3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
3S3XA 2QTSA 4NYKA 4NTYA 1WP8A 4FZ1A 4FZ0A 2L35A 3S3WA 4NTWA 4NTXA 1WP7A 2FB5A 3IJ4A 3N27A
chains in the Genus database with same CATH superfamily
1JPXA 5FNVB 1EBOA 3K5NA 4GCZA 3C3TA 4PJ0Z 2B1IA 1QLNA 4LF5O 1L1FA 1P49A 5IT9N 1P7BA 4FLTA 4I0XA 4DV7O 3S3XA 2O57A 1EM1A 3ETGA 5LYJB 1IBKB 1KP2A 4O2AB 2WWWA 2BOCC 5LXTA 5H5NA 1X59A 1ZL8B 2XHBA 1SC5B 4O4LB 1K8AW 2V7QG 3DGEA 5EIBC 5KMGA 4U3JB 3KCXA 1XNQB 4PA9A 4QPJA 3LDDA 3DTUB 2VQFB 1RPOA 5IYZB 3ASOB 1B3QA 1Y67A 2WSSG 4Z1VA 5J2UA 4KFMA 2DMXA 1JX9A 1P84F 2WLIB 2M7WA 1XMOB 1NKDA 1KECA 2GBOA 3SPGA 5JWPA 4ICGA 3OTOB 1ROPA 1S72V 5BMVB 3VOUA 4LFBO 4X1IA 4GX2A 4FZ1A 1JVMA 1MMMA 5LBQA 4B7EA 4IGGA 3NXSA 1OCRB 5EYPB 2YIBD 3ML0A 4D6TH 3AG3C 4X64O 5GONB 4DK1A 3X2QB 2AGAA 1PNLA 3OMNB 3WB0A 1CPYA 1FXHA 1WPXA 3SPHA 2AHZA 1GMGA 3B77A 1OV9A 1K9MW 2BSKB 3ZRWB 4IT5A 2LO1A 3BEHA 4E2LA 5L3CA 1GM9A 2WA4A 3AG1C 4PI2A 5BY1A 1SZXA 3T2MA 4JI4B 1IURA 3SPJA 1ZTEA 2B1GA 4GX0A 4JI0B 3U0ZA 5JH7B 1K92A 3H1JH 1BS3A 1I08A 3WB2A 4I9QA 2R70A 2YIBA 2EIMB 1GTOA 3T1YO 3FX7A 1IXBA 2BTOA 3CPWU 4YY3O 3ZHVA 2A0LA 4AQYO 3HKCB 1R1BA 1AI6A 2Q0AA 2EINB 4QE7A 1EN4A 4LF5B 1XL6A 4AHCA 2ZT9B 3CMAV 4DV7B 5B1BC 2P4KA 4PDRA 4DW1A 2XOKG 1VQ7V 3SPIA 4MVQA 2EILB 2QWOB 2QR4A 4MVOA 4WFFA 5EZYB 1YJNV 1N33O 4TV8B 3SYQA 2Y69B 4CS4A 5KHHA 3RYFA 1AJPA 3J80N 4IHJB 5CA0B 4BAYA 2CE4A 4X65B 5IDJA 2JIZG 3K08A 2PY5A 1SQXH 4PELA 2L6LA 1P4RA 3W7XA 4DV6O 4ASUG 2PYJA 1R3KC 4JAUA 2JJ2G 5JQGB 3JALB 4LFBB 3I56V 4UCSA 4BIOA 4DK0A 3RYIA 5GW7A 4IYHA 2CH7A 2HG5C 5CMUA 3JYCA 1EFRG 4HNAB 3CC7V 2VRZA 4X64B 3IAYA 1WN7A 2QTOA 5AG2A 3CCRV 3G6EV 3CXCU 2JVDA 3ABKC 3P3NA 4O4JB 3AG4C 2XT9A 3E8FA 5IWAO 1AP5A 1N4CA 4JI7O 1YJWV 1WA8A 2OCHA 1SZTA 2HP8A 1AI7A 1IBMO 1EZVH 4IL6Z 1GKFA 3ABLB 1DF5A 2ZIOA 5BZBA 4MVMA 1CXZB 2VWJA 1L0NH 3H1IH 2PF4E 2DE0X 3T1YB 1WP8A 3FAVB 4WBNB 1NH2B 4MT8A 4LFCO 3GWOA 3OMAB 1AJNA 3ZBHA 4B3TO 4X9QA 4AQYB 3LDEA 1QR8A 4TUYB 2HJFC 1Q7YW 1YVWA 4UVBA 4XBFA 3A0RA 2XAQA 4DRXA 1S0VA 3ZS8C 1WNSA 1SA0B 1VEWA 4J9YB 4UUJC 4W4LA 1MSDA 3UO3A 1MOFA 4U7NA 4RQFA 2BTQA 4JPRA 2EIKC 3BRCA 2AW9A 3G71V 1K7DA 1XMQO 5JCOA 2IJHA 2LP7A 1N33B 1Q81W 3L72H 3TETA 4YIPA 1Q82W 1ZWIC 1FAFA 2F4VO 4JI8O 5EBLC 5ITZB 3K0GA 1WPBA 1I7FA 4BIUA 5JJNB 2YXYA 1MA1A 2YDEA 3RFRA 3N2GB 4O4IA 4H0LB 2AZ2A 2W0XA 2QKCA 4RAIA 4DV6B 1Z5VA 2QJ1A 2Q67A 4G27B 5EYPA 4IIJA 4WFGA 1R6NA 1YTFB 3CCMV 3FFQA 4F4LA 2QSAA 2A3QA 1OCZB 2GDSA 1R6TA 4JAVA 1GO3F 1PM9A 2W6JG 4TQFA 4LF9O 5IJ0A 4I50B 2UUAO 2BSKA 4XDKA 3ZRWA 1QBZA 1SQBH 1NR7A 4HBNA 4TWKA 1K34A 1G6UA 1LR1A 4LR3A 1WP7A 5CBHA 5D5PA 3LSUA 4ZHQB 4ZI7B 4L87A 2AXTZ 4UVCA 3ZRSA 2F66C 5DECA 5CB4A 2FTKA 2EX3A 3TGUH 3CHXA 5H6RA 3CCUV 3J81N 3HKDA 5IWAB 2DYSB 2W0FC 4JI7B 4LFAO 3ZEDA 1IBMB 1DK1A 3F7YC 2YS8A 4RUEA 3MAQA 4O4HA 1NR1A 2ITDC 4EEQA 4KUMA 4WFAV 1QU7A 5HFMA 3ZCCA 4MVUA 1BSMA 1OHHG 4DV4O 4FFKA 2ZXWC 2CGNA 4RQEA 1VP7A 4LFCB 1GAXA 4LC1A 4B3TB 1N0JA 4GKJO 4R6ZA 1KKCA 2Q69A 4K3AA 4FLYA 3HKBA 2FKXA 3CD6V 1FXVA 5EZYA 3A8TA 4BR6A 4TV8A 3DSQA 2QWQB 5FPRA 2DWEC 4RO2A 2P06A 4PDMA 1M57C 3H1HH 4LH7A 3CC2V 3AK1A 3HKEA 5A2QN 2DWDC 4JGSA 1H2NA 4F6EA 1R3JC 4TT3G 4QPKA 4DR2O 1XMQB 1XQ8A 2QWPB 2QWNB 1BQ0A 5C8YA 1RSOA 3N2KB 2N04A 2F4VB 2CDYA 4JI8B 3QNEA 3RYHA 3E22B 5CBGA 2IJIA 1QQCA 4MVRA 4B08A 5JQGA 4JYBA 4TSFG 1WAZA 1L0LH 3DXRB 3HPLC 4JI5O 3N27A 3CRAA 4OPAA 2WLKA 1KKDA 4LNUB 2YICA 4DV1O 1Q8IA 1UJWB 4DR3O 2XAHA 1I94B 1PP9H 2ZDIC 3ASNC 2X7RB 3L9DA 3A0HZ 1YEWA 3G4SV 2BCCH 4FM2A 3OW2U 2YI8A 4LF9B 1QLEB 2UUAB 5F2VO 1AP6A 3OM3B 2LW1A 5JVDB 1US6A 4YJ2B 4UCOA 4JI2O 1GK9A 4D7TA 3G6BA 1YJ9V 3OR7C 4DW0A 1Q86W 2JEXA 1XREA 3L74H 4RUFA 2ATKC 4PA4A 3AK2A 3H1KH 3SJBC 3G67A 3SYAA 3K5LA 1OCCC 5JCOC 1GM8A 