3S3WA

Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
402
structure length
396
Chain Sequence
b'ALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 101
structure length 396
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3wA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3wA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3wA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3wA02
1WP8A 1WP7A 4NTYA 3IJ4A 2L35A 4FZ1A 4NTWA 2FB5A 4FZ0A 4NYKA 4NTXA 3S3XA 3S3WA 2QTSA 3N27A
chains in the Genus database with same CATH superfamily
3E86A 4X20A 1H38A 4DR4O 4U3JB 4X66O 2VWKA 2BOCC 1T5EA 3U10A 5LOVA 1JJ2U 3OMNB 3FYIB 2FMLA 5DN6G 1EZVH 3X2QC 2JRIA 3LDDA 2EILC 1I94O 2EZPA 1QLEC 2JGUA 4JI8O 2Y69C 3LSUA 1IBKB 4EFBA 3WB1A 4X88A 1XNQO 2UUCB 3H01A 1KC8W 1SQGA 2ZIOA 3K9AA 5IE9A 1BS3A 5IYZB 3IFXA 1AP5A 2ZINA 4MTXA 1VQOV 4GKKO 5EC2C 2OIGA 3B40A 5E79Z 1DGSA 4KP4A 4TUYB 3P30A 1NT2B 2IU3A 5D5PA 1AJQA 3SJAC 3AG1B 3RYFA 1YTFD 5KHHA 1I7FA 4XDJA 4JV5O 4X64B 4YHHO 3E83A 2N74A 5KHGA 3DC6A 5BR8B 4FFKA 5CA1B 4PHZA 3D36C 1H2NA 2P6JA 4H44B 1R3KC 3N2KB 4UVCA 3ZEDA 3IAYA 1NQTA 2QTSA 2PYJA 4OX9O 1VQ5V 2WLKA 1VARA 3KCXA 5JJNB 5H5NA 3AK3A 4DV6B 4DV3B 2PZSA 5IYZA 1AR5A 1NVPD 1TGOA 5KA6A 1WP7A 1I0HA 4WF9V 4UVAA 2Y0PA 1KYOF 2E76B 1GM7A 3E89A 1N4CA 4J7JA 3E8HA 2AHZA 1KB9F 3JAMN 1K73W 3D3QA 1DF4A 1NU1H 4KUMA 4RO2A 4HZ3A 4E2LA 3G71V 1COWG 4GX5A 2ZM6O 4LFAO 2FYUH 5IYDO 1J5EB 1YJNV 2EULA 2ZXWB 3KCYA 3QTCA 5CA1A 2HJFC 4X1IB 1IZ3A 1G8MA 3QVNA 3N2KA 4J42A 4PA3A 3VQXA 3M99B 2RDCA 1Q81W 3FX7A 1RPOA 4I50B 1KP3A 3JAWB 1DK1A 1SC5B 1Q86W 1BGYH 4JI4O 3AK2A 4K0KO 3G67A 5EIBD 1V9PA 3CP1A 4ZHQB 2CK3G 1XOUA 4Q20A 2Q67A 3FYEB 1YJWV 2CDYA 4WCEV 1K33A 2KB1A 4CH4A 4P2ZA 1IBMO 1QHTA 1HNZB 2QA4V 1PV0A 2LGQA 1SQFA 4DW1A 3TGUH 2JEXA 4UVBA 4DR3O 2Q73A 1BQZA 4MVUA 3T1HO 2EIMC 5TISZ 1AP6A 5J2TB 4JASA 2XHBA 3G6EV 1P49A 1K3EA 1OCZB 1Q8IA 3JAWA 4O4IB 1S3JA 3E8GA 2ZR2A 3I55V 3RYHB 5BY1A 2DE0X 1O9HA 1GTOA 2L35A 1GN3A 1LUVA 4PJ0Z 4GKJO 1F51A 2JS3A 1MABG 4ZHQA 3VQYA 1QCEA 2HHHB 2YDEA 3HKDB 4NKGB 4I7ZB 2GTSA 4DR4B 1A32A 1ENVA 1WPXA 2DYRC 3JASB 4RQFA 4CZZA 1BHAA 4B3TO 4NTXA 2EIMB 2BOBC 4I55A 3CRMA 5IYBO 4CH6A 1XNQB 2VQEO 1Y74B 2DQ0A 3K08A 1V54B 2OYQA 1D2DA 2UXBO 1K8AW 3J81N 1FXVA 5J2TA 2ODMA 5CBGA 4QGPA 2ZKOA 2YI9A 3CXCU 2YXHA 3AG7A 4IL6Z 5A2QN 1H2MA 3RYHA 2HP8A 4BIUA 1ZLZA 3OW2U 2ZE6A 2EIKB 2CE4A 2IJHA 3AEIA 3OAAG 3MHSC 3K79A 5LMUB 4TV9B 1VF6A 1SERA 3JASA 3ZRSA 1Z5WA 3SR2C 4BIZA 5CMUA 1J95A 1GN2A 4MW3A 3RWRD 3SJBC 2FTKA 1S0VA 4X62O 1PM9A 4OX9B 1XNRO 2DJVA 4P30A 2Z0AA 1Y74A 1SZXA 1URFA 4ZI7B 4C7UA 1GH6A 3H9VA 4FZ0A 3ZIAG 3OUSA 4HNAB 2PI4A 2IH1C 4PD4F 