3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
b'ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
3S3XA 4NTYA 1WP7A 2L35A 4FZ0A 4NTWA 1WP8A 2QTSA 3N27A 3S3WA 4FZ1A 4NYKA 4NTXA 3IJ4A 2FB5A
chains in the Genus database with same CATH superfamily
1KQSU 4JI4B 2QWRB 4X1YA 3S3XA 4EB6B 4R7CA 3KZIZ 4UVBA 5IE9A 2RCVA 3ETQA 2MK3A 2ZXWB 1FKAO 4X62O 5IT9N 2R9IA 3SJAC 2OIGA 4UCOA 1P7GA 2CE4A 2DOSA 3QG5A 3FD9A 2V7QG 1PNMA 2EIMC 3RBZA 1VQ8V 3LSQA 2QTOA 1PV0A 2FKXA 2WLNA 4D7SA 5EIBC 4OX9O 1XNRO 4UUJC 4OGQB 4DR1O 1G6UA 1NBMG 4DR7O 5IWAB 1AROP 1TGOA 1Q81W 3A0RA 2UUAO 3CJHB 2GV9A 4QE7A 5L3BA 4BR6A 2UXCO 2ZQMA 3H01A 1GM8A 1PD3A 5LA6A 4UV9A 4YJ2A 2B1IA 2WLMA 1K92A 4HZ3A 1VARA 1RM1C 3JASA 2ZINA 4O4HB 2ITDC 2W0XA 3SPJA 4LF5O 3ABMC 4DUZO 1OCZB 4X66O 4RWUA 2Q67A 2UXBO 5JCOA 1Y74A 1MOFA 4QIWF 2Q0OC 2OYQA 3SJCC 4DR5O 5LXTB 1JJOA 3F5WC 2ZIMA 4HNAB 3BPZA 4X1KB 4E2LA 3T4DA 4MVSA 1IX9A 3H1LH 5IY5B 4IL6Z 4LF6O 4DV1O 3ZMUA 1CEZA 4EKWA 3CRQA 5IYBO 4EEQA 3T1YO 1Y76B 3TXQA 2UUBB 3TGUH 3VQYA 3RYIB 1XHZA 2QKAA 2QEXV 3SYPA 3UKMA 1D5NA 4FM2A 1FFXB 3OTOB 4GX5A 4MW3A 3I55V 4YHHB 1L0NH 5E79Z 1VQKV 3N2KA 4Q20A 5LP6C 4DW0A 4WFAV 4MS2A 2QJ1A 3EHBB 2UU9B 3ZN0A 1M56C 1IBLO 3AEIA 5A9GA 1HNWO 3WG7B 1B04A 1YDXA 5DN6G 4L87A 3FAVB 2YSUB 1AP6A 2PTMA 5H2FZ 3HR0A 4A5UB 1H2NA 5IYCO 2D3OW 1K4CC 3LDEA 3B09A 2CH7A 4LWSB 1NVPB 4O2BB 1QVGU 4X20B 1ZWIC 4O4LA 1HNXO 2QTSA 2ZDIA 2JIZG 5L3CA 5LHGA 2DE0X 1L1FA 1TUBB 2X6AA 2UXDO 1HNZO 4TUYB 4NB5A 5CA1B 4LF7B 2HLDG 5GONB 4DRXA 1IBMB 5LGTA 3ETDA 3FFQA 3CX5F 4JZGA 2GDSA 2YXHA 4ZOLA 4JYYA 3J80N 1GO3F 5CA0A 4IIJA 1AR5A 4FLXA 5KA5A 4LF9B 3M7MX 1PNKA 2A3QA 1YI2V 4JI1B 1M57C 2OIEA 4X8AA 5J2TA 1Y66A 2RMKB 1SZTA 1GAXA 2EULA 3RVYA 3GB7C 1F51A 2OT5A 4U7NA 2Q8VA 4B3TB 2UXNA 1F23A 2R70A 4AQYB 4GT1A 3OW2U 2C2AA 1SQGA 3P3NA 1QBZA 4EB6A 1XEQA 1Q6UA 1W2BU 5DEDA 4I9QA 3OGIB 1Y6XA 1HR0B 1J5EO 3CCJV 2HVKC 4GKJO 1E1RG 4XDJA 3CCMV 3B8MA 3CCUV 2YXLA 1MSWD 3G71V 3ASNC 1KYOF 1OCOB 4I55B 4FM0A 3T4ZA 3SYAA 3H1KH 4QE9A 4QPJA 2AHYA 1R1BA 5CA3A 1SQFA 3CJHA 5EIBD 2WPDG 4X9QA 3HKCA 1IXBA 4JV5B 2KG7B 2W0FC 3U10A 1DLBA 2ADQB 4JAVA 3CCLV 3CE2A 2GSMB 1V54B 2BCCH 4NTXA 1BHAA 4H44B 2WA4A 4O4HA 4Z2WA 1GM7A 1MSDA 2B5UA 3BA8A 4Z1VA 1EZVH 2G38A 3JAMN 2H94A 4U7OA 4NTYA 4G27B 1SERA 4K8ZA 1IXMA 2Q6AA 1XBLA 5LXTA 2CAZC 4HNAA 2QE7G 1I94O 4X1KA 1Q7YW 4JI8O 1QQCA 4AI8A 5K1XA 2FL4A 4K0KB 3UCSC 3CSXA 1OCCC 2VRZA 1Q8IA 4BW9A 2DYSB 3BHPA 3JD3A 3B77A 1HP8A 2EIJB 1Y76A 1DF5A 4G2KA 4JI3O 3DXRB 1D2DA 4CBCA 3SJBC 5CBFA 2B1GA 1UJWB 3RYIA 4C7UA 1NS1A 5C93A 4ABMA 3B2EE 4DUYO 2P4KA 3D36C 4BIZA 1FFXA 1MNGA 1YCIA 3MHHC 1FXVA 3E8HA 4RQEA 1P84F 1YEWA 5JVDA 4PA9A 2Z5UA 2ZE7A 2F43G 3APOA 4JI2B 1WA8B 4DK0A 5FL7G 1K34A 1FS0G 3O65A 4WFBV 4MSWC 5H9CA 2EIKB 4FFKA 2A79B 4DR3B 3FAVA 2M7WA 4MT8A 2VS0A 3C90A 2JGUA 2EILB 1GH6A 1R3LC 3CCSV 1AP5A 4I4TB 3K59A 2PGGA 2OCCC 1FJGB 4LWSA 2Q9LA 1E79G 4O2BA 1QLEC 4DYLA 4QPKA 4X20A 5JQGB 2N74A 3CCRV 3K9SA 1I08A 3ZMVA 1TUBA 3L73H 1EZJA 1OJHA 3G80A 3QVNA 2QA4V 4TUYA 1EN4A 5CA1A 5KLVH 2VQEO 1H8EG 3ZRVA 2BOCC 2IJIA 5LHIA 1P7BA 1X59A 5GONA 2XT9A 4J7KA 4X65B 2HVJC 3SYQA 3ZMTA 3ML0A 4XBFA 4FLZA 2DJVA 4MVMA 5K1PA 1EN5A 1NZ6A 3OTOO 3D8CA 1JPXA 1VEWA 4RUFA 3LNMB 3GWKC 2LO1A 2YEVB 5IJ9B 3JSNA 2UU9O 2V4DA 3K0DA 4DO2A 3K0GA 4B3SO 1NJIW 4TV9B 1N32B 5KAIZ 2PY5A 1K97A 2XASA 2LGWA 4WBNA 3MAQA 4KFMA 5EYPA 3BA9A 3RYCB 3ETGA 1XHXA 3KG2A 2ZM6B 1WP8A 4OXSA 4LC1A 1F7YA 1XNQB 2DN9A 3HKDB 1VIBA 1EBOA 3AG4C 1HW7A 2XNDG 3K04A 1AJQA 1Q43A 4XDLA 4I55A 1W0KG 5L3GA 1XOUA 3ABUA 1G4YB 5E1AC 1URFA 4LF7O 3CEIA 1W0JG 1ROPA 1V9PA 1MMMA 2KG7A 3JD2A 2QDOA 2QGNA 2R9AA 4B7KA 2Q69A 1XREA 4YIOA 3AG2C 5FPRA 4R6ZA 2QWQB 3EVKA 1VMGA 1XILA 4JI1O 4UVAA 2VQFB 5EBWC 4JI6O 1KMIZ 2CTPA 