1BL8A

Potassium channel (kcsa) from streptomyces lividans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (POTASSIUM CHANNEL PROTEIN)
publication title The structure of the potassium channel: molecular basis of K+ conduction and selectivity.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 29
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bl8A00
4WFGA 4X89A 3SPJA 4PDRA 2AHYA 4WFHA 5EBWC 3RVZA 4MW8A 5CBFA 2EINC 2K1EA 3LDDA 4J9ZB 2DYSC 2QTOA 2BOCC 2X6AA 3EFFK 3HPLC 4MSWC 3SPIA 4RUEA 2OCCC 3KG2A 1JVMA 4QE7A 3SJQC 2IH3C 3SYAA 4LCUC 1LNQA 5CBHA 3ZJZA 2H8PC 2Y69C 4MVMA 2WLJA 4PA6A 2Q67A 4ZBMA 2P7TC 1G4YB 3K04A 4P30A 3SYOA 5KUKA 4WFEA 3AG4C 3FB8C 1OCZC 3E8BA 2ITCC 2A9HA 3K0DA 1KKDA 2HG5C 2WLNA 4MTOA 4GX0A 4X8AA 2NLJC 2YEVA 3OGCC 5EBMC 3ABKC 3OUFA 3VOUA 2KB1A 4XDKA 4JTCB 2WLLA 4LBEC 4GX1A 1R3IC 2BOBC 3E89A 2JK5C 3IGAC 1BL8A 3RW0A 3FB5C 1K4CC 4MVRA 3K06A 2AHZA 3FB7C 4GX2A 4PA9A 3TETA 4X88A 3LUTB 2A79B 1M56C 3F5WC 3JYCA 2WLIB 3E83A 3STZC 1XL4A 4P9PA 3LNMB 1M57C 2ATKC 4TWKA 2DYRC 2ITDC 1ZWIC 3WG7C 3ASNC 4MVOA 2WLKA 4MS2A 4UUJC 3SYCA 1R3KC 3RBZA 2HVKC 3T4DA 4EKWA 4JTAB 2WLIA 2A0LA 4HZ3A 4MVSA 4RUFA 2X6CA 3E8GA 3SYPA 1R3LC 2HVJC 3LDEA 5E1AC 4G27B 2EIJC 4PDVA 3ABMC 3FB6C 4H37A 3OR7C 4R50A 5EC2C 5EK0A 2Q68A 5IY5C 1V54C 4MW3A 1OCRC 2IH1C 2ZD9A 3BEHA 3F7YC 3E8HA 4H33A 4KFMA 2EIKC 5KUMA 1V55C 4RO2A 3TCUA 3K03A 1S5HC 2EILC 2Q6AA 3OR6C 4PDLA 4MVUA 3RVYA 4LP8A 3E86A 2HJFC 4PA7A 3ASOC 4GX5A 4R8CA 5EBLC 5B1BC 4MTFA 1OCCC 3R65A 3ABLC 2R9RB 4MTGA 4QE9A 4XDJA 3SPHA 3SPCA 4DXWA 1XL6A 3F7VC 4R7CA 3T1CA 4WFFA 3PJSK 3UM7A 3E8FA 4PA4A 4JTDB 4MVZA 3SPGA 4P2ZA 4F4LA 1J95A 3STLC 2W0FC 1P7BA 4MVQA 2EIMC 4BW5A 1R3JC 4I9WA 3AG3C 3T4ZA 4G28B 4CBCA 3LDCA 4OXSA 2WLLB 3AG1C 2ZXWC 5BZBA 2X6BA 5EC1C 3K08A 5B3SC 3UKMA 4R6ZA 3K0GA 1K4DC 4PA3A 4P9OA 2HFEC 3T2MA 1OCOC 5CBGA 3GB7C 2WLHA 2WLMA 3AG2C 1QLEC 3IFXA 4J9YB 4PDMA 1ORQC 2QKSA 3ZRSA 4QNHB 3X2QC 5J9PC 4HYOA 2DWEC 3SYQA 5B1AC 4XDLA 4RAIA 2Q69A 2DWDC 3OUSA
chains in the Genus database with same CATH superfamily
1WNSA 4YJ3A 3BPZA 2EBOA 1Y4MA 5LMUB 1EN6A 5LBQA 3K58A 5B3SB 4DV5O 1HNXO 2D3OW 2KQXA 2UUCO 1PL4A 5EIBD 2QWOB 4JI5O 4DV7O 3K3WA 1FFXB 4XBFA 1YHQV 1K34A 1JQ0A 3ZHQA 1NJIW 5L3DA 1AI5A 2UUBB 2VQEB 4BIUA 2VS0A 4J80A 1SQVH 1GN4A 4LF5O 4JZ2A 1FFXA 4GX1A 2CTWA 2HHHO 5FPOA 3L74H 4MVRA 3K06A 2WLIB 3TK1A 2OIGA 1FXHA 3LNMB 3SGIA 1DF5A 4FJCC 3UQ8A 1L0NH 1R1BA 4Z2WA 5KMGB 4X65O 1ZWIC 3WG7C 4MVOA 2WLKA 1KQSU 4QIWF 2WLIA 3P3NA 1B3QA 4UXNA 1VF7A 3K5OA 3ZMTA 5CA1B 4NKGB 4PDVA 1Z5WA 5KMGA 1QBZA 1XNRB 4YIPA 2RN9A 1B04A 1WP8A 1FAFA 4PDLA 2QM8A 3RVYA 1NH2D 5J2UB 3E22B 3JARB 3OTFA 1NS1A 5CA1A 2OIEA 3ABUA 2ZR3A 5DN6G 1NTZH 2VRZA 1AR4A 1F7YA 3Q4HB 1VQ7V 2JJ2G 2XOKG 4JI3B 1AP6A 3IJ4A 3MAQA 5LMUO 2EIMC 3AG3C 4LWSB 1KC8W 4CBCA 3ZCCA 3WB1A 4R6ZA 2YI9A 4DR1O 1W0KG 2AW9A 1K33A 4JYCA 4EFEA 2DWEC 4WBNB 4OGQB 4LWSA 3BY6A 2Q69A 1R6NA 3OGIB 4JI1B 2YXLA 5EBWC 2VQEO 4IL6Z 3TJTA 1GM9A 2DYSC 3MHSC 2DE0X 4YHHB 2JDIG 5KHGA 5IYCO 1NI8A 1ROPA 4WBNA 1UFIA 4JPRA 3LSQA 4MVMA 1MG1A 4UB8Z 2PY5A 4NXNB 3OAAG 4X8AA 1AB3A 4XDKA 2GDSA 4LBEC 4DV6B 2HEPA 1GTOA 4NYKA 4GCZA 4GX2A 5KA5A 2NR5A 4N23A 1SESA 3I55V 3ZIAG 2E3CA 3BHPA 4LH7A 1EFRG 4NB5A 4I55B 1XNRO 1PL0A 3CXHF 3ZEDA 4JYBA 4FZ1A 2ITDC 2JRIA 5B5EZ 1O9HA 1DF4A 2A7WA 5EYPB 4LH6A 3SYPA 4I55A 3LDEA 2LJ2A 4X66B 4JI4B 2IH1C 1SF9A 3BEHA 5LP6B 2F93B 1YITV 5EYPA 3AG4B 2UUAB 1V55C 3DXRB 1Q8IA 2QJ1A 5JCOA 1DTOA 3H01A 2Q7HA 5HFLA 4LP8A 3CRMA 3CCMV 1S76D 5L3FA 5ITZB 4HBNA 5KAFZ 2M7WA 2W0XA 1DK1A 5LP6A 3SPCA 3DXRA 4JI1O 2YXHA 3CYOA 1Q7YW 2BCCH 3STLC 5ITZA 5JVDB 3TXSA 1MABG 4Q6GA 3IC7A 4G28B 4DK0A 4DV2O 4OX9O 1KP2A 1WJZA 2YXYA 3ASNB 1JOYA 2E76B 1EZJA 3H1IH 1D2DA 3N2KB 3ZRXA 3SYQA 2X6CA 1I0HA 2B9ZA 2DQ3A 2Q73A 2ZE5A 3EFFK 2B1IA 4CH5A 3RWRD 3W7SA 3SJQC 1YF2A 4JYAB 4L8JA 2YEVB 3R66A 2Y69C 3IAYA 1BQZA 1QQCA 2L6LA 3ZMSA 4IT5A 4CS4A 3CC4V 2WA3A 4FM2A 1T5EA 1FJGB 2YEVA 3H1LH 2JGDA 3D36C 4LF7O 4LF4B 5KAIZ 1VQ4V 3CCUV 4YIOA 1ZAUA 3WB2A 2ZE6A 3CCRV 1PPJH 2F95B 1M56C 4X66O 4JI4O 4O4HB 4MT8A 4O4JB 4MTXA 1M90W 2V7QG 2AZ2A 3G4SV 2RJZA 5KX5B 5CMUA 3T4DA 4MS2A 3VQXA 2QWPB 2HVKC 1ZSPA 4O4HA 2FTKA 3B8NA 2FMLA 3ABMC 3C90A 4TQDA 1O9GA 1Y74B 3F7YC 5L3EA 3VOUA 1VMGA 5GW7A 4O4IB 1IXBA 3HKBA 3CJHB 3MDSA 4FM0A 3ABKB 1OCCC 5GONA 2R9RB 4A5UB 2EULA 1Y74A 3N2GA 5LL6Y 4K8ZA 1VQ9V 4B3RB 3T1CA 2XAJA 2JEXA 4WFAV 4O4IA 1QLNA 3CJHA 3I5DA 2BTOA 1F51A 4ICGA 3K5LA 3JATB 3MHHC 1EBOA 2W6JG 4U3JB 2LP7A 4NXMB 3CSXA 3JAKB 3CS5A 4F6RB 1S72V 1N32B 5H9CA 3JATA 5IJ9A 1IXMA 1FJGO 2RNBA 1FPOA 4U3JA 1BGYH 4RUEA 4U7NA 4GKJB 1G1XB 2EILB 2LW1A 4YY3B 2GHYA 1XILA 3W7UA 5B1BB 3U0ZA 2QWRB 1GKFA 3AG7A 2ITCC 3RYCB 1WA8A 1KKDA 2VWKA 3T1HB 2IJKA 2AZ0A 4OPHA 4DUYO 2YIAA 3CC2V 1H38A 2PI4A 5FNVB 1K4CC 1JJ2U 4DV1O 3RFRA 1W0JG 3APQA 4FPPA 5L3CA 4JI2B 4UFZA 1GN3A 2ATKC 4DV0B 1ZX3A 5FNVA 2DMXA 4W4LA 3CCQV 4UUJC 3K59A 2A0LA 4FLZA 2GSMB 1FKAO 3FB6C 1G8MA 2RDCA 3UT5A 4ZI7A 1RPOA 4WCEV 3P3PA 1XBLA 2WA4A 5LYJA 2E5LB 2Y0IA 3OR6C 2LQTA 3A0RA 1IBKB 3ASOC 4NXMO 3OMNB 1RM1B 1JFFB 1N32O 1Z2GA 4X20B 2ZE8A 4B08A 2ARHA 4JI8B 3PJSK 1KU9A 1P4RA 2AGAA 4P2ZA 1ENVA 1R3JC 1JFFA 3LDCA 3W7XA 2P6JA 2A06H 4JV5O 2X6BA 3FAVB 1CP9A 3A8TA 5J9PC 4D6TH 4XDLA 1NR1A 4UCTA 3D3IA 4LR3A 4DR4B 2AHYA 4B3MB 2K1EA 3FAVA 1K97A 2LFRA 4LFAB 5B1OA 5L3GA 3QO8A 1ZL8B 5IYZB 3LSSA 3SYAA 2ZNIA 1KMIZ 3DC5A 1FD9A 2OTJV 2Q67A 4ZBMA 1JR9A 1G4YB 3K04A 1N33B 3FB8C 4J41A 1BCCH 1ZL8A 5IYZA 2QGNA 4UB6Z 3OGCC 2Y4TA 1VQNV 4BWAA 1S5LZ 4TSFG 3ZHTA 1VP7A 2L35A 2A79B 1RFYA 4YXWG 2JJ1G 1Y76A 2XAQA 4JI6B 5LGTA 2N74A 2ZR2A 3CC7V 2JEUA 2EINB 5C93A 1M4UA 1IX9A 4DV5B 2XAGA 1GO3F 3BA9A 4JI5B 5CN0A 1YI2V 3QVNA 4DV4O 1R6KA 1TUBB 