3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
3IJ4A 2L35A 4FZ1A 4NTYA 2FB5A 3S3WA 3S3XA 4NTXA 4NYKA 4NTWA 2QTSA 1WP7A 1WP8A 3N27A 4FZ0A
chains in the Genus database with same CATH superfamily
4TOIA 1SQXH 1V55B 4BIZA 1I08A 4J7ZA 1FYJA 4HAMA 5HFLA 3BHPA 1YITV 3FB8C 1Y74A 2BCCH 4GX2A 2GV9A 1EFRG 1YHQV 4R6ZA 4WFAV 3AG1B 3JD4A 1SQVH 4KP4A 1XHZA 4JI0B 5LA6A 3RYIB 1RSOA 1BZKA 1Q6UA 1FD9A 5EBWC 2XOKG 4NVPA 1CXZB 5JQGB 3KG2A 3VBBA 2ZIMA 3D8CA 3RYCA 5LXTA 1EZJA 2DW4A 3D36A 4ZOLA 1XL6A 5LHIA 3JD2A 4FM2A 2VQFB 1QVFU 5KX5A 1US6A 1OCRB 2NN4A 3HKDA 3SPHA 2UXCO 3ZEDA 1MZEA 3JCZA 4TWKA 2UUAB 5J2UB 3B09A 1S76D 1FPOA 1E1QG 2E5LB 1YVWA 3CS5A 4DR4O 1N0NA 3CCQV 1BE3H 2Q8VA 3H1KH 1NTZH 3ZRXA 1AI5A 3Q4HA 5IYZB 3E8HA 1A32A 2GTSA 5CA1B 4J41A 3ASNC 3RVZA 5CA1A 3JD0A 2QA4V 3BAAA 4B3TO 3HKCA 4FM1A 3S3WA 2YIAA 4DV2O 1YCIA 2EULA 1F7YA 4OPAA 1Q43A 4PV1B 4RWUA 1KU9A 2HVJC 2EIMC 1ZL8B 4FFKA 2V7QG 2Q73A 4F6EA 1NI8A 2IBZH 5B1BB 5JCOA 1XNRO 5L3EA 4NB5A 1FXKC 3W7SA 3C3TA 3K59A 3ASOC 3ZHRA 4LF4O 3BA8A 5JJJB 3OR6C 4PHZA 2QTSA 3RT3C 2QKSA 5TISZ 3OAAG 1ZAUA 1GN4A 4L87A 3RYCB 1J95A 1XDCA 2PY5A 1WA8A 1AI4A 2M6YA 2NNUA 3CC2V 2WAMA 3P32A 4UXNA 2A79B 3P30A 2EJRA 3SYPA 1PNKA 3K03A 3N27A 3AG4C 2YICA 4J42A 1JJOA 2Y4UA 5EBMC 1XREA 3CJHA 1R6TA 4DR4B 4LFAB 2JIZG 2E3CA 2C2AA 3AG1C 3I55V 4U3JA 2FL4A 1U97A 2F95B 1N8RW 1I7FA 4XBFA 1YXBA 1K5QA 3W7UA 1RM1C 1H8EG 4LF7O 1K34A 2DWDC 3FX7A 1EBOA 2B5UA 2UXCB 1K5SA 1QVGU 3OTOB 4KHPB 1ZLZA 4K3AA 4O2BA 1MNGA 3STZC 1J5EO 3A0HZ 2VWKA 2ZNIA 2UXXA 2JK5C 2YIBD 3ETGA 4FLXA 2ZE6A 1W0KG 3H9VA 3UKMA 1I0HA 4LCUC 1F4NA 3CMEV 1Q86W 2UU9O 2RQ6A 1K73W 1VQMV 1VQLV 5EZYB 1R1BA 3AG7A 2OCCC 2LJ2A 3GVMA 4FLZA 2UXBO 4W4KA 2A7WA 2ZCEA 2LFRA 4CH3A 1HNZO 4TV8A 2HG5C 4X62B 1IBMB 1VQ9V 5CA3A 3HKEA 4AILC 1K33A 2YIDA 2QM7A 1OV9A 1U96A 4JI6O 2YI9A 4IYIA 3AG3B 1N36B 3UCSC 1Y76A 2N04A 4LNUA 4J9YB 3CYOA 4WFFA 5C93A 1XMOO 1XI1A 3G4SV 4CH4A 2CTQA 1KQSU 1TUEB 4PA9A 3BVOA 1BHAA 2ZR2A 4HBNA 3QTCA 3OM3B 1FJGO 5IJ9A 1AVMA 4X88A 1YZBA 4MW8A 3K06A 2ZINA 1VF6A 1R6KA 4AHCA 2Q7HA 3KZIZ 1IX9A 4K8ZA 2Y69B 5GONA 2Z5UA 3AG2B 2QE7G 3ZCCA 2EZPA 4JGSA 4X20A 5LGTA 2RJZA 3QNEA 1M57C 1SQQH 5LYJB 4FLWA 5BMVB 3CP1A 3SYOA 2BOCC 4PDRA 2R72A 5FLXN 1VF7A 4FMTA 2F66C 4NXNB 4LWSA 1KYOF 1VQKV 2F23A 4I4TB 4NXMO 1DK1A 1XMQO 5F2VO 2IJIA 5JJNB 4EFBA 2DQ0A 4L8JA 5LMUB 2HR3A 5KHIA 2QJ1A 1N34O 1R3JC 4I55A 1JA8A 2ZDIC 2HHHO 1N33O 3JSNA 1WJZA 2Y69C 4B3RO 2R70A 2Y0PA 3T1CA 3JAKB 1SQBH 3UO3A 3JAMN 5KMGA 2RNBA 5KHGA 1FXKB 2QGNA 2ZQMA 3SJBC 1YI2V 3FB6C 3SYQA 5IDJA 2CTPA 3CC4V 3OMNB 3DGEA 2WA4A 4A5UB 3JYCA 3IFXA 2W0FC 1ORQC 1S5LZ 2HHHB 1M5IA 3RYFB 3U0ZA 1GK9A 4K8XA 2H8PC 2FMLA 2XTAA 3CCLV 3ETDA 1AILA 1XMOB 1P84F 2UUBO 5IY5B 2KG7B 4BW9A 4WFEA 4JI5B 5FPRA 3UM7A 3ZRVA 3UO2A 2N74A 3N2GA 4DR1O 1D5NA 3TCUA 1JX9A 2JJ1G 3SPJA 3R65A 1Y66A 1PP9H 4LBEC 1DF4A 1NU1H 3JAKA 1Q6IA 3DC6A 4JI3O 3TXQA 1RP3B 1P49A 4JI2O 1KKCA 2LO1A 5D5QA 1OCZB 2AHYA 1FS0G 1JVMA 2ATKC 5AG2A 1N4CA 4LF6B 2XT9A 2V1DA 4DV1B 4JI2B 3HPLC 4UCTA 4EB6B 1AP5A 1SESA 3FYIB 3DXRB 2Y0IA 4Q6GA 4UFZA 4DV0O 3ICXA 2X7RB 2BSKB 4WBNB 1HWYA 4PDVA 1MSDA 2CUGA 3T4ZA 2FB5A 4I50A 4I0XB 2E76B 2OIGA 1NH2B 1N32O 2A0LA 1PNMA 1YSCA 4QJFB 3ABMC 3RWRD 3LNNA 1PD3A 3QVNA 1N0JA 1XQ8A 3E8BA 3K0DA 1QLNA 3QO7A 1YTFD 4ASUG 1CP9A 2G38A 4X9QA 4KHPO 2A3QA 1G6UA 3ABKB 3L9DA 4DR5B 4X66O 4O4JB 3E8GA 4ICGA 4GLXA 3L73H 4X8AA 4DV2B 3G6BA 3K9SA 4WF9V 3ZN0A 2IJJA 4UCOA 3SJQC 3UQ8A 1LNQA 2QR4A 5B3SC 3HR0A 4OX9O 4MVMA 4FIPC 2Q7EA 1BCCH 1XILA 4J80A 4TQFA 1NJIW 5KA5A 3OGCC 3WB1A 3CCEV 1I94O 1S5JA 2MW2B 2YXYA 3BY6A 1F51A 2EIKB 3TGUH 1ZSPA 4DR6O 3SPGA 3WB2A 2CH7B 2R9IA 3J7AU 3HKBA 3JARA 1GM8A 3D3QA 3LUTB 4JAAA 4JI8O 4RAIA 4B3MB 1PL0A 2WLIA 3M7MX 4B3RB 2B9ZA 1XHXA 