3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
2FB5A 1WP8A 4FZ1A 4NTYA 4NTWA 2QTSA 1WP7A 2L35A 3IJ4A 4FZ0A 4NYKA 4NTXA 3N27A 3S3WA 3S3XA
chains in the Genus database with same CATH superfamily
3LDEA 1MNGA 3LSQA 1S77D 3ICXA 1QCEA 4FLXA 1VQ6V 3LDCA 1SESA 3L72H 3OEHG 2DOSA 2NLJC 3RVYA 3TJTA 3BCCH 3OMAB 1QVFU 2WA3A 5LYJB 1SF9A 3JARA 2HEPA 3F5TA 1G1XB 5LXTB 1N34O 1KQSU 1GMGA 5L3FA 4DUYO 2NNUA 4FM1A 2UXNA 2XAGA 1FXHA 3CRQA 1HWYA 3UCSC 1AB3A 4I4TB 2LFSA 4IHJB 3J80N 2AW9A 5CA1B 2Q73A 4MVZA 1W0JG 1K3EA 3OFNG 1KYOF 2CAZC 2E5LO 1FS0G 1KMIZ 2P90A 4X65O 3LNNA 3RFRA 1QLNA 3TK1A 1GK9A 1THZA 2GBOA 4EB6B 2PI4A 4JI8B 2VRZA 3ABKC 4ZOLB 3B4SA 2EJ7A 1YCIA 4FVMA 5KAIZ 3ZBHA 5LL6Y 5DEDA 1H2GA 3E8BA 4KHPO 2OCCC 3BEHA 1Y66A 2UXCO 5L3GA 1YXBA 4O4LB 4ABMA 1P4RA 2JJ1G 2HVJC 1N34B 1AVMA 2QR4A 4R6ZA 3KCXA 4FLZA 3RT3C 3WB2A 4BW9A 3CHXA 1NKDA 3B2EE 2UUAO 3QO5A 1SQFA 3SPCA 4DR4O 2Y69C 1OCRC 2N74A 5L3CA 2Q5ZA 2V7QG 3RYHB 5B1NA 2L35A 1AI6A 4PDLA 2C2AA 5L3DA 4MW3A 4I0XB 1L0LH 3T4ZA 5JCOA 3AG1B 4KXRA 4JTCB 3K5OA 2GV9A 4YIPA 3K04A 3OUFA 3UQ8A 5IJ9B 1M93A 3DTUB 4XDJA 4TQDA 2CH7B 4MVQA 3SR2C 1AJNA 2UXXA 3SJBC 2W6IG 2Q0OC 3ZHQA 1WB7A 2ZCEA 2Q6AA 1FPOA 4YJ2B 3A2FA 2WLIA 2YEVA 4D6TH 2UUBO 4HNAB 4WFEA 3E89A 5GONB 4QJFB 1EM1A 2CTWA 1FXKA 2YC0A 1KC8W 4UXNA 1NJIW 1B04A 5LOVA 1AJPA 3JATB 3LDDA 2AHYA 3AG4B 4WFBV 2Q9LA 3SGIA 5LXTA 5HFLA 3IC9A 4O2AB 4IT5A 1JX9A 1R1BA 3ASNB 3CCMV 3CX5F 4PI0A 2DYRC 3MDSA 3H1HH 4JF3A 1F4NA 3KZIZ 2LFRA 1YITV 2G38A 5BXZA 5L3EA 2QEXV 2EIJC 4MTOA 3CRCA 5FPRA 3AG2C 2QKAA 4JI3O 2YIAA 4YXWG 1Q5OA 4JI2B 4JI5B 3DXRB 1IZ3A 4GX5A 5A2QN 3BY6A 2QDOA 1DF4A 5KA5A 3ZRXA 4E2LA 1BE3H 3WG7C 3EFFK 2OTJV 4DR2B 1KKCA 2MK3A 2HVKC 3ETQA 2PZSA 2EIJB 2VWJA 2IU0A 2EIKB 2GSMB 2P4VA 4LNUB 4OXSA 4PDRA 3JALB 1GTOA 1VQ5V 1QR8A 4UCTA 4R7CA 5KHGA 1Y76B 1Q3EA 1FXKC 3APOA 1US6A 1AI7A 1FD9A 1G8MA 4X1IA 3ASOB 5IYZB 2EZPA 3JYCA 3G80A 4KUMA 3N2KB 2YI8A 4YJ3B 2EBOA 4O4JB 3ZEDA 3L9DA 2ITCC 4DK1A 3STZC 4WBNB 1UFIA 4LWSA 1KECA 2A79B 5CA0B 4D7TA 5EC2C 1O9HA 3MHHC 3JSLA 4LFCB 3AG3C 1QU7A 5B5EZ 3ZHRA 2F1MA 2WLIB 4FFKA 4JI4B 1S5HC 3U10A 1BQZA 4QIWF 1WJZA 5KHHA 1I08A 4IHJA 4G28B 3CSXA 1QBZA 2JGUA 4DV2O 5EBWC 2F4VO 1SZTA 4DR3B 1AP6A 2UXBO 3HKDA 2IH1C 1IBKB 2WPDG 4NVPA 1HNZO 2P7TC 1AJQA 4I0XA 3ZMVA 1TUBA 2EIKC 4MTFA 4KL1A 2UXCB 4X1YB 3ZMUA 5LMNO 4GKKB 2BOBC 3OM3B 4ZOLA 4PHZA 2UUCO 3OW2U 1VMGA 4LCUC 5IJ0A 5LHIA 1R3JC 4X66O 2YI9A 5D5QA 4X20B 5LMUO 5B1OA 4RUFA 4YY3B 2Q69A 1NBMG 4QE7A 1U97A 4NXNB 5HFMA 2X6AA 1FFTB 3R65A 5F2VO 5LMNB 3CE2A 1IURA 4LF8O 4I7ZB 1WLEA 2ZR3A 4UUJC 3T4DA 4DV1O 3RVZA 4YJ3A 3JATA 1GO3F 1D5AA 1K5SA 4MTXA 1VQ9V 3OTFA 4DV7O 3IAYA 1Q7YW 1N32B 1Q8IA 2ADQB 2L6LA 3D36C 4DK0A 1M5IA 3K5MA 5DN6G 4X65B 3OAAG 3B40A 3FYIB 3B77A 2OCHA 3FFQA 1FYJA 4UVBA 3ZMTA 5EYPA 1JR9A 1V54C 1IBMB 5EBLC 1PNKA 1OCCB 2VQEB 1Z2GA 3SYCA 3SPGA 2E75B 4MVMA 1K5QA 4O4IB 2Z5UA 2Y4UA 4CC6A 4EKWA 2UUCB 4TT3G 2WWWA 1NTZH 1HNWO 2VQFB 3JCUZ 4X1KB 1X59A 3CJHA 1DGSA 4TUYA 2R9IA 1VF6A 3OTOB 2IU3A 1ZSPA 2P22C 1FXKB 4MS2A 1EZVH 4KP4A 5H6QA 2M7WA 4WF9V 1RM1C 2ZNJA 3VQVA 3OMNB 5EIBC 3VQXA 1V54B 4X62O 1M90W 4GX2A 4QE9A 5IWAO 3BFRA 3G6BA 1SA0A 1ZWIC 1ZTEA 1DTOA 2KSDA 1NVPB 3S3WA 4B3RO 4RO2A 4OGQB 4DR4B 3HKBB 5KHIA 2ZE6A 2DWDC 3D36A 1OZ0A 2RCVA 2K1EA 3K0GA 4J10A 5JH7B 4CH6A 4PA4A 2FYUH 2P5OA 3L73H 1NH2D 1EN6A 3F7YC 2B1IA 2W0XA 2YXHA 4LF7O 1KB9F 4GYCB 1S72V 2RJZA 1P7BA 1XI1A 3HPLC 1IBLO 3N27A 4EEQA 1IDSA 1J95A 4O4IA 3C3TA 5GW7A 3A8TA 4LF5B 1VF7A 2CGNA 1BQ0A 3NXSA 4JTDB 5D5PA 2BSKA 2UU9B 1OCZB 3E83A 3W7UA 4NXMB 2CGOA 4O4JA 3OEEG 4B3MO 4DO2A 2XAHA 5B3SC 2XT9A 1SQPH 3OE7G 3P30A 2WLMA 1ZUQA 2EILB 1MG1A 2E5LB 4B3RB 2A9HA 1VIBA 1H2KA 3U0ZA 5CN0A 3AG7A 4X66B 1QVGU 1VQ7V 1XL4A 1DLBA 2QKCA 