3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
3IJ4A 4NTXA 2FB5A 1WP8A 2L35A 4FZ0A 4FZ1A 3S3WA 4NYKA 3N27A 1WP7A 2QTSA 4NTYA 3S3XA 4NTWA
chains in the Genus database with same CATH superfamily
2ITDC 1R6KA 1MG1A 1S5JA 4JI8O 1IZ3A 3T2MA 1MZEA 1V55C 5B5EZ 2XAQA 1BHAA 2Y4UA 1FXVA 2Q67A 4KHPO 2ARHA 1XHXA 2ATKC 4TQFA 1YTFB 5JQGA 1Y74A 3DSQA 2PUSA 5KAFZ 3H1HH 3K9SA 4DR6O 1TVKB 1RP3B 2HP8A 3E2EA 4LF7O 3MHSC 3RVZA 3WFVA 1Y6XA 5H6QA 3ABTA 3L75H 1B6QA 4IHJB 3OR6C 5LGTA 2QWNB 4NYKA 4JZ2A 1IURA 4JI5B 4FM2A 4DR3O 3RYCA 1BT8A 3UKMA 3IAYA 1FXKB 1JFFA 2BE3A 3T1YO 1ZUQA 3L73H 4RUFA 2ZCEA 4TT3G 1KP2A 4GYCB 2ODMA 4I9QA 2CTQA 2ZNJA 3ASOC 3BA8A 4WFAV 4DV5O 2JEXA 1W0JG 2ADQB 1AJQA 3VQVA 4K0KB 3HKCB 1KB9F 1S5HC 4O2AA 2HR3A 2IJHA 2YUAA 3QO5A 2DQ0A 3B4SA 1R3LC 4NR1A 4X1IA 4B7EA 1DK1A 1IVSA 4X20B 1L0NH 1HDJA 3HPLC 4LF6B 3BABA 3BPZA 1OJHA 2GUZB 4PDRA 3BY6A 5JCOC 4J7JA 2R9IA 3JALB 3CXCU 2XAGA 5KHHA 1HP8A 1SQBH 1G8MA 2EILC 5J2TB 1YIJV 2BSKB 2P22C 1XUQA 3TJTA 2ZE8A 4UVAA 2R70A 4IHJA 5LMNB 2Q9LA 4UV9A 5KA6A 3B8MA 2P90A 4F6RB 2XAJA 3D36A 2CTPA 3B8NA 2R9AA 1NVPB 2UUAO 3T4ZA 3JARB 4JTCB 1OCCC 1XMQO 1JCHA 3WG7C 2WLNA 1LUWA 2Q0AA 2NNUA 1RM1C 1FJGO 2YEVA 4B3TB 1YCIA 1IXMA 4LBEC 4QPKA 4RQEA 4LFBO 3G4SV 4LNUB 1B3QA 3B77A 3UM7A 3OR7C 4FLUA 3ZMZA 1W59A 3ZHTA 1YTFD 4K8ZA 3CRMA 4JI0O 4CH4A 4JZGA 1XI1A 2X0LA 3K08A 2IJIA 5IWAB 4G27B 3ETGA 2HVKC 4G28B 2ZT9B 2QKCA 4LR3A 1QNMA 1VMGA 2DYRC 4FK5C 2ZINA 4FLYA 3ZRVA 2RN9A 3W7TA 3JALA 1K8AW 1ZSPA 1D2DA 1PM9A 2CAZC 3FB8C 3K04A 3K57A 5FNVB 4DK0A 2BSKA 4B3RO 5LHHA 2R9RB 2WLHA 5KMGB 1VQ7V 2Q0OC 4H44B 4YJ2B 3OD4A 2XAFA 2GTAA 3AK3A 3J7AU 3SYAA 4JAVA 1URFA 3JARA 2UU9O 1HNZO 2XOKG 3L9DA 3CCRV 1XNRO 3SYPA 2F4VB 1K5QA 2B9ZA 3F5TA 4FVMA 5ITZA 2CK3G 2JIZG 4FFKA 1VQMV 3RYHB 5EIBC 1U97A 4DV4B 4H0LB 1GAXA 3CCJV 4GT1A 5TISZ 4DV1B 4LF5B 4NB5A 3D3QA 5LP6C 1Q5OA 2OTLV 4LNUA 3OFNG 4LWSA 2YDEA 3SR2C 1NTKH 1XNQB 3Q4HB 1BQ0A 4UXNA 3HKBB 3W7UA 2E74B 1SQPH 3STZC 3ASOB 4QPJA 3EFFK 5BR8O 3LSQA 3RN4A 2HFEC 1H38A 1Y4MA 2KSDA 2RCVA 1NVPD 1I94O 1BL8A 2OCCB 4J9ZB 5FNVA 3CCSV 1WAZA 2GDSA 3CP1A 1HNXB 4DRXB 1IDSA 1VF5B 3OMIB 5CB4B 1NR1A 4GX2A 4YXWG 1D5AA 3K0GA 4RUEA 4JPRA 3WU2Z 3JAMN 4JI2O 1K7DA 4YJ2A 2F66C 1EBOA 1NTMH 4K0KO 4P9PA 4F6EA 2A3QA 4MVRA 2L6LA 2GTSA 2EILB 2QR4A 2YC0A 1V9PA 2JRIA 2UUCO 1OHHG 2V4DA 1GK9A 2EINC 3OEEG 4K35A 5EYPB 1KECA 2A7WA 4O4HB 3AG2C 1AI4A 4X1KB 3E8HA 5IY5C 1XILA 3UO3A 3EHBB 2WA4A 5EK0A 4DV6O 2YICA 2IU3A 5FPOA 5K1PA 2EJRA 3GWOA 1YITV 3HKBA 3JSNA 4NXNB 4NXMB 4DK1A 5CMUA 4X1YB 5L3DA 2EIKC 5KA5A 5F2VO 3U10A 1R1BA 3CJHB 1Q81W 3E8BA 4RWUA 2O57A 3L70H 4RO2A 1L0LH 2CGOA 3R66A 1QR8A 1ZWIC 2LP7A 1SQXH 5CB4A 5DN6G 1CPYA 2HJFC 5BMVB 3K79A 3F5WC 1M56C 2DYRB 5KUMA 2F95B 2L35A 3T4DA 1R6TA 4DW0A 2ZKOA 5JCOA 3D3IA 2DW4A 2DYSB 3RYIB 1SZTA 3FX7A 5JVDB 1Y76B 4PHZA 4JI3O 2HHHB 4EKWA 2EZOA 3SJQC 4CH5A 4Q20A 4LF9O 3N2KB 2E5LB 2WLIA 1NH2B 2KG7A 3K3WA 3JD3A 1QLNA 1K4DC 1M5IA 5JJEB 4X65B 4CS4A 4ZBMA 4DR4B 1BS3A 4X1KA 3IGAC 3E35A 2ADPA 1M90W 2W0XA 1BE3H 3ZHRA 3ETQA 4UV8A 4PDMA 1WNSA 4JYBA 2EZPA 2LFRA 5J9PC 4Z2WA 2HG5C 4B3SB 4PA7A 3OTOB 4UB8Z 4AILC 3CJHA 2JGDB 3ZHVA 2XAHA 3HB3B 1RFYA 1OCOC 4W4KA 2XHBA 3UCSC 3PN1A 4X66B 4GUNA 1THZA 2Q4PA 1W2BU 4FFBB 2BTQB 3S3WA 3CRCA 2ZXWC 3ZMTA 2XTAA 1VQNV 4GKJO 2AHZA 4KFMA 3UO2A 2QJ1A 3CB2A 1Q6UA 1JQ0A 3RYIA 4DV0B 4MT8A 2BOBC 4PA9A 1Y76A 4FIPC 3OMNB 1GH6A 3O65A 4J10A 4DV2B 1YJWV 3U0ZA 5GONB 1BMFG 4JF3A 4N21A 2GV9A 1Q82W 2WLMA 5CA1B 4NTYA 5KHKA 1YJNV 3OEHG 4J7KA 3VQWA 2EULA 1F51A 1HNXO 3KZIZ 1P4RA 4JYAO 3A0HZ 1PPJH 1HNWB 5CBGA 3ZRWA 4LP8A 1W0KG 4DYLA 4GKKO 3FYIB 2Y69B 2Q7EA 1Z5WA 2P4KA 3WB2A 5LP6A 1SQFA 1M57C 4E2LA 5C8YA 4JV5O 1NS1A 3ABKC 3ZIAG 1VF7A 2ZR2A 4TV9B 1IBLB 3SYCA 2WLJA 