1BL8A

Potassium channel (kcsa) from streptomyces lividans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (POTASSIUM CHANNEL PROTEIN)
publication title The structure of the potassium channel: molecular basis of K+ conduction and selectivity.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 29
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bl8A00
2EINC 4J9ZB 4MTOA 1OCRC 2K1EA 4MVOA 4JTCB 4G28B 2Q69A 3IGAC 4MVUA 3SPHA 3T4ZA 3K03A 4P30A 5B1BC 5EBWC 2A0LA 2BOCC 2ITDC 3BEHA 4KFMA 2EILC 3RW0A 1V54C 1OCCC 4WFGA 3FB8C 3ZJZA 2NLJC 2Y69C 4R6ZA 5KUKA 4R50A 4XDJA 2Q68A 2AHYA 2DYRC 3JYCA 4PDVA 2DYSC 5EC2C 4R8CA 1QLEC 4PDMA 5B1AC 3KG2A 3WG7C 2KB1A 3E8GA 2EIKC 5J9PC 3K0GA 3SPJA 3LNMB 4P9PA 4GX0A 1P7BA 2OCCC 4RUEA 2HFEC 1XL4A 3RBZA 3EFFK 3SPCA 3F7VC 4J9YB 2QTOA 2HVKC 3SYAA 4MS2A 3E8FA 3T1CA 4LBEC 5BZBA 1KKDA 2R9RB 3HPLC 3K06A 3LDDA 2W0FC 1V55C 5CBGA 4PA7A 4OXSA 2Q6AA 1ORQC 3R65A 4GX2A 2P7TC 2A79B 2YEVA 3SPIA 3SJQC 2WLJA 4MTGA 4TWKA 3UM7A 1J95A 3E89A 3ABMC 3T4DA 3LDCA 3ABKC 2DWDC 5B3SC 1LNQA 4DXWA 3ASOC 2WLLB 3SYOA 3FB6C 4XDKA 2WLNA 5CBFA 4PA3A 2DWEC 2H8PC 2Q67A 4MVRA 2HVJC 3TCUA 3LDEA 2ZXWC 1K4DC 3IFXA 1R3KC 1S5HC 4MW3A 2X6BA 3RVZA 2WLLA 3K08A 2ATKC 2EIJC 3LUTB 1G4YB 3OUSA 1JVMA 1K4CC 2JK5C 4LCUC 4LP8A 4R7CA 5EK0A 2WLHA 3K04A 4MW8A 4QE9A 3OUFA 3STZC 4F4LA 3F7YC 4BW5A 4PA6A 3PJSK 4QE7A 4RO2A 4ZBMA 3ASNC 3AG3C 4EKWA 2QKSA 3FB7C 3F5WC 1OCZC 1R3IC 3AG2C 4X8AA 4CBCA 4WFFA 4WFHA 3OR6C 4RAIA 5E1AC 4MVQA 2BOBC 3FB5C 4GX1A 4PDLA 3SYQA 5EBMC 3GB7C 4H33A 3AG4C 4MTFA 3E8BA 4PDRA 3SPGA 3UKMA 4HZ3A 2AHZA 4RUFA 4X89A 3AG1C 1R3JC 3E83A 3E8HA 3T2MA 2IH1C 4UUJC 2X6AA 2WLMA 2EIMC 2ZD9A 1XL6A 4MVMA 2HG5C 4HYOA 4P9OA 3OR7C 1BL8A 4PA9A 4WFEA 3ZRSA 1R3LC 2HJFC 4X88A 3STLC 4QNHB 4G27B 4MVZA 3VOUA 1OCOC 4I9WA 4JTAB 4GX5A 4JTDB 4H37A 2WLIB 5EBLC 4MVSA 2A9HA 3K0DA 3OGCC 5KUMA 3ABLC 2WLKA 4PA4A 3SYCA 5CBHA 4MSWC 5EC1C 5IY5C 3X2QC 2IH3C 1M57C 1M56C 4P2ZA 3SYPA 2X6CA 1ZWIC 3E86A 4XDLA 3RVYA 2ITCC 3TETA 2WLIA
chains in the Genus database with same CATH superfamily
1E1RG 5CA1A 1BHBA 1Y74A 4DV6O 1Q6UA 1RPRA 4DUZB 1HWYA 3IAYA 5IYZA 2QKCA 2EILC 3HKDB 4F6RB 1QR8A 2LQTA 2Y69C 4R6ZA 2LGWA 4XDJA 1VQNV 1P4RA 2DYSC 1GKFA 2Z3YA 4LF8O 1W2BU 2P5OA 4DW0A 1Q7YW 5KHIA 3RFRA 4RQFA 1DF4A 3RYIB 4Q20A 4LBEC 2GHYA 1NS1A 3JAKA 1Q8IA 1B04A 2CUGA 2R9RB 5KAIZ 1PD3A 4QGPA 2W0FC 2P6JA 3Q4HA 1WB8A 3SR2C 2YEVA 1BCCH 4FPPA 3SJQC 2EINB 2WLJA 1NBMG 3E89A 1FXKA 2DWDC 1DGSA 4JYAB 3ZMVA 4YXWG 4GT1A 5CBFA 1MOFA 5CA3A 4OX9O 1AP5A 2N74A 1XUQA 1F4NA 1WAZA 4O4LA 4KXRA 5FNVA 2OCCB 4LF4O 4R7CA 5LBQA 3BRCA 5KA5A 4X66B 3PJSK 1Y76A 4JGSA 1N36B 3WFVA 4KP4A 4YHHB 3UT5B 3K79A 2VWJA 3SGIA 3FB5C 5BMVB 5L3DA 2ARHA 5B1NA 2MW2B 1JX9A 4JYBA 5H5NA 4UCOA 3J80N 4CH4A 2ZE8A 1I94O 4PJ0Z 4GUNA 2HG5C 2PUSA 4JV5O 4ZKIA 1GO3F 1D5NA 4MVZA 3P32A 3JALA 1ZTEA 4LF9B 3P30A 2PTMA 4MVSA 1XNQB 4NXNB 2LFSA 3BAAA 2XTAA 4NVPA 2PYJA 1BGYH 5LHGA 2Y4TA 1PNLA 4JTCB 2Q69A 3SPHA 4LFAO 4JI0O 1ZUQA 2RN9A 2P90A 1BE3H 2NLJC 4JI1B 4X9QA 4FFBA 4CS2A 3CCQV 1K7DA 3E8GA 3B8MA 3K9AA 4DR4B 3N2KB 5EZYB 4E2LA 1K3EA 4Z2WA 4IIJA 1YJNV 4ZOLA 4J10A 3SPCA 2JGDB 3CCSV 4FM0A 3T1CA 1FAFA 3QO7A 3LDDA 1V55C 2DW4A 3BABA 3TXQA 2CGNA 4MTGA 2E76B 4U3JA 3LSQA 3JD4A 3E35A 1KYOF 2P4KA 4TUYA 3D3QA 2IU0A 3N2GA 2WLLA 4DR6B 1SQQH 1M1KW 1N34O 3OD4A 4ZBMA 4EKWA 2QKSA 1N0JA 1VF6C 4FJCC 3FAVB 2OT5A 2CH7B 3J7AU 4WFHA 2HHHB 4MVQA 4PDLA 1KMIZ 2DQ0A 3ABMB 3M8AA 4O4JA 4UVBA 1KKCA 1PNMA 2EBOA 1IZ3A 4LWSA 2HLDG 3AK2A 1BL8A 5AG2A 2CTPA 2E75B 3T1YB 4GCZA 3RT3C 4DK0A 3MAQA 3B8NA 1IXMA 4W4LA 2EIJB 5CA0B 1J5EB 1YTFD 2R9IA 3ASNB 4CZZA 1GTOA 1L0LH 4J9ZB 3THOA 1OCRC 2EX3A 4DUYO 1YTFB 5EYPB 1QQCA 2JEXA 5LP6B 5JH7A 2V7QG 4FLTA 3AG1B 3RYFB 1X59A 1NH2D 4R50A 5EC2C 2KB1A 3LNMB 3OMIB 1NH2B 1D5AA 1UPGA 3W7XA 4O2AA 1GN6A 4UB6Z 1KECA 3F7VC 4J9YB 2RQ6A 4KL1A 1IBLB 3C90A 4X1KA 5CBGA 3BHPA 1ORQC 1SC5B 2JS3A 4IHJB 4LF7B 4X65B 1ZL8B 4I9QA 1FJGB 2CAZC 4PI0A 4U3FH 1XHXA 3HR0A 3WB0A 2EILB 4C7UA 2Y69B 1JFFB 2Y4UA 2DYSB 1SZXA 2VS0A 4ABMA 3CRCA 1DK1A 3OUFA 4JPRA 2ZR2A 1NKDA 3GWKC 5C8YB 3B09A 4UCVA 1SRYA 3CD6V 1SESA 3CMAV 4DR2O 2UXDO 3NR7A 5EIBC 4B3MO 1HNWB 5EBMC 1F51A 2RNBA 1WB7A 2VQEB 4PDRA 4FLYA 4QPKA 2AHZA 2IH1C 2PI5A 2BE3A 4I55A 1YI2V 3OR7C 3DC5A 1ZLZA 4LFBB 3ZN1A 2XOKG 1IBKO 4CH6A 5L3CA 2A9HA 1H8EG 4K35A 2WLKA 2YXLA 4JI4O 2ITCC 4J7KA 4BIUA 4G28B 2WPDG 2E3CA 3G4SV 5JJNB 3CX5F 3BA9A 5D5PA 1K33A 3BEHA 4KFMA 1IVSA 4JAVA 1JJOA 1HNZB 3OT7A 1JOYA 4B3RB 3L73H 1E79G 5J9PC 3C3SA 4P9PA 1K92A 4DR5O 1XOUA 4F6RA 3HKDA 5GONB 3SDLA 5J2TB 4DR3O 2QWOB 1I0HA 2ZDIA 1US6A 2Q6AA 4CS3A 3CRQA 3RYIA 3LDCA 2AXTZ 2G38A 3LSUA 4ZIBA 2ZQMA 1G6UA 2UXCO 4PI2A 2ADQB 2H8PC 2P06A 4MVRA 2UUBO 1YDXA 1H2NA 1JR9A 4CC5A 1S5HC 3ABUA 2X6BA 4PHZA 1MSDA 2Z5UA 1VARA 2JK5C 3TCUA 4GKJB 5LL6Y 5IYBO 4LF6O 1V55B 3BY6A 4GLXA 1KU9A 2X0LA 2FTKA 3E8BA 3QNEA 4HZ3A 1OCZB 2L35A 3A2FA 3E8HA 2OTJV 1H38A 1VQ9V 3H9VA 4I4TB 3UT5A 3OEEG 3APOA 5LHIA 5BMVA 1XL6A 1KB9F 4HYOA 5LHHA 4PA9A 4N23A 4JI3O 2GV9A 2HJFC 1NR7A 4X20B 3LSSA 1Y67A 1I5YA 2EJRA 1A32A 3CC7V 2JDIG 1BSMA 1M5IA 1GM8A 1MG1A 2V1DA 2IJIA 1EN4A 1N32O 1BS3A 3T4ZA 2YUAA 5JCOC 1N4CA 4DV0O 3JASB 2NN4A 1M9NA 2A3QA 4PDVA 4NR1A 3DGEA 4JI6O 4R8CA 1QLEC 3SPJA 2JJ1G 2JS5A 4DYLA 4BIOA 1M93A 3AEIA 3RBZA 4JV5B 3SYAA 3SJBC 4MS2A 3JATB 1FPOA 5EZYA 1NR1A 3JAMN 5GTIZ 2JGDA 3CRAA 2YC0A 4DV7B 4AI8A 3D8CA 3CCVV 3K58A 4O4HB 4E4EA 3J81N 2KKWA 1H2KA 4FZ1A 5B5EZ 2PI4A 3CRRA 3OTOO 1ENVA 3C3TA 2WLHA 1B06A 2R72A 1KC8W 2QE7G 2F4VB 4TQFA 3MDSA 5BR8B 1Y66A 1SKVA 3CJHB 3PN1A 5FLXN 3VBBA 3NXSA 1O9HA 2QDOA 1K73W 2DMXA 3FAVA 4O2BB 2CH7A 1QNMA 1Q82W 1VQ8V 1SQFA 5J2UB 3CCJV 3WB2A 1G8MA 4H37A 3L74H 2LGQA 2RCVA 3SYCA 5CBHA 