1BL8A

Potassium channel (kcsa) from streptomyces lividans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (POTASSIUM CHANNEL PROTEIN)
publication title The structure of the potassium channel: molecular basis of K+ conduction and selectivity.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 29
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bl8A00
2OCCC 4PA3A 4MVRA 3F5WC 4GX1A 4PDVA 2P7TC 1JVMA 3K0GA 3ZJZA 3K03A 3SYAA 3E8BA 4KFMA 2W0FC 4HZ3A 3E8FA 4PA6A 4DXWA 5EC2C 2Q67A 2WLJA 4WFHA 3SYQA 3E86A 4MVOA 3TETA 3SPCA 1R3LC 4TWKA 2EIMC 1G4YB 3OUSA 2WLIA 2ITDC 5B1AC 3RVZA 2QKSA 3K0DA 5CBHA 1KKDA 1S5HC 2HVKC 3AG4C 4MVMA 4MVSA 3SYPA 1R3KC 2A0LA 2ZXWC 4MTGA 4XDKA 3SYCA 1R3IC 2R9RB 4GX0A 4GX5A 3SPIA 4R50A 4CBCA 1OCCC 4JTDB 2A9HA 4P9PA 5B3SC 5J9PC 2EIJC 5IY5C 2HVJC 5CBGA 3E89A 2Q68A 3IGAC 4XDLA 2H8PC 3ABMC 3E8GA 4XDJA 4MS2A 5B1BC 3ABLC 4G27B 4H37A 4MW3A 4P30A 1K4DC 4PA4A 2WLKA 3STZC 3UM7A 5EBMC 4PDMA 3HPLC 4R6ZA 3T1CA 1J95A 3FB8C 3OGCC 1M56C 2WLLB 2DWDC 1ZWIC 4MVZA 4PDLA 4QNHB 4R7CA 1V54C 4RO2A 3SJQC 1ORQC 3ABKC 4OXSA 2X6BA 3ASOC 3KG2A 2HJFC 3E83A 2ZD9A 4UUJC 4X8AA 2Q6AA 4GX2A 3IFXA 4BW5A 2BOBC 2HG5C 3LNMB 4LBEC 3SPJA 2HFEC 3LDEA 3LDDA 1OCRC 4R8CA 3K06A 4MW8A 3E8HA 3SPGA 4PA9A 4HYOA 3RBZA 3T4ZA 2NLJC 3FB6C 1XL6A 2A79B 4WFFA 4MVUA 3T4DA 4JTAB 4PA7A 4PDRA 4EKWA 5BZBA 5EBWC 2X6CA 3UKMA 5EBLC 2KB1A 3BEHA 4J9YB 3FB7C 3RW0A 4LCUC 4J9ZB 5EC1C 2AHYA 2Q69A 4ZBMA 2WLLA 5KUKA 3LDCA 3OUFA 3R65A 3WG7C 1OCOC 4WFEA 4G28B 4RUFA 3SPHA 2ATKC 2JK5C 3GB7C 4I9WA 4P2ZA 1LNQA 3SYOA 1BL8A 2IH1C 2ITCC 3AG2C 3K04A 4LP8A 2K1EA 4QE9A 3F7VC 3ZRSA 1QLEC 4QE7A 2IH3C 1P7BA 4H33A 2X6AA 5EK0A 1R3JC 5CBFA 4P9OA 4F4LA 3JYCA 3T2MA 4RUEA 2EILC 3FB5C 3K08A 2DYRC 3OR6C 4WFGA 3AG3C 1XL4A 2BOCC 2AHZA 4RAIA 1K4CC 2WLHA 2WLNA 2EIKC 3PJSK 2WLIB 3OR7C 5KUMA 3RVYA 4MTFA 1V55C 3F7YC 3EFFK 4JTCB 4MTOA 2DYSC 3VOUA 2QTOA 2DWEC 3AG1C 3X2QC 1M57C 1OCZC 3LUTB 2EINC 4MSWC 4MVQA 2YEVA 5E1AC 3STLC 2WLMA 2Y69C 3TCUA 3ASNC 4X89A 4X88A
chains in the Genus database with same CATH superfamily
2OCCC 5IYDO 2ZQMA 4LR3A 4NTYA 4CH5A 4DRXA 4FZ0A 3RYIB 4LH6A 3SYAA 3RWRD 2JJ2G 4UCTA 2DYSB 2ZT9B 3C3TA 3H9VA 2UXXA 1MSDA 4PD4F 3ZRWB 3U11A 4FVMA 2ZNJA 1OCCC 4UVAA 3H01A 1VQ8V 2WA3A 1VQPV 3IGAC 3HKDA 2PGGA 2VWKA 1QVGU 5EBMC 3RYFA 2HHHO 4JI3B 2V7QG 4F6RB 1J95A 3OGCC 2OCHA 1H38A 2DWDC 5CA1A 3WB2A 1JR9A 1YDXA 3MD0A 2Q4PA 4GKJB 4X8AA 1M90W 1BHAA 1QU7A 2HG5C 2ADQB 3ZHSA 4UXNA 3ZHVA 4O4JA 4WFFA 5J2TB 1OV9A 3FD9A 4G2KA 1AI5A 1RPOA 3APOA 1B6QA 1N4CA 1H2GA 1YVWA 1Q6HA 3DTUB 2UUBB 3QVNA 2PI5A 4X64O 2A7WA 4IYHA 1GMGA 2F1MA 2BE3A 2IH3C 1P7BA 5JVDB 5CBFA 4WFBV 4CS2A 1W0JG 2WAMA 1ZL8A 3AG3C 1HR0B 1XNRB 2FB5A 2XNDG 3HB3B 2G38A 1MABG 4I50A 1VEWA 3M7MX 3J7AU 2LFSA 1Y67A 4K8XA 5FNVA 4JI6B 4GKKO 2ZR3A 4JYAB 3CC4V 4MVRA 1SQPH 1THZA 4J80A 4ZKIA 1QHTA 2Q67A 4OGQB 5IT9N 1G4YB 1NVPB 5CBHA 2ZCEA 5JCOC 3H1IH 3OT7A 4PHZA 4BIZA 4IGGA 2ZE8A 1QR9A 4YIPA 5IYZB 3ZMTA 1VQ4V 5GTIZ 4TUYA 1PNMA 5BR8O 1XEQA 5CA0B 1OHHG 1FAFA 3NR7A 4O2BA 1M56C 4B7KA 4LFAO 4DK0A 5BXZA 3JSNA 1SZTA 1XMOO 3QO5A 2JDIG 4LBEC 3SPJA 1XREA 2HFEC 4J41A 3ZHRA 2D3OW 2ADPA 5FLXN 3T1YB 2LFRA 5L3BA 1AJNA 3FB7C 3RW0A 3JATB 3ZIAG 3EHBB 4N23A 1S76D 4JI8B 2EZPA 3HKEB 4FLXA 4P2ZA 3D36A 1Y74A 1BS3A 2FKXA 2WPDG 4CH6A 2LGWA 2QWOB 2YI8A 4QGPA 5KHGA 4NTXA 4JI7B 2FYUH 4LH7A 3Q4HA 2JGUA 5KA6A 4NKGB 1Q8IA 1HNWO 2QA4V 5JJJB 2Y69C 3G4SV 1AJPA 3N2GB 4X88A 5BMVA 2LQTA 1Q7YW 1JVMA 3ZJZA 2IJJA 5IDJA 3QNEA 4TWKA 3HKCB 5JH7A 5JQGB 2ITDC 2VQFO 3RVZA 3K0DA 2YXYA 1S5HC 1IXMA 2CTWA 3CCLV 1R3KC 4FLTA 4CH4A 5B1NA 1X4TA 2F4VO 5CBGA 3JD2A 1I08A 4MS2A 2QM8A 3GWOA 3UM7A 2HR3A 2ARHA 1SQFA 2Q9LA 2GUZB 1F4MA 4ZHQB 2ZM6B 4TV8A 4UB6Z 2IU3A 2BOBC 4YJ2B 3DSQA 3B77A 4E2LA 3ZCCA 2GBOA 3FB6C 4UB8Z 5LA6A 1IBMO 3N2KA 1ROPA 4NYKA 1GN3A 3T1HO 2KG7B 1BE3H 3WG7C 5LYJB 2ZE5A 1SQBH 4Q6GA 3W7UA 2K1EA 2B9ZA 4QE7A 1R6KA 3M8AA 4DRXB 1R3JC 2QWNB 4LC1A 4DV1O 4UCRA 1YTFD 1R6NA 4WFGA 2HLDG 1KYOF 1VP7A 4DV6O 3CS5A 4DR6O 3ZN1A 1TGOA 1XDCA 3K3WA 4CH3A 1FS0G 4H0LB 2IJKA 4B7EA 2YEVA 3JD1A 5DM6V 5EC2C 3CRCA 3RFRA 1Q81W 2K9PA 4PDVA 2UXCB 3HKDB 1BCCH 2EIKB 1YSCA 4UCOA 3E8FA 1BQ0A 3SYQA 1Y76A 2QWRB 3AG1B 1K97A 1M57B 1WP7A 5CA1B 5LMNO 4FFKA 3IJ4A 3K9SA 5LXTA 2IW5A 3G80A 3ZHTA 5CMUA 3OFNG 2CTQA 3K58A 4DR4B 2PTMA 5J9PC 4O4JB 2YIBA 3CE2A 5KLVH 4DK1A 2RN9A 4DR5B 5GW7A 3P32A 4JGSA 2PZSA 4FPPA 1SQVH 4PDLA 1GRJA 4H13B 4JI0O 3ZX6A 3BA8A 2RDCA 4OXSA 3J81N 4LF5B 1NU1H 4GX2A 2UXDO 3IFXA 4JI5B 5F2VO 3IC9A 1L0NH 2XAQA 3E8HA 1ZL8B 2ILMA 5KAIZ 2A79B 4Z2WA 1NKDA 3ZMSA 2KB1A 4L87A 3THOA 3P30A 4I50B 5JCOA 2YS8A 1NTZH 1KQSU 4JV5B 5ITZA 5FNVB 3LDCA 2BCCH 2WWWA 3OD4A 4DUZO 2XAFA 2JK5C 4NXNO 1KKCA 3BCCH 4I0XA 4DV0B 3U10A 3UO2A 3CRQA 1AR1B 4BR6A 1AP6A 2DYRC 1AR4A 4I5SA 4J7ZA 1K92A 2IJHA 1WPXA 4LF4O 4X1YA 2AHZA 3PJSK 1MNGA 5B66Z 1KMIZ 3SR2C 2H3OA 3EFFK 1YJWV 3X2QC 1I5YA 2JIZG 4DR3B 3CHXA 1ZUQA 3CC7V 2WLMA 2PUSA 2AXTZ 3G67A 4X89A 2FMLA 2RNBA 1FKAO 4TUYB 5FPOA 2Y0IA 4BIUA 5IJ9A 4O2BB 4WBNA 3CRRA 4BWAA 1N33O 3SJAC 5K1PA 4JAAA 1H2KA 2QTSA 3G71V 4DYLA 2DQ0A 5IY5C 1F7YA 1CEZA 2UXNA 3TJTA 3OW2U 5EYPA 5B1AB 2EJRA 1NH2D 1JPXA 3CMEV 1MOFA 1TAEA 2XHBA 5AG2A 4LF8O 2JGDB 4QNHB 3JAKA 3H1JH 1IBLO 1HDJA 1F23A 2LW1A 1WB8A 1Y74B 4JI4B 5IE9A 4B3SB 1R1BA 1OCRC 5LHGA 3RBZA 2P4KA 2KSDA 4X62O 2UUAO 2YDEA 4LF7O 3OMIB 2X6CA 1Q82W 3OTOO 4J9ZB 1N8RW 3Q4HB 2OIEA 4JI1B 5L3FA 4UV9A 4FLYA 2M7WA 5B1OA 5BMVB 5C93A 4LF9B 4ZI7A 4DR6B 4H33A 4JYYA 4F4LA 1ZTEA 3OR6C 1HNXB 3I55V 2WLHA 5JH7B 3OR7C 2HJDA 1W59A 3FX7A 1L8DA 3FFQA 1SRYA 3I56V 1R73A 1AP5A 4PELA 2XAJA 4OX9O 2Y48A 2ZIMA 1VQ6V 2EILB 4JI2B 5LMNB 2JS3A 4PA3A 1HW7A 5B3SB 4AI8A 2GV9A 3K03A 1M9NA 4OPAA 4JZ2A 5KHJA 3E86A 