4YIPA 3SPCA 3IJ4A 4I50B 5IE9A 3UT5A 1FFTB 4QJFB 1XL6A 2HEPA 3OUSA 1QQCA 4UCTA 4LFAB 1R6NA 4GZRB 4ZIBA 4JYCA 2OIEA 1QR9A 3BEHA 3RYCB 2KKWA 3T1HO 2CDYA 3ZEDA 1JFFB 2AZ2A 5B66Z 3AG3B 4B3MO 3JD0A 5GONA 1AR4A 5K1XA 3H1KH 3G71V 1QLEC 5CA1A 4WBNB 3M7MX 3JAWA 1KKCA 5LMUB 4JI6B 1NR7A 1FAFA 2C2AA 2LW7A 4CBCA 4DV7O 4LFCB 4X1IB 3LSSA 4J80A 3STLC 1OCZC 3RGBA 1JMKC 4ICGA 1R3JC 3L71H 3CHXA 1VIBA 1ZX3A 2DOSA 2W6JG 2D3OW 4AHCA 1K33A 4UCSA 4WFEA 3DC5A 3JD1A 5B3SC 1B06A 3B09A 4NTXA 4TV9A 1R3IC 1FFXB 4QIWF 4I50A 4DV3B 1H2KA 3E83A 1J5EO 4UCUA 2UUBB 5DEDA 1M93A 3E8GA 3NR7A 1CP9A 2Y0PA 4I4TB 4MW3A 1K97A 3VQXA 3CE2A 2AGAA 3RYFA 3FAVA 4Z1VA 2VWJA 1YDXA 1SQVH 3OAAG 1XQ8A 1GTOA 2P7TC 1YHQV 5B1AB 2YEVB 4PDLA 1LNQA 2QDOA 4DUZB 3JSLA 4DR5B 2Q7GA 2EIMB 4I0XB 4IT5A 4WBNA 4JAAA 4X64O 5GTIZ 4DR7O 2PZSA 2ZE6A 1H8HG 2JVDA 4YHHO 3AG1C 3CRQA 4QNHB 5HFMA 2ZM6B 1D5NA 1XMOO 1PL0A 4X8AA 2LFSA 3VBBA 4D7SA 1EZVH 2Y0IA 3OE7G 1E1QG 3MDSA 4I55B 2RJZA 2QGNA 1AB3A 3SJAC 3OM3B 1GN2A 1VQKV 1Q90D 4DV0O 1H2LA 5HFLA 2H8PC 3G6BA 1AI5A 1AJNA 3JCUZ 1YJ9V 2P4VA 3LUTB 1FFXA 3SJBC 3SJCC 2WLLA 4DUYB 3HR0A 3PJSK 2NR5A 2PYJA 1PP9H 1WA8A 2N04A 2DMXA 4I4TA 1V54B 1VEWA 3K59A 5BXZA 1SC5B 2EIJC 4MTGA 1SETA 3ABKB 4DR1B 3K58A 3I55V 5DM6V 3JAKB 1RSOB 2N74A 1IXBA 2DWDC 2X6AA 5ITZB 1AJPA 3ZRSA 1US6A 4X62O 5CBFA 1OZ0A 3MD0A 1MA1A 5L3EA 5LHIA 4PI0A 5LA6A 4I0XA 1G6UA 1MABG 2NN4A 3ABUA 1PNMA 4BAYA 1L8DA 1JJ2U 2CE4A 4LWSB 2NLJC 1N32O 4NKGB 2LO1A 3BFRA 5JWPA 2DQ3A 4X9QA 1M4UA 2Q8VA 4LFAO 3ABLC 5BZBA 3ABMC 2JS5A 1N4CA 3SPJA 1ENVA 3LNNA 2UXDO 4GX5A 1IBMB 1BSMA 1KMIZ 4I55A 1QLEB 3K5LA 1TUBB 4UFZA 2V1DA 5IYZB 2A79B 2Y48A 3B40A 2IH3C 4HBNA 4OX9O 4O4JA 4JI7B 1Z5VA 4H13B 1K73W 3OGIB 4OPAA 1V55B 2ZNIA 2G38A 4JI1O 5A2QN 1N33B 1X4TA 3L74H 2UXBB 1HW7A 5B3SB 5A9GA 3AG4C 3JAKA 1RSOA 1K34A 3TXQA 3CMAV 5J2UA 2LGQA 3APQA 2CH7B 1JOYA 3CRRA 1N34B 5FLXN 2AHYA 3SYOA 1OV9A 2B1IA 4I9WA 4LH6A 1H2NA 3EXAA 3FKSG 4BIOA 2X6BA 4YIOA 2E76B 1P7GA 2YIBD 3C3TA 5EBLC 3CPWU 1I08A 1Q43A 3SDLA 3I56V 4JI4B 2YIAA 4XDLA 2YXHA 2EBOA 4J7ZA 4DR2B 2PI4A 2P06A 3N2GB 2QE7G 3GB7C 1KD1W 2FMLA 3K5MA 2YI9A 4PI2A 2QSAA 4TQDA 4JI5O 1YI2V 3CCEV 1F23A 1TUBA 1R3KC 4LF8B 4MVSA 4TUYA 3G80A 1FPOA 5IYZA 1PKXA 3HKDA 1ORQC 2ZQMA 4UCRA 3LDDA 3SPIA 2BTOA 1NQTA 4JASA 4BW5A 1Y67A 5E79Z 2UXCB 1O9GA 2WAMA 3G6EV 2EJ7A 1AVMA 1WB7A 3NXSA 3J80N 1HR0B 4IYIA 2QTOA 3OMAB 1DTOA 4ZKIA 2WLIB 2KG7B 2CH7A 4DXWA 4LF6O 1GM7A 4LCUC 3BA9A 4GX1A 1NBMG 1NT2B 1KBHA 2ZE7A 1N36B 4K8XA 2EIJB 4FJCC 4HNAA 1VF6C 1OCCB 4BIZA 1UJWB 2YS8A 3WG7B 2ZE5A 1PNLA 2QA4V 1BHBA 1KUQA 1RM1B 5LMNO 2JK5C 1NKDA 1I0HA 2QWOB 2RDCA 3N2GA 1NI8A 3CX5F 3H1IH 2UXXA 4BW9A 1IBKB 2QEXV 3QVNA 1Q7YW 1K9MW 3KCXA 4O4LA 3KCYA 2YSUB 1GN6A 2WPDG 5JJJB 3JATA 4NVPA 4TV8A 4B3TO 2VQFB 2QM8A 1PV0A 4MW8A 2MW2B 3ZX6A 1MSWD 5LHGA 4AQYB 4IL6Z 4PD4F 5KHJA 1GMGA 1B04A 5JJNB 5IWAO 2IBZH 5IJ9A 5EC2C 5IT9N 2FYUH 5B1NA 2MK3A 1LUVA 4JI8B 4YY3B 5H6RA 2YXYA 4WFGA 4KHPB 4LH7A 1ZL8A 2A9HA 3IC9A 2JS3A 3AK1A 3E8FA 4DR6B 2WSSG 4LF7B 3AK2A 2E3CA 1SF9A 3KKYA 1T5EA 3TCUA 3ZRWB 3P3NA 1JJOA 1XDCA 3DC6A 3IC7A 4I7ZB 3THOA 1K3EA 2V7QG 5LP6B 4HAMA 2A0LA 5C8YB 3IFXA 2F4VO 4DR3B 1MOFA 4HZ3A 3A0BZ 1VQPV 1VQ9V 3P30A 2W6IG 5CBHA 2Q73A 4U7NA 2KQXA 4DV4O 3UT5B 2PY5A 5LOVA 4MVZA 3T1YB 2IJJA 3K03A 3LNMB 4EB6B 1J95A 4DV1O 4LF5O 1DF5A 3CC7V 3QF7A 2B5UA 1NJIW 5CA3A 2DE0X 2JDIG 4MS2A 4DV5B 1NU1H 2FKXA 2UXNA 1VQ6V 1XNQO 2PGGA 2IW5A 1FXKC 2XUMA 4LF4B 3JYCA 2B1GA 1EM1A 4DR2O 4KL1A 4EFEA 1SA0A 3P3PA 3JCZA 4OGQB 4B08A 1AR5A 2JJ2G 4UVCA 4Q6GA 5E1AC 1X59A 2HVJC 1XEQA 3BAAA 2LGWA 1BGYH 3JAWB 2QWQB 1G4YB 1TUEB 4FM0A 4P30A 2JEUA 2IU0A 5IJ0B 2OT5A 4BR6A 1QVGU 3A0RA 2ZDIC 2EINB 3CCMV 4JTDB 1N0JA 2A06H 4MVMA 4R7CA 2HLDG 3AG2B 3T1CA 5BY1A 