1K92A 2ZD9A 1TAEA 4JI0O 4FFBB 4FZ0A 3B09A 1KP3A 4JTAB 2UUBB 1RSOB 1FAFA 1JA8A 1SA0B 1BHBA 5JJNB 1K34A 1Q90D 3CJHB 5EK0A 3O9OA 1V9PA 3JAKA 4JYAB 1KBHA 4DR2O 1YVWA 1SZXA 2JDIG 3IC7A 3JCZA 5IJ0B 2WLLA 2ZR2A 3M99B 4H13B 1Q43A 1FFXB 3CB2A 2PY5A 2R9RB 1VEWA 1EFRG 3E8FA 1SRYA 3C90A 2Q67A 2XTAA 2MW2B 4CBCA 4DV0O 1N8RW 1OCRB 2RNBA 5JQGB 3DGEA 3T1HO 5LP6A 2ZINA 4K8XA 4CH4A 1VF5B 2ODMA 3CRRA 2QWRB 4CS4A 5BR8B 3RBZA 4X64O 4OX9B 1QHTA 4K35A 3ETDA 4TV9B 2UUAB 3THOA 2ZT9B 1KU9A 4EFBA 4WFHA 1I5YA 3SPHA 3FAVA 1MSDA 1WPBA 2ZE7A 3L70H 3N2GA 1JFFB 4JV5O 4FLUA 1TUEB 1PM9A 1MABG 3RWRD 4QGPA 3SYOA 4LWSB 3A0BZ 3IFXA 2XUMA 3K08A 4RQEA 1WPXA 4DR7B 1S5LZ 4UVCA 2X7RB 4BW5A 2KG7B 4X64B 4Z1VA 1CXZB 3OTOO 4PA3A 5CA0A 3ABMB 2HHHO 4DW0A 3BRCA 2B1GA 4MSWC 4L8JA 2QTOA 2EULA 5H5NA 4LH7A 3JD1A 2FMLA 4PV1B 1GN4A 5EZYB 4HYOA 2OYQA 3ZHTA 5GONA 3W7SA 4F6RB 3P3NA 4O2BA 1Q6UA 1QNMA 2XNDG 2ZNIA 4DRXB 1I94O 4YHHO 4CH5A 1GKFA 4JYYA 5BZBA 5J2TB 1HNZB 5LHHA 3DXRA 1Y6XA 4FK5C 4HAMA 4LF4B 3OR6C 3FAVB 1M9NA 2DWEC 1N36B 3A0HZ 2RDCA 3ZHSA 2JEUA 4ZI7B 1Q82W 2UXDO 5LP6C 3K5NA 4QPJA 4JI1B 3UM7A 4JI5O 1J5EO 1I0HA 1COWG 4DV3B 3X2QC 3CCUV 3RYFA 4J7KA 1N33B 4FFBA 2DMXA 4W4KA 4O4LA 1KUQA 3OUSA 3WFVA 1PNMA 3RGBA 4JASA 4DR6O 2R9AA 3OT7A 1EZJA 4B3MB 3IJ4A 3SJQC 2QWOB 4WFAV 4XDKA 2OTLV 4B7KA 5LA6A 2ILMA 1WNSA 1XHXA 5KUKA 1FKAO 2ATKC 5BMVA 5C8YA 2B9ZA 2WAMA 3HB3B 1XMQO 4DR5O 5K1XA 5IJ9A 2YEVB 5LHGA 4RUEA 4AI8A 4X1YA 1R3IC 3PN1A 3CD6V 2JS3A 4XDLA 5A9GA 3H9VA 4AQYO 4OPHA 1IBKO 1XEQA 1OHHG 2QWQB 4MVUA 1F23A 1GM7A 3RW0A 3EXAA 1H2SB 4ZBMA 4Z1MG 2UXDB 2KG7A 3KCYA 2QM8A 3ABTA 4LC1A 1N33O 3MHSC 1XHZA 4LF4O 2HP8A 2LQTA 1NT2B 1K9MW 3ZRWA 1E79G 3K03A 4JI4O 2Q68A 4GLXA 4I55B 4DUYB 4J41A 3E8HA 5C93A 3TXQA 3PJSK 1Q6HA 3VOUA 3T1CA 4BAYA 3UT5B 4U7OA 3JALA 1ORQC 2A7WA 2CDYA 5CBFA 4DR3O 4I4TA 2E74B 4UCSA 3RN4A 5CB4B 1OCCC 1XL6A 1GH6A 1NTKH 5AG2A 2XHBA 4ASUG 4B7EA 2ETNA 2Y4TA 3ABLC 2CTRA 1MOFA 4I5SA 1Q6IA 5JJEB 2N04A 5B1AB 3K3WA 5JVDB 3TXSA 1XMQB 1GN2A 2HFEC 3B8MA 3F7VC 1P7GA 4UFZA 4LFAB 4G27B 4X89A 3GB7C 5FNVB 1YTFB 2ZXWB 2QA4V 4JYCA 1JCHA 1MMMA 5IE9A 2ZQMA 1NQTA 2CTQA 2JIZG 4GX0A 3WG7B 4HNAA 2HKOA 3CEIA 5CB4A 1N32O 5LGUA 1FJGO 1WB8A 5H6RA 3JSNA 2QE7G 3E35A 5B3SB 4X20A 3IGAC 4U7NA 5LGTA 2DW4A 4JI8O 1HNXB 4ICGA 2VS0A 1O9GA 1XOUA 2CH7A 3SPJA 1OCZC 4PD4F 3G6EV 4DUZO 4ZKIA 3CCQV 4DR1B 1RPOA 1AI4A 1V55C 5BY1A 4YJ2A 2FB5A 3H1JH 2K9PA 3WB0A 3QF7A 3JAMN 3M8AA 3R66A 2AZ0A 5L3BA 1XILA 2CUGA 3E2EA 2WLLB 1ROPA 1SETA 1FJGB 5KMGB 1NI8A 2ZXWC 1I94B 4J9ZB 2HG5C 2P6JA 3JAKB 5DECA 1P84F 2DQ3A 4JYAO 2E3CA 2DE0X 4GT1A 3GVMA 1TVKA 5IYCO 1YF2A 1NZ6A 2OWOA 5B1AC 1XDCA 3AK2A 1NTMH 4JAAA 4O2AA 4JI6B 3ZHUA 3CRMA 1VF6C 1M56C 3LSSA 2A06H 4FJCC 4QNHB 1MA1A 1PKXA 3UO2A 2IJIA 3SPIA 4TV9A 4NKGB 1JMKC 2QSAA 3JD4A 3GWKC 3ZRWB 3D3IA 3JAWB 4X1IB 3BA9A 2HR3A 2LGWA 3ZCCA 4RQFA 3UT5A 1CP9A 3C3SA 5JQGA 5GTHZ 2P67A 3JARB 4GZRB 1Z5VA 5CA3A 5GTIZ 3QO8A 5ITZB 4JI6O 4NXNO 1PNLA 2GDSA 4DUZB 2YICA 1BGYH 1R6TA 1RFYA 5TISZ 4DV1B 5ITZA 3ZX6A 4W4LA 4UB6Z 1IX9A 4UCVA 2IM9A 4EFEA 1UPGA 4DR7O 4YY3O 3CC4V 4K3AA 2DN9A 3LSUA 3TETA 3CCRV 2YXYA 5J2TA 2F43G 4QPKA 4P30A 2PTMA 2EZOA 4GX1A 2LW1A 2Y0IA 5IYBO 4JV5B 1VP7A 1OCOB 3HKCB 1TA8A 1K73W 1AROP 1YDXA 4DV4O 4MTGA 4NTYA 1PL0A 1L0NH 3UO3A 3E22A 3ZN1A 3FX7A 2IW5A 2WLJA 1VQLV 1YIJV 2F95B 1GM8A 4DV5B 1YJ9V 3OGCC 2YUAA 4JI3B 3STLC 1WAZA 1Y67A 1H2MA 1YSCA 2JRIA 3K59A 3LNMB 4B3TB 2VQFO 1GM9A 4FM2A 1K4CC 3K58A 4UV8A 2EX3A 5B1BC 4CH3A 4DV3O 5CBHA 1ZLZA 4CZZA 2CK3G 4LF9O 4DV0B 2F4VB 4C7UA 1E1RG 2GHYA 1R3LC 4P9OA 2IH3C 4I9WA 2WLKA 5J2UA 2UXBB 1PL4A 4X1KA 1QLEB 1YEWA 2QM4A 2YDEA 4O2BB 1B3QA 2Q4PA 1JVMA 2DYSC 3K57A 1YHQV 4PDVA 4FLVA 1LUVA 4PA6A 2EINB 2R72A 4PA9A 1K33A 2D3OW 1Y74B 3E86A 