1L1FA 1I5XA 4TT3G 5EIBD 3HKEB 1H8HG 3CXHF 1MA1A 3K5MA 5CA0A 4DR7B 4JZ2A 1SZTA 3OFNG 5IE9A 3ZBHA 3ZHRA 1N33B 5LA6B 3RW0A 1OCCC 3JSNA 5EYPA 3R66A 5LP6A 3W7WA 4HNAB 3RYFA 5KLVH 3F5TA 2KQXA 4I5SA 4DV4B 4LFCO 1FS0G 1WNSA 4EB6B 4FLVA 2ZM6O 5FPRA 4BW9A 2JIZG 1E1QG 4PV1B 2DQ3A 5HFLA 1VP7A 3KKYA 3ZHUA 1EM1A 5LGUA 4IT5A 4B3TO 4DUYB 4IHJA 3FB6C 3HKCB 1K5QA 1TA8A 1ZL8A 5F2VO 5LMNO 3RVZA 2UUAO 3JCZA 4QE7A 4CC6A 3D36C 1PL0A 5JJEB 1KBHA 3IC7A 4QIWF 1EN6A 2ZIMA 4H33A 5C8YA 3CRMA 4TSFG 1PM9A 2JEUA 1Y6XA 4X62O 2GSMB 1SERA 1QBZA 2WLMA 3FFQA 4UCTA 5ITZB 2ZD9A 2VQFO 3AG4B 2E74B 1XNRB 1R6TA 5GTHZ 2CK3G 4GX5A 1S5JA 2WLIB 3ZRVA 5LGTA 4W4KA 2N04A 4PA4A 3UO2A 4XBFA 2F43G 3BPZA 2ADPA 3AK3A 1MZEA 1RM1C 4IYHA 1WPXA 1COWG 1XQ8A 2LO1A 4BWAA 5JWPA 3JD3A 3ZS8C 3ZHSA 4EEQA 4ASUG 3T1HO 3A8TA 2Q9LA 3A0HZ 1KUQA 5B1BC 4FLXA 3HKBB 4LH6A 4NXMB 1RP3B 5KHJA 2CTQA 4B3MB 1EBOA 4WFGA 3FB8C 1VQ7V 3ZJZA 2OWOA 2DE0X 4EFEA 1Q5OA 5B1AC 3ZCCA 3FX7A 2QTSA 2HFEC 1NU1H 2BTQA 1TGOA 3OGIB 1IBKB 2UU9O 2Y0IA 3CC4V 3WU2Z 4X1YB 2UUCO 1XMOO 1EZJA 3SPIA 2E5LO 4JI4B 4TWKA 2GDSA 4FLUA 1YEWA 1SS3A 3DXRB 5J2TA 2LJ2A 1LNQA 4DXWA 1AI6A 1AI4A 3ZHTA 2R9AA 4B08A 3H1JH 1K4DC 2HKOA 1B3QA 3IFXA 1QLEB 3ZIAG 1HR0B 1G4YB 1K4CC 3STZC 3ZHVA 1T5EA 4BW5A 4PA6A 4KHPO 4RQEA 1XMQO 1U97A 1OCZC 1AJNA 4JYCA 3CCUV 1M90W 3BA8A 5LYJB 2XT9A 3G6EV 1AR1B 4UCSA 4DV5O 2HR3A 4UVAA 4GKKB 1R3LC 4UV8A 3BFRA 3ZMTA 4TOIA 1F23A 2AZ2A 3VOUA 3CWBH 2UXCB 3CCRV 1SQXH 3SJCC 4JF3A 3VQYA 4K8ZA 2IH3C 2YXHA 4X20A 3L72H 1IBMB 1H2LA 2X6CA 2XAJA 1AB3A 2IM9A 1PL4A 5LMUO 4MTOA 1XILA 2K1EA 4MVOA 2P22C 3CXCU 1PP9H 4X1IB 5EBWC 1VF6A 2UXXA 2OIEA 2DYRC 4DV2O 2CTWA 4K3AA 1WA8B 4JI8O 2X7RB 1LR1A 3K5OA 1XL4A 4MTXA 1S77D 3JASA 2QEXV 3I5DA 5KA6A 5KHHA 2OYQA 3P3NA 1UFIA 2LP7A 1MNGA 3L70H 1R73A 1K5SA 3JAWB 1AVMA 2A7WA 5KHGA 1L0NH 3JATA 4J41A 4DUZO 3ABKC 5DM6V 3O65A 3N27A 4U7OA 2GUZB 5IWAB 1OCCB 2Q4PA 1IXBA 3FKSG 1OZ0A 2DOSA 2ZXWC 1P49A 1ZSPA 3S3XA 2RMKB 1KP2A 4FFKA 4O4HA 5KUKA 1IURA 2QM7A 3A0RA 4YY3B 1Y74B 1IDSA 4CBCA 2XAFA 2QGNA 4A5UB 1BT8A 3E83A 4JYAO 3CJHA 4I0XB 3OEHG 2H3OA 5BXZA 1OCOC 1FXVA 1GM7A 4O2BA 5CN0A 1YITV 2ILMA 4J7ZA 3WB1A 5J2UA 4X66O 5EC1C 2F1MA 1N36O 3OTOB 2VRZA 3TETA 1AILA 2FB5A 4UCUA 5L3GA 3U10A 4ICGA 3ZMUA 3HKEA 2ZKOA 1VMGA 4O4IB 4JZGA 2W6JG 4PDMA 3KG2A 5JQGB 1XEQA 4IGGA 2LW7A 1SQVH 3RN4A 1XNQO 3FD9A 3UCSC 2BTOA 4JI5O 3ETQA 4JAUA 3E8FA 4NXNO 4DR1B 3EHBB 4HNAA 2D3OW 4DV1O 2MK3A 1IX9A 3DC6A 1RM1B 1JQ0A 4OXSA 3JARB 4EB6A 1P84F 2FL4A 3K5NA 3ZN0A 2FMLA 4D7SA 5B1BB 3EXAA 2QWPB 4PA3A 1Q6HA 1JA8A 1GN4A 1Z5VA 1YHQV 5B1AB 4G2KA 2WSSG 3HKCA 3ZMZA 2GTAA 2YICA 5EK0A 4NTXA 3MD0A 2BSKB 1BZKA 5H6QA 4Z1MG 3FB7C 4WFBV 2BCCH 3TXSA 3JD1A 2DN9A 2C2AA 2PF4E 3OR6C 4DV6B 3KZIZ 4MTFA 3AG4C 3UKMA 3ZX6A 3JD0A 4TV8B 1Z2GA 3OAAG 1FD9A 4FFBB 4B3TB 4WFEA 1EZVH 4WBNB 4LF8B 3STLC 1DLBA 4Q6GA 4DR6O 4YJ2B 2QM8A 5ITZA 4WF9V 5KUMA 3ABLC 3G80A 2EJ7A 1CPYA 2ETNA 1M56C 2WLIA 3G71V 1FFTB 2ZE5A 4U3JB 2KSDA 1KD1W 3K03A 5H2FZ 2QWQB 5KAFZ 3S3WA 2UXBO 1V54C 4NTWA 4D6TH 4BR6A 4WFAV 1XBLA 2AHYA 1WN7A 4DRXB 3I55V 3WG7C 3K59A 4OX9B 3T1YO 4X62B 3HKBA 4RUEA 4K0KO 4AHCA 2QM4A 1J5EO 4HBNA 4LF4B 3ETGA 4LH7A 4FM2A 2ZIOA 2A79B 1ZAUA 2LW1A 2DJVA 1XREA 2XNDG 4FLWA 4K8XA 2Y48A 4X1YA 1VF5B 3RWRD 1RPOA 2Y0PA 1ROPA 3T1HB 1I94B 2RJZA 1UJWB 5HFMA 3UO3A 5JCOA 3DXRA 2DYRB 4J42A 1XI1A 1NQTA 4J11A 5KX5B 4MW3A 2VWKA 3B40A 4JYYA 2F66C 3N2KA 1JVMA 1QVGU 1VF7A 1IBLO 3H1IH 4LF7O 1K34A 4J80A 1S3JA 3ICXA 4B3SO 1TVKB 3GB7C 1YF2A 4LFAB 2W6IG 4JI0B 3SPGA 4DV3O 4RUFA 5IJ0B 3ABKB 4CH3A 2PGGA 4TQDA 5LYJA 3SJAC 1SF9A 5GW7A 5IDJA 4ZHQB 2ZXWB 3ETDA 1ZX3A 1TAEA 1EN5A 3ZRXA 5IYDO 5KHKA 1BQ0A 5IY5C 4UB8Z 3X2QC 4P2ZA 3RVYA 1ZWIC 3JSLA 2HVKC 4X64O 3OMNB 5LOVB 3JD2A 4KHPB 3KCYA 2VQEO 4DO2A 4ZI7B 2Z0AA 1WP8A 3FYIB 2IU3A 2YDEA 3VQWA 4X1IA 2HJDA 2XUMA 4LFBO 2JGUA 1HNXO 4DV5B 1OCOB 3H01A 1HW7A 1N34B 1WA8A 1N8RW 1MZFA 4TV9B 4WCEV 5B66Z 1VIBA 1VQ5V 2QA4V 2ODMA 3JAWA 3G67A 4B3RO 2Q7GA 3OE7G 4H44B 1H2MA 2DWEC 2Q67A 3LDEA 3CSXA 1R6KA 2GUZA 3K08A 3IC9A 1F4MA 5B1OA 4OPHA 1TUEB 4JI8B 1QVFU 1AJPA 4LC1A 3AG2C 2EZPA 3LNNA 5E1AC 2BOBC 3O9OA 4RWUA 3ZRWB 2KG7B 4FIPC 4X89A 3H1LH 1PV0A 1DTOA 2WA3A 2A06H 3CCLV 4P9OA 2CE4A 1NT2B 2YIAA 1QCEA 2F23A 4D7TA 1JFFA 1SETA 1NTMH 4I0XA 2NR5A 4NTYA 4MSWC 1FXKC 1GN3A 1M57C 5A9GA 4GKJO 3SYPA 4XDLA 2Q0AA 2IJHA 5DN6G 4YJ3B 1YJWV 1FFXB 3I56V 3MHHC 3D36A 2A0LA 3IJ4A 3ZHQA 5KMGB 4O4IA 3EFFK 3ABLB 2EIKB 5JQGA 2XHBA 1XDCA 2ZCEA 5H9CA 3K06A 1M56B 4PA7A 3CEIA 3R65A 1Z5WA 2UXDB 4DR2B 3UM7A 1YSCA 2QWNB 3RYHB 3CC2V 1SA0B 4HAMA 5B3SC 3E22B 2B1IA 2M7WA 1WP7A 1V54B 4JI7O 3JARA 5LGNA 5DEDA 3WG7B 1R3KC 1DF5A 3LUTB 1NTZH 2Q7EA 4FK5C 5GONA 3F7YC 4AQYO 5K1XA 3DSQA 4H0LB 2AZ0A 5JVDB 4JI5B 4WFFA 1NVPD 3GWOA 4DV7O 2BSKA 4DV1B 2ZNJA 2ZINA 1NVPB 2B1GA 4QPJA 2EIMC 4MVMA 4NKGB 5L3FA 1S5LZ 3RYCB 1W59A 1N0NA 4I9WA 4JTAB 4DR5B 2Q7HA 4TV8A 1AJQA 1U96A 5CB4B 4WBNA 3QO5A 2F4VO 5FL7G 5BR8O 4DR3B 4YJ2A 1CXZB 4EFBA 3CCMV 5A2QN 1RSOB 2YIBD 1FXHA 2XAHA 3A0BZ 1CEZA 1K8AW 5IYCO 4LF5O 3L71H 2ITDC 4I50B 2P4VA 4L87A 4I4TA 1OV9A 5L3EA 2UUBB 2YSUB 4UCRA 3RGBA 1VEWA 2ZE6A 4LNUB 4DRXA 3CHXA 1JMKC 2ZT9B 5BZBA 5C93A 5IY5B 3X2QB 2IBZH 1VQ4V 3H1KH 4FM1A 4GX2A 3VQVA 3CP1A 4H13B 4LF6B 4DR7O 3OMAB 1SQPH 2YI8A 4FVMA 1N33O 4L8JA 4JASA 1AI7A 3QVNA 3W7TA 5K1PA 3W7SA 1KQSU 4JI2O 3SYOA 5L3BA 4YIOA 4YIPA 1VQLV 4JI3B 5D5QA 2UXBB 5IJ9B 1AI5A 3KCXA 2RDCA 4DV4O 4LCUC 2WAMA 4MW8A 1AR5A 1JPXA 2WWWA 1K97A 2M6YA 1URFA 1V9PA 3AG3C 5KX5A 3F5WC 1R3IC 1CP9A 4K0KB 2OCHA 1VQ6V 2V4DA 1R1BA 3SYQA 1EFRG 1N32B 4LR3A 1YIJV 3T2MA 1Y4MA 3QG5A 5LXTB 4UUJC 4DV0B 1PPJH 1TUBB 2PY5A 4UXNA 1TVKA 1RFYA 2QR4A 4Z1VA 4JI6B 2IW5A 5IJ0A 4G27B 4GZRB 2GTSA 3CCEV 5CA1B 3K0DA 