1VQ6V 2KG7B 1AI4A 4QPKA 2VQFB 2Q7EA 3OTOO 3SPHA 2PYJA 4JI7O 4DUZO 2HHHB 1TUBA 4DV3O 3O65A 4MVZA 4B3MO 3BA8A 1KP3A 4H44B 2P4KA 3OMAB 1PP9H 2K9PA 1WPXA 1PV0A 1NVPB 5EC1C 2B1GA 4P9OA 2Q0OC 1VF6C 5CBGA 3CD6V 1N33O 5JJEB 4PHZA 3ABTA 4RAIA 1V54C 4X89A 1MZFA 4WFHA 2WAMA 2CH7A 2X6AA 3HKDB 3JD0A 5IY5B 2B5UA 2OTLV 3AK3A 1Q6UA 2IJHA 4LCUC 4I9QA 5J2TB 1SS3A 1BMFG 4B7KA 4WFBV 4JAAA 3CCSV 4X1KB 3P32A 3EVKA 5J2TA 1XEQA 1K9MW 3K57A 3JSNA 1R3IC 2BOBC 1OHHG 4DRXA 4K8XA 3LUTB 4OPAA 5H6RA 1BS3A 1LUVA 1KYOF 3ZBHA 4DR1B 3X2QB 1R3KC 3RBZA 2FYUH 3G67A 1MA1A 5KLVH 2VQFO 5IWAB 1DLBA 1QVGU 5JJJB 3SDLA 1NBMG 2N04A 1OCRC 3TCUA 2EIKC 1N0JA 3ETGA 4NR1A 3K03A 1W2BU 2FKXA 4IIJB 3EXAA 3ZS8C 2OCHA 4J7ZA 2EX3A 3CP1A 2DJVA 4CS3A 4B3SO 3SPGA 4IIJA 4E2LA 2UXBO 4AHCA 4ABMA 4BW5A 1M57B 1QR9A 4OXSA 2ZXWC 1P49A 2DYRB 5LP6C 2XUMA 5GTHZ 3T2MA 1AR5A 2IM9A 3BVOA 3H9VA 2BTQB 3L70H 2V1DA 4D7TA 4I4TB 2R9AA 2HLDG 5FL7G 5J2UA 3ZN0A 3E22A 3JARA 4UV9A 4QGPA 1S0VA 5H2FZ 2QKAA 4I4TA 3Q4HA 3NR7A 3ABLB 3SJCC 4WF9V 3CE2A 1IDSA 3SR2C 2XT9A 5LHIA 3TXQA 1XMOO 1VQ5V 4KL1A 2IJJA 1H8HG 4DR5O 4FFBB 3WB0A 1OJHA 4X88A 4FFKA 5IWAO 4DV2B 3F5WC 4OX9B 2P5OA 3ETEA 1YSCA 1SQQH 3AG2B 3BFRA 1ZLZA 3AEIA 4TWKA 3G71V 3K9AA 1MOFA 4FFBA 3OFNG 2O57A 1SQPH 5JH7B 2MW2B 5E1AC 3DC6A 3RGBA 2BE3A 1NVPD 3QNEA 1GN2A 3JCUZ 1VQLV 2CGNA 1I94O 2F43G 4UVBA 3AK2A 3FFQA 4I50B 3E86A 3OE7G 2IW5A 2QM7A 4FLXA 3L9DA 4G2KA 1R73A 4LF7B 2EJRA 3B2EE 4DXWA 1XL6A 4YJ2B 3C3TA 1K5QA 2NNUA 1IBMO 4PELA 3T1YB 2W6IG 4CC6A 1EZVH 2YC0A 2KSDA 3RYIB 4LFCO 1IVSA 4YJ2A 3WG7B 1K73W 3A0HZ 1SQXH 4J11A 3G6BA 4HYOA 1B06A 1H2GA 3RYIA 3ZRWB 4ZKIA 5B1NA 1CEZA 1K5SA 3FKSG 1FYJA 3D3QA 2BSKB 2GTAA 4X64B 1F23A 4I5SA 4DR2B 2UXNA 3HR0A 3UCSC 2RCVA 1NTMH 2X0LA 1CXZB 1NQTA 3ZN1A 1FFTB 2BSKA 1Q3EA 4TV9B 5JVDA 1VEWA 3B4SA 1H2NA 3FD9A 1RSOB 2EIMB 3FB5C 3AG3B 4TV9A 1N4CA 2C2AA 3M8AA 1E79G 4IGGA 3N2KA 5BY1A 5KA6A 3ETQA 4FIPC 3ZMZA 4UCSA 1F4MA 2F4VB 4EEQA 1Y6XA 2XHBA 4EKWA 1E1QG 2DYSB 4AI8A 1HP8A 4B7EA 3OW2U 2ILMA 1N36B 3VQYA 1D5AA 3APOA 2ZQMA 4BR6A 3T1YO 2XAHA 1URFA 2ZD9A 2JGUA 4U3FH 3WU2Z 1N0NA 1AROP 4KHPO 4R8CA 1XREA 4MTGA 4DUYB 4LF6B 4O4JA 2ETNA 4DV1B 5KX5A 3KKYA 4PV1B 4X9QA 3JD3A 3T4ZA 4X64O 4DR2O 1IZ3A 3UKMA 1XI1A 1OCOC 5A2QN 2WLMA 1WPBA 4GLXA 5EIBC 1YJWV 2QR4A 4RQEA 1RM1C 4FVMA 3L72H 5CBFA 2Z0AA 2ADQB 3SPIA 2OCCC 3BAAA 3ZX6A 1XHZA 1ZUQA 1V55B 1V9PA 3B09A 1KKCA 2CGOA 5LXTB 2N05A 1GM8A 2HG5C 5IYDO 2F4VO 4NVPA 2HP8A 1H8EG 1TA8A 3OUFA 1JJOA 1Q5OA 1BL8A 4F6EA 1XHXA 3JAKA 3BRCA 2ZCEA 4UCVA 5LGNA 1N36O 3QG5A 4PA9A 4F6RA 1M9NA 4JV5B 3STZC 3GWOA 2NN4A 1BZKA 4TT3G 4IHJB 1VQ8V 2ZNJA 4B3TO 4LF6O 2AXTZ 2KKWA 3RYCA 2Y69B 3CHXA 4L87A 2D2CB 1AI7A 2Q6AA 3CB2A 2RQ6A 4GZRB 2IU3A 5B1AB 1I7FA 1FXVA 1N34O 4DR3B 1YXBA 4Z1VA 1YIJV 3F7VC 3UO2A 1GM7A 4UVAA 5FPRA 1M56B 4QJFB 3I56V 1QR8A 5JQGB 1AR1B 1FXKC 4X1IB 4KP4A 1K4DC 2GUZB 2V4DA 2ZM6B 1VQKV 1QLEC 3J7AU 3SJAC 1NU1H 4U7OA 1HW7A 1MSDA 1I5XA 5JQGA 5LMNB 2Q8VA 3OUSA 5IE9A 1SC5B 3ICXA 3RVZA 3W7TA 5AG2A 3LDDA 3ABMB 2BOCC 2GUZA 4CH4A 3J81N 1US6A 4UCOA 1S5JA 1EN5A 4DV4B 5CBHA 5FLXN 3BCCH 2UXXA 1L1FA 3JD1A 4X20A 5D5PA 5A9GA 3JAWB 5KUKA 1OCCB 2F66C 5KHKA 3HB3B 3OTOB 2EZPA 4JI7B 4DUZB 4DV3B 4JTCB 1WB7A 3JAWA 3IGAC 2EIJB 3RW0A 3JAMN 4UV8A 3FB7C 4FLTA 1PKXA 3H1JH 4UCUA 3CEIA 2OWOA 1THZA 3RT3C 3ETDA 3SYCA 3GVMA 3N27A 1GK9A 4JTAB 2EZOA 4HZ3A 5JWPA 3E8GA 2HVJC 4DR3O 1AILA 2IU0A 4H37A 3M99B 5BMVB 5B3SC 4KFMA 1A32A 5BXZA 4ZIBA 3VBBA 3GWKC 2HJDA 1LUWA 2WPDG 1MSWD 2ZM6O 1SZTA 1M5IA 5BMVA 2P06A 1JMKC 3HKEB 4QE9A 1KUQA 3CCLV 5LMNO 1M93A 2Y0PA 1MNGA 1H2KA 4PJ0Z 1P7BA 4BW9A 1YZBA 2WLLB 2CTPA 2UU9O 2JVDA 1HDJA 4DK1A 1K3EA 1VARA 3IC9A 1K7DA 1IURA 4DR7B 5LHHA 4O2AB 3THOA 1QCEA 2EJ7A 3CPWU 3EHBB 2KG7A 5BR8O 4GKKB 2IH3C 1AJQA 1Q6HA 2P22C 1AJPA 4UVCA 4K35A 5L3BA 2OYQA 3ASOB 4LFBB 4P30A 2F1MA 3E8BA 2A9HA 1NZ6A 5CA3A 1YDXA 3FYIB 2ODMA 1L8DA 1H2SB 4B3SB 1WAZA 4RWUA 4UCRA 4AQYO 2UXBB 2Q0AA 1FS0G 2X7RB 2AHZA 1Z5VA 4FK5C 3BABA 3HKCB 3HKDA 2P90A 1HNZB 5LOVB 1JCHA 1SA0B 4O4LB 1S3JA 3S3WA 1DGSA 3CCJV 3HKCA 4CH3A 1SRYA 4C7UA 4X1KA 3OR7C 2XTAA 1SA0A 3AG1B 4O4LA 4KUMA 4MVUA 5DEDA 2Q7GA 3J80N 3ZMVA 2R70A 1XMOB 3CX5F 1AI6A 1RPRA 2Y4UA 3CRQA 4X62O 1CPYA 2QTSA 5E79Z 4DR5B 4DR7O 1XMQB 5TISZ 4PA4A 1EN4A 2YUAA 4F4LA 2CE4A 3O9OA 2Y48A 4LF9B 3F5TA 4GKKO 2R9IA 1PNKA 1OCZB 3ZHUA 5IDJA 2LO1A 4LFBO 1ORQC 3OMIB 3QF7A 4PDRA 3K5NA 1VQMV 1M1KW 4MW8A 1QHTA 5JCOC 4QE7A 4JI0B 1I94B 4TV8B 3WFVA 3L75H 5K1PA 3AG4C 2CTQA 4K0KO 3K0DA 1F4NA 2UXCO 3JASB 4J7KA 1NKDA 1HNZO 4TV8A 3E35A 4JAVA 1IBMB 1TAEA 4D7SA 1GRJA 2JK5C 1MMMA 1YEWA 3QO7A 2ZDIA 2ZE7A 3VQWA 5K1XA 3S3XA 5IT9N 1NTKH 1Q90D 4LFCB 1TVKB 3JASA 2DQ0A 2BTQA 2JS3A 1BE3H 2Q9LA 2CTRA 3UO3A 3B8MA 3E2EA 4X1YB 5C8YB 1V54B 3ASNC 3U11A 1TVKA 4H13B 2QE7G 2IBZH 3CWBH 1VF6A 2CUGA 2XAFA 1P84F 3KCXA 2ZIOA 3W7WA 4X1YA 5C8YA 1XMQO 1Q82W 5KUMA 2F23A 4LF9O 2YIDA 1JPXA 2ZKOA 1IBLB 2PI5A 4PA7A 5EBLC 4IYHA 1NT2B 2UUBO 1QU7A 1SKVA 1H2LA 1PM9A 1I08A 3E8FA 2ZIMA 1PD3A 1J95A 4FLVA 4MVQA 5JH7A 4JI0O 4LC1A 4DW1A 2PZSA 4NTXA 4PA3A 1VQPV 4J7JA 4H0LB 4JASA 2H94A 3JALB 3SPJA 1SQGA 4TOIA 4J9ZB 4I50A 2A3QA 1OCRB 2UXDB 3LNNA 5F2VO 2EIKB 4PI0A 2P4VA 2WWWA 3JALA 4DW0A 4KHPB 4DYLA 2P7TC 4WFEA 1R6TA 3L71H 3JCZA 3M7MX 2PF4E 2YDEA 4MTOA 1WP7A 2NLJC 1XDCA 3ABKC 3D8CA 1S77D 3P30A 1D5NA 3CRRA 1XQ8A 4FLYA 2XNDG 2GTSA 4PD4F 1HR0B 3ZRVA 5HFMA 4JI3O 2ZXWB 1YCIA 3E83A 1UPGA 1WB8A 1XL4A 3ZRWA 1HNWB 3G6EV 5CA0B 4RQFA 1G6UA 3B40A 3ZHVA 3K9SA 3OM3B 1IBLO 3RYFB 4DR6B 4LNUB 4RUFA 2RMKB 2PYLA 2M6YA 4CH6A 1WN7A 5CA0A 3L73H 4I0XB 1RP3B 1XUQA 5EC2C 4YHHO 1QVFU 1Q43A 4GYCB 4MW3A 1BQ0A 3RYFA 4FZ0A 4LNUA 1S5HC 2EILC 3K79A 2QWNB 1RSOA 5B1BC 4NXNO 4I0XA 3JD4A 2YICA 4GT1A 2FL4A 