3K9SA 4LFCO 1NH2B 4TQFA 1VQPV 1AR1B 2QWPB 4JAVA 1BSMA 4LF9B 3KKYA 3CXCU 3L71H 2ZIOA 3EVKA 3E22B 1GRJA 2IBZH 1V55B 5KX5A 3BAAA 2KQXA 3CPWU 4NYKA 4LH6A 3QNEA 3QO7A 3I56V 3ZMSA 3MAQA 2M6YA 1UJWB 4DYLA 4DV4B 4B3TO 1GAXA 3CCEV 3FB6C 2EIMC 2XAJA 2PUSA 2N05A 1EBOA 2XOKG 4LF8B 3JASB 1LNQA 5FLXN 4OX9O 1HR0O 2ZE8A 1NR1A 1DK1A 4TOIA 3B8NA 2JK5C 3K5LA 3BPZA 3DC6A 1BT8A 2IJHA 3BA8A 4TWKA 1YJNV 2A3QA 2DQ0A 2VWKA 1ZAUA 4WBNA 3QVNA 3SJAC 1XUQA 3RYCB 4HZ3A 1AR4A 4X8AA 2YIBD 1RPRA 1R73A 4JGSA 3X2QB 2HLDG 4AQYB 1GN6A 5IYDO 2PGGA 4XBFA 4NTWA 1CPYA 2FKXA 4DRXA 1HR0B 3RYCA 4UCOA 2FTKA 3K0DA 4Q20A 1XNRO 3K9AA 2JJ2G 4BWAA 1N36O 2P06A 1JQ0A 2OIEA 4TV8B 4N23A 3CCLV 1JPXA 2GUZB 3CXHF 4J9YB 1AR5A 2Y48A 3D8CA 2R70A 3L74H 1WP7A 1SQVH 2NR5A 2CE4A 4ZHQA 1TGOA 4LFAO 1IBMO 4F6EA 5KHKA 5LA6B 3CYOA 4O4HB 3A0RA 1H8EG 3DC5A 1N4CA 3K79A 3BVOA 5FL7G 4X62B 1SKVA 3K06A 4FMTA 1XNRB 5IWAB 3I55V 3AG3B 4NTXA 2ZDIC 4H0LB 5DM6V 4GKJB 4PA7A 4DV2B 3APQA 4FLYA 4LFBB 1EN5A 2QTSA 3SDLA 1R3KC 1F7YA 1SERA 2F23A 3HKEB 2O57A 1XMOB 4B3SO 3QTCA 1YI2V 2Q0AA 3Q4HA 4DV5O 2H8PC 4D7SA 3ASOC 4UVAA 4LR3A 1Z5WA 5E1AC 3CC7V 3CMAV 1IXMA 4UCUA 2YXLA 4BIOA 4WFFA 1WN7A 2BTQA 2IJKA 3T2MA 2ZKOA 1MSWD 1S3JA 4BR6A 3EHBB 2EILC 3FKSG 1N0NA 4GCZA 2ZIMA 3HKCA 1W0KG 3SYAA 3DSQA 2BCCH 1IVSA 3ZS8C 1YJWV 1SQGA 3AG2B 4UB8Z 1Y74A 4DV6O 5JCOC 2XAQA 1PP9H 4JZ2A 4JI2O 1R6KA 4DR5B 1X4TA 3AK1A 2ITDC 4IYIA 4U3JB 3GWOA 3F5WC 4FLWA 5JVDA 4X9QA 2QWNB 4L87A 3M7MX 1D5NA 2LO1A 1PV0A 4LBEC 4I50A 3J7AU 1Q86W 1G4YB 1M1KW 4TUYB 3SJCC 3HKBA 1K97A 3LUTB 5IDJA 2EINC 1M4UA 2EIMB 4WCEV 1ZL8B 4P9PA 1BS3A 3CMEV 4MVSA 1BZKA 1P49A 2DYSB 4UV9A 1M57B 5IY5C 1JOYA 5EZYA 5BMVB 2PYJA 2RMKB 4MW8A 1QQCA 4B08A 2BTQB 3H1LH 3I5DA 3G4SV 4WFGA 1VARA 3TCUA 3CCJV 2YIDA 1T5EA 4I55A 3S3XA 2ZE5A 2YSUB 4Z2WA 4IGGA 2AGAA 1E1QG 1HW7A 1U96A 1SQBH 5CMUA 1K4DC 4BIZA 3AG1C 3W7WA 3QG5A 2A0LA 2W0FC 5B1BB 3JASA 4K8ZA 3RYIB 3ABMC 1H2LA 2PYLA 4TV8A 1A32A 2X6BA 3RYHA 1I7FA 2WLNA 4FIPC 2LP7A 3FB7C 4PELA 2XASA 3AK3A 2B5UA 5KLVH 4J7JA 2JGDB 4JZGA 4KHPB 2OCCB 1TVKB 2FL4A 1MZFA 2GTSA 4R8CA 3OGIB 4FM0A 4G2KA 4J11A 4LP8A 1SC5B 1H2NA 3T1YO 5LMUB 1BMFG 1VQKV 1VQ4V 2Z0AA 4F6RA 4NXMO 4LF7B 1H8HG 4JAUA 4R50A 3VBBA 3RYFB 3NR7A 1L1FA 4YIOA 1XNQO 2QGNA 2F66C 1IXBA 1OV9A 1ZL8A 2QKSA 4TSFG 2KKWA 1L8DA 4JI7B 1G6UA 3W7XA 4OPAA 4ZIBA 2DYRB 5LP6B 2CTPA 2ZM6B 4B3SB 1XMOO 3FB5C 3ETEA 1SQQH 3TGUH 1PD3A 1NR7A 2HHHB 3HKDB 1NU1H 5KA6A 1VQ8V 2JVDA 3SYPA 4I9QA 1JFFA 1FXVA 3ETGA 1B06A 1YTFD 4JI7O 1M56B 1KP2A 4IIJB 1QLEC 1KKDA 2BOCC 1MZEA 1EN4A 1AI5A 4F4LA 5B66Z 1AP5A 2LGQA 4J42A 5KHJA 4FLTA 5JJJB 1M57C 5IY5B 2Q8VA 2Y69B 3BHPA 5FPOA 4PI2A 3JD2A 4H33A 2ZDIA 3O65A 4JYBA 4GUNA 1H38A 4DV6B 2NN4A 1WA8A 3VQWA 2W6JG 5LOVB 3ZRVA 1S5JA 4KFMA 4CS2A 4RAIA 5CA1A 4P2ZA 2WSSG 4CS3A 4PDMA 4DR6B 1RSOA 5LGNA 1QR9A 2ZM6O 1XNQB 3H1IH 2JGDA 3T1HB 4ZHQB 4N21A 5KAFZ 1BCCH 5EIBD 1D2DA 1BL8A 3CP1A 1F51A 4JI1O 2PI5A 2Q7GA 3HR0A 3UKMA 4J7ZA 5EYPB 2Y0PA 2XAFA 3ML0A 3Q4HB 4LF5O 1ENVA 1FFXA 1Y4MA 2BE3A 3FB8C 1VQMV 4O4HA 1WP8A 1XBLA 3G67A 3U11A 2UU9O 3OMIB 5EC1C 4MT8A 3E8GA 2JS5A 3CS5A 2HJFC 4LF6O 2OT5A 2IJJA 3L75H 5K1PA 5FNVA 1R6NA 2PF4E 4U3JA 5KMGA 3W7TA 4GKKO 3HKEA 2Q7HA 4U3FH 1B6QA 1JJOA 2LW7A 1RM1B 2Q7EA 1N0JA 4NR1A 4GKJO 4ZI7A 4J80A 3JAWA 3ABUA 2WLHA 1NVPD 3ASNC 1TUBB 2RN9A 1W2BU 5KX5B 3AEIA 3CCSV 2F93B 1HP8A 1LUWA 2V1DA 3CC2V 4FZ1A 2ADPA 2VQEO 1VQOV 4JI0B 3RYIA 1LR1A 3KG2A 3P32A 2HJDA 4FPPA 4IYHA 2AHZA 4CC5A 1HDJA 3ZIAG 3H01A 4E4EA 1NS1A 5JH7A 4HBNA 1Y76A 2BSKB 3FD9A 2WA4A 4MVOA 3BABA 4A5UB 1ZX3A 5C8YB 4YHHB 1XREA 2BTOA 2AZ2A 3OR7C 4DV7B 5EBMC 4IL6Z 4DXWA 1AILA 4X88A 4K0KO 3CCVV 2DJVA 4DW1A 5KUMA 3VQYA 3JD3A 4LF6B 2H3OA 1VQNV 2EJRA 1OJHA 2RQ6A 4MVRA 1S76D 3SYQA 3JD0A 4H37A 3N2KA 