1BL8A

Potassium channel (kcsa) from streptomyces lividans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the potassium channel: molecular basis of K+ conduction and selectivity.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords PROTEIN (POTASSIUM CHANNEL PROTEIN)
total genus 29
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bl8A00
3OUFA 3FB8C 3SPIA 4PA3A 4PDVA 3X2QC 2X6AA 2DYRC 4J9YB 3SPHA 1V55C 3AG3C 2EIMC 3ASOC 4MS2A 4H37A 1QLEC 4GX0A 2WLHA 4GX2A 3OGCC 4WFGA 3F7VC 3LNMB 4R50A 3AG1C 4RUFA 2X6CA 2BOBC 2X6BA 3AG4C 3OR6C 4MW8A 5B1AC 2ZXWC 3LUTB 2H8PC 4LP8A 2IH3C 3F5WC 4BW5A 1K4CC 3JYCA 5BZBA 3K0DA 4XDLA 4MVZA 4MTFA 2WLIA 4MSWC 4J9ZB 1V54C 3STZC 3K04A 2NLJC 4PA6A 1R3KC 4MW3A 1KKDA 1R3JC 3SYCA 4HZ3A 4ZBMA 4LBEC 4R8CA 3ZRSA 3LDDA 3FB6C 2Q6AA 3E8GA 3SPCA 4OXSA 3UKMA 5EC2C 3K03A 1S5HC 2A79B 3GB7C 1BL8A 2IH1C 3UM7A 3K0GA 2ATKC 3VOUA 1ZWIC 1M57C 4QNHB 2BOCC 4RUEA 4MTGA 4P9OA 4XDJA 2EIJC 3OR7C 3K06A 2P7TC 1R3LC 4X8AA 4MVSA 3K08A 1K4DC 4PDLA 3RW0A 3ABKC 5E1AC 4R7CA 3T4ZA 2DYSC 2EIKC 4MVQA 4PDRA 4WFHA 3SJQC 5EC1C 3SYPA 3T1CA 1OCRC 2WLNA 2K1EA 2DWDC 3E8HA 4LCUC 4MVUA 3ZJZA 2OCCC 2QKSA 3RBZA 4MVRA 5EBWC 2Q69A 1ORQC 2W0FC 3SPJA 4KFMA 1XL4A 4JTDB 4P30A 4PA4A 3PJSK 2DWEC 4X88A 3WG7C 2Q67A 1XL6A 5CBGA 4JTCB 2WLKA 4RAIA 3T2MA 4MVMA 3SYAA 2EILC 2WLLB 3HPLC 2HG5C 3TETA 2HVKC 2WLMA 4GX5A 4MTOA 1LNQA 3IGAC 4GX1A 3E8FA 1J95A 1JVMA 2HVJC 3LDCA 2HFEC 2AHZA 2ITDC 3ABLC 3SPGA 2AHYA 4EKWA 3E83A 3AG2C 2R9RB 4PA7A 4XDKA 2EINC 5EK0A 5EBMC 2ZD9A 3E89A 4PA9A 5B3SC 3KG2A 5CBFA 4MVOA 2WLIB 4P9PA 4TWKA 3RVYA 4WFFA 4QE9A 5J9PC 5KUKA 4I9WA 4P2ZA 4UUJC 2KB1A 4WFEA 3IFXA 4JTAB 3SYQA 1OCZC 1OCCC 1M56C 5IY5C 4G28B 2Q68A 3OUSA 3R65A 4G27B 2A0LA 3F7YC 3ASNC 3FB5C 3SYOA 4H33A 4PDMA 4R6ZA 3RVZA 2HJFC 3ABMC 3E8BA 3EFFK 1R3IC 5KUMA 4F4LA 5EBLC 4HYOA 3T4DA 1P7BA 2YEVA 3FB7C 4QE7A 3TCUA 3STLC 2A9HA 4X89A 4CBCA 4DXWA 1G4YB 3BEHA 1OCOC 3E86A 2Y69C 5CBHA 2ITCC 2WLJA 2JK5C 5B1BC 4RO2A 2WLLA 3LDEA 2QTOA
chains in the Genus database with same CATH superfamily
2ZR2A 3DSQA 3RT3C 1SS3A 1E79G 1FXKC 2DYRC 4YIPA 4DK1A 4MT8A 2QSAA 3BFRA 1QLEC 2UUBB 2Y69B 3H01A 4LF6O 1YJWV 4CH6A 2BOBC 1OCOB 4BW5A 3UCSC 2UXBO 2IU0A 2UXNA 3FAVB 4PA6A 1KKDA 1R3JC 2DYRB 4DR7O 4LF8B 1KB9F 1AVMA 1P7GA 5H2FZ 2JJ1G 4QIWF 4RUEA 3B77A 2XTAA 2R70A 3G67A 3S3WA 5CB4B 4FLTA 3MDSA 1K9MW 3WB0A 2OWOA 4GKKB 1OV9A 1WPXA 3OT7A 3R66A 5EC1C 1K5SA 2K1EA 2X7RB 4LF7O 2Q67A 4J80A 4JTCB 2P5OA 5JJNB 4ZI7A 2KG7B 1NI8A 3ZHUA 2QWNB 3SJCC 3S3XA 2HVKC 3CRMA 3CCMV 1NBMG 3D8CA 3APQA 2QWPB 4PI2A 5DM6V 5JH7A 4WFAV 2PI5A 3E89A 3RVYA 3OMNB 1US6A 3UO2A 4I4TB 2N74A 1EZJA 1P84F 3R65A 3E8BA 1MG1A 2UUCB 2B1GA 1WA8B 1MSWD 3QO5A 3AEIA 4JI7B 4K0KB 2UXXA 5IDJA 4JI6O 3WB1A 5TISZ 2ZM6B 4OX9O 1JFFB 2ETNA 3AG7A 3ZRWB 1BE3H 2Q0AA 1SF9A 1FXVA 2ZQMA 5C93A 1AJQA 1TUBA 4DW0A 2HR3A 2N04A 3OGIB 1XOUA 5JH7B 2Z5UA 2HKOA 1BCCH 4JI3B 1KU9A 1OJHA 4GCZA 1VQ9V 3HKCA 3JAWA 4LF9B 1AP6A 1IDSA 4JASA 3ZEDA 4TQDA 1L0NH 3FB6C 3K03A 5CA0A 1YHQV 3RYHA 4DV5B 4FFBB 2JEXA 5B1NA 3ZN0A 5LA6A 1VQ7V 2RNBA 3QG5A 3K06A 2IJIA 1PNKA 3L73H 2YEVB 4LFBB 1Z5VA 4DV2O 1W59A 4I55B 4NB5A 3SPJA 3PJSK 4YY3B 4JYYA 2PI4A 4B7KA 2WLKA 1K97A 4UVCA 1Z2GA 4O2BA 3SDLA 1BQZA 1XNQB 3FX7A 1Y76B 3IAYA 1BGYH 2WSSG 5CBFA 3CRCA 3TGUH 3KG2A 2XAHA 4WCEV 4LNUA 3O9OA 1SKVA 4TUYB 1M56C 2KQXA 1FFTB 5LMNO 5B1BB 1W0KG 3F7YC 4JYBA 1KUQA 2B9ZA 1P7BA 3EHBB 2QTSA 2FMLA 3T1YO 1OCOC 5CBHA 2GTSA 4LWSB 1HWYA 5KA5A 3LDEA 4FM2A 2N05A 2W6JG 4PA3A 4PDVA 3X2QC 4K35A 1GMGA 3SPHA 2Q9LA 3ASOC 1NH2D 1MSDA 2X0LA 2WPDG 4X65B 2QEXV 1M4UA 1MA1A 2D2CB 2HEPA 4UCRA 4X66O 1ZL8B 3K57A 2PGGA 2H8PC 3LUTB 2QDOA 5A2QN 2F93B 3ZHSA 4JYAB 3HKBB 3H1LH 1WB8A 1HW7A 1R3KC 4BIOA 2YIDA 4NXNB 4DUZB 4CH3A 1BL8A 5LP6C 2PYLA 3CE2A 3J80N 5IE9A 4CC6A 4FFBA 1ENVA 1R3LC 4MVSA 2EILB 1VQMV 4WFHA 4PD4F 3L72H 2Y0IA 3H1KH 4DV5O 3JD2A 2P06A 4IHJB 3G71V 2KKWA 2ZNJA 4J41A 3ZCCA 1M5IA 4RAIA 1M57B 4LNUB 4ABMA 4NKGB 1L0LH 1SERA 3P30A 2BSKA 3RGBA 2ZKOA 4XDKA 1HR0O 4ZKIA 5IYZB 4PA9A 1DF5A 4DV7B 2IU3A 2YXLA 1SA0B 4QJFB 3SYQA 3KCXA 3Q4HB 1NKDA 2QWQB 3UT5A 2RJZA 4X1KB 2CAZC 4L8JA 1RM1C 2LJ2A 2BSKB 1VARA 2A7WA 2K9PA 2BTOA 1PL4A 3A8TA 2GUZA 3FB8C 2Q8VA 3SPIA 3CCEV 2GSMB 3ETEA 3N2KB 4MS2A 1RPRA 3CC2V 3OFNG 4GX2A 3K5LA 1VQ4V 3C3SA 4UV9A 4DUYO 3AG4C 3P3PA 2VQFO 5BZBA 4LF5B 1FJGB 1VF7A 2LW1A 2WLIA 2R9AA 2VWJA 1L1FA 4OPHA 1QCEA 4R8CA 4CS4A 3HKEA 4IHJA 1JFFA 1WN7A 1SQXH 2YUAA 1M57C 4D7SA 3F5TA 1QHTA 1H2KA 5LGUA 4O2AA 1FYJA 4JV5O 4MVQA 2L6LA 3CCQV 2EX3A 2FB5A 3E35A 4Z2WA 2OIGA 2DQ3A 2JDIG 3MHSC 4X88A 2YSUB 3CPWU 4JI2B 5IYBO 1CEZA 2CTRA 3G80A 1PL0A 4DV4B 3SGIA 2M7WA 2HG5C 4IL6Z 5KX5A 4X64B 4Z1VA 1XHZA 5EZYB 1VQ5V 1RFYA 3LDCA 1ZL8A 2CUGA 4ZHQA 3G4SV 3ABLC 4FM1A 5IWAO 3E83A 1MMMA 2XAGA 4UUJC 1TVKB 3ETGA 3WU2Z 4JF3A 5F2VO 1BZKA 2Q5ZA 1NS1A 5KHIA 3ASNC 4CC5A 1B6QA 1DF4A 1M93A 2HJFC 2EIKB 3PN1A 2UUBO 4TV9B 4UCSA 4DV3B 3ASOB 3JALA 3AG4B 4IIJA 3RFRA 5KAFZ 4AHCA 2CTQA 4PI0A 3A0HZ 1NTMH 3A0RA 1GN4A 4FLZA 1Q86W 1UPGA 1AI7A 3UO3A 1YSCA 5KMGB 1S5LZ 2UUAO 5IYCO 4U3JA 3OGCC 3IJ4A 1YIJV 3BA9A 2ZE7A 2ZNIA 1HR0B 5B1AC 1VQOV 1BT8A 1XBLA 1K73W 3JATA 2CGOA 3QF7A 4MSWC 1V54C 1HNXB 2DYSB 3THOA 1FXKB 4RWUA 2LW7A 4X1YB 3MAQA 4XBFA 1HNZB 4DR2O 1XMOB 1T5EA 5EIBD 5LMUO 4J11A 4KHPB 3JAKA 4XDJA 3OMAB 1H38A 1O9GA 3OR7C 2UU9O 1EBOA 4K0KO 1JR9A 1PNMA 1LR1A 2YIBA 2ADPA 4LFBO 2WLNA 3AK2A 4DV2B 1AR5A 3RBZA 4MVRA 2QKAA 3JARA 4FLWA 1S3JA 1KP2A 1XL6A 5CBGA 2Z3YA 2HJDA 3QO8A 4F6RA 3T2MA 5L3FA 4YJ2B 1BMFG 1LNQA 2ZDIC 4ZOLB 1JMKC 3BA8A 1PNLA 1FXKA 4LF9O 1VEWA 1FPOA 3AG1B 3T1HB 1B04A 5KUKA 2JGUA 1Q6UA 2YC0A 4JI1O 1YJNV 3ML0A 1I5XA 5FNVA 2YS8A 2BE3A 2AZ0A 1H2SB 3GWKC 1NQTA 5KMGA 1XNRO 2NNUA 