4DV6O 3VQVA 2W0FC 2JGDB 5CB4B 2UXDO 3B77A 1COWG 3K0GA 3OD4A 2HFEC 2WLHA 4J9YB 3H1HH 1YTFB 5B1AC 5KHJA 4B3TB 1TUEB 5CB4A 1B6QA 3K5MA 3ZMUA 2QTOA 4MSWC 2Z3YA 1Q6IA 3KG2A 1JVMA 1U96A 1HR0O 3ZJZA 2WLJA 1WLEA 4JYYA 5DECA 3SYOA 4Z1MG 2UUAO 2E74B 1VQOV 2YS8A 4PI2A 1N34B 1HNWO 2WLNA 1JX9A 1X59A 5GTIZ 1SZXA 3PN1A 1BSMA 5D5QA 3HKBB 2CDYA 1BHBA 1MZEA 3E89A 4DR6O 5GONB 3N2GB 1GMGA 2MK3A 3JYCA 4P9PA 4DO2A 1I5YA 4CC5A 3OT7A 2FB5A 2DW4A 4Q20A 2JIZG 3FYEB 4HAMA 2E75B 1KB9F 4MVSA 1J5EB 4KXRA 1KECA 1R3LC 5LXTA 3NXSA 2LW7A 2EIJC 3DTUB 1PNLA 1XOUA 5EK0A 2Q68A 3DGEA 5IJ9B 3RYHB 4JYAO 5H5NA 3DSQA 4NTYA 2QA4V 4FLWA 2XASA 1Q86W 4CZZA 1YVWA 2HJFC 4GX5A 4EB6B 4XDJA 3RYHA 4I7ZB 4WFFA 1N8RW 4ZOLB 2WSSG 1WA8B 4LF4O 4ZHQB 3C3SA 4BIOA 4IYIA 2DOSA 4IHJA 3OEHG 4EB6A 4GUNA 1L0LH 1GN6A 4LF8B 2ZT9B 3LSUA 4ZOLA 4ZHQA 1HWYA 2ZINA 1YJNV 1Q81W 4WFGA 3A0BZ 2EINC 3HPLC 1NR7A 5KHHA 2YSUB 5LA6B 3RN4A 3H1KH 2H8PC 3D36A 4TUYB 4PA6A 5JJNB 2G38A 2YIBA 2H3OA 3UT5B 4ZI7B 5LA6A 2ADPA 2P67A 2YI8A 5LYJB 5EBMC 4TUYA 2KB1A 4J10A 4O2BB 5H6QA 4B3RO 4X1IA 1J5EO 4BIZA 3AK1A 3TETA 2QWQB 4JGSA 2UU9B 5DM6V 3ZHSA 1OCOB 3QTCA 4O2BA 1JA8A 5LGUA 4EFBA 4FLUA 4JAUA 2DN9A 3U10A 1GH6A 4CS2A 2OCCB 5BR8B 4G27B 2QEXV 1TGOA 5IY5C 4GKJO 4H33A 3E8HA 4RO2A 4YY3O 4ASUG 1YTFD 1XNQB 4HNAB 4MTFA 4LF8O 4BAYA 1SETA 3TGUH 1W59A 1VF5B 4AQYB 1SQFA 3T1HO 3CXCU 1BHAA 4N21A 4E4EA 1ZTEA 1BT8A 3QO5A 4HNAA 3SJBC 3CRCA 4J42A 3AG1C 1VIBA 3K08A 1H2MA 4JI2O 2Z5UA 3GB7C 4DV0O 3A2FA 1NH2B 3ZRSA 4QNHB 3X2QC 3JD2A 1KBHA 2DWDC 4FM1A 3CMEV 3ZHRA 1Y76B 3OEEG 1YJ9V 5IJ0B 2QM4A 1LNQA 2VWJA 2QSAA 3HKEA 5KHIA 2JS5A 2E5LO 2QDOA 1OCZC 2Q4PA 1EM1A 1AP5A 5IJ0A 1AJNA 4GX0A 4X62B 1IBKO 5EZYB 2GBOA 2WLLA 1AVMA 1HNXB 3CMAV 4JI8O 2UUCB 3KZIZ 4DV7B 2LGQA 5EZYA 2LFSA 1FXKB 2CK3G 2LGWA 4O2AA 4AILC 1M57C 1QLEB 3MD0A 2DYRC 2ZDIC 4LF5B 1FXKA 1XNQO 1Y67A 1Y66A 3CCEV 3CCVV 1QNMA 1P7GA 4DR4O 1E1RG 3CRAA 3JSLA 4K3AA 1X4TA 4LFAO 4R50A 4W4KA 5LHGA 2R72A 4JZGA 1GAXA 3ML0A 4NTWA 2CH7B 4X65B 4K0KB 2UXCB 1PNMA 3FX7A 3R65A 1U97A 3ABLC 2OT5A 2Q5ZA 2PGGA 2YIBD 4QPJA 4R7CA 1UJWB 2IJIA 4TQFA 2HR3A 3G80A 3UM7A 5B66Z 4JTDB 3KCYA 4JF3A 1KD1W 1SERA 5LOVA 2PUSA 2GV9A 2PTMA 5IYBO 1OV9A 4I9WA 2QKCA 4YJ3B 5BZBA 4FMTA 1LR1A 1SQBH 2CAZC 1K92A 4DRXB 1K8AW 3AG2C 4PDMA 3IFXA 2QKSA 4JI6O 1OZ0A 2HKOA
chains in the Genus database with same CATH topology
3D3IA 3SPJA 1RM1C 2AHYA 2EBOA 1Y4MA 5CBFA 2K1EA 4J9ZB 1K97A 2LFRA 3SPIA 5B1OA 5L3GA 2OCCC 5LBQA 3QO8A 1OCRB 5B3SB 3LSSA 2EIKB 1V55B 3SYAA 2D3OW 2WWWA 2OTJV 2Q67A 4ZBMA 3K3WA 2P7TC 1G4YB 3K04A 4XBFA 1YHQV 1K34A 4WFEA 3FB8C 1JQ0A 3JCZA 1GM8A 1NJIW 2HG5C 5L3DA 5IYDO 1AI5A 4MTOA 2NLJC 3OGCC 4BIUA 1H8EG 1VQNV 3ABKC 3OUFA 1S77D 3P30A 4GX1A 4TSFG 1BL8A 2XNDG 4MVRA 5LGNA 3K06A 3ZRVA 4PA9A 5HFMA 1M9NA 2ZXWB 2A79B 2WLIB 3E83A 4YXWG 3STZC 3TK1A 1XL4A 1FXHA 2JJ1G 3LNMB 3ZRWA 3GWOA 1DF5A 2XAQA 4FJCC 3G6EV 4RQFA 5LGTA 4TT3G 1ZWIC 3OM3B 3WG7C 4MVOA 2ZR2A 3CC7V 2WLKA 1KQSU 2JEUA 4QIWF 2WLIA 2EINB 1VQ8V 4RUFA 5C93A 4UXNA 3ZMTA 2XAGA 4PDVA 2Y69B 1GO3F 1QBZA 5EC2C 1QVFU 5CN0A 4MW3A 1YI2V 4L87A 1R6KA 1AI7A 1S5HC 2EILC 2Q6AA 3K79A 4PDLA 1VQ6V 2QM8A 3RVYA 1NH2D 1AI4A 5B1BC 2IU3A 5B1AB 3ABUA 2ZR3A 1FXVA 5DN6G 4QPKA 3JD4A 3SPHA 4GT1A 1YIJV 1VQ7V 3F7VC 1GM7A 2JJ2G 4UVAA 2XOKG 4MVZA 1M56B 2W0FC 4QJFB 3I56V 1KP3A 1QR8A 2EIMC 3AG3C 1KC8W 3OMAB 4CBCA 1WPXA 1NVPB 3ZCCA 3B77A 5EC1C 1COWG 1FXKC 1AR1B 4R6ZA 2B1GA 1K4DC 3K0GA 4KP4A 4P9OA 1VQKV 2HFEC 5CBGA 2WLHA 4J9YB 1QLEC 1W0KG 3CD6V 1K33A 4JYCA 4U7OA 1YTFB 2DWEC 3ABTA 5B1AC 4RAIA 1I5XA 3BY6A 1V54C 1TUEB 2Q69A 1R6NA 1B6QA 3OUSA 4X89A 4WFHA 5EBWC 3RVZA 3W7TA 3LDDA 3ZMUA 1GM9A 2DYSC 2BOCC 2QTOA 2WAMA 2X6AA 3ABMB 3MHSC 3JD0A 4MSWC 2B5UA 5IY5B 2Z3YA 2OTLV 3KG2A 1JVMA 2JDIG 5IYCO 1ROPA 2IJHA 4LCUC 4JPRA 5CBHA 3LSQA 3ZJZA 4MVMA 1MG1A 2WLJA 2UXXA 1BMFG 1WLEA 1L1FA 3JD1A 3SYOA 4Z1MG 5KUKA 4WFBV 1OCCB 1VQOV 3CCSV 3OAAG 3HB3B 2WLNA 1JX9A 3P32A 4X8AA 2EZPA 4XDKA 1K9MW 4JTCB 4LBEC 1R3IC 2BOBC 1GTOA 3E89A 1OHHG 2EIJB 3IGAC 1BHBA 3RW0A 4GCZA 4UV8A 3FB7C 4GX2A 5KA5A 3LUTB 1GMGA 1PKXA 2MK3A 3JYCA 4N23A 1SESA 5H6RA 3I55V 3ZIAG 4P9PA 4DO2A 1EFRG 1I5YA 1THZA 1PL0A 4JYBA 3X2QB 2ITDC 2DW4A 4Q20A 3ETDA 3SYCA 1R3KC 1GK9A 2JIZG 3RBZA 1DF4A 3FYEB 4JTAB 4HAMA 2EZOA 4HZ3A 4MVSA 3E8GA 3SYPA 1KECA 1R3LC 2HVJC 3LDEA 3NXSA 1DLBA 2IU0A 1QVGU 3DTUB 2EIJC 1PNLA 4H37A 5EK0A 3M99B 2Q68A 3DGEA 1NBMG 1OCRC 2IH1C 3BEHA 5B3SC 1YITV 4KFMA 2EIKC 3AG4B 1V55C 3ETGA 3TCUA 3K03A 3VBBA 1DTOA 3H01A 2QA4V 1W2BU 5HFLA 4LP8A 2XASA 2WPDG 3CCMV 1Q86W 4CZZA 2HJFC 1S76D 1MSWD 4GX5A 5L3FA 2M7WA 1SZTA 3CP1A 4QE9A 4XDJA 3SPCA 4WFFA 3CCLV 1N8RW 2WSSG 3SPGA 3CYOA 1Q7YW 4E2LA 3STLC 1P7BA 4BW5A 1MABG 1M57B 3IC7A 4G28B 3OEHG 1QR9A 4OXSA 2WLLB 2ZXWC 1KP2A 2DYRB 3ASNB 1K3EA 3T2MA 1EZJA 1JOYA 1K7DA 3ZRXA 1HWYA 3SYQA 2V1DA 5LHHA 1YJNV 1Q81W 2X6CA 4WFGA 2DQ3A 1QCEA 2EINC 2HLDG 5FL7G 3EFFK 2B1IA 3HPLC 1NR7A 3ZN0A 3EHBB 3CPWU 2YSUB 3W7SA 4UV9A 3SJQC 2IH3C 1S0VA 2YEVB 1AJQA 2H8PC 2Y69C 3D36A 1AJPA 4UVCA 4PA6A 5L3BA 3ASOB 4P30A 3ZMSA 3ABLB 3E8BA 4WF9V 2A9HA 3CC4V 5CA3A 2P67A 3FYIB 5LHIA 1VQ5V 2YEVA 5EBMC 2IJJA 2KB1A 5H6QA 1H8HG 1VQ4V 3CCUV 1FS0G 4BIZA 2X7RB 2AHZA 3CCRV 3TETA 4X88A 1M56C 3F5WC 4JGSA 4FK5C 3ETEA 1YSCA 5DM6V 4MT8A 1OCOB 4MTXA 3AG2B 1M90W 2V7QG 5LGUA 3G4SV 3AEIA 4TWKA 3G71V 2P90A 1MOFA 3K9AA 3OFNG 5CMUA 1JCHA 3T4DA 4MS2A 2HVKC 4JAUA 1S3JA 3CCJV 2FTKA 2OCCB 5E1AC 3B8NA 4G27B 1SRYA 3ABMC 2QEXV 1NVPD 3OR7C 5IY5C 3QNEA 3AG1B 4H33A 3F7YC 1VQLV 3E8HA 5L3EA 4RO2A 4KUMA 3VOUA 2F43G 4UVBA 4MVUA 5GW7A 4ASUG 1YTFD 3ZMVA 3E86A 3OE7G 3ABKB 4MTFA 1OCCC 2IW5A 2QM7A 4BAYA 4G2KA 2R9RB 1SETA 1R73A 1AI6A 1RPRA 1VQ9V 2EJRA 4DXWA 1CPYA 1XL6A 1BHAA 3T1CA 3CXCU 2XAJA 