4I5SA 1HR0O 1NVPD 4GX0A 3CWBH 5IYZA 4TQDA 3C3SA 3Q4HB 1PV0A 2EBOA 4YJ2A 2OCCB 3ZHUA 5BY1A 3B2EE 3CC7V 1YJWV 1IVSA 2HVKC 4LH7A 2H3OA 3IAYA 4U3JB 2ADQB 4CS2A 1WNSA 5H6RA 3C90A 1HP8A 3SR2C 1AI7A 3ZMZA 1KB9F 5LHHA 1Y4MA 4AQYB 2X6AA 3ABLB 3VQWA 1R3LC 2ZNJA 5A2QN 2ZDIA 4UVAA 2CGNA 5B5EZ 3FB5C 4MTFA 4FFBB 4F6RB 1IBLO 3OFNG 1Q90D 5LXTB 2E75B 5ITZA 1K4CC 4NTWA 3CRCA 4J9ZB 1HNWO 3GWKC 4E4EA 1OJHA 5CMUA 2P22C 1OCCB 4IIJA 2ITCC 1CEZA 1VP7A 1GAXA 2F93B 1HW7A 1W0JG 5IWAB 1Y74B 2HEPA 4YJ2B 4DW0A 1RSOB 2VQEO 3OGIB 3CCSV 2YXHA 4K35A 4I50B 4OPHA 4CZZA 1HNXO 2LGWA 4TUYB 3IC7A 3JALB 3CRRA 1XL4A 5FNVB 3HKCB 2BSKA 3T1YO 4G28B 4JI4O 2O57A 2P4KA 4TT3G 3OTFA 3T1HO 1VQ4V 4B3SO 2P90A 3ABUA 4I9QA 2YC0A 1KECA 2IH3C 3HKBB 3JARB 2PI4A 2PTMA 4GKJO 4D6TH 2YUAA 1OCOB 2XAGA 2R9RB 2YSUB 5L3FA 4MVQA 1AP6A 1Q6HA 1WN7A 2CGOA 2E74B 3O65A 3P3NA 1WB8A 4DK1A 2Q9LA 1IBKO 2GHYA 1L1FA 3ZJZA 4JI4B 1JCHA 1IDSA 2XNDG 1Q8IA 2WLKA 1UFIA 1XNRB 4DR7O 1MSWD 2DOSA 2YS8A 1RM1B 1R3IC 5J2TB 1NTMH 2VWJA 2JS5A 2KG7A 3ZIAG 4P2ZA 5E1AC 1GMGA 4DYLA 1VQOV 3KCXA 2QWNB 2AHZA 4MVSA 3RYFA 3MAQA 3MD0A 3ETQA 2ILMA 3JASA 4JI3B 2P7TC 1N32B 5IWAO 2H94A 2KB1A 1VIBA 1PL4A 3SDLA 5IYCO 4TV9B 1T5EA 3H01A 1TVKB 4UB8Z 4DR1B 4EEQA 4JYYA 2QDOA 3R66A 1XUQA 3U10A 2BTOA 4DV4B 2B1IA 4H13B 5EIBD 1KMIZ 2Y4TA 4F4LA 5FPOA 3TXSA 1AJQA 3BA9A 3ZHVA 4DV7O 2NLJC 3AK1A 4LC1A 1XNQB 1NS1A 5LGNA 4CS3A 1YTFB 3OMIB 5E79Z 2PYLA 2UXDB 1V9PA 2ETNA 3K5NA 4WFBV 1EM1A 1WB7A 3W7XA 5J2TA 4GX1A 1H2KA 1LUVA 1MA1A 5K1XA 1AR4A 2QKAA 2ZT9B 5L3GA 2D2CB 4O2AB 2P67A 2DYSB 1V55C 2ZR3A 4UCUA 2BOBC 4RQFA 1P4RA 3T4DA 4EB6A 2Q5ZA 2Q4PA 3CE2A 1FFXA 3TK1A 2UUCO 4BIUA 4LF5O 5CBHA 1VQ7V 1H2LA 2AW9A 3WFVA 4R7CA 1DGSA 2EX3A 2L35A 5B1OA 2EJ7A 1MMMA 3EFFK 3HB3B 5IT9N 4O4LB 3EVKA 3FYEB 1VQ5V 1G8MA 5H2FZ 1K7DA 2ODMA 4CC6A 1O9HA 2FKXA 2P4VA 4IHJB 1XNQO 4X65O 4FZ0A 5GTIZ 4OGQB 2CTWA 1K92A 1YDXA 2K1EA 2CK3G 2BTQA 1L8DA 3X2QC 3KCYA 4JPRA 3H1LH 4DR5O 4MVZA 5LOVB 2EZOA 4WCEV 3RYHA 1S5HC 4LNUB 2RN9A 4KUMA 1R3KC 2ZD9A 4R50A 1PPJH 2F43G 1AR5A 4LF6O 2DYRC 2QWRB 1OCZC 4DO2A 4I7ZB 3I5DA 1SQFA 1KC8W 2ZXWB 1IBMO 2DE0X 1WLEA 4NTXA 1VQ8V 1K8AW 1YIJV 3OEHG 2UXBB 1EN6A 1L0LH 1BQ0A 5B1NA 1Z2GA 2YIBA 4DV7B 1BS3A 2KKWA 4Z1MG 2ZM6O 2KSDA 1KUQA 4X62O 4QNHB 4PDLA 4DR3B 3SGIA 4BW5A 2Z3YA 4YY3B 4NYKA 1BQZA 1H38A 4U7NA 5KHKA 1S0VA 2IU3A 4ZIBA 4LWSB 4U3FH 5BR8B 1TA8A 5GONB 3K79A 2GSMB 3LNMB 3W7TA 1NVPB 4LFBB 1M90W 4YY3O 2WLHA 5LMNO 5BMVA 2OWOA 2MK3A 4FLYA 1P7BA 1EZVH 1VF6C 5D5PA 4ABMA 1KD1W 2WPDG 4O4HA 1SRYA 4YXWG 2Q68A 4UUJC 2RMKB 4DV5O 3DC5A 3K3WA 4ZHQB 2WLMA 4UCSA 3WG7C 1WA8B 3BEHA 4Z2WA 1MABG 4B7KA 3H1JH 1K4DC 3CRQA 5EIBC 1AJNA 3WB0A 3TJTA 5B1BC 5IYBO 1M93A 1SC5B 4FZ1A 4UVCA 3UT5A 1S72V 4BWAA 3VQVA 1WP8A 3E83A 3OD4A 3SYAA 2HJFC 4TV8B 1JPXA 3G67A 2OYQA 3CPWU 4NXMB 4HYOA 2ZE7A 1MG1A 3A0BZ 3H1HH 4LF4B 2AGAA 1BMFG 3BCCH 4KFMA 4YJ3A 4K0KB 3L71H 2Q0AA 3CHXA 5LMUO 3L70H 5HFMA 3LSUA 4O4LA 1H2SB 3U11A 3LSSA 4I55B 5GW7A 4DR6B 4R8CA 5CB4B 1QCEA 3IC9A 4QGPA 1F23A 1YF2A 1QLEC 4DUYB 4J7JA 1SETA 3MHHC 1I5YA 2ITDC 2YXLA 1GH6A 2GBOA 2EIJB 1NTKH 3AG4B 3JAWB 2WLJA 5BZBA 3ZMSA 3VQYA 1HNZB 5K1PA 4AQYO 2XHBA 4TUYA 2QWQB 4MS2A 1ROPA 2XAFA 2DN9A 1MOFA 3H1IH 1M56C 1NBMG 4WBNA 1MZFA 2AZ2A 3APQA 2DQ3A 4FLUA 3ZS8C 1M1KW 3CXHF 2JDIG 5KX5B 4JI6B 1DLBA 4ZI7A 2YEVB 3ZRWB 1QLEB 4PA6A 2ZE5A 4H44B 4ZBMA 3CJHB 4XDJA 5GTHZ 1IBKB 1YJ9V 1BSMA 3JD3A 3OUFA 3VOUA 1O9GA 4G2KA 4XDLA 4TV9A 4D7SA 2PI5A 1B04A 1D5AA 4LP8A 3FD9A 2WSSG 3JSLA 1DTOA 2BE3A 2XASA 2W0XA 4JV5O 1FKAO 3B8NA 1AROP 2XAQA 1KKDA 2WWWA 1B06A 3N2GB 5B3SB 1QU7A 2EINB 2KQXA 3I56V 3AG3C 1OCOC 4JI1B 4IYHA 4DV0B 1KBHA 3OR7C 5IJ0B 2QWOB 4MVRA 5DEDA 3L72H 1Q81W 1Z5WA 4MTXA 3VQXA 2IM9A 3K58A 2W6JG 2BTQB 3F5TA 3BFRA 2ZKOA 5EK0A 