3RGBA 1BT8A 3OUSA 1I7FA 1NQTA 2HEPA 1AJQA 5C8YA 2MW2B 2KG7A 2OCCB 4TV8B 1AI6A 3MDSA 2QR4A 3A8TA 2A3QA 4EB6A 2XT9A 5LA6B 2B1IA 4B3MB 3E8GA 1NBMG 3A0BZ 1T5EA 1WP8A 4MW3A 4D6TH 3N2KB 3QF7A 1SZXA 2M6YA 2UXDB 1ZX3A 2E74B 2ZIOA 4WFAV 1SETA 1N34O 1OCCB 1B04A 5IYCO 2NNUA 5EZYA 3W7WA 3CCEV 2E75B 1ORQC 2XAHA 3ABKC 4EEQA 3LNMB 4DV7O 4I9QA 4DW0A 2P67A 4CS4A 3W7TA 1DF5A 4DV5O 4B08A 1QNMA 1VQMV 4DUZB 3CD6V 3BEHA 4X66B 4YXWG 4MT8A 1VQ7V 1Q6IA 3FAVA 2JS5A 4PI2A 4LFCB 1IBKO 1N0JA 2YEVB 2ITCC 2DOSA 1MG1A 4GUNA 1NTMH 2IBZH 5JWPA 1NTKH 1Y66A 1Y76B 3OMAB 1K4CC 2P4VA 3RVYA 2DMXA 1EFRG 2AGAA 2QSAA 1V55C 5LXTB 2P6JA 4FM2A 4FM0A 2F95B 4MVQA 1J5EB 2ODMA 3ASNC 1W0KG 5JJEB 1Q86W 3AG3B 2EZOA 2YICA 4O4LA 1ZAUA 2LO1A 1F51A 2XUMA 1FJGO 1N32O 2F43G 1EN6A 1FXKC 2VQEB 1Z2GA 2EIMC 5H5NA 5LBQA 1U97A 2LP7A 3CCQV 3ZMUA 4DV3B 4MVMA 3BRCA 1AR5A 3HKBA 2ZXWC 3CCRV 1R3IC 4GX0A 4GX5A 4QPKA 3TXQA 3JAWA 1M1KW 2EIJC 1EBOA 1D5NA 2JJ1G 3ABMC 5H6QA 4B3RB 4B3TO 1XNQO 2Z0AA 3G6BA 4U7OA 1KECA 2IU0A 1XOUA 2QKAA 4R6ZA 1KUQA 4MVZA 5ITZB 2PYLA 3SJCC 4QPJA 4RO2A 4FLZA 4LF7B 2Q7HA 4UUJC 4I0XB 1SS3A 2E5LO 4DV4O 2UXBO 2Y4TA 3K06A 3UT5A 3CC2V 3OTFA 4HYOA 4IIJA 1M56B 4DO2A 4MVUA 4X1YB 1WAZA 3W7XA 4X65O 2YIDA 2QWPB 4LFBO 5LGNA 2L6LA 4YHHB 4QJFB 3R65A 2OTJV 4G28B 4FMTA 4FLUA 4W4LA 1BGYH 2RQ6A 4DV2B 3W7SA 1QR8A 4CC5A 4P9OA 1NH2B 5IJ9B 1YXBA 3FB5C 1VF7A 1FFTB 3AEIA 5TISZ 4WBNB 3JD3A 1ZLZA 2EINB 4FFBA 2GTSA 1URFA 4JTCB 2QTOA 1O9GA 1CPYA 2JGDA 2YC0A 3DXRB 1FXVA 4YJ3B 3ETQA 2EX3A 2EINC 1I94O 2CUGA 3OE7G 3E35A 2H94A 3L71H 1Y6XA 3PN1A 2ZKOA 4GLXA 4BAYA 1IZ3A 4KP4A 5EYPB 2NN4A 2DQ3A 2DN9A 4ZIBA 3CYOA 3DC6A 3JAKB 4FJCC 2RCVA 2Y69B 1GH6A 4J7KA 3CCMV 3H1KH 2A0LA 4CBCA 1XBLA 5LHIA 4FM1A 4GT1A 2IJIA 4U3JA 4UVBA 3JCUZ 1N34B 4P30A 2WLKA 3BY6A 3STZC 5E79Z 1SA0B 1TUEB 2V4DA 1Q5OA 1EZJA 1PKXA 3ZRXA 2W6IG 2ZNIA 4NR1A 4ZI7B 2HHHB 3LDEA 2WA4A 1XMQO 1VF5B 3LSUA 4IYIA 3D3QA 3CPWU 3UKMA 4DR1O 3SJBC 1JJOA 1EM1A 3ICXA 4HBNA 1NS1A 1XILA 3B4SA 4J10A 4UCVA 3LSSA 2QEXV 3AG2C 1QLEC 4N21A 2Q5ZA 4KXRA 4IHJA 3JD4A 2O57A 4Z1VA 1DGSA 3NXSA 2EBOA 1XL4A 4PI0A 1GM9A 3WG7B 4X1IA 4X64B 2WLNA 4MTXA 5KX5A 5C8YB 2OT5A 1SERA 4DR2O 2DWEC 1OCZC 1JFFA 3LUTB 4FZ1A 1L1FA 2BSKB 2Z3YA 5KA5A 4EB6B 4L8JA 3OEHG 2P5OA 3JSLA 1GK9A 3VQVA 1EZVH 4GKKB 3M99B 3RYHA 2WLIA 5EZYB 1LUWA 1NT2B 1JX9A 1TUBA 3B40A 4XDKA 2R9RB 3ZS8C 2BTQA 2NR5A 4A5UB 5KMGA 1DK1A 1YEWA 3E89A 5D5QA 2H8PC 5H6RA 3BAAA 5L3CA 1SQQH 4DV4B 4DUYO 3FAVB 2FTKA 4X20A 5L3DA 1PL0A 3BABA 4U7NA 2JEUA 1A32A 4BW9A 5BR8B 4BW5A 3G6EV 5KHHA 4PA9A 3VQXA 4TV9A 2NLJC 2F66C 1VARA 4LFAB 1FXKA 4UV8A 4O4IA 5IWAO 3T4DA 4EKWA 1RM1B 1XMOB 4X1KA 5EBLC 1ZSPA 1WNSA 3KCYA 4U3FH 2UU9O 2UUCO 4ZBMA 1RM1C 2N74A 1TA8A 3JALA 1OCOC 4XBFA 4ASUG 4KL1A 3ZEDA 4QE9A 4LP8A 5GONA 2QKCA 4O4LB 4YY3O 2X6AA 3JYCA 4RQFA 3UQ8A 4TQDA 3B2EE 5A9GA 2QDOA 2AZ2A 5H2FZ 1Z5VA 4JPRA 2Q7EA 3HKBB 1UPGA 5LP6C 1P7GA 1B06A 2OIGA 3JAWB 1YJ9V 2HKOA 1K7DA 3ZHUA 3H1HH 3OMNB 2DYRB 2ZDIC 4FLWA 2HP8A 2D2CB 4UFZA 4KFMA 3MHHC 2CGNA 3QTCA 1HNWB 4MVOA 3X2QB 1YZBA 5A2QN 4FIPC 1L0LH 3AG4C 4F6EA 1RSOA 3SYCA 3SPIA 3CEIA 1XI1A 4D7SA 1YIJV 3EVKA 3UT5B 3BVOA 4IIJB 3P3PA 4XDLA 1I5XA 1S5JA 2VQFB 3ABLC 4GKJO 2KKWA 5L3EA 3CCSV 3ASOB 1H2LA 2ZE6A 3CRAA 1K9MW 2F4VB 1K3EA 1ENVA 1NI8A 5IY5B 2AW9A 4K35A 3ETEA 3ASOC 3L73H 3DXRA 2ZD9A 4YJ3A 4DR1B 3GWKC 3SGIA 3VQWA 1TVKA 2UUBO 1YCIA 4ZOLA 1CXZB 5LMUO 4WCEV 2GHYA 4FFBB 2Q8VA 3WB0A 4NB5A 2AHYA 3N27A 1QBZA 3ZHQA 3MAQA 1OCRB 1HR0O 2LGQA 1XNRO 1PP9H 3ETGA 3FYIB 3CCVV 3I5DA 1BL8A 1IBMB 3K04A 1KP3A 3ZRVA 5DEDA 3AG7A 4JI6O 4GYCB 1MMMA 4JYBA 5CA3A 3T1HB 1M4UA 1XQ8A 5DECA 3OM3B 3VOUA 1SA0A 5HFLA 3ZMVA 4CS3A 4DV1B 1JJ2U 3LNNA 5E1AC 3R66A 4U3JB 4XDJA 3JAMN 4DV6B 4GX1A 5LOVA 2CTRA 2V1DA 2W0FC 3O65A 3SPCA 1R3LC 3RYCB 1D2DA 4E4EA 4O2AA 5CB4A 3SYPA 1S5LZ 4JTDB 1FPOA 4TSFG 2WSSG 1HNZO 2HVJC 5EIBC 1P84F 4QIWF 2XTAA 3WFVA 3CSXA 4TOIA 4JF3A 4UCUA 2GDSA 3T1CA 3K5NA 4BIOA 5L3GA 1V54C 3SJQC 1MZEA 1VQ9V 3T1YO 2F23A 2X6BA 3HR0A 1E79G 1YF2A 1YHQV 2YSUB 2BSKA 2OTLV 4IHJB 2ETNA 1YTFB 1GO3F 4JI0B 1LR1A 4PA7A 2P90A 4X1IB 1VQKV 1G1XB 5KX5B 3ABKB 1G6UA 2XAGA 2C2AA 3CP1A 4EFBA 1YJNV 1H8EG 1JFFB 4WFEA 3CJHA 3A0RA 3SPHA 2ATKC 4HNAA 4I9WA 3WU2Z 3RYHB 4UVCA 1GN6A 3KKYA 3MHSC 4RAIA 4NXNB 1E1QG 2WLIB 2W0XA 1TUBB 1FD9A 2DYSC 1GTOA 2CAZC 2BTQB 3ABTA 4LWSA 5KMGB 5JJNB 4RWUA 1BSMA 4LF4B 1GN2A 2LJ2A 2L35A 3CX5F 4PA6A 1XHZA 1V55B 3TETA 5KHIA 2QKSA 4X20B 1KKDA 2HVKC 3ASNB 4D7TA 1D5AA 3K79A 4OPHA 4GCZA 4TV9B 4PV1B 1FXKB 1N33B 1JQ0A 2Y4UA 4O4IB 2ZM6O 2CH7A 2EIMB 4X1KB 1K4DC 4PA4A 1PM9A 3TGUH 3L9DA 3L74H 3HPLC 5J2UA 2ZXWB 2A06H 5LP6A 3JALB 2EIJB 2XOKG 5LMUB 2ZDIA 2FL4A 3ABMB 5GONB 5KHKA 2PYJA 2E76B 4MW8A 3ZBHA 3K57A 1MZFA 1H2SB 4LF8B 1MSWD 1K5QA 1IBLB 4JTAB 4PDRA 1Z5WA 2DE0X 2Z5UA 1RPRA 1S77D 1QQCA 1S3JA 2R72A 1N36O 2CE4A 4I55A 4JAUA 4X62B 1GM7A 1BQZA 1VQOV 2UUAB 1IX9A 1K34A 2YXHA 3JASA 3OTOB 3ZRSA 5EK0A 3DC5A 3P3NA 1GKFA 4RUEA 2EJ7A 3K08A 1QVFU 2DJVA 2BOCC 3E22A 1VMGA 2VRZA 1WJZA 3D3IA 3C90A 2UXCO 3F7YC 1RSOB 2YI9A 3CMAV 3CWBH 2R70A 4LF6O 5H9CA 2VS0A 3ZMZA 3TCUA 2YUAA 4AQYO 5IJ0B 3F5WC 3U0ZA 2DW4A 3L70H 3K0GA 2QM7A 4HZ3A 4DR4O 3S3XA 3GVMA 4OX9B 3J80N 1HNZB 1W2BU 1CP9A 2CTPA 4DR5O 4MVSA 1SF9A 1JCHA 3AK2A 4MTGA 1WA8A 2QE7G 1KB9F 4R50A 2ZE7A 4P9PA 4JZGA 4H44B 1TVKB 1AI4A 3KCXA 2Q68A 4CZZA 4I4TA 4WF9V 4ZOLB 1KC8W 4LF5O 5IYBO 1KD1W 3CXCU 4YIOA 2GSMB 4JI5O 1AROP 1SC5B 5D5PA 1ZWIC 4JYCA 2HJFC 3E83A 2QGNA 1VQ5V 1JA8A 1FFXA 2QWQB 3QO7A 4JAVA 4JV5O 3AK3A 4Q20A 5KAFZ 4NXMO 3SPGA 4LNUA 2R9AA 5EBWC 4FLVA 1VF6C 1QCEA 4DV0O 1FXHA 3WB1A 1AB3A 2OWOA 3IAYA 2Q69A 1WB7A 2WLLA 4DV7B 5KUKA 3RYCA 4J7JA 1OZ0A 4O4HA 4DV5B 2Q0OC 1O9HA 5FL7G 4X9QA 1DLBA 2P22C 4J42A 5LOVB 