4N21A 2JEXA 1K5QA 2NNUA 4WFAV 4PELA 4PA4A 1QLNA 2W6IG 4F4LA 3QO5A 2Y48A 1F51A 3MHHC 1EBOA 2W6JG 2R9IA 3AG1C 1PNKA 1OCZB 3K08A 5IDJA 2LP7A 3WG7B 1K73W 2Z5UA 3GB7C 1S72V 1NH2B 3ZRSA 1ORQC 4QNHB 3OMIB 5H9CA 3X2QC 3JD2A 4HYOA 1H2GA 2DWDC 1IXMA 3ZRWB 4ZKIA 3CMEV 4PDRA 5B1NA 1CEZA 1VQMV 1M1KW 1K5SA 4MW8A 3OEEG 1YJ9V 3FKSG 4RUEA 4U7NA 4QE7A 1F23A 4I5SA 2UXNA 1LNQA 2EILB 2GHYA 3WFVA 3W7UA 2X0LA 5B1BB 1NQTA 3AG4C 3ZN1A 1GKFA 1OCZC 2ITCC 1FFTB 3K0DA 1KKDA 1F4NA 1AJNA 4GX0A 1NKDA 2IJKA 3E35A 4JAVA 2WLLA 3CC2V 1H38A 2JK5C 3QO7A 2PI4A 2ZDIA 3CMAV 2EIMB 3FB5C 1K4CC 3AG3B 1JJ2U 2C2AA 1E79G 1W0JG 2LFSA 2DQ0A 1FXKB 2CK3G 5KA6A 4FIPC 1M57C 4FPPA 3ZMZA 3B8MA 5L3CA 1F4MA 1QLEB 2ATKC 3MD0A 3E2EA 2DYRC 1V54B 2ZDIC 3ASNC 3CCQV 4UUJC 4EKWA 2QE7G 1E1QG 1FXKA 2A0LA 2DYSB 2GSMB 1Y66A 3CCEV 3CCVV 3OW2U 2XAFA 1E1RG 3W7WA 2ZQMA 3FB6C 1G8MA 4R50A 2XAHA 1RPOA 5LHGA 4WCEV 2ZD9A 1Q82W 5KUMA 3ML0A 3OR6C 1AROP 1JPXA 2PI5A 1PNMA 3A0RA 4R8CA 4PA7A 3ASOC 5EBLC 3R65A 3ABLC 2OT5A 3OMNB 1RM1B 4MTGA 4QPJA 4R7CA 1UJWB 2IJIA 3PJSK 2HR3A 3UM7A 3E8FA 4JTDB 1P4RA 1PD3A 4JF3A 4P2ZA 1J95A 1ENVA 1KD1W 1SERA 4MVQA 5IYBO 1R3JC 3JD3A 4I9WA 3T4ZA 3LDCA 3W7XA 2P6JA 5BZBA 4LC1A 4FMTA 2X6BA 3UKMA 4PA3A 1K92A 1CP9A 1OCOC 1VQPV 1K8AW 2WLMA 3AG2C 4PDMA 3IFXA 4JASA 2QKSA 5J9PC 2H94A 1OZ0A 4XDLA 1YJWV 1NR1A 4RQEA 2HKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFG A;  4X89 A;  3SPJ A;  4PDR A;  2AHY A;  4WFH A;  5EBW C;  3RVZ A;  4MW8 A;  5CBF A;  2EIN C;  2K1E A;  3LDD A;  4J9Z B;  2DYS C;  2QTO A;  2BOC C;  2X6A A;  3EFF K;  3HPL C;  4MSW C;  3SPI A;  4RUE A;  2OCC C;  3KG2 A;  1JVM A;  4QE7 A;  3SJQ C;  2IH3 C;  3SYA A;  4LCU C;  1LNQ A;  5CBH A;  3ZJZ A;  2H8P C;  2Y69 C;  4MVM A;  2WLJ A;  4PA6 A;  2Q67 A;  4ZBM A;  2P7T C;  1G4Y B;  3K04 A;  4P30 A;  3SYO A;  5KUK A;  4WFE A;  3AG4 C;  3FB8 C;  1OCZ C;  3E8B A;  2ITC C;  2A9H A;  3K0D A;  1KKD A;  2HG5 C;  2WLN A;  4MTO A;  4GX0 A;  4X8A A;  2NLJ C;  2YEV A;  3OGC C;  5EBM C;  3ABK C;  3OUF A;  3VOU A;  2KB1 A;  4XDK A;  4JTC B;  2WLL A;  4LBE C;  4GX1 A;  1R3I C;  2BOB C;  3E89 A;  2JK5 C;  3IGA C;  1BL8 A;  3RW0 A;  3FB5 C;  1K4C C;  4MVR A;  3K06 A;  2AHZ A;  3FB7 C;  4GX2 A;  4PA9 A;  3TET A;  4X88 A;  3LUT B;  2A79 B;  1M56 C;  3F5W C;  3JYC A;  2WLI B;  3E83 A;  3STZ C;  1XL4 A;  4P9P A;  3LNM B;  1M57 C;  2ATK C;  4TWK A;  2DYR C;  2ITD C;  1ZWI C;  3WG7 C;  3ASN C;  4MVO A;  2WLK A;  4MS2 A;  4UUJ C;  3SYC A;  1R3K C;  3RBZ A;  2HVK C;  3T4D A;  4EKW A;  4JTA B;  2WLI A;  2A0L A;  4HZ3 A;  4MVS A;  4RUF A;  2X6C A;  3E8G A;  3SYP A;  1R3L C;  2HVJ C;  3LDE A;  5E1A C;  4G27 B;  2EIJ C;  4PDV A;  3ABM C;  3FB6 C;  4H37 A;  3OR7 C;  4R50 A;  5EC2 C;  5EK0 A;  2Q68 A;  5IY5 C;  1V54 C;  4MW3 A;  1OCR C;  2IH1 C;  2ZD9 A;  3BEH A;  3F7Y C;  3E8H A;  4H33 A;  4KFM A;  2EIK C;  5KUM A;  1V55 C;  4RO2 A;  3TCU A;  3K03 A;  1S5H C;  2EIL C;  2Q6A A;  3OR6 C;  4PDL A;  4MVU A;  3RVY A;  4LP8 A;  3E86 A;  2HJF C;  4PA7 A;  3ASO C;  4GX5 A;  4R8C A;  5EBL C;  5B1B C;  4MTF A;  1OCC C;  3R65 A;  3ABL C;  2R9R B;  4MTG A;  4QE9 A;  4XDJ A;  3SPH A;  3SPC A;  4DXW A;  1XL6 A;  3F7V C;  4R7C A;  3T1C A;  4WFF A;  3PJS K;  3UM7 A;  3E8F A;  4PA4 A;  4JTD B;  4MVZ A;  3SPG A;  4P2Z A;  4F4L A;  1J95 A;  3STL C;  2W0F C;  1P7B A;  4MVQ A;  2EIM C;  4BW5 A;  1R3J C;  4I9W A;  3AG3 C;  3T4Z A;  4G28 B;  4CBC A;  3LDC A;  4OXS A;  2WLL B;  3AG1 C;  2ZXW C;  5BZB A;  2X6B A;  5EC1 C;  3K08 A;  5B3S C;  3UKM A;  4R6Z A;  3K0G A;  1K4D C;  4PA3 A;  4P9O A;  2HFE C;  3T2M A;  1OCO C;  5CBG A;  3GB7 C;  2WLH A;  2WLM A;  3AG2 C;  1QLE C;  3IFX A;  4J9Y B;  4PDM A;  1ORQ C;  2QKS A;  3ZRS A;  4QNH B;  3X2Q C;  5J9P C;  4HYO A;  2DWE C;  3SYQ A;  5B1A C;  4XDL A;  4RAI A;  2Q69 A;  2DWD C;  3OUS A; 
#chains in the Genus database with same CATH topology
 1WNS A;  4YJ3 A;  3BPZ A;  2EBO A;  1Y4M A;  5LMU B;  1EN6 A;  5LBQ A;  3K58 A;  5B3S B;  4DV5 O;  1HNX O;  2D3O W;  2KQX A;  2UUC O;  1PL4 A;  5EIB D;  2QWO B;  4JI5 O;  4DV7 O;  3K3W A;  1FFX B;  4XBF A;  1YHQ V;  1K34 A;  1JQ0 A;  3ZHQ A;  1NJI W;  5L3D A;  1AI5 A;  2UUB B;  2VQE B;  4BIU A;  2VS0 A;  4J80 A;  1SQV H;  1GN4 A;  4LF5 O;  4JZ2 A;  1FFX A;  4GX1 A;  2CTW A;  2HHH O;  5FPO A;  3L74 H;  4MVR A;  3K06 A;  2WLI B;  3TK1 A;  2OIG A;  1FXH A;  3LNM B;  3SGI A;  1DF5 A;  4FJC C;  3UQ8 A;  1L0N H;  1R1B A;  4Z2W A;  5KMG B;  4X65 O;  1ZWI C;  3WG7 C;  4MVO A;  2WLK A;  1KQS U;  4QIW F;  2WLI A;  3P3N A;  1B3Q A;  4UXN A;  1VF7 A;  3K5O A;  3ZMT A;  5CA1 B;  4NKG B;  4PDV A;  1Z5W A;  5KMG A;  1QBZ A;  1XNR B;  4YIP A;  2RN9 A;  1B04 A;  1WP8 A;  1FAF A;  4PDL A;  2QM8 A;  3RVY A;  1NH2 D;  5J2U B;  3E22 B;  3JAR B;  3OTF A;  1NS1 A;  5CA1 A;  2OIE A;  3ABU A;  2ZR3 A;  5DN6 G;  1NTZ H;  2VRZ A;  1AR4 A;  1F7Y A;  3Q4H B;  1VQ7 V;  2JJ2 G;  2XOK G;  4JI3 B;  1AP6 A;  3IJ4 A;  3MAQ A;  5LMU O;  2EIM C;  3AG3 C;  4LWS B;  1KC8 W;  4CBC A;  3ZCC A;  3WB1 A;  4R6Z A;  2YI9 A;  4DR1 O;  1W0K G;  2AW9 A;  1K33 A;  4JYC A;  4EFE A;  2DWE C;  4WBN B;  4OGQ B;  4LWS A;  3BY6 A;  2Q69 A;  1R6N A;  3OGI B;  4JI1 B;  2YXL A;  5EBW C;  2VQE O;  4IL6 Z;  3TJT A;  1GM9 A;  2DYS C;  3MHS C;  2DE0 X;  4YHH B;  2JDI G;  5KHG A;  5IYC O;  1NI8 A;  1ROP A;  4WBN A;  1UFI A;  4JPR A;  3LSQ A;  4MVM A;  1MG1 A;  4UB8 Z;  2PY5 A;  4NXN B;  3OAA G;  4X8A A;  1AB3 A;  4XDK A;  2GDS A;  4LBE C;  4DV6 B;  2HEP A;  1GTO A;  4NYK A;  4GCZ A;  4GX2 A;  5KA5 A;  2NR5 A;  4N23 A;  1SES A;  3I55 V;  3ZIA G;  2E3C A;  3BHP A;  4LH7 A;  1EFR G;  4NB5 A;  4I55 B;  1XNR O;  1PL0 A;  3CXH F;  3ZED