2GUZB 2WLIB 1D2DA 4JTCB 1AR1B 1SQPH 1UJWB 1YEWA 4IHJA 2RCVA 5DN6G 2CH7A 5BR8O 5CA0A 4PELA 1ZUQA 3O9OA 5FNVA 3K5MA 4X1YB 4EFEA 2DWEC 1OCCC 5IJ0A 5IE9A 2UU9B 2EILC 4GCZA 1ZX3A 4LR3A 1JJ2U 4JASA 1E79G 4KXRA 5FL7G 1X4TA 3JATB 4FJCC 4JYAB 4RO2A 1NQTA 3CEIA 1K3EA 4GKKO 3ASNB 4MTOA 4IL6Z 3T1YB 1NR7A 2OIEA 3L75H 3D36C 3W7WA 1TUBB 3X2QB 4X65B 3A2FA 2UUAO 2R9AA 3NXSA 4GUNA 1BT8A 5KLVH 1SZTA 4PD4F 3A8TA 3DTUB 1XBLA 1GN2A 5LMNB 4ZI7B 1W59A 3K5LA 3CCVV 5IJ9B 4JZ2A 2B1GA 4EKWA 5KUKA 2IJHA 3M99B 3ABLC 2IJKA 2ARHA 3CCMV 4B08A 2EIKC 2Q67A 4BAYA 4X1KA 4DV6O 3RW0A 2UUBB 4UV8A 1WAZA 4J11A 1IZ3A 4PI2A 5EBLC 1B6QA 2JGDA 5LL6Y 5C8YB 3JAWA 3FB7C 1GN6A 2CAZC 5JH7B 5EC1C 1OCRC 3B4SA 5KAFZ 2FTKA 4QE7A 2JRIA 3CX5F 4DV6B 1SKVA 2P06A 3N2KB 4DV3B 3SJAC 1N33B 4LFCB 2CDYA 2QM4A 1SF9A 1HR0B 2NR5A 4PI0A 5C8YA 3SYCA 4DXWA 1GO3F 3A0RA 1EN5A 3TETA 3G71V 1JQ0A 4JF3A 3E22A 1S3JA 4FM0A 4UV9A 4GYCB 2JEUA 3THOA 4DUZO 4X1KB 1Q82W 3AEIA 3JALA 4NXNO 1FAFA 1R6NA 2JGDB 3ZMUA 4DR7B 3WG7B 3ZRWA 3ABTA 5JQGA 3JCUZ 1M56B 1OZ0A 4PA7A 4O4HB 1JR9A 3BABA 1QBZA 4X89A 1NR1A 4PA3A 2LP7A 4O4JA 3CRMA 1CPYA 1TVKA 2LGQA 5CN0A 4FPPA 3ZMVA 2Q0OC 2ADPA 3RYIA 5LA6B 3ABKC 4PDMA 3E89A 4JI5O 1TUBA 2XAJA 5DECA 3LDEA 1BGYH 5ITZB 4X64B 4HZ3A 2LFSA 1KP2A 4YHHB 4G27B 1GRJA 2LW7A 3JATA 2LW1A 3AK2A 1B3QA 3F5WC 3OMAB 1HNXB 3IJ4A 1TAEA 4OXSA 2XAHA 4NR1A 2IW5A 1UPGA 4FLVA 4MTGA 2ZXWC 3BRCA 3T1HB 4B3SB 4LFBO 1NKDA 3OEEG 4X20B 1H2NA 2GUZA 2IH1C 4LH6A 4DW1A 5B1AB 3K0GA 3J81N 2WLNA 1P7GA 5J9PC 2HKOA 1QR8A 3SPCA 3AK3A 3ZHSA 4B7EA 4ZHQA 2DJVA 2QKCA 1M4UA 2OTLV 4LFAO 1H2MA 2P5OA 2N05A 4ZKIA 2QTOA 4W4LA 4LF7B 1Y67A 1X59A 1SA0B 3ZX6A 4GZRB 2LQTA 3HKDB 2WLLA 3STLC 1KP3A 1Z5VA 4LF5B 4QPJA 3LSQA 2F1MA 2UUCB 5KMGB 4GX5A 1FXVA 4ZOLB 1I5XA 4DR2O 3EXAA 2PF4E 3MHSC 1Q3EA 4FVMA 5JJEB 1FXKA 4RQEA 5H6QA 2YEVA 5IYDO 2JJ2G 3OT7A 1YJNV 1LUWA 4Q20A 4E2LA 1WPXA 4IGGA 5L3DA 3G80A 4LF8B 2E5LO 1IXBA 3RFRA 5IY5C 3LDDA 1VF5B 2VS0A 1NH2D 4RUFA 2X6BA 1V54B 3J80N 1ZTEA 1F4MA 4LF9O 2QM8A 3F7YC 3EHBB 1SQGA 4GT1A 4UVBA 2VQEB 2EIMB 2YI8A 4B3TB 1FJGB 4P30A 1DF5A 1VEWA 2Y48A 4X1YA 3WU2Z 1JFFB 3RBZA 4NTYA 5CBGA 4I0XA 1IXMA 1THZA 2QEXV 1AJPA 3ZMTA 1WPBA 1GM7A 1SS3A 3IGAC 1XEQA 3RYHB 4JTAB 4DRXA 4LF9B 4J7KA 1PNLA 5H5NA 2F4VB 4JV5B 3M8AA 3B40A 4UCRA 4LF8O 5LGUA 1COWG 1SERA 2A06H 5CB4A 4HNAB 4K0KO 3ZN1A 4GKKB 4PA4A 1VARA 4BR6A 4AI8A 3AG2C 2DYRB 3HKEB 4C7UA 3CXCU 1M57B 2L6LA 3P3PA 4H0LB 3NR7A 1Y76B 4HNAA 3CCUV 3SPIA 2EILB 2VQFO 5EYPA 4MT8A 3UT5B 1M9NA 1FFXB 4JYCA 2IU0A 5JCOC 3K5OA 1PKXA 1ZL8A 2YDEA 4PJ0Z 5LP6C 3CCJV 1VQ6V 4JYBA 4CH5A 4OX9B 5LP6B 4B3MO 2AZ0A 4DRXB 4JI0O 1Y6XA 3RN4A 5LBQA 3E8FA 4GKJB 2OCHA 5EZYA 5L3CA 4TSFG 5KA6A 3PN1A 2W6IG 3D3IA 3CD6V 1HDJA 3FAVA 1JFFA 3OW2U 4MSWC 4NKGB 2JVDA 1IURA 1EN4A 3CCRV 4CC5A 2X0LA 3KKYA 4UCVA 4O2BB 2PYJA 5J2UA 3CMAV 2EINC 2QWPB 3K57A 2GTAA 4DR3O 2D3OW 3ZHTA 3FAVB 3CRAA 2ZM6B 1E1RG 3E86A 3B8MA 3DXRA 5H9CA 5KHJA 3QG5A 5B1AC 4JAVA 4IIJB 1IBLB 2V4DA 1R73A 2DYSC 3QO8A 1FXHA 2K9PA 2EIJC 5A9GA 4JI1O 1GKFA 1FFTB 1J5EB 4JI8B 2XUMA 3QO5A 5B66Z 2Q69A 4YIPA 3CSXA 2HFEC 3GWOA 4FFBA 4F6RA 1H8HG 5EYPB 1Q7YW 2P6JA 4X64O 2F4VO 1G1XB 1QNMA 4DUZB 3ZBHA 3ASOB 5LYJA 1S77D 2PUSA 1SA0A 3OE7G 3APOA 4MVUA 1Q5OA 3S3XA 5LOVA 1AB3A 1RPOA 3K9AA 4H37A 1H2GA 3K04A 1AI6A 4Z1VA 2CE4A 2Q7GA 1K97A 4P9PA 2PGGA 4DK0A 1OHHG 3FKSG 1XMQB 2JGUA 1LR1A 2HP8A 4CS4A 2HLDG 5JWPA 2OTJV 2A9HA 1V54C 5BXZA 3E35A 3ZRSA 1RFYA 4UB6Z 2ZIOA 3RVYA 1BL8A 4J10A 5EC2C 4JTDB 1L0NH 1URFA 4QPKA 5CBFA 3CB2A 1W2BU 4LFCO 4FLTA 1N34B 3L74H 4QIWF 4YIOA 4FK5C 1VMGA 3FFQA 4N23A 4XDKA 5DM6V 5KHHA 2HJDA 2M7WA 3ZHQA 1BHBA 3ML0A 2JS3A 4N21A 3RGBA 5LHGA 3SJCC 4D7TA 1I94B 3K08A 4I4TA 3T2MA 4QE9A 1JMKC 4O2AA 4IT5A 1PM9A 1SZXA 3ETEA 4DV3O 1XOUA 