1A32A 1AILA 1N34B 4B3TO 1SS3A 4LFAB 4QJFB 1AB3A 2IBZH 2F4VO 2E5LB 4TT3G 3BVOA 4DV0B 1IBKB 1HWYA 1JCHA 3DC6A 3UT5B 5ITZB 3L74H 4LF4O 3BRCA 3OUSA 2ZR2A 3ZMZA 2YI9A 4DV5B 1AR1B 1IDSA 1FXKC 3OE7G 3OR7C 4NKGB 4LNUA 3OFNG 3DSQA 4LBEC 3RGBA 3DXRA 3RYHB 1KBHA 3CC7V 5KHGA 3D3IA 2P67A 3MD0A 3CXHF 3JATB 1H2SB 3B4SA 4DW1A 2IM9A 1VQNV 1VQ7V 2ZDIC 1S72V 5GTIZ 5KHJA 2HFEC 3DTUB 4I5SA 2DYRC 2YS8A 4JV5O 4YXWG 1WA8A 4L8JA 1K73W 3E8GA 1V55B 4LFCB 2IH1C 3WB1A 2B9ZA 1ZX3A 4I4TA 4KP4A 1FYJA 1WJZA 1K4DC 2OTLV 1Q82W 4JYAB 2JEUA 5JQGA 2XAGA 4ZI7A 4XDKA 2Y69B 2PYJA 4K0KO 1JJ2U 3ABMB 4UB8Z 2EINC 3T1HB 3AG3C 2BSKB 2ZNIA 3JAKB 2X0LA 1OZ0A 2IU3A 3G6EV 3SYOA 4UCRA 4NXNB 4WF9V 2JS3A 1SKVA 3K06A 3N2GB 1US6A 1KP2A 4DV6B 2AGAA 1NTMH 3IJ4A 1W59A 4O2AB 4PA4A 2YEVA 5IJ9A 3CC4V 4RUEA 3WFVA 5IYZB 4JI2O 4ASUG 3R65A 1NT2B 2EBOA 2E74B 5B66Z 4R8CA 1JFFB 3CCVV 4TV9A 1H38A 3UQ8A 3E8FA 2UUCB 1OV9A 4GZRB 4KHPO 3CMEV 3RYCA 2Y4TA 4EFEA 1AI7A 2LW1A 5B1AC 1VQ4V 1K33A 1BGYH 1M56B 1N0NA 2QKCA 4DR4B 1SC5B 2AZ0A 5KMGB 3HKDA 4E4EA 2ITCC 2W6JG 2RDCA 5JJJB 3L9DA 1Y67A 4P9OA 4X89A 1LR1A 4FK5C 4GYCB 1BSMA 1RSOB 5LGNA 1KKCA 1M5IA 5IY5C 4P9PA 2QM4A 2HP8A 5FNVB 5H5NA 1PPJH 2Q5ZA 5LMUB 1Q5OA 3X2QB 3OEHG 1QCEA 2PF4E 4FIPC 5J2UB 4MTFA 1F4MA 2WLIB 3AG1B 3M8AA 3S3WA 1M9NA 1GTOA 2N04A 4ZKIA 2LW7A 2Q68A 4I7ZB 1AI4A 5FLXN 4ICGA 2DMXA 5A2QN 2YIAA 3AK1A 1K9MW 1JVMA 1XMQO 4F6EA 4UCTA 1R6NA 3ETEA 4JZ2A 4FLTA 3K5OA 3UT5A 5ITZA 3CC2V 4LF8B 5HFMA 2ZM6O 5CB4B 1XMOO 1H2MA 1P4RA 2Y0PA 3WG7C 4PA3A 3FB8C 2MW2B 4LR3A 1SQBH 1GK9A 4MTXA 3RYHA 3W7SA 1I5YA 5HFLA 3CD6V 1YHQV 1O9HA 3G67A 1M1KW 2A7WA 4YJ3B 4DXWA 3ZRWB 2WLLB 2DW4A 3JATA 1B6QA 3FB7C 4PI0A 1SQQH 5CBHA 2M6YA 1NR1A 2OTJV 5DECA 1KB9F 1NH2D 2ODMA 3ZBHA 1GN2A 4PHZA 3ASOC 4U3FH 4TSFG 1JQ0A 3MHSC 4O4JB 3Q4HB 4GKKO 3QF7A 2XAJA 5LMNO 1R73A 3F5TA 1PNLA 3ZN1A 1UPGA 3E83A 1N36B 2VQFO 1ZSPA 2JJ1G 1YTFB 2DQ3A 3JYCA 4DV2O 4LFAO 1PP9H 4OPAA 1UFIA 2H3OA 3E86A 4BIOA 2GHYA 1BS3A 2E5LO 3UM7A 4DV0O 1L8DA 3CPWU 4DV4B 5KAFZ 3JD1A 4CH4A 4JI7B 2BSKA 1E1QG 4B08A 3JAKA 3WU2Z 1YVWA 2NNUA 4KUMA 3K5NA 4GUNA 3L70H 3FYIB 3ABKB 3N2GA 3ICXA 5LHHA 1S77D 2YUAA 5LMNB 4O2AA 2P6JA 2CDYA 1H8HG 1NI8A 5IYZA 4JI4O 4K35A 4OPHA 1PL0A 4FM1A 1IVSA 2ZIOA 1JFFA 2RNBA 1WPBA 4UCVA 5EBLC 2RN9A 5BZBA 5IDJA 1U97A 4N23A 5KHIA 4YY3B 5JJEB 3CWBH 2X7RB 1V54C 1NQTA 1COWG 1XNRB 1Z5VA 2Q7HA 4DR1B 5KMGA 4JAAA 4DR7B 4UCUA 2JJ2G 1KUQA 1ZUQA 4FLUA 3JALB 1JOYA 4CS3A 5IWAO 2UUAB 3RVZA 3MDSA 2PYLA 5LGUA 3UO3A 4R50A 4KL1A 2UXXA 1G8MA 4I50B 1RSOA 1QLEB 1BT8A 1S5LZ 1BQZA 4MVOA 1B3QA 4LF5B 4UVCA 4DUZB 2ARHA 5FNVA 3TJTA 3OAAG 4X66B 2CTQA 1R3IC 1VF7A 4BAYA 3ABLC 1P49A 5EZYB 4DV6O 3FB5C 1CP9A 1VF5B 4CC5A 4CS4A 4DR5B 5LYJB 5J2UA 1FAFA 1MZEA 2WLIA 4JASA 4JI5B 2YICA 3QO7A 2DWEC 1QNMA 5LOVB 2XUMA 3IC9A 4DV1B 3BEHA 4JI0B 5KUKA 2XOKG 2HHHB 5GW7A 3M99B 4B3MB 2YIBD 2P22C 2UUCO 4X64B 2ETNA 1I0HA 1EN6A 3T1YB 4J7ZA 3ZHQA 2N05A 2PI4A 1ENVA 3C3SA 3LDCA 5B1OA 2UUBO 2F95B 2W6IG 3O9OA 3VQXA 5CB4A 5J9PC 2WWWA 2PUSA 3ZHVA 2NN4A 1VQ6V 1N33B 2JGDB 3K79A 4CH6A 2EILC 2GTAA 5B3SC 4YHHO 4WFHA 3ZRWA 2WLLA 3JAWB 5B1BB 4AILC 2HJDA 2KB1A 2XTAA 2CGNA 3CYOA 3HKBB 4JTAB 4UCSA 3ZMSA 5JH7B 1HNWB 3EFFK 5BR8B 4PDMA 3HKEB 1Q3EA 3A2FA 4P2ZA 1LUVA 1VQ9V 5F2VO 1NKDA 1H2GA 2QWNB 2JDIG 4D7TA 1QHTA 4O4JA 3Q4HA 1HNXB 1K5SA 3APQA 1GN6A 3CRMA 3RYFB 3LDDA 4FFBB 2RQ6A 2HJFC 1JA8A 4UXNA 5EBMC 2ZE6A 4FMTA 4NXMB 5BXZA 5JCOC 3E22B 3EXAA 2YC0A 4MW8A 1O9GA 3AG2B 4NYKA 2Q7EA 4D6TH 1WLEA 1K7DA 2BE3A 2IU0A 2Z3YA 4J11A 1IBMO 3ZCCA 3BFRA 3IAYA 1ZLZA 3JCZA 1VQOV 3K08A 4FPPA 1TAEA 3IFXA 3ZHUA 4WCEV 3K5LA 1TVKB 1ORQC 1L0LH 1XI1A 4LF9O 2QM8A 1AI6A 2GUZB 4Q6GA 1LNQA 2CTRA 3W7TA 1FXKB 1MG1A 4CZZA 2ZR3A 1AJPA 4AQYO 4JTDB 4FVMA 2PI5A 1ZL8B 3QO5A 1QR9A 