A;  4JYB A;  4FZ1 A;  2ITD C;  2JRI A;  5B5E Z;  1O9H A;  1DF4 A;  2A7W A;  5EYP B;  4LH6 A;  3SYP A;  4I55 A;  3LDE A;  2LJ2 A;  4X66 B;  4JI4 B;  2IH1 C;  1SF9 A;  3BEH A;  5LP6 B;  2F93 B;  1YIT V;  5EYP A;  3AG4 B;  2UUA B;  1V55 C;  3DXR B;  1Q8I A;  2QJ1 A;  5JCO A;  1DTO A;  3H01 A;  2Q7H A;  5HFL A;  4LP8 A;  3CRM A;  3CCM V;  1S76 D;  5L3F A;  5ITZ B;  4HBN A;  5KAF Z;  2M7W A;  2W0X A;  1DK1 A;  5LP6 A;  3SPC A;  3DXR A;  4JI1 O;  2YXH A;  3CYO A;  1Q7Y W;  2BCC H;  3STL C;  5ITZ A;  5JVD B;  3TXS A;  1MAB G;  4Q6G A;  3IC7 A;  4G28 B;  4DK0 A;  4DV2 O;  4OX9 O;  1KP2 A;  1WJZ A;  2YXY A;  3ASN B;  1JOY A;  2E76 B;  1EZJ A;  3H1I H;  1D2D A;  3N2K B;  3ZRX A;  3SYQ A;  2X6C A;  1I0H A;  2B9Z A;  2DQ3 A;  2Q73 A;  2ZE5 A;  3EFF K;  2B1I A;  4CH5 A;  3RWR D;  3W7S A;  3SJQ C;  1YF2 A;  4JYA B;  4L8J A;  2YEV B;  3R66 A;  2Y69 C;  3IAY A;  1BQZ A;  1QQC A;  2L6L A;  3ZMS A;  4IT5 A;  4CS4 A;  3CC4 V;  2WA3 A;  4FM2 A;  1T5E A;  1FJG B;  2YEV A;  3H1L H;  2JGD A;  3D36 C;  4LF7 O;  4LF4 B;  5KAI Z;  1VQ4 V;  3CCU V;  4YIO A;  1ZAU A;  3WB2 A;  2ZE6 A;  3CCR V;  1PPJ H;  2F95 B;  1M56 C;  4X66 O;  4JI4 O;  4O4H B;  4MT8 A;  4O4J B;  4MTX A;  1M90 W;  2V7Q G;  2AZ2 A;  3G4S V;  2RJZ A;  5KX5 B;  5CMU A;  3T4D A;  4MS2 A;  3VQX A;  2QWP B;  2HVK C;  1ZSP A;  4O4H A;  2FTK A;  3B8N A;  2FML A;  3ABM C;  3C90 A;  4TQD A;  1O9G A;  1Y74 B;  3F7Y C;  5L3E A;  3VOU A;  1VMG A;  5GW7 A;  4O4I B;  1IXB A;  3HKB A;  3CJH B;  3MDS A;  4FM0 A;  3ABK B;  1OCC C;  5GON A;  2R9R B;  4A5U B;  2EUL A;  1Y74 A;  3N2G A;  5LL6 Y;  4K8Z A;  1VQ9 V;  4B3R B;  3T1C A;  2XAJ A;  2JEX A;  4WFA V;  4O4I A;  1QLN A;  3CJH A;  3I5D A;  2BTO A;  1F51 A;  4ICG A;  3K5L A;  3JAT B;  3MHH C;  1EBO A;  2W6J G;  4U3J B;  2LP7 A;  4NXM B;  3CSX A;  3JAK B;  3CS5 A;  4F6R B;  1S72 V;  1N32 B;  5H9C A;  3JAT A;  5IJ9 A;  1IXM A;  1FJG O;  2RNB A;  1FPO A;  4U3J A;  1BGY H;  4RUE A;  4U7N A;  4GKJ B;  1G1X B;  2EIL B;  2LW1 A;  4YY3 B;  2GHY A;  1XIL A;  3W7U A;  5B1B B;  3U0Z A;  2QWR B;  1GKF A;  3AG7 A;  2ITC C;  3RYC B;  1WA8 A;  1KKD A;  2VWK A;  3T1H B;  2IJK A;  2AZ0 A;  4OPH A;  4DUY O;  2YIA A;  3CC2 V;  1H38 A;  2PI4 A;  5FNV B;  1K4C C;  1JJ2 U;  4DV1 O;  3RFR A;  1W0J G;  3APQ A;  4FPP A;  5L3C A;  4JI2 B;  4UFZ A;  1GN3 A;  2ATK C;  4DV0 B;  1ZX3 A;  5FNV A;  2DMX A;  4W4L A;  3CCQ V;  4UUJ C;  3K59 A;  2A0L A;  4FLZ A;  2GSM B;  1FKA O;  3FB6 C;  1G8M A;  2RDC A;  3UT5 A;  4ZI7 A;  1RPO A;  4WCE V;  3P3P A;  1XBL A;  2WA4 A;  5LYJ A;  2E5L B;  2Y0I A;  3OR6 C;  2LQT A;  3A0R A;  1IBK B;  3ASO C;  4NXM O;  3OMN B;  1RM1 B;  1JFF B;  1N32 O;  1Z2G A;  4X20 B;  2ZE8 A;  4B08 A;  2ARH A;  4JI8 B;  3PJS K;  1KU9 A;  1P4R A;  2AGA A;  4P2Z A;  1ENV A;  1R3J C;  1JFF A;  3LDC A;  3W7X A;  2P6J A;  2A06 H;  4JV5 O;  2X6B A;  3FAV B;  1CP9 A;  3A8T A;  5J9P C;  4D6T H;  4XDL A;  1NR1 A;  4UCT A;  3D3I A;  4LR3 A;  4DR4 B;  2AHY A;  4B3M B;  2K1E A;  3FAV A;  1K97 A;  2LFR A;  4LFA B;  5B1O A;  5L3G A;  3QO8 A;  1ZL8 B;  5IYZ B;  3LSS A;  3SYA A;  2ZNI A;  1KMI Z;  3DC5 A;  1FD9 A;  2OTJ V;  2Q67 A;  4ZBM A;  1JR9 A;  1G4Y B;  3K04 A;  1N33 B;  3FB8 C;  4J41 A;  1BCC H;  1ZL8 A;  5IYZ A;  2QGN A;  4UB6 Z;  3OGC C;  2Y4T A;  1VQN V;  4BWA A;  1S5L Z;  4TSF G;  3ZHT A;  1VP7 A;  2L35 A;  2A79 B;  1RFY A;  4YXW G;  2JJ1 G;  1Y76 A;  2XAQ A;  4JI6 B;  5LGT A;  2N74 A;  2ZR2 A;  3CC7 V;  2JEU A;  2EIN B;  5C93 A;  1M4U A;  1IX9 A;  4DV5 B;  2XAG A;  1GO3 F;  3BA9 A;  4JI5 B;  5CN0 A;  1YI2 V;  3QVN A;  4DV4 O;  1R6K A;  1TUB B;  1VQ6 V;  2KG7 B;  1AI4 A;  4QPK A;  2VQF B;  2Q7E A;  3OTO O;  3SPH A;  2PYJ A;  4JI7 O;  4DUZ O;  2HHH B;  1TUB A;  4DV3 O;  3O65 A;  4MVZ A;  4B3M O;  3BA8 A;  1KP3 A;  4H44 B;  2P4K A;  3OMA B;  1PP9 H;  2K9P A;  1WPX A;  1PV0 A;  1NVP B;  5EC1 C;  2B1G A;  4P9O A;  2Q0O C;  1VF6 C;  5CBG A;  3CD6 V;  1N33 O;  5JJE B;  4PHZ A;  3ABT A;  4RAI A;  1V54 C;  4X89 A;  1MZF A;  4WFH A;  2WAM A;  2CH7 A;  2X6A A;  3HKD B;  3JD0 A;  5IY5 B;  2B5U A;  2OTL V;  3AK3 A;  1Q6U A;  2IJH A;  4LCU C;  4I9Q A;  5J2T B;  1SS3 A;  1BMF G;  4B7K A;  4WFB V;  4JAA A;  3CCS V;  4X1K B;  3P32 A;  3EVK A;  5J2T A;  1XEQ A;  1K9M W;  3K57 A;  3JSN A;  1R3I C;  2BOB C;  1OHH G;  4DRX A;  4K8X A;  3LUT B;  4OPA A;  5H6R A;  1BS3 A;  1LUV A;  1KYO F;  3ZBH A;  4DR1 B;  3X2Q B;  1R3K C;  3RBZ A;  2FYU H;  3G67 A;  1MA1 A;  5KLV H;  2VQF O;  5IWA B;  1DLB A;  1QVG U;  5JJJ B;  3SDL A;  1NBM G;  2N04 A;  1OCR C;  3TCU A;  2EIK C;  1N0J A;  3ETG A;  4NR1 A;  3K03 A;  1W2B U;  2FKX A;  4IIJ B;  3EXA A;  3ZS8 C;  2OCH A;  4J7Z A;  2EX3 A;  3CP1 A;  2DJV A;  4CS3 A;  4B3S O;  3SPG A;  4IIJ A;  4E2L A;  2UXB O;  4AHC A;  4ABM A;  4BW5 A;  1M57 B;  1QR9 A;  4OXS A;  2ZXW C;  1P49 A;  2DYR B;  5LP6 C;  2XUM A;  5GTH Z;  3T2M A;  1AR5 A;  2IM9 A;  3BVO A;  3H9V A;  2BTQ B;  3L70 H;  2V1D A;  4D7T A;  4I4T B;  2R9A A;  2HLD G;  5FL7 G;  5J2U A;  3ZN0 A;  3E22 A;  3JAR A;  4UV9 A;  4QGP A;  1S0V A;  5H2F Z;  2QKA A;  4I4T A;  3Q4H A;  3NR7 A;  3ABL B;  3SJC C;  4WF9 V;  3CE2 A;  1IDS A;  3SR2 C;  2XT9 A;  5LHI A;  3TXQ A;  1XMO O;  1VQ5 V;  4KL1 A;  2IJJ A;  1H8H G;  4DR5 O;  4FFB B;  3WB0 A;  1OJH A;  4X88 A;  4FFK A;  5IWA O;  4DV2 B;  3F5W C;  4OX9 B;  2P5O A;  3ETE A;  1YSC A;  1SQQ H;  3AG2 B;  3BFR A;  1ZLZ A;  3AEI A;  4TWK A;  3G71 V;  3K9A A;  1MOF A;  4FFB A;  3OFN G;  2O57 A;  1SQP H;  5JH7 B;  2MW2 B;  5E1A C;  3DC6 A;  3RGB A;  2BE3 A;  1NVP D;  3QNE A;  1GN2 A;  3JCU Z;  1VQL V;  2CGN A;  1I94 O;  2F43 G;  4UVB A;  3AK2 A;  3FFQ A;  