1DLBA 2Y69C 2IJJA 1Q7YW 2GBOA 2HP8A 4TT3G 3VQVA 2JGDB 3OUFA 5D5QA 4JI7O 2X6AA 2R9IA 3CCRV 3N27A 3AK1A 2LGWA 4TV9A 4X20A 4BIUA 1N34B 1IBKO 3H1HH 1WJZA 1HNZO 4O4JA 1EN4A 2BTQA 4O2BB 2GV9A 3L70H 5JQGB 1LUVA 2P4VA 3I55V 4YHHB 2P67A 3K5OA 4I55A 4YY3O 1N33O 5CN0A 3ZMSA 1IBLB 3T1YB 1SQPH 4H0LB 3JAKB 3SJBC 2HLDG 3L74H 4U7OA 4FJCC 2AZ2A 3B40A 1VF6A 3ZX6A 5L3CA 5AG2A 3AG2B 2QKSA 1ZUQA 4JAUA 4A5UB 4I50B 4I50A 1S5JA 5GONB 3CCJV 2UXCO 1F4MA 2ADQB 4JI1B 4DRXB 2OTJV 1L8DA 2JS3A 3BAAA 1SQVH 4EKWA 2EINC 1P49A 4DV7O 1Y67A 4DR3O 4LR3A 4X62O 1N32B 5CB4A 5IJ9A 5DEDA 2JGDA 4JGSA 4RQFA 1SQFA 2ZINA 1M1KW 3ABUA 4HYOA 4BW9A 4O4IB 3W7TA 2HHHB 4JI8O 1CPYA 5FPOA 5LXTB 1YXBA 1GTOA 4J9YB 1TUBB 2QE7G 2PYJA 4KL1A 4DUZO 2WLHA 4K3AA 2ZE8A 1F51A 3GWOA 5B3SB 3O65A 4RUFA 4FLXA 3ZRWA 4CZZA 1HNXO 3OR6C 3CYOA 4MW8A 1Q43A 3LSSA 5LL6Y 4B3TO 1MABG 4LP8A 1GN3A 3K79A 5CA0B 2IM9A 2NLJC 4B3SB 4LFCO 1V55B 3RYIA 2XUMA 3FFQA 4LF7B 3OE7G 4I5SA 5GW7A 3SPCA 1AB3A 1BHAA 2VQFB 2ATKC 1OZ0A 2R72A 4P9OA 2LP7A 1SQQH 4I0XA 1OCZB 5IJ0A 3ZIAG 5BMVA 1O9HA 2A3QA 3SYPA 1OCRC 4DV1O 3APOA 4EB6B 1VQNV 5LP6B 2CK3G 1XILA 4DW1A 2WWWA 4DV3O 4ZI7B 4X62B 1NZ6A 2XT9A 4FZ1A 4MTOA 4PJ0Z 3IGAC 2HVJC 2AHZA 1DTOA 2F1MA 4NVPA 2XASA 1OCRB 2KSDA 4U3JB 1I94O 2LQTA 3ZMUA 2PY5A 4YJ3B 1G8MA 4P9PA 4WFEA 4JTAB 2DJVA 1HDJA 1K3EA 2LGQA 1JJOA 2Q68A 3OUSA 3QNEA 4G27B 1FD9A 3B2EE 4JAAA 5H9CA 3ZRXA 4GKJB 4JYCA 4KP4A 4X89A 1SZTA 2CH7A 1G4YB 1Q82W 2W6IG 4TUYA 4D7TA 2G38A 3W7SA 3K5NA 2C2AA 3CD6V 1Y76A 1IXBA 2GTAA 2DOSA 5LMUB 1QQCA 1B3QA 4B3SO 1Y4MA 3JCUZ 3JASA 2P90A 1FAFA 3F5WC 4CS3A 1EFRG 1H2GA 4XDLA 1GH6A 2Q4PA 5ITZA 4TSFG 2IW5A 1JPXA 4LF5O 3H1IH 4Q20A 4JI0O 2AXTZ 1GN6A 1FS0G 2E74B 4OXSA 1URFA 1S5HC 3RYIB 4LH6A 1IBMB 3ABTA 4O4LB 1NH2B 2MK3A 1MZFA 3HKCB 3JAWB 4QNHB 3HKBA 4JI5B 5CA1A 1IX9A 1QVFU 1SA0A 1AJPA 5L3EA 1N36O 1EN5A 2P6JA 3ABKC 1V54B 1BHBA 1VF5B 3ZHVA 1ZTEA 5IYDO 1XMOO 2W0FC 5B1AB 4EFEA 3FKSG 3DC6A 5BXZA 1VMGA 2LO1A 1W0JG 2V4DA 3BPZA 3OM3B 2HFEC 1FKAO 5KA6A 1N32O 4UXNA 3Q4HA 3HKDB 2PZSA 3JCZA 4I9WA 4O4LA 4GYCB 3ZN1A 1R6NA 5LBQA 3D36A 3U11A 5JWPA 1R3IC 3K5MA 2UUAB 4F4LA 3RYCA 4W4KA 5LOVA 2JRIA 3CMAV 3RYFA 4FIPC 1QU7A 4CBCA 1WNSA 3B8NA 4DRXA 1Y74B 2ITCC 3K3WA 4TOIA 2JK5C 4TQFA 3CEIA 4RO2A 3K9AA 3NXSA 2QWOB 1Y6XA 2UXDB 2WAMA 2QGNA 1AI4A 1V55C 3M99B 4B3RB 3WB2A 3M7MX 2F95B 4R50A 3QO7A 1IBMO 4J10A 1K7DA 5IT9N 5FPRA 3JD4A 4MVZA 4MTFA 2YXHA 1GRJA 1N4CA 2ZE6A 2ZR3A 3SR2C 4LBEC 4NTYA 1N34O 2ZM6O 4JI4B 3ICXA 4UCUA 2ILMA 3BABA 1IXMA 1THZA 1JCHA 1NTZH 1WP8A 4PDLA 4R7CA 3T1CA 2VWKA 4FK5C 2EULA 3WFVA 4FLUA 4X20B 5LYJA 2VQEB 2OCCC 2ZIOA 3QVNA 4GT1A 4FLYA 3CRAA 1YI2V 5LHHA 3CJHA 4PA4A 4JZGA 4OGQB 1N36B 4B3MO 3CP1A 4YXWG 1Q90D 1R1BA 3DC5A 5LOVB 1BQ0A 3FAVA 1FFXB 3P32A 4QE9A 3FYEB 1K8AW 2ZIMA 1CP9A 3EXAA 4ICGA 3FB5C 1TUEB 3N2GA 1IURA 1GK9A 2OTLV 3EFFK 3GVMA 3W7WA 4UV8A 1JOYA 2QM7A 5JQGA 2ZE5A 4D6TH 1SQBH 2XAJA 1QR8A 3LSUA 1G1XB 4X1IA 3OEHG 2UUCO 4UFZA 1NR7A 4X1IB 2FKXA 5C8YB 3CXCU 2E75B 1P4RA 1M56B 1YTFD 4J42A 2B1IA 1SETA 4FLVA 4LC1A 4WFGA 3N2GB 4JZ2A 2VRZA 4JI4O 1M90W 3K0DA 1WP7A 2PTMA 3E2EA 4DR3B 1NTKH 2ARHA 1Z5WA 5LYJB 4H13B 1VIBA 4GUNA 3I5DA 1ZLZA 2M6YA 1AILA 5KX5B 4W4LA 4X64O 2VS0A 3FYIB 3A0BZ 1H2NA 1X59A 4B3MB 3K08A 3JASB 5KLVH 2E76B 3ABMB 4BIZA 3OW2U 4OPAA 4JV5B 1DK1A 5ITZB 4ZOLA 2XHBA 5H6QA 1HNWO 4GKJO 5K1XA 2DE0X 4RQEA 1KC8W 2EIMB 4LFAO 3C90A 1K92A 2AHYA 1OHHG 4WFBV 4AI8A 4E4EA 4X65O 1RPOA 1WAZA 4TWKA 4TV8A 4X66B 1PM9A 4TV8B 4JYAO 4UCTA 2EJRA 4AILC 1TVKA 2EZOA 1H8HG 3RVZA 1GAXA 1CXZB 2V7QG 1LUWA 2YDEA 4UCOA 5H5NA 4HNAA 4U7NA 1Y66A 3E86A 1PP9H 1IVSA 5D5PA 3CXHF 2EZPA 5GTHZ 5KHHA 2QTOA 4JI8B 1AR4A 2EIMC 3BRCA 2AGAA 3TJTA 1G6UA 1KP3A 4GX0A 5FLXN 2ODMA 4PHZA 4I9QA 2YI8A 4KHPO 5BMVB 4ZHQB 3KZIZ 1I5YA 1VQ6V 3DXRB 4DV0O 1K4CC 3JYCA 1D5NA 4NXNO 4KUMA 3ETQA 1AI5A 1Q5OA 5B1OA 1M9NA 4I7ZB 3OTOO 2Q6AA 2IBZH 4CS2A 2QJ1A 3JATB 1YDXA 3WG7B 1K5QA 3K0GA 4I4TA 1XNQO 2OCCB 3E22B 3VOUA 3CCUV 1TA8A 2YIAA 2AW9A 2ZXWB 2EIJC 1FXHA 2IJHA 4O4HB 2EIKC 3FD9A 2F23A 1PKXA 4MVUA 3ZHRA 5EBWC 3B8MA 3QTCA 3NR7A 4JTDB 4LF8O 2E5LB 4DO2A 2EINB 2L35A 3SYAA 2EILC 1ZSPA 1V9PA 4NR1A 2QA4V 1J95A 1JVMA 1KECA 3CSXA 2CDYA 2ITDC 5KHGA 5FL7G 3MHHC 2R9RB 5E79Z 2WLIB 4DUYB 4YJ2A 1GM9A 2JJ2G 5GONA 4B08A 3ETDA 3K9SA 3J7AU 1MOFA 4G28B 3SYOA 3ABLB 2RN9A 1SZXA 5JVDA 1Q6HA 4QE7A 4DV6O 5H6RA 4DV4O 5LGNA 1XNRB 4WBNA 5IJ9B 1YJ9V 4KXRA 3JARB 2WLLA 1AI6A 3E8GA 4UVBA 3G6BA 3OAAG 2YIBD 3AG3C 3L71H 4O4IA 1SESA 4H37A 2JIZG 3F7VC 1FJGO 1YCIA 4DR6B 4UB6Z 5JCOC 2ZT9B 2JS5A 4UVAA 3ZMZA 1XI1A 2V1DA 2CTPA 4PELA 2Q73A 5LA6B 3STZC 1S77D 3SYCA 3RYCB 3AG3B 1X4TA 4C7UA 1J5EB 4DV0B 2A79B 5KAIZ 5DN6G 1ZWIC 2Q7HA 4N21A 4DR1B 5IJ0B 5KHKA 2P4KA 2BTQB 3DXRA 5JJJB 5J2TA 3E22A 3VQWA 1QR9A 3ZJZA 3LNNA 4LF4B 2ZCEA 1XL4A 2DWEC 1QVGU 4CH4A 3I56V 3RN4A 1NT2B 3HPLC 4EB6A 1YTFB 3BVOA 1A32A 2PF4E 4IYHA 4GX1A 1I7FA 1R6KA 4HAMA 5EK0A 2ZD9A 3CB2A 4WFFA 4I0XB 4QPKA 1COWG 5IWAB 3JD1A 5IY5C 1WA8A 4H33A 4PDMA 4DV1B 2Y4TA 2A9HA 2NR5A 1RSOB 3BEHA 3CRRA 3A2FA 2ZDIA 2WLJA 3LSQA 3OMIB 3ASNB 3M8AA 4U3FH 3OTFA 4DV6B 1XMQO 5LMNB 4QGPA 3UQ8A 1PD3A 1D2DA 3LNMB 4J7ZA 1I08A 3U0ZA 3OD4A 2X6CA 4DR4B 2UXBB 2X6BA 1J5EO 2ZXWC 2D3OW 2XAQA 4IGGA 4HZ3A 5LHIA 3HR0A 5J2TB 4L87A 1KKCA 2Q0OC 4BWAA 2E3CA 2IH1C 3KKYA 3H9VA 2Y0PA 3D3QA 2BOCC 2B5UA 4MTGA 1JJ2U 2Y4UA 5EYPB 4O4JB 4DK0A 4K8XA 5L3BA 2E5LO 2DN9A 4X1KA 4DR5B 3E8HA 1NU1H 4H44B 4DR1O 1R6TA 3SJAC 2CE4A 2GUZB 2RQ6A 3J81N 4NTXA 1XQ8A 4NXMO 2LFRA 3H1JH 3VQXA 4YHHO 1KQSU 1YEWA 1HP8A 3P3NA 2EIJB 2WLMA 2A06H 3E8FA 3UT5B 3CX5F 1AROP 4K8ZA 3JSLA 1ZAUA 3JALB 2CTWA 3BY6A 4FPPA 2LFSA 3BCCH 4PA7A 5B3SC 3CCLV 3L75H 2H3OA 4FVMA 1HNWB 4UCVA 3U10A 1OCZC 2XNDG 3RYFB 3ABKB 3ABMC 