5KUMA 5B1AC 4IIJB 1TAEA 2Q0OC 1S77D 5C93A 1Q6IA 3OD4A 4DR5B 4HAMA 1NZ6A 3CB2A 4F4LA 2YXLA 2UUCO 3SGIA 3UCSC 2ETNA 5DECA 3RN4A 2L6LA 1G6UA 1HR0B 3JARB 4TV9A 1P7BA 4LFAB 3ZJZA 1EN4A 4FLYA 3ABUA 2B1IA 1AI7A 1TUEB 4TSFG 4JTAB 4IHJB 1XBLA 1U97A 1YDXA 2W6IG 5EC1C 4O4HB 2P22C 5LP6B 1S5HC 2YXYA 2EX3A 2ZD9A 4YJ3B 1YITV 3CE2A 1R73A 2P5OA 1D5AA 4ZI7A 3ZN1A 2QTOA 3QF7A 1M4UA 2DW4A 1OV9A 4JI4B 2RJZA 4K0KB 4HNAA 2GUZB 5BR8O 3HKEB 4PA4A 2KQXA 4TQFA 1AI5A 5GTHZ 2QE7G 2QWOB 1YF2A 3FB8C 4I9QA 1VQ6V 3HKCB 4DV4O 2M6YA 1AR4A 2F93B 1NI8A 1RFYA 3CCLV 4LF6B 4DV6O 2WPDG 4DV3O 4B3RB 3JARA 2DOSA 2LGWA 3N27A 1S72V 3F7YC 1YTFB 4B7KA 3OT7A 5CBHA 5FPOA 2QJ1A 4MTOA 1XMOB 3F7VC 1XUQA 2OIEA 4IHJA 3W7XA 2ZDIC 1ORQC 3T1HB 4O4HA 5LP6A 2Z5UA 4PI2A 4YJ3A 4DK1A 4PDVA 2QWNB 4R6ZA 3OR6C 4JYAB 2WSSG 2DWEC 4PDRA 4DR6B 5ITZB 1IXBA 3ZRWA 2ITDC 2GUZA 1QVFU 1Q43A 1R1BA 3U0ZA 4FVMA 3K0DA 4UCRA 5JH7B 5IY5B 4DR7B 3CEIA 1K5SA 3HKCA 4YIPA 4H0LB 1H8HG 2Q7HA 2RCVA 2HVJC 4G28B 1PNMA 4NVPA 2IH3C 3JALB 2QM8A 3SDLA 3K58A 5JWPA 1U96A 4J9ZB 5EIBC 2BE3A 1ZAUA 4JF3A 2QWQB 3JAKB 1NTMH 1AI4A 1AJNA 3ZHSA 3K5LA 5H6QA 4X20B 2OTJV 3E8BA 4X1YB 2CGOA 4KL1A 4B7EA 4B3SO 4UCSA 5ITZA 1JVMA 5CA0B 4MTGA 2OT5A 3Q4HB 5IWAO 1RP3B 4NTWA 4NYKA 2DWDC 5IT9N 1S5LZ 2D2CB 2Q9LA 5JH7A 1M5IA 3APOA 3TETA 2XT9A 3E22A 3GWKC 1HW7A 3BVOA 1FKAO 1FXKC 3RFRA 3N2GA 3K5MA 1P4RA 5A9GA 3ZHTA 1DTOA 3JALA 2P7TC 4QIWF 3A0BZ 3O65A 5JJEB 2WAMA 3RGBA 1VEWA 2HJDA 4UXNA 1CXZB 1UPGA 5LHGA 2CAZC 3JAKA 4UFZA 1W59A 3OUFA 2LW7A 3S3XA 1UFIA 3AG3B 2HHHO 4LNUB 1Y66A 2QM4A 4RWUA 4LF4B 3AG1C 4X1YA 3ZMZA 1PD3A 4XBFA 4CC5A 3D3IA 3OGIB 4B08A 1M56B 1NS1A 3APQA 1AVMA 5CA0A 5IDJA 4DV2B 3Q4HA 2XASA 1SQQH 1GRJA 4MVMA 3EFFK 1FXKB 2Y4TA 1Y4MA 5KAIZ 4DRXB 1RM1C 1HNWO 4PI0A 4LH7A 3LDEA 4LFCO 4YY3B 2OTLV 4WFBV 4RUFA 4O2AA 2GBOA 3HR0A 2DYSB 4FLXA 1K92A 4UUJC 5B1OA 3H1IH 4DV5O 3FAVB 2IJJA 2PY5A 1AI6A 5KA5A 1JCHA 1L0LH 4EEQA 2WLHA 4PA6A 3CD6V 3HPLC 1IURA 5EBLC 1NTKH 2ZNJA 3AG2C 2JEUA 3A8TA 2M7WA 5C8YB 5LMUO 5IJ9B 1WPBA 1QR9A 2RNBA 1WB7A 2CTWA 4LNUA 2Q4PA 5D5QA 1WN7A 2UXXA 1N34O 2DN9A 1S5JA 2HKOA 4YXWG 4CH5A 1ZX3A 4NXMB 4GLXA 1M9NA 4JPRA 1RM1B 2EJRA 2YC0A 1N33B 2ZXWC 2AW9A 4DV4B 1EN5A 1FXKA 2YIBA 3QO5A 4DRXA 2Q8VA 4RQEA 4LF7B 1NR7A 4DV1B 1WJZA 4KFMA 4F6RB 2F23A 2E74B 3FKSG 4FJCC 3UQ8A 3T4ZA 4MVRA 3RYCB 2Q5ZA 5L3BA 4A5UB 3CCSV 4LH6A 3AG2B 1X59A 2K9PA 3FAVA 3ZMSA 3IC9A 1LUWA 4JAVA 2A9HA 4DR5O 1BQ0A 1WLEA 1RPRA 1MSWD 5LMNO 1JMKC 4UB8Z 3ZRXA 1B6QA 4X89A 5LBQA 4DR1O 4ZKIA 3A0RA 3CS5A 5C8YA 2X6AA 5IJ9A 1HR0O 3WG7C 1ZL8B 1SA0A 5L3EA 1SETA 3C3SA 1N32B 4PA7A 1NR1A 2YEVB 2LW1A 4EFEA 2DMXA 3ZMUA 4JI6B 5KHKA 3JCUZ 1I5XA 2FL4A 4W4KA 3L70H 5K1XA 