2ARHA 1HNWB 4PJ0Z 1OCOC 2YIBA 2D2CB 5LBQA 1YZBA 3G71V 4IIJA 4EB6A 2AXTZ 1CEZA 1I5XA 4LNUA 3J81N 4RWUA 1HNXO 1RP3B 3T1YB 4Q6GA 2GUZA 3CRAA 2E76B 3WU2Z 3CWBH 1JJ2U 4H44B 5IYZA 5J9PC 2YS8A 1F4MA 1S0VA 1KD1W 1Q81W 1XQ8A 5LYJA 1DF5A 3ZMZA 3FYEB 1J5EB 3D3QA 2OIGA 3MD0A 5JWPA 1URFA 3H1KH 2V4DA 1IBLB 3WB1A 2H94A 4BIUA 2JEXA 3ZJZA 2QJ1A 4DR1O 4I50B 1BHAA 1GN3A 5H2FZ 1K7DA 5IT9N 1WA8B 3OD4A 2GTAA 5BR8O 4LFBO 3N2GB 3AG4C 2KB1A 5H9CA 4AHCA 2X6CA 4NB5A 3ZN0A 2LJ2A 1SS3A 5J2UB 3ZHVA 5CBGA 3ABKB 1SQXH 2QM7A 2P4KA 2X0LA 2Z3YA 4AILC 4K0KB 3ZRSA 1PPJH 1W59A 3ABLB 5E79Z 4JPRA 3P3PA 1K8AW 4UCRA
chains in the Genus database with same CATH topology
2FB5A 1WP8A 4FZ1A 4NTYA 4NTWA 2QTSA 1WP7A 2L35A 3IJ4A 4FZ0A 4NYKA 4NTXA 3N27A 3S3WA 3S3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB5 A;  1WP8 A;  4FZ1 A;  4NTY A;  4NTW A;  2QTS A;  1WP7 A;  2L35 A;  3IJ4 A;  4FZ0 A;  4NYK A;  4NTX A;  3N27 A;  3S3W A;  3S3X A; 
#chains in the Genus database with same CATH topology
 3LDE A;  1MNG A;  3LSQ A;  1S77 D;  3ICX A;  1QCE A;  4FLX A;  1VQ6 V;  3LDC A;  1SES A;  3L72 H;  3OEH G;  2DOS A;  2NLJ C;  3RVY A;  3TJT A;  3BCC H;  3OMA B;  1QVF U;  2WA3 A;  5LYJ B;  1SF9 A;  3JAR A;  2HEP A;  3F5T A;  1G1X B;  5LXT B;  1N34 O;  1KQS U;  1GMG A;  5L3F A;  4DUY O;  2NNU A;  4FM1 A;  2UXN A;  2XAG A;  1FXH A;  3CRQ A;  1HWY A;  3UCS C;  1AB3 A;  4I4T B;  2LFS A;  4IHJ B;  3J80 N;  2AW9 A;  5CA1 B;  2Q73 A;  4MVZ A;  1W0J G;  1K3E A;  3OFN G;  1KYO F;  2CAZ C;  2E5L O;  1FS0 G;  1KMI Z;  2P90 A;  4X65 O;  3LNN A;  3RFR A;  1QLN A;  3TK1 A;  1GK9 A;  1THZ A;  2GBO A;  4EB6 B;  2PI4 A;  4JI8 B;  2VRZ A;  3ABK C;  4ZOL B;  3B4S A;  2EJ7 A;  1YCI A;  4FVM A;  5KAI Z;  3ZBH A;  5LL6 Y;  5DED A;  1H2G A;  3E8B A;  4KHP O;  2OCC C;  3BEH A;  1Y66 A;  2UXC O;  5L3G A;  1YXB A;  4O4L B;  4ABM A;  1P4R A;  2JJ1 G;  2HVJ C;  1N34 B;  1AVM A;  2QR4 A;  4R6Z A;  3KCX A;  4FLZ A;  3RT3 C;  3WB2 A;  4BW9 A;  3CHX A;  1NKD A;  3B2E E;  2UUA O;  3QO5 A;  1SQF A;  3SPC A;  4DR4 O;  2Y69 C;  1OCR C;  2N74 A;  5L3C A;  2Q5Z A;  2V7Q G;  3RYH B;  5B1N A;  2L35 A;  1AI6 A;  4PDL A;  2C2A A;  5L3D A;  4MW3 A;  4I0X B;  1L0L H;  3T4Z A;  5JCO A;  3AG1 B;  4KXR A;  4JTC B;  3K5O A;  2GV9 A;  4YIP A;  3K04 A;  3OUF A;  3UQ8 A;  5IJ9 B;  1M93 A;  3DTU B;  4XDJ A;  4TQD A;  2CH7 B;  4MVQ A;  3SR2 C;  1AJN A;  2UXX A;  3SJB C;  2W6I G;  2Q0O C;  3ZHQ A;  1WB7 A;  2ZCE A;  2Q6A A;  1FPO A;  4YJ2 B;  3A2F A;  2WLI A;  2YEV A;  4D6T H;  2UUB O;  4HNA B;  4WFE A;  3E89 A;  5GON B;  4QJF B;  1EM1 A;  2CTW A;  1FXK A;  2YC0 A;  1KC8 W;  4UXN A;  1NJI W;  1B04 A;  5LOV A;  1AJP A;  3JAT B;  3LDD A;  2AHY A;  3AG4 B;  4WFB V;  2Q9L A;  3SGI A;  5LXT A;  5HFL A;  3IC9 A;  4O2A B;  4IT5 A;  1JX9 A;  1R1B A;  3ASN B;  3CCM V;  3CX5 F;  4PI0 A;  2DYR C;  3MDS A;  3H1H H;  4JF3 A;  1F4N A;  3KZI Z;  2LFR A;  1YIT V;  2G38 A;  5BXZ A;  5L3E A;  2QEX V;  2EIJ C;  4MTO A;  3CRC A;  5FPR A;  3AG2 C;  2QKA A;  4JI3 O;  2YIA A;  4YXW G;  1Q5O A;  4JI2 B;  4JI5 B;  3DXR B;  1IZ3 A;  4GX5 A;  5A2Q N;  3BY6 A;  2QDO A;  1DF4 A;  5KA5 A;  3ZRX A;  4E2L A;  1BE3 H;  3WG7 C;  3EFF K;  2OTJ V;  4DR2 B;  1KKC A;  2MK3 A;  2HVK C;  3ETQ A;  2PZS A;  2EIJ B;  2VWJ A;  2IU0 A;  2EIK B;  2GSM B;  2P4V A;  4LNU B;  4OXS A;  4PDR A;  3JAL B;  1GTO A;  1VQ5 V;  1QR8 A;  4UCT A;  4R7C A;  5KHG A;  1Y76 B;  1Q3E A;  1FXK C;  3APO A;  1US6 A;  1AI7 A;  1FD9 A;  1G8M A;  4X1I A;  3ASO B;  5IYZ B;  2EZP A;  3JYC A;  3G80 A;  4KUM A;  3N2K B;  2YI8 A;  4YJ3 B;  2EBO A;  4O4J B;  3ZED A;  3L9D A;  2ITC C;  4DK1 A;  3STZ C;  4WBN B;  1UFI A;  4LWS A;  1KEC A;  2A79 B;  5CA0 B;  4D7T A;  5EC2 