4RWUA 2OCCC 1GN3A 1XL4A 3SPCA 1U96A 1ZX3A 2ILMA 5CN0A 2F43G 4U7OA 4K8ZA 5KAFZ 4LFAB 5EBMC 1OCOB 3K9SA 5H6QA 2HHHO 3R65A 2UXCO 4DV0B 4H44B 3AG2B 1RPRA 2QWRB 4I4TA 1OCRC 3SYOA 3ZHUA 2RN9A 2IW5A 4GT1A 3ZHQA 4UCVA 4J11A 1SESA 4NXMO 1YTFD 4AI8A 4DV4B 1JA8A 2LFRA 3CCJV 4LP8A 5KAIZ 1QVFU 4GKJB 1MZEA 5FL7G 2QKAA 1N8RW 2GUZB 1SQPH 3D3QA 2G38A 4O2BA 1FXKB 3ZHRA 2XASA 5LOVB 1M56C 3RBZA 2UXBO 2HEPA 3JARB 4YHHO 4I55B 5IE9A 4FFBB 5K1PA 2RDCA 3BPZA 4DR2B 1JFFB 2Y0IA 3BVOA 4X65O 3BHPA 1M93A 4LCUC 1LNQA 2A7WA 3E86A 4P9OA 3CCQV 2X6AA 5IY5B 1FFXA 3CJHA 3IC9A 1NBMG 5TISZ 2EJRA 3ZHTA 3OR6C 4JV5O 1SQFA 4JI5B 1UPGA 1VIBA 4DV1B 4IYIA 4DR3B 4JYAO 1FPOA 5KHGA 4OX9O 2N05A 1XUQA 2WLLB 2OTLV 3CXHF 2OIEA 2ZCEA 1SQGA 2Y4TA 3CMEV 3K59A 4OXSA 1SF9A 5LHGA 2DYRC 4JI2B 3ETEA 5EBWC 1MABG 3IGAC 1GRJA 4DUZO 2Y69C 1TA8A 3UT5B 3G80A 3JASB 4JI6O 3FYEB 3ETQA 3I5DA 3OE7G 1NVPB 2DQ0A 1W2BU 3OEEG 4FM0A 2ZE8A 2K1EA 2CTRA 5J2TB 1K73W 5KA6A 2IBZH 2RQ6A 1IDSA 4ZOLA 2Q73A 1KD1W 2CUGA 2KSDA 3RYCB 4NR1A 2MW2B 1GH6A 3APQA 3Q4HA 2ITCC 2IM9A 2IU0A 4Z2WA 1KBHA 5LA6B 4P2ZA 2P67A 2HHHB 1D2DA 1ENVA 2UXCB 3UQ8A 4EB6B 5KA5A 3KKYA 3CCLV 2JGDA 3D36A 4MTFA 2ZKOA 1V9PA 1FFTB 2JJ1G 2CTPA 3EVKA 1K3EA 1RP3B 2HLDG 1JMKC 3OGIB 4NXMB 2Q68A 5B1OA 4DR5O 5B66Z 4BW9A 3K79A 2P22C 1S77D 4P9PA 1BZKA 5CBFA 3W7SA 5C93A 2CK3G 2P6JA 2NLJC 3JAWB 2YC0A 3IJ4A 3JD0A 2UXBB 3ABMB 2EIJC 4P30A 2W6IG 1AROP 4YHHB 3MHSC 4H33A 2ADQB 2C2AA 1PNKA 3TK1A 1AJQA 3JCUZ 3BCCH 1YZBA 4JTAB 3GVMA 1EN5A 2E76B 3AG3B 1RM1C 4PDLA 3R66A 4WFBV 2JEUA 4X1YB 5L3FA 2QE7G 2DOSA 4DR7O 4CBCA 2LGQA 4OGQB 4BIZA 1H8EG 5L3EA 3JATB 1L8DA 1AB3A 1IXMA 2PGGA 2F1MA 3TXQA 3L73H 1KQSU 4I5SA 2GSMB 3F7VC 1AI5A 4NTXA 4JV5B 3SJQC 4CH6A 2H94A 2E75B 4K0KO 3AG1B 5JVDA 1M5IA 1F51A 3CB2A 4JYAB 2Z3YA 1IVSA 1HNZO 4OX9B 3K57A 1BE3H 4FJCC 4LF6O 1KB9F 2P7TC 1YF2A 2ZR3A 1H2LA 2IH1C 4H13B 2E74B 1N32O 1FJGO 4BWAA 1M90W 2HVJC 4DUZB 5D5QA 1PPJH 4JI6B 4ZIBA 2UXDO 3DC5A 3BAAA 5B5EZ 2XTAA 3S3WA 1NS1A 4FLUA 2KG7B 1BHBA 3B4SA 4BW5A 2A06H 4KHPO 3ZMVA 4FLVA 3ABTA 5B1BB 4QE9A 1TUBB 5IYBO 4Z1MG 2VQEO 5FNVA 1EZJA 1XHZA 1H38A 5BXZA 2AZ0A 2UXNA 3L71H 5B3SC 1I0HA 3LUTB 1ZAUA 2K9PA 2FMLA 3FB5C 1J95A 4ZBMA 5LYJA 4O2AA 1Q90D 3KCYA 1FXKA 4NTWA 4QIWF 1ZL8A 4DR5B 5LOVA 2VWKA 4GYCB 4CH3A 4O4LA 2L35A 4PD4F 3OMIB 4X62O 3RGBA 1LUWA 4G2KA 3JARA 2LJ2A 3FB6C 4FFBA 1Y66A 2QDOA 4U3JA 2HR3A 1HNWO 4JZGA 1JFFA 3IFXA 2YIDA 5IYZA 3JCZA 1SS3A 2F93B 4X66O 4GLXA 2ZINA 3CS5A 4JTDB 2WLIA 4CH4A 3QF7A 3MDSA 3E89A 1O9GA 4I0XB 2OTJV 3JAMN 3APOA 5BMVA 4KP4A 2CTQA 4DR7B 4CC5A 4ZKIA 5LXTB 1LUVA 2ZE5A 4DUYO 1TVKB 1WJZA 4NXNO 3O65A 1XDCA 2ZE7A 5GONA 3ABKB 1I94O 5KMGB 3D36C 3JAKB 2XAJA 3AG4B 3FB7C 3M7MX 3MHHC 1XOUA 4UCUA 4K0KB 5LP6B 4JYCA 4KL1A 1HNZB 1J5EB 2N74A 3CE2A 4PI0A 2XNDG 3JASA 4LF6B 4J41A 4B3RO 4NTYA 1YIJV 2IJKA 3SDLA 2R9RB 5J2UB 4D7SA 4UVAA 5JJJB 1N32B 1FJGB 4MVSA 3LNMB 1YXBA 1BGYH 2UXDB 4X1IB 2UUCO 5B1NA 5JH7A 1JQ0A 2B9ZA 5LA6A 3CCSV 3RWRD 5KX5B 4UV9A 4KHPB 3RVYA 1VQNV 4GX5A 1E1RG 3H1LH 4YIOA 1M4UA 3C90A 4DR6B 1ZSPA 4DV0O 2VQEB 1IX9A 4JI1O 1SERA 3HKCA 4WFEA 2P90A 3UO2A 1F7YA 2HVKC 2FL4A 4J10A 1F4MA 4MTXA 3CP1A 4TV9B 1DTOA 1URFA 1FKAO 1AVMA 1BMFG 1N0NA 1S76D 1F23A 2YIAA 5KHKA 4J7ZA 4FPPA 4MW3A 1EN6A 3EHBB 4X62B 4DV3O 3SJAC 3ZIAG 5GTHZ 3JD2A 4JASA 2QM7A 1HNWB 1NTZH 3O9OA 1JR9A 4IHJA 1V54C 5CA0A 4X89A 5HFLA 2X6CA 1HNXO 4OPHA 3B8MA 4X1YA 3ZN0A 4DXWA 2WA3A 1BQZA 1CEZA 2P5OA 4X66B 3WU2Z 1FS0G 3JATA 1V55C 2BOBC 3RVZA 4DR4B 1GM7A 3KG2A 3E8HA 3AG2C 4JAAA 4DR1O 3BA8A 1E1QG 1CP9A 2NR5A 3JALA 4MVZA 1M9NA 2MK3A 3BABA 3VBBA 1WB8A 3FKSG 3OFNG 1HWYA 4DUYB 1R3IC 2JGUA 4NVPA 4EKWA 4NXNB 4HNAA 4LF8O 1D5AA 3LSSA 1DLBA 4Q6GA 1QR9A 2JS5A 3QO5A 5LHHA 1NH2D 1TAEA 3RYFB 4DV5O 4EFEA 4X1KB 