1E1RG 1K4CC 4X65O 4F6RA 3CCUV 2BCCH 3UO2A 3CCJV 1FD9A 4PELA 3JATB 5CB4A 1OCZC 3ASOB 5B3SB 2ZR3A 2C2AA 3STLC 3RYCA 3DC5A 3ABLC 3KKYA 4OXSA 1M90W 1EM1A 2AZ2A 3WG7B 3GWOA 4DV0O 2PYLA 3RT3C 3CX5F 4B3SB 4LF6O 4MS2A 4D7TA 4B3RO 1VF6C 1ZL8A 3B77A 2CGNA 2Q0AA 4FK5C 1HDJA 5IWAB 2ZNIA 4I55B 2W0XA 1XMOO 5FNVB 3B8MA 1F4NA 2YEVA 4MT8A 1IDSA 4JI3O 1HWYA 4QE7A 2Y0IA 4JI5B 1ZSPA 5E1AC 1YJ9V 1VQNV 2QM7A 3JSNA 2QKAA 3WU2Z 4DUZB 1XILA 2HG5C 4FLUA 1V54C 5K1PA 1QQCA 4JYAO 1L1FA 4LF9B 4DR6O 2R9IA 3WFVA 2UXCB 1OCCB 1Y76A 2YIBD 3ABLB 5AG2A 4J10A 3MAQA 3JATA 4TWKA 4JI7B 1L8DA 2ZIMA 4H37A 2VWJA 2V1DA 4LF8B 3ML0A 4FIPC 3QO7A 4DR7O 3AG4C 2EIKC 4JAUA 5LYJB 2BSKB 2WWWA 2PGGA 1Q82W 4JYCA 5LA6B 1D5NA 2X6BA 1K97A 4G27B 5BZBA 4P9PA 2CTQA 3R66A 2ZE7A 4CH3A 5FNVA 5L3CA 1MG1A 2QKSA 3HB3B 1HNWB 3ZHVA 4LFCB 1OJHA 5BXZA 3CCRV 1SRYA 4CS3A 1B06A 3SYAA 1Y67A 3PN1A 3RYIB 3CMAV 3ZHQA 1GAXA 3I56V 4DV5B 2EBOA 4E4EA 3AG4B 2YSUB 4CS2A 2A79B 4YJ2B 4JZ2A 4HYOA 1JPXA 3BEHA 2IM9A 5B5EZ 2RN9A 1Q7YW 1VQMV 3E35A 1GK9A 5LYJA 2BSKA 3OM3B 3F5WC 1N34B 3B2EE 5LA6A 2IW5A 1NJIW 2Q6AA 4J80A 2AZ0A 2AHYA 4LP8A 5JQGB 4QE9A 4DV7B 1KKCA 3UT5B 3W7SA 2Q7EA 1XEQA 3LSQA 5L3DA 5LP6C 3CYOA 3I5DA 4HBNA 3C90A 4LF4O 1Y6XA 3JD2A 4NB5A 3ZBHA 4D7SA 5JVDB 3RYIA 3ZCCA 2BTQB 1Q90D 2PI5A 3L74H 4DV2O 5KHJA 1H2GA 2XTAA 4YJ2A 5LMNB 4DR1B 3CSXA 1Q5OA 1O9GA 4YY3O 3TK1A 1YIJV 4KHPB 4UCVA 2YI8A 1YEWA 4UB6Z 3ZHUA 1R3IC 2UU9O 3VBBA 4G2KA 1VIBA 2ZT9B 4DR2B 3ASNC 3SPJA 4DUYO 1IXMA 2VS0A 5JQGA 3UT5A 2N04A 3H1LH 3T4DA 2OWOA 2ADPA 3CMEV 4LBEC 2JIZG 2QKCA 2A7WA 5KAFZ 1PPJH 1PKXA 4FPPA 4FM1A 1TVKB 5LL6Y 2LJ2A 1IBLB 4X65B 4JI0O 4WFFA 4I4TB 3SPHA 3STZC 2JGDB 4FMTA 3ZRWB 4ZIBA 3GB7C 5L3GA 3DXRB 5JVDA 1XMQO 2BTQA 4NXMO 2FB5A 2XUMA 3BPZA 2HLDG 4J11A 3A2FA 4IT5A 1F23A 2UUAB 1XHZA 1N33O 4DV0B 1YVWA 3G6BA 1MOFA 3SJQC 5IY5C 4J9YB 4DXWA 4LF7O 1JQ0A 4DV1O 3ASNB 4L87A 3EVKA 4JI3B 2QEXV 1VF5B 3OMIB 1BE3H 4Z1VA 3SPIA 2IU0A 5EBMC 2CTPA 3UM7A 2RMKB 3ABMB 1TVKA 1V55C 1K9MW 1QLNA 3K3WA 1M93A 4I5SA 4I4TA 2JGDA 2GDSA 2WLNA 3SYCA 2H8PC 3CRQA 4ZOLB 1N8RW 1KMIZ 2D3OW 3K5NA 4OPHA 1VMGA 3DXRA 1XQ8A 1N32O 5EK0A 4JTCB 1SZTA 3CRRA 2NNUA 4JI6O 3E22B 1K4DC 2ITCC 1OCOB 3N2GB 1FJGB 4U3FH 2HR3A 4XDKA 3ZRVA 1QR8A 3D8CA 1TA8A 3P3PA 3TXQA 3UO3A 2R9RB 4IYHA 2CTRA 4FZ1A 4FLWA 2X0LA 1N0NA 2P4KA 4MTFA 5LHHA 3HKBB 1PL0A 5LXTB 4JI2B 4NXNB 1V55B 2ZQMA 3BFRA 2JVDA 5GTIZ 3BABA 3CCMV 2V7QG 2IJKA 3AG3C 2IBZH 2XAQA 2KSDA 3CRCA 4R50A 2A3QA 1VP7A 4ZOLA 3CC2V 4BIOA 1M56C 3T1YB 2XAFA 1KECA 3CC4V 1XHXA 1SQPH 4JI5O 4Z1MG 4JTDB 4O2AB 5B1BC 4DUZO 1R6KA 1JA8A 1WAZA 1RSOB 3OR7C 2ZCEA 2XAGA 4B3MB 4LF9O 2UXCO 4CS4A 2BTOA 4JI7O 4MSWC 2DYSC 4WFEA 2R9AA 1OHHG 