3KCXA 3ABTA 3D36A 3E35A 1KD1W 2ZCEA 4CH3A 1N36O 3U11A 2KQXA 2A9HA 4UFZA 1VQ5V 3QNEA 4PDVA 1HR0O 4TQFA 3GVMA 1M4UA 2EZOA 4QNHB 3F7YC 3OMNB 2CGOA 3JALA 1YSCA 4CH5A 2OCHA 3IGAC 4DK1A 4NVPA 4PDRA 1K5QA 1WNSA 5H6RA 3CCQV 2EIMB 1OCRC 4I50A 4H37A 2R72A 2FMLA 3JARB 4J80A 1AR4A 1BZKA 3RFRA 2JVDA 4YIPA 1VF6A 1MABG 3NR7A 1TA8A 1WB7A 3HPLC 4GCZA 4BWAA 4J9ZB 5FPOA 3FB6C 5EZYA 4K8XA 2EINB 1RP3B 5B5EZ 1YJWV 2PZSA 2IH3C 1I94B 2AW9A 4IYHA 3VBBA 2AXTZ 4O4IB 1F4NA 3AK3A 3H1IH 1Z2GA 4JI8B 4LFBB 2LFRA 5LOVA 2D2CB 3K9AA 3U0ZA 2FYUH 2R9RB 1RM1B 5LBQA 1Q6HA 4RQFA 1JMKC 3CHXA 1WB8A 5EK0A 3SGIA 3K57A 5KA6A 4JI3B 4PDLA 4YY3O 3F7VC 1Q6IA 3G4SV 4GLXA 1S0VA 3E8BA 3VQWA 1V55C 4DUYB 4NR1A 2ZXWC 3H9VA 3T2MA 2ZE8A 1FD9A 2JGDA 3OMIB 3FYEB 4I0XB 2ILMA 1CPYA 1LUWA 3ZRXA 1H2KA 3HKCB 2V1DA 5BMVB 3JAWA 4BIUA 1SETA 5C8YB 2NR5A 4I9WA 2HKOA 4UV8A 3HKBA 5B1AB 3VQVA 3LNNA 5JH7A 2XHBA 1BHBA 2Y69C 1R3JC 1XDCA 3HKEA 4CC6A 1K8AW 2CTWA 4GX2A 4W4KA 3TK1A 4DR3O 4IHJB 2OWOA 3ZHRA 4F6RB 1SQPH 2F93B 2FTKA 4JF3A 5LP6B 4JI5O 1FJGO 2XAHA 3RYFA 4PA7A 4FFBA 3L72H 4DR2B 3JSLA 3E2EA 4AHCA 4JI0O 1OCZC 5L3EA 2HHHO 2ZE5A 3E22A 2QSAA 1VQMV 4B3MO 2VQEB 2ZT9B 4MVQA 4X64O 1QU7A 4H33A 3CCEV 3H1HH 2HG5C 2CK3G 2Y48A 2EJ7A 1HDJA 5B1NA 1PL4A 1SQVH 4X65O 1N33O 1CXZB 1NTKH 1BQ0A 5CBGA 2K9PA 4J7JA 3P32A 3TCUA 3STLC 4GX1A 5JVDB 1TVKA 2JS5A 3TETA 1SQXH 1RPRA 3LUTB 3K58A 2GUZA 2VWKA 4WFGA 1M90W 2HEPA 3RN4A 1DGSA 1FXKA 4B3SB 2O57A 5BR8O 1FFTB 2ZD9A 1FXHA 1N32O 1G1XB 5KUMA 5BY1A 1Q86W 1ZL8A 4GX0A 4CS2A 4EFBA 2IW5A 4PV1B 1VP7A 3ZEDA 3OMAB 1M57B 2YXYA 2Y4UA 4X88A 1H2LA 2ADPA 2X6BA 3ZS8C 1XNQO 1SF9A 4DR6B 3X2QC 2DWDC 4NXMO 2YDEA 5IJ0B 3ZX6A 1KC8W 4LH6A 1J95A 3L71H 1SRYA 1YZBA 3AG1C 4ZBMA 3ASOB 1S76D 2YIDA 3OT7A 1Q90D 4P30A 1XQ8A 1WP7A 3SPHA 4MVRA 4U3JB 1U96A 2BTQB 4KXRA 1DTOA 1R3KC 3JARA 4PELA 4X1IB 5KX5B 1IZ3A 3ASNB 2ZKOA 2JEXA 4JI6B 3ZHTA 5L3FA 4IYIA 4FLYA 2WA3A 3L75H 3N27A 3JCUZ 3K3WA 4O4IA 1N34O 2F4VB 1EFRG 3QO8A 4WBNB 5EYPB 1SA0B 2LQTA 2EJRA 1D5AA 4RAIA 4LF4B 1IBKO 3G6BA 4DV3B 3CRCA 1N4CA 1OHHG 2BOBC 4ZHQB 1AJNA 4LH7A 3W7XA 2IJHA 2LP7A 4DV5O 1YIJV 5EC2C 1FPOA 5JWPA 2EX3A 1X4TA 1NR7A 1NU1H 4RO2A 2P06A 1NTZH 4B3RB 3ZJZA 3UO2A 2Y0IA 4TV8B 4IGGA 1TUEB 2XAQA 1S5HC 3A0HZ 4I0XA 3SR2C 3OD4A 1OCCB 1SESA 2Q0AA 1I7FA 3A0BZ 3W7UA 4FZ0A 4DV7B 3T1CA 5BMVA 5C8YA 1N0JA 1OCOC 1R6TA 1WAZA 2DQ0A 3P30A 3B8NA 4NTWA 1QR8A 1GKFA 1RPOA 4IT5A 4X62B 3FKSG 2WLJA 3P3PA 4LFCO 4G28B 4IHJA 3JD0A 3CS5A 4F6RA 3STZC 3QTCA 5L3DA 1BL8A 4QGPA 1GN4A 5LP6A 3K5MA 3ABKC 2WLKA 4OX9B 4JYAO 1QLNA 4LFBO 3RT3C 2RJZA 3K03A 3B40A 4HBNA 3IC7A 4PD4F 3ABLB 1YITV 3OUFA 5CMUA 3T1HO 2JRIA 4JTCB 4LNUB 2WLHA 2UXCB 4TOIA 1XUQA 3RW0A 2KSDA 2OCCB 3SDLA 3CMAV 1GRJA 2QWOB 1SZXA 4FLVA 2YIBA 3CXCU 1B06A 3J7AU 2E75B 4NXNO 3GWOA 4JGSA 2ZNJA 2CUGA 4TQDA 1MA1A 2DYSC 3BY6A 2Q73A 2P90A 2UXBB 3OGCC 2K1EA 3ZHSA 2EIJC 2L35A 1JR9A 4Z1MG 2QWPB 4ZIBA 2A0LA 3CB2A 5TISZ 1AVMA 1YJ9V 5KHHA 3SPIA 4X1YB 3TXSA 2YI8A 1QVFU 4LF6B 3I56V 1Y4MA 3CRAA 4PI2A 2Q4PA 4KHPB 1WN7A 5B3SB 4LP8A 4MTGA 1WPXA 1KKDA 3PN1A 4ZI7B 1VF6C 3ZIAG 2LJ2A 2EIKC 4WFFA 4DR2O 4DR4O 1YF2A 2L6LA 2P4VA 4LCUC 4N21A 2QKSA 1MZFA 4PJ0Z 5IJ0A 2WSSG 2BTOA 3AG7A 1PM9A 5DM6V 1EM1A 2ATKC 2X6CA 5D5QA 1M93A 3HB3B 4YJ3A 4FLWA 4FJCC 3LSUA 4UB6Z 3DGEA 4MVUA 3OR6C 5LA6B 1IBLB 2Q7GA 4YJ2B 3FX7A 3JASB 2XAFA 4U3JA 2BTQA 1NVPD 3D3QA 1KP3A 4JPRA 3AG4B 5LMUO 4X1IA 2IJKA 5KX5A 3BAAA 1K3EA 1Y74B 1S3JA 2E3CA 1DF4A 1YXBA 3CRRA 1JX9A 3KCYA 4JAUA 1DK1A 4JYCA 3PJSK 3C3TA 3JD4A 2GBOA 2QR4A 2UXDB 4W4LA 1HNZB 1XMQB 1SA0A 1KECA 5KHKA 5B1BC 4HAMA 1XMOB 4ZHQA 4LF8O 3WB2A 5H6QA 3J81N 1BMFG 2H8PC 2AZ2A 1XL6A 3R66A 1R6KA 5AG2A 3SYCA 5JJNB 1PKXA 2LGQA 3H1JH 3OTFA 4DR6O 3RWRD 4J41A 3DC5A 4BW5A 3WB0A 1I5XA 3N2KB 4TV8A 3A8TA 