1ZX3A 3CCSV 1EM1A 4NTWA 2Q7GA 3HKDA 3T4DA 1JX9A 2WA3A 5GTIZ 1AR1B 2F43G 4Z1MG 2QKCA 4DXWA 2BCCH 1YZBA 3EVKA 4AQYB 4LF4O 4GKKO 4OX9B 1YITV 5B1BC 4WF9V 5KUMA 3KCYA 1Y74A 1N0NA 1N8RW 1XDCA 1Q3EA 4NYKA 2PUSA 2UU9B 4DR7B 1NR1A 5L3GA 5FNVB 3T1HO 2IJKA 3TXQA 5HFMA 4LH7A 1S0VA 1F7YA 5HFLA 1E1QG 4J7JA 3BHPA 2GHYA 2KG7A 2P22C 1SQGA 3ZRVA 5K1PA 5A9GA 1VF6C 4HNAB 3ZRSA 1XREA 1XUQA 1SC5B 3N2KA 3UM7A 2YXYA 2Y48A 1U96A 3B4SA 2UXDO 2WA4A 2O57A 3ZHTA 4GZRB 2RDCA 4CH5A 5BR8O 1UFIA 2QM8A 1AJNA 5JVDB 2DWDC 5LXTA 2XOKG 1N0JA 1ORQC 3CS5A 4P30A 5B5EZ 2F4VB 1R73A 3CRQA 2WLLB 3CJHB 3TETA 4F6EA 5LGTA 1RM1B 1QLEB 3D3IA 4QPJA 4MVOA 4FM0A 5J9PC 2Q7EA 1F23A 4JI2O 3C3TA 1UJWB 1F4NA 4R6ZA 1XEQA 5EBLC 1H2LA 2YEVA 3FB7C 1KD1W 4DR5O 3STLC 3JD0A 5EZYA 1XMQB 4HBNA 3VBBA 3DTUB 3ZS8C 1N33B 1YF2A 2HHHO 1IBLO 3G6EV 3JSNA 3D36C 3AG1C 3MD0A 1IZ3A 1EZVH 1GM8A 2RMKB 4JI3O 2IH3C 2MW2B 5LHGA 4LFCB 1GO3F 5C8YA 1AP5A 4LF6B 1BSMA 2F66C 5DECA 3CC4V 4J7KA 4X1YA 1D5AA 3OEEG 4FMTA 1S76D 3LDDA 4O4HA 5EC2C 4N23A 3GB7C 2Z0AA 2EBOA 4O2AB 5L3DA 4PV1B 1K33A 1KBHA 4LWSA 1PPJH 2P7TC 4X8AA 3T4ZA 1K4DC 1KMIZ 4IT5A 3RW0A 4GLXA 1NVPB 4PDRA 3CWBH 2DMXA 2OT5A 3L9DA 4UB8Z 4EEQA 2YI9A 3DGEA 2JVDA 1DGSA 4BR6A 2DQ0A 2Q69A 1VQKV 4KFMA 3W7XA 3WG7C 4F6RB 4IIJB 3K59A 1Q8IA 4MVMA 1H8EG 4WBNB 3W7UA 1WPBA 2EJ7A 3HKEB 1EN6A 1GM7A 2XAFA 1JA8A 3SPGA 3TK1A 2OCHA 1ROPA 5EBMC 5EYPA 1YVWA 5CA3A 5J2UA 1VQ8V 4P2ZA 2KB1A 2FTKA 1TAEA 2OIEA 4FZ0A 4E2LA 1GN2A 4B3TB 1E1RG 5IYZA 2H94A 5BR8B 2DW4A 3K58A 1NJIW 1TGOA 1U97A 3RWRD 1GKFA 3HB3B 4DR2B 3ZHQA 3JAMN 3RYHB 5JJEB 5LP6A 1Q6IA 5J2UB 1B06A 3CC7V 3CHXA 2JEUA 3VQYA 1BS3A 1I94B 5CA1B 2QM4A 2OYQA 1H2MA 3ZBHA 5BY1A 4MTXA 2QWRB 1WLEA 5B66Z 1I0HA 4DR6O 1OCCB 4JI0B 1QNMA 2CH7B 1VQLV 1KYOF 4YJ3A 4EFBA 4J9ZB 3K04A 4BAYA 2GDSA 4MW3A 4NXMB 2FL4A 1S72V 4ZBMA 3CCVV 3UKMA 4DR4O 3ZMVA 4ASUG 1JQ0A 3AK3A 3B09A 5KHJA 3ZMTA 3JD3A 5EIBC 5IY5B 1NVPD 5E1AC 1W2BU 4IYIA 2F4VO 2DYSC 3SJQC 1WB7A 4G2KA 4JI5O 4LCUC 1K34A 4X9QA 2YICA 1XHXA 3TXSA 1RSOA 5JCOA 3OTOB 3X2QB 4YIOA 4GX5A 4JPRA 4FFKA 2W0XA 1VQPV 1MZEA 2CGNA 4LFAB 3AG2C 1QLNA 4DYLA 1RP3B 4ZIBA 1VP7A 4JAVA 2RCVA 3IFXA 1IBKB 1QBZA 1OCCC 3CMEV 3IC7A 2VQEO 2A0LA 4JI6B 2UXCB 4Q6GA 2NN4A 2FYUH 3TCUA 1SRYA 4AQYO 5CMUA 3IC9A 4B3RO 1MNGA 1PV0A 2QR4A 1Q81W 1FFXA 4B7EA
chains in the Genus database with same CATH topology
3NXSA 2ZR2A 2WAMA 1E79G 1AI4A 1FXKC 2DYRC 3A0RA 1V55C 3M99B 1Q86W 1AI7A 1YSCA 4MT8A 1QLEC 2Y69B 5IYCO 3H01A 3OGCC 1PD3A 1YIJV 3LNMB 4R50A 1YJWV 2X6CA 3QO7A 2BOBC 2X6BA 5B1AC 2ZXWC 1VQOV 2D3OW 1OCOB 1K73W 4BW5A 1K7DA 3JD4A 2IU0A 4MVZA 4MTFA 4MSWC 1V54C 2DYSB 2UXNA 4PA6A 1FXKB 2XAQA 1KKDA 1R3JC 2ZR3A 2DYRB 4HZ3A 5LHIA 4LBEC 4L87A 2IH1C 4XBFA 2JJ1G 4QIWF 2BOCC 4RUEA 2B5UA 3B77A 4MTGA 3OMAB 4XDJA 1H38A 1IXMA 1JJ2U 1JCHA 1THZA 3OR7C 1EBOA 1K9MW 1PNMA 1WPXA 4PDLA 5L3BA 4R7CA 3T1CA 5EC1C 4FK5C 3WFVA 2WLNA 1K5SA 2K1EA 3E8HA 2OCCC 3RBZA 4GT1A 4MVRA 1YI2V 2X7RB 5LHHA 4PA4A 1S3JA 2Q67A 1KP2A 1XL6A 5CBGA 2LFRA 2Z3YA 4JTCB 3QO8A 3T2MA 5L3FA 3CP1A 1KQSU 4YXWG 1BMFG 2EIJB 2HVKC 2WLMA 3CCMV 1LNQA 1NBMG 2ZDIC 3E8FA 1AROP 5DM6V 1PNLA 3BY6A 4FPPA 2LFSA 4WFAV 1FXKA 2PI5A 4PA7A 3AG1B 3E89A 5B3SC 3RVYA 3CCLV 3P32A 4QE9A 5KUKA 3FYEB 1K8AW 3OMNB 1EZJA 1CP9A 1OCZC 2XNDG 3R65A 1YJNV 3FB5C 3ML0A 3ABKB 1I5XA 1TUEB 3ABMC 1GK9A 3E8BA 3EFFK 3CCSV 2OTLV 3W7WA 1NQTA 3T4DA 4UV8A 1MG1A 1JX9A 1JOYA 2B1GA 2QM7A 1AR1B 2NNUA 2F43G 1MSWD 4Z1MG 4DXWA 1DLBA 2XAJA 3QO5A 2Y69C 1QR8A 2IJJA 3AEIA 1Q7YW 2UXXA 5IDJA 4TT3G 1YITV 5B1BC 3OEHG 4WF9V 5KUMA 1NR7A 3OUFA 3CXCU 1P4RA 2X6AA 2R9IA 1M56B 3CCRV 3ZRWB 1N8RW 1YTFD 1FXVA 2B1IA 1SETA 2ZQMA 5C93A 1AJQA 4LC1A 2HR3A 4WFGA 4BIUA 1NR1A 5L3GA 2IJKA 2Z5UA 2HKOA 5HFMA 1S0VA 5HFLA 4GCZA 1E1QG 1VQ9V 1M90W 3K0DA 2GHYA 3E2EA 3ZRVA 4JASA 3I55V 3ZRSA 2P67A 3FB6C 3K03A 1YHQV 3UM7A 2Y48A 2JEXA 5B1NA 3ZN0A 5CN0A 3ZMSA 3FYIB 1VQ7V 3K06A 2HLDG 2IJIA 1PNKA 3K08A 4FJCC 4U7OA 3ABMB 2YEVB 5L3CA 2QM8A 1AJNA 4BIZA 3AG2B 3OW2U 2DWDC 2QKSA 2XOKG 1ORQC 3SPJA 4P30A 3PJSK 4JAUA 1R73A 2PI4A 5H6QA 2WLKA 3CCJV 2WLLB 1F4MA 1K97A 4UVCA 3TETA 4RQEA 1KC8W 2OTJV 2EIMB 5LGTA 1K92A 2AHYA 1QLEB 1RM1B 4EKWA 1OHHG 4WFBV 2WSSG 3D3IA 1RPOA 2EINC 5CBFA 4QPJA 3KG2A 2XAHA 4MVOA 4TWKA 5J9PC 4WCEV 1F23A 2EJRA 1UJWB 1M56C 2EZOA 1FFTB 1H8HG 5B1BB 3F7YC 1F4NA 1W0KG 4JGSA 4JYBA 4R6ZA 3RVZA 4RQFA 1M1KW 3ABUA 5EBLC 2V7QG 4HYOA 1P7BA 1KD1W 2YEVA 3FB7C 3STLC 3EHBB 3JD0A 4U7NA 1Y66A 3W7TA 3E86A 1OCOC 5CBHA 1CPYA 2EZPA 3VBBA 1HWYA 5KA5A 3LDEA 2QTOA 3DTUB 2W6JG 4PA3A 4PDVA 3X2QC 1GTOA 1GMGA 4J9YB 2QE7G 3SPHA 2EIMC 3ASOC 1NH2D 2X0LA 2WPDG 3G6EV 1KP3A 4GX0A 2WLHA 2QEXV 1F51A 3GWOA 3AG1C 4RUFA 5B3SB 3ZRWA 3MD0A 4CZZA 3OR6C 3CYOA 1GM8A 1I5YA 4MW8A 3LSSA 1VQ6V 3LUTB 2H8PC 1MABG 4LP8A 2IH3C 5LHGA 1GO3F 3K79A 1K4CC 3JYCA 4KUMA 3CC4V 1AI5A 2NLJC 1R3KC 5B1OA 3OEEG 1M9NA 4FMTA 1V55B 3OE7G 1S76D 3LDDA 4I5SA 2Q6AA 5GW7A 3SPCA 5EC2C 4N23A 3GB7C 1BL8A 3WG7B 1BHAA 1K5QA 3K0GA 2ATKC 2OCCB 3VOUA 3CCUV 2EBOA 1OZ0A 5L3DA 2ZXWB 4P9OA 1K33A 2LP7A 2EIJC 1FXHA 1ENVA 1OCZB 2IJHA 2P7TC 1R3LC 4X8AA 4MVSA 3T4ZA 1K4DC 2EILB 3RW0A 3ZIAG 1VQMV 1NVPB 2EIKC 4PDRA 4WFHA 2OT5A 3SYPA 1OCRC 3JD2A 1PKXA 3DGEA 4MVUA 3G71V 2DQ0A 2Q69A 3B8MA 5EBWC 1VQKV 4KFMA 3W7XA 4JTDB 1VQNV 3ZCCA 3WG7C 4DO2A 2EINB 4RAIA 1M57B 4MVMA 2CK3G 3SYAA 2EILC 2WWWA 2QA4V 1H8EG 4MTOA 1SERA 3IGAC 3P30A 1J95A 1JVMA 1KECA 3W7UA 2HVJC 1GM7A 2AHZA 2XAFA 2ITDC 1DTOA 3SPGA 3TK1A 5FL7G 3MHHC 1ROPA 2XASA 1OCRB 2R9RB 4XDKA 4ZKIA 5EBMC 3ZMUA 4PA9A 2WLIB 1DF5A 1G8MA 4P9PA 2IU3A 5CA3A 1GM9A 2JJ2G 1VQ8V 4P2ZA 4QJFB 3ETDA 2KB1A 4WFEA 2FTKA 4JTAB 3SYQA 1K3EA 1MOFA 4G28B 2Q68A 3OUSA 3QNEA 4G27B 3SYOA 4E2LA 1NKDA 3ABLB 1E1RG 5H9CA 2H94A 3ZRXA 2DW4A 