3QF7A 2UXDO 5JVDB 4JI7O 1K9MW 2ZE8A 4JZGA 3ABMB 1N36O 3F7VC 1JOYA 2WA3A 4DUYO 1QQCA 4MVOA 2RDCA 1GN3A 2VRZA 2WLLB 4H33A 4DV5B 2CTRA 3JASB 2X6CA 4I9WA 1WP7A 5LP6A 3E2EA 2Q6AA 1RPRA 1QHTA 3LDCA 3B77A 4KL1A 5JVDA 1ENVA 2OT5A 2AXTZ 4DR2B 4DV4O 2FYUH 2UXNA 4RUEA 1G4YB 2PZSA 1GTOA 4O4IB 2Z0AA 1QR9A 2JEXA 3MDSA 1ZWIC 1NT2B 1TGOA 4BIOA 3PJSK 4P9OA 3E22B 3DSQA 4X66B 3N2KA 1VQNV 1NZ6A 4CBCA 4JYAO 3GB7C 5KAIZ 4DV1O 4X1IA 4MW3A 1GM9A 4WFHA 5L3BA 4YJ3B 4JI7B 4JAUA 3JD1A 4U7OA 5CA0B 3OUSA 2GDSA 3G6EV 4CH6A 4O4IA 4WFGA 2QSAA 4X1IB 1VQPV 4YHHO 5JH7A 1HNWB 3OTOO 2DMXA 5KUMA 3BPZA
chains in the Genus database with same CATH topology
3IJ4A 2L35A 4FZ1A 4NTYA 2FB5A 3S3WA 3S3XA 4NTXA 4NYKA 4NTWA 2QTSA 1WP7A 1WP8A 3N27A 4FZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ4 A;  2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  3S3W A;  3S3X A;  4NTX A;  4NYK A;  4NTW A;  2QTS A;  1WP7 A;  1WP8 A;  3N27 A;  4FZ0 A; 
#chains in the Genus database with same CATH topology
 4TOI A;  1SQX H;  1V55 B;  4BIZ A;  1I08 A;  4J7Z A;  1FYJ A;  4HAM A;  5HFL A;  3BHP A;  1YIT V;  3FB8 C;  1Y74 A;  2BCC H;  4GX2 A;  2GV9 A;  1EFR G;  1YHQ V;  4R6Z A;  4WFA V;  3AG1 B;  3JD4 A;  1SQV H;  4KP4 A;  1XHZ A;  4JI0 B;  5LA6 A;  3RYI B;  1RSO A;  1BZK A;  1Q6U A;  1FD9 A;  5EBW C;  2XOK G;  4NVP A;  1CXZ B;  5JQG B;  3KG2 A;  3VBB A;  2ZIM A;  3D8C A;  3RYC A;  5LXT A;  1EZJ A;  2DW4 A;  3D36 A;  4ZOL A;  1XL6 A;  5LHI A;  3JD2 A;  4FM2 A;  2VQF B;  1QVF U;  5KX5 A;  1US6 A;  1OCR B;  2NN4 A;  3HKD A;  3SPH A;  2UXC O;  3ZED A;  1MZE A;  3JCZ A;  4TWK A;  2UUA B;  5J2U B;  3B09 A;  1S76 D;  1FPO A;  1E1Q G;  2E5L B;  1YVW A;  3CS5 A;  4DR4 O;  1N0N A;  3CCQ V;  1BE3 H;  2Q8V A;  3H1K H;  1NTZ H;  3ZRX A;  1AI5 A;  3Q4H A;  5IYZ B;  3E8H A;  1A32 A;  2GTS A;  5CA1 B;  4J41 A;  3ASN C;  3RVZ A;  5CA1 A;  3JD0 A;  2QA4 V;  3BAA A;  4B3T O;  3HKC A;  4FM1 A;  3S3W A;  2YIA A;  4DV2 O;  1YCI A;  2EUL A;  1F7Y A;  4OPA A;  1Q43 A;  4PV1 B;  4RWU A;  1KU9 A;  2HVJ C;  2EIM C;  1ZL8 B;  4FFK A;  2V7Q G;  2Q73 A;  4F6E A;  1NI8 A;  2IBZ H;  5B1B B;  5JCO A;  1XNR O;  5L3E A;  4NB5 A;  1FXK C;  3W7S A;  3C3T A;  3K59 A;  3ASO C;  3ZHR A;  4LF4 O;  3BA8 A;  5JJJ B;  3OR6 C;  4PHZ A;  2QTS A;  3RT3 C;  2QKS A;  5TIS Z;  3OAA G;  1ZAU A;  1GN4 A;  4L87 A;  3RYC B;  1J95 A;  1XDC A;  2PY5 A;  1WA8 A;  1AI4 A;  2M6Y A;  2NNU A;  3CC2 V;  2WAM A;  3P32 A;  4UXN A;  2A79 B;  3P30 A;  2EJR A;  3SYP A;  1PNK A;  3K03 A;  3N27 A;  3AG4 C;  2YIC A;  4J42 A;  1JJO A;  2Y4U A;  5EBM C;  1XRE A;  3CJH A;  1R6T A;  4DR4 B;  4LFA B;  2JIZ G;  2E3C A;  2C2A A;  3AG1 C;  3I55 V;  4U3J A;  2FL4 A;  1U97 A;  2F95 B;  1N8R W;  1I7F A;  4XBF A;  1YXB A;  1K5Q A;  3W7U A;  1RM1 C;  1H8E G;  4LF7 O;  1K34 A;  2DWD C;  3FX7 A;  1EBO A;  2B5U A;  2UXC B;  1K5S A;  1QVG U;  3OTO B;  4KHP B;  1ZLZ A;  4K3A A;  4O2B A;  1MNG A;  3STZ C;  1J5E O;  3A0H Z;  2VWK A;  2ZNI A;  2UXX A;  2JK5 C;  2YIB D;  3ETG A;  4FLX A;  2ZE6 A;  1W0K G;  3H9V A;  3UKM A;  1I0H A;  4LCU C;  1F4N A;  3CME V;  1Q86 W;  2UU9 O;  2RQ6 A;  1K73 W;  1VQM V;  1VQL V;  5EZY B;  1R1B A;  3AG7 A;  2OCC C;  2LJ2 A;  3GVM A;  4FLZ A;  2UXB O;  4W4K A;  2A7W A;  2ZCE A;  2LFR A;  4CH3 A;  1HNZ O;  4TV8 A;  2HG5 C;  4X62 B;  1IBM B;  1VQ9 V;  5CA3 A;  3HKE A;  4AIL C;  1K33 A;  2YID A;  2QM7 A;  1OV9 A;  1U96 A;  4JI6 O;  2YI9 A;  4IYI A;  3AG3 B;  1N36 B;  3UCS C;  1Y76 A;  2N04 A;  4LNU A;  4J9Y B;  3CYO A;  4WFF A;  5C93 A;  1XMO O;  1XI1 A;  3G4S V;  4CH4 A;  2CTQ A;  1KQS U;  1TUE B;  4PA9 A;  3BVO A;  1BHA A;  2ZR2 A;  4HBN A;  3QTC A;  3OM3 B;  1FJG O;  5IJ9 A;  1AVM A;  4X88 A;  1YZB A;  4MW8 