3KZIZ 3HKBA 1WB8A 5LXTA 4LF8O 2W6JG 1R3JC 3OTFA 3ICXA 5BMVB 4BW5A 2PF4E 2LFRA 3OFNG 1R6NA 4ABMA 1MA1A 3SPGA 1HP8A 5HFLA 1PP9H 3ETGA 3EHBB 1LR1A 1AR1B 4UCUA 3WB2A 5KHIA 1M57C 3B09A 1PNLA 3L71H 2N05A 1N0JA 3FFQA 4I9WA 4X9QA 1KU9A 1YSCA 2EZOA 5B1BB 3JD1A 2XOKG 3RVZA 2E5LO 5FLXN 1P84F 4O4LB 4WFAV 1UJWB 3ABKC 3LUTB 3O9OA 4O4JB 1W2BU 1RSOA 2UU9B 1G4YB 2ARHA 4R7CA 2XNDG 4DUYB 2JDIG 4AI8A 3OE7G 1SF9A 3OTOO 2O57A 5CA3A 1VQ9V 4K8XA 2B9ZA 4FM2A 2XAHA 4CC6A 5BMVA 3ZN0A 2HVKC 4QNHB 4JI0B 5J9PC 1SA0B 1M57B 3FB5C 4LF5B 3CHXA 4RAIA 1VQLV 3TJTA 1XMQB 4KXRA 5JCOA 5KUKA 2HFEC 3CCVV 4DV7O 4MW8A 1VQPV 1IVSA 2QGNA 3JCZA 1GMGA 3ABKB 1AROP 3LDCA 5FPRA 3X2QB 1DLBA 2KKWA 2EILB 1QLEB 2EIJC 4U3JA 2Y69B 1L0NH 2X7RB 5FL7G 2EINC 1B04A 4O4LA 4CBCA 1SESA 4O4JA 5CB4B 1JFFB 3MHHC 2JK5C 3K59A 4BWAA 2UUBO 2LP7A 1MZFA 3JD0A 3QNEA 1ROPA 1WA8B 3IGAC 3CCEV 3DGEA 1BL8A 2H3OA 2NN4A 4QPKA 3FB6C 4XDLA 3ASOC 5HFMA 3JD4A 5B3SC 4JI1B 1VQ4V 3KG2A 4K8ZA 1MNGA 4WBNB 4MVSA 1SKVA 4AILC 4MVQA 2F4VB 4KHPO 3E2EA 4TUYA 2GHYA 4DR2O 4TT3G 3M8AA 2EIJB 2NLJC 5B66Z 5KX5B 1FS0G 2EINB 3LNMB 4TV8B 3BRCA 3B4SA 3TCUA 3VOUA 4GUNA 1M1KW 3OEHG 2E3CA 1IBLO 3G4SV 1R3LC 1FAFA 1Y76B 3DTUB 2WLJA 1JJOA 5LHIA 1JFFA 1S76D 2MW2B 3K57A 5JJJB 1WA8A 1CEZA 1OCCC 3VQVA 4GZRB 4UV8A 2RQ6A 4FLTA 1I08A 1AILA 2UUAO 1CPYA 2UXDO 1MSDA 5EYPB 2CUGA 4FLZA 3ZS8C 4WBNA 4MVZA 1IX9A 5H6RA 3B8NA 4Q6GA 3WB0A 1OCRC 4K35A 4U7NA 4LFBB 1THZA 2ZE5A 1BHBA 1PNKA 1K34A 3RW0A 4J7ZA 1EBOA 4F6EA 1K7DA 1P7GA 1DF5A 5KX5A 4AQYO 4JGSA 1HNXB 1NBMG 2GSMB 4TV8A 3IC7A 4N21A 3D36A 4DO2A 4FFBB 1QBZA 3W7WA 3ETEA 4L8JA 1FPOA 2ZE8A 4UCOA 1XDCA 4U7OA 4RUEA 4AHCA 2P4VA 3UKMA 4BR6A 1BCCH 4X1IA 3BCCH 1YI2V 4PDLA 2KG7B 1YHQV 2IJIA 3U11A 3L72H 3M7MX 1QVGU 4I50A 3F5TA 2R70A 4EB6B 1KUQA 4GX0A 3CXHF 2E75B 1OCRB 1ZWIC 5EYPA 2Q7GA 1FJGO 3BAAA 4GT1A 3ETQA 1MZEA 4R8CA 2VQFO 4IGGA 2A0LA 1JX9A 3QG5A 2VRZA 2YIAA 2QWPB 1Q3EA 4K3AA 3JD3A 1VQ8V 1XL4A 4JI2O 4NXNO 4X66B 4LC1A 2E5LB 1BSMA 3CCQV 2YUAA 4FFBA 3C3TA 3ETDA 3CC7V 2F1MA 1I94B 4JI8B 2WA4A 3L75H 4ASUG 5EZYB 2JJ1G 1SQVH 1YCIA 3H1HH 3R65A 1SS3A 3OTOB 2X6CA 2KG7A 4LR3A 5H2FZ 1FFTB 2QR4A 1KP2A 3T1YO 1W0JG 1LNQA 1AJPA 2ADQB 4GKKB 2ILMA 2QDOA 4EB6A 3OMAB 4OGQB 1GO3F 4O4IA 1R6TA 3RVYA 1I5YA 3FD9A 3OGCC 5LGNA 4H33A 4B3MO 2F43G 2OCCC 2AXTZ 1N36O 4JV5B 2DYRB 3BA8A 4I0XB 3HKDA 4YHHB 1QU7A 1MMMA 2LQTA 3VQWA 1FYJA 4MVOA 2G38A 1KQSU 3SYPA 4IYIA 2R72A 4JZGA 5IJ0B 3GVMA 3LSSA 1GM8A 3ZMTA 4D6TH 2GV9A 1JR9A 2UUBB 5EZYA 2WA3A 4JYBA 1H2SB 2QWRB 3H1KH 2P06A 3ZHRA 2B5UA 2EJ7A 2LFSA 1YZBA 3AK1A 4DW0A 3TXSA 2WLIB 3JYCA 2K1EA 1NH2B 4YIOA 1KKDA 4GCZA 1XL6A 3CJHB 2OCCB 1QNMA 3K06A 2H94A 1JOYA 3QO8A 1EZJA 1IBKO 