4QE7A 4JYCA 4KP4A 4X89A 5H6RA 1RM1C 1NJIW 1SZTA 1G4YB 1Q82W 5LGNA 2W6IG 1GKFA 3HB3B 1YJ9V 3E8GA 2WLLA 1AI6A 3W7SA 2C2AA 4UVBA 3FB8C 3SPIA 3CCEV 2GSMB 3ETEA 3OAAG 3CD6V 3AG3C 4MS2A 3CC7V 1RPRA 1SESA 2JEUA 4H37A 3CC2V 2JIZG 3OFNG 4GX2A 1VQ4V 1Y4MA 3F7VC 4UV9A 3AG4C 4UVAA 3ZMZA 2P90A 2V1DA 3F5WC 4MTXA 1EFRG 4PELA 1WLEA 5BZBA 1H2GA 1OCCB 4XDLA 1VQLV 2WLIA 4J9ZB 4TSFG 1L1FA 3STZC 3K04A 4BAYA 2IW5A 1S77D 1QCEA 4MW3A 1JPXA 3SYCA 4Q20A 3AG3B 4ZBMA 1S72V 4R8CA 3CCVV 3UKMA 1FS0G 4OXSA 1S5HC 2A79B 3ZMVA 4ASUG 1JQ0A 3ABTA 5DN6G 2MK3A 1NH2B 1ZWIC 1M57C 4QNHB 4N21A 3ZMTA 1QVFU 3JD3A 1AJPA 5IY5B 5L3EA 5LGUA 2P6JA 1NVPD 3ABKC 5E1AC 1W2BU 2DYSC 4MVQA 1V54B 3SJQC 1QR9A 1BHBA 4G2KA 3CCQV 4LCUC 3ZJZA 1K34A 3E35A 5IYDO 2W0FC 2DQ3A 2JDIG 1XL4A 3MHSC 2YSUB 4X88A 5B1AB 2DWEC 3CPWU 1QVGU 3FKSG 5IYBO 3I56V 1CEZA 1PL0A 3HPLC 1YTFB 2M7WA 2HG5C 3X2QB 1W0JG 4GX5A 4JPRA 4GX1A 3OM3B 1VQPV 1VQ5V 3LDCA 1R6KA 2HFEC 5KA6A 4UXNA 3G4SV 3ABLC 3K9AA 4HAMA 3E83A 3AG2C 1QLNA 5EK0A 2ZD9A 4WFFA 2XAGA 3JCZA 4JAVA 4I9WA 4UUJC 4QPKA 1COWG 3ETGA 3IFXA 3JD1A 1QBZA 1OCCC 4JF3A 5IY5C 3CMEV 3IC7A 2A0LA 3ASNC 4H33A 4PDMA 1B6QA 1DF4A 3ZN1A 1R6NA 5LBQA 2HJFC 2EIKB 3D36A 1R3IC 4F4LA 3CMAV 3ASOB 3TCUA 1SRYA 2A9HA 4FIPC 4CBCA 3AG4B 3BEHA 2ZDIA 3B8NA 3K3WA 2ITCC 5CMUA 2WLJA 2JK5C 3LSQA 3OMIB 1Q81W 4RO2A 3ASNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUF A;  3FB8 C;  3SPI A;  4PA3 A;  4PDV A;  3X2Q C;  2X6A A;  2DYR C;  4J9Y B;  3SPH A;  1V55 C;  3AG3 C;  2EIM C;  3ASO C;  4MS2 A;  4H37 A;  1QLE C;  4GX0 A;  2WLH A;  4GX2 A;  3OGC C;  4WFG A;  3F7V C;  3LNM B;  4R50 A;  3AG1 C;  4RUF A;  2X6C A;  2BOB C;  2X6B A;  3AG4 C;  3OR6 C;  4MW8 A;  5B1A C;  2ZXW C;  3LUT B;  2H8P C;  4LP8 A;  2IH3 C;  3F5W C;  4BW5 A;  1K4C C;  3JYC A;  5BZB A;  3K0D A;  4XDL A;  4MVZ A;  4MTF A;  2WLI A;  4MSW C;  4J9Z B;  1V54 C;  3STZ C;  3K04 A;  2NLJ C;  4PA6 A;  1R3K C;  4MW3 A;  1KKD A;  1R3J C;  3SYC A;  4HZ3 A;  4ZBM A;  4LBE C;  4R8C A;  3ZRS A;  3LDD A;  3FB6 C;  2Q6A A;  3E8G A;  3SPC A;  4OXS A;  3UKM A;  5EC2 C;  3K03 A;  1S5H C;  2A79 B;  3GB7 C;  1BL8 A;  2IH1 C;  3UM7 A;  3K0G A;  2ATK C;  3VOU A;  1ZWI C;  1M57 C;  4QNH B;  2BOC C;  4RUE A;  4MTG A;  4P9O A;  4XDJ A;  2EIJ C;  3OR7 C;  3K06 A;  2P7T C;  1R3L C;  4X8A A;  4MVS A;  3K08 A;  1K4D C;  4PDL A;  3RW0 A;  3ABK C;  5E1A C;  4R7C A;  3T4Z A;  2DYS C;  2EIK C;  4MVQ A;  4PDR A;  4WFH A;  3SJQ C;  5EC1 C;  3SYP A;  3T1C A;  1OCR C;  2WLN A;  2K1E A;  2DWD C;  3E8H A;  4LCU C;  4MVU A;  3ZJZ A;  2OCC C;  2QKS A;  3RBZ A;  4MVR A;  5EBW C;  2Q69 A;  1ORQ C;  2W0F C;  3SPJ A;  4KFM A;  1XL4 A;  4JTD B;  4P30 A;  4PA4 A;  3PJS K;  2DWE C;  4X88 A;  3WG7 C;  2Q67 A;  1XL6 A;  5CBG A;  4JTC B;  2WLK A;  4RAI A;  3T2M A;  4MVM A;  3SYA A;  2EIL C;  2WLL B;  3HPL C;  2HG5 C;  3TET A;  2HVK C;  2WLM A;  4GX5 A;  4MTO A;  1LNQ A;  3IGA C;  4GX1 A;  3E8F A;  1J95 A;  1JVM A;  2HVJ C;  3LDC A;  2HFE C;  2AHZ A;  2ITD C;  3ABL C;  3SPG A;  2AHY A;  4EKW A;  3E83 A;  3AG2 C;  2R9R B;  4PA7 A;  4XDK A;  2EIN C;  5EK0 A;  5EBM C;  2ZD9 A;  3E89 A;  4PA9 A;  5B3S C;  3KG2 A;  5CBF A;  4MVO A;  2WLI B;  4P9P A;  4TWK A;  3RVY A;  4WFF A;  4QE9 A;  5J9P C;  5KUK A;  4I9W A;  4P2Z A;  4UUJ C;  2KB1 A;  4WFE A;  3IFX A;  4JTA B;  3SYQ A;  1OCZ C;  1OCC C;  1M56 C;  5IY5 C;  4G28 B;  2Q68 A;  3OUS A;  3R65 A;  4G27 B;  2A0L A;  3F7Y C;  3ASN C;  3FB5 C;  3SYO A;  4H33 A;  4PDM A;  4R6Z A;  3RVZ A;  2HJF C;  3ABM C;  3E8B A;  3EFF K;  1R3I C;  5KUM A;  4F4L A;  5EBL C;  4HYO A;  3T4D A;  1P7B A;  2YEV A;  3FB7 C;  4QE7 A;  3TCU A;  3STL C;  2A9H A;  4X89 A;  4CBC A;  4DXW A;  1G4Y B;  3BEH A;  1OCO C;  3E86 A;  2Y69 C;  5CBH A;  2ITC C;  2WLJ A;  2JK5 C;  5B1B C;  4RO2 A;  2WLL A;  3LDE A;  2QTO A; 
#chains in the Genus database with same CATH topology
 2ZR2 A;  3DSQ A;  3RT3 C;  1SS3 A;  1E79 G;  1FXK C;  2DYR C;  4YIP A;  4DK1 A;  4MT8 A;  2QSA A;  3BFR A;  1QLE C;  2UUB B;  2Y69 B;  3H01 A;  4LF6 O;  1YJW V;  4CH6 A;  2BOB C;  1OCO B;  4BW5 A;  3UCS C;  2UXB O;  2IU0 A;  2UXN A;  3FAV B;  4PA6 A;  1KKD A;  1R3J C;  2DYR B;  4DR7 O;  4LF8 B;  1KB9 F;  1AVM A;  1P7G A;  5H2F Z;  2JJ1 G;  4QIW F;  4RUE A;  3B77 A;  2XTA A;  2R70 A;  3G67 A;  3S3W A;  5CB4 B;  4FLT A;  3MDS A;  1K9M W;  3WB0 A;  2OWO A;  4GKK B;  1OV9 A;  1WPX A;  3OT7 A;  3R66 A;  5EC1 C;  1K5S A;  2K1E A;  2X7R B;  4LF7 O;  2Q67 A;  4J80 A;  4JTC B;  2P5O A;  5JJN B;  4ZI7 A;  2KG7 B;  1NI8 A;  3ZHU A;  2QWN B;  3SJC C;  3S3X A;  2HVK C;  3CRM A;  3CCM V;  1NBM G;  3D8C A;  3APQ A;  2QWP B;  4PI2 A;  5DM6 V;  5JH7 A;  4WFA V;  2PI5 A;  3E89 A;  3RVY A;  3OMN B;  1US6 A;  3UO2 A;  4I4T B;  2N74 A;  1EZJ A;  1P84 F;  3R65 A;  3E8B A;  1MG1 A;  2UUC B;  2B1G A;  1WA8 B;  1MSW D;  3QO5 A;  3AEI A;  4JI7 B;  4K0K B;  2UXX A;  5IDJ A;  4JI6 O;  3WB1 A;  5TIS Z;  2ZM6 B;  4OX9 O;  1JFF B;  2ETN A;  3AG7 A;  3ZRW B;  1BE3 H;  2Q0A A;  1SF9 A;  1FXV A;  2ZQM A;  5C93 A;  1AJQ A;  1TUB A;  4DW0 A;  2HR3 A;  2N04 A;  3OGI B;  1XOU A;  5JH7 B;  2Z5U A;  2HKO A;  1BCC H;  4JI3 B;  1KU9 A;  1OJH A;  4GCZ A;  1VQ9 V;  3HKC A;  3JAW A;  4LF9 B;  1AP6 A;  1IDS A;  4JAS A;  3ZED A;  4TQD A;  1L0N H;  3FB6 C;  3K03 A;  5CA0 A;  1YHQ V;  3RYH A;  4DV5 B;  4FFB B;  2JEX A;  5B1N A;  3ZN0 A;  5LA6 A;  1VQ7 V;  2RNB A;  3QG5 A;  3K06 A;  2IJI A;  1PNK A;  3L73 H;  2YEV B;  4LFB B;  1Z5V A;  4DV2 O;  1W59 A;  4I55 B;  4NB5 A;  3SPJ A;  3PJS K;  4YY3 B;  4JYY A;  2PI4 A;  4B7K A;  2WLK A;  1K97 A;  4UVC A;  1Z2G A;  4O2B A;  3SDL A;  1BQZ A;  1XNQ B;  3FX7 A;  1Y76 B;  3IAY A;  