A;  3K06 A;  2ZIN A;  1VF6 A;  1R6K A;  4AHC A;  2Q7H A;  3KZI Z;  1IX9 A;  4K8Z A;  2Y69 B;  5GON A;  2Z5U A;  3AG2 B;  2QE7 G;  3ZCC A;  2EZP A;  4JGS A;  4X20 A;  5LGT A;  2RJZ A;  3QNE A;  1M57 C;  1SQQ H;  5LYJ B;  4FLW A;  5BMV B;  3CP1 A;  3SYO A;  2BOC C;  4PDR A;  2R72 A;  5FLX N;  1VF7 A;  4FMT A;  2F66 C;  4NXN B;  4LWS A;  1KYO F;  1VQK V;  2F23 A;  4I4T B;  4NXM O;  1DK1 A;  1XMQ O;  5F2V O;  2IJI A;  5JJN B;  4EFB A;  2DQ0 A;  4L8J A;  5LMU B;  2HR3 A;  5KHI A;  2QJ1 A;  1N34 O;  1R3J C;  4I55 A;  1JA8 A;  2ZDI C;  2HHH O;  1N33 O;  3JSN A;  1WJZ A;  2Y69 C;  4B3R O;  2R70 A;  2Y0P A;  3T1C A;  3JAK B;  1SQB H;  3UO3 A;  3JAM N;  5KMG A;  2RNB A;  5KHG A;  1FXK B;  2QGN A;  2ZQM A;  3SJB C;  1YI2 V;  3FB6 C;  3SYQ A;  5IDJ A;  2CTP A;  3CC4 V;  3OMN B;  3DGE A;  2WA4 A;  4A5U B;  3JYC A;  3IFX A;  2W0F C;  1ORQ C;  1S5L Z;  2HHH B;  1M5I A;  3RYF B;  3U0Z A;  1GK9 A;  4K8X A;  2H8P C;  2FML A;  2XTA A;  3CCL V;  3ETD A;  1AIL A;  1XMO B;  1P84 F;  2UUB O;  5IY5 B;  2KG7 B;  4BW9 A;  4WFE A;  4JI5 B;  5FPR A;  3UM7 A;  3ZRV A;  3UO2 A;  2N74 A;  3N2G A;  4DR1 O;  1D5N A;  3TCU A;  1JX9 A;  2JJ1 G;  3SPJ A;  3R65 A;  1Y66 A;  1PP9 H;  4LBE C;  1DF4 A;  1NU1 H;  3JAK A;  1Q6I A;  3DC6 A;  4JI3 O;  3TXQ A;  1RP3 B;  1P49 A;  4JI2 O;  1KKC A;  2LO1 A;  5D5Q A;  1OCZ B;  2AHY A;  1FS0 G;  1JVM A;  2ATK C;  5AG2 A;  1N4C A;  4LF6 B;  2XT9 A;  2V1D A;  4DV1 B;  4JI2 B;  3HPL C;  4UCT A;  4EB6 B;  1AP5 A;  1SES A;  3FYI B;  3DXR B;  2Y0I A;  4Q6G A;  4UFZ A;  4DV0 O;  3ICX A;  2X7R B;  2BSK B;  4WBN B;  1HWY A;  4PDV A;  1MSD A;  2CUG A;  3T4Z A;  2FB5 A;  4I50 A;  4I0X B;  2E76 B;  2OIG A;  1NH2 B;  1N32 O;  2A0L A;  1PNM A;  1YSC A;  4QJF B;  3ABM C;  3RWR D;  3LNN A;  1PD3 A;  3QVN A;  1N0J A;  1XQ8 A;  3E8B A;  3K0D A;  1QLN A;  3QO7 A;  1YTF D;  4ASU G;  1CP9 A;  2G38 A;  4X9Q A;  4KHP O;  2A3Q A;  1G6U A;  3ABK B;  3L9D A;  4DR5 B;  4X66 O;  4O4J B;  3E8G A;  4ICG A;  4GLX A;  3L73 H;  4X8A A;  4DV2 B;  3G6B A;  3K9S A;  4WF9 V;  3ZN0 A;  2IJJ A;  4UCO A;  3SJQ C;  3UQ8 A;  1LNQ A;  2QR4 A;  5B3S C;  3HR0 A;  4OX9 O;  4MVM A;  4FIP C;  2Q7E A;  1BCC H;  1XIL A;  4J80 A;  4TQF A;  1NJI W;  5KA5 A;  3OGC C;  3WB1 A;  3CCE V;  1I94 O;  1S5J A;  2MW2 B;  2YXY A;  3BY6 A;  1F51 A;  2EIK B;  3TGU H;  1ZSP A;  4DR6 O;  3SPG A;  3WB2 A;  2CH7 B;  2R9I A;  3J7A U;  3HKB A;  3JAR A;  1GM8 A;  3D3Q A;  3LUT B;  4JAA A;  4JI8 O;  4RAI A;  4B3M B;  1PL0 A;  2WLI A;  3M7M X;  4B3R B;  2B9Z A;  1XHX A;  4I5S A;  1HR0 O;  1NVP D;  4GX0 A;  3CWB H;  5IYZ A;  4TQD A;  3C3S A;  3Q4H B;  1PV0 A;  2EBO A;  4YJ2 A;  2OCC B;  3ZHU A;  5BY1 A;  3B2E E;  3CC7 V;  1YJW V;  1IVS A;  2HVK C;  4LH7 A;  2H3O A;  3IAY A;  4U3J B;  2ADQ B;  4CS2 A;  1WNS A;  5H6R A;  3C90 A;  1HP8 A;  3SR2 C;  1AI7 A;  3ZMZ A;  1KB9 F;  5LHH A;  1Y4M A;  4AQY B;  2X6A A;  3ABL B;  3VQW A;  1R3L C;  2ZNJ A;  5A2Q N;  2ZDI A;  4UVA A;  2CGN A;  5B5E Z;  3FB5 C;  4MTF A;  4FFB B;  4F6R B;  1IBL O;  3OFN G;  1Q90 D;  5LXT B;  2E75 B;  5ITZ A;  1K4C C;  4NTW A;  3CRC A;  4J9Z B;  1HNW O;  3GWK C;  4E4E A;  1OJH A;  5CMU A;  2P22 C;  1OCC B;  4IIJ A;  2ITC C;  1CEZ A;  1VP7 A;  1GAX A;  2F93 B;  1HW7 A;  1W0J G;  5IWA B;  1Y74 B;  2HEP A;  4YJ2 B;  4DW0 A;  1RSO B;  2VQE O;  3OGI B;  3CCS V;  2YXH A;  4K35 A;  4I50 B;  4OPH A;  4CZZ A;  1HNX O;  2LGW A;  4TUY B;  3IC7 A;  3JAL B;  3CRR A;  1XL4 A;  5FNV B;  3HKC B;  2BSK A;  3T1Y O;  4G28 B;  4JI4 O;  2O57 A;  2P4K A;  4TT3 G;  3OTF A;  3T1H O;  1VQ4 V;  4B3S O;  2P90 A;  3ABU A;  4I9Q A;  2YC0 A;  1KEC A;  2IH3 C;  3HKB B;  3JAR B;  2PI4 A;  2PTM A;  4GKJ O;  4D6T H;  2YUA A;  