5KHJA 1G4YB 2D3OW 1KU9A 4NKGB 5KHIA 1TGOA 3KZIZ 5A9GA 2FYUH 3SJCC 1ORQC 2Q8VA 4N21A 4B3RB 2ARHA 5K1XA 4O4JA 5E1AC 4J42A 2KG7A 3I55V 2ZQMA 2LW7A 3W7TA 2B5UA 3CRQA 3ZMZA 4B3MO 5BR8B 4F6RB 3CRMA 2ZXWB 3ASOC 4PDVA 2UUCB 3BA9A 2CH7B 1W59A 3WFVA 4B3SB 2FB5A 4UXNA 2Q7EA 4I9WA 1N34O 3JD4A 3UM7A 4QJFB 3EFFK 3FAVA 4WBNA 1XBLA 3WG7B 1K97A 2YXLA 3THOA 4A5UB 1VQ8V 4JI1B 2GTSA 1R6KA 4TUYA 1W0KG 3K9AA 3ZRVA 2Z5UA 2PI4A 3X2QC 4FMTA 4X8AA 1SRYA 3P3PA 1FYJA 1SA0A 2ZE6A 3SGIA 4MTGA 1KP3A 3OD4A 3E8GA 1SQVH 2QGNA 1PNMA 2EJ7A 3ZJZA 4PHZA 2Z0AA 3MD0A 1SKVA 4CS3A 1WA8B 3FD9A 4DV3B 1F4NA 2AHYA 4LF7O 2UUBO 2Q7HA 1O9HA 5CA1B 3K5OA 5ITZA 3K0DA 4CH5A 4JI3O 4CZZA 1VQLV 1HNXB 1KUQA 3ASNB 1Q6HA 1Q6UA 1VQMV 3N2GA 3CWBH 5B1AB 4LWSB 1AILA 2JRIA 4FLZA 2E3CA 2Q0OC 2X0LA 1TVKA 2ZNIA 4GKKO 2WLNA 1GN2A 1QHTA 2GTAA 2EIMC 1THZA 4DR1B 3RN4A 3LSQA 4FLXA 1JJOA 3JAKA 4NB5A 4DRXB 1VF6A 3LDCA 2IJJA 5LP6A 3PJSK 1ZLZA 4HYOA 1Q6IA 1VQ9V 2RMKB 5IJ9B 1VQPV 4I50A 1VQ4V 4LF8B 1VF7A 2BTQB 2EINC 4YJ3B 4KXRA 2RJZA 1OCCB 3K58A 4DV5B 2OCCB 1MG1A 4X20B 1T5EA 2YEVB 2EILC 2GHYA 3ABMC 4ZHQA 4ZI7A 4MW8A 4O4IB 2CGOA 2DJVA 1OZ0A 2JDIG 5KX5A 4IIJB 3H9VA 3OUFA 3CRRA 4B3MB 1BL8A 2IH3C 1XI1A 1G1XB 4L8JA 4JTCB 2A79B 2UXXA 1GN4A 3K03A 4FZ0A 3CYOA 3C3SA 5IJ0B 1Z2GA 4TOIA 1N34B 2Q5ZA 2QKSA 4TV9A 4N23A 1HDJA 2V4DA 1M56B 4LH6A 1H2KA 2OIGA 3ZX6A 4XDLA 3ZMUA 3QVNA 1Y74B 1K4CC 5DM6V 3K04A 1KC8W 2D2CB 3F5TA 3ZRXA 4JF3A 3U11A 5CB4B 3QG5A 1RFYA 1NTMH 2P4VA 2OT5A 2EULA 2A9HA 1H2MA 3HKDB 4U3FH 1K33A 2Q7GA 1Y4MA 4LF7B 2UUBB 2XAGA 1KMIZ 4O4HB 3N2KA 4J80A 3T1HO 3E22A 4JI3B 4UV8A 3FB8C 2E5LO 3P30A 3H01A 1SETA 1Y76B 3JSLA 3ABLC 2EZPA 3HKBB 4GKKB 3DXRA 1E79G 2WAMA 5CA3A 2DYRB 3D3IA 4B7KA 4LNUA 2PZSA 4AILC 2WLJA 4I7ZB 4X1KA 1X4TA 1JOYA 4QGPA 3T4DA 3OGCC 3A2FA 3M8AA 3HKEB 2OYQA 3QTCA 4YJ2A 5C8YB 2LGWA 1J5EO 1RSOB 2QTSA 4LBEC 3ZHSA 3M99B 1YCIA 3B2EE 1NZ6A 3PN1A 3RYHB 4FM1A 3OT7A 3B8NA 4F6RA 3W7UA 3SYCA 3JD3A 1VF5B 2KQXA 1NI8A 3WB1A 1VQKV 5KLVH 5EK0A 1HP8A 1MZFA 3VQVA 3OAAG 4FIPC 2CTWA 2LQTA 4Q20A 3HB3B 2V1DA 1NT2B 5L3GA 1M1KW 5JJEB 3W7WA 1N36O 2Q4PA 3U10A 4TQDA 1Y6XA 2H8PC 4J7JA 4DR6O 1Q43A 2HKOA 2Y48A 2WLHA 4NYKA 4R8CA 4J9ZB 1H2GA 4XDJA 2EBOA 1S5LZ 1NJIW 1OCZC 3L75H 2EIJB 1VF6C 2Q6AA 5LP6C 1NU1H 4X88A 1PL0A 4JZ2A 1GN6A 2PYLA 4MSWC 3CC4V 5GTIZ 2ZM6O 1U97A 2Y0PA 2GUZA 2HJDA 1RM1B 1BCCH 4G28B 2GV9A 2PI5A 1W0JG 3LNNA 4R50A 5CA1A 4I55A 3K06A 4W4KA 4H37A 1VQOV 3ABUA 1HR0O 2ZDIA 1I5YA 1YI2V 3F5WC 4DYLA 4YY3B 4K8XA 3STLC 4LWSA 4CS2A 3CEIA 4I4TB 1ZUQA 3OEHG 4UB8Z 2ZNJA 1IBLO 1K4DC 3T1HB 4JYYA 2DN9A 1AR1B 1AI4A 1NVPD 1YDXA 2DYSC 2KB1A 2KKWA 2PTMA 2HFEC 4DR4O 2E5LB 1K5QA 1A32A 2M6YA 1DGSA 5LGNA 3P32A 2WLMA 5IJ9A 3T1CA 4HZ3A 3STZC 4O2BB 1S5HC 5H9CA 4LF4O 3AK3A 2F23A 4YJ3A 5LMNO 3BFRA 3A0BZ 2WLLA 3ZN1A 4DV2O 5LMUO 4X20A 4WCEV 4PA7A 2YEVA 5LL6Y 5EIBD 4YXWG 2X6BA 3ZMTA 3NR7A 3E35A 4UB6Z 5EC2C 5L3DA 4EFBA 3VQWA 1H2SB 3UT5A 1PL4A 4ABMA 3FYIB 1JCHA 5FLXN 4FVMA 2R9IA 1FFXB 4UCTA 3CJHB 3RW0A 3ZMSA 5J2TA 3DC6A 4MS2A 1Q3EA 5B3SB 3VQYA 2YUAA 3JD1A 1K5SA 3CX5F 3OUSA 2QEXV 1HW7A 5BR8O 1Q5OA 2JS3A 3RYCA 2BE3A 1JJ2U 5FPOA 4R7CA 1N36B 2DW4A 1DF4A 4B3SO 4EB6A 3SR2C 1MNGA 1XNRO 2NNUA 1KYOF 2ZIMA 1Y74A 2CAZC 1S5JA 4K35A 1PV0A 4FK5C 2YI9A 1UFIA 1XEQA 3T4ZA 2EIKB 4GZRB 1D5NA 1QLEC 2ZM6B 1YHQV 1VQ5V 4PA6A 4GX1A 3K5MA 5J9PC 3JAWA 3QO7A 4ZOLB 3TCUA 3ICXA 2NN4A 2H3OA 2ADPA 3K3WA 4UFZA 5L3BA 2WPDG 4WF9V 3Q4HB 3CCEV 5KUMA 2IU3A 2UU9O 1FD9A 1HR0B 4CC6A 1VARA 1B06A 4HAMA 4DO2A 4GUNA 1P7GA 1Y76A 3E2EA 4MTOA 2JGDB 2DQ3A 2Q9LA 2Y4UA 3UKMA 1IBLB 1BT8A 3UCSC 1QVGU 1PD3A 1IBKO 3B40A 1XILA 5DEDA 3VQXA 1QCEA 1WB7A 1OCOC 3WG7C 1WLEA 2RCVA 1VMGA 2R72A 1VQ6V 1NQTA 2YXHA 2QM8A 3AG7A 1XNQO 2ETNA 4LF4B 5LMNB 2RNBA 1G8MA 4QNHB 