5IY5B 1DGSA 3RT3C 5LXTA 3W7XA 1EN4A 1XMQB 1AILA 4O2BA 1Y66A 2WLKA 4TWKA 5KHIA 3QNEA 3J81N 3UQ8A 1XREA 4XDJA 1EZJA 1FJGB 5KLVH 3JD4A 1QVFU 5IDJA 4EB6A 1NH2D 5JH7A 4LFBB 3CRAA 2XT9A 2EIKB 1H8EG 5L3GA 2PF4E 4FPPA 3CC2V 3RYFB 3FAVB 5IYBO 5FPRA 2FL4A 3O9OA 1GN3A 4MVQA 4JI0B 1UFIA 1AR1B 1COWG 3S3XA 1SQQH 2X6CA 4A5UB 4NXNO 4U3FH 4NXMO 1SKVA 1QBZA 1VP7A 3SPGA 1AP5A 1M56B 5EIBD 4FZ1A 1S5LZ 1F4NA 1I5XA 4MTOA 2IH1C 3CS5A 2F1MA 1DLBA 5EZYA 4UCOA 1SESA 4MVOA 1BCCH 4CS3A 4MTXA 5IJ0A 1RPOA 4B3RB 1YSCA 2K1EA 2X7RB 1XOUA 1TGOA 3C90A 4RAIA 1KU9A 1YZBA 5H9CA 3LDEA 3FB6C 3SPHA 3SYQA 4L87A 1YVWA 3CWBH 1VF6A 4KXRA 2HHHO 2UU9B 1Q86W 1HNZB 1WPBA 2HJDA 3N27A 4RQFA 2Q5ZA 1XNRB 2E5LO 1SERA 2YI8A 4XDKA 4YY3O 2PTMA 1E1RG 2WLLB 3APOA 4X65O 5L3CA 5KUKA 5CA0A 1CEZA 2CTRA 4DR4O 1WA8B 1TA8A 3JD2A 4JYYA 4BWAA 4CS2A 5EC1C 3ETDA 1GN4A 2FB5A 4N23A 1OCOB 2HKOA 4QE7A 1S0VA 1ZAUA 3OGCC 3QTCA 3P32A 2Q6AA 1WP8A 2OYQA 5LA6B 4B3SO 1EN5A 5BR8B 3OTOO 2ZXWB 4F4LA 4U3JA 3GVMA 1BZKA 1MZFA 3OTFA 5GW7A 2LJ2A 1F7YA 4PA6A 2M7WA 1I94B 1WN7A 2RMKB 3F7VC 3FYEB 2VS0A 3AEIA 3CSXA 4X66O 5LGUA 2XNDG 4JTAB 4YJ3A 4JI2B 5LYJB 2BOCC 4ZHQB 1O9HA 3HKEA 3G67A 4IYHA 4FLVA 4MVUA 4LF4O 2W0FC 4FLWA 1KC8W 2OCCC 4R8CA 3VQYA 4O4JB 2QTSA 4DV2O 2UUCB 1QCEA 2F93B 1WJZA 1Q6IA 4X88A 4J42A 2CGNA 3X2QC 3BCCH 1I7FA 1NTZH 4JGSA 2FTKA 1M57B 2LW1A 1WB8A 4D7TA 1TVKA 4DV6B 2Q68A 1HNWO 4WF9V 3JASB 2QKSA 5J2UB 2Q69A 1KQSU 2VRZA 3L72H 4ABMA 4ZOLB 2OWOA 2WA3A 4H37A 4ASUG 4UCVA 1Q8IA 4HYOA 1IBLO 1M9NA 1A32A 1FXKA 2IJKA 1R73A 5CN0A 2YXLA 3RFRA 1E79G 3LSUA 1L1FA 1ZLZA 5LYJA 2GHYA 2QKAA 4W4LA 2N05A 3ZCCA 4ZHQA 1YF2A 2BCCH 3H01A 4TUYB 1WLEA 3HKCA 2H94A 4UB6Z 3ZRXA 3HKDB 4IIJB 3M99B 4CC6A 5B1BC 1AI7A 4JI3B 2VQEB 3A8TA 1Q3EA 1OCZB 1PL4A 4LF9B 4J11A 4X20A 2ZDIA 3ETEA 3DTUB 1AP6A 3E22B 2DJVA 4PJ0Z 3OUFA 2YIBA 2GUZA 4G2KA 5L3BA 2GBOA 5LMUO 4JI6O 2DYSC 3ZJZA 3AG7A 5J2TA 4LFCO 1JVMA 1JA8A 1K4CC 2ETNA 3F7YC 2QM7A 1SS3A 3JASA 4PV1B 4ZOLA 4PA4A 4WFHA 4F6RA 3W7SA 4QE9A 5L3FA 2DWEC 2P67A 4HNAB 3ZMUA 1VQOV 3CCVV 3MAQA 2JJ1G 2H3OA 4DV3O 4R50A 1AI6A 1XL4A 3FFQA 3ASNC 2UUBO 2WWWA 1JR9A 2P5OA 4U7OA 1VARA 1EFRG 1OCRC 4GKJB 1MNGA 3FB7C 1ZTEA 3A2FA 4O4LB 5KHGA 5EBMC 3AG1B 2JGUA 3JATB 4ZI7B 1BQZA 5FL7G 4TV8B 1VQ5V 4IIJA 4FLTA 3WB0A 3ZN1A 1F4MA 5EBWC 1WPXA 4DUZO 4DR5O 1NZ6A 4PELA 3E89A 4H33A 3E22A 2QWPB 1SQGA 2Z3YA 4QGPA 3C3SA 2ZM6O 2KB1A 1QU7A 4JYAB 5IJ9B 2ZIOA 5KMGA 3QO7A 3X2QB 3SGIA 1RPRA 3H1JH 1H2SB 1KP3A 4GKKB 1MSDA 1SRYA 1ZL8B 3VOUA 4JV5B 1Z2GA 3FB5C 2OIGA 4C7UA 1I5YA 4FLXA 3RVYA 2P6JA 3RYHA 1Q6HA 4DUYO 4L8JA 1KYOF 1YEWA 2Y69C 4P2ZA 3BVOA 1FKAO 3BHPA 4DR1O 4KP4A 4MSWC 4EFBA 3T1HB 3Q4HA 4ZI7A 2Q7HA 3QO8A 5LOVB 4B3MB 3ABLB 1XBLA 3ABMB 3W7WA 1VQ4V 1U96A 3FD9A 4GX0A 5KAIZ 5LBQA 1TAEA 1SZXA 4LC1A 3TGUH 1JX9A 5GTHZ 4CH6A 4DRXA 1K92A 5B1BB 3AG3C 4JAUA 4WFFA 4DV7B 1SA0B 4B7KA 3EVKA 3ML0A 3DGEA 2QM4A 5D5PA 5LGNA 1IBMO 3M8AA 2ILMA 1WP7A 4R6ZA 1GM9A 2OCHA 2F43G 1PNKA 3CCQV 1ROPA 2Z5UA 4JI7O 2VQEO 3TETA 4KUMA 3AG4B 4FM1A 3CYOA 1YXBA 4O4IB 3CD6V 2VWKA 4AI8A 5EYPA 3ZS8C 4E4EA 3CEIA 4O4HA 1J5EB 1N33O 1XHZA 2UXBO 2AXTZ 1S3JA 3U11A 3ZHQA 1S77D 4EEQA 5LXTB 1HWYA 4WFBV 2ITCC 3TXSA 1AROP 4O2BB 4Z1MG 2EX3A 1MMMA 2M6YA 4NTWA 3TK1A 4J9YB 2CUGA 3CXHF 1GO3F 3DXRB 3CC4V 1N34O 3ASNB 3RW0A 4CZZA 4J41A 3ICXA 4FZ0A 3BRCA 4X1YA 5H5NA 5JH7B 3D36C 2CTWA 3CMEV 3ZN0A 1FD9A 3QG5A 1OCRB 4DR7B 4X64B 4PDVA 4FMTA 4P9OA 2GSMB 1DF4A 3I5DA 4YHHB 2ZD9A 4JI4O 2AZ0A 1XMOB 1P49A 5B1AC 2Y4TA 3K5OA 4MTFA 2Z0AA 5BMVA 1UPGA 2EIMC 1H2GA 5B1OA 1N8RW 3K5NA 4OXSA 1N0NA 5KX5B 4DW1A 4LF8O 1G1XB 3MHHC 3ZHSA 1S76D 5EZYB 5JVDA 4TOIA 5AG2A 1S72V 3LDCA 2ZIMA 3WB1A 4CC5A 1CXZB 4D6TH 1GKFA 3N2KA 2R72A 3H1LH 5D5QA 1M1KW 4O4IA 1PD3A 3K0DA 4I5SA 3K06A 4K3AA 1LR1A 