4H13B 1Z5WA 2AHZA 2WAMA 4MVZA 5EC1C 2Z0AA 1XL4A 4J42A 1IURA 2HR3A 4HYOA 4FZ1A 2F1MA 5GTHZ 3SPGA 3NXSA 3AK2A 3OEEG 3E89A 3BCCH 4J9YB 2GTSA 3CP1A 1ZAUA 2VWJA 1T5EA 4H0LB 1THZA 1S5JA 1YTFD 4WFEA 2E76B 4TWKA 1KU9A 1VQLV 4GKKB 1VQPV 2CH7B 3I5DA 2EZPA 5LL6Y 2IJJA 4O4LB 5CN0A 2JK5C 1BE3H 4PA6A 1RFYA 1N8RW 1NH2B 2P5OA 1J5EB 4GKJB 2NLJC 2F66C 1OCRB 2DYRB 4DV2B 4JYBA 1AI5A 3KKYA 2FB5A 5IYDO 4J10A 3SJQC 1BCCH 4DV3O 4DRXB 4DV4O 3ZRSA 5D5PA 4JI7O 2P7TC 4K3AA 2A06H 4ZOLB 4B7EA 3OM3B 4F4LA 3BABA 5CA0B 2F23A 4IIJB 3VOUA 3LSSA 2LFSA 4B3RO 1GM9A 2QM7A 2KKWA 5J2TB 1GN3A 1YJNV 3SPCA 3THOA 3AG3B 3W7WA 4DV7O 5LYJA 4MTOA 1ZTEA 1GMGA
chains in the Genus database with same CATH topology
3S3XA 4NTYA 1WP7A 2L35A 4FZ0A 4NTWA 1WP8A 2QTSA 3N27A 3S3WA 4FZ1A 4NYKA 4NTXA 3IJ4A 2FB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3X A;  4NTY A;  1WP7 A;  2L35 A;  4FZ0 A;  4NTW A;  1WP8 A;  2QTS A;  3N27 A;  3S3W A;  4FZ1 A;  4NYK A;  4NTX A;  3IJ4 A;  2FB5 A; 
#chains in the Genus database with same CATH topology
 1KQS U;  4JI4 B;  2QWR B;  4X1Y A;  3S3X A;  4EB6 B;  4R7C A;  3KZI Z;  4UVB A;  5IE9 A;  2RCV A;  3ETQ A;  2MK3 A;  2ZXW B;  1FKA O;  4X62 O;  5IT9 N;  2R9I A;  3SJA C;  2OIG A;  4UCO A;  1P7G A;  2CE4 A;  2DOS A;  3QG5 A;  3FD9 A;  2V7Q G;  1PNM A;  2EIM C;  3RBZ A;  1VQ8 V;  3LSQ A;  2QTO A;  1PV0 A;  2FKX A;  2WLN A;  4D7S A;  5EIB C;  4OX9 O;  1XNR O;  4UUJ C;  4OGQ B;  4DR1 O;  1G6U A;  1NBM G;  4DR7 O;  5IWA B;  1ARO P;  1TGO A;  1Q81 W;  3A0R A;  2UUA O;  3CJH B;  2GV9 A;  4QE7 A;  5L3B A;  4BR6 A;  2UXC O;  2ZQM A;  3H01 A;  1GM8 A;  1PD3 A;  5LA6 A;  4UV9 A;  4YJ2 A;  2B1I A;  2WLM A;  1K92 A;  4HZ3 A;  1VAR A;  1RM1 C;  3JAS A;  2ZIN A;  4O4H B;  2ITD C;  2W0X A;  3SPJ A;  4LF5 O;  3ABM C;  4DUZ O;  1OCZ B;  4X66 O;  4RWU A;  2Q67 A;  2UXB O;  5JCO A;  1Y74 A;  1MOF A;  4QIW F;  2Q0O C;  2OYQ A;  3SJC C;  4DR5 O;  5LXT B;  1JJO A;  3F5W C;  2ZIM A;  4HNA B;  3BPZ A;  4X1K B;  4E2L A;  3T4D A;  4MVS A;  1IX9 A;  3H1L H;  5IY5 B;  4IL6 Z;  4LF6 O;  4DV1 O;  3ZMU A;  1CEZ A;  4EKW A;  3CRQ A;  5IYB O;  4EEQ A;  3T1Y O;  1Y76 B;  3TXQ A;  2UUB B;  3TGU H;  3VQY A;  3RYI B;  1XHZ A;  2QKA A;  2QEX V;  3SYP A;  3UKM A;  1D5N A;  4FM2 A;  1FFX B;  3OTO B;  4GX5 A;  4MW3 A;  3I55 V;  4YHH B;  1L0N H;  5E79 Z;  1VQK V;  3N2K A;  4Q20 A;  5LP6 C;  4DW0 A;  4WFA V;  4MS2 A;  2QJ1 A;  3EHB B;  2UU9 B;  3ZN0 A;  1M56 C;  1IBL O;  3AEI A;  5A9G A;  1HNW O;  3WG7 B;  1B04 A;  1YDX A;  5DN6 G;  4L87 A;  3FAV B;  2YSU B;  1AP6 A;  2PTM A;  5H2F Z;  3HR0 A;  4A5U B;  1H2N A;  5IYC O;  2D3O W;  1K4C C;  3LDE A;  3B09 A;  2CH7 A;  4LWS B;  1NVP B;  4O2B B;  1QVG U;  4X20 B;  1ZWI C;  4O4L A;  1HNX O;  2QTS A;  2ZDI A;  2JIZ G;  5L3C A;  5LHG A;  2DE0 X;  1L1F A;  1TUB B;  2X6A A;  2UXD O;  1HNZ O;  4TUY B;  4NB5 A;  5CA1 B;  4LF7 B;  2HLD G;  5GON B;  4DRX A;  1IBM B;  5LGT A;  3ETD A;  3FFQ A;  3CX5 F;  4JZG A;  2GDS A;  2YXH A;  4ZOL A;  4JYY A;  3J80 N;  1GO3 F;  5CA0 A;  4IIJ A;  1AR5 A;  4FLX A;  5KA5 A;  4LF9 B;  3M7M X;  1PNK A;  2A3Q A;  1YI2 V;  4JI1 B;  1M57 C;  2OIE A;  4X8A A;  5J2T A;  1Y66 A;  2RMK B;  1SZT A;  1GAX A;  2EUL A;  3RVY A;  3GB7 C;  1F51 A;  2OT5 A;  4U7N A;  2Q8V A;  4B3T B;  2UXN A;  1F23 A;  2R70 A;  4AQY B;  4GT1 A;  3OW2 U;  2C2A A;  1SQG A;  3P3N A;  1QBZ A;  4EB6 A;  1XEQ A;  1Q6U A;  1W2B U;  5DED A;  4I9Q A;  3OGI B;  1Y6X A;  1HR0 B;  1J5E O;  3CCJ V;  2HVK C;  4GKJ O;  1E1R G;  4XDJ A;  3CCM V;  3B8M A;  3CCU V;  2YXL A;  1MSW D;  3G71 V;  3ASN C;  1KYO F;  1OCO B;  4I55 B;  4FM0 A;  3T4Z A;  3SYA A;  3H1K H;  4QE9 A;  4QPJ A;  2AHY A;  1R1B A;  5CA3 A;  1SQF A;  3CJH A;  5EIB D;  