2VQFO 3JSNA 4DV2B 5LMUB 2F95B 3B09A 5H2FZ 2QM4A 4WFHA 4PA3A 5KUKA 4J7KA 1XMOO 1YITV 4UCRA 1IZ3A 1FXKC 3E83A 3E8BA 3OTOO 5IYDO 4C7UA 2LFSA 3ETDA 1SQQH 2VS0A 1XHXA 2ODMA 3D8CA 3QO8A 1OJHA 5LGUA 1PKXA 2QA4V 3HR0A 1R3LC 1COWG 5B1AC 1TUBA 1I5XA 3TXSA 2OWOA 3RYIB 5IY5C 2EZOA 3CCVV 3AEIA 1B04A 2ZR2A 2XAFA 3GB7C 5EC1C 3TJTA 5DN6G 1XNRB 2XUMA 3EXAA 1YSCA 4E4EA 5LGTA 2R9AA 3L70H 4FLWA 1QNMA 3GWKC 1M57B 1V54B 1S3JA 1Z5WA 2JK5C 5E79Z 3CRCA 3BY6A 4JI4O 1H8HG 3OTFA 4JI0O 3IC7A 1V55B 1B6QA 1R73A 1TUEB 3CSXA 3RT3C 4PV1B 5IYCO 2YSUB 1MSWD 1AR5A 2PUSA 2ZD9A 3SYPA 3J7AU 1BHAA 5LHIA 1AR4A 1NTKH 2UU9B
chains in the Genus database with same CATH topology
3S3XA 2QTSA 4NYKA 4NTYA 1WP8A 4FZ1A 4FZ0A 2L35A 3S3WA 4NTWA 4NTXA 1WP7A 2FB5A 3IJ4A 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3X A;  2QTS A;  4NYK A;  4NTY A;  1WP8 A;  4FZ1 A;  4FZ0 A;  2L35 A;  3S3W A;  4NTW A;  4NTX A;  1WP7 A;  2FB5 A;  3IJ4 A;  3N27 A; 
#chains in the Genus database with same CATH topology
 1JPX A;  5FNV B;  1EBO A;  3K5N A;  4GCZ A;  3C3T A;  4PJ0 Z;  2B1I A;  1QLN A;  4LF5 O;  1L1F A;  1P49 A;  5IT9 N;  1P7B A;  4FLT A;  4I0X A;  4DV7 O;  3S3X A;  2O57 A;  1EM1 A;  3ETG A;  5LYJ B;  1IBK B;  1KP2 A;  4O2A B;  2WWW A;  2BOC C;  5LXT A;  5H5N A;  1X59 A;  1ZL8 B;  2XHB A;  1SC5 B;  4O4L B;  1K8A W;  2V7Q G;  3DGE A;  5EIB C;  5KMG A;  4U3J B;  3KCX A;  1XNQ B;  4PA9 A;  4QPJ A;  3LDD A;  3DTU B;  2VQF B;  1RPO A;  5IYZ B;  3ASO B;  1B3Q A;  1Y67 A;  2WSS G;  4Z1V A;  5J2U A;  4KFM A;  2DMX A;  1JX9 A;  1P84 F;  2WLI B;  2M7W A;  1XMO B;  1NKD A;  1KEC A;  2GBO A;  3SPG A;  5JWP A;  4ICG A;  3OTO B;  1ROP A;  1S72 V;  5BMV B;  3VOU A;  4LFB O;  4X1I A;  4GX2 A;  4FZ1 A;  1JVM A;  1MMM A;  5LBQ A;  4B7E A;  4IGG A;  3NXS A;  1OCR B;  5EYP B;  2YIB D;  3ML0 A;  4D6T H;  3AG3 C;  4X64 O;  5GON B;  4DK1 A;  3X2Q B;  2AGA A;  1PNL A;  3OMN B;  3WB0 A;  1CPY A;  1FXH A;  1WPX A;  3SPH A;  2AHZ A;  1GMG A;  3B77 A;  1OV9 A;  1K9M W;  2BSK B;  3ZRW B;  4IT5 A;  2LO1 A;  3BEH A;  4E2L A;  5L3C A;  1GM9 A;  2WA4 A;  3AG1 C;  4PI2 A;  5BY1 A;  1SZX A;  3T2M A;  4JI4 B;  1IUR A;  3SPJ A;  1ZTE A;  2B1G A;  4GX0 A;  4JI0 B;  3U0Z A;  5JH7 B;  1K92 A;  3H1J H;  1BS3 A;  1I08 A;  3WB2 A;  4I9Q A;  2R70 A;  2YIB A;  2EIM B;  1GTO A;  3T1Y O;  3FX7 A;  1IXB A;  2BTO A;  3CPW U;  4YY3 O;  3ZHV A;  2A0L A;  4AQY O;  3HKC B;  1R1B A;  1AI6 A;  2Q0A A;  2EIN B;  4QE7 A;  1EN4 A;  4LF5 B;  1XL6 A;  4AHC A;  2ZT9 B;  3CMA V;  4DV7 B;  5B1B C;  2P4K A;  4PDR A;  4DW1 A;  2XOK G;  1VQ7 V;  3SPI A;  4MVQ A;  2EIL B;  2QWO B;  2QR4 A;  4MVO A;  4WFF A;  5EZY B;  1YJN V;  1N33 O;  4TV8 B;  3SYQ A;  2Y69 B;  4CS4 A;  5KHH A;  3RYF A;  1AJP A;  3J80 N;  4IHJ B;  5CA0 B;  4BAY A;  2CE4 A;  4X65 B;  5IDJ A;  2JIZ G;  3K08 A;  2PY5 A;  1SQX H;  4PEL A;  2L6L A;  1P4R A;  3W7X A;  4DV6 O;  4ASU G;  2PYJ A;  1R3K C;  4JAU A;  2JJ2 G;  5JQG B;  3JAL B;  4LFB B;  3I56 V;  4UCS A;  4BIO A;  4DK0 A;  3RYI A;  5GW7 A;  4IYH A;  2CH7 A;  2HG5 C;  5CMU A;  3JYC A;  1EFR G;  4HNA B;  3CC7 V;  2VRZ A;  4X64 B;  3IAY A;  1WN7 A;  2QTO A;  5AG2 A;  3CCR V;  3G6E V;  3CXC U;  2JVD A;  3ABK C;  3P3N A;  4O4J B;  3AG4 C;  2XT9 A;  3E8F A;  5IWA O;  1AP5 A;  1N4C A;  4JI7 O;  1YJW V;  1WA8 A;  2OCH A;  1SZT A;  2HP8 A;  1AI7 A;  1IBM O;  1EZV H;  4IL6 Z;  1GKF A;  3ABL B;  1DF5 A;  2ZIO A;  5BZB A;  4MVM A;  1CXZ B;  2VWJ A;  1L0N H;  3H1I H;  2PF4 E;  2DE0 X;  3T1Y B;  1WP8 A;  3FAV B;  4WBN B;  1NH2 B;  4MT8 A;  4LFC O;  3GWO A;  3OMA B;  1AJN A;  3ZBH A;  4B3T O;  4X9Q A;  4AQY B;  3LDE A;  1QR8 A;  4TUY B;  2HJF C;  1Q7Y W;  1YVW A;  4UVB A;  4XBF A;  3A0R A;  2XAQ A;  