4I50 B;  3E86 A;  3OE7 G;  2IW5 A;  2QM7 A;  4FLX A;  3L9D A;  4G2K A;  1R73 A;  4LF7 B;  2EJR A;  3B2E E;  4DXW A;  1XL6 A;  4YJ2 B;  3C3T A;  1K5Q A;  2NNU A;  1IBM O;  4PEL A;  3T1Y B;  2W6I G;  4CC6 A;  1EZV H;  2YC0 A;  2KSD A;  3RYI B;  4LFC O;  1IVS A;  4YJ2 A;  3WG7 B;  1K73 W;  3A0H Z;  1SQX H;  4J11 A;  3G6B A;  4HYO A;  1B06 A;  1H2G A;  3RYI A;  3ZRW B;  4ZKI A;  5B1N A;  1CEZ A;  1K5S A;  3FKS G;  1FYJ A;  3D3Q A;  2BSK B;  2GTA A;  4X64 B;  1F23 A;  4I5S A;  4DR2 B;  2UXN A;  3HR0 A;  3UCS C;  2RCV A;  1NTM H;  2X0L A;  1CXZ B;  1NQT A;  3ZN1 A;  1FFT B;  2BSK A;  1Q3E A;  4TV9 B;  5JVD A;  1VEW A;  3B4S A;  1H2N A;  3FD9 A;  1RSO B;  2EIM B;  3FB5 C;  3AG3 B;  4TV9 A;  1N4C A;  2C2A A;  3M8A A;  1E79 G;  4IGG A;  3N2K A;  5BY1 A;  5KA6 A;  3ETQ A;  4FIP C;  3ZMZ A;  4UCS A;  1F4M A;  2F4V B;  4EEQ A;  1Y6X A;  2XHB A;  4EKW A;  1E1Q G;  2DYS B;  4AI8 A;  1HP8 A;  4B7E A;  3OW2 U;  2ILM A;  1N36 B;  3VQY A;  1D5A A;  3APO A;  2ZQM A;  4BR6 A;  3T1Y O;  2XAH A;  1URF A;  2ZD9 A;  2JGU A;  4U3F H;  3WU2 Z;  1N0N A;  1ARO P;  4KHP O;  4R8C A;  1XRE A;  4MTG A;  4DUY B;  4LF6 B;  4O4J A;  2ETN A;  4DV1 B;  5KX5 A;  3KKY A;  4PV1 B;  4X9Q A;  3JD3 A;  3T4Z A;  4X64 O;  4DR2 O;  1IZ3 A;  3UKM A;  1XI1 A;  1OCO C;  5A2Q N;  2WLM A;  1WPB A;  4GLX A;  5EIB C;  1YJW V;  2QR4 A;  4RQE A;  1RM1 C;  4FVM A;  3L72 H;  5CBF A;  2Z0A A;  2ADQ B;  3SPI A;  2OCC C;  3BAA A;  3ZX6 A;  1XHZ A;  1ZUQ A;  1V55 B;  1V9P A;  3B09 A;  1KKC A;  2CGO A;  5LXT B;  2N05 A;  1GM8 A;  2HG5 C;  5IYD O;  2F4V O;  4NVP A;  2HP8 A;  1H8E G;  1TA8 A;  3OUF A;  1JJO A;  1Q5O A;  1BL8 A;  4F6E A;  1XHX A;  3JAK A;  3BRC A;  2ZCE A;  4UCV A;  5LGN A;  1N36 O;  3QG5 A;  4PA9 A;  4F6R A;  1M9N A;  4JV5 B;  3STZ C;  3GWO A;  2NN4 A;  1BZK A;  4TT3 G;  4IHJ B;  1VQ8 V;  2ZNJ A;  4B3T O;  4LF6 O;  2AXT Z;  2KKW A;  3RYC A;  2Y69 B;  3CHX A;  4L87 A;  2D2C B;  1AI7 A;  2Q6A A;  3CB2 A;  2RQ6 A;  4GZR B;  2IU3 A;  5B1A B;  1I7F A;  1FXV A;  1N34 O;  4DR3 B;  1YXB A;  4Z1V A;  1YIJ V;  3F7V C;  3UO2 A;  1GM7 A;  4UVA A;  5FPR A;  1M56 B;  4QJF B;  3I56 V;  1QR8 A;  5JQG B;  1AR1 B;  1FXK C;  4X1I B;  4KP4 A;  1K4D C;  2GUZ B;  2V4D A;  2ZM6 B;  1VQK V;  1QLE C;  3J7A U;  3SJA C;  1NU1 H;  4U7O A;  1HW7 A;  1MSD A;  1I5X A;  5JQG A;  5LMN B;  2Q8V A;  3OUS A;  5IE9 A;  1SC5 B;  3ICX A;  3RVZ A;  3W7T A;  5AG2 A;  3LDD A;  3ABM B;  2BOC C;  2GUZ A;  4CH4 A;  3J81 N;  1US6 A;  4UCO A;  1S5J A;  1EN5 A;  4DV4 B;  5CBH A;  5FLX N;  3BCC H;  2UXX A;  1L1F A;  3JD1 A;  4X20 A;  5D5P A;  5A9G A;  3JAW B;  5KUK A;  1OCC B;  2F66 C;  5KHK A;  3HB3 B;  3OTO B;  2EZP A;  4JI7 B;  4DUZ B;  4DV3 B;  4JTC B;  1WB7 A;  3JAW A;  3IGA C;  2EIJ B;  3RW0 A;  3JAM N;  4UV8 A;  3FB7 C;  4FLT A;  1PKX A;  3H1J H;  4UCU A;  3CEI A;  2OWO A;  1THZ A;  3RT3 C;  3ETD A;  3SYC A;  3GVM A;  3N27 A;  1GK9 A;  4JTA B;  2EZO A;  4HZ3 A;  5JWP A;  3E8G A;  2HVJ C;  4DR3 O;  1AIL A;  2IU0 A;  4H37 A;  3M99 B;  5BMV B;  5B3S C;  4KFM A;  1A32 A;  5BXZ A;  4ZIB A;  3VBB A;  3GWK C;  2HJD A;  1LUW A;  2WPD G;  1MSW D;  2ZM6 O;  1SZT A;  1M5I A;  5BMV A;  2P06 A;  1JMK C;  3HKE B;  4QE9 A;  1KUQ A;  3CCL V;  5LMN O;  1M93 A;  2Y0P A;  1MNG A;  1H2K A;  4PJ0 Z;  1P7B A;  4BW9 A;  1YZB A;  2WLL B;  2CTP A;  2UU9 O;  2JVD A;  1HDJ A;  4DK1 A;  1K3E A;  1VAR A;  3IC9 A;  1K7D A;  1IUR A;  4DR7 B;  5LHH A;  4O2A B;  3THO A;  1QCE A;  2EJ7 A;  3CPW U;  3EHB B;  2KG7 A;  5BR8 O;  4GKK B;  2IH3 C;  1AJQ A;  1Q6H A;  2P22 C;  1AJP A;  4UVC A;  4K35 A;  5L3B A;  2OYQ A;  3ASO B;  4LFB B;  4P30 A;  2F1M A;  3E8B A;  2A9H A;  1NZ6 A;  5CA3 A;  1YDX A;  3FYI B;  2ODM A;  1L8D A;  1H2S B;  4B3S B;  1WAZ A;  4RWU A;  4UCR A;  4AQY O;  2UXB B;  2Q0A A;  1FS0 G;  2X7R B;  2AHZ A;  1Z5V A;  4FK5 C;  3BAB A;  3HKC B;  3HKD A;  2P90 A;  1HNZ B;  5LOV B;  1JCH A;  1SA0 B;  4O4L B;  1S3J A;  3S3W A;  1DGS A;  3CCJ V;  3HKC A;  4CH3 A;  1SRY A;  4C7U A;  4X1K A;  3OR7 C;  2XTA A;  1SA0 A;  3AG1 B;  4O4L A;  4KUM A;  4MVU A;  5DED A;  2Q7G A;  3J80 N;  3ZMV A;  2R70 A;  1XMO B;  3CX5 F;  1AI6 A;  1RPR A;  2Y4U A;  3CRQ A;  4X62 O;  1CPY A;  2QTS A;  5E79 Z;  4DR5 B;  4DR7 O;  1XMQ B;  5TIS Z;  4PA4 A;  1EN4 A;  2YUA A;  4F4L A;  2CE4 A;  3O9O A;  2Y48 A;  4LF9 B;  3F5T A;  4GKK O;  2R9I A;  1PNK A;  1OCZ B;  3ZHU A;  5IDJ A;  2LO1 A;  4LFB O;  1ORQ C;  3OMI B;  3QF7 A;  4PDR A;  3K5N A;  1VQM V;  1M1K W;  4MW8 A;  1QHT A;  5JCO C;  4QE7 A;  4JI0 B;  1I94 B;  4TV8 B;  3WFV A;  3L75 H;  5K1P A;  3AG4 C;  2CTQ A;  4K0K O;  3K0D A;  1F4N A;  2UXC O;  3JAS B;  4J7K A;  1NKD A;  1HNZ O;  4TV8 A;  3E35 A;  4JAV A;  1IBM B;  1TAE A;  4D7S A;  1GRJ A;  2JK5 C;  1MMM A;  1YEW A;  3QO7 A;  2ZDI A;  2ZE7 A;  3VQW A;  5K1X A;  3S3X A;  5IT9 N;  1NTK H;  1Q90 D;  4LFC B;  1TVK B;  3JAS A;  2DQ0 A;  2BTQ A;  2JS3 A;  1BE3 H;  2Q9L A;  2CTR A;  3UO3 A;  3B8M A;  3E2E A;  4X1Y B;  5C8Y B;  1V54 B;  3ASN C;  3U11 A;  1TVK A;  4H13 B;  2QE7 G;  2IBZ H;  3CWB H;  1VF6 A;  2CUG A;  2XAF A;  1P84 F;  3KCX A;  2ZIO A;  3W7W A;  4X1Y A;  5C8Y A;  1XMQ O;  1Q82 W;  5KUM A;  2F23 A;  4LF9 O;  2YID A;  1JPX A;  2ZKO A;  1IBL B;  2PI5 A;  4PA7 A;  5EBL C;  4IYH A;  1NT2 B;  2UUB O;  1QU7 A;  1SKV A;  1H2L A;  1PM9 A;  1I08 A;  3E8F A;  2ZIM A;  1PD3 A;  1J95 A;  4FLV A;  4MVQ A;  5JH7 A;  4JI0 O;  4LC1 A;  4DW1 A;  2PZS A;  4NTX A;  4PA3 A;  1VQP V;  4J7J A;  4H0L B;  4JAS A;  2H94 A;  3JAL B;  3SPJ A;  1SQG A;  4TOI A;  4J9Z B;  4I50 A;  2A3Q A;  1OCR B;  2UXD B;  3LNN A;  5F2V O;  2EIK B;  4PI0 A;  2P4V A;  2WWW A;  