1OCO B;  2XAG A;  2R9R B;  2YSU B;  5L3F A;  4MVQ A;  1AP6 A;  1Q6H A;  1WN7 A;  2CGO A;  2E74 B;  3O65 A;  3P3N A;  1WB8 A;  4DK1 A;  2Q9L A;  1IBK O;  2GHY A;  1L1F A;  3ZJZ A;  4JI4 B;  1JCH A;  1IDS A;  2XND G;  1Q8I A;  2WLK A;  1UFI A;  1XNR B;  4DR7 O;  1MSW D;  2DOS A;  2YS8 A;  1RM1 B;  1R3I C;  5J2T B;  1NTM H;  2VWJ A;  2JS5 A;  2KG7 A;  3ZIA G;  4P2Z A;  5E1A C;  1GMG A;  4DYL A;  1VQO V;  3KCX A;  2QWN B;  2AHZ A;  4MVS A;  3RYF A;  3MAQ A;  3MD0 A;  3ETQ A;  2ILM A;  3JAS A;  4JI3 B;  2P7T C;  1N32 B;  5IWA O;  2H94 A;  2KB1 A;  1VIB A;  1PL4 A;  3SDL A;  5IYC O;  4TV9 B;  1T5E A;  3H01 A;  1TVK B;  4UB8 Z;  4DR1 B;  4EEQ A;  4JYY A;  2QDO A;  3R66 A;  1XUQ A;  3U10 A;  2BTO A;  4DV4 B;  2B1I A;  4H13 B;  5EIB D;  1KMI Z;  2Y4T A;  4F4L A;  5FPO A;  3TXS A;  1AJQ A;  3BA9 A;  3ZHV A;  4DV7 O;  2NLJ C;  3AK1 A;  4LC1 A;  1XNQ B;  1NS1 A;  5LGN A;  4CS3 A;  1YTF B;  3OMI B;  5E79 Z;  2PYL A;  2UXD B;  1V9P A;  2ETN A;  3K5N A;  4WFB V;  1EM1 A;  1WB7 A;  3W7X A;  5J2T A;  4GX1 A;  1H2K A;  1LUV A;  1MA1 A;  5K1X A;  1AR4 A;  2QKA A;  2ZT9 B;  5L3G A;  2D2C B;  4O2A B;  2P67 A;  2DYS B;  1V55 C;  2ZR3 A;  4UCU A;  2BOB C;  4RQF A;  1P4R A;  3T4D A;  4EB6 A;  2Q5Z A;  2Q4P A;  3CE2 A;  1FFX A;  3TK1 A;  2UUC O;  4BIU A;  4LF5 O;  5CBH A;  1VQ7 V;  1H2L A;  2AW9 A;  3WFV A;  4R7C A;  1DGS A;  2EX3 A;  2L35 A;  5B1O A;  2EJ7 A;  1MMM A;  3EFF K;  3HB3 B;  5IT9 N;  4O4L B;  3EVK A;  3FYE B;  1VQ5 V;  1G8M A;  5H2F Z;  1K7D A;  2ODM A;  4CC6 A;  1O9H A;  2FKX A;  2P4V A;  4IHJ B;  1XNQ O;  4X65 O;  4FZ0 A;  5GTI Z;  4OGQ B;  2CTW A;  1K92 A;  1YDX A;  2K1E A;  2CK3 G;  2BTQ A;  1L8D A;  3X2Q C;  3KCY A;  4JPR A;  3H1L H;  4DR5 O;  4MVZ A;  5LOV B;  2EZO A;  4WCE V;  3RYH A;  1S5H C;  4LNU B;  2RN9 A;  4KUM A;  1R3K C;  2ZD9 A;  4R50 A;  1PPJ H;  2F43 G;  1AR5 A;  4LF6 O;  2DYR C;  2QWR B;  1OCZ C;  4DO2 A;  4I7Z B;  3I5D A;  1SQF A;  1KC8 W;  2ZXW B;  1IBM O;  2DE0 X;  1WLE A;  4NTX A;  1VQ8 V;  1K8A W;  1YIJ V;  3OEH G;  2UXB B;  1EN6 A;  1L0L H;  1BQ0 A;  5B1N A;  1Z2G A;  2YIB A;  4DV7 B;  1BS3 A;  2KKW A;  4Z1M G;  2ZM6 O;  2KSD A;  1KUQ A;  4X62 O;  4QNH B;  4PDL A;  4DR3 B;  3SGI A;  4BW5 A;  2Z3Y A;  4YY3 B;  4NYK A;  1BQZ A;  1H38 A;  4U7N A;  5KHK A;  1S0V A;  2IU3 A;  4ZIB A;  4LWS B;  4U3F H;  5BR8 B;  1TA8 A;  5GON B;  3K79 A;  2GSM B;  3LNM B;  3W7T A;  1NVP B;  4LFB B;  1M90 W;  4YY3 O;  2WLH A;  5LMN O;  5BMV A;  2OWO A;  2MK3 A;  4FLY A;  1P7B A;  1EZV H;  1VF6 C;  5D5P A;  4ABM A;  1KD1 W;  2WPD G;  4O4H A;  1SRY A;  4YXW G;  2Q68 A;  4UUJ C;  2RMK B;  4DV5 O;  3DC5 A;  3K3W A;  4ZHQ B;  2WLM A;  4UCS A;  3WG7 C;  1WA8 B;  3BEH A;  4Z2W A;  1MAB G;  4B7K A;  3H1J H;  1K4D C;  3CRQ A;  5EIB C;  1AJN A;  3WB0 A;  3TJT A;  5B1B C;  5IYB O;  1M93 A;  1SC5 B;  4FZ1 A;  4UVC A;  3UT5 A;  1S72 V;  4BWA A;  3VQV A;  1WP8 A;  3E83 A;  3OD4 A;  3SYA A;  2HJF C;  4TV8 B;  1JPX A;  3G67 A;  2OYQ A;  3CPW U;  4NXM B;  4HYO A;  2ZE7 A;  1MG1 A;  3A0B Z;  3H1H H;  4LF4 B;  2AGA A;  1BMF G;  3BCC H;  4KFM A;  4YJ3 A;  4K0K B;  3L71 H;  2Q0A A;  3CHX A;  5LMU O;  3L70 H;  5HFM A;  3LSU A;  4O4L A;  1H2S B;  3U11 A;  3LSS A;  4I55 B;  5GW7 A;  4DR6 B;  4R8C A;  5CB4 B;  1QCE A;  3IC9 A;  4QGP A;  1F23 A;  1YF2 A;  1QLE C;  4DUY B;  4J7J A;  1SET A;  3MHH C;  1I5Y A;  2ITD C;  2YXL A;  1GH6 A;  2GBO A;  2EIJ B;  1NTK H;  3AG4 B;  3JAW B;  2WLJ A;  5BZB A;  3ZMS A;  3VQY A;  1HNZ B;  5K1P A;  4AQY O;  2XHB A;  4TUY A;  2QWQ B;  4MS2 A;  1ROP A;  2XAF A;  2DN9 A;  1MOF A;  3H1I H;  1M56 C;  1NBM G;  4WBN A;  1MZF A;  2AZ2 A;  3APQ A;  2DQ3 A;  4FLU A;  3ZS8 C;  1M1K W;  3CXH F;  2JDI G;  