2XASA 2UXCO 4GCZA 1EN6A 4BIUA 3H9VA 2IM9A 2UUAB 5LL6Y 1VQLV 1HR0O 2OTJV 4IGGA 4WCEV 4TSFG 4X89A 4DO2A 3DXRA 2E75B 3B2EE 4X62B 5CA0B 4CH3A 2LQTA 3ZHUA 3GWKC 3KG2A 5JQGB 1Y74B 1N36O 2K9PA 3ZMVA 4FLZA 1V54C 2RNBA 1P7BA 4PA3A 1K5SA 2JGDA 5C93A 2YIDA 1N32B 3E86A 2RQ6A 2PI5A 1QHTA 2QWRB 3OW2U 2AW9A 1VQ8V 1IX9A 1JPXA 4FFBA 3RWRD 2BTQA 2UXDB 1IBKO 2ZR3A 5KX5A 4U3JB 3CCLV 4UVBA 1H2MA 2PYLA 5IYCO 4OX9B 1FS0G 2VQFO 5IYDO 4XBFA 3ZMSA 2DN9A 5H2FZ 2F23A 1P84F 3K9AA 4UUJC 2D2CB 4YJ3B 3CCUV 1GRJA 1KKDA 3R65A 3ZBHA 3RBZA 1FYJA 3HKEB 4AQYO 1GM8A 3D8CA 5DECA 4OPHA 4JI1B 1FXHA 4O2AB 3OT7A 4GLXA
chains in the Genus database with same CATH topology
3IJ4A 4NTXA 2FB5A 1WP8A 2L35A 4FZ0A 4FZ1A 3S3WA 4NYKA 3N27A 1WP7A 2QTSA 4NTYA 3S3XA 4NTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ4 A;  4NTX A;  2FB5 A;  1WP8 A;  2L35 A;  4FZ0 A;  4FZ1 A;  3S3W A;  4NYK A;  3N27 A;  1WP7 A;  2QTS A;  4NTY A;  3S3X A;  4NTW A; 
#chains in the Genus database with same CATH topology
 2ITD C;  1R6K A;  1MG1 A;  1S5J A;  4JI8 O;  1IZ3 A;  3T2M A;  1MZE A;  1V55 C;  5B5E Z;  2XAQ A;  1BHA A;  2Y4U A;  1FXV A;  2Q67 A;  4KHP O;  2ARH A;  1XHX A;  2ATK C;  4TQF A;  1YTF B;  5JQG A;  1Y74 A;  3DSQ A;  2PUS A;  5KAF Z;  3H1H H;  3K9S A;  4DR6 O;  1TVK B;  1RP3 B;  2HP8 A;  3E2E A;  4LF7 O;  3MHS C;  3RVZ A;  3WFV A;  1Y6X A;  5H6Q A;  3ABT A;  3L75 H;  1B6Q A;  4IHJ B;  3OR6 C;  5LGT A;  2QWN B;  4NYK A;  4JZ2 A;  1IUR A;  4JI5 B;  4FM2 A;  4DR3 O;  3RYC A;  1BT8 A;  3UKM A;  3IAY A;  1FXK B;  1JFF A;  2BE3 A;  3T1Y O;  1ZUQ A;  3L73 H;  4RUF A;  2ZCE A;  4TT3 G;  1KP2 A;  4GYC B;  2ODM A;  4I9Q A;  2CTQ A;  2ZNJ A;  3ASO C;  3BA8 A;  4WFA V;  4DV5 O;  2JEX A;  1W0J G;  2ADQ B;  1AJQ A;  3VQV A;  4K0K B;  3HKC B;  1KB9 F;  1S5H C;  4O2A A;  2HR3 A;  2IJH A;  2YUA A;  3QO5 A;  2DQ0 A;  3B4S A;  1R3L C;  4NR1 A;  4X1I A;  4B7E A;  1DK1 A;  1IVS A;  4X20 B;  1L0N H;  1HDJ A;  3HPL C;  4LF6 B;  3BAB A;  3BPZ A;  1OJH A;  2GUZ B;  4PDR A;  3BY6 A;  5JCO C;  4J7J A;  2R9I A;  3JAL B;  3CXC U;  2XAG A;  5KHH A;  1HP8 A;  1SQB H;  1G8M A;  2EIL C;  5J2T B;  1YIJ V;  2BSK B;  2P22 C;  1XUQ A;  3TJT A;  2ZE8 A;  4UVA A;  2R70 A;  4IHJ A;  5LMN B;  2Q9L A;  4UV9 A;  5KA6 A;  3B8M A;  2P90 A;  4F6R B;  2XAJ A;  3D36 A;  2CTP A;  3B8N A;  2R9A A;  1NVP B;  2UUA O;  3T4Z A;  3JAR B;  4JTC B;  1OCC C;  1XMQ O;  1JCH A;  3WG7 C;  2WLN A;  1LUW A;  2Q0A A;  2NNU A;  1RM1 C;  1FJG O;  2YEV A;  4B3T B;  1YCI A;  1IXM A;  4LBE C;  4QPK A;  4RQE A;  4LFB O;  3G4S V;  4LNU B;  1B3Q A;  3B77 A;  3UM7 A;  3OR7 C;  4FLU A;  3ZMZ A;  1W59 A;  3ZHT A;  1YTF D;  4K8Z A;  3CRM A;  4JI0 O;  4CH4 A;  4JZG A;  1XI1 A;  2X0L A;  3K08 A;  2IJI A;  5IWA B;  4G27 B;  3ETG A;  2HVK C;  4G28 B;  2ZT9 B;  2QKC A;  4LR3 A;  1QNM A;  1VMG A;  2DYR C;  4FK5 C;  2ZIN A;  4FLY A;  3ZRV A;  2RN9 A;  3W7T A;  3JAL A;  1K8A W;  1ZSP A;  1D2D A;  1PM9 A;  2CAZ C;  3FB8 C;  3K04 A;  3K57 A;  5FNV B;  4DK0 A;  2BSK A;  4B3R O;  5LHH A;  2R9R B;  2WLH A;  5KMG B;  1VQ7 V;  2Q0O C;  4H44 B;  4YJ2 B;  3OD4 A;  2XAF A;  2GTA A;  3AK3 A;  3J7A U;  3SYA A;  4JAV A;  1URF A;  3JAR A;  2UU9 O;  1HNZ O;  2XOK G;  3L9D A;  3CCR V;  1XNR O;  3SYP A;  2F4V B;  1K5Q A;  2B9Z A;  3F5T A;  4FVM A;  5ITZ A;  2CK3 G;  2JIZ G;  4FFK A;  1VQM V;  3RYH B;  5EIB C;  1U97 A;  4DV4 B;  4H0L B;  1GAX A;  3CCJ V;  4GT1 A;  5TIS Z;  4DV1 B;  4LF5 B;  4NB5 A;  3D3Q A;  5LP6 C;  1Q5O A;  2OTL V;  4LNU A;  3OFN G;  4LWS A;  2YDE A;  3SR2 C;  1NTK H;  1XNQ B;  3Q4H B;  1BQ0 A;  4UXN A;  3HKB B;  3W7U A;  2E74 B;  1SQP H;  3STZ C;  3ASO B;  4QPJ A;  3EFF K;  5BR8 O;  3LSQ A;  3RN4 A;  2HFE C;  1H38 A;  1Y4M