3JAL A;  4DW0 A;  4KHP B;  4DYL A;  2P7T C;  4WFE A;  1R6T A;  3L71 H;  3JCZ A;  3M7M X;  2PF4 E;  2YDE A;  4MTO A;  1WP7 A;  2NLJ C;  1XDC A;  3ABK C;  3D8C A;  1S77 D;  3P30 A;  1D5N A;  3CRR A;  1XQ8 A;  4FLY A;  2XND G;  2GTS A;  4PD4 F;  1HR0 B;  3ZRV A;  5HFM A;  4JI3 O;  2ZXW B;  1YCI A;  3E83 A;  1UPG A;  1WB8 A;  1XL4 A;  3ZRW A;  1HNW B;  3G6E V;  5CA0 B;  4RQF A;  1G6U A;  3B40 A;  3ZHV A;  3K9S A;  3OM3 B;  1IBL O;  3RYF B;  4DR6 B;  4LNU B;  4RUF A;  2RMK B;  2PYL A;  2M6Y A;  4CH6 A;  1WN7 A;  5CA0 A;  3L73 H;  4I0X B;  1RP3 B;  1XUQ A;  5EC2 C;  4YHH O;  1QVF U;  1Q43 A;  4GYC B;  4MW3 A;  1BQ0 A;  3RYF A;  4FZ0 A;  4LNU A;  1S5H C;  2EIL C;  3K79 A;  2QWN B;  1RSO A;  5B1B C;  4NXN O;  4I0X A;  3JD4 A;  2YIC A;  4GT1 A;  2FL4 A;  4DV6 O;  3VQV A;  2W0F C;  2JGD B;  5CB4 B;  2UXD O;  3B77 A;  1COW G;  3K0G A;  3OD4 A;  2HFE C;  2WLH A;  4J9Y B;  3H1H H;  1YTF B;  5B1A C;  5KHJ A;  4B3T B;  1TUE B;  5CB4 A;  1B6Q A;  3K5M A;  3ZMU A;  2QTO A;  4MSW C;  2Z3Y A;  1Q6I A;  3KG2 A;  1JVM A;  1U96 A;  1HR0 O;  3ZJZ A;  2WLJ A;  1WLE A;  4JYY A;  5DEC A;  3SYO A;  4Z1M G;  2UUA O;  2E74 B;  1VQO V;  2YS8 A;  4PI2 A;  1N34 B;  1HNW O;  2WLN A;  1JX9 A;  1X59 A;  5GTI Z;  1SZX A;  3PN1 A;  1BSM A;  5D5Q A;  3HKB B;  2CDY A;  1BHB A;  1MZE A;  3E89 A;  4DR6 O;  5GON B;  3N2G B;  1GMG A;  2MK3 A;  3JYC A;  4P9P A;  4DO2 A;  1I5Y A;  4CC5 A;  3OT7 A;  2FB5 A;  2DW4 A;  4Q20 A;  2JIZ G;  3FYE B;  4HAM A;  2E75 B;  1KB9 F;  4MVS A;  1J5E B;  4KXR A;  1KEC A;  1R3L C;  5LXT A;  3NXS A;  2LW7 A;  2EIJ C;  3DTU B;  1PNL A;  1XOU A;  5EK0 A;  2Q68 A;  3DGE A;  5IJ9 B;  3RYH B;  4JYA O;  5H5N A;  3DSQ A;  4NTY A;  2QA4 V;  4FLW A;  2XAS A;  1Q86 W;  4CZZ A;  1YVW A;  2HJF C;  4GX5 A;  4EB6 B;  4XDJ A;  3RYH A;  4I7Z B;  4WFF A;  1N8R W;  4ZOL B;  2WSS G;  1WA8 B;  4LF4 O;  4ZHQ B;  3C3S A;  4BIO A;  4IYI A;  2DOS A;  4IHJ A;  3OEH G;  4EB6 A;  4GUN A;  1L0L H;  1GN6 A;  4LF8 B;  2ZT9 B;  3LSU A;  4ZOL A;  4ZHQ A;  1HWY A;  2ZIN A;  1YJN V;  1Q81 W;  4WFG A;  3A0B Z;  2EIN C;  3HPL C;  1NR7 A;  5KHH A;  2YSU B;  5LA6 B;  3RN4 A;  3H1K H;  2H8P C;  3D36 A;  4TUY B;  4PA6 A;  5JJN B;  2G38 A;  2YIB A;  2H3O A;  3UT5 B;  4ZI7 B;  5LA6 A;  2ADP A;  2P67 A;  2YI8 A;  5LYJ B;  5EBM C;  4TUY A;  2KB1 A;  4J10 A;  4O2B B;  5H6Q A;  4B3R O;  4X1I A;  1J5E O;  4BIZ A;  3AK1 A;  3TET A;  2QWQ B;  4JGS A;  2UU9 B;  5DM6 V;  3ZHS A;  1OCO B;  3QTC A;  4O2B A;  1JA8 A;  5LGU A;  4EFB A;  4FLU A;  4JAU A;  2DN9 A;  3U10 A;  1GH6 A;  4CS2 A;  2OCC B;  5BR8 B;  4G27 B;  2QEX V;  1TGO A;  5IY5 C;  4GKJ O;  4H33 A;  3E8H A;  4RO2 A;  4YY3 O;  4ASU G;  1YTF D;  1XNQ B;  4HNA B;  4MTF A;  4LF8 O;  4BAY A;  1SET A;  3TGU H;  1W59 A;  1VF5 B;  4AQY B;  1SQF A;  3T1H O;  3CXC U;  1BHA A;  4N21 A;  4E4E A;  1ZTE A;  1BT8 A;  3QO5 A;  4HNA A;  3SJB C;  3CRC A;  4J42 A;  3AG1 C;  1VIB A;  3K08 A;  1H2M A;  4JI2 O;  2Z5U A;  3GB7 C;  4DV0 O;  3A2F A;  1NH2 B;  3ZRS A;  4QNH B;  3X2Q C;  3JD2 A;  1KBH A;  2DWD C;  4FM1 A;  3CME V;  3ZHR A;  1Y76 B;  3OEE G;  1YJ9 V;  5IJ0 B;  2QM4 A;  1LNQ A;  2VWJ A;  2QSA A;  3HKE A;  5KHI A;  2JS5 A;  2E5L O;  2QDO A;  1OCZ C;  2Q4P A;  1EM1 A;  1AP5 A;  5IJ0 A;  1AJN A;  4GX0 A;  4X62 B;  1IBK O;  5EZY B;  2GBO A;  2WLL A;  1AVM A;  1HNX B;  3CMA V;  4JI8 O;  2UUC B;  3KZI Z;  4DV7 B;  2LGQ A;  5EZY A;  2LFS A;  1FXK B;  2CK3 G;  2LGW A;  4O2A A;  4AIL C;  1M57 C;  1QLE B;  3MD0 A;  2DYR C;  2ZDI C;  4LF5 B;  1FXK A;  1XNQ O;  1Y67 A;  1Y66 A;  3CCE V;  3CCV V;  1QNM A;  1P7G A;  4DR4 O;  1E1R G;  3CRA A;  3JSL A;  4K3A A;  1X4T A;  4LFA O;  4R50 A;  4W4K A;  5LHG A;  2R72 A;  4JZG A;  1GAX A;  3ML0 A;  4NTW A;  2CH7 B;  4X65 B;  4K0K B;  2UXC B;  1PNM A;  3FX7 A;  3R65 A;  1U97 A;  3ABL C;  2OT5 A;  2Q5Z A;  2PGG A;  2YIB D;  4QPJ A;  4R7C A;  1UJW B;  2IJI A;  4TQF A;  2HR3 A;  3G80 A;  3UM7 A;  5B66 Z;  4JTD B;  3KCY A;  4JF3 A;  1KD1 W;  1SER A;  5LOV A;  2PUS A;  2GV9 A;  2PTM A;  5IYB O;  1OV9 A;  4I9W A;  2QKC A;  4YJ3 B;  5BZB A;  4FMT A;  1LR1 A;  1SQB H;  2CAZ C;  1K92 A;  4DRX B;  1K8A W;  3AG2 C;  4PDM A;  3IFX A;  2QKS A;  4JI6 O;  1OZ0 A;  2HKO A; 
#chains in the Genus database with same CATH homology
 3D3I A;  3SPJ A;  1RM1 C;  2AHY A;  2EBO A;  1Y4M A;  5CBF A;  2K1E A;  4J9Z B;  1K97 A;  2LFR A;  3SPI A;  5B1O A;  5L3G A;  2OCC C;  5LBQ A;  3QO8 A;  1OCR B;  5B3S B;  3LSS A;  2EIK B;  1V55 B;  3SYA A;  2D3O W;  2WWW A;  2OTJ V;  2Q67 A;  4ZBM A;  3K3W A;  2P7T C;  1G4Y B;  3K04 A;  4XBF A;  1YHQ V;  1K34 A;  4WFE A;  3FB8 C;  1JQ0 A;  3JCZ A;  1GM8 A;  1NJI W;  2HG5 C;  5L3D A;  5IYD O;  1AI5 A;  4MTO A;  2NLJ C;  3OGC C;  4BIU A;  1H8E G;  1VQN V;  3ABK C;  3OUF A;  1S77 D;  3P30 A;  4GX1 A;  4TSF G;  1BL8 A;  2XND G;  4MVR A;  5LGN A;  3K06 A;  3ZRV A;  4PA9 A;  5HFM A;  1M9N A;  2ZXW B;  2A79 B;  2WLI B;  3E83 A;  4YXW G;  3STZ C;  3TK1 A;  1XL4 A;  1FXH A;  2JJ1 G;  3LNM B;  3ZRW A;  3GWO A;  1DF5 A;  2XAQ A;  4FJC C;  3G6E V;  4RQF A;  5LGT A;  4TT3 G;  1ZWI C;  3OM3 B;  3WG7 C;  4MVO A;  2ZR2 A;  3CC7 V;  2WLK A;  1KQS U;  2JEU A;  4QIW F;  2WLI A;  2EIN B;  1VQ8 V;  4RUF A;  5C93 A;  4UXN A;  3ZMT A;  2XAG A;  4PDV A;  2Y69 B;  1GO3 F;  1QBZ A;  5EC2 C;  1QVF U;  5CN0 A;  4MW3 A;  1YI2 V;  4L87 A;  1R6K A;  1AI7 A;  1S5H C;  2EIL C;  2Q6A A;  3K79 A;  4PDL A;  1VQ6 V;  2QM8 A;  3RVY A;  1NH2 D;  1AI4 A;  5B1B C;  2IU3 A;  5B1A B;  3ABU A;  2ZR3 A;  1FXV A;  5DN6 G;  4QPK A;  3JD4 A;  3SPH A;  4GT1 A;  1YIJ V;  1VQ7 V;  3F7V C;  1GM7 A;  2JJ2 G;  4UVA A;  2XOK G;  4MVZ A;  