1BGY H;  2WSS G;  5CBF A;  3CRC A;  3TGU H;  3KG2 A;  2XAH A;  4WCE V;  4LNU A;  3O9O A;  1SKV A;  4TUY B;  1M56 C;  2KQX A;  1FFT B;  5LMN O;  5B1B B;  1W0K G;  3F7Y C;  4JYB A;  1KUQ A;  2B9Z A;  1P7B A;  3EHB B;  2QTS A;  2FML A;  3T1Y O;  1OCO C;  5CBH A;  2GTS A;  4LWS B;  1HWY A;  5KA5 A;  3LDE A;  4FM2 A;  2N05 A;  2W6J G;  4PA3 A;  4PDV A;  3X2Q C;  4K35 A;  1GMG A;  3SPH A;  2Q9L A;  3ASO C;  1NH2 D;  1MSD A;  2X0L A;  2WPD G;  4X65 B;  2QEX V;  1M4U A;  1MA1 A;  2D2C B;  2HEP A;  4UCR A;  4X66 O;  1ZL8 B;  3K57 A;  2PGG A;  2H8P C;  3LUT B;  2QDO A;  5A2Q N;  2F93 B;  3ZHS A;  4JYA B;  3HKB B;  3H1L H;  1WB8 A;  1HW7 A;  1R3K C;  4BIO A;  2YID A;  4NXN B;  4DUZ B;  4CH3 A;  1BL8 A;  5LP6 C;  2PYL A;  3CE2 A;  3J80 N;  5IE9 A;  4CC6 A;  4FFB A;  1ENV A;  1R3L C;  4MVS A;  2EIL B;  1VQM V;  4WFH A;  4PD4 F;  3L72 H;  2Y0I A;  3H1K H;  4DV5 O;  3JD2 A;  2P06 A;  4IHJ B;  3G71 V;  2KKW A;  2ZNJ A;  4J41 A;  3ZCC A;  1M5I A;  4RAI A;  1M57 B;  4LNU B;  4ABM A;  4NKG B;  1L0L H;  1SER A;  3P30 A;  2BSK A;  3RGB A;  2ZKO A;  4XDK A;  1HR0 O;  4ZKI A;  5IYZ B;  4PA9 A;  1DF5 A;  4DV7 B;  2IU3 A;  2YXL A;  1SA0 B;  4QJF B;  3SYQ A;  3KCX A;  3Q4H B;  1NKD A;  2QWQ B;  3UT5 A;  2RJZ A;  4X1K B;  2CAZ C;  4L8J A;  1RM1 C;  2LJ2 A;  2BSK B;  1VAR A;  2A7W A;  2K9P A;  2BTO A;  1PL4 A;  3A8T A;  2GUZ A;  3FB8 C;  2Q8V A;  3SPI A;  3CCE V;  2GSM B;  3ETE A;  3N2K B;  4MS2 A;  1RPR A;  3CC2 V;  3OFN G;  4GX2 A;  3K5L A;  1VQ4 V;  3C3S A;  4UV9 A;  4DUY O;  3AG4 C;  3P3P A;  2VQF O;  5BZB A;  4LF5 B;  1FJG B;  1VF7 A;  2LW1 A;  2WLI A;  2R9A A;  2VWJ A;  1L1F A;  4OPH A;  1QCE A;  4R8C A;  4CS4 A;  3HKE A;  4IHJ A;  1JFF A;  1WN7 A;  1SQX H;  2YUA A;  1M57 C;  4D7S A;  3F5T A;  1QHT A;  1H2K A;  5LGU A;  4O2A A;  1FYJ A;  4JV5 O;  4MVQ A;  2L6L A;  3CCQ V;  2EX3 A;  2FB5 A;  3E35 A;  4Z2W A;  2OIG A;  2DQ3 A;  2JDI G;  3MHS C;  4X88 A;  2YSU B;  3CPW U;  4JI2 B;  5IYB O;  1CEZ A;  2CTR A;  3G80 A;  1PL0 A;  4DV4 B;  3SGI A;  2M7W A;  2HG5 C;  4IL6 Z;  5KX5 A;  4X64 B;  4Z1V A;  1XHZ A;  5EZY B;  1VQ5 V;  1RFY A;  3LDC A;  1ZL8 A;  2CUG A;  4ZHQ A;  3G4S V;  3ABL C;  4FM1 A;  5IWA O;  3E83 A;  1MMM A;  2XAG A;  4UUJ C;  1TVK B;  3ETG A;  3WU2 Z;  4JF3 A;  5F2V O;  1BZK A;  2Q5Z A;  1NS1 A;  5KHI A;  3ASN C;  4CC5 A;  1B6Q A;  1DF4 A;  1M93 A;  2HJF C;  2EIK B;  3PN1 A;  2UUB O;  4TV9 B;  4UCS A;  4DV3 B;  3ASO B;  3JAL A;  3AG4 B;  4IIJ A;  3RFR A;  5KAF Z;  4AHC A;  2CTQ A;  4PI0 A;  3A0H Z;  1NTM H;  3A0R A;  1GN4 A;  4FLZ A;  1Q86 W;  1UPG A;  1AI7 A;  3UO3 A;  1YSC A;  5KMG B;  1S5L Z;  2UUA O;  5IYC O;  4U3J A;  3OGC C;  3IJ4 A;  1YIJ V;  3BA9 A;  2ZE7 A;  2ZNI A;  1HR0 B;  5B1A C;  1VQO V;  1BT8 A;  1XBL A;  1K73 W;  3JAT A;  2CGO A;  3QF7 A;  4MSW C;  1V54 C;  1HNX B;  2DYS B;  3THO A;  1FXK B;  4RWU A;  2LW7 A;  4X1Y B;  3MAQ A;  4XBF A;  1HNZ B;  4DR2 O;  1XMO B;  1T5E A;  5EIB D;  5LMU O;  4J11 A;  4KHP B;  3JAK A;  4XDJ A;  3OMA B;  1H38 A;  1O9G A;  3OR7 C;  2UU9 O;  1EBO A;  4K0K O;  1JR9 A;  1PNM A;  1LR1 A;  2YIB A;  2ADP A;  4LFB O;  2WLN A;  3AK2 A;  4DV2 B;  1AR5 A;  3RBZ A;  4MVR A;  2QKA A;  3JAR A;  4FLW A;  1S3J A;  1KP2 A;  1XL6 A;  5CBG A;  2Z3Y A;  2HJD A;  3QO8 A;  4F6R A;  3T2M A;  5L3F A;  4YJ2 B;  1BMF G;  1LNQ A;  2ZDI C;  4ZOL B;  1JMK C;  3BA8 A;  1PNL A;  1FXK A;  4LF9 O;  1VEW A;  1FPO A;  3AG1 B;  3T1H B;  1B04 A;  5KUK A;  2JGU A;  1Q6U A;  2YC0 A;  4JI1 O;  1YJN V;  3ML0 A;  1I5X A;  5FNV A;  2YS8 A;  2BE3 A;  2AZ0 A;  1H2S B;  3GWK C;  1NQT A;  5KMG A;  1XNR O;  2NNU A;  1DLB A;  2Y69 C;  2IJJ A;  1Q7Y W;  2GBO A;  2HP8 A;  4TT3 G;  3VQV A;  2JGD B;  3OUF A;  5D5Q A;  4JI7 O;  2X6A A;  2R9I A;  3CCR V;  3N27 A;  3AK1 A;  2LGW A;  4TV9 A;  4X20 A;  4BIU A;  1N34 B;  1IBK O;  3H1H H;  1WJZ A;  1HNZ O;  4O4J A;  1EN4 A;  2BTQ A;  4O2B B;  2GV9 A;  3L70 H;  5JQG B;  1LUV A;  2P4V A;  3I55 V;  4YHH B;  2P67 A;  3K5O A;  4I55 A;  4YY3 O;  1N33 O;  5CN0 A;  3ZMS A;  1IBL B;  3T1Y B;  1SQP H;  4H0L B;  3JAK B;  3SJB C;  2HLD G;  3L74 H;  4U7O A;  4FJC C;  2AZ2 A;  3B40 A;  1VF6 A;  3ZX6 A;  5L3C A;  5AG2 A;  3AG2 B;  2QKS A;  1ZUQ A;  4JAU A;  4A5U B;  4I50 B;  4I50 A;  1S5J A;  5GON B;  3CCJ V;  2UXC O;  1F4M A;  2ADQ B;  4JI1 B;  4DRX B;  2OTJ V;  1L8D A;  2JS3 A;  3BAA A;  1SQV H;  4EKW A;  2EIN C;  1P49 A;  4DV7 O;  1Y67 A;  4DR3 O;  4LR3 A;  4X62 O;  1N32 B;  5CB4 A;  5IJ9 A;  5DED A;  2JGD A;  4JGS A;  4RQF A;  1SQF A;  2ZIN A;  1M1K W;  3ABU A;  4HYO A;  4BW9 A;  4O4I B;  3W7T A;  2HHH B;  4JI8 O;  1CPY A;  5FPO A;  5LXT B;  1YXB A;  1GTO A;  4J9Y B;  1TUB B;  2QE7 G;  2PYJ A;  4KL1 A;  4DUZ O;  2WLH A;  4K3A A;  2ZE8 A;  1F51 A;  3GWO A;  5B3S B;  3O65 A;  4RUF A;  4FLX A;  3ZRW A;  4CZZ A;  1HNX O;  3OR6 C;  3CYO A;  4MW8 A;  1Q43 A;  3LSS A;  5LL6 Y;  4B3T O;  1MAB G;  4LP8 A;  1GN3 A;  3K79 A;  5CA0 B;  2IM9 A;  2NLJ C;  4B3S B;  4LFC O;  1V55 B;  3RYI A;  2XUM A;  3FFQ A;  4LF7 B;  3OE7 G;  4I5S A;  5GW7 A;  3SPC A;  1AB3 A;  1BHA A;  2VQF B;  2ATK C;  1OZ0 A;  2R72 A;  4P9O A;  2LP7 A;  1SQQ H;  4I0X A;  1OCZ B;  5IJ0 A;  3ZIA G;  5BMV A;  1O9H A;  2A3Q A;  3SYP A;  1OCR C;  4DV1 O;  3APO A;  4EB6 B;  1VQN V;  5LP6 B;  2CK3 G;  1XIL A;  4DW1 A;  2WWW A;  4DV3 O;  4ZI7 B;  4X62 B;  1NZ6 A;  2XT9 A;  4FZ1 A;  4MTO A;  4PJ0 Z;  3IGA C;  2HVJ C;  2AHZ A;  1DTO A;  2F1M A;  4NVP A;  2XAS A;  1OCR B;  2KSD A;  4U3J B;  1I94 O;  2LQT A;  3ZMU A;  2PY5 A;  4YJ3 B;  1G8M A;  4P9P A;  4WFE A;  4JTA B;  2DJV A;  1HDJ A;  1K3E A;  2LGQ A;  1JJO A;  2Q68 A;  3OUS A;  3QNE A;  4G27 