5KLVH 2P90A 3THOA 2AGAA 4I0XA 4OPAA 1X4TA 2CH7B 2ZM6B 1YXBA 1AB3A 1E1QG 4JYYA 2Y48A 1CP9A 4DYLA 5IJ0A 2Q69A 5GONB 2V4DA 3IJ4A 4WFGA 1NKDA 3L9DA 4PDMA 4LF5O 3ABMC 3FB7C 2PTMA 1H2KA 1F7YA 5J2UB 2NR5A 1H2LA 4P9OA 3NR7A 1WNSA 4X64O 2UXDB 5B1AB 2DQ3A 3BHPA 3NXSA 1SQBH 2WLIA 3MDSA 3SPCA 2WLLB 3BY6A 1ZTEA 3OEEG 5EBWC 1OZ0A 1EFRG 3T1CA 3CJHA 1OCOC 1B3QA 4X1KB 4IIJA 3SYOA 5CBFA 3H1JH 4UV9A 3L73H 3BA9A 1KBHA 3A0HZ 1K5QA 2Q68A 2Z3YA 4JAAA 1GKFA 4AQYB 1IBMB 3K5OA 4WFHA 4UCTA 4JI1O 2F95B 3J80N 2CH7A 2XAJA 5DEDA 1XREA 4O2BB 4TQDA 4PV1B 4BAYA 3ABTA 2F4VO 4H13B 5GONA 3SJCC 4DR3B 3LNNA 4GYCB 1Q6UA 4ZBMA 3CWBH 3CPWU 2JJ2G 3CRAA 2W0FC 1PL4A 5GW7A 1Z5VA 3JSLA 5J2UA 3K9SA 3MD0A 4BW9A 4GX1A 2P67A 4LWSB 1BZKA 1H8EG 1GN4A 5KMGB 1KD1W 4EKWA 1GN6A 1Z2GA 2WLMA 5H9CA 4J41A 2VQFB 1J5EO 2WLLA 1GM9A 3HKEA 5F2VO 3P3NA 3SYQA 5LGTA 2GTAA 2QSAA 1NVPB 5L3FA 4GKJB 1WP8A 5IYCO 4X1KA 2LO1A 1VQKV 1W0KG 3DSQA 4ICGA 1Q6HA 1TUBB 2YICA 1VF7A 4B3TB 3K04A 1FFXB 4FLVA 4O2BA 1XI1A 1EN6A 2OCHA 2YS8A 4TOIA 2VQEB 4LFBO 1E79G 3G80A 2UXBB 3ZX6A 5JCOC 4FM0A 5CN0A 3K0GA 4GX2A 3ZMVA 4QPJA 3PJSK 4LWSA 1HNXO 5LOVB 2PUSA 4NTYA 4X8AA 1HNZO 5KMGA 4J7KA 4NR1A 3K03A 2HEPA 4W4LA 2Y4UA 1SQXH 3E8FA 1NTZH 1ZUQA 1N36B 1F4MA 2A06H 2ATKC 3S3WA 5DM6V 2JS5A 5LGUA 1NH2D 3W7TA 4N23A 4QJFB 3RBZA 3T2MA 2YIDA 1BMFG 1US6A 5B1NA 1TUBA 4Z2WA 1FFXA 2ZDIA 2F66C 1BT8A 4LCUC 4X62B 1XNRB 2B1GA 1G1XB 3RYFB 3EXAA 3W7UA 2FKXA 3J7AU 2MK3A 4DK0A 1VQ7V 2UXNA 3P32A 4PA9A 1FXHA
chains in the Genus database with same CATH topology
1WP8A 1WP7A 4NTYA 3IJ4A 2L35A 4FZ1A 4NTWA 2FB5A 4FZ0A 4NYKA 4NTXA 3S3XA 3S3WA 2QTSA 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  1WP7 A;  4NTY A;  3IJ4 A;  2L35 A;  4FZ1 A;  4NTW A;  2FB5 A;  4FZ0 A;  4NYK A;  4NTX A;  3S3X A;  3S3W A;  2QTS A;  3N27 A; 
#chains in the Genus database with same CATH topology
 3E86 A;  4X20 A;  1H38 A;  4DR4 O;  4U3J B;  4X66 O;  2VWK A;  2BOC C;  1T5E A;  3U10 A;  5LOV A;  1JJ2 U;  3OMN B;  3FYI B;  2FML A;  5DN6 G;  1EZV H;  3X2Q C;  2JRI A;  3LDD A;  2EIL C;  1I94 O;  2EZP A;  1QLE C;  2JGU A;  4JI8 O;  2Y69 C;  3LSU A;  1IBK B;  4EFB A;  3WB1 A;  4X88 A;  1XNQ O;  2UUC B;  3H01 A;  1KC8 W;  1SQG A;  2ZIO A;  3K9A A;  5IE9 A;  1BS3 A;  5IYZ B;  3IFX A;  1AP5 A;  2ZIN A;  4MTX A;  1VQO V;  4GKK O;  5EC2 C;  2OIG A;  3B40 A;  5E79 Z;  1DGS A;  4KP4 A;  4TUY B;  3P30 A;  1NT2 B;  2IU3 A;  5D5P A;  1AJQ A;  3SJA C;  3AG1 B;  3RYF A;  1YTF D;  5KHH A;  1I7F A;  4XDJ A;  4JV5 O;  4X64 B;  4YHH O;  3E83 A;  2N74 A;  5KHG A;  3DC6 A;  5BR8 B;  4FFK A;  5CA1 B;  4PHZ A;  3D36 C;  1H2N A;  2P6J A;  4H44 B;  1R3K C;  3N2K B;  