1M56 B;  2W0F C;  4QJF B;  3I56 V;  1KP3 A;  1QR8 A;  2EIM C;  3AG3 C;  1KC8 W;  3OMA B;  4CBC A;  1WPX A;  1NVP B;  3ZCC A;  3B77 A;  5EC1 C;  1COW G;  1FXK C;  1AR1 B;  4R6Z A;  2B1G A;  1K4D C;  3K0G A;  4KP4 A;  4P9O A;  1VQK V;  2HFE C;  5CBG A;  2WLH A;  4J9Y B;  1QLE C;  1W0K G;  3CD6 V;  1K33 A;  4JYC A;  4U7O A;  1YTF B;  2DWE C;  3ABT A;  5B1A C;  4RAI A;  1I5X A;  3BY6 A;  1V54 C;  1TUE B;  2Q69 A;  1R6N A;  1B6Q A;  3OUS A;  4X89 A;  4WFH A;  5EBW C;  3RVZ A;  3W7T A;  3LDD A;  3ZMU A;  1GM9 A;  2DYS C;  2BOC C;  2QTO A;  2WAM A;  2X6A A;  3ABM B;  3MHS C;  3JD0 A;  4MSW C;  2B5U A;  5IY5 B;  2Z3Y A;  2OTL V;  3KG2 A;  1JVM A;  2JDI G;  5IYC O;  1ROP A;  2IJH A;  4LCU C;  4JPR A;  5CBH A;  3LSQ A;  3ZJZ A;  4MVM A;  1MG1 A;  2WLJ A;  2UXX A;  1BMF G;  1WLE A;  1L1F A;  3JD1 A;  3SYO A;  4Z1M G;  5KUK A;  4WFB V;  1OCC B;  1VQO V;  3CCS V;  3OAA G;  3HB3 B;  2WLN A;  1JX9 A;  3P32 A;  4X8A A;  2EZP A;  4XDK A;  1K9M W;  4JTC B;  4LBE C;  1R3I C;  2BOB C;  1GTO A;  3E89 A;  1OHH G;  2EIJ B;  3IGA C;  1BHB A;  3RW0 A;  4GCZ A;  4UV8 A;  3FB7 C;  4GX2 A;  5KA5 A;  3LUT B;  1GMG A;  1PKX A;  2MK3 A;  3JYC A;  4N23 A;  1SES A;  5H6R A;  3I55 V;  3ZIA G;  4P9P A;  4DO2 A;  1EFR G;  1I5Y A;  1THZ A;  1PL0 A;  4JYB A;  3X2Q B;  2ITD C;  2DW4 A;  4Q20 A;  3ETD A;  3SYC A;  1R3K C;  1GK9 A;  2JIZ G;  3RBZ A;  1DF4 A;  3FYE B;  4JTA B;  4HAM A;  2EZO A;  4HZ3 A;  4MVS A;  3E8G A;  3SYP A;  1KEC A;  1R3L C;  2HVJ C;  3LDE A;  3NXS A;  1DLB A;  2IU0 A;  1QVG U;  3DTU B;  2EIJ C;  1PNL A;  4H37 A;  5EK0 A;  3M99 B;  2Q68 A;  3DGE A;  1NBM G;  1OCR C;  2IH1 C;  3BEH A;  5B3S C;  1YIT V;  4KFM A;  2EIK C;  3AG4 B;  1V55 C;  3ETG A;  3TCU A;  3K03 A;  3VBB A;  1DTO A;  3H01 A;  2QA4 V;  1W2B U;  5HFL A;  4LP8 A;  2XAS A;  2WPD G;  3CCM V;  1Q86 W;  4CZZ A;  2HJF C;  1S76 D;  1MSW D;  4GX5 A;  5L3F A;  2M7W A;  1SZT A;  3CP1 A;  4QE9 A;  4XDJ A;  3SPC A;  4WFF A;  3CCL V;  1N8R W;  2WSS G;  3SPG A;  3CYO A;  1Q7Y W;  4E2L A;  3STL C;  1P7B A;  4BW5 A;  1MAB G;  1M57 B;  3IC7 A;  4G28 B;  3OEH G;  1QR9 A;  4OXS A;  2WLL B;  2ZXW C;  1KP2 A;  2DYR B;  3ASN B;  1K3E A;  3T2M A;  1EZJ A;  1JOY A;  1K7D A;  3ZRX A;  1HWY A;  3SYQ A;  2V1D A;  5LHH A;  1YJN V;  1Q81 W;  2X6C A;  4WFG A;  2DQ3 A;  1QCE A;  2EIN C;  2HLD G;  5FL7 G;  3EFF K;  2B1I A;  3HPL C;  1NR7 A;  3ZN0 A;  3EHB B;  3CPW U;  2YSU B;  3W7S A;  4UV9 A;  3SJQ C;  2IH3 C;  1S0V A;  2YEV B;  1AJQ A;  2H8P C;  2Y69 C;  3D36 A;  1AJP A;  4UVC A;  4PA6 A;  5L3B A;  3ASO B;  4P30 A;  3ZMS A;  3ABL B;  3E8B A;  4WF9 V;  2A9H A;  3CC4 V;  5CA3 A;  2P67 A;  3FYI B;  5LHI A;  1VQ5 V;  2YEV A;  5EBM C;  2IJJ A;  2KB1 A;  5H6Q A;  1H8H G;  1VQ4 V;  3CCU V;  1FS0 G;  4BIZ A;  2X7R B;  2AHZ A;  3CCR V;  3TET A;  4X88 A;  1M56 C;  3F5W C;  4JGS A;  4FK5 C;  3ETE A;  1YSC A;  5DM6 V;  4MT8 A;  1OCO B;  4MTX A;  3AG2 B;  1M90 W;  2V7Q G;  5LGU A;  3G4S V;  3AEI A;  4TWK A;  3G71 V;  2P90 A;  1MOF A;  3K9A A;  3OFN G;  5CMU A;  1JCH A;  3T4D A;  4MS2 A;  2HVK C;  4JAU A;  1S3J A;  3CCJ V;  2FTK A;  2OCC B;  5E1A C;  3B8N A;  4G27 B;  1SRY A;  3ABM C;  2QEX V;  1NVP D;  3OR7 C;  5IY5 C;  3QNE A;  3AG1 B;  4H33 A;  3F7Y C;  1VQL V;  3E8H A;  5L3E A;  4RO2 A;  4KUM A;  3VOU A;  2F43 G;  4UVB A;  4MVU A;  5GW7 A;  4ASU G;  1YTF D;  3ZMV A;  3E86 A;  3OE7 G;  3ABK B;  4MTF A;  1OCC C;  2IW5 A;  2QM7 A;  4BAY A;  4G2K A;  2R9R B;  1SET A;  1R73 A;  1AI6 A;  1RPR A;  1VQ9 V;  2EJR A;  4DXW A;  1CPY A;  1XL6 A;  1BHA A;  3T1C A;  3CXC U;  2XAJ A;  4N21 A;  2JEX A;  1K5Q A;  2NNU A;  4WFA V;  4PEL A;  4PA4 A;  1QLN A;  2W6I G;  4F4L A;  3QO5 A;  2Y48 A;  1F51 A;  3MHH C;  1EBO A;  2W6J G;  2R9I A;  3AG1 C;  1PNK A;  1OCZ B;  3K08 A;  5IDJ A;  2LP7 A;  3WG7 B;  1K73 W;  2Z5U A;  3GB7 C;  1S72 V;  1NH2 B;  3ZRS A;  1ORQ C;  4QNH B;  3OMI B;  5H9C A;  3X2Q C;  3JD2 A;  4HYO A;  1H2G A;  2DWD C;  1IXM A;  3ZRW B;  4ZKI A;  3CME V;  4PDR A;  5B1N A;  1CEZ A;  1VQM V;  1M1K W;  1K5S A;  4MW8 A;  3OEE G;  1YJ9 V;  3FKS G;  4RUE A;  4U7N A;  4QE7 A;  1F23 A;  4I5S A;  2UXN A;  1LNQ A;  2EIL B;  2GHY A;  3WFV A;  3W7U A;  2X0L A;  5B1B B;  1NQT A;  3AG4 C;  3ZN1 A;  1GKF A;  1OCZ C;  2ITC C;  1FFT B;  3K0D A;  1KKD A;  1F4N A;  1AJN A;  4GX0 A;  1NKD A;  2IJK A;  3E35 A;  4JAV A;  2WLL A;  3CC2 V;  1H38 A;  2JK5 C;  3QO7 A;  2PI4 A;  2ZDI A;  3CMA V;  2EIM B;  3FB5 C;  1K4C C;  3AG3 B;  1JJ2 U;  2C2A A;  1E79 G;  1W0J G;  2LFS A;  2DQ0 A;  1FXK B;  2CK3 G;  5KA6 A;  4FIP C;  1M57 C;  4FPP A;  3ZMZ A;  3B8M A;  5L3C A;  1F4M A;  1QLE B;  2ATK C;  3MD0 A;  3E2E A;  2DYR C;  1V54 B;  2ZDI C;  3ASN C;  3CCQ V;  4UUJ C;  4EKW A;  2QE7 G;  1E1Q G;  1FXK A;  2A0L A;  2DYS B;  2GSM B;  1Y66 A;  3CCE V;  3CCV V;  3OW2 U;  2XAF A;  1E1R G;  3W7W A;  2ZQM A;  3FB6 C;  1G8M A;  4R50 A;  2XAH A;  1RPO A;  5LHG A;  4WCE V;  2ZD9 A;  1Q82 W;  5KUM A;  3ML0 A;  3OR6 C;  1ARO P;  1JPX A;  2PI5 A;  1PNM A;  3A0R A;  4R8C A;  4PA7 A;  3ASO C;  5EBL C;  3R65 A;  3ABL C;  2OT5 A;  3OMN B;  1RM1 B;  4MTG A;  4QPJ A;  4R7C A;  1UJW B;  2IJI A;  3PJS K;  2HR3 A;  3UM7 A;  3E8F A;  4JTD B;  1P4R A;  1PD3 A;  4JF3 A;  4P2Z A;  1J95 A;  1ENV A;  1KD1 W;  1SER A;  4MVQ A;  5IYB O;  1R3J C;  3JD3 A;  4I9W A;  3T4Z A;  3LDC A;  3W7X A;  2P6J A;  5BZB A;  4LC1 A;  4FMT A;  2X6B A;  3UKM A;  4PA3 A;  1K92 A;  1CP9 A;  1OCO C;  1VQP V;  1K8A W;  2WLM A;  3AG2 C;  4PDM A;  3IFX A;  4JAS A;  2QKS A;  5J9P C;  2H94 A;  1OZ0 A;  4XDL A;  1YJW V;  1NR1 A;  4RQE A;  2HKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...