B;  1FD9 A;  3B2E E;  4JAA A;  5H9C A;  3ZRX A;  4GKJ B;  4JYC A;  4KP4 A;  4X89 A;  1SZT A;  2CH7 A;  1G4Y B;  1Q82 W;  2W6I G;  4TUY A;  4D7T A;  2G38 A;  3W7S A;  3K5N A;  2C2A A;  3CD6 V;  1Y76 A;  1IXB A;  2GTA A;  2DOS A;  5LMU B;  1QQC A;  1B3Q A;  4B3S O;  1Y4M A;  3JCU Z;  3JAS A;  2P90 A;  1FAF A;  3F5W C;  4CS3 A;  1EFR G;  1H2G A;  4XDL A;  1GH6 A;  2Q4P A;  5ITZ A;  4TSF G;  2IW5 A;  1JPX A;  4LF5 O;  3H1I H;  4Q20 A;  4JI0 O;  2AXT Z;  1GN6 A;  1FS0 G;  2E74 B;  4OXS A;  1URF A;  1S5H C;  3RYI B;  4LH6 A;  1IBM B;  3ABT A;  4O4L B;  1NH2 B;  2MK3 A;  1MZF A;  3HKC B;  3JAW B;  4QNH B;  3HKB A;  4JI5 B;  5CA1 A;  1IX9 A;  1QVF U;  1SA0 A;  1AJP A;  5L3E A;  1N36 O;  1EN5 A;  2P6J A;  3ABK C;  1V54 B;  1BHB A;  1VF5 B;  3ZHV A;  1ZTE A;  5IYD O;  1XMO O;  2W0F C;  5B1A B;  4EFE A;  3FKS G;  3DC6 A;  5BXZ A;  1VMG A;  2LO1 A;  1W0J G;  2V4D A;  3BPZ A;  3OM3 B;  2HFE C;  1FKA O;  5KA6 A;  1N32 O;  4UXN A;  3Q4H A;  3HKD B;  2PZS A;  3JCZ A;  4I9W A;  4O4L A;  4GYC B;  3ZN1 A;  1R6N A;  5LBQ A;  3D36 A;  3U11 A;  5JWP A;  1R3I C;  3K5M A;  2UUA B;  4F4L A;  3RYC A;  4W4K A;  5LOV A;  2JRI A;  3CMA V;  3RYF A;  4FIP C;  1QU7 A;  4CBC A;  1WNS A;  3B8N A;  4DRX A;  1Y74 B;  2ITC C;  3K3W A;  4TOI A;  2JK5 C;  4TQF A;  3CEI A;  4RO2 A;  3K9A A;  3NXS A;  2QWO B;  1Y6X A;  2UXD B;  2WAM A;  2QGN A;  1AI4 A;  1V55 C;  3M99 B;  4B3R B;  3WB2 A;  3M7M X;  2F95 B;  4R50 A;  3QO7 A;  1IBM O;  4J10 A;  1K7D A;  5IT9 N;  5FPR A;  3JD4 A;  4MVZ A;  4MTF A;  2YXH A;  1GRJ A;  1N4C A;  2ZE6 A;  2ZR3 A;  3SR2 C;  4LBE C;  4NTY A;  1N34 O;  2ZM6 O;  4JI4 B;  3ICX A;  4UCU A;  2ILM A;  3BAB A;  1IXM A;  1THZ A;  1JCH A;  1NTZ H;  1WP8 A;  4PDL A;  4R7C A;  3T1C A;  2VWK A;  4FK5 C;  2EUL A;  3WFV A;  4FLU A;  4X20 B;  5LYJ A;  2VQE B;  2OCC C;  2ZIO A;  3QVN A;  4GT1 A;  4FLY A;  3CRA A;  1YI2 V;  5LHH A;  3CJH A;  4PA4 A;  4JZG A;  4OGQ B;  1N36 B;  4B3M O;  3CP1 A;  4YXW G;  1Q90 D;  1R1B A;  3DC5 A;  5LOV B;  1BQ0 A;  3FAV A;  1FFX B;  3P32 A;  4QE9 A;  3FYE B;  1K8A W;  2ZIM A;  1CP9 A;  3EXA A;  4ICG A;  3FB5 C;  1TUE B;  3N2G A;  1IUR A;  1GK9 A;  2OTL V;  3EFF K;  3GVM A;  3W7W A;  4UV8 A;  1JOY A;  2QM7 A;  5JQG A;  2ZE5 A;  4D6T H;  1SQB H;  2XAJ A;  1QR8 A;  3LSU A;  1G1X B;  4X1I A;  3OEH G;  2UUC O;  4UFZ A;  1NR7 A;  4X1I B;  2FKX A;  5C8Y B;  3CXC U;  2E75 B;  1P4R A;  1M56 B;  1YTF D;  4J42 A;  2B1I A;  1SET A;  4FLV A;  4LC1 A;  4WFG A;  3N2G B;  4JZ2 A;  2VRZ A;  4JI4 O;  1M90 W;  3K0D A;  1WP7 A;  2PTM A;  3E2E A;  4DR3 B;  1NTK H;  2ARH A;  1Z5W A;  5LYJ B;  4H13 B;  1VIB A;  4GUN A;  3I5D A;  1ZLZ A;  2M6Y A;  1AIL A;  5KX5 B;  4W4L A;  4X64 O;  2VS0 A;  3FYI B;  3A0B Z;  1H2N A;  1X59 A;  4B3M B;  3K08 A;  3JAS B;  5KLV H;  2E76 B;  3ABM B;  4BIZ A;  3OW2 U;  4OPA A;  4JV5 B;  1DK1 A;  5ITZ B;  4ZOL A;  2XHB A;  5H6Q A;  1HNW O;  4GKJ O;  5K1X A;  2DE0 X;  4RQE A;  1KC8 W;  2EIM B;  4LFA O;  3C90 A;  1K92 A;  2AHY A;  1OHH G;  4WFB V;  4AI8 A;  4E4E A;  4X65 O;  1RPO A;  1WAZ A;  4TWK A;  4TV8 A;  4X66 B;  1PM9 A;  4TV8 B;  4JYA O;  4UCT A;  2EJR A;  4AIL C;  1TVK A;  2EZO A;  1H8H G;  3RVZ A;  1GAX A;  1CXZ B;  2V7Q G;  1LUW A;  2YDE A;  4UCO A;  5H5N A;  4HNA A;  4U7N A;  1Y66 A;  3E86 A;  1PP9 H;  1IVS A;  5D5P A;  3CXH F;  2EZP A;  5GTH Z;  5KHH A;  2QTO A;  4JI8 B;  1AR4 A;  2EIM C;  3BRC A;  2AGA A;  3TJT A;  1G6U A;  1KP3 A;  4GX0 A;  5FLX N;  2ODM A;  4PHZ A;  4I9Q A;  2YI8 A;  4KHP O;  5BMV B;  4ZHQ B;  3KZI Z;  1I5Y A;  1VQ6 V;  3DXR B;  4DV0 O;  1K4C C;  3JYC A;  1D5N A;  4NXN O;  4KUM A;  3ETQ A;  1AI5 A;  1Q5O A;  5B1O A;  1M9N A;  4I7Z B;  3OTO O;  2Q6A A;  2IBZ H;  4CS2 A;  2QJ1 A;  3JAT B;  1YDX A;  3WG7 B;  1K5Q A;  3K0G A;  4I4T A;  1XNQ O;  2OCC B;  3E22 B;  3VOU A;  3CCU V;  1TA8 A;  2YIA A;  2AW9 A;  2ZXW B;  2EIJ C;  1FXH A;  2IJH A;  4O4H B;  2EIK C;  3FD9 A;  2F23 A;  1PKX A;  4MVU A;  3ZHR A;  5EBW C;  3B8M A;  3QTC A;  3NR7 A;  4JTD B;  4LF8 O;  2E5L B;  4DO2 A;  2EIN B;  2L35 A;  3SYA A;  2EIL C;  1ZSP A;  1V9P A;  4NR1 A;  2QA4 V;  1J95 A;  1JVM A;  1KEC A;  3CSX A;  2CDY A;  2ITD C;  5KHG A;  5FL7 G;  3MHH C;  2R9R B;  5E79 Z;  2WLI B;  4DUY B;  4YJ2 A;  1GM9 A;  2JJ2 G;  5GON A;  4B08 A;  3ETD A;  3K9S A;  3J7A U;  1MOF A;  4G28 B;  3SYO A;  3ABL B;  2RN9 A;  1SZX A;  5JVD A;  1Q6H A;  4QE7 A;  4DV6 O;  5H6R A;  4DV4 O;  5LGN A;  1XNR B;  4WBN A;  5IJ9 B;  1YJ9 V;  4KXR A;  3JAR B;  2WLL A;  1AI6 A;  3E8G A;  4UVB A;  3G6B A;  3OAA G;  2YIB D;  3AG3 C;  3L71 H;  4O4I A;  1SES A;  4H37 A;  2JIZ G;  3F7V C;  1FJG O;  1YCI A;  4DR6 B;  4UB6 Z;  5JCO C;  2ZT9 B;  2JS5 A;  4UVA A;  3ZMZ A;  1XI1 A;  2V1D A;  2CTP A;  4PEL A;  2Q73 A;  5LA6 B;  3STZ C;  1S77 D;  3SYC A;  3RYC B;  3AG3 B;  1X4T A;  4C7U A;  1J5E B;  4DV0 B;  2A79 B;  5KAI Z;  5DN6 G;  1ZWI C;  2Q7H A;  4N21 A;  4DR1 B;  5IJ0 B;  5KHK A;  2P4K A;  2BTQ B;  3DXR A;  5JJJ B;  5J2T A;  3E22 A;  3VQW A;  1QR9 A;  3ZJZ A;  3LNN A;  4LF4 B;  2ZCE A;  1XL4 A;  2DWE C;  1QVG U;  4CH4 A;  3I56 V;  3RN4 A;  1NT2 B;  3HPL C;  4EB6 A;  1YTF B;  3BVO A;  1A32 A;  2PF4 E;  4IYH A;  4GX1 A;  1I7F A;  1R6K A;  4HAM A;  5EK0 A;  2ZD9 A;  3CB2 A;  4WFF A;  4I0X B;  4QPK A;  1COW G;  5IWA B;  3JD1 A;  5IY5 C;  1WA8 A;  4H33 A;  4PDM A;  4DV1 B;  2Y4T A;  2A9H A;  2NR5 A;  1RSO B;  3BEH A;  3CRR A;  3A2F A;  2ZDI A;  2WLJ A;  3LSQ A;  3OMI B;  3ASN B;  3M8A A;  4U3F H;  3OTF A;  4DV6 B;  1XMQ O;  5LMN B;  4QGP A;  3UQ8 A;  1PD3 A;  1D2D A;  3LNM B;  4J7Z A;  1I08 A;  3U0Z A;  3OD4 A;  2X6C A;  4DR4 B;  2UXB B;  2X6B