2WPD G;  4X9Q A;  3HKC A;  1IXB A;  4JV5 B;  2KG7 B;  2W0F C;  3U10 A;  1DLB A;  2ADQ B;  4JAV A;  3CCL V;  3CE2 A;  2GSM B;  1V54 B;  2BCC H;  4NTX A;  1BHA A;  4H44 B;  2WA4 A;  4O4H A;  4Z2W A;  1GM7 A;  1MSD A;  2B5U A;  3BA8 A;  4Z1V A;  1EZV H;  2G38 A;  3JAM N;  2H94 A;  4U7O A;  4NTY A;  4G27 B;  1SER A;  4K8Z A;  1IXM A;  2Q6A A;  1XBL A;  5LXT A;  2CAZ C;  4HNA A;  2QE7 G;  1I94 O;  4X1K A;  1Q7Y W;  4JI8 O;  1QQC A;  4AI8 A;  5K1X A;  2FL4 A;  4K0K B;  3UCS C;  3CSX A;  1OCC C;  2VRZ A;  1Q8I A;  4BW9 A;  2DYS B;  3BHP A;  3JD3 A;  3B77 A;  1HP8 A;  2EIJ B;  1Y76 A;  1DF5 A;  4G2K A;  4JI3 O;  3DXR B;  1D2D A;  4CBC A;  3SJB C;  5CBF A;  2B1G A;  1UJW B;  3RYI A;  4C7U A;  1NS1 A;  5C93 A;  4ABM A;  3B2E E;  4DUY O;  2P4K A;  3D36 C;  4BIZ A;  1FFX A;  1MNG A;  1YCI A;  3MHH C;  1FXV A;  3E8H A;  4RQE A;  1P84 F;  1YEW A;  5JVD A;  4PA9 A;  2Z5U A;  2ZE7 A;  2F43 G;  3APO A;  4JI2 B;  1WA8 B;  4DK0 A;  5FL7 G;  1K34 A;  1FS0 G;  3O65 A;  4WFB V;  4MSW C;  5H9C A;  2EIK B;  4FFK A;  2A79 B;  4DR3 B;  3FAV A;  2M7W A;  4MT8 A;  2VS0 A;  3C90 A;  2JGU A;  2EIL B;  1GH6 A;  1R3L C;  3CCS V;  1AP5 A;  4I4T B;  3K59 A;  2PGG A;  2OCC C;  1FJG B;  4LWS A;  2Q9L A;  1E79 G;  4O2B A;  1QLE C;  4DYL A;  4QPK A;  4X20 A;  5JQG B;  2N74 A;  3CCR V;  3K9S A;  1I08 A;  3ZMV A;  1TUB A;  3L73 H;  1EZJ A;  1OJH A;  3G80 A;  3QVN A;  2QA4 V;  4TUY A;  1EN4 A;  5CA1 A;  5KLV H;  2VQE O;  1H8E G;  3ZRV A;  2BOC C;  2IJI A;  5LHI A;  1P7B A;  1X59 A;  5GON A;  2XT9 A;  4J7K A;  4X65 B;  2HVJ C;  3SYQ A;  3ZMT A;  3ML0 A;  4XBF A;  4FLZ A;  2DJV A;  4MVM A;  5K1P A;  1EN5 A;  1NZ6 A;  3OTO O;  3D8C A;  1JPX A;  1VEW A;  4RUF A;  3LNM B;  3GWK C;  2LO1 A;  2YEV B;  5IJ9 B;  3JSN A;  2UU9 O;  2V4D A;  3K0D A;  4DO2 A;  3K0G A;  4B3S O;  1NJI W;  4TV9 B;  1N32 B;  5KAI Z;  2PY5 A;  1K97 A;  2XAS A;  2LGW A;  4WBN A;  3MAQ A;  4KFM A;  5EYP A;  3BA9 A;  3RYC B;  3ETG A;  1XHX A;  3KG2 A;  2ZM6 B;  1WP8 A;  4OXS A;  4LC1 A;  1F7Y A;  1XNQ B;  2DN9 A;  3HKD B;  1VIB A;  1EBO A;  3AG4 C;  1HW7 A;  2XND G;  3K04 A;  1AJQ A;  1Q43 A;  4XDL A;  4I55 A;  1W0K G;  5L3G A;  1XOU A;  3ABU A;  1G4Y B;  5E1A C;  1URF A;  4LF7 O;  3CEI A;  1W0J G;  1ROP A;  1V9P A;  1MMM A;  2KG7 A;  3JD2 A;  2QDO A;  2QGN A;  2R9A A;  4B7K A;  2Q69 A;  1XRE A;  4YIO A;  3AG2 C;  5FPR A;  4R6Z A;  2QWQ B;  3EVK A;  1VMG A;  1XIL A;  4JI1 O;  4UVA A;  2VQF B;  5EBW C;  4JI6 O;  1KMI Z;  2CTP A;  1A32 A;  1AIL A;  1N34 B;  4B3T O;  1SS3 A;  4LFA B;  4QJF B;  1AB3 A;  2IBZ H;  2F4V O;  2E5L B;  4TT3 G;  3BVO A;  4DV0 B;  1IBK B;  1HWY A;  1JCH A;  3DC6 A;  3UT5 B;  5ITZ B;  3L74 H;  4LF4 O;  3BRC A;  3OUS A;  2ZR2 A;  3ZMZ A;  2YI9 A;  4DV5 B;  1AR1 B;  1IDS A;  1FXK C;  3OE7 G;  3OR7 C;  4NKG B;  4LNU A;  3OFN G;  3DSQ A;  4LBE C;  3RGB A;  3DXR A;  3RYH B;  1KBH A;  3CC7 V;  5KHG A;  3D3I A;  2P67 A;  3MD0 A;  3CXH F;  3JAT B;  1H2S B;  3B4S A;  4DW1 A;  2IM9 A;  1VQN V;  1VQ7 V;  2ZDI C;  1S72 V;  5GTI Z;  5KHJ A;  2HFE C;  3DTU B;  4I5S A;  2DYR C;  2YS8 A;  4JV5 O;  4YXW G;  1WA8 A;  4L8J A;  1K73 W;  3E8G A;  1V55 B;  4LFC B;  2IH1 C;  3WB1 A;  2B9Z A;  1ZX3 A;  4I4T A;  4KP4 A;  1FYJ A;  1WJZ A;  1K4D C;  2OTL V;  1Q82 W;  4JYA B;  2JEU A;  5JQG A;  2XAG A;  4ZI7 A;  4XDK A;  2Y69 B;  2PYJ A;  4K0K O;  1JJ2 U;  3ABM B;  4UB8 Z;  2EIN C;  3T1H B;  3AG3 C;  2BSK B;  2ZNI A;  3JAK B;  2X0L A;  1OZ0 A;  2IU3 A;  3G6E V;  3SYO A;  4UCR A;  4NXN B;  4WF9 V;  2JS3 A;  1SKV A;  3K06 A;  3N2G B;  1US6 A;  1KP2 A;  4DV6 B;  2AGA A;  1NTM H;  3IJ4 A;  1W59 A;  4O2A B;  4PA4 A;  2YEV A;  5IJ9 A;  3CC4 V;  4RUE A;  3WFV A;  5IYZ B;  4JI2 O;  4ASU