4DRX A;  1S0V A;  3ZS8 C;  1WNS A;  1SA0 B;  1VEW A;  4J9Y B;  4UUJ C;  4W4L A;  1MSD A;  3UO3 A;  1MOF A;  4U7N A;  4RQF A;  2BTQ A;  4JPR A;  2EIK C;  3BRC A;  2AW9 A;  3G71 V;  1K7D A;  1XMQ O;  5JCO A;  2IJH A;  2LP7 A;  1N33 B;  1Q81 W;  3L72 H;  3TET A;  4YIP A;  1Q82 W;  1ZWI C;  1FAF A;  2F4V O;  4JI8 O;  5EBL C;  5ITZ B;  3K0G A;  1WPB A;  1I7F A;  4BIU A;  5JJN B;  2YXY A;  1MA1 A;  2YDE A;  3RFR A;  3N2G B;  4O4I A;  4H0L B;  2AZ2 A;  2W0X A;  2QKC A;  4RAI A;  4DV6 B;  1Z5V A;  2QJ1 A;  2Q67 A;  4G27 B;  5EYP A;  4IIJ A;  4WFG A;  1R6N A;  1YTF B;  3CCM V;  3FFQ A;  4F4L A;  2QSA A;  2A3Q A;  1OCZ B;  2GDS A;  1R6T A;  4JAV A;  1GO3 F;  1PM9 A;  2W6J G;  4TQF A;  4LF9 O;  5IJ0 A;  4I50 B;  2UUA O;  2BSK A;  4XDK A;  3ZRW A;  1QBZ A;  1SQB H;  1NR7 A;  4HBN A;  4TWK A;  1K34 A;  1G6U A;  1LR1 A;  4LR3 A;  1WP7 A;  5CBH A;  5D5P A;  3LSU A;  4ZHQ B;  4ZI7 B;  4L87 A;  2AXT Z;  4UVC A;  3ZRS A;  2F66 C;  5DEC A;  5CB4 A;  2FTK A;  2EX3 A;  3TGU H;  3CHX A;  5H6R A;  3CCU V;  3J81 N;  3HKD A;  5IWA B;  2DYS B;  2W0F C;  4JI7 B;  4LFA O;  3ZED A;  1IBM B;  1DK1 A;  3F7Y C;  2YS8 A;  4RUE A;  3MAQ A;  4O4H A;  1NR1 A;  2ITD C;  4EEQ A;  4KUM A;  4WFA V;  1QU7 A;  5HFM A;  3ZCC A;  4MVU A;  1BSM A;  1OHH G;  4DV4 O;  4FFK A;  2ZXW C;  2CGN A;  4RQE A;  1VP7 A;  4LFC B;  1GAX A;  4LC1 A;  4B3T B;  1N0J A;  4GKJ O;  4R6Z A;  1KKC A;  2Q69 A;  4K3A A;  4FLY A;  3HKB A;  2FKX A;  3CD6 V;  1FXV A;  5EZY A;  3A8T A;  4BR6 A;  4TV8 A;  3DSQ A;  2QWQ B;  5FPR A;  2DWE C;  4RO2 A;  2P06 A;  4PDM A;  1M57 C;  3H1H H;  4LH7 A;  3CC2 V;  3AK1 A;  3HKE A;  5A2Q N;  2DWD C;  4JGS A;  1H2N A;  4F6E A;  1R3J C;  4TT3 G;  4QPK A;  4DR2 O;  1XMQ B;  1XQ8 A;  2QWP B;  2QWN B;  1BQ0 A;  5C8Y A;  1RSO A;  3N2K B;  2N04 A;  2F4V B;  2CDY A;  4JI8 B;  3QNE A;  3RYH A;  3E22 B;  5CBG A;  2IJI A;  1QQC A;  4MVR A;  4B08 A;  5JQG A;  4JYB A;  4TSF G;  1WAZ A;  1L0L H;  3DXR B;  3HPL C;  4JI5 O;  3N27 A;  3CRA A;  4OPA A;  2WLK A;  1KKD A;  4LNU B;  2YIC A;  4DV1 O;  1Q8I A;  1UJW B;  4DR3 O;  2XAH A;  1I94 B;  1PP9 H;  2ZDI C;  3ASN C;  2X7R B;  3L9D A;  3A0H Z;  1YEW A;  3G4S V;  2BCC H;  4FM2 A;  3OW2 U;  2YI8 A;  4LF9 B;  1QLE B;  2UUA B;  5F2V O;  1AP6 A;  3OM3 B;  2LW1 A;  5JVD B;  1US6 A;  4YJ2 B;  4UCO A;  4JI2 O;  1GK9 A;  4D7T A;  3G6B A;  1YJ9 V;  3OR7 C;  4DW0 A;  1Q86 W;  2JEX A;  1XRE A;  3L74 H;  4RUF A;  2ATK C;  4PA4 A;  3AK2 A;  3H1K H;  3SJB C;  3G67 A;  3SYA A;  3K5L A;  1OCC C;  5JCO C;  1GM8 A;  4RWU A;  2OCC C;  1GN3 A;  1XL4 A;  3SPC A;  1U96 A;  1ZX3 A;  2ILM A;  5CN0 A;  2F43 G;  4U7O A;  4K8Z A;  5KAF Z;  4LFA B;  5EBM C;  1OCO B;  3K9S A;  5H6Q A;  2HHH O;  3R65 A;  2UXC O;  4DV0 B;  4H44 B;  3AG2 B;  1RPR A;  2QWR B;  4I4T A;  1OCR C;  3SYO A;  3ZHU A;  2RN9 A;  2IW5 A;  4GT1 A;  3ZHQ A;  4UCV A;  4J11 A;  1SES A;  4NXM O;  1YTF D;  4AI8 A;  4DV4 B;  1JA8 A;  2LFR A;  3CCJ V;  4LP8 A;  5KAI Z;  1QVF U;  4GKJ B;  1MZE A;  5FL7 G;  2QKA A;  1N8R W;  2GUZ B;  1SQP H;  3D3Q A;  2G38 A;  4O2B A;  1FXK B;  3ZHR A;  2XAS A;  5LOV B;  1M56 C;  3RBZ A;  2UXB O;  2HEP A;  3JAR B;  4YHH O;  4I55 B;  5IE9 A;  4FFB B;  5K1P A;  2RDC A;  3BPZ A;  4DR2 B;  1JFF B;  2Y0I A;  3BVO A;  4X65 O;  3BHP A;  1M93 A;  4LCU C;  1LNQ A;  2A7W A;  3E86 A;  4P9O A;  3CCQ V;  2X6A A;  5IY5 B;  1FFX A;  3CJH A;  3IC9 A;  1NBM G;  5TIS Z;  2EJR A;  3ZHT A;  3OR6 C;  4JV5 O;  1SQF A;  4JI5 B;  1UPG A;  1VIB A;  4DV1 B;  4IYI A;  4DR3 B;  4JYA O;  1FPO A;  5KHG A;  4OX9 O;  2N05 A;  1XUQ A;  2WLL B;  2OTL V;  3CXH F;  2OIE A;  2ZCE A;  1SQG A;  2Y4T A;  3CME V;  3K59 A;  4OXS A;  1SF9 A;  5LHG A;  2DYR C;  4JI2 