1K73W 3CXHF 1NZ6A 4DR3O 3ETDA 1IBKB 2BTOA 5KUMA 4CC6A 4O2AB 1Y4MA 5CB4B 1BMFG 5FPRA 3AG2B 1AI7A 1QLEB 3ZN0A 5EIBD 3B8MA 2JVDA 2P7TC 5HFMA 1IURA 5DN6G 1M5IA 4DXWA 1JOYA 3RN4A 1OCZB 3FYEB 1UFIA 3F5TA 3JARA 1NR1A 3IC7A 2XASA 4KHPO 2A9HA 1FJGB 1N32B 3DGEA 2CK3G 1PPJH 1AVMA 3APQA 2X7RB 1VIBA 1DTOA 4G27B 2YIAA 2Q0AA 3RYIA 4B3SO 4JI4O 4DR7O 4HAMA 4DW1A 1IVSA 1EN5A 4W4KA 3RT3C 3B09A 2OYQA 1V9PA 1YI2V 1I0HA 3CJHB 3ZRWA 4B3TB 4HNAB 1XNQB 2Q6AA 3EXAA 2MK3A 4GZRB 4R8CA 4JI1O 3E2EA 1VQLV 1N36B 4Z1MG 3A0HZ 5BZBA 4LF9O 4J9YB 1LUVA 2E3CA 2E5LB 5EC1C 4F6RA 1US6A 1KBHA 2UXBB 3K5LA 1SQGA 1VQNV 1KU9A 2F93B 1PL4A 3CRMA 4LWSB 1HNXO 1MA1A 3H1LH 4RUFA 2ZINA 4X65B 5GTHZ 3F7VC 1Q90D 4LFBB 4FK5C 1Q43A 3RYFB 1WN7A 4LF6B 5J2TA 3AK1A 4JI2O 2EIKC 1OCOB 1NJIW 4K3AA 4AQYB 1H8HG 1GAXA 1WLEA 4K0KO 4MTOA 3AG1C 3BPZA 1P49A 1M57C 1DF4A 5LL6Y 4C7UA 3UO3A 1BZKA 3D8CA 3QO8A 2CH7B 4NTWA 5JVDA 4AHCA 2Y0PA 1SESA 5J2UB 5B5EZ 2AZ0A 3ML0A 1I94B 2YXLA 5LP6B 4B3MO 1U96A 1Q6UA 3BHPA 3TXSA 2IM9A 5B1BB 1PD3A 1S0VA 2VWJA 3UCSC 2YIBD 3B8NA 4ICGA 4AILC 4I7ZB 5B1BC 1E1RG 4PDMA 3AG4B 3FB8C 4NXMB 1EN4A 4I55B 1M93A 3KG2A 3K5OA 4X66O 4JI3O 1PNLA 3JASB 2JRIA 3ABLB 2QJ1A 3JCZA 5IYZA 3T4ZA 4LFCO 1H2NA 1HP8A 5IJ0A 3E22B 5CA0A 2PY5A 2W6JG 4IT5A 1UJWB 1K33A 2RJZA 3OUFA 1XMQB 2RMKB 4NVPA 4KUMA 1NVPD 4K8ZA 1LNQA 3SYOA 2IH1C 2N05A 2N04A 1K5SA 3QG5A 1PNKA 1GM8A 1WPBA 1P4RA 2CDYA 1J5EO 1K8AW 2QM4A 1KP2A 3SDLA 3A2FA 3JATA 1YITV 4TQFA 3OAAG 1WA8B 2EULA 3KZIZ 2B5UA 3HKEA 2VQEO 3STLC 4I4TB 4ABMA 5LHHA 4DV3O 3CB2A 1OJHA 1VF6A 1Q3EA 5LGUA 4RQEA 3L75H 3E8BA 4DR2B 4KHPB 2WLJA 4WFHA 4JYAO 1XUQA 1JMKC 5B1AC 4B3RO 1SKVA 3LSQA 1FFXB 4DR7B 3S3WA 1H2MA 3OGIB 1S72V 5CN0A 3K5MA 3N2GA 3D36C 2R9IA 4J11A 2X0LA 2KQXA 4LNUB 4PJ0Z 4H37A 3K59A 1HWYA 4EFEA 1B3QA 2PI4A 1X59A 4IL6Z 3FKSG 3VBBA 1GN4A 2WLLB 3K9AA 2P06A 3HKCA 5JQGA 4R7CA 2ZR2A 3OEEG 4O4HB 3BA9A 3CCUV 1COWG 1IDSA 3LDDA 4YHHO 4DUYB 1F4NA 1FYJA 5LGTA 1XL6A 1NR7A 2Q73A 1V54B 1G8MA 4DV2O 4LCUC 3BFRA 2GUZA 1N0NA 2CGOA 4ZHQA 2LW7A 5IWAB 1SQXH 3GB7C 1AILA 4UCSA 5BY1A 1QLNA 3L72H 3CCJV 4YJ2A 2UU9B 2Q7GA 4K0KB 2UUCB 2JEXA 2GTAA 4JI8O 1RP3B 3T2MA 3O9OA 2EILC 1BHBA 2PF4E 3ABUA 5B3SC 4MTFA 3TK1A 3JARB 1RFYA 4YY3B 1IXBA 2B1GA 4TT3G 3C3SA 1PV0A 4MSWC 1XHXA 3JD0A 5LYJA 5K1XA 3VQYA 4JI7O 4JASA 1R6TA
chains in the Genus database with same CATH topology
2OCCC 3OEHG 5IYDO 2ZQMA 1GK9A 3F5WC 2DW4A 3K0GA 2QM7A 4BIUA 3SYAA 4HZ3A 2JJ2G 3M99B 2DYSB 2UXXA 1W2BU 1CP9A 2WLIA 1JX9A 3ZRWB 4MVSA 1JCHA 4MTGA 4XDKA 2R9RB 2QE7G 4R50A 1OCCC 4UVAA 3G71V 3H01A 4P9PA 1VQ8V 2DQ0A 5IY5C 1CEZA 1AI4A 1VQPV 3E89A 2Q68A 3IGAC 4CZZA 2H8PC 2UXNA 5H6RA 4WF9V 1KC8W 3OW2U 5IYBO 5B1AB 1QVGU 1KD1W 5EBMC 5L3CA 3CXCU 2EJRA 1NH2D 1JPXA 2GSMB 3CMEV 2V7QG 1AROP 1MOFA 1J95A 3OGCC 1H38A 2DWDC 1ZWIC 4QNHB 2FTKA 4JYCA 5L3DA 1PL0A 4U7NA 2JEUA 1F23A 3MD0A 2HJFC 3E83A 4X8AA 1M90W 1VQ5V 1BHAA 4JAVA 3QO7A 2HG5C 4BW5A 3G6EV 4Q20A 1OCRC 4UXNA 5LHGA 3SPGA 4PA9A 3RBZA 2NLJC 1FXKA 4UV8A 4WFFA 3T4DA 3OMIB 4EKWA 1RM1B 5EBWC 2X6CA 1QCEA 4G2KA 5EBLC 1Q82W 1AI5A 1FXHA 4J9ZB 1RPOA 1N8RW 1B6QA 2Q69A 4ZBMA 2WLLA 5KUKA 1RM1C 1H2GA 1OZ0A 5L3FA 3DTUB 1OCOC 2PI5A 4XBFA 4ASUG 4UV9A 2M7WA 4QE9A 5B1OA 1GMGA 4LP8A 5C93A 5FL7G 1DLBA 2IH3C 1P7BA 4H33A 2X6AA 5CBFA 4WFBV 1K73W 4F4LA 3JYCA 1W0JG 2WAMA 4RQFA 3OR6C 3ETDA 3AG3C 3I55V 2WLHA 2XNDG 3HB3B 5KUMA 1MABG 3OR7C 1Y4MA 4JPRA 2LFSA 1BMFG 3AG2B 1AI7A 1SRYA 3I56V 1QLEB 1YJ9V 1R73A 4PELA 3ZN0A 2XAJA 2HKOA 2Y48A 1K7DA 2ZR3A 1VQ6V 2EILB 3CC4V 3B8MA 3OMNB 2ZDIC 2DYRB 4PA3A 4MVRA 2P7TC 1THZA 5B3SB 5HFMA 3K03A 1M9NA 4KFMA 3MHHC 4ZKIA 5DN6G 4DXWA 2Q67A 1JOYA 3E86A 4MVOA 3X2QB 1G4YB 1OCZB 3FYEB 3OUSA 1NVPB 5CBHA 1NQTA 4FIPC 1AJQA 3AG4C 1NR1A 3IC7A 2XASA 3SYCA 2OCCB 3SPIA 4BIZA 1AI6A 2A9HA 1YIJV 1QR9A 3DGEA 3ZMTA 2CK3G 1VQ4V 4XDLA 1I5XA 2B1IA 3E8GA 1NBMG 2X7RB 1PNMA 1DTOA 3ABLC 4G27B 4MW3A 1OHHG 4HAMA 5L3EA 3CCSV 3ASOB 1M56C 4WFAV 1SETA 1K9MW 1OCCB 1K3EA 1ENVA 5IYCO 2NNUA 1YI2V 3W7WA 3CCEV 1SZTA 1ORQC 5IY5B 2XAHA 3ABKC 3ZRWA 3ETEA 3ASOC 3QO5A 2ZD9A 2Q6AA 2JDIG 4LBEC 3SPJA 3LNMB 2MK3A 2HFEC 4R8CA 3E2EA 2P67A 1VQLV 3W7TA 1DF5A 4Z1MG 2D3OW 1VQMV 5BZBA 4WCEV 2LFRA 3CD6V 5L3BA 1AJNA 2GHYA 3BEHA 3FB7C 4J9YB 4YXWG 4MT8A 3RW0A 3ZIAG 3EHBB 1VQ7V 5EC1C 2AHYA 4N23A 1S76D 1QBZA 1VQNV 2EZPA 1OCRB 3ETGA 2YEVB 3FYIB 4RUFA 4P2ZA 3CCVV 3D36A 1BL8A 2ITCC 3K04A 2WPDG 3F7VC 1KP3A 3ZRVA 1MG1A 4FK5C 5CA3A 4JYBA 1Y66A 3OMAB 1K4CC 3RVYA 2EIKC 1OCOB 1NJIW 1EFRG 1H8HG 1WLEA 1V55C 3OM3B 4MTOA 3VOUA 5KA6A 2P6JA 5HFLA 3AG1C 3ZMVA 1M57C 1DF4A 1JJ2U 2QA4V 4MVQA 5E1AC 2Y69C 3G4SV 1AJPA 3ASNC 1W0KG 4X88A 4XDJA 1Q86W 3AG3B 3QO8A 2EZOA 1Q7YW 4GX1A 1JVMA 3ZJZA 1F51A 2V1DA 2IJJA 2W0FC 1SESA 5IDJA 2F43G 1FXKC 3QNEA 3ML0A 3SPCA 1R3LC 4TWKA 2EIMC 5LBQA 2LP7A 3CCQV 2ITDC 3RVZA 3ZMUA 3K0DA 1S5HC 1IXMA 4MVMA 3SYPA 3CCLV 1R3KC 2ZXWC 3CCRV 1R3IC 4GX0A 4GX5A 4QPKA 4JTDB 5B1NA 1M1KW 4TSFG 2WSSG 5B1BB 1PD3A 2EIJC 1S0VA 2HVJC 1EBOA 4QIWF 5CBGA 2JJ1G 3JD2A 3ABMC 3B8NA 5H6QA 3WFVA 4MS2A 5B1BC 2QM8A 1E1RG 4U7OA 3GWOA 1KECA 4JF3A 2IU0A 3UM7A 2HR3A 4PDMA 3AG4B 4R6ZA 3T1CA 3FB8C 4MVZA 1F4MA 4QPJA 5L3GA 1V54C 4RO2A 3SJQC 1VQ9V 2X6BA 3KG2A 1E79G 4UUJC 1YHQV 1PNLA 2IU3A 2BOBC 2YSUB 3ABLB 3B77A 4E2LA 3ZCCA 2OTLV 3JCZA 3K06A 1YTFB 3T4ZA 3CC2V 4HYOA 3FB6C 1GO3F 1M56B 4DO2A 4MVUA 4PA7A 2P90A 3W7XA 1VQKV 1ROPA 2W6JG 1UJWB 3ABKB 2XAGA 2C2AA 3CP1A 1YJNV 5LGNA 1K33A 4QJFB 3OUFA 3R65A 1H8EG 3WG7C 2OTJV 4KUMA 1NVPD 4WFEA 4G28B 3A0RA 3SPHA 2ATKC 4I9WA 4FMTA 1LNQA 3SYOA 2IH1C 3W7UA 1K5SA 2K1EA 1PNKA 3W7SA 1GM8A 1R6KA 4QE7A 1QR8A 1R3JC 4LC1A 4P9OA 1P4RA 1NH2B 3FB5C 1YTFD 1R6NA 4WFGA 4UVCA 3AEIA 1FFTB 2HLDG 3JD3A 3MHSC 4RAIA 1E1QG 1K8AW 2WLIB 1KP2A 