4UVC A;  3ZED A;  3IAY A;  1NQT A;  2QTS A;  2PYJ A;  4OX9 O;  1VQ5 V;  2WLK A;  1VAR A;  3KCX A;  5JJN B;  5H5N A;  3AK3 A;  4DV6 B;  4DV3 B;  2PZS A;  5IYZ A;  1AR5 A;  1NVP D;  1TGO A;  5KA6 A;  1WP7 A;  1I0H A;  4WF9 V;  4UVA A;  2Y0P A;  1KYO F;  2E76 B;  1GM7 A;  3E89 A;  1N4C A;  4J7J A;  3E8H A;  2AHZ A;  1KB9 F;  3JAM N;  1K73 W;  3D3Q A;  1DF4 A;  1NU1 H;  4KUM A;  4RO2 A;  4HZ3 A;  4E2L A;  3G71 V;  1COW G;  4GX5 A;  2ZM6 O;  4LFA O;  2FYU H;  5IYD O;  1J5E B;  1YJN V;  2EUL A;  2ZXW B;  3KCY A;  3QTC A;  5CA1 A;  2HJF C;  4X1I B;  1IZ3 A;  1G8M A;  3QVN A;  3N2K A;  4J42 A;  4PA3 A;  3VQX A;  3M99 B;  2RDC A;  1Q81 W;  3FX7 A;  1RPO A;  4I50 B;  1KP3 A;  3JAW B;  1DK1 A;  1SC5 B;  1Q86 W;  1BGY H;  4JI4 O;  3AK2 A;  4K0K O;  3G67 A;  5EIB D;  1V9P A;  3CP1 A;  4ZHQ B;  2CK3 G;  1XOU A;  4Q20 A;  2Q67 A;  3FYE B;  1YJW V;  2CDY A;  4WCE V;  1K33 A;  2KB1 A;  4CH4 A;  4P2Z A;  1IBM O;  1QHT A;  1HNZ B;  2QA4 V;  1PV0 A;  2LGQ A;  1SQF A;  4DW1 A;  3TGU H;  2JEX A;  4UVB A;  4DR3 O;  2Q73 A;  1BQZ A;  4MVU A;  3T1H O;  2EIM C;  5TIS Z;  1AP6 A;  5J2T B;  4JAS A;  2XHB A;  3G6E V;  1P49 A;  1K3E A;  1OCZ B;  1Q8I A;  3JAW A;  4O4I B;  1S3J A;  3E8G A;  2ZR2 A;  3I55 V;  3RYH B;  5BY1 A;  2DE0 X;  1O9H A;  1GTO A;  2L35 A;  1GN3 A;  1LUV A;  4PJ0 Z;  4GKJ O;  1F51 A;  2JS3 A;  1MAB G;  4ZHQ A;  3VQY A;  1QCE A;  2HHH B;  2YDE A;  3HKD B;  4NKG B;  4I7Z B;  2GTS A;  4DR4 B;  1A32 A;  1ENV A;  1WPX A;  2DYR C;  3JAS B;  4RQF A;  4CZZ A;  1BHA A;  4B3T O;  4NTX A;  2EIM B;  2BOB C;  4I55 A;  3CRM A;  5IYB O;  4CH6 A;  1XNQ B;  2VQE O;  1Y74 B;  2DQ0 A;  3K08 A;  1V54 B;  2OYQ A;  1D2D A;  2UXB O;  1K8A W;  3J81 N;  1FXV A;  5J2T A;  2ODM A;  5CBG A;  4QGP A;  2ZKO A;  2YI9 A;  3CXC U;  2YXH A;  3AG7 A;  4IL6 Z;  5A2Q N;  1H2M A;  3RYH A;  2HP8 A;  4BIU A;  1ZLZ A;  3OW2 U;  2ZE6 A;  2EIK B;  2CE4 A;  2IJH A;  3AEI A;  3OAA G;  3MHS C;  3K79 A;  5LMU B;  4TV9 B;  1VF6 A;  1SER A;  3JAS A;  3ZRS A;  1Z5W A;  3SR2 C;  4BIZ A;  5CMU A;  1J95 A;  1GN2 A;  4MW3 A;  3RWR D;  3SJB C;  2FTK A;  1S0V A;  4X62 O;  1PM9 A;  4OX9 B;  1XNR O;  2DJV A;  4P30 A;  2Z0A A;  1Y74 A;  1SZX A;  1URF A;  4ZI7 B;  4C7U A;  1GH6 A;  3H9V A;  4FZ0 A;  3ZIA G;  3OUS A;  4HNA B;  2PI4 A;  2IH1 C;  4PD4 F;  5KUM A;  5B1A C;  4IIJ B;  1TAE A;  2Q0O C;  1S77 D;  5C93 A;  1Q6I A;  3OD4 A;  4DR5 B;  4HAM A;  1NZ6 A;  3CB2 A;  4F4L A;  2YXL A;  2UUC O;  3SGI A;  3UCS C;  2ETN A;  5DEC A;  3RN4 A;  2L6L A;  1G6U A;  1HR0 B;  3JAR B;  4TV9 A;  1P7B A;  4LFA B;  3ZJZ A;  1EN4 A;  4FLY A;  3ABU A;  2B1I A;  1AI7 A;  1TUE B;  4TSF G;  