B;  3ETE A;  5EBW C;  1MAB G;  3IGA C;  1GRJ A;  4DUZ O;  2Y69 C;  1TA8 A;  3UT5 B;  3G80 A;  3JAS B;  4JI6 O;  3FYE B;  3ETQ A;  3I5D A;  3OE7 G;  1NVP B;  2DQ0 A;  1W2B U;  3OEE G;  4FM0 A;  2ZE8 A;  2K1E A;  2CTR A;  5J2T B;  1K73 W;  5KA6 A;  2IBZ H;  2RQ6 A;  1IDS A;  4ZOL A;  2Q73 A;  1KD1 W;  2CUG A;  2KSD A;  3RYC B;  4NR1 A;  2MW2 B;  1GH6 A;  3APQ A;  3Q4H A;  2ITC C;  2IM9 A;  2IU0 A;  4Z2W A;  1KBH A;  5LA6 B;  4P2Z A;  2P67 A;  2HHH B;  1D2D A;  1ENV A;  2UXC B;  3UQ8 A;  4EB6 B;  5KA5 A;  3KKY A;  3CCL V;  2JGD A;  3D36 A;  4MTF A;  2ZKO A;  1V9P A;  1FFT B;  2JJ1 G;  2CTP A;  3EVK A;  1K3E A;  1RP3 B;  2HLD G;  1JMK C;  3OGI B;  4NXM B;  2Q68 A;  5B1O A;  4DR5 O;  5B66 Z;  4BW9 A;  3K79 A;  2P22 C;  1S77 D;  4P9P A;  1BZK A;  5CBF A;  3W7S A;  5C93 A;  2CK3 G;  2P6J A;  2NLJ C;  3JAW B;  2YC0 A;  3IJ4 A;  3JD0 A;  2UXB B;  3ABM B;  2EIJ C;  4P30 A;  2W6I G;  1ARO P;  4YHH B;  3MHS C;  4H33 A;  2ADQ B;  2C2A A;  1PNK A;  3TK1 A;  1AJQ A;  3JCU Z;  3BCC H;  1YZB A;  4JTA B;  3GVM A;  1EN5 A;  2E76 B;  3AG3 B;  1RM1 C;  4PDL A;  3R66 A;  4WFB V;  2JEU A;  4X1Y B;  5L3F A;  2QE7 G;  2DOS A;  4DR7 O;  4CBC A;  2LGQ A;  4OGQ B;  4BIZ A;  1H8E G;  5L3E A;  3JAT B;  1L8D A;  1AB3 A;  1IXM A;  2PGG A;  2F1M A;  3TXQ A;  3L73 H;  1KQS U;  4I5S A;  2GSM B;  3F7V C;  1AI5 A;  4NTX A;  4JV5 B;  3SJQ C;  4CH6 A;  2H94 A;  2E75 B;  4K0K O;  3AG1 B;  5JVD A;  1M5I A;  1F51 A;  3CB2 A;  4JYA B;  2Z3Y A;  1IVS A;  1HNZ O;  4OX9 B;  3K57 A;  1BE3 H;  4FJC C;  4LF6 O;  1KB9 F;  2P7T C;  1YF2 A;  2ZR3 A;  1H2L A;  2IH1 C;  4H13 B;  2E74 B;  1N32 O;  1FJG O;  4BWA A;  1M90 W;  2HVJ C;  4DUZ B;  5D5Q A;  1PPJ H;  4JI6 B;  4ZIB A;  2UXD O;  3DC5 A;  3BAA A;  5B5E Z;  2XTA A;  3S3W A;  1NS1 A;  4FLU A;  2KG7 B;  1BHB A;  3B4S A;  4BW5 A;  2A06 H;  4KHP O;  3ZMV A;  4FLV A;  3ABT A;  5B1B B;  4QE9 A;  1TUB B;  5IYB O;  4Z1M G;  2VQE O;  5FNV A;  1EZJ A;  1XHZ A;  1H38 A;  5BXZ A;  2AZ0 A;  2UXN A;  3L71 H;  5B3S C;  1I0H A;  3LUT B;  1ZAU A;  2K9P A;  2FML A;  3FB5 C;  1J95 A;  4ZBM A;  5LYJ A;  4O2A A;  1Q90 D;  3KCY A;  1FXK A;  4NTW A;  4QIW F;  1ZL8 A;  4DR5 B;  5LOV A;  2VWK A;  4GYC B;  4CH3 A;  4O4L A;  2L35 A;  4PD4 F;  3OMI B;  4X62 O;  3RGB A;  1LUW A;  4G2K A;  3JAR A;  2LJ2 A;  3FB6 C;  4FFB A;  1Y66 A;  2QDO A;  4U3J A;  2HR3 A;  1HNW O;  4JZG A;  1JFF A;  3IFX A;  2YID A;  5IYZ A;  3JCZ A;  1SS3 A;  2F93 B;  4X66 O;  4GLX A;  2ZIN A;  3CS5 A;  4JTD B;  2WLI A;  4CH4 A;  3QF7 A;  3MDS A;  3E89 A;  1O9G A;  4I0X B;  2OTJ V;  3JAM N;  3APO A;  5BMV A;  4KP4 A;  2CTQ A;  4DR7 B;  4CC5 A;  4ZKI A;  5LXT B;  1LUV A;  2ZE5 A;  4DUY O;  1TVK B;  1WJZ A;  4NXN O;  3O65 A;  1XDC A;  2ZE7 A;  5GON A;  3ABK B;  1I94 O;  5KMG B;  3D36 C;  3JAK B;  2XAJ A;  3AG4 B;  3FB7 C;  3M7M X;  3MHH C;  1XOU A;  4UCU A;  4K0K B;  5LP6 B;  4JYC A;  4KL1 A;  1HNZ B;  1J5E B;  2N74 A;  3CE2 A;  4PI0 A;  2XND G;  3JAS A;  4LF6 B;  4J41 A;  4B3R O;  4NTY A;  1YIJ V;  2IJK A;  3SDL A;  2R9R B;  5J2U B;  4D7S A;  4UVA A;  5JJJ B;  1N32 B;  1FJG B;  4MVS A;  3LNM B;  1YXB A;  1BGY H;  2UXD B;  4X1I B;  2UUC O;  5B1N A;  5JH7 A;  1JQ0 A;  2B9Z A;  5LA6 A;  3CCS V;  3RWR D;  5KX5 B;  4UV9 A;  4KHP B;  3RVY A;  1VQN V;  4GX5 A;  1E1R G;  3H1L H;  4YIO A;  1M4U A;  3C90 A;  4DR6 B;  1ZSP A;  4DV0 O;  2VQE B;  1IX9 A;  4JI1 O;  1SER A;  3HKC A;  4WFE A;  2P90 A;  3UO2 A;  1F7Y A;  2HVK C;  2FL4 A;  4J10 A;  1F4M A;  4MTX A;  3CP1 A;  4TV9 B;  1DTO A;  1URF A;  1FKA O;  1AVM A;  1BMF G;  1N0N A;  1S76 D;  1F23 A;  2YIA A;  5KHK A;  4J7Z A;  4FPP A;  4MW3 A;  1EN6 A;  3EHB B;  4X62 B;  4DV3 O;  3SJA C;  3ZIA G;  5GTH