A;  2KSD A;  2RCV A;  1NVP D;  1I94 O;  1BL8 A;  2OCC B;  4J9Z B;  5FNV A;  3CCS V;  1WAZ A;  2GDS A;  3CP1 A;  1HNX B;  4DRX B;  1IDS A;  1VF5 B;  3OMI B;  5CB4 B;  1NR1 A;  4GX2 A;  4YXW G;  1D5A A;  3K0G A;  4RUE A;  4JPR A;  3WU2 Z;  3JAM N;  4JI2 O;  1K7D A;  4YJ2 A;  2F66 C;  1EBO A;  1NTM H;  4K0K O;  4P9P A;  4F6E A;  2A3Q A;  4MVR A;  2L6L A;  2GTS A;  2EIL B;  2QR4 A;  2YC0 A;  1V9P A;  2JRI A;  2UUC O;  1OHH G;  2V4D A;  1GK9 A;  2EIN C;  3OEE G;  4K35 A;  5EYP B;  1KEC A;  2A7W A;  4O4H B;  3AG2 C;  1AI4 A;  4X1K B;  3E8H A;  5IY5 C;  1XIL A;  3UO3 A;  3EHB B;  2WA4 A;  5EK0 A;  4DV6 O;  2YIC A;  2IU3 A;  5FPO A;  5K1P A;  2EJR A;  3GWO A;  1YIT V;  3HKB A;  3JSN A;  4NXN B;  4NXM B;  4DK1 A;  5CMU A;  4X1Y B;  5L3D A;  2EIK C;  5KA5 A;  5F2V O;  3U10 A;  1R1B A;  3CJH B;  1Q81 W;  3E8B A;  4RWU A;  2O57 A;  3L70 H;  4RO2 A;  1L0L H;  2CGO A;  3R66 A;  1QR8 A;  1ZWI C;  2LP7 A;  1SQX H;  5CB4 A;  5DN6 G;  1CPY A;  2HJF C;  5BMV B;  3K79 A;  3F5W C;  1M56 C;  2DYR B;  5KUM A;  2F95 B;  2L35 A;  3T4D A;  1R6T A;  4DW0 A;  2ZKO A;  5JCO A;  3D3I A;  2DW4 A;  2DYS B;  3RYI B;  1SZT A;  3FX7 A;  5JVD B;  1Y76 B;  4PHZ A;  4JI3 O;  2HHH B;  4EKW A;  2EZO A;  3SJQ C;  4CH5 A;  4Q20 A;  4LF9 O;  3N2K B;  2E5L B;  2WLI A;  1NH2 B;  2KG7 A;  3K3W A;  3JD3 A;  1QLN A;  1K4D C;  1M5I A;  5JJE B;  4X65 B;  4CS4 A;  4ZBM A;  4DR4 B;  1BS3 A;  4X1K A;  3IGA C;  3E35 A;  2ADP A;  1M90 W;  2W0X A;  1BE3 H;  3ZHR A;  3ETQ A;  4UV8 A;  4PDM A;  1WNS A;  4JYB A;  2EZP A;  2LFR A;  5J9P C;  4Z2W A;  2HG5 C;  4B3S B;  4PA7 A;  3OTO B;  4UB8 Z;  4AIL C;  3CJH A;  2JGD B;  3ZHV A;  2XAH A;  3HB3 B;  1RFY A;  1OCO C;  4W4K A;  2XHB A;  3UCS C;  3PN1 A;  4X66 B;  4GUN A;  1THZ A;  2Q4P A;  1W2B U;  4FFB B;  2BTQ B;  3S3W A;  3CRC A;  2ZXW C;  3ZMT A;  2XTA A;  1VQN V;  4GKJ O;  2AHZ A;  4KFM A;  3UO2 A;  2QJ1 A;  3CB2 A;  1Q6U A;  1JQ0 A;  3RYI A;  4DV0 B;  4MT8 A;  2BOB C;  4PA9 A;  1Y76 A;  4FIP C;  3OMN B;  1GH6 A;  3O65 A;  4J10 A;  4DV2 B;  1YJW V;  3U0Z A;  5GON B;  1BMF G;  4JF3 A;  4N21 A;  2GV9 A;  1Q82 W;  2WLM A;  5CA1 B;  4NTY A;  5KHK A;  1YJN V;  3OEH G;  4J7K A;  3VQW A;  2EUL A;  1F51 A;  1HNX O;  3KZI Z;  1P4R A;  4JYA O;  3A0H Z;  1PPJ H;  1HNW B;  5CBG A;  3ZRW A;  4LP8 A;  1W0K G;  4DYL A;  4GKK O;  3FYI B;  2Y69 B;  2Q7E A;  1Z5W A;  2P4K A;  3WB2 A;  5LP6 A;  1SQF A;  1M57 C;  4E2L A;  5C8Y A;  4JV5 O;  1NS1 A;  3ABK C;  3ZIA G;  1VF7 A;  2ZR2 A;  4TV9 B;  1IBL B;  3SYC A;  2WLJ A;  4YIP A;  3SPC A;  3IJ4 A;  4I50 B;  5IE9 A;  3UT5 A;  1FFT B;  4QJF B;  1XL6 A;  2HEP A;  3OUS A;  1QQC A;  4UCT A;  4LFA B;  1R6N A;  4GZR B;  4ZIB A;  4JYC A;  2OIE A;  1QR9 A;  3BEH A;  3RYC B;  2KKW A;  3T1H O;  2CDY A;  3ZED A;  1JFF B;  2AZ2 A;  5B66 Z;  3AG3 B;  4B3M O;  3JD0 A;  5GON A;  1AR4 A;  5K1X A;  3H1K H;  3G71 V;  1QLE C;  5CA1 A;  4WBN B;  3M7M X;  3JAW A;  1KKC A;  5LMU B;  4JI6 B;  1NR7 A;  1FAF A;  2C2A A;  2LW7 A;  4CBC A;  4DV7 O;  4LFC B;  4X1I B;  3LSS A;  4J80 A;  3STL C;  1OCZ C;  3RGB A;  1JMK C;  4ICG A;  1R3J C;  3L71 H;  3CHX A;  1VIB A;  1ZX3 A;  2DOS A;  2W6J G;  2D3O W;  4AHC A;  1K33 A;  4UCS A;  4WFE A;  3DC5 A;  3JD1 A;  5B3S C;  1B06 A;  3B09 A;  4NTX A;  4TV9 A;  1R3I C;  1FFX B;  4QIW F;  4I50 A;  4DV3 B;  1H2K A;  3E83 A;  1J5E O;  4UCU A;  2UUB B;  5DED A;  1M93 A;  3E8G A;  3NR7 A;  1CP9 A;  2Y0P A;  4I4T B;  4MW3 A;  1K97 A;  3VQX A;  3CE2 A;  2AGA A;  3RYF A;  3FAV A;  4Z1V A;  2VWJ A;  1YDX A;  1SQV H;  3OAA G;  1XQ8 A;  1GTO A;  2P7T C;  1YHQ V;  5B1A B;  2YEV B;  4PDL A;  1LNQ A;  2QDO A;  4DUZ B;  3JSL A;  4DR5 B;  2Q7G A;  2EIM B;  4I0X B;  4IT5 