4JTA B;  4IHJ B;  1XBL A;  1U97 A;  1YDX A;  2W6I G;  5EC1 C;  4O4H B;  2P22 C;  5LP6 B;  1S5H C;  2YXY A;  2EX3 A;  2ZD9 A;  4YJ3 B;  1YIT V;  3CE2 A;  1R73 A;  2P5O A;  1D5A A;  4ZI7 A;  3ZN1 A;  2QTO A;  3QF7 A;  1M4U A;  2DW4 A;  1OV9 A;  4JI4 B;  2RJZ A;  4K0K B;  4HNA A;  2GUZ B;  5BR8 O;  3HKE B;  4PA4 A;  2KQX A;  4TQF A;  1AI5 A;  5GTH Z;  2QE7 G;  2QWO B;  1YF2 A;  3FB8 C;  4I9Q A;  1VQ6 V;  3HKC B;  4DV4 O;  2M6Y A;  1AR4 A;  2F93 B;  1NI8 A;  1RFY A;  3CCL V;  4LF6 B;  4DV6 O;  2WPD G;  4DV3 O;  4B3R B;  3JAR A;  2DOS A;  2LGW A;  3N27 A;  1S72 V;  3F7Y C;  1YTF B;  4B7K A;  3OT7 A;  5CBH A;  5FPO A;  2QJ1 A;  4MTO A;  1XMO B;  3F7V C;  1XUQ A;  2OIE A;  4IHJ A;  3W7X A;  2ZDI C;  1ORQ C;  3T1H B;  4O4H A;  5LP6 A;  2Z5U A;  4PI2 A;  4YJ3 A;  4DK1 A;  4PDV A;  2QWN B;  4R6Z A;  3OR6 C;  4JYA B;  2WSS G;  2DWE C;  4PDR A;  4DR6 B;  5ITZ B;  1IXB A;  3ZRW A;  2ITD C;  2GUZ A;  1QVF U;  1Q43 A;  1R1B A;  3U0Z A;  4FVM A;  3K0D A;  4UCR A;  5JH7 B;  5IY5 B;  4DR7 B;  3CEI A;  1K5S A;  3HKC A;  4YIP A;  4H0L B;  1H8H G;  2Q7H A;  2RCV A;  2HVJ C;  4G28 B;  1PNM A;  4NVP A;  2IH3 C;  3JAL B;  2QM8 A;  3SDL A;  3K58 A;  5JWP A;  1U96 A;  4J9Z B;  5EIB C;  2BE3 A;  1ZAU A;  4JF3 A;  2QWQ B;  3JAK B;  1NTM H;  1AI4 A;  1AJN A;  3ZHS A;  3K5L A;  5H6Q A;  4X20 B;  2OTJ V;  3E8B A;  4X1Y B;  2CGO A;  4KL1 A;  4B7E A;  4B3S O;  4UCS A;  5ITZ A;  1JVM A;  5CA0 B;  4MTG A;  2OT5 A;  3Q4H B;  5IWA O;  1RP3 B;  4NTW A;  4NYK A;  2DWD C;  5IT9 N;  1S5L Z;  2D2C B;  2Q9L A;  5JH7 A;  1M5I A;  3APO A;  3TET A;  2XT9 A;  3E22 A;  3GWK C;  1HW7 A;  3BVO A;  1FKA O;  1FXK C;  3RFR A;  3N2G A;  3K5M A;  1P4R A;  5A9G A;  3ZHT A;  1DTO A;  3JAL A;  2P7T C;  4QIW F;  3A0B Z;  3O65 A;  5JJE B;  2WAM A;  3RGB A;  1VEW A;  2HJD A;  4UXN A;  1CXZ B;  1UPG A;  5LHG A;  2CAZ C;  3JAK A;  4UFZ A;  1W59 A;  3OUF A;  2LW7 A;  3S3X A;  1UFI A;  3AG3 B;  2HHH O;  4LNU B;  1Y66 A;  2QM4 A;  4RWU A;  4LF4 B;  3AG1 C;  4X1Y A;  3ZMZ A;  1PD3 A;  4XBF A;  4CC5 A;  3D3I A;  3OGI B;  4B08 A;  1M56 B;  1NS1 A;  3APQ A;  1AVM A;  5CA0 A;  5IDJ A;  4DV2 B;  3Q4H A;  2XAS A;  1SQQ H;  1GRJ A;  4MVM A;  3EFF K;  1FXK B;  2Y4T A;  1Y4M A;  5KAI Z;  4DRX B;  1RM1 C;  1HNW O;  4PI0 A;  4LH7 A;  3LDE A;  4LFC O;  4YY3 B;  2OTL V;  4WFB V;  4RUF A;  4O2A A;  2GBO A;  3HR0 A;  2DYS B;  4FLX A;  1K92 A;  4UUJ C;  5B1O A;  3H1I H;  4DV5 O;  3FAV B;  2IJJ A;  2PY5 A;  1AI6 A;  5KA5 A;  1JCH A;  1L0L H;  4EEQ A;  2WLH A;  4PA6 A;  3CD6 V;  3HPL C;  1IUR A;  5EBL C;  1NTK H;  2ZNJ A;  3AG2 C;  2JEU A;  3A8T A;  2M7W A;  5C8Y B;  5LMU O;  5IJ9 