B;  4UCU A;  3JAL B;  4JI2 B;  5JVD B;  2E5L B;  1HNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...