A;  4WBN A;  4JAA A;  4X64 O;  5GTI Z;  4DR7 O;  2PZS A;  2ZE6 A;  1H8H G;  2JVD A;  4YHH O;  3AG1 C;  3CRQ A;  4QNH B;  5HFM A;  2ZM6 B;  1D5N A;  1XMO O;  1PL0 A;  4X8A A;  2LFS A;  3VBB A;  4D7S A;  1EZV H;  2Y0I A;  3OE7 G;  1E1Q G;  3MDS A;  4I55 B;  2RJZ A;  2QGN A;  1AB3 A;  3SJA C;  3OM3 B;  1GN2 A;  1VQK V;  1Q90 D;  4DV0 O;  1H2L A;  5HFL A;  2H8P C;  3G6B A;  1AI5 A;  1AJN A;  3JCU Z;  1YJ9 V;  2P4V A;  3LUT B;  1FFX A;  3SJB C;  3SJC C;  2WLL A;  4DUY B;  3HR0 A;  3PJS K;  2NR5 A;  2PYJ A;  1PP9 H;  1WA8 A;  2N04 A;  2DMX A;  4I4T A;  1V54 B;  1VEW A;  3K59 A;  5BXZ A;  1SC5 B;  2EIJ C;  4MTG A;  1SET A;  3ABK B;  4DR1 B;  3K58 A;  3I55 V;  5DM6 V;  3JAK B;  1RSO B;  2N74 A;  1IXB A;  2DWD C;  2X6A A;  5ITZ B;  1AJP A;  3ZRS A;  1US6 A;  4X62 O;  5CBF A;  1OZ0 A;  3MD0 A;  1MA1 A;  5L3E A;  5LHI A;  4PI0 A;  5LA6 A;  4I0X A;  1G6U A;  1MAB G;  2NN4 A;  3ABU A;  1PNM A;  4BAY A;  1L8D A;  1JJ2 U;  2CE4 A;  4LWS B;  2NLJ C;  1N32 O;  4NKG B;  2LO1 A;  3BFR A;  5JWP A;  2DQ3 A;  4X9Q A;  1M4U A;  2Q8V A;  4LFA O;  3ABL C;  5BZB A;  3ABM C;  2JS5 A;  1N4C A;  3SPJ A;  1ENV A;  3LNN A;  2UXD O;  4GX5 A;  1IBM B;  1BSM A;  1KMI Z;  4I55 A;  1QLE B;  3K5L A;  1TUB B;  4UFZ A;  2V1D A;  5IYZ B;  2A79 B;  2Y48 A;  3B40 A;  2IH3 C;  4HBN A;  4OX9 O;  4O4J A;  4JI7 B;  1Z5V A;  4H13 B;  1K73 W;  3OGI B;  4OPA A;  1V55 B;  2ZNI A;  2G38 A;  4JI1 O;  5A2Q N;  1N33 B;  1X4T A;  3L74 H;  2UXB B;  1HW7 A;  5B3S B;  5A9G A;  3AG4 C;  3JAK A;  1RSO A;  1K34 A;  3TXQ A;  3CMA V;  5J2U A;  2LGQ A;  3APQ A;  2CH7 B;  1JOY A;  3CRR A;  1N34 B;  5FLX N;  2AHY A;  3SYO A;  1OV9 A;  2B1I A;  4I9W A;  4LH6 A;  1H2N A;  3EXA A;  3FKS G;  4BIO A;  2X6B A;  4YIO A;  2E76 B;  1P7G A;  2YIB D;  3C3T A;  5EBL C;  3CPW U;  1I08 A;  1Q43 A;  3SDL A;  3I56 V;  4JI4 B;  2YIA A;  4XDL A;  2YXH A;  2EBO A;  4J7Z A;  4DR2 B;  2PI4 A;  2P06 A;  3N2G B;  2QE7 G;  3GB7 C;  1KD1 W;  2FML A;  3K5M A;  2YI9 A;  4PI2 A;  2QSA A;  4TQD A;  4JI5 O;  1YI2 V;  3CCE V;  1F23 A;  1TUB A;  1R3K C;  4LF8 B;  4MVS A;  4TUY A;  3G80 A;  1FPO A;  5IYZ A;  1PKX A;  3HKD A;  1ORQ C;  2ZQM A;  4UCR A;  3LDD A;  3SPI A;  2BTO A;  1NQT A;  4JAS A;  4BW5 A;  1Y67 A;  5E79 Z;  2UXC B;  1O9G A;  2WAM A;  3G6E V;  2EJ7 A;  1AVM A;  1WB7 A;  3NXS A;  3J80 N;  1HR0 B;  4IYI A;  2QTO A;  3OMA B;  1DTO A;  4ZKI A;  2WLI B;  2KG7 B;  2CH7 A;  4DXW A;  4LF6 O;  1GM7 A;  4LCU C;  3BA9 A;  4GX1 A;  1NBM G;  1NT2 B;  1KBH A;  2ZE7 A;  1N36 B;  4K8X A;  2EIJ B;  4FJC C;  4HNA A;  1VF6 C;  1OCC B;  4BIZ A;  1UJW B;  2YS8 A;  3WG7 B;  2ZE5 A;  1PNL A;  2QA4 V;  1BHB A;  1KUQ A;  1RM1 B;  5LMN O;  2JK5 C;  1NKD A;  1I0H A;  2QWO B;  2RDC A;  3N2G A;  1NI8 A;  3CX5 F;  3H1I H;  2UXX A;  4BW9 A;  1IBK B;  2QEX V;  3QVN A;  1Q7Y W;  1K9M W;  3KCX A;  4O4L A;  3KCY A;  2YSU B;  1GN6 A;  2WPD G;  5JJJ B;  3JAT A;  4NVP A;  4TV8 A;  4B3T O;  2VQF B;  2QM8 A;  1PV0 A;  4MW8 A;  2MW2 B;  3ZX6 A;  1MSW D;  5LHG A;  4AQY B;  4IL6 Z;  4PD4 F;  5KHJ A;  1GMG A;  1B04 A;  5JJN B;  5IWA O;  2IBZ H;  5IJ9 A;  5EC2 C;  5IT9 N;  2FYU H;  5B1N A;  2MK3 A;  1LUV A;  4JI8 B;  4YY3 B;  5H6R A;  2YXY A;  4WFG A;  4KHP B;  4LH7 A;  1ZL8 A;  2A9H A;  3IC9 A;  2JS3 A;  3AK1 A;  3E8F A;  4DR6 B;  2WSS G;  4LF7 B;  3AK2 A;  2E3C A;  1SF9 A;  3KKY A;  1T5E A;  3TCU A;  3ZRW B;  3P3N A;  1JJO A;  1XDC A;  3DC6 A;  3IC7 A;  4I7Z B;  3THO A;  1K3E A;  2V7Q G;  5LP6 B;  4HAM A;  2A0L A;  5C8Y B;  3IFX A;  2F4V O;  4DR3 B;  1MOF A;  4HZ3 A;  3A0B Z;  1VQP V;  1VQ9 V;  3P30 A;  2W6I G;  5CBH A;  2Q73 A;  4U7N A;  2KQX A;  4DV4 O;  3UT5 B;  2PY5 A;  5LOV A;  4MVZ A;  3T1Y B;  2IJJ A;  