1MABG 2F95B 4ZHQA 1LUWA 4FZ0A 4NB5A 5IYZB 3U11A 3AG2B 3IGAC 2K9PA 2D2CB 4UV9A 2JJ2G 2R70A 2PYLA 3JCUZ 2Q0OC 2UXNA 5LOVA 4IL6Z 4B3SB 1JJ2U 3P3PA 1HP8A 5BY1A 5H6RA 4DV3B 4BAYA 1XNRO 4OGQB 2QSAA 4ZI7A 3OW2U 3CE2A 3JAKB 1WJZA 2OIGA 3M99B 1PKXA 3Q4HB 2YEVB 1YVWA 3BVOA 4YHHO 3CMEV 1FXKB 1M57B 4AILC 2FKXA 4BIZA 1S0VA 3T4DA 3OTFA 4X64B 2F93B 4NXMO 1I08A 2LFRA 3ASOC 4O4LB 4TV9A 2JRIA 2L6LA 5LA6A 5FNVB 1I7FA 4LF9O 2GBOA 2ZR3A 1GAXA 1Y76B 1YXBA 1H2GA 1GN2A 2W0XA 1MSWD 3G6BA 1HNXB 4QE9A 4U7NA 4RO2A 2FYUH 1X4TA 4KUMA 1Q90D 3ZEDA 1G1XB 1QR9A 3H1HH 4JI1O 1R3JC 5B3SB 2X6AA 5TISZ 4DR4O 3JALB 4DK1A 2PZSA 1FYJA 2AW9A 4IYIA 3ZRWA 2KG7A 1HDJA 2YI9A 1VQKV 4B7KA 3AK1A 4QNHB 1R6NA 2ZDIC 1AROP 3GVMA 1HR0O 2BTQB 2O57A 4LFCB 1YJ9V 4OPAA 2B5UA 3ML0A 2YS8A 2YIDA 2ZM6B 2EINC 4MVUA 1LUVA 3E2EA 4P30A 1KP3A 4MT8A 1H2SB 3B77A 4YJ3A 1MMMA 3K9SA 2EZOA 3U0ZA 4IIJB 4PELA 1FFXA 3W7UA 4ZOLB 2Q68A 3JYCA 5LMNB 4GKKO 2EIMB 2QKAA 3TK1A 2H94A 2EIKC 2P67A 3K0GA 2Q5ZA 2N05A 3FYEB 1Q86W 1P7BA 2OCCC 1AR4A 2JVDA 2UUAB 1L8DA 2HHHO 1JCHA 1IBMO 1S76D 1KKDA 3L75H 1B6QA 2IJJA 3CPWU 2XAQA 5KMGA 1NI8A 2ZE7A 3MHSC 4TUYB 3N2GB 4B7EA 2WLLB 1NJIW 1P7GA 1Q6IA 2CDYA 2VQFB 2HVJC 2NNUA 1SA0A 4UVCA 3RYHA 3AG7A 3E22A 3EVKA 3B2EE 4FLZA 3QTCA 3L9DA 2ATKC 2YXYA 3QO8A 3M7MX 4F4LA 3DTUB 3B4SA 4O4JB 1QHTA 1QU7A 4LWSB 1YZBA 1BHAA 2IJKA 3TGUH 2CTRA 1SQBH 5IT9N 5DECA 1M4UA 5JVDA 2HEPA 1SQGA 4QJFB 5IWAO 1WPBA 2XAGA 3K5LA 5E79Z 4DW1A 1XHZA 1FKAO 2ZNIA 3ETEA 4JTDB 1W0JG 4JI7B 1WLEA 3APQA 1GMGA 3UQ8A 3RYCA 3BCCH 3CB2A 4X65O 2UU9B 4YY3O 5JH7B 1FJGO 3AG3B 4N21A 3QF7A 1PNKA 4I7ZB 5CB4A 4AQYB 2UUCB 4NYKA 1XMOB 2E5LB 4F6EA 4GYCB 3CS5A 1OHHG 4PD4F 2BOCC 2B9ZA 1THZA 1RSOA 1OCRB 2HP8A 2Q8VA 4UFZA 1BMFG 4O2AB 1NTKH 1Q43A 3CYOA 2YIBA 2WA4A 3D3IA 4GX0A 4X1KB 4I50A 3ZMSA 4J7JA 2QTOA 3ABTA 1HNWO 1W0KG 2XASA 1XMQB 3HPLC 4JAAA 2Q73A 2P7TC 1VQMV 4LNUA 1J95A 3ABMC 1BQZA 1QLNA 3VQXA 4CH5A 5JJJB 4XDKA 2WLNA 3K3WA 2OTLV 1GK9A 4LF5B 4FMTA 2EIJC 1OJHA 3OUSA 4LP8A 1GRJA 3K04A 1K9MW 1VQOV 1D2DA 4DR1O 3ASNC 1NZ6A 5IJ9A 4X8AA 5LMUB 4RAIA 4I55B 4GX1A 1HNZO 5LP6C 1Q3EA 3TJTA 1AP6A 2EULA 3HB3B 3AG1C 1F7YA 5CMUA 1S72V 3ASOB 1YCIA 3K57A 3ZRSA 4DV2B 1VQPV 1O9GA 4X88A 4JI2B 5LXTA 2QJ1A 2AGAA 5EBLC 1TUBA 3OGCC 3OM3B 5FPOA 1Q81W 1GM9A 4CS4A 2CGOA 3E86A 2QWRB 1GH6A
chains in the Genus database with same CATH topology
1E1RG 1FXHA 2IJIA 2XAHA 1BHBA 3T4ZA 1CEZA 1RPRA 5L3GA 1K8AW 1HWYA 3ZMUA 5IYCO 2ITDC 2EILC 1QR8A 2Y69C 4R6ZA 1VQNV 4XDJA 1M9NA 4L87A 4PDVA 3DGEA 1P4RA 2DYSC 1GKFA 1QLEC 2W6JG 2Z3YA 3KG2A 4PDMA 4R8CA 5L3EA 1W2BU 3SPJA 2JJ1G 1Q7YW 2YSUB 3AEIA 4RQFA 3RBZA 1DF4A 4Q20A 3SYAA 4JAUA 4MS2A 3E8FA 4LBEC 5BZBA 5C93A 5IY5B 2GHYA 1VQ4V 3X2QB 3EHBB 2D3OW 2R9RB 1PD3A 2MK3A 2W0FC 1NR1A 1RM1B 2P6JA 1JQ0A 4OXSA 4GX2A 3CP1A 2YEVA 4FPPA 3SJQC 2EINB 2WLJA 1NBMG 3E89A 3OMAB 1FXKA 3ZN0A 2DWDC 3CCVV 4JASA 1AI7A 3W7TA 3W7SA 1KQSU 5B1BB 3SYOA 3ZMVA 4YXWG 4GT1A 5CBFA 4PA3A 1MOFA 5L3BA 5CA3A 1VQLV 1YHQV 5B1AB 4G2KA 2PI4A 1F4NA 2WSSG 1AI5A 3ZMZA 1ENVA 5EK0A 2OCCB 4LCUC 4R7CA 2WAMA 2WLHA 4MW8A 5LBQA 1JPXA 5KA5A 3MD0A 2WWWA 1KC8W 1K97A 3PJSK 2QE7G 3AG3C 5H6QA 4JGSA 4Z1MG 3FB7C 3WFVA 1Y66A 3F5WC 1R3IC 1CP9A 4KP4A 4WFBV 1VQ6V 3JD1A 3VBBA 3K79A 2C2AA 3OR6C 3SYQA 1EFRG 3FB5C 5L3DA 3NXSA 5B1NA 4MTFA 3AG4C 1JX9A 4JYBA 3UKMA 1K73W 3JD0A 1YIJV 3T2MA 1Y4MA 4UUJC 3OAAG 1Q82W 1VQ8V 2HG5C 4UXNA 4WFEA 4ZKIA 1GO3F 2IW5A 3CCJV 3STLC 1DLBA 4G27B 4MVZA 3P32A 1G8MA 4H37A 3CCEV 2QM8A 3P30A 4MVSA 4WF9V 3K0DA 5KUMA 3SYCA 3ABLC 5CBHA 1MABG 1L1FA 1CPYA 1M56C 1I5XA 2LFSA 4TT3G 2WLIA 1H8HG 3G71V 1FFTB 3AG2B 5LHGA 1PNLA 4JTCB 2Q69A 3IGAC 3SPHA 1KD1W 3K03A 4UV9A 2JJ2G 1SZTA 3OFNG 2P90A 2UXNA 3RW0A 1V54C 1OCCC 2NLJC 1JJ2U 4WFAV 2AHYA 5H6RA 4BAYA 3I55V 3WG7C 3CCQV 1K7DA 3E8GA 3W7WA 3OW2U 3B8MA 3K9AA 4E2LA 1K3EA 3M99B 1PKXA 4RUEA 1YJNV 2YEVB 4I5SA 3SPCA 3CCSV 1FS0G 3CMEV 3ETGA 3T1CA 1FXKB 1M57B 3QO7A 2JIZG 3LDDA 1V55C 2DW4A 1E1QG 2DQ3A 2A79B 5HFLA 4MTGA 4BIZA 1S0VA 3T4DA 5LGUA 2XNDG 2Y48A 2LFRA 3ASOC 3FB6C 3LSQA 1RPOA 3JD4A 1K5QA 1ROPA 3E35A 1UJWB 5HFMA 2ZR3A 2DYRB 1NQTA 2IU0A 4MW3A 3RVZA 1H2GA 2WLLA 1MSWD 1M1KW 1JVMA 1QVGU 4QE9A 4U7NA 4RO2A 3JCZA 4QE7A 4ZBMA 4EKWA 2QKSA 4KUMA 1PL0A 1QR9A 4FJCC 2OT5A 1K34A 3IC7A 1S3JA 4QIWF 4WFHA 4MVQA 4PDLA 2DQ0A 3GB7C 4H33A 2W6IG 3ABMB 3SPGA 4RUFA 4TSFG 3ABKB 1PNMA 4UVBA 2EBOA 1R3JC 5B3SB 2JEUA 2GSMB 1SERA 2X6AA 1QBZA 2WLMA 2HLDG 2ZD9A 3AG4B 1BL8A 3ZRWA 5GW7A 1VQKV 5IDJA 4GCZA 4QNHB 1R6NA 2ZXWB 3ETDA 2ZDIC 1AROP 2CK3G 4GX5A 3B8NA 2WLIB 3ZRVA 3ZRXA 1IXMA 5LGTA 2EIJB 5IYDO 4PA4A 5IY5C 1YJ9V 3X2QC 2B5UA 4XBFA 1YTFD 2F43G 3ML0A 2R9IA 4P2ZA 1RM1C 3ASNB 3RVYA 1WPXA 1ZWIC 1COWG 4CZZA 2HVKC 1GTOA 3OMNB 2EINC 4J9ZB 3JD3A 1OCRC 3JD2A 4MVUA 1YTFB 3E2EA 4ASUG 4P30A 2JEXA 1KP3A 4DO2A 3FYIB 5B1BC 4MT8A 2IU3A 2V7QG 3B77A 3AG1B 1EBOA 4WFGA 2EZOA 3FB8C 3ZJZA 1VQ7V 4PELA 1NH2D 3W7UA 4R50A 2Q68A 3JYCA 2EIMB 5EC2C 3TK1A 5B1AC 2H94A 2KB1A 2EIKC 2P67A 3K0GA 3LNMB 3ZCCA 3OMIB 1NH2B 3FYEB 1Q86W 1OCOB 1P7BA 2OCCC 2HFEC 3W7XA 3H01A 1KECA 3F7VC 4J9YB 1JCHA 1S76D 1KKDA 3CC4V 1B6QA 2IJJA 3CPWU 5CBGA 1N8RW 2XAQA 1ORQC 4WCEV 1EZJA 3SPIA 4TWKA 3MHSC 1VQ5V 1LNQA 4DXWA 2QA4V 1AI6A 1AI4A 2WLLB 1NJIW 2EILB 3OE7G 2DWEC 2Q67A 2Y69B 2HVJC 2NNUA 4UVCA 3LDEA 1K4DC 2HKOA 2DYSB 3IFXA 1QLEB 1R6KA 3ZIAG 3K08A 2ATKC 3QO8A 1G4YB 1F4MA 1K4CC 3STZC 5B1OA 3OUFA 4F4LA 3DTUB 1TUEB 4JPRA 4PA6A 4BW5A 2ZR2A 4RQEA 1QVFU 1NKDA 1AJPA 4LC1A 1SRYA 1OCZC 3AG2C 1BHAA 1AJNA 4JYCA 3CCUV 3CD6V 1SESA 3CMAV 1M90W 2EZPA 2IJKA 5E1AC 2BOBC 5EBMC 3G6EV 3ZRWB 1F51A 4FIPC 4PDRA 4QPKA 1AR1B 2AHZA 4X89A 1DTOA 2IH1C 4QJFB 2PI5A 2HR3A 1YI2V 3CCLV 4P9OA 3OR7C 4UVAA 2XAGA 1R3LC 3ZN1A 2XOKG 1QCEA 4UV8A 3ZMTA 