Z;  3JD2 A;  4JAS A;  2QM7 A;  1HNW B;  1NTZ H;  3O9O A;  1JR9 A;  4IHJ A;  1V54 C;  5CA0 A;  4X89 A;  5HFL A;  2X6C A;  1HNX O;  4OPH A;  3B8M A;  4X1Y A;  3ZN0 A;  4DXW A;  2WA3 A;  1BQZ A;  1CEZ A;  2P5O A;  4X66 B;  3WU2 Z;  1FS0 G;  3JAT A;  1V55 C;  2BOB C;  3RVZ A;  4DR4 B;  1GM7 A;  3KG2 A;  3E8H A;  3AG2 C;  4JAA A;  4DR1 O;  3BA8 A;  1E1Q G;  1CP9 A;  2NR5 A;  3JAL A;  4MVZ A;  1M9N A;  2MK3 A;  3BAB A;  3VBB A;  1WB8 A;  3FKS G;  3OFN G;  1HWY A;  4DUY B;  1R3I C;  2JGU A;  4NVP A;  4EKW A;  4NXN B;  4HNA A;  4LF8 O;  1D5A A;  3LSS A;  1DLB A;  4Q6G A;  1QR9 A;  2JS5 A;  3QO5 A;  5LHH A;  1NH2 D;  1TAE A;  3RYF B;  4DV5 O;  4EFE A;  4X1K B;  5KHJ A;  1G4Y B;  2D3O W;  1KU9 A;  4NKG B;  5KHI A;  1TGO A;  3KZI Z;  5A9G A;  2FYU H;  3SJC C;  1ORQ C;  2Q8V A;  4N21 A;  4B3R B;  2ARH A;  5K1X A;  4O4J A;  5E1A C;  4J42 A;  2KG7 A;  3I55 V;  2ZQM A;  2LW7 A;  3W7T A;  2B5U A;  3CRQ A;  3ZMZ A;  4B3M O;  5BR8 B;  4F6R B;  3CRM A;  2ZXW B;  3ASO C;  4PDV A;  2UUC B;  3BA9 A;  2CH7 B;  1W59 A;  3WFV A;  4B3S B;  2FB5 A;  4UXN A;  2Q7E A;  4I9W A;  1N34 O;  3JD4 A;  3UM7 A;  4QJF B;  3EFF K;  3FAV A;  4WBN A;  1XBL A;  3WG7 B;  1K97 A;  2YXL A;  3THO A;  4A5U B;  1VQ8 V;  4JI1 B;  2GTS A;  1R6K A;  4TUY A;  1W0K G;  3K9A A;  3ZRV A;  2Z5U A;  2PI4 A;  3X2Q C;  4FMT A;  4X8A A;  1SRY A;  3P3P A;  1FYJ A;  1SA0 A;  2ZE6 A;  3SGI A;  4MTG A;  1KP3 A;  3OD4 A;  3E8G A;  1SQV H;  2QGN A;  1PNM A;  2EJ7 A;  3ZJZ A;  4PHZ A;  2Z0A A;  3MD0 A;  1SKV A;  4CS3 A;  1WA8 B;  3FD9 A;  4DV3 B;  1F4N A;  2AHY A;  4LF7 O;  2UUB O;  2Q7H A;  1O9H A;  5CA1 B;  3K5O A;  5ITZ A;  3K0D A;  4CH5 A;  4JI3 O;  4CZZ A;  1VQL V;  1HNX B;  1KUQ A;  3ASN B;  1Q6H A;  1Q6U A;  1VQM V;  3N2G A;  3CWB H;  5B1A B;  4LWS B;  1AIL A;  2JRI A;  4FLZ A;  2E3C A;  2Q0O C;  2X0L A;  1TVK A;  2ZNI A;  4GKK O;  2WLN A;  1GN2 A;  1QHT A;  2GTA A;  2EIM C;  1THZ A;  4DR1 B;  3RN4 A;  3LSQ A;  4FLX A;  1JJO A;  3JAK A;  4NB5 A;  4DRX B;  1VF6 A;  3LDC A;  2IJJ A;  5LP6 A;  3PJS K;  1ZLZ A;  4HYO A;  1Q6I A;  1VQ9 V;  2RMK B;  5IJ9 B;  1VQP V;  4I50 A;  1VQ4 V;  4LF8 B;  1VF7 A;  2BTQ B;  2EIN C;  4YJ3 B;  4KXR A;  2RJZ A;  1OCC B;  3K58 A;  4DV5 B;  2OCC B;  1MG1 A;  4X20 B;  1T5E A;  2YEV B;  2EIL C;  2GHY A;  3ABM C;  4ZHQ A;  4ZI7 A;  4MW8 A;  4O4I B;  2CGO A;  2DJV A;  1OZ0 A;  2JDI G;  5KX5 A;  4IIJ B;  3H9V A;  3OUF A;  3CRR A;  4B3M B;  1BL8 A;  2IH3 C;  1XI1 A;  1G1X B;  4L8J A;  4JTC B;  2A79 B;  2UXX A;  1GN4 A;  3K03 A;  4FZ0 A;  3CYO A;  3C3S A;  5IJ0 B;  1Z2G A;  4TOI A;  1N34 B;  2Q5Z A;  2QKS A;  4TV9 A;  4N23 A;  1HDJ A;  2V4D A;  1M56 B;  4LH6 A;  1H2K A;  2OIG A;  3ZX6 A;  4XDL A;  3ZMU A;  3QVN A;  1Y74 B;  1K4C C;  5DM6 V;  3K04 A;  1KC8 W;  2D2C B;  3F5T A;  3ZRX A;  4JF3 A;  3U11 A;  5CB4 B;  3QG5 A;  1RFY A;  1NTM H;  2P4V A;  2OT5 A;  2EUL A;  2A9H A;  1H2M A;  3HKD B;  4U3F H;  1K33 A;  2Q7G A;  1Y4M A;  4LF7 B;  2UUB B;  2XAG A;  1KMI Z;  4O4H B;  3N2K A;  4J80 A;  3T1H O;  3E22 A;  4JI3 B;  4UV8 A;  3FB8 C;  2E5L O;  3P30 A;  3H01 A;  1SET A;  1Y76 B;  3JSL A;  3ABL C;  2EZP A;  3HKB B;  4GKK B;  3DXR A;  1E79 G;  2WAM A;  5CA3 A;  2DYR B;  3D3I A;  4B7K A;  4LNU A;  2PZS A;  4AIL C;  2WLJ A;  4I7Z B;  4X1K A;  1X4T A;  1JOY A;  4QGP A;  3T4D A;  3OGC C;  3A2F A;  3M8A A;  3HKE B;  2OYQ A;  3QTC A;  4YJ2 A;  5C8Y B;  2LGW A;  1J5E O;  1RSO B;  2QTS A;  4LBE C;  3ZHS A;  3M99 B;  1YCI A;  3B2E E;  1NZ6 A;  3PN1 A;  3RYH B;  4FM1 A;  3OT7 A;  3B8N A;  4F6R A;  3W7U A;  3SYC A;  3JD3 A;  1VF5 B;  2KQX A;  1NI8 A;  3WB1 A;  1VQK V;  5KLV H;  5EK0 A;  1HP8 A;  1MZF A;  3VQV A;  3OAA G;  4FIP C;  2CTW A;  