A;  1J5E O;  2ZXW C;  2D3O W;  2XAQ A;  4IGG A;  4HZ3 A;  5LHI A;  3HR0 A;  5J2T B;  4L87 A;  1KKC A;  2Q0O C;  4BWA A;  2E3C A;  2IH1 C;  3KKY A;  3H9V A;  2Y0P A;  3D3Q A;  2BOC C;  2B5U A;  4MTG A;  1JJ2 U;  2Y4U A;  5EYP B;  4O4J B;  4DK0 A;  4K8X A;  5L3B A;  2E5L O;  2DN9 A;  4X1K A;  4DR5 B;  3E8H A;  1NU1 H;  4H44 B;  4DR1 O;  1R6T A;  3SJA C;  2CE4 A;  2GUZ B;  2RQ6 A;  3J81 N;  4NTX A;  1XQ8 A;  4NXM O;  2LFR A;  3H1J H;  3VQX A;  4YHH O;  1KQS U;  1YEW A;  1HP8 A;  3P3N A;  2EIJ B;  2WLM A;  2A06 H;  3E8F A;  3UT5 B;  3CX5 F;  1ARO P;  4K8Z A;  3JSL A;  1ZAU A;  3JAL B;  2CTW A;  3BY6 A;  4FPP A;  2LFS A;  3BCC H;  4PA7 A;  5B3S C;  3CCL V;  3L75 H;  2H3O A;  4FVM A;  1HNW B;  4UCV A;  3U10 A;  1OCZ C;  2XND G;  3RYF B;  3ABK B;  3ABM C;  1ZX3 A;  3CCS V;  1EM1 A;  4NTW A;  2Q7G A;  3HKD A;  3T4D A;  1JX9 A;  2WA3 A;  5GTI Z;  1AR1 B;  2F43 G;  4Z1M G;  2QKC A;  4DXW A;  2BCC H;  1YZB A;  3EVK A;  4AQY B;  4LF4 O;  4GKK O;  4OX9 B;  1YIT V;  5B1B C;  4WF9 V;  5KUM A;  3KCY A;  1Y74 A;  1N0N A;  1N8R W;  1XDC A;  1Q3E A;  4NYK A;  2PUS A;  2UU9 B;  4DR7 B;  1NR1 A;  5L3G A;  5FNV B;  3T1H O;  2IJK A;  3TXQ A;  5HFM A;  4LH7 A;  1S0V A;  1F7Y A;  5HFL A;  1E1Q G;  4J7J A;  3BHP A;  2GHY A;  2KG7 A;  2P22 C;  1SQG A;  3ZRV A;  5K1P A;  5A9G A;  1VF6 C;  4HNA B;  3ZRS A;  1XRE A;  1XUQ A;  1SC5 B;  3N2K A;  3UM7 A;  2YXY A;  2Y48 A;  1U96 A;  3B4S A;  2UXD O;  2WA4 A;  2O57 A;  3ZHT A;  4GZR B;  2RDC A;  4CH5 A;  5BR8 O;  1UFI A;  2QM8 A;  1AJN A;  5JVD B;  2DWD C;  5LXT A;  2XOK G;  1N0J A;  1ORQ C;  3CS5 A;  4P30 A;  5B5E Z;  2F4V B;  1R73 A;  3CRQ A;  2WLL B;  3CJH B;  3TET A;  4F6E A;  5LGT A;  1RM1 B;  1QLE B;  3D3I A;  4QPJ A;  4MVO A;  4FM0 A;  5J9P C;  2Q7E A;  1F23 A;  4JI2 O;  3C3T A;  1UJW B;  1F4N A;  4R6Z A;  1XEQ A;  5EBL C;  1H2L A;  2YEV A;  3FB7 C;  1KD1 W;  4DR5 O;  3STL C;  3JD0 A;  5EZY A;  1XMQ B;  4HBN A;  3VBB A;  3DTU B;  3ZS8 C;  1N33 B;  1YF2 A;  2HHH O;  1IBL O;  3G6E V;  3JSN A;  3D36 C;  3AG1 C;  3MD0 A;  1IZ3 A;  1EZV H;  1GM8 A;  2RMK B;  4JI3 O;  2IH3 C;  2MW2 B;  5LHG A;  4LFC B;  1GO3 F;  5C8Y A;  1AP5 A;  4LF6 B;  1BSM A;  2F66 C;  5DEC A;  3CC4 V;  4J7K A;  4X1Y A;  1D5A A;  3OEE G;  4FMT A;  1S76 D;  3LDD A;  4O4H A;  5EC2 C;  4N23 A;  3GB7 C;  2Z0A A;  2EBO A;  4O2A B;  5L3D A;  4PV1 B;  1K33 A;  1KBH A;  4LWS A;  1PPJ H;  2P7T C;  4X8A A;  3T4Z A;  1K4D C;  1KMI Z;  4IT5 A;  3RW0 A;  4GLX A;  1NVP B;  4PDR A;  3CWB H;  2DMX A;  2OT5 A;  3L9D A;  4UB8 Z;  4EEQ A;  2YI9 A;  3DGE A;  2JVD A;  1DGS A;  4BR6 A;  2DQ0 A;  2Q69 A;  1VQK V;  4KFM A;  3W7X A;  3WG7 C;  4F6R B;  4IIJ B;  3K59 A;  1Q8I A;  4MVM A;  1H8E G;  4WBN B;  3W7U A;  1WPB A;  2EJ7 A;  3HKE B;  1EN6 A;  1GM7 A;  2XAF A;  1JA8 A;  3SPG A;  3TK1 A;  2OCH A;  1ROP A;  5EBM C;  5EYP A;  1YVW A;  5CA3 A;  5J2U A;  1VQ8 V;  4P2Z A;  2KB1 A;  2FTK A;  1TAE A;  2OIE A;  4FZ0 A;  4E2L A;  1GN2 A;  4B3T B;  1E1R G;  5IYZ A;  2H94 A;  5BR8 B;  2DW4 A;  3K58 A;  1NJI W;  1TGO A;  1U97 A;  3RWR D;  1GKF A;  3HB3 B;  4DR2 B;  3ZHQ A;  3JAM N;  3RYH B;  5JJE B;  5LP6 A;  1Q6I A;  5J2U B;  1B06 A;  3CC7 V;  3CHX A;  2JEU A;  3VQY A;  1BS3 A;  1I94 B;  5CA1 B;  2QM4 A;  2OYQ A;  1H2M A;  3ZBH A;  5BY1 A;  4MTX A;  2QWR B;  1WLE A;  5B66 Z;  1I0H A;  4DR6 O;  1OCC B;  4JI0 B;  1QNM A;  2CH7 B;  1VQL V;  1KYO F;  4YJ3 A;  4EFB A;  4J9Z B;  3K04 A;  4BAY A;  2GDS A;  4MW3 A;  4NXM B;  2FL4 A;  1S72 V;  4ZBM A;  3CCV V;  3UKM A;  4DR4 O;  3ZMV A;  4ASU G;  1JQ0 A;  3AK3 A;  3B09 A;  5KHJ A;  3ZMT A;  3JD3 A;  5EIB C;  5IY5 B;  1NVP D;  5E1A C;  1W2B U;  4IYI A;  2F4V O;  2DYS C;  3SJQ C;  1WB7 A;  4G2K A;  4JI5 O;  4LCU C;  1K34 A;  4X9Q A;  2YIC A;  1XHX A;  3TXS A;  1RSO A;  5JCO A;  3OTO B;  3X2Q B;  4YIO A;  4GX5 A;  4JPR A;  4FFK A;  2W0X A;  1VQP V;  1MZE A;  2CGN A;  4LFA B;  3AG2 C;  1QLN A;  4DYL A;  1RP3 B;  4ZIB A;  1VP7 A;  4JAV A;  2RCV A;  3IFX A;  1IBK B;  1QBZ A;  1OCC C;  3CME V;  3IC7 A;  2VQE O;  2A0L A;  4JI6 B;  2UXC B;  4Q6G A;  2NN4 A;  2FYU H;  3TCU A;  1SRY A;  4AQY O;  5CMU A;  3IC9 A;  4B3R O;  1MNG A;  1PV0 A;  2QR4 A;  1Q81 W;  1FFX A;  4B7E A; 
#chains in the Genus database with same CATH homology
 3NXS A;  2ZR2 A;  2WAM A;  1E79 G;  1AI4 A;  1FXK C;  2DYR C;  3A0R A;  1V55 C;  3M99 B;  1Q86 W;  1AI7 A;  1YSC A;  4MT8 A;  1QLE C;  2Y69 B;  5IYC O;  3H01 A;  3OGC C;  1PD3 A;  1YIJ V;  3LNM B;  4R50 A;  1YJW V;  2X6C A;  3QO7 A;  2BOB C;  2X6B A;  5B1A C;  2ZXW C;  1VQO V;  2D3O W;  1OCO B;  1K73 W;  4BW5 A;  1K7D A;  3JD4 A;  2IU0 A;  4MVZ A;  4MTF A;  4MSW C;  1V54 C;  2DYS B;  2UXN A;  4PA6 A;  1FXK B;  2XAQ A;  1KKD A;  1R3J C;  2ZR3 A;  2DYR B;  4HZ3 A;  5LHI A;  4LBE C;  4L87 A;  2IH1 C;  4XBF A;  2JJ1 G;  4QIW F;  2BOC C;  4RUE A;  2B5U A;  3B77 A;  4MTG A;  3OMA B;  4XDJ A;  1H38 A;  1IXM A;  1JJ2 U;  1JCH A;  1THZ A;  3OR7 C;  1EBO A;  1K9M W;  1PNM A;  1WPX A;  4PDL A;  5L3B A;  4R7C A;  3T1C A;  5EC1 C;  4FK5 C;  3WFV A;  2WLN A;  1K5S A;  2K1E A;  3E8H A;  2OCC C;  3RBZ A;  4GT1 A;  4MVR A;  1YI2 V;  2X7R B;  5LHH A;  4PA4 A;  1S3J A;  2Q67 A;  1KP2 A;  1XL6 A;  5CBG A;  2LFR A;  2Z3Y A;  4JTC B;  3QO8 A;  3T2M A;  5L3F A;  3CP1 A;  1KQS U;  4YXW G;  1BMF G;  2EIJ B;  2HVK C;  2WLM A;  3CCM V;  1LNQ A;  1NBM G;  2ZDI C;  3E8F A;  1ARO P;  5DM6 V;  1PNL A;  3BY6 A;  4FPP A;  2LFS A;  4WFA V;  1FXK A;  2PI5 A;  4PA7 A;  3AG1 B;  3E89 A;  5B3S C;  3RVY A;  3CCL V;  3P32 A;  4QE9 A;  5KUK A;  3FYE B;  1K8A W;  3OMN B;  1EZJ A;  1CP9 A;  1OCZ C;  2XND G;  3R65 A;  1YJN V;  3FB5 