2EINB 3ZN1A 1YITV 3K3WA 4JTCB 2DYSC 1GTOA 3OAAG 2QTOA 1CPYA 1FS0G 1FXVA 3ABTA 2B5UA 2IJKA 2EINC 2YEVA 3STLC 3OE7G 3JD1A 3E35A 2H94A 5DM6V 5EC2C 5LHHA 4BAYA 1Q81W 4KP4A 4PDVA 2EIKB 1YSCA 5LGUA 4RQEA 3E8BA 4PA6A 3E8FA 1V55B 2DQ3A 2WLJA 4WFHA 3SYQA 3AG1B 3CYOA 3TETA 1K97A 1M57B 4FJCC 5B1AC 2QKSA 1KKDA 2HVKC 2Y69B 3LSQA 3CCMV 3ASNB 2A0LA 2IW5A 4CBCA 5CMUA 3OFNG 5LHIA 3K79A 4GCZA 5J9PC 1S72V 4GT1A 2IJIA 5CN0A 4UVBA 1FXKB 1JQ0A 2R9IA 2X0LA 2EIMB 4H37A 3P32A 4JGSA 4P30A 1K4DC 1HWYA 4PA4A 2WLKA 5GW7A 3BY6A 3STZC 2PI4A 3HPLC 3FKSG 4FPPA 2ZXWB 3VBBA 4PDLA 2WLLB 3K9AA 1TUEB 4R7CA 2ZR2A 3OEEG 1EZJA 2EIJB 1PKXA 2XOKG 3CCUV 4OXSA 3ZRXA 2ZDIA 1COWG 2W6IG 3ABMB 4GX2A 3IFXA 3LDEA 3LDDA 4MW8A 1F4NA 2XAQA 3E8HA 1MSWD 5LGTA 1XL6A 1K5QA 1NR7A 2A79B 4JTAB 4PDRA 3CPWU 2Z5UA 1NKDA 3UKMA 3ZMSA 1RPRA 1V54B 1G8MA 2KB1A 4L87A 3P30A 4LCUC 1S77D 1KQSU 1S3JA 3LDCA 4JAUA 2WWWA 1GM7A 1VQOV 2XAFA 2JK5C 3GB7C 1K34A 3LSSA 2QEXV 3AG2C 1QLNA 3CCJV 3ZRSA 1QLEC 4N21A 5EK0A 1AR1B 2JEXA 3JD4A 1GKFA 3T2MA 4RUEA 2EILC 3NXSA 3K08A 2DYRC 4I5SA 1QVFU 2EBOA 1K92A 1BHBA 2IJHA 1XL4A 1WPXA 2BOCC 1GM9A 3WG7B 2AHZA 3ABUA 3PJSK 2WLNA 5B3SC 4MTXA 3D3IA 4MTFA 3TK1A 3F7YC 3EFFK 2OT5A 1YJWV 1SERA 2DWEC 3CMAV 2B1GA 4TT3G 3X2QC 1OCZC 1I5YA 2JIZG 3LUTB 5H9CA 4MSWC 1L1FA 3JD0A 3ZMZA 2Z3YA 3CC7V 2WLMA 5KA5A 3TCUA 4JASA 4X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC C;  4PA3 A;  4MVR A;  3F5W C;  4GX1 A;  4PDV A;  2P7T C;  1JVM A;  3K0G A;  3ZJZ A;  3K03 A;  3SYA A;  3E8B A;  4KFM A;  2W0F C;  4HZ3 A;  3E8F A;  4PA6 A;  4DXW A;  5EC2 C;  2Q67 A;  2WLJ A;  4WFH A;  3SYQ A;  3E86 A;  4MVO A;  3TET A;  3SPC A;  1R3L C;  4TWK A;  2EIM C;  1G4Y B;  3OUS A;  2WLI A;  2ITD C;  5B1A C;  3RVZ A;  2QKS A;  3K0D A;  5CBH A;  1KKD A;  1S5H C;  2HVK C;  3AG4 C;  4MVM A;  4MVS A;  3SYP A;  1R3K C;  2A0L A;  2ZXW C;  4MTG A;  4XDK A;  3SYC A;  1R3I C;  2R9R B;  4GX0 A;  4GX5 A;  3SPI A;  4R50 A;  4CBC A;  1OCC C;  4JTD B;  2A9H A;  4P9P A;  5B3S C;  5J9P C;  2EIJ C;  5IY5 C;  2HVJ C;  5CBG A;  3E89 A;  2Q68 A;  3IGA C;  4XDL A;  2H8P C;  3ABM C;  3E8G A;  4XDJ A;  4MS2 A;  5B1B C;  3ABL C;  4G27 B;  4H37 A;  4MW3 A;  4P30 A;  1K4D C;  4PA4 A;  2WLK A;  3STZ C;  3UM7 A;  5EBM C;  4PDM A;  3HPL C;  4R6Z A;  3T1C A;  1J95 A;  3FB8 C;  3OGC C;  1M56 C;  2WLL B;  2DWD C;  1ZWI C;  4MVZ A;  4PDL A;  4QNH B;  4R7C A;  1V54 C;  4RO2 A;  3SJQ C;  1ORQ C;  3ABK C;  4OXS A;  2X6B A;  3ASO C;  3KG2 A;  2HJF C;  3E83 A;  2ZD9 A;  4UUJ C;  4X8A A;  2Q6A A;  4GX2 A;  3IFX A;  4BW5 A;  2BOB C;  2HG5 C;  3LNM B;  4LBE C;  3SPJ A;  2HFE C;  3LDE A;  3LDD A;  1OCR C;  4R8C A;  3K06 A;  4MW8 A;  3E8H A;  3SPG A;  4PA9 A;  4HYO A;  3RBZ A;  3T4Z A;  2NLJ C;  3FB6 C;  1XL6 A;  2A79 B;  4WFF A;  4MVU A;  3T4D A;  4JTA B;  4PA7 A;  4PDR A;  4EKW A;  5BZB A;  5EBW C;  2X6C A;  3UKM A;  5EBL C;  2KB1 A;  3BEH A;  4J9Y B;  3FB7 C;  3RW0 A;  4LCU C;  4J9Z B;  5EC1 C;  2AHY A;  2Q69 A;  4ZBM A;  2WLL A;  5KUK A;  3LDC A;  3OUF A;  3R65 A;  3WG7 C;  1OCO C;  4WFE A;  4G28 B;  4RUF A;  3SPH A;  2ATK C;  2JK5 C;  3GB7 C;  4I9W A;  4P2Z A;  1LNQ A;  3SYO A;  1BL8 A;  2IH1 C;  2ITC C;  3AG2 C;  3K04 A;  4LP8 A;  2K1E A;  4QE9 A;  3F7V C;  3ZRS A;  1QLE C;  4QE7 A;  2IH3 C;  1P7B A;  4H33 A;  2X6A A;  5EK0 A;  1R3J C;  5CBF A;  4P9O A;  4F4L A;  3JYC A;  3T2M A;  4RUE A;  2EIL C;  3FB5 C;  3K08 A;  2DYR C;  3OR6 C;  4WFG A;  3AG3 C;  1XL4 A;  2BOC C;  2AHZ A;  4RAI A;  1K4C C;  2WLH A;  2WLN A;  2EIK C;  3PJS K;  2WLI B;  3OR7 C;  5KUM A;  3RVY A;  4MTF A;  1V55 C;  3F7Y C;  3EFF K;  4JTC B;  4MTO A;  2DYS C;  3VOU A;  2QTO A;  2DWE C;  3AG1 C;  3X2Q C;  1M57 C;  1OCZ C;  3LUT B;  2EIN C;  4MSW C;  4MVQ A;  2YEV A;  5E1A C;  3STL C;  2WLM A;  2Y69 C;  3TCU A;  3ASN C;  4X89 A;  4X88 A; 
#chains in the Genus database with same CATH topology
 2OCC C;  5IYD O;  2ZQM A;  4LR3 A;  4NTY A;  4CH5 A;  4DRX A;  4FZ0 A;  3RYI B;  4LH6 A;  3SYA A;  3RWR D;  2JJ2 G;  4UCT A;  2DYS B;  2ZT9 B;  3C3T A;  3H9V A;  2UXX A;  1MSD A;  4PD4 F;  3ZRW B;  3U11 A;  4FVM A;  2ZNJ A;  1OCC C;  4UVA A;  3H01 A;  1VQ8 V;  2WA3 A;  1VQP V;  3IGA C;  3HKD A;  2PGG A;  2VWK A;  1QVG U;  5EBM C;  3RYF A;  2HHH O;  4JI3 B;  2V7Q G;  4F6R B;  1J95 A;  3OGC C;  2OCH A;  1H38 A;  2DWD C;  5CA1 A;  3WB2 A;  1JR9 A;  1YDX A;  3MD0 A;  2Q4P A;  4GKJ B;  4X8A A;  1M90 W;  1BHA A;  1QU7 A;  2HG5 C;  2ADQ B;  3ZHS A;  4UXN A;  3ZHV A;  4O4J A;  4WFF A;  5J2T B;  1OV9 A;  3FD9 A;  4G2K A;  1AI5 A;  1RPO A;  3APO A;  1B6Q A;  1N4C A;  1H2G A;  1YVW A;  1Q6H A;  3DTU B;  2UUB B;  3QVN A;  2PI5 A;  4X64 O;  2A7W A;  4IYH A;  1GMG A;  2F1M A;  2BE3 A;  2IH3 C;  1P7B A;  5JVD B;  5CBF A;  4WFB V;  4CS2 A;  1W0J G;  2WAM A;  1ZL8 A;  3AG3 C;  1HR0 B;  1XNR B;  2FB5 A;  2XND G;  3HB3 B;  2G38 A;  1MAB G;  4I50 A;  1VEW A;  3M7M X;  3J7A U;  2LFS A;  1Y67 A;  4K8X A;  5FNV A;  4JI6 B;  4GKK O;  2ZR3 A;  4JYA B;  3CC4 V;  4MVR A;  1SQP H;  1THZ A;  4J80 A;  4ZKI A;  1QHT A;  2Q67 A;  4OGQ B;  5IT9 N;  1G4Y B;  1NVP B;  5CBH A;  2ZCE A;  5JCO C;  3H1I H;  3OT7 A;  4PHZ A;  4BIZ A;  4IGG A;  2ZE8 A;  1QR9 A;  4YIP A;  5IYZ B;  3ZMT A;  1VQ4 V;  5GTI Z;  4TUY A;  1PNM A;  5BR8 O;  1XEQ A;  5CA0 B;  1OHH G;  1FAF A;  3NR7 A;  4O2B A;  1M56 C;  4B7K A;  4LFA O;  4DK0 A;  5BXZ A;  3JSN A;  1SZT A;  1XMO O;  3QO5 A;  2JDI G;  4LBE C;  3SPJ A;  1XRE A;  2HFE C;  4J41 A;  3ZHR A;  2D3O W;  2ADP A;  5FLX N;  3T1Y B;  2LFR A;  5L3B A;  1AJN A;  3FB7 C;  3RW0 A;  3JAT B;  3ZIA G;  3EHB B;  4N23 A;  1S76 D;  4JI8 B;  2EZP A;  3HKE B;  4FLX A;  4P2Z A;  3D36 A;  1Y74 