5KX5 B;  4JI6 B;  1DLB A;  4ZI7 A;  2YEV B;  3ZRW B;  1QLE B;  4PA6 A;  2ZE5 A;  4H44 B;  4ZBM A;  3CJH B;  4XDJ A;  5GTH Z;  1IBK B;  1YJ9 V;  1BSM A;  3JD3 A;  3OUF A;  3VOU A;  1O9G A;  4G2K A;  4XDL A;  4TV9 A;  4D7S A;  2PI5 A;  1B04 A;  1D5A A;  4LP8 A;  3FD9 A;  2WSS G;  3JSL A;  1DTO A;  2BE3 A;  2XAS A;  2W0X A;  4JV5 O;  1FKA O;  3B8N A;  1ARO P;  2XAQ A;  1KKD A;  2WWW A;  1B06 A;  3N2G B;  5B3S B;  1QU7 A;  2EIN B;  2KQX A;  3I56 V;  3AG3 C;  1OCO C;  4JI1 B;  4IYH A;  4DV0 B;  1KBH A;  3OR7 C;  5IJ0 B;  2QWO B;  4MVR A;  5DED A;  3L72 H;  1Q81 W;  1Z5W A;  4MTX A;  3VQX A;  2IM9 A;  3K58 A;  2W6J G;  2BTQ B;  3F5T A;  3BFR A;  2ZKO A;  5EK0 A;  2GUZ B;  2WLI B;  1D2D A;  4JTC B;  1AR1 B;  1SQP H;  1UJW B;  1YEW A;  4IHJ A;  2RCV A;  5DN6 G;  2CH7 A;  5BR8 O;  5CA0 A;  4PEL A;  1ZUQ A;  3O9O A;  5FNV A;  3K5M A;  4X1Y B;  4EFE A;  2DWE C;  1OCC C;  5IJ0 A;  5IE9 A;  2UU9 B;  2EIL C;  4GCZ A;  1ZX3 A;  4LR3 A;  1JJ2 U;  4JAS A;  1E79 G;  4KXR A;  5FL7 G;  1X4T A;  3JAT B;  4FJC C;  4JYA B;  4RO2 A;  1NQT A;  3CEI A;  1K3E A;  4GKK O;  3ASN B;  4MTO A;  4IL6 Z;  3T1Y B;  1NR7 A;  2OIE A;  3L75 H;  3D36 C;  3W7W A;  1TUB B;  3X2Q B;  4X65 B;  3A2F A;  2UUA O;  2R9A A;  3NXS A;  4GUN A;  1BT8 A;  5KLV H;  1SZT A;  4PD4 F;  3A8T A;  3DTU B;  1XBL A;  1GN2 A;  5LMN B;  4ZI7 B;  1W59 A;  3K5L A;  3CCV V;  5IJ9 B;  4JZ2 A;  2B1G A;  4EKW A;  5KUK A;  2IJH A;  3M99 B;  3ABL C;  2IJK A;  2ARH A;  3CCM V;  4B08 A;  2EIK C;  2Q67 A;  4BAY A;  4X1K A;  4DV6 O;  3RW0 A;  2UUB B;  4UV8 A;  1WAZ A;  4J11 A;  1IZ3 A;  4PI2 A;  5EBL C;  1B6Q A;  2JGD A;  5LL6 Y;  5C8Y B;  3JAW A;  3FB7 C;  1GN6 A;  2CAZ C;  5JH7 B;  5EC1 C;  1OCR C;  3B4S A;  5KAF Z;  2FTK A;  4QE7 A;  2JRI A;  3CX5 F;  4DV6 B;  1SKV A;  2P06 A;  3N2K B;  4DV3 B;  3SJA C;  1N33 B;  4LFC B;  2CDY A;  2QM4 A;  1SF9 A;  1HR0 B;  2NR5 A;  4PI0 A;  5C8Y A;  3SYC A;  4DXW A;  1GO3 F;  3A0R A;  1EN5 A;  3TET A;  3G71 V;  1JQ0 A;  4JF3 A;  3E22 A;  1S3J A;  4FM0 A;  4UV9 A;  4GYC B;  2JEU A;  3THO A;  4DUZ O;  4X1K B;  1Q82 W;  3AEI A;  3JAL A;  4NXN O;  1FAF A;  1R6N A;  2JGD B;  3ZMU A;  4DR7 B;  3WG7 B;  3ZRW A;  3ABT A;  5JQG A;  3JCU Z;  1M56 B;  1OZ0 A;  4PA7 A;  4O4H B;  1JR9 A;  3BAB A;  1QBZ A;  4X89 A;  1NR1 A;  4PA3 A;  2LP7 A;  4O4J A;  3CRM A;  1CPY A;  1TVK A;  2LGQ A;  5CN0 A;  4FPP A;  3ZMV A;  2Q0O C;  2ADP A;  3RYI A;  5LA6 B;  3ABK C;  4PDM A;  3E89 A;  4JI5 O;  1TUB A;  2XAJ A;  5DEC A;  3LDE A;  1BGY H;  5ITZ B;  4X64 B;  4HZ3 A;  2LFS A;  1KP2 A;  4YHH B;  4G27 B;  1GRJ A;  2LW7 A;  3JAT A;  2LW1 A;  3AK2 A;  1B3Q A;  3F5W C;  3OMA B;  1HNX B;  3IJ4 A;  1TAE A;  4OXS A;  2XAH A;  4NR1 A;  2IW5 A;  1UPG A;  4FLV A;  4MTG A;  2ZXW C;  3BRC A;  3T1H B;  4B3S B;  4LFB O;  1NKD A;  3OEE G;  4X20 B;  1H2N A;  2GUZ A;  2IH1 C;  4LH6 A;  4DW1 A;  5B1A B;  3K0G A;  3J81 N;  2WLN A;  1P7G A;  5J9P C;  2HKO A;  1QR8 A;  3SPC A;  3AK3 A;  3ZHS A;  4B7E A;  4ZHQ A;  2DJV A;  2QKC A;  1M4U A;  2OTL V;  4LFA O;  1H2M A;  2P5O A;  2N05 A;  4ZKI A;  2QTO A;  4W4L A;  4LF7 B;  1Y67 A;  1X59 A;  1SA0 B;  3ZX6 A;  4GZR B;  2LQT A;  3HKD B;  2WLL A;  3STL C;  1KP3 A;  1Z5V A;  4LF5 B;  4QPJ A;  3LSQ A;  2F1M A;  2UUC B;  5KMG B;  4GX5 A;  1FXV A;  4ZOL B;  1I5X A;  4DR2 O;  3EXA A;  2PF4 E;  3MHS C;  1Q3E A;  4FVM A;  5JJE B;  1FXK A;  4RQE A;  5H6Q A;  2YEV A;  5IYD O;  2JJ2 G;  3OT7 A;  1YJN V;  1LUW A;  4Q20 A;  4E2L A;  1WPX A;  4IGG A;  5L3D A;  3G80 A;  4LF8 B;  2E5L O;  1IXB A;  3RFR A;  5IY5 C;  3LDD A;  1VF5 B;  2VS0 A;  1NH2 D;  4RUF A;  2X6B A;  1V54 B;  3J80 N;  1ZTE A;  1F4M A;  4LF9 O;  2QM8 A;  3F7Y C;  3EHB B;  1SQG A;  