C;  3ML0 A;  3ABK B;  1I5X A;  1TUE B;  3ABM C;  1GK9 A;  3E8B A;  3EFF K;  3CCS V;  2OTL V;  3W7W A;  1NQT A;  3T4D A;  4UV8 A;  1MG1 A;  1JX9 A;  1JOY A;  2B1G A;  2QM7 A;  1AR1 B;  2NNU A;  2F43 G;  1MSW D;  4Z1M G;  4DXW A;  1DLB A;  2XAJ A;  3QO5 A;  2Y69 C;  1QR8 A;  2IJJ A;  3AEI A;  1Q7Y W;  2UXX A;  5IDJ A;  4TT3 G;  1YIT V;  5B1B C;  3OEH G;  4WF9 V;  5KUM A;  1NR7 A;  3OUF A;  3CXC U;  1P4R A;  2X6A A;  2R9I A;  1M56 B;  3CCR V;  3ZRW B;  1N8R W;  1YTF D;  1FXV A;  2B1I A;  1SET A;  2ZQM A;  5C93 A;  1AJQ A;  4LC1 A;  2HR3 A;  4WFG A;  4BIU A;  1NR1 A;  5L3G A;  2IJK A;  2Z5U A;  2HKO A;  5HFM A;  1S0V A;  5HFL A;  4GCZ A;  1E1Q G;  1VQ9 V;  1M90 W;  3K0D A;  2GHY A;  3E2E A;  3ZRV A;  4JAS A;  3I55 V;  3ZRS A;  2P67 A;  3FB6 C;  3K03 A;  1YHQ V;  3UM7 A;  2Y48 A;  2JEX A;  5B1N A;  3ZN0 A;  5CN0 A;  3ZMS A;  3FYI B;  1VQ7 V;  3K06 A;  2HLD G;  2IJI A;  1PNK A;  3K08 A;  4FJC C;  4U7O A;  3ABM B;  2YEV B;  5L3C A;  2QM8 A;  1AJN A;  4BIZ A;  3AG2 B;  3OW2 U;  2DWD C;  2QKS A;  2XOK G;  1ORQ C;  3SPJ A;  4P30 A;  3PJS K;  4JAU A;  1R73 A;  2PI4 A;  5H6Q A;  2WLK A;  3CCJ V;  2WLL B;  1F4M A;  1K97 A;  4UVC A;  3TET A;  4RQE A;  1KC8 W;  2OTJ V;  2EIM B;  5LGT A;  1K92 A;  2AHY A;  1QLE B;  1RM1 B;  4EKW A;  1OHH G;  4WFB V;  2WSS G;  3D3I A;  1RPO A;  2EIN C;  5CBF A;  4QPJ A;  3KG2 A;  2XAH A;  4MVO A;  4TWK A;  5J9P C;  4WCE V;  1F23 A;  2EJR A;  1UJW B;  1M56 C;  2EZO A;  1FFT B;  1H8H G;  5B1B B;  3F7Y C;  1F4N A;  1W0K G;  4JGS A;  4JYB A;  4R6Z A;  3RVZ A;  4RQF A;  1M1K W;  3ABU A;  5EBL C;  2V7Q G;  4HYO A;  1P7B A;  1KD1 W;  2YEV A;  3FB7 C;  3STL C;  3EHB B;  3JD0 A;  4U7N A;  1Y66 A;  3W7T A;  3E86 A;  1OCO C;  5CBH A;  1CPY A;  2EZP A;  3VBB A;  1HWY A;  5KA5 A;  3LDE A;  2QTO A;  3DTU B;  2W6J G;  4PA3 A;  4PDV A;  3X2Q C;  1GTO A;  1GMG A;  4J9Y B;  2QE7 G;  3SPH A;  2EIM C;  3ASO C;  1NH2 D;  2X0L A;  2WPD G;  3G6E V;  1KP3 A;  4GX0 A;  2WLH A;  2QEX V;  1F51 A;  3GWO A;  3AG1 C;  4RUF A;  5B3S B;  3ZRW A;  3MD0 A;  4CZZ A;  3OR6 C;  3CYO A;  1GM8 A;  1I5Y A;  4MW8 A;  3LSS A;  1VQ6 V;  3LUT B;  2H8P C;  1MAB G;  4LP8 A;  2IH3 C;  5LHG A;  1GO3 F;  3K79 A;  1K4C C;  3JYC A;  4KUM A;  3CC4 V;  1AI5 A;  2NLJ C;  1R3K C;  5B1O A;  3OEE G;  1M9N A;  4FMT A;  1V55 B;  3OE7 G;  1S76 D;  3LDD A;  4I5S A;  2Q6A A;  5GW7 A;  3SPC A;  5EC2 C;  4N23 A;  3GB7 C;  1BL8 A;  3WG7 B;  1BHA A;  1K5Q A;  3K0G A;  2ATK C;  2OCC B;  3VOU A;  3CCU V;  2EBO A;  1OZ0 A;  5L3D A;  2ZXW B;  4P9O A;  1K33 A;  2LP7 A;  2EIJ C;  1FXH A;  1ENV A;  1OCZ B;  2IJH A;  2P7T C;  1R3L C;  4X8A A;  4MVS A;  3T4Z A;  1K4D C;  2EIL B;  3RW0 A;  3ZIA G;  1VQM V;  1NVP B;  2EIK C;  4PDR A;  4WFH A;  2OT5 A;  3SYP A;  1OCR C;  3JD2 A;  1PKX A;  3DGE A;  4MVU A;  3G71 V;  2DQ0 A;  2Q69 A;  3B8M A;  5EBW C;  1VQK V;  4KFM A;  3W7X A;  4JTD B;  1VQN V;  3ZCC A;  3WG7 C;  4DO2 A;  2EIN B;  4RAI A;  1M57 B;  4MVM A;  2CK3 G;  3SYA A;  2EIL C;  2WWW A;  2QA4 V;  1H8E G;  4MTO A;  1SER A;  3IGA C;  3P30 A;  1J95 A;  1JVM A;  1KEC A;  3W7U A;  2HVJ C;  1GM7 A;  2AHZ A;  2XAF A;  2ITD C;  1DTO A;  3SPG A;  3TK1 A;  5FL7 G;  3MHH C;  1ROP A;  2XAS A;  1OCR B;  2R9R B;  4XDK A;  4ZKI A;  5EBM C;  3ZMU A;  4PA9 A;  2WLI B;  1DF5 A;  1G8M A;  4P9P A;  2IU3 A;  5CA3 A;  1GM9 A;  2JJ2 G;  1VQ8 V;  4P2Z A;  4QJF B;  3ETD A;  2KB1 A;  4WFE A;  2FTK A;  4JTA B;  3SYQ A;  1K3E A;  1MOF A;  4G28 B;  2Q68 A;  3OUS A;  3QNE A;  4G27 B;  3SYO A;  4E2L A;  1NKD A;  3ABL B;  1E1R G;  5H9C A;  2H94 A;  3ZRX A;  2DW4 A;  4QE7 A;  4JYC A;  4KP4 A;  4X89 A;  5H6R A;  1RM1 C;  1NJI W;  1SZT A;  1G4Y B;  1Q82 W;  5LGN A;  2W6I G;  1GKF A;  3HB3 B;  1YJ9 V;  3E8G A;  2WLL A;  1AI6 A;  3W7S A;  2C2A A;  4UVB A;  3FB8 C;  3SPI A;  3CCE V;  2GSM B;  3ETE A;  3OAA G;  3CD6 V;  3AG3 C;  4MS2 A;  3CC7 V;  1RPR A;  1SES A;  2JEU A;  4H37 A;  3CC2 V;  2JIZ G;  3OFN G;  4GX2 A;  1VQ4 V;  1Y4M A;  3F7V C;  4UV9 A;  3AG4 C;  4UVA A;  3ZMZ A;  2P90 A;  2V1D A;  3F5W C;  4MTX A;  1EFR G;  4PEL A;  1WLE A;  5BZB A;  1H2G A;  1OCC B;  4XDL A;  1VQL V;  2WLI A;  4J9Z B;  4TSF G;  1L1F A;  3STZ C;  3K04 A;  4BAY A;  2IW5 A;  1S77 D;  1QCE A;  4MW3 A;  1JPX A;  3SYC A;  4Q20 A;  3AG3 B;  4ZBM A;  1S72 V;  4R8C A;  3CCV V;  3UKM A;  1FS0 G;  4OXS A;  1S5H C;  2A79 B;  3ZMV A;  4ASU G;  1JQ0 A;  3ABT A;  5DN6 G;  2MK3 A;  1NH2 B;  1ZWI C;  1M57 C;  4QNH B;  4N21 A;  3ZMT A;  1QVF U;  3JD3 A;  1AJP A;  5IY5 B;  5L3E A;  5LGU A;  2P6J A;  1NVP D;  3ABK C;  5E1A C;  1W2B U;  2DYS C;  4MVQ A;  1V54 B;  3SJQ C;  1QR9 A;  1BHB A;  4G2K A;  3CCQ V;  4LCU C;  3ZJZ A;  1K34 A;  3E35 A;  5IYD O;  2W0F C;  2DQ3 A;  2JDI G;  1XL4 A;  3MHS C;  2YSU B;  4X88 A;  5B1A B;  2DWE C;  3CPW U;  1QVG U;  3FKS G;  5IYB O;  3I56 V;  1CEZ A;  1PL0 A;  3HPL C;  1YTF B;  2M7W A;  2HG5 C;  3X2Q B;  1W0J G;  4GX5 A;  4JPR A;  4GX1 A;  3OM3 B;  1VQP V;  1VQ5 V;  3LDC A;  1R6K A;  2HFE C;  5KA6 A;  4UXN A;  3G4S V;  3ABL C;  3K9A A;  4HAM A;  3E83 A;  3AG2 C;  1QLN A;  5EK0 A;  2ZD9 A;  4WFF A;  2XAG A;  3JCZ A;  4JAV A;  4I9W A;  4UUJ C;  4QPK A;  1COW G;  3ETG A;  3IFX A;  3JD1 A;  1QBZ A;  1OCC C;  4JF3 A;  5IY5 C;  3CME V;  3IC7 A;  2A0L A;  3ASN C;  4H33 A;  4PDM A;  1B6Q A;  1DF4 A;  3ZN1 A;  1R6N A;  5LBQ A;  2HJF C;  2EIK B;  3D36 A;  1R3I C;  4F4L A;  3CMA V;  3ASO B;  3TCU A;  1SRY A;  2A9H A;  4FIP C;  4CBC A;  3AG4 B;  3BEH A;  2ZDI A;  3B8N A;  3K3W A;  2ITC C;  5CMU A;  2WLJ A;  2JK5 C;  3LSQ A;  3OMI B;  1Q81 W;  4RO2 A;  3ASN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...