1F23A 3ETEA 3VOUA 4JTDB 1W0JG 3CCRV 1SETA 4JF3A 5L3CA 1WLEA 1GMGA 2A9HA 1H8EG 2WLKA 4MSWC 1FXKC 2IH3C 1M57C 3SYPA 2X6CA 3AG3B 4N21A 4XDLA 2XAJA 2ITCC 2IJHA 1PNKA 5DN6G 1YJWV 4MTOA 4BIUA 2K1EA 4MVOA 4G28B 3CXCU 2WPDG 3I56V 3MHHC 3G4SV 3D36A 5EBWC 1OHHG 1K33A 2A0LA 2BOCC 3BEHA 1THZA 4KFMA 1OCRB 4JAVA 2UXXA 1BMFG 1JOYA 2DYRC 3CYOA 1E79G 5J9PC 3D3IA 4P9PA 1K92A 4GX0A 2X7RB 1XL4A 4MTXA 1S77D 3ZMSA 3EFFK 2QEXV 2QTOA 5KA6A 3ABLB 2EIKB 2LP7A 3ABTA 1W0KG 2XASA 3HPLC 3K06A 1M56B 1R73A 5H9CA 2ZDIA 1K5SA 4PA7A 2Q6AA 3R65A 2P7TC 1VQMV 3UM7A 1J95A 1YSCA 3ABMC 3LDCA 3ABKC 3CC2V 4HAMA 5B3SC 2B1IA 1QLNA 5DM6V 2M7WA 2ZQMA 4U7OA 4XDKA 2WLNA 1V54B 1OCCB 2H8PC 3K3WA 4MVRA 3FKSG 1OZ0A 2OTLV 1GK9A 5LGNA 2ZXWC 3WG7B 1R3KC 1S5HC 3ABUA 2X6BA 1KP2A 1DF5A 4FMTA 2EIJC 2Z5UA 3LUTB 3OUSA 2JK5C 4LP8A 3TCUA 5KUKA 3K04A 2QM7A 1K9MW 4FK5C 1VQOV 3F7YC 3ASNC 3A0RA 4CBCA 4X8AA 4WFFA 5IYBO 1NVPD 1V55B 3BY6A 3GWOA 4RAIA 2X0LA 4GX1A 2XAFA 2FTKA 3E8BA 3QNEA 4HZ3A 3HB3B 1OCZB 3AG1C 1NVPB 3E83A 3E8HA 5CMUA 2B1GA 2OTJV 1H38A 1S72V 1VQ9V 4QPJA 3ASOB 3OEEG 5LHIA 2EIMC 3OEHG 1XL6A 4MVMA 4HYOA 5L3FA 5LHHA 4PA9A 3ZRSA 4N23A 1VQPV 2HJFC 4X88A 1NR7A 3LSSA 1OCOC 1I5YA 4I9WA 4JTAB 1FXVA 1GM7A 1AJQA 2EJRA 5CN0A 1YITV 5EBLC 3CC7V 3OGCC 2JDIG 3OM3B 5EC1C 3QO5A 1GM8A 1Q81W 1GM9A 5FL7G 1MG1A 2V1DA 3E86A 3TETA 3CCMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN C;  4J9Z B;  4MTO A;  1OCR C;  2K1E A;  4MVO A;  4JTC B;  4G28 B;  2Q69 A;  3IGA C;  4MVU A;  3SPH A;  3T4Z A;  3K03 A;  4P30 A;  5B1B C;  5EBW C;  2A0L A;  2BOC C;  2ITD C;  3BEH A;  4KFM A;  2EIL C;  3RW0 A;  1V54 C;  1OCC C;  4WFG A;  3FB8 C;  3ZJZ A;  2NLJ C;  2Y69 C;  4R6Z A;  5KUK A;  4R50 A;  4XDJ A;  2Q68 A;  2AHY A;  2DYR C;  3JYC A;  4PDV A;  2DYS C;  5EC2 C;  4R8C A;  1QLE C;  4PDM A;  5B1A C;  3KG2 A;  3WG7 C;  2KB1 A;  3E8G A;  2EIK C;  5J9P C;  3K0G A;  3SPJ A;  3LNM B;  4P9P A;  4GX0 A;  1P7B A;  2OCC C;  4RUE A;  2HFE C;  1XL4 A;  3RBZ A;  3EFF K;  3SPC A;  3F7V C;  4J9Y B;  2QTO A;  2HVK C;  3SYA A;  4MS2 A;  3E8F A;  3T1C A;  4LBE C;  5BZB A;  1KKD A;  2R9R B;  3HPL C;  3K06 A;  3LDD A;  2W0F C;  1V55 C;  5CBG A;  4PA7 A;  4OXS A;  2Q6A A;  1ORQ C;  3R65 A;  4GX2 A;  2P7T C;  2A79 B;  2YEV A;  3SPI A;  3SJQ C;  2WLJ A;  4MTG A;  4TWK A;  3UM7 A;  1J95 A;  3E89 A;  3ABM C;  3T4D A;  3LDC A;  3ABK C;  2DWD C;  5B3S C;  1LNQ A;  4DXW A;  3ASO C;  2WLL B;  3SYO A;  3FB6 C;  4XDK A;  2WLN A;  5CBF A;  4PA3 A;  2DWE C;  2H8P C;  2Q67 A;  4MVR A;  2HVJ C;  3TCU A;  3LDE A;  2ZXW C;  1K4D C;  3IFX A;  1R3K C;  1S5H C;  4MW3 A;  2X6B A;  3RVZ A;  2WLL A;  3K08 A;  2ATK C;  2EIJ C;  3LUT B;  1G4Y B;  3OUS A;  1JVM A;  1K4C C;  2JK5 C;  4LCU C;  4LP8 A;  4R7C A;  5EK0 A;  2WLH A;  3K04 A;  4MW8 A;  4QE9 A;  3OUF A;  3STZ C;  4F4L A;  3F7Y C;  4BW5 A;  4PA6 A;  3PJS K;  4QE7 A;  4RO2 A;  4ZBM A;  3ASN C;  3AG3 C;  4EKW A;  2QKS A;  3FB7 C;  3F5W C;  1OCZ C;  1R3I C;  3AG2 C;  4X8A A;  4CBC A;  4WFF A;  4WFH A;  3OR6 C;  4RAI A;  5E1A C;  4MVQ A;  2BOB C;  3FB5 C;  4GX1 A;  4PDL A;  3SYQ A;  5EBM C;  3GB7 C;  4H33 A;  3AG4 C;  4MTF A;  3E8B A;  4PDR A;  3SPG A;  3UKM A;  4HZ3 A;  2AHZ A;  4RUF A;  4X89 A;  3AG1 C;  1R3J C;  3E83 A;  3E8H A;  3T2M A;  2IH1 C;  4UUJ C;  2X6A A;  2WLM A;  2EIM C;  2ZD9 A;  1XL6 A;  4MVM A;  2HG5 C;  4HYO A;  4P9O A;  3OR7 C;  1BL8 A;  4PA9 A;  4WFE A;  3ZRS A;  1R3L C;  2HJF C;  4X88 A;  3STL C;  4QNH B;  4G27 B;  4MVZ A;  3VOU A;  1OCO C;  4I9W A;  4JTA B;  4GX5 A;  4JTD B;  4H37 A;  2WLI B;  5EBL C;  4MVS A;  2A9H A;  3K0D A;  3OGC C;  5KUM A;  3ABL C;  2WLK A;  4PA4 A;  3SYC A;  5CBH A;  4MSW C;  5EC1 C;  5IY5 C;  3X2Q C;  2IH3 C;  1M57 C;  1M56 C;  4P2Z A;  3SYP A;  2X6C A;  1ZWI C;  3E86 A;  4XDL A;  3RVY A;  2ITC C;  3TET A;  2WLI A; 
#chains in the Genus database with same CATH topology
 1E1R G;  5CA1 A;  1BHB A;  1Y74 A;  4DV6 O;  1Q6U A;  1RPR A;  4DUZ B;  1HWY A;  3IAY A;  5IYZ A;  2QKC A;  2EIL C;  3HKD B;  4F6R B;  1QR8 A;  2LQT A;  2Y69 C;  4R6Z A;  2LGW A;  4XDJ A;  1VQN V;  1P4R A;  2DYS C;  1GKF A;  2Z3Y A;  4LF8 O;  1W2B U;  2P5O A;  4DW0 A;  1Q7Y W;  5KHI A;  3RFR A;  4RQF A;  1DF4 A;  3RYI B;  4Q20 A;  4LBE C;  2GHY A;  1NS1 A;  3JAK A;  1Q8I A;  1B04 A;  2CUG A;  2R9R B;  5KAI Z;  1PD3 A;  4QGP A;  2W0F C;  2P6J A;  3Q4H A;  1WB8 A;  3SR2 C;  2YEV A;  1BCC H;  4FPP A;  3SJQ C;  2EIN B;  2WLJ A;  1NBM G;  3E89 A;  1FXK A;  2DWD C;  1DGS A;  4JYA B;  3ZMV A;  4YXW G;  4GT1 A;  5CBF A;  1MOF A;  5CA3 A;  4OX9 O;  1AP5 A;  2N74 A;  1XUQ A;  1F4N A;  1WAZ A;  4O4L A;  4KXR A;  5FNV A;  2OCC B;  4LF4 O;  4R7C A;  5LBQ A;  3BRC A;  5KA5 A;  4X66 B;  3PJS K;  1Y76 A;  4JGS A;  1N36 B;  3WFV A;  4KP4 A;  4YHH B;  3UT5 B;  3K79 A;  2VWJ A;  3SGI A;  3FB5 C;  5BMV B;  5L3D A;  2ARH A;  5B1N A;  2MW2 B;  1JX9 A;  4JYB A;  5H5N A;  4UCO A;  3J80 N;  4CH4 A;  2ZE8 A;  1I94 O;  4PJ0 Z;  4GUN A;  2HG5 C;  2PUS A;  4JV5 O;  4ZKI A;  1GO3 F;  1D5N A;  4MVZ A;  3P32 A;  3JAL A;  1ZTE A;  4LF9 B;  3P30 A;  2PTM A;  4MVS A;  1XNQ B;  4NXN B;  2LFS A;  3BAA A;  2XTA A;  4NVP A;  2PYJ A;  1BGY H;  5LHG A;  2Y4T A;  1PNL A;  4JTC B;  2Q69 A;  3SPH A;  4LFA O;  4JI0 O;  1ZUQ A;  2RN9 A;  2P90 A;  1BE3 H;  2NLJ C;  4JI1 B;  4X9Q A;  4FFB A;  4CS2 A;  3CCQ V;  1K7D A;  3E8G A;  3B8M A;  3K9A A;  4DR4 B;  3N2K B;  5EZY B;  4E2L A;  1K3E A;  4Z2W A;  4IIJ A;  1YJN V;  4ZOL A;  4J10 A;  3SPC A;  2JGD B;  3CCS V;  4FM0 A;  3T1C A;  1FAF A;  3QO7 A;  3LDD A;  1V55 C;  2DW4 A;  3BAB A;  3TXQ A;  2CGN A;  4MTG A;  2E76 B;  4U3J A;  3LSQ A;  3JD4 A;  3E35 A;  1KYO F;  2P4K