A;  1BS3 A;  2FKX A;  2WPD G;  4CH6 A;  2LGW A;  2QWO B;  2YI8 A;  4QGP A;  5KHG A;  4NTX A;  4JI7 B;  2FYU H;  4LH7 A;  3Q4H A;  2JGU A;  5KA6 A;  4NKG B;  1Q8I A;  1HNW O;  2QA4 V;  5JJJ B;  2Y69 C;  3G4S V;  1AJP A;  3N2G B;  4X88 A;  5BMV A;  2LQT A;  1Q7Y W;  1JVM A;  3ZJZ A;  2IJJ A;  5IDJ A;  3QNE A;  4TWK A;  3HKC B;  5JH7 A;  5JQG B;  2ITD C;  2VQF O;  3RVZ A;  3K0D A;  2YXY A;  1S5H C;  1IXM A;  2CTW A;  3CCL V;  1R3K C;  4FLT A;  4CH4 A;  5B1N A;  1X4T A;  2F4V O;  5CBG A;  3JD2 A;  1I08 A;  4MS2 A;  2QM8 A;  3GWO A;  3UM7 A;  2HR3 A;  2ARH A;  1SQF A;  2Q9L A;  2GUZ B;  1F4M A;  4ZHQ B;  2ZM6 B;  4TV8 A;  4UB6 Z;  2IU3 A;  2BOB C;  4YJ2 B;  3DSQ A;  3B77 A;  4E2L A;  3ZCC A;  2GBO A;  3FB6 C;  4UB8 Z;  5LA6 A;  1IBM O;  3N2K A;  1ROP A;  4NYK A;  1GN3 A;  3T1H O;  2KG7 B;  1BE3 H;  3WG7 C;  5LYJ B;  2ZE5 A;  1SQB H;  4Q6G A;  3W7U A;  2K1E A;  2B9Z A;  4QE7 A;  1R6K A;  3M8A A;  4DRX B;  1R3J C;  2QWN B;  4LC1 A;  4DV1 O;  4UCR A;  1YTF D;  1R6N A;  4WFG A;  2HLD G;  1KYO F;  1VP7 A;  4DV6 O;  3CS5 A;  4DR6 O;  3ZN1 A;  1TGO A;  1XDC A;  3K3W A;  4CH3 A;  1FS0 G;  4H0L B;  2IJK A;  4B7E A;  2YEV A;  3JD1 A;  5DM6 V;  5EC2 C;  3CRC A;  3RFR A;  1Q81 W;  2K9P A;  4PDV A;  2UXC B;  3HKD B;  1BCC H;  2EIK B;  1YSC A;  4UCO A;  3E8F A;  1BQ0 A;  3SYQ A;  1Y76 A;  2QWR B;  3AG1 B;  1K97 A;  1M57 B;  1WP7 A;  5CA1 B;  5LMN O;  4FFK A;  3IJ4 A;  3K9S A;  5LXT A;  2IW5 A;  3G80 A;  3ZHT A;  5CMU A;  3OFN G;  2CTQ A;  3K58 A;  4DR4 B;  2PTM A;  5J9P C;  4O4J B;  2YIB A;  3CE2 A;  5KLV H;  4DK1 A;  2RN9 A;  4DR5 B;  5GW7 A;  3P32 A;  4JGS A;  2PZS A;  4FPP A;  1SQV H;  4PDL A;  1GRJ A;  4H13 B;  4JI0 O;  3ZX6 A;  3BA8 A;  2RDC A;  4OXS A;  3J81 N;  4LF5 B;  1NU1 H;  4GX2 A;  2UXD O;  3IFX A;  4JI5 B;  5F2V O;  3IC9 A;  1L0N H;  2XAQ A;  3E8H A;  1ZL8 B;  2ILM A;  5KAI Z;  2A79 B;  4Z2W A;  1NKD A;  3ZMS A;  2KB1 A;  4L87 A;  3THO A;  3P30 A;  4I50 B;  5JCO A;  2YS8 A;  1NTZ H;  1KQS U;  4JV5 B;  5ITZ A;  5FNV B;  3LDC A;  2BCC H;  2WWW A;  3OD4 A;  4DUZ O;  2XAF A;  2JK5 C;  4NXN O;  1KKC A;  3BCC H;  4I0X A;  4DV0 B;  3U10 A;  3UO2 A;  3CRQ A;  1AR1 B;  4BR6 A;  1AP6 A;  2DYR C;  1AR4 A;  4I5S A;  4J7Z A;  1K92 A;  2IJH A;  1WPX A;  4LF4 O;  4X1Y A;  2AHZ A;  3PJS K;  1MNG A;  5B66 Z;  1KMI Z;  3SR2 C;  2H3O A;  3EFF K;  1YJW V;  3X2Q C;  1I5Y A;  2JIZ G;  4DR3 B;  3CHX A;  1ZUQ A;  3CC7 V;  2WLM A;  2PUS A;  2AXT Z;  3G67 A;  4X89 A;  2FML A;  2RNB A;  1FKA O;  4TUY B;  5FPO A;  2Y0I A;  4BIU A;  5IJ9 A;  4O2B B;  4WBN A;  3CRR A;  4BWA A;  1N33 O;  3SJA C;  5K1P A;  4JAA A;  1H2K A;  2QTS A;  3G71 V;  4DYL A;  2DQ0 A;  5IY5 C;  1F7Y A;  1CEZ A;  2UXN A;  3TJT A;  3OW2 U;  5EYP A;  5B1A B;  2EJR A;  1NH2 D;  1JPX A;  3CME V;  1MOF A;  1TAE A;  2XHB A;  5AG2 A;  4LF8 O;  2JGD B;  4QNH B;  3JAK A;  3H1J H;  1IBL O;  1HDJ A;  1F23 A;  2LW1 A;  1WB8 A;  1Y74 B;  4JI4 B;  5IE9 A;  4B3S B;  1R1B A;  1OCR C;  5LHG A;  3RBZ A;  2P4K A;  2KSD A;  4X62 O;  2UUA O;  2YDE A;  4LF7 O;  3OMI B;  2X6C A;  1Q82 W;  3OTO O;  4J9Z B;  1N8R W;  3Q4H B;  2OIE A;  4JI1 B;  5L3F A;  4UV9 A;  4FLY A;  2M7W A;  5B1O A;  5BMV B;  5C93 A;  4LF9 B;  4ZI7 A;  4DR6 B;  4H33 A;  4JYY A;  4F4L A;  1ZTE A;  3OR6 C;  1HNX B;  3I55 V;  2WLH A;  5JH7 B;  3OR7 C;  2HJD A;  1W59 A;  3FX7 A;  1L8D A;  3FFQ A;  1SRY A;  3I56 V;  1R73 A;  1AP5 A;  4PEL A;  2XAJ A;  4OX9 O;  2Y48 A;  2ZIM A;  1VQ6 V;  2EIL B;  4JI2 B;  5LMN B;  2JS3 A;  4PA3 A;  1HW7 A;  5B3S B;  4AI8 A;  2GV9 A;  3K03 A;  1M9N A;  4OPA A;  4JZ2 A;  5KHJ A;  3E86 A;  3RGB A;  1BT8 A;  3OUS A;  1I7F A;  1NQT A;  2HEP A;  1AJQ A;  5C8Y A;  2MW2 B;  2KG7 A;  2OCC B;  4TV8 B;  1AI6 A;  3MDS A;  2QR4 A;  3A8T A;  2A3Q A;  4EB6 A;  2XT9 A;  5LA6 B;  2B1I A;  4B3M B;  3E8G A;  1NBM G;  3A0B Z;  1T5E A;  1WP8 A;  4MW3 A;  4D6T H;  3N2K B;  3QF7 A;  1SZX A;  2M6Y A;  2UXD B;  1ZX3 A;  2E74 B;  2ZIO A;  4WFA V;  1SET A;  1N34 O;  1OCC B;  1B04 A;  5IYC O;  2NNU A;  5EZY A;  3W7W A;  3CCE V;  2E75 B;  1ORQ C;  2XAH A;  3ABK C;  4EEQ A;  3LNM B;  4DV7 O;  4I9Q A;  4DW0 A;  2P67 A;  4CS4 A;  3W7T A;  1DF5 A;  4DV5 O;  4B08 A;  1QNM A;  1VQM V;  4DUZ B;  3CD6 V;  3BEH A;  4X66 B;  4YXW G;  4MT8 A;  1VQ7 V;  1Q6I A;  3FAV A;  2JS5 A;  4PI2 A;  4LFC B;  1IBK O;  1N0J A;  2YEV B;  2ITC C;  2DOS A;  1MG1 A;  4GUN A;  1NTM H;  2IBZ H;  5JWP A;  1NTK H;  1Y66 A;  1Y76 B;  3OMA B;  1K4C C;  2P4V A;  3RVY A;  2DMX A;  1EFR G;  2AGA A;  2QSA A;  1V55 C;  5LXT B;  2P6J A;  4FM2 A;  4FM0 A;  2F95 B;  4MVQ A;  1J5E B;  2ODM A;  3ASN C;  1W0K G;  5JJE B;  1Q86 W;  3AG3 B;  2EZO A;  2YIC A;  4O4L A;  1ZAU A;  2LO1 A;  1F51 A;  2XUM A;  1FJG O;  1N32 O;  2F43 G;  1EN6 A;  1FXK C;  2VQE B;  1Z2G A;  2EIM C;  5H5N A;  5LBQ A;  1U97 A;  2LP7 A;  3CCQ V;  3ZMU A;  4DV3 B;  4MVM A;  3BRC A;  1AR5 A;  3HKB A;  2ZXW C;  3CCR V;  1R3I C;  4GX0 A;  4GX5 A;  4QPK A;  3TXQ A;  3JAW A;  1M1K W;  2EIJ C;  1EBO A;  1D5N A;  2JJ1 G;  3ABM C;  5H6Q A;  4B3R B;  4B3T O;  1XNQ O;  2Z0A A;  3G6B A;  4U7O A;  1KEC A;  2IU0 A;  1XOU A;  2QKA A;  4R6Z A;  1KUQ A;  4MVZ A;  5ITZ B;  2PYL A;  3SJC C;  4QPJ A;  4RO2 A;  4FLZ A;  4LF7 B;  2Q7H A;  4UUJ C;  4I0X B;  1SS3 A;  2E5L O;  4DV4 O;  2UXB O;  2Y4T A;  3K06 A;  3UT5 A;  3CC2 V;  3OTF A;  4HYO A;  4IIJ A;  1M56 B;  4DO2 A;  4MVU A;  4X1Y B;  1WAZ A;  3W7X A;  4X65 O;  2YID A;  2QWP B;  4LFB O;  5LGN A;  2L6L A;  4YHH B;  4QJF B;  3R65 A;  2OTJ V;  4G28 B;  4FMT A;  4FLU A;  4W4L A;  1BGY H;  2RQ6 A;  4DV2 B;  3W7S A;  1QR8 A;  4CC5 A;  4P9O A;  1NH2 B;  5IJ9 B;  1YXB A;  