4GT1 A;  4UVB A;  2VQE B;  2EIM B;  2YI8 A;  4B3T B;  1FJG B;  4P30 A;  1DF5 A;  1VEW A;  2Y48 A;  4X1Y A;  3WU2 Z;  1JFF B;  3RBZ A;  4NTY A;  5CBG A;  4I0X A;  1IXM A;  1THZ A;  2QEX V;  1AJP A;  3ZMT A;  1WPB A;  1GM7 A;  1SS3 A;  3IGA C;  1XEQ A;  3RYH B;  4JTA B;  4DRX A;  4LF9 B;  4J7K A;  1PNL A;  5H5N A;  2F4V B;  4JV5 B;  3M8A A;  3B40 A;  4UCR A;  4LF8 O;  5LGU A;  1COW G;  1SER A;  2A06 H;  5CB4 A;  4HNA B;  4K0K O;  3ZN1 A;  4GKK B;  4PA4 A;  1VAR A;  4BR6 A;  4AI8 A;  3AG2 C;  2DYR B;  3HKE B;  4C7U A;  3CXC U;  1M57 B;  2L6L A;  3P3P A;  4H0L B;  3NR7 A;  1Y76 B;  4HNA A;  3CCU V;  3SPI A;  2EIL B;  2VQF O;  5EYP A;  4MT8 A;  3UT5 B;  1M9N A;  1FFX B;  4JYC A;  2IU0 A;  5JCO C;  3K5O A;  1PKX A;  1ZL8 A;  2YDE A;  4PJ0 Z;  5LP6 C;  3CCJ V;  1VQ6 V;  4JYB A;  4CH5 A;  4OX9 B;  5LP6 B;  4B3M O;  2AZ0 A;  4DRX B;  4JI0 O;  1Y6X A;  3RN4 A;  5LBQ A;  3E8F A;  4GKJ B;  2OCH A;  5EZY A;  5L3C A;  4TSF G;  5KA6 A;  3PN1 A;  2W6I G;  3D3I A;  3CD6 V;  1HDJ A;  3FAV A;  1JFF A;  3OW2 U;  4MSW C;  4NKG B;  2JVD A;  1IUR A;  1EN4 A;  3CCR V;  4CC5 A;  2X0L A;  3KKY A;  4UCV A;  4O2B B;  2PYJ A;  5J2U A;  3CMA V;  2EIN C;  2QWP B;  3K57 A;  2GTA A;  4DR3 O;  2D3O W;  3ZHT A;  3FAV B;  3CRA A;  2ZM6 B;  1E1R G;  3E86 A;  3B8M A;  3DXR A;  5H9C A;  5KHJ A;  3QG5 A;  5B1A C;  4JAV A;  4IIJ B;  1IBL B;  2V4D A;  1R73 A;  2DYS C;  3QO8 A;  1FXH A;  2K9P A;  2EIJ C;  5A9G A;  4JI1 O;  1GKF A;  1FFT B;  1J5E B;  4JI8 B;  2XUM A;  3QO5 A;  5B66 Z;  2Q69 A;  4YIP A;  3CSX A;  2HFE C;  3GWO A;  4FFB A;  4F6R A;  1H8H G;  5EYP B;  1Q7Y W;  2P6J A;  4X64 O;  2F4V O;  1G1X B;  1QNM A;  4DUZ B;  3ZBH A;  3ASO B;  5LYJ A;  1S77 D;  2PUS A;  1SA0 A;  3OE7 G;  3APO A;  4MVU A;  1Q5O A;  3S3X A;  5LOV A;  1AB3 A;  1RPO A;  3K9A A;  4H37 A;  1H2G A;  3K04 A;  1AI6 A;  4Z1V A;  2CE4 A;  2Q7G A;  1K97 A;  4P9P A;  2PGG A;  4DK0 A;  1OHH G;  3FKS G;  1XMQ B;  2JGU A;  1LR1 A;  2HP8 A;  4CS4 A;  2HLD G;  5JWP A;  2OTJ V;  2A9H A;  1V54 C;  5BXZ A;  3E35 A;  3ZRS A;  1RFY A;  4UB6 Z;  2ZIO A;  3RVY A;  1BL8 A;  4J10 A;  5EC2 C;  4JTD B;  1L0N H;  1URF A;  4QPK A;  5CBF A;  3CB2 A;  1W2B U;  4LFC O;  4FLT A;  1N34 B;  3L74 H;  4QIW F;  4YIO A;  4FK5 C;  1VMG A;  3FFQ A;  4N23 A;  4XDK A;  5DM6 V;  5KHH A;  2HJD A;  2M7W A;  3ZHQ A;  1BHB A;  3ML0 A;  2JS3 A;  4N21 A;  3RGB A;  5LHG A;  3SJC C;  4D7T A;  1I94 B;  3K08 A;  4I4T A;  3T2M A;  4QE9 A;  1JMK C;  4O2A A;  4IT5 A;  1PM9 A;  1SZX A;  3ETE A;  4DV3 O;  1XOU A;  3QF7 A;  2UXD O;  5JVD B;  4JI7 O;  1K9M W;  2ZE8 A;  4JZG A;  3ABM B;  1N36 O;  3F7V C;  1JOY A;  2WA3 A;  4DUY O;  1QQC A;  4MVO A;  2RDC A;  1GN3 A;  2VRZ A;  2WLL B;  4H33 A;  4DV5 B;  2CTR A;  3JAS B;  2X6C A;  4I9W A;  1WP7 A;  5LP6 A;  3E2E A;  2Q6A A;  1RPR A;  1QHT A;  3LDC A;  3B77 A;  4KL1 A;  5JVD A;  1ENV A;  2OT5 A;  2AXT Z;  4DR2 B;  4DV4 O;  2FYU H;  2UXN A;  4RUE A;  1G4Y B;  2PZS A;  1GTO A;  4O4I B;  2Z0A A;  1QR9 A;  2JEX A;  3MDS A;  1ZWI C;  1NT2 B;  1TGO A;  4BIO A;  3PJS K;  4P9O A;  3E22 B;  3DSQ A;  4X66 B;  3N2K A;  1VQN V;  1NZ6 A;  4CBC A;  4JYA O;  3GB7 C;  5KAI Z;  4DV1 O;  4X1I A;  4MW3 A;  1GM9 A;  4WFH A;  5L3B A;  4YJ3 B;  4JI7 B;  4JAU A;  3JD1 A;  4U7O A;  5CA0 B;  3OUS A;  2GDS A;  3G6E V;  4CH6 A;  4O4I A;  4WFG A;  2QSA A;  4X1I B;  1VQP V;  4YHH O;  5JH7 A;  1HNW B;  3OTO O;  2DMX A;  5KUM A;  3BPZ A; 
#chains in the Genus database with same CATH homology
 3IJ4 A;  2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  3S3W A;  3S3X A;  4NTX A;  4NYK A;  4NTW A;  2QTS A;  1WP7 A;  1WP8 A;  3N27 A;  4FZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...