C;  1O9H A;  3MHH C;  3JSL A;  4LFC B;  3AG3 C;  1QU7 A;  5B5E Z;  3ZHR A;  2F1M A;  2WLI B;  4FFK A;  4JI4 B;  1S5H C;  3U10 A;  1BQZ A;  4QIW F;  1WJZ A;  5KHH A;  1I08 A;  4IHJ A;  4G28 B;  3CSX A;  1QBZ A;  2JGU A;  4DV2 O;  5EBW C;  2F4V O;  1SZT A;  4DR3 B;  1AP6 A;  2UXB O;  3HKD A;  2IH1 C;  1IBK B;  2WPD G;  4NVP A;  1HNZ O;  2P7T C;  1AJQ A;  4I0X A;  3ZMV A;  1TUB A;  2EIK C;  4MTF A;  4KL1 A;  2UXC B;  4X1Y B;  3ZMU A;  5LMN O;  4GKK B;  2BOB C;  3OM3 B;  4ZOL A;  4PHZ A;  2UUC O;  3OW2 U;  1VMG A;  4LCU C;  5IJ0 A;  5LHI A;  1R3J C;  4X66 O;  2YI9 A;  5D5Q A;  4X20 B;  5LMU O;  5B1O A;  4RUF A;  4YY3 B;  2Q69 A;  1NBM G;  4QE7 A;  1U97 A;  4NXN B;  5HFM A;  2X6A A;  1FFT B;  3R65 A;  5F2V O;  5LMN B;  3CE2 A;  1IUR A;  4LF8 O;  4I7Z B;  1WLE A;  2ZR3 A;  4UUJ C;  3T4D A;  4DV1 O;  3RVZ A;  4YJ3 A;  3JAT A;  1GO3 F;  1D5A A;  1K5S A;  4MTX A;  1VQ9 V;  3OTF A;  4DV7 O;  3IAY A;  1Q7Y W;  1N32 B;  1Q8I A;  2ADQ B;  2L6L A;  3D36 C;  4DK0 A;  1M5I A;  3K5M A;  5DN6 G;  4X65 B;  3OAA G;  3B40 A;  3FYI B;  3B77 A;  2OCH A;  3FFQ A;  1FYJ A;  4UVB A;  3ZMT A;  5EYP A;  1JR9 A;  1V54 C;  1IBM B;  5EBL C;  1PNK A;  1OCC B;  2VQE B;  1Z2G A;  3SYC A;  3SPG A;  2E75 B;  4MVM A;  1K5Q A;  4O4I B;  2Z5U A;  2Y4U A;  4CC6 A;  4EKW A;  2UUC B;  4TT3 G;  2WWW A;  1NTZ H;  1HNW O;  2VQF B;  3JCU Z;  4X1K B;  1X59 A;  3CJH A;  1DGS A;  4TUY A;  2R9I A;  1VF6 A;  3OTO B;  2IU3 A;  1ZSP A;  2P22 C;  1FXK B;  4MS2 A;  1EZV H;  4KP4 A;  5H6Q A;  2M7W A;  4WF9 V;  1RM1 C;  2ZNJ A;  3VQV A;  3OMN B;  5EIB C;  3VQX A;  1V54 B;  4X62 O;  1M90 W;  4GX2 A;  4QE9 A;  5IWA O;  3BFR A;  3G6B A;  1SA0 A;  1ZWI C;  1ZTE A;  1DTO A;  2KSD A;  1NVP B;  3S3W A;  4B3R O;  4RO2 A;  4OGQ B;  4DR4 B;  3HKB B;  5KHI A;  2ZE6 A;  2DWD C;  3D36 A;  1OZ0 A;  2RCV A;  2K1E A;  3K0G A;  4J10 A;  5JH7 B;  4CH6 A;  4PA4 A;  2FYU H;  2P5O A;  3L73 H;  1NH2 D;  1EN6 A;  3F7Y C;  2B1I A;  2W0X A;  2YXH A;  4LF7 O;  1KB9 F;  4GYC B;  1S72 V;  2RJZ A;  1P7B A;  1XI1 A;  3HPL C;  1IBL O;  3N27 A;  4EEQ A;  1IDS A;  1J95 A;  4O4I A;  3C3T A;  5GW7 A;  3A8T A;  4LF5 B;  1VF7 A;  2CGN A;  1BQ0 A;  3NXS A;  4JTD B;  5D5P A;  2BSK A;  2UU9 B;  1OCZ B;  3E83 A;  3W7U A;  4NXM B;  2CGO A;  4O4J A;  3OEE G;  4B3M O;  4DO2 A;  2XAH A;  5B3S C;  2XT9 A;  1SQP H;  3OE7 G;  3P30 A;  2WLM A;  1ZUQ A;  2EIL B;  1MG1 A;  2E5L B;  4B3R B;  2A9H A;  1VIB A;  1H2K A;  3U0Z A;  5CN0 A;  3AG7 A;  4X66 B;  1QVG U;  1VQ7 V;  1XL4 A;  1DLB A;  2QKC A;  1K92 A;  2ZD9 A;  1TAE A;  4JI0 O;  4FFB B;  4FZ0 A;  3B09 A;  1KP3 A;  4JTA B;  2UUB B;  1RSO B;  1FAF A;  1JA8 A;  1SA0 B;  1BHB A;  5JJN B;  1K34 A;  1Q90 D;  3CJH B;  5EK0 A;  3O9O A;  1V9P A;  3JAK A;  4JYA B;  1KBH A;  4DR2 O;  1YVW A;  1SZX A;  2JDI G;  3IC7 A;  3JCZ A;  5IJ0 B;  2WLL A;  2ZR2 A;  3M99 B;  4H13 B;  1Q43 A;  1FFX B;  3CB2 A;  2PY5 A;  2R9R B;  1VEW A;  1EFR G;  3E8F A;  1SRY A;  3C90 A;  2Q67 A;  2XTA A;  2MW2 B;  4CBC A;  4DV0 O;  1N8R W;  1OCR B;  2RNB A;  5JQG B;  3DGE A;  3T1H O;  5LP6 A;  2ZIN A;  4K8X A;  4CH4 A;  1VF5 B;  2ODM A;  3CRR A;  2QWR B;  4CS4 A;  5BR8 B;  3RBZ A;  4X64 O;  4OX9 B;  1QHT A;  4K35 A;  3ETD A;  4TV9 B;  2UUA B;  3THO A;  2ZT9 B;  1KU9 A;  4EFB A;  4WFH A;  1I5Y A;  3SPH A;  3FAV A;  1MSD A;  1WPB A;  2ZE7 A;  3L70 H;  3N2G A;  1JFF B;  4JV5 O;  4FLU A;  1TUE B;  1PM9 A;  1MAB G;  3RWR D;  4QGP A;  3SYO A;  4LWS B;  3A0B Z;  3IFX A;  2XUM A;  3K08 A;  4RQE A;  1WPX A;  4DR7 B;  1S5L Z;  4UVC A;  2X7R B;  4BW5 A;  2KG7 B;  4X64 B;  4Z1V A;  1CXZ B;  3OTO O;  4PA3 A;  5CA0 A;  3ABM B;  2HHH O;  4DW0 A;  3BRC A;  2B1G A;  4MSW C;  4L8J A;  2QTO