3K03 A;  3LNM B;  4EB6 B;  1J95 A;  4DV1 O;  4LF5 O;  1DF5 A;  3CC7 V;  3QF7 A;  2B5U A;  1NJI W;  5CA3 A;  2DE0 X;  2JDI G;  4MS2 A;  4DV5 B;  1NU1 H;  2FKX A;  2UXN A;  1VQ6 V;  1XNQ O;  2PGG A;  2IW5 A;  1FXK C;  2XUM A;  4LF4 B;  3JYC A;  2B1G A;  1EM1 A;  4DR2 O;  4KL1 A;  4EFE A;  1SA0 A;  3P3P A;  3JCZ A;  4OGQ B;  4B08 A;  1AR5 A;  2JJ2 G;  4UVC A;  4Q6G A;  5E1A C;  1X59 A;  2HVJ C;  1XEQ A;  3BAA A;  2LGW A;  1BGY H;  3JAW B;  2QWQ B;  1G4Y B;  1TUE B;  4FM0 A;  4P30 A;  2JEU A;  2IU0 A;  5IJ0 B;  2OT5 A;  4BR6 A;  1QVG U;  3A0R A;  2ZDI C;  2EIN B;  3CCM V;  4JTD B;  1N0J A;  2A06 H;  4MVM A;  4R7C A;  2HLD G;  3AG2 B;  3T1C A;  5BY1 A;  5IY5 B;  1DGS A;  3RT3 C;  5LXT A;  3W7X A;  1EN4 A;  1XMQ B;  1AIL A;  4O2B A;  1Y66 A;  2WLK A;  4TWK A;  5KHI A;  3QNE A;  3J81 N;  3UQ8 A;  1XRE A;  4XDJ A;  1EZJ A;  1FJG B;  5KLV H;  3JD4 A;  1QVF U;  5IDJ A;  4EB6 A;  1NH2 D;  5JH7 A;  4LFB B;  3CRA A;  2XT9 A;  2EIK B;  1H8E G;  5L3G A;  2PF4 E;  4FPP A;  3CC2 V;  3RYF B;  3FAV B;  5IYB O;  5FPR A;  2FL4 A;  3O9O A;  1GN3 A;  4MVQ A;  4JI0 B;  1UFI A;  1AR1 B;  1COW G;  3S3X A;  1SQQ H;  2X6C A;  4A5U B;  4NXN O;  4U3F H;  4NXM O;  1SKV A;  1QBZ A;  1VP7 A;  3SPG A;  1AP5 A;  1M56 B;  5EIB D;  4FZ1 A;  1S5L Z;  1F4N A;  1I5X A;  4MTO A;  2IH1 C;  3CS5 A;  2F1M A;  1DLB A;  5EZY A;  4UCO A;  1SES A;  4MVO A;  1BCC H;  4CS3 A;  4MTX A;  5IJ0 A;  1RPO A;  4B3R B;  1YSC A;  2K1E A;  2X7R B;  1XOU A;  1TGO A;  3C90 A;  4RAI A;  1KU9 A;  1YZB A;  5H9C A;  3LDE A;  3FB6 C;  3SPH A;  3SYQ A;  4L87 A;  1YVW A;  3CWB H;  1VF6 A;  4KXR A;  2HHH O;  2UU9 B;  1Q86 W;  1HNZ B;  1WPB A;  2HJD A;  3N27 A;  4RQF A;  2Q5Z A;  1XNR B;  2E5L O;  1SER A;  2YI8 A;  4XDK A;  4YY3 O;  2PTM A;  1E1R G;  2WLL B;  3APO A;  4X65 O;  5L3C A;  5KUK A;  5CA0 A;  1CEZ A;  2CTR A;  4DR4 O;  1WA8 B;  1TA8 A;  3JD2 A;  4JYY A;  4BWA A;  4CS2 A;  5EC1 C;  3ETD A;  1GN4 A;  2FB5 A;  4N23 A;  1OCO B;  2HKO A;  4QE7 A;  1S0V A;  1ZAU A;  3OGC C;  3QTC A;  3P32 A;  2Q6A A;  1WP8 A;  2OYQ A;  5LA6 B;  4B3S O;  1EN5 A;  5BR8 B;  3OTO O;  2ZXW B;  4F4L A;  4U3J A;  3GVM A;  1BZK A;  1MZF A;  3OTF A;  5GW7 A;  2LJ2 A;  1F7Y A;  4PA6 A;  2M7W A;  1I94 B;  1WN7 A;  2RMK B;  3F7V C;  3FYE B;  2VS0 A;  3AEI A;  3CSX A;  4X66 O;  5LGU A;  2XND G;  4JTA B;  4YJ3 A;  4JI2 B;  5LYJ B;  2BOC C;  4ZHQ B;  1O9H A;  3HKE A;  3G67 A;  4IYH A;  4FLV A;  4MVU A;  4LF4 O;  2W0F C;  4FLW A;  1KC8 W;  2OCC C;  4R8C A;  3VQY A;  4O4J B;  2QTS A;  4DV2 O;  2UUC B;  1QCE A;  2F93 B;  1WJZ A;  1Q6I A;  4X88 A;  4J42 A;  2CGN A;  3X2Q C;  3BCC H;  1I7F A;  1NTZ H;  4JGS A;  2FTK A;  1M57 B;  2LW1 A;  1WB8 A;  4D7T A;  1TVK A;  4DV6 B;  2Q68 A;  1HNW O;  4WF9 V;  3JAS B;  2QKS A;  5J2U B;  2Q69 A;  1KQS U;  2VRZ A;  3L72 H;  4ABM A;  4ZOL B;  2OWO A;  2WA3 A;  4H37 A;  4ASU G;  4UCV A;  1Q8I A;  4HYO A;  1IBL O;  1M9N A;  1A32 A;  1FXK A;  2IJK A;  1R73 A;  5CN0 A;  2YXL A;  3RFR A;  1E79 G;  3LSU A;  1L1F A;  1ZLZ A;  5LYJ A;  2GHY A;  2QKA A;  4W4L A;  2N05 A;  3ZCC A;  4ZHQ A;  1YF2 A;  2BCC H;  3H01 A;  4TUY B;  1WLE A;  3HKC A;  2H94 A;  4UB6 Z;  3ZRX A;  3HKD B;  4IIJ B;  3M99 B;  4CC6 A;  5B1B C;  1AI7 A;  4JI3 B;  2VQE B;  3A8T A;  1Q3E A;  1OCZ B;  1PL4 A;  4LF9 B;  4J11 A;  4X20 A;  2ZDI A;  3ETE A;  3DTU B;  1AP6 A;  3E22 B;  2DJV A;  4PJ0 Z;  3OUF A;  2YIB A;  2GUZ A;  4G2K A;  5L3B A;  2GBO A;  5LMU O;  4JI6 O;  2DYS C;  3ZJZ A;  3AG7 A;  5J2T A;  4LFC O;  1JVM A;  1JA8 A;  1K4C C;  2ETN A;  3F7Y C;  2QM7 A;  1SS3 A;  3JAS A;  4PV1 B;  4ZOL A;  4PA4 A;  4WFH A;  4F6R A;  3W7S A;  4QE9 A;  5L3F A;  2DWE C;  2P67 A;  4HNA B;  3ZMU A;  1VQO