G;  3R65 A;  1NT2 B;  2EBO A;  2E74 B;  5B66 Z;  4R8C A;  1JFF B;  3CCV V;  4TV9 A;  1H38 A;  3UQ8 A;  3E8F A;  2UUC B;  1OV9 A;  4GZR B;  4KHP O;  3CME V;  3RYC A;  2Y4T A;  4EFE A;  1AI7 A;  2LW1 A;  5B1A C;  1VQ4 V;  1K33 A;  1BGY H;  1M56 B;  1N0N A;  2QKC A;  4DR4 B;  1SC5 B;  2AZ0 A;  5KMG B;  3HKD A;  4E4E A;  2ITC C;  2W6J G;  2RDC A;  5JJJ B;  3L9D A;  1Y67 A;  4P9O A;  4X89 A;  1LR1 A;  4FK5 C;  4GYC B;  1BSM A;  1RSO B;  5LGN A;  1KKC A;  1M5I A;  5IY5 C;  4P9P A;  2QM4 A;  2HP8 A;  5FNV B;  5H5N A;  1PPJ H;  2Q5Z A;  5LMU B;  1Q5O A;  3X2Q B;  3OEH G;  1QCE A;  2PF4 E;  4FIP C;  5J2U B;  4MTF A;  1F4M A;  2WLI B;  3AG1 B;  3M8A A;  3S3W A;  1M9N A;  1GTO A;  2N04 A;  4ZKI A;  2LW7 A;  2Q68 A;  4I7Z B;  1AI4 A;  5FLX N;  4ICG A;  2DMX A;  5A2Q N;  2YIA A;  3AK1 A;  1K9M W;  1JVM A;  1XMQ O;  4F6E A;  4UCT A;  1R6N A;  3ETE A;  4JZ2 A;  4FLT A;  3K5O A;  3UT5 A;  5ITZ A;  3CC2 V;  4LF8 B;  5HFM A;  2ZM6 O;  5CB4 B;  1XMO O;  1H2M A;  1P4R A;  2Y0P A;  3WG7 C;  4PA3 A;  3FB8 C;  2MW2 B;  4LR3 A;  1SQB H;  1GK9 A;  4MTX A;  3RYH A;  3W7S A;  1I5Y A;  5HFL A;  3CD6 V;  1YHQ V;  1O9H A;  3G67 A;  1M1K W;  2A7W A;  4YJ3 B;  4DXW A;  3ZRW B;  2WLL B;  2DW4 A;  3JAT A;  1B6Q A;  3FB7 C;  4PI0 A;  1SQQ H;  5CBH A;  2M6Y A;  1NR1 A;  2OTJ V;  5DEC A;  1KB9 F;  1NH2 D;  2ODM A;  3ZBH A;  1GN2 A;  4PHZ A;  3ASO C;  4U3F H;  4TSF G;  1JQ0 A;  3MHS C;  4O4J B;  3Q4H B;  4GKK O;  3QF7 A;  2XAJ A;  5LMN O;  1R73 A;  3F5T A;  1PNL A;  3ZN1 A;  1UPG A;  3E83 A;  1N36 B;  2VQF O;  1ZSP A;  2JJ1 G;  1YTF B;  2DQ3 A;  3JYC A;  4DV2 O;  4LFA O;  1PP9 H;  4OPA A;  1UFI A;  2H3O A;  3E86 A;  4BIO A;  2GHY A;  1BS3 A;  2E5L O;  3UM7 A;  4DV0 O;  1L8D A;  3CPW U;  4DV4 B;  5KAF Z;  3JD1 A;  4CH4 A;  4JI7 B;  2BSK A;  1E1Q G;  4B08 A;  3JAK A;  3WU2 Z;  1YVW A;  2NNU A;  4KUM A;  3K5N A;  4GUN A;  3L70 H;  3FYI B;  3ABK B;  3N2G A;  3ICX A;  5LHH A;  1S77 D;  2YUA A;  5LMN B;  4O2A A;  2P6J A;  2CDY A;  1H8H G;  1NI8 A;  5IYZ A;  4JI4 O;  4K35 A;  4OPH A;  1PL0 A;  4FM1 A;  1IVS A;  2ZIO A;  1JFF A;  2RNB A;  1WPB A;  4UCV A;  5EBL C;  2RN9 A;  5BZB A;  5IDJ A;  1U97 A;  4N23 A;  5KHI A;  4YY3 B;  5JJE B;  3CWB H;  2X7R B;  1V54 C;  1NQT A;  1COW G;  1XNR B;  1Z5V A;  2Q7H A;  4DR1 B;  5KMG A;  4JAA A;  4DR7 B;  4UCU A;  2JJ2 G;  1KUQ A;  1ZUQ A;  4FLU A;  3JAL B;  1JOY A;  4CS3 A;  5IWA O;  2UUA B;  3RVZ A;  3MDS A;  2PYL A;  5LGU A;  3UO3 A;  4R50 A;  4KL1 A;  2UXX A;  1G8M A;  4I50 B;  1RSO A;  1QLE B;  1BT8 A;  1S5L Z;  1BQZ A;  4MVO A;  1B3Q A;  4LF5 B;  4UVC A;  4DUZ B;  2ARH A;  5FNV A;  3TJT A;  3OAA G;  4X66 B;  2CTQ A;  1R3I C;  1VF7 A;  4BAY A;  3ABL C;  1P49 A;  5EZY B;  4DV6 O;  3FB5 C;  1CP9 A;  1VF5 B;  4CC5 A;  4CS4 A;  4DR5 B;  5LYJ B;  5J2U A;  1FAF A;  1MZE A;  2WLI A;  4JAS A;  4JI5 B;  2YIC A;  3QO7 A;  2DWE C;  1QNM A;  5LOV B;  2XUM A;  3IC9 A;  4DV1 B;  3BEH A;  4JI0 B;  5KUK A;  2XOK G;  2HHH B;  5GW7 A;  3M99 B;  4B3M B;  2YIB D;  2P22 C;  2UUC O;  4X64 B;  2ETN A;  1I0H A;  1EN6 A;  3T1Y B;  4J7Z A;  3ZHQ A;  2N05 A;  2PI4 A;  1ENV A;  3C3S A;  3LDC A;  5B1O A;  2UUB O;  2F95 B;  2W6I G;  3O9O A;  3VQX A;  5CB4 A;  5J9P C;  2WWW A;  2PUS A;  3ZHV A;  2NN4 A;  1VQ6 V;  1N33 B;  2JGD B;  3K79 A;  4CH6 A;  2EIL C;  2GTA A;  5B3S C;  4YHH O;  4WFH A;  3ZRW A;  2WLL A;  3JAW B;  5B1B B;  4AIL C;  2HJD A;  2KB1 A;  2XTA A;  2CGN A;  3CYO A;  3HKB B;  4JTA B;  4UCS A;  3ZMS A;  5JH7 B;  1HNW B;  3EFF K;  5BR8 B;  4PDM A;  3HKE B;  1Q3E A;  3A2F A;  4P2Z A;  1LUV A;  1VQ9 V;  5F2V O;  1NKD A;  1H2G A;  2QWN B;  2JDI G;  4D7T A;  1QHT A;  4O4J A;  3Q4H A;  1HNX B;  1K5S A;  3APQ A;  1GN6 