A;  2EUL A;  5H5N A;  4LH7 A;  3JD1 A;  2FML A;  4PV1 B;  1GN4 A;  5EZY B;  4HYO A;  2OYQ A;  3ZHT A;  5GON A;  3W7S A;  4F6R B;  3P3N A;  4O2B A;  1Q6U A;  1QNM A;  2XND G;  2ZNI A;  4DRX B;  1I94 O;  4YHH O;  4CH5 A;  1GKF A;  4JYY A;  5BZB A;  5J2T B;  1HNZ B;  5LHH A;  3DXR A;  1Y6X A;  4FK5 C;  4HAM A;  4LF4 B;  3OR6 C;  3FAV B;  1M9N A;  2DWE C;  1N36 B;  3A0H Z;  2RDC A;  3ZHS A;  2JEU A;  4ZI7 B;  1Q82 W;  2UXD O;  5LP6 C;  3K5N A;  4QPJ A;  4JI1 B;  3UM7 A;  4JI5 O;  1J5E O;  1I0H A;  1COW G;  4DV3 B;  3X2Q C;  3CCU V;  3RYF A;  4J7K A;  1N33 B;  4FFB A;  2DMX A;  4W4K A;  4O4L A;  1KUQ A;  3OUS A;  3WFV A;  1PNM A;  3RGB A;  4JAS A;  4DR6 O;  2R9A A;  3OT7 A;  1EZJ A;  4B3M B;  3IJ4 A;  3SJQ C;  2QWO B;  4WFA V;  4XDK A;  2OTL V;  4B7K A;  5LA6 A;  2ILM A;  1WNS A;  1XHX A;  5KUK A;  1FKA O;  2ATK C;  5BMV A;  5C8Y A;  2B9Z A;  2WAM A;  3HB3 B;  1XMQ O;  4DR5 O;  5K1X A;  5IJ9 A;  2YEV B;  5LHG A;  4RUE A;  4AI8 A;  4X1Y A;  1R3I C;  3PN1 A;  3CD6 V;  2JS3 A;  4XDL A;  5A9G A;  3H9V A;  4AQY O;  4OPH A;  1IBK O;  1XEQ A;  1OHH G;  2QWQ B;  4MVU A;  1F23 A;  1GM7 A;  3RW0 A;  3EXA A;  1H2S B;  4ZBM A;  4Z1M G;  2UXD B;  2KG7 A;  3KCY A;  2QM8 A;  3ABT A;  4LC1 A;  1N33 O;  3MHS C;  1XHZ A;  4LF4 O;  2HP8 A;  2LQT A;  1NT2 B;  1K9M W;  3ZRW A;  1E79 G;  3K03 A;  4JI4 O;  2Q68 A;  4GLX A;  4I55 B;  4DUY B;  4J41 A;  3E8H A;  5C93 A;  3TXQ A;  3PJS K;  1Q6H A;  3VOU A;  3T1C A;  4BAY A;  3UT5 B;  4U7O A;  3JAL A;  1ORQ C;  2A7W A;  2CDY A;  5CBF A;  4DR3 O;  4I4T A;  2E74 B;  4UCS A;  3RN4 A;  5CB4 B;  1OCC C;  1XL6 A;  1GH6 A;  1NTK H;  5AG2 A;  2XHB A;  4ASU G;  4B7E A;  2ETN A;  2Y4T A;  3ABL C;  2CTR A;  1MOF A;  4I5S A;  1Q6I A;  5JJE B;  2N04 A;  5B1A B;  3K3W A;  5JVD B;  3TXS A;  1XMQ B;  1GN2 A;  2HFE C;  3B8M A;  3F7V C;  1P7G A;  4UFZ A;  4LFA B;  4G27 B;  4X89 A;  3GB7 C;  5FNV B;  1YTF B;  2ZXW B;  2QA4 V;  4JYC A;  1JCH A;  1MMM A;  5IE9 A;  2ZQM A;  1NQT A;  2CTQ A;  2JIZ G;  4GX0 A;  3WG7 B;  4HNA A;  2HKO A;  3CEI A;  5CB4 A;  1N32 O;  5LGU A;  1FJG O;  1WB8 A;  5H6R A;  3JSN A;  2QE7 G;  3E35 A;  5B3S B;  4X20 A;  3IGA C;  4U7N A;  5LGT A;  2DW4 A;  4JI8 O;  1HNX B;  4ICG A;  2VS0 A;  1O9G A;  1XOU A;  2CH7 A;  3SPJ A;  1OCZ C;  4PD4 F;  3G6E V;  4DUZ O;  4ZKI A;  3CCQ V;  4DR1 B;  1RPO A;  1AI4 A;  1V55 C;  5BY1 A;  4YJ2 A;  2FB5 A;  3H1J H;  2K9P A;  3WB0 A;  3QF7 A;  3JAM N;  3M8A A;  3R66 A;  2AZ0 A;  5L3B A;  1XIL A;  2CUG A;  3E2E A;  2WLL B;  1ROP A;  1SET A;  1FJG B;  5KMG B;  1NI8 A;  2ZXW C;  1I94 B;  4J9Z B;  2HG5 C;  2P6J A;  3JAK B;  5DEC A;  1P84 F;  2DQ3 A;  4JYA O;  2E3C A;  2DE0 X;  4GT1 A;  3GVM A;  1TVK A;  5IYC O;  1YF2 A;  1NZ6 A;  2OWO A;  5B1A C;  1XDC A;  3AK2 A;  1NTM H;  4JAA A;  4O2A A;  4JI6 B;  3ZHU A;  3CRM A;  1VF6 C;  1M56 C;  3LSS A;  2A06 H;  4FJC C;  4QNH B;  1MA1 A;  1PKX A;  3UO2 A;  2IJI A;  3SPI A;  4TV9 A;  4NKG B;  1JMK C;  2QSA A;  3JD4 A;  3GWK C;  3ZRW B;  3D3I A;  3JAW B;  4X1I B;  3BA9 A;  2HR3 A;  2LGW A;  3ZCC A;  4RQF A;  3UT5 A;  1CP9 A;  3C3S A;  5JQG A;  5GTH Z;  2P67 A;  3JAR B;  4GZR B;  1Z5V A;  5CA3 A;  5GTI Z;  3QO8 A;  5ITZ B;  4JI6 O;  4NXN O;  1PNL A;  2GDS A;  4DUZ B;  2YIC A;  1BGY H;  1R6T A;  1RFY A;  5TIS Z;  4DV1 B;  5ITZ A;  3ZX6 A;  4W4L A;  4UB6 Z;  1IX9 A;  4UCV A;  2IM9 A;  4EFE A;  1UPG A;  4DR7 O;  4YY3 O;  3CC4 V;  4K3A A;  2DN9 A;  3LSU A;  3TET A;  3CCR V;  2YXY A;  5J2T A;  2F43 G;  4QPK A;  4P30 A;  2PTM A;  2EZO A;  4GX1 A;  2LW1 A;  2Y0I A;  5IYB O;  4JV5 B;  1VP7 A;  1OCO B;  3HKC B;  1TA8 A;  1K73 W;  1ARO P;  1YDX A;  4DV4 O;  4MTG A;  4NTY A;  1PL0 A;  1L0N H;  3UO3 A;  3E22 A;  