V;  3CCV V;  3MAQ A;  2JJ1 G;  2H3O A;  4DV3 O;  4R50 A;  1AI6 A;  1XL4 A;  3FFQ A;  3ASN C;  2UUB O;  2WWW A;  1JR9 A;  2P5O A;  4U7O A;  1VAR A;  1EFR G;  1OCR C;  4GKJ B;  1MNG A;  3FB7 C;  1ZTE A;  3A2F A;  4O4L B;  5KHG A;  5EBM C;  3AG1 B;  2JGU A;  3JAT B;  4ZI7 B;  1BQZ A;  5FL7 G;  4TV8 B;  1VQ5 V;  4IIJ A;  4FLT A;  3WB0 A;  3ZN1 A;  1F4M A;  5EBW C;  1WPX A;  4DUZ O;  4DR5 O;  1NZ6 A;  4PEL A;  3E89 A;  4H33 A;  3E22 A;  2QWP B;  1SQG A;  2Z3Y A;  4QGP A;  3C3S A;  2ZM6 O;  2KB1 A;  1QU7 A;  4JYA B;  5IJ9 B;  2ZIO A;  5KMG A;  3QO7 A;  3X2Q B;  3SGI A;  1RPR A;  3H1J H;  1H2S B;  1KP3 A;  4GKK B;  1MSD A;  1SRY A;  1ZL8 B;  3VOU A;  4JV5 B;  1Z2G A;  3FB5 C;  2OIG A;  4C7U A;  1I5Y A;  4FLX A;  3RVY A;  2P6J A;  3RYH A;  1Q6H A;  4DUY O;  4L8J A;  1KYO F;  1YEW A;  2Y69 C;  4P2Z A;  3BVO A;  1FKA O;  3BHP A;  4DR1 O;  4KP4 A;  4MSW C;  4EFB A;  3T1H B;  3Q4H A;  4ZI7 A;  2Q7H A;  3QO8 A;  5LOV B;  4B3M B;  3ABL B;  1XBL A;  3ABM B;  3W7W A;  1VQ4 V;  1U96 A;  3FD9 A;  4GX0 A;  5KAI Z;  5LBQ A;  1TAE A;  1SZX A;  4LC1 A;  3TGU H;  1JX9 A;  5GTH Z;  4CH6 A;  4DRX A;  1K92 A;  5B1B B;  3AG3 C;  4JAU A;  4WFF A;  4DV7 B;  1SA0 B;  4B7K A;  3EVK A;  3ML0 A;  3DGE A;  2QM4 A;  5D5P A;  5LGN A;  1IBM O;  3M8A A;  2ILM A;  1WP7 A;  4R6Z A;  1GM9 A;  2OCH A;  2F43 G;  1PNK A;  3CCQ V;  1ROP A;  2Z5U A;  4JI7 O;  2VQE O;  3TET A;  4KUM A;  3AG4 B;  4FM1 A;  3CYO A;  1YXB A;  4O4I B;  3CD6 V;  2VWK A;  4AI8 A;  5EYP A;  3ZS8 C;  4E4E A;  3CEI A;  4O4H A;  1J5E B;  1N33 O;  1XHZ A;  2UXB O;  2AXT Z;  1S3J A;  3U11 A;  3ZHQ A;  1S77 D;  4EEQ A;  5LXT B;  1HWY A;  4WFB V;  2ITC C;  3TXS A;  1ARO P;  4O2B B;  4Z1M G;  2EX3 A;  1MMM A;  2M6Y A;  4NTW A;  3TK1 A;  4J9Y B;  2CUG A;  3CXH F;  1GO3 F;  3DXR B;  3CC4 V;  1N34 O;  3ASN B;  3RW0 A;  4CZZ A;  4J41 A;  3ICX A;  4FZ0 A;  3BRC A;  4X1Y A;  5H5N A;  5JH7 B;  3D36 C;  2CTW A;  3CME V;  3ZN0 A;  1FD9 A;  3QG5 A;  1OCR B;  4DR7 B;  4X64 B;  4PDV A;  4FMT A;  4P9O A;  2GSM B;  1DF4 A;  3I5D A;  4YHH B;  2ZD9 A;  4JI4 O;  2AZ0 A;  1XMO B;  1P49 A;  5B1A C;  2Y4T A;  3K5O A;  4MTF A;  2Z0A A;  5BMV A;  1UPG A;  2EIM C;  1H2G A;  5B1O A;  1N8R W;  3K5N A;  4OXS A;  1N0N A;  5KX5 B;  4DW1 A;  4LF8 O;  1G1X B;  3MHH C;  3ZHS A;  1S76 D;  5EZY B;  5JVD A;  4TOI A;  5AG2 A;  1S72 V;  3LDC A;  2ZIM A;  3WB1 A;  4CC5 A;  1CXZ B;  4D6T H;  1GKF A;  3N2K A;  2R72 A;  3H1L H;  5D5Q A;  1M1K W;  4O4I A;  1PD3 A;  3K0D A;  4I5S A;  3K06 A;  4K3A A;  1LR1 A;  2XAS A;  2UXC O;  4GCZ A;  1EN6 A;  4BIU A;  3H9V A;  2IM9 A;  2UUA B;  5LL6 Y;  1VQL V;  1HR0 O;  2OTJ V;  4IGG A;  4WCE V;  4TSF G;  4X89 A;  4DO2 A;  3DXR A;  2E75 B;  3B2E E;  4X62 B;  5CA0 B;  4CH3 A;  2LQT A;  3ZHU A;  3GWK C;  3KG2 A;  5JQG B;  1Y74 B;  1N36 O;  2K9P A;  3ZMV A;  4FLZ A;  1V54 C;  2RNB A;  1P7B A;  4PA3 A;  1K5S A;  2JGD A;  5C93 A;  2YID A;  1N32 B;  3E86 A;  2RQ6 A;  2PI5 A;  1QHT A;  2QWR B;  3OW2 U;  2AW9 A;  1VQ8 V;  1IX9 A;  1JPX A;  4FFB A;  3RWR D;  2BTQ A;  2UXD B;  1IBK O;  2ZR3 A;  5KX5 A;  4U3J B;  3CCL V;  4UVB A;  1H2M A;  2PYL A;  5IYC O;  4OX9 B;  1FS0 G;  2VQF O;  5IYD O;  4XBF A;  3ZMS A;  2DN9 A;  5H2F Z;  2F23 A;  1P84 F;  3K9A A;  4UUJ C;  2D2C B;  4YJ3 B;  3CCU V;  1GRJ A;  1KKD A;  3R65 A;  3ZBH A;  3RBZ A;  1FYJ A;  3HKE B;  4AQY O;  1GM8 A;  3D8C A;  5DEC A;  4OPH A;  4JI1 B;  1FXH A;  4O2A B;  3OT7 A;  4GLX A; 
#chains in the Genus database with same CATH homology
 3IJ4 A;  4NTX A;  2FB5 A;  1WP8 A;  2L35 A;  4FZ0 A;  4FZ1 A;  3S3W A;  4NYK A;  3N27 A;  1WP7 A;  2QTS A;  4NTY A;  3S3X A;  4NTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...