3FB5 C;  1VF7 A;  1FFT B;  3AEI A;  5TIS Z;  4WBN B;  3JD3 A;  1ZLZ A;  2EIN B;  4FFB A;  2GTS A;  1URF A;  4JTC B;  2QTO A;  1O9G A;  1CPY A;  2JGD A;  2YC0 A;  3DXR B;  1FXV A;  4YJ3 B;  3ETQ A;  2EX3 A;  2EIN C;  1I94 O;  2CUG A;  3OE7 G;  3E35 A;  2H94 A;  3L71 H;  1Y6X A;  3PN1 A;  2ZKO A;  4GLX A;  4BAY A;  1IZ3 A;  4KP4 A;  5EYP B;  2NN4 A;  2DQ3 A;  2DN9 A;  4ZIB A;  3CYO A;  3DC6 A;  3JAK B;  4FJC C;  2RCV A;  2Y69 B;  1GH6 A;  4J7K A;  3CCM V;  3H1K H;  2A0L A;  4CBC A;  1XBL A;  5LHI A;  4FM1 A;  4GT1 A;  2IJI A;  4U3J A;  4UVB A;  3JCU Z;  1N34 B;  4P30 A;  2WLK A;  3BY6 A;  3STZ C;  5E79 Z;  1SA0 B;  1TUE B;  2V4D A;  1Q5O A;  1EZJ A;  1PKX A;  3ZRX A;  2W6I G;  2ZNI A;  4NR1 A;  4ZI7 B;  2HHH B;  3LDE A;  2WA4 A;  1XMQ O;  1VF5 B;  3LSU A;  4IYI A;  3D3Q A;  3CPW U;  3UKM A;  4DR1 O;  3SJB C;  1JJO A;  1EM1 A;  3ICX A;  4HBN A;  1NS1 A;  1XIL A;  3B4S A;  4J10 A;  4UCV A;  3LSS A;  2QEX V;  3AG2 C;  1QLE C;  4N21 A;  2Q5Z A;  4KXR A;  4IHJ A;  3JD4 A;  2O57 A;  4Z1V A;  1DGS A;  3NXS A;  2EBO A;  1XL4 A;  4PI0 A;  1GM9 A;  3WG7 B;  4X1I A;  4X64 B;  2WLN A;  4MTX A;  5KX5 A;  5C8Y B;  2OT5 A;  1SER A;  4DR2 O;  2DWE C;  1OCZ C;  1JFF A;  3LUT B;  4FZ1 A;  1L1F A;  2BSK B;  2Z3Y A;  5KA5 A;  4EB6 B;  4L8J A;  3OEH G;  2P5O A;  3JSL A;  1GK9 A;  3VQV A;  1EZV H;  4GKK B;  3M99 B;  3RYH A;  2WLI A;  5EZY B;  1LUW A;  1NT2 B;  1JX9 A;  1TUB A;  3B40 A;  4XDK A;  2R9R B;  3ZS8 C;  2BTQ A;  2NR5 A;  4A5U B;  5KMG A;  1DK1 A;  1YEW A;  3E89 A;  5D5Q A;  2H8P C;  5H6R A;  3BAA A;  5L3C A;  1SQQ H;  4DV4 B;  4DUY O;  3FAV B;  2FTK A;  4X20 A;  5L3D A;  1PL0 A;  3BAB A;  4U7N A;  2JEU A;  1A32 A;  4BW9 A;  5BR8 B;  4BW5 A;  3G6E V;  5KHH A;  4PA9 A;  3VQX A;  4TV9 A;  2NLJ C;  2F66 C;  1VAR A;  4LFA B;  1FXK A;  4UV8 A;  4O4I A;  5IWA O;  3T4D A;  4EKW A;  1RM1 B;  1XMO B;  4X1K A;  5EBL C;  1ZSP A;  1WNS A;  3KCY A;  4U3F H;  2UU9 O;  2UUC O;  4ZBM A;  1RM1 C;  2N74 A;  1TA8 A;  3JAL A;  1OCO C;  4XBF A;  4ASU G;  4KL1 A;  3ZED A;  4QE9 A;  4LP8 A;  5GON A;  2QKC A;  4O4L B;  4YY3 O;  2X6A A;  3JYC A;  4RQF A;  3UQ8 A;  4TQD A;  3B2E E;  5A9G A;  2QDO A;  2AZ2 A;  5H2F Z;  1Z5V A;  4JPR A;  2Q7E A;  3HKB B;  1UPG A;  5LP6 C;  1P7G A;  1B06 A;  2OIG A;  3JAW B;  1YJ9 V;  2HKO A;  1K7D A;  3ZHU A;  3H1H H;  3OMN B;  2DYR B;  2ZDI C;  4FLW A;  2HP8 A;  2D2C B;  4UFZ A;  4KFM A;  3MHH C;  2CGN A;  3QTC A;  1HNW B;  4MVO A;  3X2Q B;  1YZB A;  5A2Q N;  4FIP C;  1L0L H;  3AG4 C;  4F6E A;  1RSO A;  3SYC A;  3SPI A;  3CEI A;  1XI1 A;  4D7S A;  1YIJ V;  3EVK A;  3UT5 B;  3BVO A;  4IIJ B;  3P3P A;  4XDL A;  1I5X A;  1S5J A;  2VQF B;  3ABL C;  4GKJ O;  2KKW A;  5L3E A;  3CCS V;  3ASO B;  1H2L A;  2ZE6 A;  3CRA A;  1K9M W;  2F4V B;  1K3E A;  1ENV A;  1NI8 A;  5IY5 B;  2AW9 A;  4K35 A;  3ETE A;  3ASO C;  3L73 H;  3DXR A;  2ZD9 A;  4YJ3 A;  4DR1 B;  3GWK C;  3SGI A;  3VQW A;  1TVK A;  2UUB O;  1YCI A;  4ZOL A;  1CXZ B;  5LMU O;  4WCE V;  2GHY A;  4FFB B;  2Q8V A;  3WB0 A;  4NB5 A;  2AHY A;  3N27 A;  1QBZ A;  3ZHQ A;  3MAQ A;  1OCR B;  1HR0 O;  2LGQ A;  1XNR O;  1PP9 H;  3ETG A;  3FYI B;  3CCV V;  3I5D A;  1BL8 A;  1IBM B;  3K04 A;  1KP3 A;  3ZRV A;  5DED A;  3AG7 A;  4JI6 O;  4GYC B;  1MMM A;  4JYB A;  5CA3 A;  3T1H B;  1M4U A;  1XQ8 A;  5DEC A;  3OM3 B;  3VOU A;  1SA0 A;  5HFL A;  3ZMV A;  4CS3 A;  4DV1 B;  1JJ2 U;  3LNN A;  5E1A C;  3R66 A;  4U3J B;  4XDJ A;  3JAM N;  4DV6 B;  4GX1 A;  5LOV A;  2CTR A;  2V1D A;  2W0F C;  3O65 A;  3SPC A;  1R3L C;  3RYC B;  1D2D A;  4E4E A;  4O2A A;  5CB4 A;  3SYP A;  1S5L Z;  4JTD B;  1FPO A;  4TSF G;  2WSS G;  1HNZ O;  2HVJ C;  5EIB C;  1P84 F;  4QIW F;  2XTA A;  3WFV A;  3CSX A;  4TOI A;  4JF3 A;  4UCU A;  2GDS A;  3T1C A;  3K5N A;  4BIO A;  5L3G A;  1V54 C;  3SJQ C;  1MZE A;  1VQ9 V;  3T1Y O;  2F23 A;  2X6B A;  3HR0 A;  1E79 G;  1YF2 A;  1YHQ V;  2YSU B;  2BSK A;  2OTL V;  4IHJ B;  2ETN A;  1YTF B;  1GO3 F;  4JI0 B;  1LR1 A;  4PA7 A;  2P90 A;  4X1I B;  1VQK V;  1G1X B;  5KX5 B;  3ABK B;  1G6U A;  2XAG A;  2C2A A;  3CP1 A;  4EFB A;  1YJN V;  1H8E G;  1JFF B;  4WFE A;  3CJH A;  3A0R A;  3SPH A;  2ATK C;  4HNA A;  4I9W A;  3WU2 Z;  3RYH B;  4UVC A;  1GN6 A;  3KKY A;  3MHS C;  4RAI A;  4NXN B;  1E1Q G;  2WLI B;  2W0X A;  1TUB B;  1FD9 A;  2DYS C;  1GTO A;  2CAZ C;  2BTQ B;  3ABT A;  4LWS A;  5KMG B;  5JJN B;  4RWU A;  1BSM A;  4LF4 B;  1GN2 A;  2LJ2 A;  2L35 A;  3CX5 F;  4PA6 A;  1XHZ A;  1V55 B;  3TET A;  5KHI A;  2QKS A;  4X20 B;  1KKD A;  2HVK C;  3ASN B;  4D7T A;  1D5A A;  3K79 A;  4OPH A;  4GCZ A;  4TV9 B;  4PV1 B;  1FXK B;  1N33 B;  1JQ0 A;  2Y4U A;  4O4I B;  2ZM6 O;  2CH7 A;  2EIM B;  4X1K B;  1K4D C;  4PA4 A;  1PM9 A;  3TGU H;  3L9D A;  3L74 H;  3HPL C;  5J2U A;  2ZXW B;  2A06 H;  5LP6 A;  3JAL B;  2EIJ B;  2XOK G;  5LMU B;  2ZDI A;  2FL4 A;  3ABM B;  5GON B;  5KHK A;  2PYJ A;  2E76 B;  4MW8 A;  3ZBH A;  3K57 A;  1MZF A;  1H2S B;  4LF8 B;  1MSW D;  1K5Q A;  1IBL B;  4JTA B;  4PDR A;  1Z5W A;  2DE0 X;  2Z5U A;  1RPR A;  1S77 D;  1QQC A;  1S3J A;  2R72 A;  1N36 O;  2CE4 A;  4I55 A;  4JAU A;  4X62 B;  1GM7 A;  1BQZ A;  1VQO V;  2UUA B;  1IX9 A;  1K34 A;  2YXH A;  3JAS A;  3OTO B;  3ZRS A;  5EK0 A;  3DC5 A;  3P3N A;  1GKF A;  4RUE A;  2EJ7 A;  3K08 A;  1QVF U;  2DJV A;  2BOC C;  3E22 A;  1VMG A;  2VRZ A;  1WJZ A;  3D3I A;  3C90 A;  2UXC O;  3F7Y C;  1RSO B;  2YI9 A;  3CMA V;  3CWB H;  2R70 A;  4LF6 O;  5H9C A;  2VS0 A;  3ZMZ A;  3TCU A;  2YUA A;  4AQY O;  5IJ0 B;  3F5W C;  3U0Z A;  2DW4 A;  3L70 H;  3K0G A;  2QM7 A;  4HZ3 A;  4DR4 O;  3S3X A;  3GVM A;  4OX9 B;  3J80 N;  