3ZN1 A;  3FX7 A;  2IW5 A;  2WLJ A;  1VQL V;  1YIJ V;  2F95 B;  1GM8 A;  4DV5 B;  1YJ9 V;  3OGC C;  2YUA A;  4JI3 B;  3STL C;  1WAZ A;  1Y67 A;  1H2M A;  1YSC A;  2JRI A;  3K59 A;  3LNM B;  4B3T B;  2VQF O;  1GM9 A;  4FM2 A;  1K4C C;  3K58 A;  4UV8 A;  2EX3 A;  5B1B C;  4CH3 A;  4DV3 O;  5CBH A;  1ZLZ A;  4CZZ A;  2CK3 G;  4LF9 O;  4DV0 B;  2F4V B;  4C7U A;  1E1R G;  2GHY A;  1R3L C;  4P9O A;  2IH3 C;  4I9W A;  2WLK A;  5J2U A;  2UXB B;  1PL4 A;  4X1K A;  1QLE B;  1YEW A;  2QM4 A;  2YDE A;  4O2B B;  1B3Q A;  2Q4P A;  1JVM A;  2DYS C;  3K57 A;  1YHQ V;  4PDV A;  4FLV A;  1LUV A;  4PA6 A;  2EIN B;  2R72 A;  4PA9 A;  1K33 A;  2D3O W;  1Y74 B;  3E86 A;  3K9S A;  4LFC O;  1NH2 B;  4TQF A;  1VQP V;  1AR1 B;  2QWP B;  4JAV A;  1BSM A;  4LF9 B;  3KKY A;  3CXC U;  3L71 H;  2ZIO A;  3EVK A;  3E22 B;  1GRJ A;  2IBZ H;  1V55 B;  5KX5 A;  3BAA A;  2KQX A;  3CPW U;  4NYK A;  4LH6 A;  3QNE A;  3QO7 A;  3I56 V;  3ZMS A;  3MAQ A;  2M6Y A;  1UJW B;  4DYL A;  4DV4 B;  4B3T O;  1GAX A;  3CCE V;  3FB6 C;  2EIM C;  2XAJ A;  2PUS A;  2N05 A;  1EBO A;  2XOK G;  4LF8 B;  3JAS B;  1LNQ A;  5FLX N;  4OX9 O;  1HR0 O;  2ZE8 A;  1NR1 A;  1DK1 A;  4TOI A;  3B8N A;  2JK5 C;  3K5L A;  3BPZ A;  3DC6 A;  1BT8 A;  2IJH A;  3BA8 A;  4TWK A;  1YJN V;  2A3Q A;  2DQ0 A;  2VWK A;  1ZAU A;  4WBN A;  3QVN A;  3SJA C;  1XUQ A;  3RYC B;  4HZ3 A;  1AR4 A;  4X8A A;  2YIB D;  1RPR A;  1R73 A;  4JGS A;  3X2Q B;  2HLD G;  4AQY B;  1GN6 A;  5IYD O;  2PGG A;  4XBF A;  4NTW A;  1CPY A;  2FKX A;  4DRX A;  1HR0 B;  3RYC A;  4UCO A;  2FTK A;  3K0D A;  4Q20 A;  1XNR O;  3K9A A;  2JJ2 G;  4BWA A;  1N36 O;  2P06 A;  1JQ0 A;  2OIE A;  4TV8 B;  4N23 A;  3CCL V;  1JPX A;  2GUZ B;  3CXH F;  4J9Y B;  1AR5 A;  2Y48 A;  3D8C A;  2R70 A;  3L74 H;  1WP7 A;  1SQV H;  2NR5 A;  2CE4 A;  4ZHQ A;  1TGO A;  4LFA O;  1IBM O;  4F6E A;  5KHK A;  5LA6 B;  3CYO A;  4O4H B;  3A0R A;  1H8E G;  3DC5 A;  1N4C A;  3K79 A;  3BVO A;  5FL7 G;  4X62 B;  1SKV A;  3K06 A;  4FMT A;  1XNR B;  5IWA B;  3I55 V;  3AG3 B;  4NTX A;  2ZDI C;  4H0L B;  5DM6 V;  4GKJ B;  4PA7 A;  4DV2 B;  3APQ A;  4FLY A;  4LFB B;  1EN5 A;  2QTS A;  3SDL A;  1R3K C;  1F7Y A;  1SER A;  2F23 A;  3HKE B;  2O57 A;  1XMO B;  4B3S O;  3QTC A;  1YI2 V;  2Q0A A;  3Q4H A;  4DV5 O;  2H8P C;  4D7S A;  3ASO C;  4UVA A;  4LR3 A;  1Z5W A;  5E1A C;  3CC7 V;  3CMA V;  1IXM A;  4UCU A;  2YXL A;  4BIO A;  4WFF A;  1WN7 A;  2BTQ A;  2IJK A;  3T2M A;  2ZKO A;  1MSW D;  1S3J A;  4BR6 A;  3EHB B;  2EIL C;  3FKS G;  1N0N A;  4GCZ A;  2ZIM A;  3HKC A;  1W0K G;  3SYA A;  3DSQ A;  2BCC H;  1IVS A;  3ZS8 C;  1YJW V;  1SQG A;  3AG2 B;  4UB8 Z;  1Y74 A;  4DV6 O;  5JCO C;  2XAQ A;  1PP9 H;  4JZ2 A;  4JI2 O;  1R6K A;  4DR5 B;  1X4T A;  3AK1 A;  2ITD C;  4IYI A;  4U3J B;  3GWO A;  3F5W C;  4FLW A;  5JVD A;  4X9Q A;  2QWN B;  4L87 A;  3M7M X;  1D5N A;  2LO1 A;  1PV0 A;  4LBE C;  4I50 A;  3J7A U;  1Q86 W;  1G4Y B;  1M1K W;  4TUY B;  3SJC C;  3HKB A;  1K97 A;  3LUT B;  5IDJ A;  2EIN C;  1M4U A;  2EIM B;  4WCE V;  1ZL8 B;  4P9P A;  1BS3 A;  3CME V;  4MVS A;  1BZK A;  1P49 A;  2DYS B;  4UV9 A;  1M57 B;  5IY5 C;  1JOY A;  5EZY A;  5BMV B;  2PYJ A;  2RMK B;  4MW8 A;  1QQC A;  4B08 A;  2BTQ B;  3H1L H;  3I5D A;  3G4S V;  4WFG A;  1VAR A;  3TCU A;  3CCJ V;  2YID A;  1T5E A;  4I55 A;  3S3X A;  2ZE5 A;  2YSU B;  4Z2W A;  4IGG A;  2AGA A;  1E1Q G;  1HW7 A;  1U96 A;  1SQB H;  5CMU A;  1K4D C;  4BIZ A;  3AG1 C;  3W7W A;  3QG5 A;  2A0L A;  2W0F C;  5B1B B;  3JAS A;  4K8Z A;  3RYI B;  3ABM C;  1H2L A;  2PYL A;  4TV8 A;  1A32 A;  2X6B A;  3RYH A;  1I7F A;  2WLN A;  4FIP C;  2LP7 A;  3FB7 C;  4PEL A;  2XAS A;  3AK3 A;  2B5U A;  5KLV H;  4J7J A;  2JGD