A;  4TUY A;  3D3Q A;  2IU0 A;  3N2G A;  2WLL A;  4DR6 B;  1SQQ H;  1M1K W;  1N34 O;  3OD4 A;  4ZBM A;  4EKW A;  2QKS A;  1N0J A;  1VF6 C;  4FJC C;  3FAV B;  2OT5 A;  2CH7 B;  3J7A U;  4WFH A;  2HHH B;  4MVQ A;  4PDL A;  1KMI Z;  2DQ0 A;  3ABM B;  3M8A A;  4O4J A;  4UVB A;  1KKC A;  1PNM A;  2EBO A;  1IZ3 A;  4LWS A;  2HLD G;  3AK2 A;  1BL8 A;  5AG2 A;  2CTP A;  2E75 B;  3T1Y B;  4GCZ A;  3RT3 C;  4DK0 A;  3MAQ A;  3B8N A;  1IXM A;  4W4L A;  2EIJ B;  5CA0 B;  1J5E B;  1YTF D;  2R9I A;  3ASN B;  4CZZ A;  1GTO A;  1L0L H;  4J9Z B;  3THO A;  1OCR C;  2EX3 A;  4DUY O;  1YTF B;  5EYP B;  1QQC A;  2JEX A;  5LP6 B;  5JH7 A;  2V7Q G;  4FLT A;  3AG1 B;  3RYF B;  1X59 A;  1NH2 D;  4R50 A;  5EC2 C;  2KB1 A;  3LNM B;  3OMI B;  1NH2 B;  1D5A A;  1UPG A;  3W7X A;  4O2A A;  1GN6 A;  4UB6 Z;  1KEC A;  3F7V C;  4J9Y B;  2RQ6 A;  4KL1 A;  1IBL B;  3C90 A;  4X1K A;  5CBG A;  3BHP A;  1ORQ C;  1SC5 B;  2JS3 A;  4IHJ B;  4LF7 B;  4X65 B;  1ZL8 B;  4I9Q A;  1FJG B;  2CAZ C;  4PI0 A;  4U3F H;  1XHX A;  3HR0 A;  3WB0 A;  2EIL B;  4C7U A;  2Y69 B;  1JFF B;  2Y4U A;  2DYS B;  1SZX A;  2VS0 A;  4ABM A;  3CRC A;  1DK1 A;  3OUF A;  4JPR A;  2ZR2 A;  1NKD A;  3GWK C;  5C8Y B;  3B09 A;  4UCV A;  1SRY A;  3CD6 V;  1SES A;  3CMA V;  4DR2 O;  2UXD O;  3NR7 A;  5EIB C;  4B3M O;  1HNW B;  5EBM C;  1F51 A;  2RNB A;  1WB7 A;  2VQE B;  4PDR A;  4FLY A;  4QPK A;  2AHZ A;  2IH1 C;  2PI5 A;  2BE3 A;  4I55 A;  1YI2 V;  3OR7 C;  3DC5 A;  1ZLZ A;  4LFB B;  3ZN1 A;  2XOK G;  1IBK O;  4CH6 A;  5L3C A;  2A9H A;  1H8E G;  4K35 A;  2WLK A;  2YXL A;  4JI4 O;  2ITC C;  4J7K A;  4BIU A;  4G28 B;  2WPD G;  2E3C A;  3G4S V;  5JJN B;  3CX5 F;  3BA9 A;  5D5P A;  1K33 A;  3BEH A;  4KFM A;  1IVS A;  4JAV A;  1JJO A;  1HNZ B;  3OT7 A;  1JOY A;  4B3R B;  3L73 H;  1E79 G;  5J9P C;  3C3S A;  4P9P A;  1K92 A;  4DR5 O;  1XOU A;  4F6R A;  3HKD A;  5GON B;  3SDL A;  5J2T B;  4DR3 O;  2QWO B;  1I0H A;  2ZDI A;  1US6 A;  2Q6A A;  4CS3 A;  3CRQ A;  3RYI A;  3LDC A;  2AXT Z;  2G38 A;  3LSU A;  4ZIB A;  2ZQM A;  1G6U A;  2UXC O;  4PI2 A;  2ADQ B;  2H8P C;  2P06 A;  4MVR A;  2UUB O;  1YDX A;  1H2N A;  1JR9 A;  4CC5 A;  1S5H C;  3ABU A;  2X6B A;  4PHZ A;  1MSD A;  2Z5U A;  1VAR A;  2JK5 C;  3TCU A;  4GKJ B;  5LL6 Y;  5IYB O;  4LF6 O;  1V55 B;  3BY6 A;  4GLX A;  1KU9 A;  2X0L A;  2FTK A;  3E8B A;  3QNE A;  4HZ3 A;  1OCZ B;  2L35 A;  3A2F A;  3E8H A;  2OTJ V;  1H38 A;  1VQ9 V;  3H9V A;  4I4T B;  3UT5 A;  3OEE G;  3APO A;  5LHI A;  5BMV A;  1XL6 A;  1KB9 F;  4HYO A;  5LHH A;  4PA9 A;  4N23 A;  4JI3 O;  2GV9 A;  2HJF C;  1NR7 A;  4X20 B;  3LSS A;  1Y67 A;  1I5Y A;  2EJR A;  1A32 A;  3CC7 V;  2JDI G;  1BSM A;  1M5I A;  1GM8 A;  1MG1 A;  2V1D A;  2IJI A;  1EN4 A;  1N32 O;  1BS3 A;  3T4Z A;  2YUA A;  5JCO C;  1N4C A;  4DV0 O;  3JAS B;  2NN4 A;  1M9N A;  2A3Q A;  4PDV A;  4NR1 A;  3DGE A;  4JI6 O;  4R8C A;  1QLE C;  3SPJ A;  2JJ1 G;  2JS5 A;  4DYL A;  4BIO A;  1M93 A;  3AEI A;  3RBZ A;  4JV5 B;  3SYA A;  3SJB C;  4MS2 A;  3JAT B;  1FPO A;  5EZY A;  1NR1 A;  3JAM N;  5GTI Z;  2JGD A;  3CRA A;  2YC0 A;  4DV7 B;  4AI8 A;  3D8C A;  3CCV V;  3K58 A;  4O4H B;  4E4E A;  3J81 N;  2KKW A;  1H2K A;  4FZ1 A;  5B5E Z;  2PI4 A;  3CRR A;  3OTO O;  1ENV A;  3C3T A;  2WLH A;  1B06 A;  2R72 A;  1KC8 W;  2QE7 G;  2F4V B;  4TQF A;  3MDS A;  5BR8 B;  1Y66 A;  1SKV A;  3CJH B;  3PN1 A;  5FLX N;  3VBB A;  3NXS A;  1O9H A;  2QDO A;  1K73 W;  2DMX A;  3FAV A;  4O2B B;  2CH7 A;  1QNM A;  1Q82 W;  1VQ8 V;  1SQF A;  5J2U B;  3CCJ V;  3WB2 A;  1G8M A;  4H37 A;  3L74 H;  2LGQ A;  2RCV A;  3SYC A;  5CBH A;  1L1F A;  1I5X A;  4TT3 G;  5EIB D;  3HKE B;  1H8H G;  3CXH F;  1MA1 A;  3K5M A;  5CA0 A;  4DR7 B;  4JZ2 A;  1SZT A;  3OFN G;  5IE9 A;  3ZBH A;  3ZHR A;  1N33 B;  5LA6 B;  3RW0 A;  1OCC C;  3JSN A;  5EYP A;  3R66 A;  5LP6 A;  3W7W A;  4HNA B;  3RYF A;  5KLV H;  3F5T A;  2KQX A;  4I5S A;  4DV4 B;  4LFC O;  1FS0 G;  1WNS A;  4EB6 B;  4FLV A;  2ZM6 O;  5FPR A;  4BW9 A;  2JIZ G;  1E1Q G;  4PV1 B;  2DQ3 A;  5HFL A;  1VP7 A;  3KKY A;  3ZHU A;  1EM1 A;  5LGU A;  4IT5 A;  4B3T O;  4DUY B;  4IHJ A;  3FB6 C;  3HKC B;  1K5Q A;  1TA8 A;  1ZL8 A;  5F2V O;  5LMN O;  3RVZ A;  2UUA O;  3JCZ A;  4QE7 A;  4CC6 A;  3D36 C;  1PL0 A;  5JJE B;  1KBH A;  3IC7 A;  4QIW F;  1EN6 A;  2ZIM A;  4H33 A;  5C8Y A;  3CRM A;  4TSF G;  1PM9 A;  2JEU A;  1Y6X A;  4X62 O;  2GSM B;  1SER A;  1QBZ A;  2WLM A;  3FFQ A;  4UCT A;  5ITZ B;  2ZD9 A;  2VQF O;  3AG4 B;  2E74 B;  1XNR B;  1R6T A;  5GTH Z;  2CK3 G;  4GX5 A;  1S5J A;  2WLI B;  3ZRV A;  5LGT A;  4W4K A;  2N04 A;  4PA4 A;  3UO2 A;  4XBF A;  2F43 G;  3BPZ A;  2ADP A;  3AK3 A;  1MZE A;  1RM1 C;  4IYH A;  1WPX A;  1COW G;  1XQ8 A;  2LO1 A;  4BWA A;  5JWP A;  3JD3 A;  3ZS8 C;  3ZHS A;  4EEQ A;  4ASU G;  3T1H O;  3A8T A;  2Q9L A;  3A0H Z;  1KUQ A;  5B1B C;  4FLX A;  3HKB B;  4LH6 A;  4NXM B;  1RP3 B;  5KHJ A;  2CTQ A;  4B3M B;  1EBO A;  4WFG A;  3FB8 C;  1VQ7 V;  3ZJZ A;  2OWO A;  2DE0 X;  4EFE A;  1Q5O A;  5B1A C;  3ZCC A;  3FX7 A;  2QTS A;  2HFE C;  1NU1 H;  2BTQ A;  1TGO A;  3OGI B;  1IBK B;  2UU9 O;  2Y0I A;  3CC4 V;  3WU2 Z;  4X1Y B;  2UUC O;  1XMO O;  1EZJ A;  3SPI A;  2E5L O;  4JI4 B;  4TWK A;  2GDS A;  4FLU A;  1YEW A;  1SS3 A;  3DXR B;  5J2T A;  2LJ2 A;  1LNQ A;  4DXW A;  1AI6 A;  1AI4 A;  3ZHT A;  2R9A A;  4B08 A;  3H1J H;  1K4D C;  2HKO A;  1B3Q A;  3IFX A;  1QLE B;  3ZIA G;  1HR0 B;  1G4Y B;  1K4C C;  3STZ C;  3ZHV A;  1T5E A;  4BW5 A;  4PA6 A;  4KHP O;  4RQE A;  1XMQ O;  1U97 A;  1OCZ C;  1AJN A;  4JYC A;  3CCU V;  1M90 W;  3BA8 A;  5LYJ B;  2XT9 A;  3G6E V;  1AR1 B;  4UCS A;  4DV5 O;  