1HNZ B;  1W2B U;  1CP9 A;  2CTP A;  4DR5 O;  4MVS A;  1SF9 A;  1JCH A;  3AK2 A;  4MTG A;  1WA8 A;  2QE7 G;  1KB9 F;  4R50 A;  2ZE7 A;  4P9P A;  4JZG A;  4H44 B;  1TVK B;  1AI4 A;  3KCX A;  2Q68 A;  4CZZ A;  4I4T A;  4WF9 V;  4ZOL B;  1KC8 W;  4LF5 O;  5IYB O;  1KD1 W;  3CXC U;  4YIO A;  2GSM B;  4JI5 O;  1ARO P;  1SC5 B;  5D5P A;  1ZWI C;  4JYC A;  2HJF C;  3E83 A;  2QGN A;  1VQ5 V;  1JA8 A;  1FFX A;  2QWQ B;  3QO7 A;  4JAV A;  4JV5 O;  3AK3 A;  4Q20 A;  5KAF Z;  4NXM O;  3SPG A;  4LNU A;  2R9A A;  5EBW C;  4FLV A;  1VF6 C;  1QCE A;  4DV0 O;  1FXH A;  3WB1 A;  1AB3 A;  2OWO A;  3IAY A;  2Q69 A;  1WB7 A;  2WLL A;  4DV7 B;  5KUK A;  3RYC A;  4J7J A;  1OZ0 A;  4O4H A;  4DV5 B;  2Q0O C;  1O9H A;  5FL7 G;  4X9Q A;  1DLB A;  2P22 C;  4J42 A;  5LOV B;  1K73 W;  3CXH F;  1NZ6 A;  4DR3 O;  3ETD A;  1IBK B;  2BTO A;  5KUM A;  4CC6 A;  4O2A B;  1Y4M A;  5CB4 B;  1BMF G;  5FPR A;  3AG2 B;  1AI7 A;  1QLE B;  3ZN0 A;  5EIB D;  3B8M A;  2JVD A;  2P7T C;  5HFM A;  1IUR A;  5DN6 G;  1M5I A;  4DXW A;  1JOY A;  3RN4 A;  1OCZ B;  3FYE B;  1UFI A;  3F5T A;  3JAR A;  1NR1 A;  3IC7 A;  2XAS A;  4KHP O;  2A9H A;  1FJG B;  1N32 B;  3DGE A;  2CK3 G;  1PPJ H;  1AVM A;  3APQ A;  2X7R B;  1VIB A;  1DTO A;  4G27 B;  2YIA A;  2Q0A A;  3RYI A;  4B3S O;  4JI4 O;  4DR7 O;  4HAM A;  4DW1 A;  1IVS A;  1EN5 A;  4W4K A;  3RT3 C;  3B09 A;  2OYQ A;  1V9P A;  1YI2 V;  1I0H A;  3CJH B;  3ZRW A;  4B3T B;  4HNA B;  1XNQ B;  2Q6A A;  3EXA A;  2MK3 A;  4GZR B;  4R8C A;  4JI1 O;  3E2E A;  1VQL V;  1N36 B;  4Z1M G;  3A0H Z;  5BZB A;  4LF9 O;  4J9Y B;  1LUV A;  2E3C A;  2E5L B;  5EC1 C;  4F6R A;  1US6 A;  1KBH A;  2UXB B;  3K5L A;  1SQG A;  1VQN V;  1KU9 A;  2F93 B;  1PL4 A;  3CRM A;  4LWS B;  1HNX O;  1MA1 A;  3H1L H;  4RUF A;  2ZIN A;  4X65 B;  5GTH Z;  3F7V C;  1Q90 D;  4LFB B;  4FK5 C;  1Q43 A;  3RYF B;  1WN7 A;  4LF6 B;  5J2T A;  3AK1 A;  4JI2 O;  2EIK C;  1OCO B;  1NJI W;  4K3A A;  4AQY B;  1H8H G;  1GAX A;  1WLE A;  4K0K O;  4MTO A;  3AG1 C;  3BPZ A;  1P49 A;  1M57 C;  1DF4 A;  5LL6 Y;  4C7U A;  3UO3 A;  1BZK A;  3D8C A;  3QO8 A;  2CH7 B;  4NTW A;  5JVD A;  4AHC A;  2Y0P A;  1SES A;  5J2U B;  5B5E Z;  2AZ0 A;  3ML0 A;  1I94 B;  2YXL A;  5LP6 B;  4B3M O;  1U96 A;  1Q6U A;  3BHP A;  3TXS A;  2IM9 A;  5B1B B;  1PD3 A;  1S0V A;  2VWJ A;  3UCS C;  2YIB D;  3B8N A;  4ICG A;  4AIL C;  4I7Z B;  5B1B C;  1E1R G;  4PDM A;  3AG4 B;  3FB8 C;  4NXM B;  1EN4 A;  4I55 B;  1M93 A;  3KG2 A;  3K5O A;  4X66 O;  4JI3 O;  1PNL A;  3JAS B;  2JRI A;  3ABL B;  2QJ1 A;  3JCZ A;  5IYZ A;  3T4Z A;  4LFC O;  1H2N A;  1HP8 A;  5IJ0 A;  3E22 B;  5CA0 A;  2PY5 A;  2W6J G;  4IT5 A;  1UJW B;  1K33 A;  2RJZ A;  3OUF A;  1XMQ B;  2RMK B;  4NVP A;  4KUM A;  1NVP D;  4K8Z A;  1LNQ A;  3SYO A;  2IH1 C;  2N05 A;  2N04 A;  1K5S A;  3QG5 A;  1PNK A;  1GM8 A;  1WPB A;  1P4R A;  2CDY A;  1J5E O;  1K8A W;  2QM4 A;  1KP2 A;  3SDL A;  3A2F A;  3JAT A;  1YIT V;  4TQF A;  3OAA G;  1WA8 B;  2EUL A;  3KZI Z;  2B5U A;  3HKE A;  2VQE O;  3STL C;  4I4T B;  4ABM A;  5LHH A;  4DV3 O;  3CB2 A;  1OJH A;  1VF6 A;  1Q3E A;  5LGU A;  4RQE A;  3L75 H;  3E8B A;  4DR2 B;  4KHP B;  2WLJ A;  4WFH A;  4JYA O;  1XUQ A;  1JMK C;  5B1A C;  4B3R O;  1SKV A;  3LSQ A;  1FFX B;  4DR7 B;  3S3W A;  1H2M A;  3OGI B;  1S72 V;  5CN0 A;  3K5M A;  3N2G A;  3D36 C;  2R9I A;  4J11 A;  2X0L A;  2KQX A;  4LNU B;  4PJ0 Z;  4H37 A;  3K59 A;  1HWY A;  4EFE A;  1B3Q A;  2PI4 A;  1X59 A;  4IL6 Z;  3FKS G;  3VBB A;  1GN4 A;  2WLL B;  3K9A A;  2P06 A;  3HKC A;  5JQG A;  4R7C A;  2ZR2 A;  3OEE G;  4O4H B;  3BA9 A;  3CCU V;  1COW G;  1IDS A;  3LDD A;  4YHH O;  4DUY B;  1F4N A;  1FYJ A;  5LGT A;  1XL6 A;  1NR7 A;  2Q73 A;  1V54 B;  1G8M A;  4DV2 O;  4LCU C;  3BFR A;  2GUZ A;  1N0N A;  2CGO A;  4ZHQ A;  2LW7 A;  5IWA B;  1SQX H;  3GB7 C;  1AIL A;  4UCS A;  5BY1 A;  1QLN A;  3L72 H;  3CCJ V;  4YJ2 A;  2UU9 B;  2Q7G A;  4K0K B;  2UUC B;  2JEX A;  2GTA A;  4JI8 O;  1RP3 B;  3T2M A;  3O9O A;  2EIL C;  1BHB A;  2PF4 E;  3ABU A;  5B3S C;  4MTF A;  3TK1 A;  3JAR B;  1RFY A;  4YY3 B;  1IXB A;  2B1G A;  4TT3 G;  3C3S A;  1PV0 A;  4MSW C;  1XHX A;  3JD0 A;  5LYJ A;  5K1X A;  3VQY A;  4JI7 O;  4JAS A;  1R6T A; 
#chains in the Genus database with same CATH homology
 2OCC C;  3OEH G;  5IYD O;  2ZQM A;  1GK9 A;  3F5W C;  2DW4 A;  3K0G A;  2QM7 A;  4BIU A;  3SYA A;  4HZ3 A;  2JJ2 G;  3M99 B;  2DYS B;  2UXX A;  1W2B U;  1CP9 A;  2WLI A;  1JX9 A;  3ZRW B;  4MVS A;  1JCH A;  4MTG A;  4XDK A;  2R9R B;  2QE7 G;  4R50 A;  1OCC C;  4UVA A;  3G71 V;  3H01 A;  4P9P A;  1VQ8 V;  2DQ0 A;  5IY5 C;  1CEZ A;  1AI4 A;  1VQP V;  3E89 A;  2Q68 A;  3IGA C;  4CZZ A;  2H8P C;  2UXN A;  5H6R A;  4WF9 V;  1KC8 W;  3OW2 U;  5IYB O;  5B1A B;  1QVG U;  1KD1 W;  5EBM C;  5L3C A;  3CXC U;  2EJR A;  1NH2 D;  1JPX A;  2GSM B;  3CME V;  2V7Q G;  1ARO P;  1MOF A;  1J95 A;  3OGC C;  1H38 A;  2DWD C;  1ZWI C;  4QNH B;  2FTK A;  4JYC A;  5L3D A;  1PL0 A;  4U7N A;  2JEU A;  1F23 A;  3MD0 A;  2HJF C;  3E83 A;  4X8A A;  1M90 W;  1VQ5 V;  1BHA A;  4JAV A;  3QO7 A;  2HG5 C;  4BW5 A;  3G6E V;  4Q20 A;  1OCR C;  4UXN A;  5LHG A;  3SPG A;  4PA9 A;  3RBZ A;  2NLJ C;  1FXK A;  4UV8 A;  4WFF A;  3T4D A;  3OMI B;  4EKW A;  1RM1 B;  5EBW C;  2X6C A;  1QCE A;  4G2K A;  5EBL C;  1Q82 W;  1AI5 A;  1FXH A;  4J9Z B;  1RPO A;  1N8R W;  1B6Q A;  2Q69 A;  4ZBM A;  2WLL A;  5KUK A;  1RM1 C;  1H2G A;  1OZ0 A;  5L3F A;  3DTU B;  1OCO C;  2PI5 A;  4XBF A;  4ASU G;  4UV9 A;  2M7W A;  4QE9 A;  5B1O A;  1GMG A;  4LP8 A;  5C93 A;  5FL7 G;  1DLB A;  2IH3 C;  1P7B A;  4H33 A;  2X6A A;  5CBF A;  4WFB V;  1K73 W;  