B;  4JZG A;  4KHP B;  2OCC B;  1TVK B;  2FL4 A;  1MZF A;  2GTS A;  4R8C A;  3OGI B;  4FM0 A;  4G2K A;  4J11 A;  4LP8 A;  1SC5 B;  1H2N A;  3T1Y O;  5LMU B;  1BMF G;  1VQK V;  1VQ4 V;  2Z0A A;  4F6R A;  4NXM O;  4LF7 B;  1H8H G;  4JAU A;  4R50 A;  3VBB A;  3RYF B;  3NR7 A;  1L1F A;  4YIO A;  1XNQ O;  2QGN A;  2F66 C;  1IXB A;  1OV9 A;  1ZL8 A;  2QKS A;  4TSF G;  2KKW A;  1L8D A;  4JI7 B;  1G6U A;  3W7X A;  4OPA A;  4ZIB A;  2DYR B;  5LP6 B;  2CTP A;  2ZM6 B;  4B3S B;  1XMO O;  3FB5 C;  3ETE A;  1SQQ H;  3TGU H;  1PD3 A;  1NR7 A;  2HHH B;  3HKD B;  1NU1 H;  5KA6 A;  1VQ8 V;  2JVD A;  3SYP A;  4I9Q A;  1JFF A;  1FXV A;  3ETG A;  1B06 A;  1YTF D;  4JI7 O;  1M56 B;  1KP2 A;  4IIJ B;  1QLE C;  1KKD A;  2BOC C;  1MZE A;  1EN4 A;  1AI5 A;  4F4L A;  5B66 Z;  1AP5 A;  2LGQ A;  4J42 A;  5KHJ A;  4FLT A;  5JJJ B;  1M57 C;  5IY5 B;  2Q8V A;  2Y69 B;  3BHP A;  5FPO A;  4PI2 A;  3JD2 A;  4H33 A;  2ZDI A;  3O65 A;  4JYB A;  4GUN A;  1H38 A;  4DV6 B;  2NN4 A;  1WA8 A;  3VQW A;  2W6J G;  5LOV B;  3ZRV A;  1S5J A;  4KFM A;  4CS2 A;  4RAI A;  5CA1 A;  4P2Z A;  2WSS G;  4CS3 A;  4PDM A;  4DR6 B;  1RSO A;  5LGN A;  1QR9 A;  2ZM6 O;  1XNQ B;  3H1I H;  2JGD A;  3T1H B;  4ZHQ B;  4N21 A;  5KAF Z;  1BCC H;  5EIB D;  1D2D A;  1BL8 A;  3CP1 A;  1F51 A;  4JI1 O;  2PI5 A;  2Q7G A;  3HR0 A;  3UKM A;  4J7Z A;  5EYP B;  2Y0P A;  2XAF A;  3ML0 A;  3Q4H B;  4LF5 O;  1ENV A;  1FFX A;  1Y4M A;  2BE3 A;  3FB8 C;  1VQM V;  4O4H A;  1WP8 A;  1XBL A;  3G67 A;  3U11 A;  2UU9 O;  3OMI B;  5EC1 C;  4MT8 A;  3E8G A;  2JS5 A;  3CS5 A;  2HJF C;  4LF6 O;  2OT5 A;  2IJJ A;  3L75 H;  5K1P A;  5FNV A;  1R6N A;  2PF4 E;  4U3J A;  5KMG A;  3W7T A;  4GKK O;  3HKE A;  2Q7H A;  4U3F H;  1B6Q A;  1JJO A;  2LW7 A;  1RM1 B;  2Q7E A;  1N0J A;  4NR1 A;  4GKJ O;  4ZI7 A;  4J80 A;  3JAW A;  3ABU A;  2WLH A;  1NVP D;  3ASN C;  1TUB B;  2RN9 A;  1W2B U;  5KX5 B;  3AEI A;  3CCS V;  2F93 B;  1HP8 A;  1LUW A;  2V1D A;  3CC2 V;  4FZ1 A;  2ADP A;  2VQE O;  1VQO V;  4JI0 B;  3RYI A;  1LR1 A;  3KG2 A;  3P32 A;  2HJD A;  4FPP A;  4IYH A;  2AHZ A;  4CC5 A;  1HDJ A;  3ZIA G;  3H01 A;  4E4E A;  1NS1 A;  5JH7 A;  4HBN A;  1Y76 A;  2BSK B;  3FD9 A;  2WA4 A;  4MVO A;  3BAB A;  4A5U B;  1ZX3 A;  5C8Y B;  4YHH B;  1XRE A;  2BTO A;  2AZ2 A;  3OR7 C;  4DV7 B;  5EBM C;  4IL6 Z;  4DXW A;  1AIL A;  4X88 A;  4K0K O;  3CCV V;  2DJV A;  4DW1 A;  5KUM A;  3VQY A;  3JD3 A;  4LF6 B;  2H3O A;  1VQN V;  2EJR A;  1OJH A;  2RQ6 A;  4MVR A;  1S76 D;  3SYQ A;  3JD0 A;  4H37 A;  3N2K A;  2ARH A;  1HNW B;  4PJ0 Z;  1OCO C;  2YIB A;  2D2C B;  5LBQ A;  1YZB A;  3G71 V;  4IIJ A;  4EB6 A;  2AXT Z;  1CEZ A;  1I5X A;  4LNU A;  3J81 N;  4RWU A;  1HNX O;  1RP3 B;  3T1Y B;  4Q6G A;  2GUZ A;  3CRA A;  2E76 B;  3WU2 Z;  3CWB H;  1JJ2 U;  4H44 B;  5IYZ A;  5J9P C;  2YS8 A;  1F4M A;  1S0V A;  1KD1 W;  1Q81 W;  1XQ8 A;  5LYJ A;  1DF5 A;  3ZMZ A;  3FYE B;  1J5E B;  3D3Q A;  2OIG A;  3MD0 A;  5JWP A;  1URF A;  3H1K H;  2V4D A;  1IBL B;  3WB1 A;  2H94 A;  4BIU A;  2JEX A;  3ZJZ A;  2QJ1 A;  4DR1 O;  4I50 B;  1BHA A;  1GN3 A;  5H2F Z;  1K7D A;  5IT9 N;  1WA8 B;  3OD4 A;  2GTA A;  5BR8 O;  4LFB O;  3N2G B;  3AG4 C;  2KB1 A;  5H9C A;  4AHC A;  2X6C A;  4NB5 A;  3ZN0 A;  2LJ2 A;  1SS3 A;  5J2U B;  3ZHV A;  5CBG A;  3ABK B;  1SQX H;  2QM7 A;  2P4K A;  2X0L A;  2Z3Y A;  4AIL C;  4K0K B;  3ZRS A;  1PPJ H;  1W59 A;  3ABL B;  5E79 Z;  4JPR A;  3P3P A;  1K8A W;  4UCR A; 
#chains in the Genus database with same CATH homology
 2FB5 A;  1WP8 A;  4FZ1 A;  4NTY A;  4NTW A;  2QTS A;  1WP7 A;  2L35 A;  3IJ4 A;  4FZ0 A;  4NYK A;  4NTX A;  3N27 A;  3S3W A;  3S3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...