A;  3CRM A;  3RYF B;  3LDD A;  4FFB B;  2RQ6 A;  2HJF C;  1JA8 A;  4UXN A;  5EBM C;  2ZE6 A;  4FMT A;  4NXM B;  5BXZ A;  5JCO C;  3E22 B;  3EXA A;  2YC0 A;  4MW8 A;  1O9G A;  3AG2 B;  4NYK A;  2Q7E A;  4D6T H;  1WLE A;  1K7D A;  2BE3 A;  2IU0 A;  2Z3Y A;  4J11 A;  1IBM O;  3ZCC A;  3BFR A;  3IAY A;  1ZLZ A;  3JCZ A;  1VQO V;  3K08 A;  4FPP A;  1TAE A;  3IFX A;  3ZHU A;  4WCE V;  3K5L A;  1TVK B;  1ORQ C;  1L0L H;  1XI1 A;  4LF9 O;  2QM8 A;  1AI6 A;  2GUZ B;  4Q6G A;  1LNQ A;  2CTR A;  3W7T A;  1FXK B;  1MG1 A;  4CZZ A;  2ZR3 A;  1AJP A;  4AQY O;  4JTD B;  4FVM A;  2PI5 A;  1ZL8 B;  3QO5 A;  1QR9 A;  3KCX A;  3ABT A;  3D36 A;  3E35 A;  1KD1 W;  2ZCE A;  4CH3 A;  1N36 O;  3U11 A;  2KQX A;  2A9H A;  4UFZ A;  1VQ5 V;  3QNE A;  4PDV A;  1HR0 O;  4TQF A;  3GVM A;  1M4U A;  2EZO A;  4QNH B;  3F7Y C;  3OMN B;  2CGO A;  3JAL A;  1YSC A;  4CH5 A;  2OCH A;  3IGA C;  4DK1 A;  4NVP A;  4PDR A;  1K5Q A;  1WNS A;  5H6R A;  3CCQ V;  2EIM B;  1OCR C;  4I50 A;  4H37 A;  2R72 A;  2FML A;  3JAR B;  4J80 A;  1AR4 A;  1BZK A;  3RFR A;  2JVD A;  4YIP A;  1VF6 A;  1MAB G;  3NR7 A;  1TA8 A;  1WB7 A;  3HPL C;  4GCZ A;  4BWA A;  4J9Z B;  5FPO A;  3FB6 C;  5EZY A;  4K8X A;  2EIN B;  1RP3 B;  5B5E Z;  1YJW V;  2PZS A;  2IH3 C;  1I94 B;  2AW9 A;  4IYH A;  3VBB A;  2AXT Z;  4O4I B;  1F4N A;  3AK3 A;  3H1I H;  1Z2G A;  4JI8 B;  4LFB B;  2LFR A;  5LOV A;  2D2C B;  3K9A A;  3U0Z A;  2FYU H;  2R9R B;  1RM1 B;  5LBQ A;  1Q6H A;  4RQF A;  1JMK C;  3CHX A;  1WB8 A;  5EK0 A;  3SGI A;  3K57 A;  5KA6 A;  4JI3 B;  4PDL A;  4YY3 O;  3F7V C;  1Q6I A;  3G4S V;  4GLX A;  1S0V A;  3E8B A;  3VQW A;  1V55 C;  4DUY B;  4NR1 A;  2ZXW C;  3H9V A;  3T2M A;  2ZE8 A;  1FD9 A;  2JGD A;  3OMI B;  3FYE B;  4I0X B;  2ILM A;  1CPY A;  1LUW A;  3ZRX A;  1H2K A;  3HKC B;  2V1D A;  5BMV B;  3JAW A;  4BIU A;  1SET A;  5C8Y B;  2NR5 A;  4I9W A;  2HKO A;  4UV8 A;  3HKB A;  5B1A B;  3VQV A;  3LNN A;  5JH7 A;  2XHB A;  1BHB A;  2Y69 C;  1R3J C;  1XDC A;  3HKE A;  4CC6 A;  1K8A W;  2CTW A;  4GX2 A;  4W4K A;  3TK1 A;  4DR3 O;  4IHJ B;  2OWO A;  3ZHR A;  4F6R B;  1SQP H;  2F93 B;  2FTK A;  4JF3 A;  5LP6 B;  4JI5 O;  1FJG O;  2XAH A;  3RYF A;  4PA7 A;  4FFB A;  3L72 H;  4DR2 B;  3JSL A;  3E2E A;  4AHC A;  4JI0 O;  1OCZ C;  5L3E A;  2HHH O;  2ZE5 A;  3E22 A;  2QSA A;  1VQM V;  4B3M O;  2VQE B;  2ZT9 B;  4MVQ A;  4X64 O;  1QU7 A;  4H33 A;  3CCE V;  3H1H H;  2HG5 C;  2CK3 G;  2Y48 A;  2EJ7 A;  1HDJ A;  5B1N A;  1PL4 A;  1SQV H;  4X65 O;  1N33 O;  1CXZ B;  1NTK H;  1BQ0 A;  5CBG A;  2K9P A;  4J7J A;  3P32 A;  3TCU A;  3STL C;  4GX1 A;  5JVD B;  1TVK A;  2JS5 A;  3TET A;  1SQX H;  1RPR A;  3LUT B;  3K58 A;  2GUZ A;  2VWK A;  4WFG A;  1M90 W;  2HEP A;  3RN4 A;  1DGS A;  1FXK A;  4B3S B;  2O57 A;  5BR8 O;  1FFT B;  2ZD9 A;  1FXH A;  1N32 O;  1G1X B;  5KUM A;  5BY1 A;  1Q86 W;  1ZL8 A;  4GX0 A;  4CS2 A;  4EFB A;  2IW5 A;  4PV1 B;  1VP7 A;  3ZED A;  3OMA B;  1M57 B;  2YXY A;  2Y4U A;  4X88 A;  1H2L A;  2ADP A;  2X6B A;  3ZS8 C;  1XNQ O;  1SF9 A;  4DR6 B;  3X2Q C;  2DWD C;  4NXM O;  2YDE A;  5IJ0 B;  3ZX6 A;  1KC8 W;  4LH6 A;  1J95 A;  3L71 H;  1SRY A;  1YZB A;  3AG1 C;  4ZBM A;  3ASO B;  1S76 D;  2YID A;  3OT7 A;  1Q90 D;  4P30 A;  1XQ8 A;  1WP7 A;  3SPH A;  4MVR A;  4U3J B;  1U96 A;  2BTQ B;  4KXR A;  1DTO A;  1R3K C;  3JAR A;  4PEL A;  4X1I B;  5KX5 B;  1IZ3 A;  3ASN B;  2ZKO A;  2JEX A;  4JI6 B;  3ZHT A;  5L3F A;  4IYI A;  4FLY A;  2WA3 A;  3L75 H;  3N27 A;  3JCU Z;  3K3W A;  4O4I A;  1N34 O;  2F4V B;  1EFR G;  3QO8 A;  4WBN B;  5EYP B;  1SA0 B;  2LQT A;  2EJR A;  1D5A A;  4RAI A;  4LF4 B;  1IBK O;  3G6B A;  4DV3 B;  3CRC A;  1N4C A;  1OHH G;  2BOB C;  4ZHQ B;  1AJN