4F4L A;  3JYC A;  1W0J G;  2WAM A;  4RQF A;  3OR6 C;  3ETD A;  3AG3 C;  3I55 V;  2WLH A;  2XND G;  3HB3 B;  5KUM A;  1MAB G;  3OR7 C;  1Y4M A;  4JPR A;  2LFS A;  1BMF G;  3AG2 B;  1AI7 A;  1SRY A;  3I56 V;  1QLE B;  1YJ9 V;  1R73 A;  4PEL A;  3ZN0 A;  2XAJ A;  2HKO A;  2Y48 A;  1K7D A;  2ZR3 A;  1VQ6 V;  2EIL B;  3CC4 V;  3B8M A;  3OMN B;  2ZDI C;  2DYR B;  4PA3 A;  4MVR A;  2P7T C;  1THZ A;  5B3S B;  5HFM A;  3K03 A;  1M9N A;  4KFM A;  3MHH C;  4ZKI A;  5DN6 G;  4DXW A;  2Q67 A;  1JOY A;  3E86 A;  4MVO A;  3X2Q B;  1G4Y B;  1OCZ B;  3FYE B;  3OUS A;  1NVP B;  5CBH A;  1NQT A;  4FIP C;  1AJQ A;  3AG4 C;  1NR1 A;  3IC7 A;  2XAS A;  3SYC A;  2OCC B;  3SPI A;  4BIZ A;  1AI6 A;  2A9H A;  1YIJ V;  1QR9 A;  3DGE A;  3ZMT A;  2CK3 G;  1VQ4 V;  4XDL A;  1I5X A;  2B1I A;  3E8G A;  1NBM G;  2X7R B;  1PNM A;  1DTO A;  3ABL C;  4G27 B;  4MW3 A;  1OHH G;  4HAM A;  5L3E A;  3CCS V;  3ASO B;  1M56 C;  4WFA V;  1SET A;  1K9M W;  1OCC B;  1K3E A;  1ENV A;  5IYC O;  2NNU A;  1YI2 V;  3W7W A;  3CCE V;  1SZT A;  1ORQ C;  5IY5 B;  2XAH A;  3ABK C;  3ZRW A;  3ETE A;  3ASO C;  3QO5 A;  2ZD9 A;  2Q6A A;  2JDI G;  4LBE C;  3SPJ A;  3LNM B;  2MK3 A;  2HFE C;  4R8C A;  3E2E A;  2P67 A;  1VQL V;  3W7T A;  1DF5 A;  4Z1M G;  2D3O W;  1VQM V;  5BZB A;  4WCE V;  2LFR A;  3CD6 V;  5L3B A;  1AJN A;  2GHY A;  3BEH A;  3FB7 C;  4J9Y B;  4YXW G;  4MT8 A;  3RW0 A;  3ZIA G;  3EHB B;  1VQ7 V;  5EC1 C;  2AHY A;  4N23 A;  1S76 D;  1QBZ A;  1VQN V;  2EZP A;  1OCR B;  3ETG A;  2YEV B;  3FYI B;  4RUF A;  4P2Z A;  3CCV V;  3D36 A;  1BL8 A;  2ITC C;  3K04 A;  2WPD G;  3F7V C;  1KP3 A;  3ZRV A;  1MG1 A;  4FK5 C;  5CA3 A;  4JYB A;  1Y66 A;  3OMA B;  1K4C C;  3RVY A;  2EIK C;  1OCO B;  1NJI W;  1EFR G;  1H8H G;  1WLE A;  1V55 C;  3OM3 B;  4MTO A;  3VOU A;  5KA6 A;  2P6J A;  5HFL A;  3AG1 C;  3ZMV A;  1M57 C;  1DF4 A;  1JJ2 U;  2QA4 V;  4MVQ A;  5E1A C;  2Y69 C;  3G4S V;  1AJP A;  3ASN C;  1W0K G;  4X88 A;  4XDJ A;  1Q86 W;  3AG3 B;  3QO8 A;  2EZO A;  1Q7Y W;  4GX1 A;  1JVM A;  3ZJZ A;  1F51 A;  2V1D A;  2IJJ A;  2W0F C;  1SES A;  5IDJ A;  2F43 G;  1FXK C;  3QNE A;  3ML0 A;  3SPC A;  1R3L C;  4TWK A;  2EIM C;  5LBQ A;  2LP7 A;  3CCQ V;  2ITD C;  3RVZ A;  3ZMU A;  3K0D A;  1S5H C;  1IXM A;  4MVM A;  3SYP A;  3CCL V;  1R3K C;  2ZXW C;  3CCR V;  1R3I C;  4GX0 A;  4GX5 A;  4QPK A;  4JTD B;  5B1N A;  1M1K W;  4TSF G;  2WSS G;  5B1B B;  1PD3 A;  2EIJ C;  1S0V A;  2HVJ C;  1EBO A;  4QIW F;  5CBG A;  2JJ1 G;  3JD2 A;  3ABM C;  3B8N A;  5H6Q A;  3WFV A;  4MS2 A;  5B1B C;  2QM8 A;  1E1R G;  4U7O A;  3GWO A;  1KEC A;  4JF3 A;  2IU0 A;  3UM7 A;  2HR3 A;  4PDM A;  3AG4 B;  4R6Z A;  3T1C A;  3FB8 C;  4MVZ A;  1F4M A;  4QPJ A;  5L3G A;  1V54 C;  4RO2 A;  3SJQ C;  1VQ9 V;  2X6B A;  3KG2 A;  1E79 G;  4UUJ C;  1YHQ V;  1PNL A;  2IU3 A;  2BOB C;  2YSU B;  3ABL B;  3B77 A;  4E2L A;  3ZCC A;  2OTL V;  3JCZ A;  3K06 A;  1YTF B;  3T4Z A;  3CC2 V;  4HYO A;  3FB6 C;  1GO3 F;  1M56 B;  4DO2 A;  4MVU A;  4PA7 A;  2P90 A;  3W7X A;  1VQK V;  1ROP A;  2W6J G;  1UJW B;  3ABK B;  2XAG A;  2C2A A;  3CP1 A;  1YJN V;  5LGN A;  1K33 A;  4QJF B;  3OUF A;  3R65 A;  1H8E G;  3WG7 C;  2OTJ V;  4KUM A;  1NVP D;  4WFE A;  4G28 B;  3A0R A;  3SPH A;  2ATK C;  4I9W A;  4FMT A;  1LNQ A;  3SYO A;  2IH1 C;  3W7U A;  1K5S A;  2K1E A;  1PNK A;  3W7S A;  1GM8 A;  1R6K A;  4QE7 A;  1QR8 A;  1R3J C;  4LC1 A;  4P9O A;  1P4R A;  1NH2 B;  3FB5 C;  1YTF D;  1R6N A;  4WFG A;  4UVC A;  3AEI A;  1FFT B;  2HLD G;  3JD3 A;  3MHS C;  4RAI A;  1E1Q G;  1K8A W;  2WLI B;  1KP2 A;  2EIN B;  3ZN1 A;  1YIT V;  3K3W A;  4JTC B;  2DYS C;  1GTO A;  3OAA G;  2QTO A;  1CPY A;  1FS0 G;  1FXV A;  3ABT A;  2B5U A;  2IJK A;  2EIN C;  2YEV A;  3STL C;  3OE7 G;  3JD1 A;  3E35 A;  2H94 A;  5DM6 V;  5EC2 C;  5LHH A;  4BAY A;  1Q81 W;  4KP4 A;  4PDV A;  2EIK B;  1YSC A;  5LGU A;  4RQE A;  3E8B A;  4PA6 A;  3E8F A;  1V55 B;  2DQ3 A;  2WLJ A;  4WFH A;  3SYQ A;  3AG1 B;  3CYO A;  3TET A;  1K97 A;  1M57 B;  4FJC C;  5B1A C;  2QKS A;  1KKD A;  2HVK C;  2Y69 B;  3LSQ A;  3CCM V;  3ASN B;  2A0L A;  2IW5 A;  4CBC A;  5CMU A;  3OFN G;  5LHI A;  3K79 A;  4GCZ A;  5J9P C;  1S72 V;  4GT1 A;  2IJI A;  5CN0 A;  4UVB A;  1FXK B;  1JQ0 A;  2R9I A;  2X0L A;  2EIM B;  4H37 A;  3P32 A;  4JGS A;  4P30 A;  1K4D C;  1HWY A;  4PA4 A;  2WLK A;  5GW7 A;  3BY6 A;  3STZ C;  2PI4 A;  3HPL C;  3FKS G;  4FPP A;  2ZXW B;  3VBB A;  4PDL A;  2WLL B;  3K9A A;  1TUE B;  4R7C A;  2ZR2 A;  3OEE G;  1EZJ A;  2EIJ B;  1PKX A;  2XOK G;  3CCU V;  4OXS A;  3ZRX A;  2ZDI A;  1COW G;  2W6I G;  3ABM B;  4GX2 A;  3IFX A;  3LDE A;  3LDD A;  4MW8 A;  1F4N A;  2XAQ A;  3E8H A;  1MSW D;  5LGT A;  1XL6 A;  1K5Q A;  1NR7 A;  2A79 B;  4JTA B;  4PDR A;  3CPW U;  2Z5U A;  1NKD A;  3UKM A;  3ZMS A;  1RPR A;  1V54 B;  1G8M A;  2KB1 A;  4L87 A;  3P30 A;  4LCU C;  1S77 D;  1KQS U;  1S3J A;  3LDC A;  4JAU A;  2WWW A;  1GM7 A;  1VQO V;  2XAF A;  2JK5 C;  3GB7 C;  1K34 A;  3LSS A;  2QEX V;  3AG2 C;  1QLN A;  3CCJ V;  3ZRS A;  1QLE C;  4N21 A;  5EK0 A;  1AR1 B;  2JEX A;  3JD4 A;  1GKF A;  3T2M A;  4RUE A;  2EIL C;  3NXS A;  3K08 A;  2DYR C;  4I5S A;  1QVF U;  2EBO A;  1K92 A;  1BHB A;  2IJH A;  1XL4 A;  1WPX A;  2BOC C;  1GM9 A;  3WG7 B;  2AHZ A;  3ABU A;  3PJS K;  2WLN A;  5B3S C;  4MTX A;  3D3I A;  4MTF A;  3TK1 A;  3F7Y C;  3EFF K;  2OT5 A;  1YJW V;  1SER A;  2DWE C;  3CMA V;  2B1G A;  4TT3 G;  3X2Q C;  1OCZ C;  1I5Y A;  2JIZ G;  3LUT B;  5H9C A;  4MSW C;  1L1F A;  3JD0 A;  3ZMZ A;  2Z3Y A;  3CC7 V;  2WLM A;  5KA5 A;  3TCU A;  4JAS A;  4X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...