2LQT A;  4Q20 A;  3HB3 B;  2V1D A;  1NT2 B;  5L3G A;  1M1K W;  5JJE B;  3W7W A;  1N36 O;  2Q4P A;  3U10 A;  4TQD A;  1Y6X A;  2H8P C;  4J7J A;  4DR6 O;  1Q43 A;  2HKO A;  2Y48 A;  2WLH A;  4NYK A;  4R8C A;  4J9Z B;  1H2G A;  4XDJ A;  2EBO A;  1S5L Z;  1NJI W;  1OCZ C;  3L75 H;  2EIJ B;  1VF6 C;  2Q6A A;  5LP6 C;  1NU1 H;  4X88 A;  1PL0 A;  4JZ2 A;  1GN6 A;  2PYL A;  4MSW C;  3CC4 V;  5GTI Z;  2ZM6 O;  1U97 A;  2Y0P A;  2GUZ A;  2HJD A;  1RM1 B;  1BCC H;  4G28 B;  2GV9 A;  2PI5 A;  1W0J G;  3LNN A;  4R50 A;  5CA1 A;  4I55 A;  3K06 A;  4W4K A;  4H37 A;  1VQO V;  3ABU A;  1HR0 O;  2ZDI A;  1I5Y A;  1YI2 V;  3F5W C;  4DYL A;  4YY3 B;  4K8X A;  3STL C;  4LWS A;  4CS2 A;  3CEI A;  4I4T B;  1ZUQ A;  3OEH G;  4UB8 Z;  2ZNJ A;  1IBL O;  1K4D C;  3T1H B;  4JYY A;  2DN9 A;  1AR1 B;  1AI4 A;  1NVP D;  1YDX A;  2DYS C;  2KB1 A;  2KKW A;  2PTM A;  2HFE C;  4DR4 O;  2E5L B;  1K5Q A;  1A32 A;  2M6Y A;  1DGS A;  5LGN A;  3P32 A;  2WLM A;  5IJ9 A;  3T1C A;  4HZ3 A;  3STZ C;  4O2B B;  1S5H C;  5H9C A;  4LF4 O;  3AK3 A;  2F23 A;  4YJ3 A;  5LMN O;  3BFR A;  3A0B Z;  2WLL A;  3ZN1 A;  4DV2 O;  5LMU O;  4X20 A;  4WCE V;  4PA7 A;  2YEV A;  5LL6 Y;  5EIB D;  4YXW G;  2X6B A;  3ZMT A;  3NR7 A;  3E35 A;  4UB6 Z;  5EC2 C;  5L3D A;  4EFB A;  3VQW A;  1H2S B;  3UT5 A;  1PL4 A;  4ABM A;  3FYI B;  1JCH A;  5FLX N;  4FVM A;  2R9I A;  1FFX B;  4UCT A;  3CJH B;  3RW0 A;  3ZMS A;  5J2T A;  3DC6 A;  4MS2 A;  1Q3E A;  5B3S B;  3VQY A;  2YUA A;  3JD1 A;  1K5S A;  3CX5 F;  3OUS A;  2QEX V;  1HW7 A;  5BR8 O;  1Q5O A;  2JS3 A;  3RYC A;  2BE3 A;  1JJ2 U;  5FPO A;  4R7C A;  1N36 B;  2DW4 A;  1DF4 A;  4B3S O;  4EB6 A;  3SR2 C;  1MNG A;  1XNR O;  2NNU A;  1KYO F;  2ZIM A;  1Y74 A;  2CAZ C;  1S5J A;  4K35 A;  1PV0 A;  4FK5 C;  2YI9 A;  1UFI A;  1XEQ A;  3T4Z A;  2EIK B;  4GZR B;  1D5N A;  1QLE C;  2ZM6 B;  1YHQ V;  1VQ5 V;  4PA6 A;  4GX1 A;  3K5M A;  5J9P C;  3JAW A;  3QO7 A;  4ZOL B;  3TCU A;  3ICX A;  2NN4 A;  2H3O A;  2ADP A;  3K3W A;  4UFZ A;  5L3B A;  2WPD G;  4WF9 V;  3Q4H B;  3CCE V;  5KUM A;  2IU3 A;  2UU9 O;  1FD9 A;  1HR0 B;  4CC6 A;  1VAR A;  1B06 A;  4HAM A;  4DO2 A;  4GUN A;  1P7G A;  1Y76 A;  3E2E A;  4MTO A;  2JGD B;  2DQ3 A;  2Q9L A;  2Y4U A;  3UKM A;  1IBL B;  1BT8 A;  3UCS C;  1QVG U;  1PD3 A;  1IBK O;  3B40 A;  1XIL A;  5DED A;  3VQX A;  1QCE A;  1WB7 A;  1OCO C;  3WG7 C;  1WLE A;  2RCV A;  1VMG A;  2R72 A;  1VQ6 V;  1NQT A;  2YXH A;  2QM8 A;  3AG7 A;  1XNQ O;  2ETN A;  4LF4 B;  5LMN B;  2RNB A;  1G8M A;  4QNH B;  2VQF O;  3JSN A;  4DV2 B;  5LMU B;  2F95 B;  3B09 A;  5H2F Z;  2QM4 A;  4WFH A;  4PA3 A;  5KUK A;  4J7K A;  1XMO O;  1YIT V;  4UCR A;  1IZ3 A;  1FXK C;  3E83 A;  3E8B A;  3OTO O;  5IYD O;  4C7U A;  2LFS A;  3ETD A;  1SQQ H;  2VS0 A;  1XHX A;  2ODM A;  3D8C A;  3QO8 A;  1OJH A;  5LGU A;  1PKX A;  2QA4 V;  3HR0 A;  1R3L C;  1COW G;  5B1A C;  1TUB A;  1I5X A;  3TXS A;  2OWO A;  3RYI B;  5IY5 C;  2EZO A;  3CCV V;  3AEI A;  1B04 A;  2ZR2 A;  2XAF A;  3GB7 C;  5EC1 C;  3TJT A;  5DN6 G;  1XNR B;  2XUM A;  3EXA A;  1YSC A;  4E4E A;  5LGT A;  2R9A A;  3L70 H;  4FLW A;  1QNM A;  3GWK C;  1M57 B;  1V54 B;  1S3J A;  1Z5W A;  2JK5 C;  5E79 Z;  3CRC A;  3BY6 A;  4JI4 O;  1H8H G;  3OTF A;  4JI0 O;  3IC7 A;  1V55 B;  1B6Q A;  1R73 A;  1TUE B;  3CSX A;  3RT3 C;  4PV1 B;  5IYC O;  2YSU B;  1MSW D;  1AR5 A;  2PUS A;  2ZD9 A;  3SYP A;  3J7A U;  1BHA A;  5LHI A;  1AR4 A;  1NTK H;  2UU9 B; 
#chains in the Genus database with same CATH homology
 3S3X A;  2QTS A;  4NYK A;  4NTY A;  1WP8 A;  4FZ1 A;  4FZ0 A;  2L35 A;  3S3W A;  4NTW A;  4NTX A;  1WP7 A;  2FB5 A;  3IJ4 A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...