2HR3 A;  4UVA A;  4GKK B;  1R3L C;  4UV8 A;  3BFR A;  3ZMT A;  4TOI A;  1F23 A;  2AZ2 A;  3VOU A;  3CWB H;  2UXC B;  3CCR V;  1SQX H;  3SJC C;  4JF3 A;  3VQY A;  4K8Z A;  2IH3 C;  2YXH A;  4X20 A;  3L72 H;  1IBM B;  1H2L A;  2X6C A;  2XAJ A;  1AB3 A;  2IM9 A;  1PL4 A;  5LMU O;  4MTO A;  1XIL A;  2K1E A;  4MVO A;  2P22 C;  3CXC U;  1PP9 H;  4X1I B;  5EBW C;  1VF6 A;  2UXX A;  2OIE A;  2DYR C;  4DV2 O;  2CTW A;  4K3A A;  1WA8 B;  4JI8 O;  2X7R B;  1LR1 A;  3K5O A;  1XL4 A;  4MTX A;  1S77 D;  3JAS A;  2QEX V;  3I5D A;  5KA6 A;  5KHH A;  2OYQ A;  3P3N A;  1UFI A;  2LP7 A;  1MNG A;  3L70 H;  1R73 A;  1K5S A;  3JAW B;  1AVM A;  2A7W A;  5KHG A;  1L0N H;  3JAT A;  4J41 A;  4DUZ O;  3ABK C;  5DM6 V;  3O65 A;  3N27 A;  4U7O A;  2GUZ B;  5IWA B;  1OCC B;  2Q4P A;  1IXB A;  3FKS G;  1OZ0 A;  2DOS A;  2ZXW C;  1P49 A;  1ZSP A;  3S3X A;  2RMK B;  1KP2 A;  4FFK A;  4O4H A;  5KUK A;  1IUR A;  2QM7 A;  3A0R A;  4YY3 B;  1Y74 B;  1IDS A;  4CBC A;  2XAF A;  2QGN A;  4A5U B;  1BT8 A;  3E83 A;  4JYA O;  3CJH A;  4I0X B;  3OEH G;  2H3O A;  5BXZ A;  1OCO C;  1FXV A;  1GM7 A;  4O2B A;  5CN0 A;  1YIT V;  2ILM A;  4J7Z A;  3WB1 A;  5J2U A;  4X66 O;  5EC1 C;  2F1M A;  1N36 O;  3OTO B;  2VRZ A;  3TET A;  1AIL A;  2FB5 A;  4UCU A;  5L3G A;  3U10 A;  4ICG A;  3ZMU A;  3HKE A;  2ZKO A;  1VMG A;  4O4I B;  4JZG A;  2W6J G;  4PDM A;  3KG2 A;  5JQG B;  1XEQ A;  4IGG A;  2LW7 A;  1SQV H;  3RN4 A;  1XNQ O;  3FD9 A;  3UCS C;  2BTO A;  4JI5 O;  3ETQ A;  4JAU A;  3E8F A;  4NXN O;  4DR1 B;  3EHB B;  4HNA A;  2D3O W;  4DV1 O;  2MK3 A;  1IX9 A;  3DC6 A;  1RM1 B;  1JQ0 A;  4OXS A;  3JAR B;  4EB6 A;  1P84 F;  2FL4 A;  3K5N A;  3ZN0 A;  2FML A;  4D7S A;  5B1B B;  3EXA A;  2QWP B;  4PA3 A;  1Q6H A;  1JA8 A;  1GN4 A;  1Z5V A;  1YHQ V;  5B1A B;  4G2K A;  2WSS G;  3HKC A;  3ZMZ A;  2GTA A;  2YIC A;  5EK0 A;  4NTX A;  3MD0 A;  2BSK B;  1BZK A;  5H6Q A;  4Z1M G;  3FB7 C;  4WFB V;  2BCC H;  3TXS A;  3JD1 A;  2DN9 A;  2C2A A;  2PF4 E;  3OR6 C;  4DV6 B;  3KZI Z;  4MTF A;  3AG4 C;  3UKM A;  3ZX6 A;  3JD0 A;  4TV8 B;  1Z2G A;  3OAA G;  1FD9 A;  4FFB B;  4B3T B;  4WFE A;  1EZV H;  4WBN B;  4LF8 B;  3STL C;  1DLB A;  4Q6G A;  4DR6 O;  4YJ2 B;  2QM8 A;  5ITZ A;  4WF9 V;  5KUM A;  3ABL C;  3G80 A;  2EJ7 A;  1CPY A;  2ETN A;  1M56 C;  2WLI A;  3G71 V;  1FFT B;  2ZE5 A;  4U3J B;  2KSD A;  1KD1 W;  3K03 A;  5H2F Z;  2QWQ B;  5KAF Z;  3S3W A;  2UXB O;  1V54 C;  4NTW A;  4D6T H;  4BR6 A;  4WFA V;  1XBL A;  2AHY A;  1WN7 A;  4DRX B;  3I55 V;  3WG7 C;  3K59 A;  4OX9 B;  3T1Y O;  4X62 B;  3HKB A;  4RUE A;  4K0K O;  4AHC A;  2QM4 A;  1J5E O;  4HBN A;  4LF4 B;  3ETG A;  4LH7 A;  4FM2 A;  2ZIO A;  2A79 B;  1ZAU A;  2LW1 A;  2DJV A;  1XRE A;  2XND G;  4FLW A;  4K8X A;  2Y48 A;  4X1Y A;  1VF5 B;  3RWR D;  1RPO A;  2Y0P A;  1ROP A;  3T1H B;  1I94 B;  2RJZ A;  1UJW B;  5HFM A;  3UO3 A;  5JCO A;  3DXR A;  2DYR B;  4J42 A;  1XI1 A;  1NQT A;  4J11 A;  5KX5 B;  4MW3 A;  2VWK A;  3B40 A;  4JYY A;  2F66 C;  3N2K A;  1JVM A;  1QVG U;  1VF7 A;  1IBL O;  3H1I H;  4LF7 O;  1K34 A;  4J80 A;  1S3J A;  3ICX A;  4B3S O;  1TVK B;  3GB7 C;  1YF2 A;  4LFA B;  2W6I G;  4JI0 B;  3SPG A;  4DV3 O;  4RUF A;  5IJ0 B;  3ABK B;  4CH3 A;  2PGG A;  4TQD A;  5LYJ A;  3SJA C;  1SF9 A;  5GW7 A;  5IDJ A;  4ZHQ B;  2ZXW B;  3ETD A;  1ZX3 A;  1TAE A;  1EN5 A;  3ZRX A;  5IYD O;  5KHK A;  1BQ0 A;  5IY5 C;  4UB8 Z;  3X2Q C;  4P2Z A;  3RVY A;  1ZWI C;  3JSL A;  2HVK C;  4X64 O;  3OMN B;  5LOV B;  3JD2 A;  4KHP B;  3KCY A;  2VQE O;  4DO2 A;  4ZI7 B;  2Z0A A;  1WP8 A;  3FYI B;  2IU3 A;  2YDE A;  3VQW A;  4X1I A;  2HJD A;  2XUM A;  4LFB O;  2JGU A;  1HNX O;  4DV5 B;  1OCO B;  3H01 A;  1HW7 A;  1N34 B;  1WA8 A;  1N8R W;  1MZF A;  4TV9 B;  4WCE V;  5B66 Z;  1VIB A;  1VQ5 V;  2QA4 V;  2ODM A;  3JAW A;  3G67 A;  4B3R O;  2Q7G A;  3OE7 G;  4H44 B;  1H2M A;  2DWE C;  2Q67 A;  3LDE A;  3CSX A;  1R6K A;  2GUZ A;  3K08 A;  3IC9 A;  1F4M A;  5B1O A;  4OPH A;  1TUE B;  4JI8 B;  1QVF U;  1AJP A;  4LC1 A;  3AG2 C;  2EZP A;  3LNN A;  5E1A C;  2BOB C;  3O9O A;  4RWU A;  3ZRW B;  2KG7 B;  4FIP C;  4X89 A;  3H1L H;  1PV0 A;  1DTO A;  2WA3 A;  2A06 H;  3CCL V;  4P9O A;  2CE4 A;  1NT2 B;  2YIA A;  1QCE A;  2F23 A;  4D7T A;  1JFF A;  1SET A;  1NTM H;  4I0X A;  2NR5 A;  4NTY A;  4MSW C;  1FXK C;  1GN3 A;  1M57 C;  5A9G A;  4GKJ O;  3SYP A;  4XDL A;  2Q0A A;  2IJH A;  5DN6 G;  4YJ3 B;  1YJW V;  1FFX B;  3I56 V;  3MHH C;  3D36 A;  2A0L A;  3IJ4 A;  3ZHQ A;  5KMG B;  4O4I A;  3EFF K;  3ABL B;  2EIK B;  5JQG A;  2XHB A;  1XDC A;  2ZCE A;  5H9C A;  3K06 A;  1M56 B;  4PA7 A;  3CEI A;  3R65 A;  1Z5W A;  2UXD B;  4DR2 B;  3UM7 A;  1YSC A;  2QWN B;  3RYH B;  3CC2 V;  1SA0 B;  4HAM A;  5B3S C;  3E22 B;  2B1I A;  2M7W A;  1WP7 A;  1V54 B;  4JI7 O;  3JAR A;  5LGN A;  5DED A;  3WG7 B;  1R3K C;  1DF5 A;  3LUT B;  1NTZ H;  2Q7E A;  4FK5 C;  5GON A;  3F7Y C;  4AQY O;  5K1X A;  3DSQ A;  4H0L B;  2AZ0 A;  5JVD B;  4JI5 B;  4WFF A;  1NVP D;  3GWO A;  4DV7 O;  2BSK A;  4DV1 B;  2ZNJ A;  2ZIN A;  1NVP B;  2B1G A;  4QPJ A;  2EIM C;  4MVM A;  4NKG B;  5L3F A;  1S5L Z;  3RYC B;  1W59 A;  1N0N A;  4I9W A;  4JTA B;  4DR5 B;  2Q7H A;  4TV8 A;  1AJQ A;  1U96 A;  5CB4 B;  4WBN A;  3QO5 A;  2F4V O;  5FL7 G;  5BR8 O;  4DR3 B;  4YJ2 A;  1CXZ B;  4EFB A;  3CCM V;  5A2Q N;  1RSO B;  2YIB D;  1FXH A;  2XAH A;  3A0B Z;  1CEZ A;  1K8A W;  5IYC O;  4LF5 O;  3L71 H;  2ITD C;  4I50 B;  2P4V A;  4L87 A;  4I4T A;  1OV9 A;  5L3E A;  2UUB B;  2YSU B;  4UCR A;  3RGB A;  1VEW A;  2ZE6 A;  4LNU B;  4DRX A;  3CHX A;  1JMK C;  2ZT9 B;  5BZB A;  5C93 A;  5IY5 B;  3X2Q B;  2IBZ H;  