A;  4LH7 A;  3W7X A;  2IJH A;  2LP7 A;  4DV5 O;  1YIJ V;  5EC2 C;  1FPO A;  5JWP A;  2EX3 A;  1X4T A;  1NR7 A;  1NU1 H;  4RO2 A;  2P06 A;  1NTZ H;  4B3R B;  3ZJZ A;  3UO2 A;  2Y0I A;  4TV8 B;  4IGG A;  1TUE B;  2XAQ A;  1S5H C;  3A0H Z;  4I0X A;  3SR2 C;  3OD4 A;  1OCC B;  1SES A;  2Q0A A;  1I7F A;  3A0B Z;  3W7U A;  4FZ0 A;  4DV7 B;  3T1C A;  5BMV A;  5C8Y A;  1N0J A;  1OCO C;  1R6T A;  1WAZ A;  2DQ0 A;  3P30 A;  3B8N A;  4NTW A;  1QR8 A;  1GKF A;  1RPO A;  4IT5 A;  4X62 B;  3FKS G;  2WLJ A;  3P3P A;  4LFC O;  4G28 B;  4IHJ A;  3JD0 A;  3CS5 A;  4F6R A;  3STZ C;  3QTC A;  5L3D A;  1BL8 A;  4QGP A;  1GN4 A;  5LP6 A;  3K5M A;  3ABK C;  2WLK A;  4OX9 B;  4JYA O;  1QLN A;  4LFB O;  3RT3 C;  2RJZ A;  3K03 A;  3B40 A;  4HBN A;  3IC7 A;  4PD4 F;  3ABL B;  1YIT V;  3OUF A;  5CMU A;  3T1H O;  2JRI A;  4JTC B;  4LNU B;  2WLH A;  2UXC B;  4TOI A;  1XUQ A;  3RW0 A;  2KSD A;  2OCC B;  3SDL A;  3CMA V;  1GRJ A;  2QWO B;  1SZX A;  4FLV A;  2YIB A;  3CXC U;  1B06 A;  3J7A U;  2E75 B;  4NXN O;  3GWO A;  4JGS A;  2ZNJ A;  2CUG A;  4TQD A;  1MA1 A;  2DYS C;  3BY6 A;  2Q73 A;  2P90 A;  2UXB B;  3OGC C;  2K1E A;  3ZHS A;  2EIJ C;  2L35 A;  1JR9 A;  4Z1M G;  2QWP B;  4ZIB A;  2A0L A;  3CB2 A;  5TIS Z;  1AVM A;  1YJ9 V;  5KHH A;  3SPI A;  4X1Y B;  3TXS A;  2YI8 A;  1QVF U;  4LF6 B;  3I56 V;  1Y4M A;  3CRA A;  4PI2 A;  2Q4P A;  4KHP B;  1WN7 A;  5B3S B;  4LP8 A;  4MTG A;  1WPX A;  1KKD A;  3PN1 A;  4ZI7 B;  1VF6 C;  3ZIA G;  2LJ2 A;  2EIK C;  4WFF A;  4DR2 O;  4DR4 O;  1YF2 A;  2L6L A;  2P4V A;  4LCU C;  4N21 A;  2QKS A;  1MZF A;  4PJ0 Z;  5IJ0 A;  2WSS G;  2BTO A;  3AG7 A;  1PM9 A;  5DM6 V;  1EM1 A;  2ATK C;  2X6C A;  5D5Q A;  1M93 A;  3HB3 B;  4YJ3 A;  4FLW A;  4FJC C;  3LSU A;  4UB6 Z;  3DGE A;  4MVU A;  3OR6 C;  5LA6 B;  1IBL B;  2Q7G A;  4YJ2 B;  3FX7 A;  3JAS B;  2XAF A;  4U3J A;  2BTQ A;  1NVP D;  3D3Q A;  1KP3 A;  4JPR A;  3AG4 B;  5LMU O;  4X1I A;  2IJK A;  5KX5 A;  3BAA A;  1K3E A;  1Y74 B;  1S3J A;  2E3C A;  1DF4 A;  1YXB A;  3CRR A;  1JX9 A;  3KCY A;  4JAU A;  1DK1 A;  4JYC A;  3PJS K;  3C3T A;  3JD4 A;  2GBO A;  2QR4 A;  2UXD B;  4W4L A;  1HNZ B;  1XMQ B;  1SA0 A;  1KEC A;  5KHK A;  5B1B C;  4HAM A;  1XMO B;  4ZHQ A;  4LF8 O;  3WB2 A;  5H6Q A;  3J81 N;  1BMF G;  2H8P C;  2AZ2 A;  1XL6 A;  3R66 A;  1R6K A;  5AG2 A;  3SYC A;  5JJN B;  1PKX A;  2LGQ A;  3H1J H;  3OTF A;  4DR6 O;  3RWR D;  4J41 A;  3DC5 A;  4BW5 A;  3WB0 A;  1I5X A;  3N2K B;  4TV8 A;  3A8T A;  4H13 B;  1Z5W A;  2AHZ A;  2WAM A;  4MVZ A;  5EC1 C;  2Z0A A;  1XL4 A;  4J42 A;  1IUR A;  2HR3 A;  4HYO A;  4FZ1 A;  2F1M A;  5GTH Z;  3SPG A;  3NXS A;  3AK2 A;  3OEE G;  3E89 A;  3BCC H;  4J9Y B;  2GTS A;  3CP1 A;  1ZAU A;  2VWJ A;  1T5E A;  4H0L B;  1THZ A;  1S5J A;  1YTF D;  4WFE A;  2E76 B;  4TWK A;  1KU9 A;  1VQL V;  4GKK B;  1VQP V;  2CH7 B;  3I5D A;  2EZP A;  5LL6 Y;  2IJJ A;  4O4L B;  5CN0 A;  2JK5 C;  1BE3 H;  4PA6 A;  1RFY A;  1N8R W;  1NH2 B;  2P5O A;  1J5E B;  4GKJ B;  2NLJ C;  2F66 C;  1OCR B;  2DYR B;  4DV2 B;  4JYB A;  1AI5 A;  3KKY A;  2FB5 A;  5IYD O;  4J10 A;  3SJQ C;  1BCC H;  4DV3 O;  4DRX B;  4DV4 O;  3ZRS A;  5D5P A;  4JI7 O;  2P7T C;  4K3A A;  2A06 H;  4ZOL B;  4B7E A;  3OM3 B;  4F4L A;  3BAB A;  5CA0 B;  2F23 A;  4IIJ B;  3VOU A;  3LSS A;  2LFS A;  4B3R O;  1GM9 A;  2QM7 A;  2KKW A;  5J2T B;  1GN3 A;  1YJN V;  3SPC A;  3THO A;  3AG3 B;  3W7W A;  4DV7 O;  5LYJ A;  4MTO A;  1ZTE A;  1GMG A; 
#chains in the Genus database with same CATH homology
 3S3X A;  4NTY A;  1WP7 A;  2L35 A;  4FZ0 A;  4NTW A;  1WP8 A;  2QTS A;  3N27 A;  3S3W A;  4FZ1 A;  4NYK A;  4NTX A;  3IJ4 A;  2FB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...