1VQ4 V;  3H1K H;  4FM1 A;  4GX2 A;  3VQV A;  3CP1 A;  4H13 B;  4LF6 B;  4DR7 O;  3OMA B;  1SQP H;  2YI8 A;  4FVM A;  1N33 O;  4L8J A;  4JAS A;  1AI7 A;  3QVN A;  3W7T A;  5K1P A;  3W7S A;  1KQS U;  4JI2 O;  3SYO A;  5L3B A;  4YIO A;  4YIP A;  1VQL V;  4JI3 B;  5D5Q A;  2UXB B;  5IJ9 B;  1AI5 A;  3KCX A;  2RDC A;  4DV4 O;  4LCU C;  2WAM A;  4MW8 A;  1AR5 A;  1JPX A;  2WWW A;  1K97 A;  2M6Y A;  1URF A;  1V9P A;  3AG3 C;  5KX5 A;  3F5W C;  1R3I C;  1CP9 A;  4K0K B;  2OCH A;  1VQ6 V;  2V4D A;  1R1B A;  3SYQ A;  1EFR G;  1N32 B;  4LR3 A;  1YIJ V;  3T2M A;  1Y4M A;  3QG5 A;  5LXT B;  4UUJ C;  4DV0 B;  1PPJ H;  1TUB B;  2PY5 A;  4UXN A;  1TVK A;  1RFY A;  2QR4 A;  4Z1V A;  4JI6 B;  2IW5 A;  5IJ0 A;  4G27 B;  4GZR B;  2GTS A;  3CCE V;  5CA1 B;  3K0D A;  1MAB G;  2F95 B;  4ZHQ A;  1LUW A;  4FZ0 A;  4NB5 A;  5IYZ B;  3U11 A;  3AG2 B;  3IGA C;  2K9P A;  2D2C B;  4UV9 A;  2JJ2 G;  2R70 A;  2PYL A;  3JCU Z;  2Q0O C;  2UXN A;  5LOV A;  4IL6 Z;  4B3S B;  1JJ2 U;  3P3P A;  1HP8 A;  5BY1 A;  5H6R A;  4DV3 B;  4BAY A;  1XNR O;  4OGQ B;  2QSA A;  4ZI7 A;  3OW2 U;  3CE2 A;  3JAK B;  1WJZ A;  2OIG A;  3M99 B;  1PKX A;  3Q4H B;  2YEV B;  1YVW A;  3BVO A;  4YHH O;  3CME V;  1FXK B;  1M57 B;  4AIL C;  2FKX A;  4BIZ A;  1S0V A;  3T4D A;  3OTF A;  4X64 B;  2F93 B;  4NXM O;  1I08 A;  2LFR A;  3ASO C;  4O4L B;  4TV9 A;  2JRI A;  2L6L A;  5LA6 A;  5FNV B;  1I7F A;  4LF9 O;  2GBO A;  2ZR3 A;  1GAX A;  1Y76 B;  1YXB A;  1H2G A;  1GN2 A;  2W0X A;  1MSW D;  3G6B A;  1HNX B;  4QE9 A;  4U7N A;  4RO2 A;  2FYU H;  1X4T A;  4KUM A;  1Q90 D;  3ZED A;  1G1X B;  1QR9 A;  3H1H H;  4JI1 O;  1R3J C;  5B3S B;  2X6A A;  5TIS Z;  4DR4 O;  3JAL B;  4DK1 A;  2PZS A;  1FYJ A;  2AW9 A;  4IYI A;  3ZRW A;  2KG7 A;  1HDJ A;  2YI9 A;  1VQK V;  4B7K A;  3AK1 A;  4QNH B;  1R6N A;  2ZDI C;  1ARO P;  3GVM A;  1HR0 O;  2BTQ B;  2O57 A;  4LFC B;  1YJ9 V;  4OPA A;  2B5U A;  3ML0 A;  2YS8 A;  2YID A;  2ZM6 B;  2EIN C;  4MVU A;  1LUV A;  3E2E A;  4P30 A;  1KP3 A;  4MT8 A;  1H2S B;  3B77 A;  4YJ3 A;  1MMM A;  3K9S A;  2EZO A;  3U0Z A;  4IIJ B;  4PEL A;  1FFX A;  3W7U A;  4ZOL B;  2Q68 A;  3JYC A;  5LMN B;  4GKK O;  2EIM B;  2QKA A;  3TK1 A;  2H94 A;  2EIK C;  2P67 A;  3K0G A;  2Q5Z A;  2N05 A;  3FYE B;  1Q86 W;  1P7B A;  2OCC C;  1AR4 A;  2JVD A;  2UUA B;  1L8D A;  2HHH O;  1JCH A;  1IBM O;  1S76 D;  1KKD A;  3L75 H;  1B6Q A;  2IJJ A;  3CPW U;  2XAQ A;  5KMG A;  1NI8 A;  2ZE7 A;  3MHS C;  4TUY B;  3N2G B;  4B7E A;  2WLL B;  1NJI W;  1P7G A;  1Q6I A;  2CDY A;  2VQF B;  2HVJ C;  2NNU A;  1SA0 A;  4UVC A;  3RYH A;  3AG7 A;  3E22 A;  3EVK A;  3B2E E;  4FLZ A;  3QTC A;  3L9D A;  2ATK C;  2YXY A;  3QO8 A;  3M7M X;  4F4L A;  3DTU B;  3B4S A;  4O4J B;  1QHT A;  1QU7 A;  4LWS B;  1YZB A;  1BHA A;  2IJK A;  3TGU H;  2CTR A;  1SQB H;  5IT9 N;  5DEC A;  1M4U A;  5JVD A;  2HEP A;  1SQG A;  4QJF B;  5IWA O;  1WPB A;  2XAG A;  3K5L A;  5E79 Z;  4DW1 A;  1XHZ A;  1FKA O;  2ZNI A;  3ETE A;  4JTD B;  1W0J G;  4JI7 B;  1WLE A;  3APQ A;  1GMG A;  3UQ8 A;  3RYC A;  3BCC H;  3CB2 A;  4X65 O;  2UU9 B;  4YY3 O;  5JH7 B;  1FJG O;  3AG3 B;  4N21 A;  3QF7 A;  1PNK A;  4I7Z B;  5CB4 A;  4AQY B;  2UUC B;  4NYK A;  1XMO B;  2E5L B;  4F6E A;  4GYC B;  3CS5 A;  1OHH G;  4PD4 F;  2BOC C;  2B9Z A;  1THZ A;  1RSO A;  1OCR B;  2HP8 A;  2Q8V A;  4UFZ A;  1BMF G;  4O2A B;  1NTK H;  1Q43 A;  3CYO A;  2YIB A;  2WA4 A;  3D3I A;  4GX0 A;  4X1K B;  4I50 A;  3ZMS A;  4J7J A;  2QTO A;  3ABT A;  1HNW O;  1W0K G;  2XAS A;  1XMQ B;  3HPL C;  4JAA A;  2Q73 A;  2P7T C;  1VQM V;  4LNU A;  1J95 A;  3ABM C;  1BQZ A;  1QLN A;  3VQX A;  4CH5 A;  5JJJ B;  4XDK A;  2WLN A;  3K3W A;  2OTL V;  1GK9 A;  4LF5 B;  4FMT A;  2EIJ C;  1OJH A;  3OUS A;  4LP8 A;  1GRJ A;  3K04 A;  1K9M W;  1VQO V;  1D2D A;  4DR1 O;  3ASN C;  1NZ6 A;  5IJ9 A;  4X8A A;  5LMU B;  4RAI A;  4I55 B;  4GX1 A;  1HNZ O;  5LP6 C;  1Q3E A;  3TJT A;  1AP6 A;  2EUL A;  3HB3 B;  3AG1 C;  1F7Y A;  5CMU A;  1S72 V;  3ASO B;  1YCI A;  3K57 A;  3ZRS A;  4DV2 B;  1VQP V;  1O9G A;  4X88 A;  4JI2 B;  5LXT A;  2QJ1 A;  2AGA A;  5EBL C;  1TUB A;  3OGC C;  3OM3 B;  5FPO A;  1Q81 W;  1GM9 A;  4CS4 A;  2CGO A;  3E86 A;  2QWR B;  1GH6 A; 
#chains in the Genus database with same CATH homology
 1E1R G;  1FXH A;  2IJI A;  2XAH A;  1BHB A;  3T4Z A;  1CEZ A;  1RPR A;  5L3G A;  1K8A W;  1HWY A;  3ZMU A;  5IYC O;  2ITD C;  2EIL C;  1QR8 A;  2Y69 C;  4R6Z A;  1VQN V;  4XDJ A;  1M9N A;  4L87 A;  4PDV A;  3DGE A;  1P4R A;  2DYS C;  1GKF A;  1QLE C;  2W6J G;  2Z3Y A;  3KG2 A;  4PDM A;  4R8C A;  5L3E A;  1W2B U;  3SPJ A;  2JJ1 G;  1Q7Y W;  2YSU B;  3AEI A;  4RQF A;  3RBZ A;  1DF4 A;  4Q20 A;  3SYA A;  4JAU A;  4MS2 A;  3E8F A;  4LBE C;  5BZB A;  5C93 A;  5IY5 B;  2GHY A;  1VQ4 V;  3X2Q B;  3EHB B;  2D3O W;  2R9R B;  1PD3 A;  2MK3 A;  2W0F C;  1NR1 A;  1RM1 B;  2P6J A;  1JQ0 A;  4OXS A;  4GX2 A;  3CP1 A;  2YEV A;  4FPP A;  3SJQ C;  2EIN B;  2WLJ A;  1NBM G;  3E89 A;  3OMA B;  1FXK A;  3ZN0 A;  2DWD C;  3CCV V;  4JAS A;  1AI7 A;  3W7T A;  3W7S A;  1KQS U;  5B1B B;  3SYO A;  3ZMV A;  4YXW G;  4GT1 A;  5CBF A;  4PA3 A;  1MOF A;  5L3B A;  5CA3 A;  1VQL V;  1YHQ V;  5B1A B;  4G2K A;  2PI4 A;  1F4N A;  2WSS G;  1AI5 A;  3ZMZ A;  1ENV A;  5EK0 A;  2OCC B;  4LCU C;  4R7C A;  2WAM A;  2WLH A;  4MW8 A;  5LBQ A;  1JPX A;  5KA5 A;  3MD0 A;  2WWW A;  1KC8 W;  1K97 A;  3PJS K;  2QE7 G;  3AG3 C;  5H6Q A;  4JGS A;  4Z1M G;  3FB7 C;  3WFV A;  1Y66 A;  3F5W C;  1R3I C;  1CP9 A;  4KP4 A;  4WFB V;  1VQ6 V;  3JD1 A;  3VBB A;  3K79 A;  2C2A A;  3OR6 C;  3SYQ A;  1EFR G;  3FB5 C;  5L3D A;  3NXS A;  5B1N A;  4MTF A;  3AG4 C;  1JX9 A;  4JYB A;  3UKM A;  1K73 W;  3JD0 A;  1YIJ V;  3T2M A;  1Y4M A;  4UUJ C;  3OAA G;  1Q82 W;  1VQ8 V;  2HG5 C;  4UXN A;  4WFE A;  4ZKI A;  1GO3 F;  2IW5 A;  3CCJ V;  3STL C;  1DLB A;  4G27 B;  4MVZ A;  3P32 A;  1G8M A;  4H37 A;  3CCE V;  2QM8 A;  3P30 A;  4MVS A;  4WF9 V;  3K0D A;  5KUM A;  3SYC A;  3ABL C;  5CBH A;  1MAB G;  1L1F A;  1CPY A;  1M56 C;  1I5X A;  2LFS A;  4TT3 G;  2WLI A;  1H8H G;  3G71 V;  1FFT B;  3AG2 B;  5LHG A;  1PNL A;  4JTC B;  2Q69 A;  3IGA C;  3SPH A;  1KD1 W;  3K03 A;  4UV9 A;  2JJ2 G;  1SZT A;  3OFN G;  2P90 A;  2UXN A;  3RW0 A;  1V54 C;  1OCC C;  2NLJ C;  1JJ2 U;  4WFA V;  2AHY A;  5H6R A;  4BAY A;  3I55 V;  3WG7 C;  3CCQ V;  1K7D A;  3E8G A;  3W7W A;  3OW2 U;  3B8M A;  3K9A A;  4E2L A;  1K3E A;  3M99 B;  1PKX A;  4RUE A;  1YJN V;  2YEV B;  4I5S A;  3SPC A;  3CCS V;  1FS0 G;  3CME V;  3ETG A;  3T1C A;  1FXK B;  1M57 B;  3QO7 A;  2JIZ G;  3LDD A;  1V55 C;  2DW4 A;  1E1Q G;  2DQ3 A;  2A79 B;  5HFL A;  4MTG A;  4BIZ A;  1S0V A;  3T4D A;  5LGU A;  2XND G;  2Y48 A;  2LFR A;  3ASO C;  3FB6 C;  3LSQ A;  1RPO A;  3JD4 A;  1K5Q A;  1ROP A;  3E35 A;  1UJW B;  5HFM A;  2ZR3 A;  2DYR B;  1NQT A;  2IU0 A;  4MW3 A;  3RVZ A;  1H2G A;  2WLL A;  1MSW D;  1M1K W;  1JVM A;  1QVG U;  4QE9 A;  4U7N A;  4RO2 A;  3JCZ A;  4QE7 A;  4ZBM A;  4EKW A;  2QKS A;  4KUM A;  1PL0 A;  1QR9 A;  4FJC C;  2OT5 A;  1K34 A;  3IC7 A;  1S3J A;  4QIW F;  4WFH A;  4MVQ A;  4PDL A;  2DQ0 A;  3GB7 C;  4H33 A;  2W6I G;  3ABM B;  3SPG A;  4RUF A;  4TSF G;  3ABK B;  1PNM A;  4UVB A;  2EBO A;  1R3J C;  5B3S B;  2JEU A;  2GSM B;  1SER A;  2X6A A;  1QBZ A;  2WLM A;  2HLD G;  2ZD9 A;  3AG4 B;  1BL8 A;  3ZRW A;  5GW7 A;  1VQK V;  5IDJ A;  4GCZ A;  4QNH B;  1R6N A;  2ZXW B;  3ETD A;  2ZDI C;  1ARO P;  2CK3 G;  4GX5 A;  3B8N A;  2WLI B;  3ZRV A;  3ZRX A;  1IXM A;  5LGT A;  2EIJ B;  5IYD O;  4PA4 A;  5IY5 C;  1YJ9 V;  3X2Q C;  2B5U A;  4XBF A;  1YTF D;  2F43 G;  3ML0 A;  2R9I A;  4P2Z A;  1RM1 C;  3ASN B;  3RVY A;  1WPX A;  1ZWI C;  1COW G;  4CZZ A;  2HVK C;  1GTO A;  3OMN B;  2EIN C;  4J9Z B;  3JD3 A;  1OCR C;  3JD2 A;  4MVU A;  1YTF B;  3E2E A;  4ASU G;  4P30 A;  2JEX A;  1KP3 A;  4DO2 A;  3FYI B;  5B1B C;  4MT8 A;  2IU3 A;  2V7Q G;  3B77 A;  3AG1 B;  1EBO A;  4WFG A;  2EZO A;  3FB8 C;  3ZJZ A;  1VQ7 V;  4PEL A;  1NH2 D;  3W7U A;  4R50 A;  2Q68 A;  3JYC A;  2EIM B;  5EC2 C;  3TK1 A;  5B1A C;  2H94 A;  2KB1 A;  2EIK C;  2P67 A;  3K0G A;  3LNM B;  3ZCC A;  3OMI B;  1NH2 B;  3FYE B;  1Q86 W;  1OCO B;  1P7B A;  2OCC C;  2HFE C;  3W7X A;  3H01 A;  1KEC A;  3F7V C;  4J9Y B;  1JCH A;  1S76 D;  1KKD A;  3CC4 V;  1B6Q A;  2IJJ A;  3CPW U;  5CBG A;  1N8R W;  2XAQ A;  1ORQ C;  4WCE V;  1EZJ A;  3SPI A;  4TWK A;  3MHS C;  1VQ5 V;  1LNQ A;  4DXW A;  2QA4 V;  1AI6 A;  1AI4 A;  2WLL B;  1NJI W;  2EIL B;  3OE7 G;  2DWE C;  2Q67 A;  2Y69 B;  2HVJ C;  2NNU A;  4UVC A;  3LDE A;  1K4D C;  2HKO A;  2DYS B;  3IFX A;  1QLE B;  1R6K A;  3ZIA G;  3K08 A;  2ATK C;  3QO8 A;  1G4Y B;  1F4M A;  1K4C C;  3STZ C;  5B1O A;  3OUF A;  4F4L A;  3DTU B;  1TUE B;  4JPR A;  4PA6 A;  4BW5 A;  2ZR2 A;  4RQE A;  1QVF U;  1NKD A;  1AJP A;  4LC1 A;  1SRY A;  1OCZ C;  3AG2 C;  1BHA A;  1AJN A;  4JYC A;  3CCU V;  3CD6 V;  1SES A;  3CMA V;  1M90 W;  2EZP A;  2IJK A;  5E1A C;  2BOB C;  5EBM C;  3G6E V;  3ZRW B;  1F51 A;  4FIP C;  4PDR A;  4QPK A;  1AR1 B;  2AHZ A;  4X89 A;  1DTO A;  2IH1 C;  4QJF B;  2PI5 A;  2HR3 A;  1YI2 V;  3CCL V;  4P9O A;  3OR7 C;  4UVA A;  2XAG A;  1R3L C;  3ZN1 A;  2XOK G;  1QCE A;  4UV8 A;  3ZMT A;  1F23 A;  3ETE A;  3VOU A;  4JTD B;  1W0J G;  3CCR V;  1SET A;  4JF3 A;  5L3C A;  1WLE A;  1GMG A;  2A9H A;  1H8E G;  2WLK A;  4MSW C;  1FXK C;  2IH3 C;  1M57 C;  3SYP A;  2X6C A;  3AG3 B;  4N21 A;  4XDL A;  2XAJ A;  2ITC C;  2IJH A;  1PNK A;  5DN6 G;  1YJW V;  4MTO A;  4BIU A;  2K1E A;  4MVO A;  4G28 B;  3CXC U;  2WPD G;  3I56 V;  3MHH C;  3G4S V;  3D36 A;  5EBW C;  1OHH G;  1K33 A;  2A0L A;  2BOC C;  3BEH A;  1THZ A;  4KFM A;  1OCR B;  4JAV A;  2UXX A;  1BMF G;  1JOY A;  2DYR C;  3CYO A;  1E79 G;  5J9P C;  3D3I A;  4P9P A;  1K92 A;  4GX0 A;  2X7R B;  1XL4 A;  4MTX A;  1S77 D;  3ZMS A;  3EFF K;  2QEX V;  2QTO A;  5KA6 A;  3ABL B;  2EIK B;  2LP7 A;  3ABT A;  1W0K G;  2XAS A;  3HPL C;  3K06 A;  1M56 B;  1R73 A;  5H9C A;  2ZDI A;  1K5S A;  4PA7 A;  2Q6A A;  3R65 A;  2P7T C;  1VQM V;  3UM7 A;  1J95 A;  1YSC A;  3ABM C;  3LDC A;  3ABK C;  3CC2 V;  4HAM A;  5B3S C;  2B1I A;  1QLN A;  5DM6 V;  2M7W A;  2ZQM A;  4U7O A;  4XDK A;  2WLN A;  1V54 B;  1OCC B;  2H8P C;  3K3W A;  4MVR A;  3FKS G;  1OZ0 A;  2OTL V;  1GK9 A;  5LGN A;  2ZXW C;  3WG7 B;  1R3K C;  1S5H C;  3ABU A;  2X6B A;  1KP2 A;  1DF5 A;  4FMT A;  2EIJ C;  2Z5U A;  3LUT B;  3OUS A;  2JK5 C;  4LP8 A;  3TCU A;  5KUK A;  3K04 A;  2QM7 A;  1K9M W;  4FK5 C;  1VQO V;  3F7Y C;  3ASN C;  3A0R A;  4CBC A;  4X8A A;  4WFF A;  5IYB O;  1NVP D;  1V55 B;  3BY6 A;  3GWO A;  4RAI A;  2X0L A;  4GX1 A;  2XAF A;  2FTK A;  3E8B A;  3QNE A;  4HZ3 A;  3HB3 B;  1OCZ B;  3AG1 C;  1NVP B;  3E83 A;  3E8H A;  5CMU A;  2B1G A;  2OTJ V;  1H38 A;  1S72 V;  1VQ9 V;  4QPJ A;  3ASO B;  3OEE G;  5LHI A;  2EIM C;  3OEH G;  1XL6 A;  4MVM A;  4HYO A;  5L3F A;  5LHH A;  4PA9 A;  3ZRS A;  4N23 A;  1VQP V;  2HJF C;  4X88 A;  1NR7 A;  3LSS A;  1OCO C;  1I5Y A;  4I9W A;  4JTA B;  1FXV A;  1GM7 A;  1AJQ A;  2EJR A;  5CN0 A;  1YIT V;  5EBL C;  3CC7 V;  3OGC C;  2JDI G;  3OM3 B;  5EC1 C;  3QO5 A;  1GM8 A;  1Q81 W;  1GM9 A;  5FL7 G;  1MG1 A;  2V1D A;  3E86 A;  3TET A;  3CCM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...