B;  1WPB A;  1QR9 A;  2RNB A;  1WB7 A;  2CTW A;  4LNU A;  2Q4P A;  5D5Q A;  1WN7 A;  2UXX A;  1N34 O;  2DN9 A;  1S5J A;  2HKO A;  4YXW G;  4CH5 A;  1ZX3 A;  4NXM B;  4GLX A;  1M9N A;  4JPR A;  1RM1 B;  2EJR A;  2YC0 A;  1N33 B;  2ZXW C;  2AW9 A;  4DV4 B;  1EN5 A;  1FXK A;  2YIB A;  3QO5 A;  4DRX A;  2Q8V A;  4RQE A;  4LF7 B;  1NR7 A;  4DV1 B;  1WJZ A;  4KFM A;  4F6R B;  2F23 A;  2E74 B;  3FKS G;  4FJC C;  3UQ8 A;  3T4Z A;  4MVR A;  3RYC B;  2Q5Z A;  5L3B A;  4A5U B;  3CCS V;  4LH6 A;  3AG2 B;  1X59 A;  2K9P A;  3FAV A;  3ZMS A;  3IC9 A;  1LUW A;  4JAV A;  2A9H A;  4DR5 O;  1BQ0 A;  1WLE A;  1RPR A;  1MSW D;  5LMN O;  1JMK C;  4UB8 Z;  3ZRX A;  1B6Q A;  4X89 A;  5LBQ A;  4DR1 O;  4ZKI A;  3A0R A;  3CS5 A;  5C8Y A;  2X6A A;  5IJ9 A;  1HR0 O;  3WG7 C;  1ZL8 B;  1SA0 A;  5L3E A;  1SET A;  3C3S A;  1N32 B;  4PA7 A;  1NR1 A;  2YEV B;  2LW1 A;  4EFE A;  2DMX A;  3ZMU A;  4JI6 B;  5KHK A;  3JCU Z;  1I5X A;  2FL4 A;  4W4K A;  3L70 H;  5K1X A;  1E1R G;  1K4C C;  4X65 O;  4F6R A;  3CCU V;  2BCC H;  3UO2 A;  3CCJ V;  1FD9 A;  4PEL A;  3JAT B;  5CB4 A;  1OCZ C;  3ASO B;  5B3S B;  2ZR3 A;  2C2A A;  3STL C;  3RYC A;  3DC5 A;  3ABL C;  3KKY A;  4OXS A;  1M90 W;  1EM1 A;  2AZ2 A;  3WG7 B;  3GWO A;  4DV0 O;  2PYL A;  3RT3 C;  3CX5 F;  4B3S B;  4LF6 O;  4MS2 A;  4D7T A;  4B3R O;  1VF6 C;  1ZL8 A;  3B77 A;  2CGN A;  2Q0A A;  4FK5 C;  1HDJ A;  5IWA B;  2ZNI A;  4I55 B;  2W0X A;  1XMO O;  5FNV B;  3B8M A;  1F4N A;  2YEV A;  4MT8 A;  1IDS A;  4JI3 O;  1HWY A;  4QE7 A;  2Y0I A;  4JI5 B;  1ZSP A;  5E1A C;  1YJ9 V;  1VQN V;  2QM7 A;  3JSN A;  2QKA A;  3WU2 Z;  4DUZ B;  1XIL A;  2HG5 C;  4FLU A;  1V54 C;  5K1P A;  1QQC A;  4JYA O;  1L1F A;  4LF9 B;  4DR6 O;  2R9I A;  3WFV A;  2UXC B;  1OCC B;  1Y76 A;  2YIB D;  3ABL B;  5AG2 A;  4J10 A;  3MAQ A;  3JAT A;  4TWK A;  4JI7 B;  1L8D A;  2ZIM A;  4H37 A;  2VWJ A;  2V1D A;  4LF8 B;  3ML0 A;  4FIP C;  3QO7 A;  4DR7 O;  3AG4 C;  2EIK C;  4JAU A;  5LYJ B;  2BSK B;  2WWW A;  2PGG A;  1Q82 W;  4JYC A;  5LA6 B;  1D5N A;  2X6B A;  1K97 A;  4G27 B;  5BZB A;  4P9P A;  2CTQ A;  3R66 A;  2ZE7 A;  4CH3 A;  5FNV A;  5L3C A;  1MG1 A;  2QKS A;  3HB3 B;  1HNW B;  3ZHV A;  4LFC B;  1OJH A;  5BXZ A;  3CCR V;  1SRY A;  4CS3 A;  1B06 A;  3SYA A;  1Y67 A;  3PN1 A;  3RYI B;  3CMA V;  3ZHQ A;  1GAX A;  3I56 V;  4DV5 B;  2EBO A;  4E4E A;  3AG4 B;  2YSU B;  4CS2 A;  2A79 B;  4YJ2 B;  4JZ2 A;  4HYO A;  1JPX A;  3BEH A;  2IM9 A;  5B5E Z;  2RN9 A;  1Q7Y W;  1VQM V;  3E35 A;  1GK9 A;  5LYJ A;  2BSK A;  3OM3 B;  3F5W C;  1N34 B;  3B2E E;  5LA6 A;  2IW5 A;  1NJI W;  2Q6A A;  4J80 A;  2AZ0 A;  2AHY A;  4LP8 A;  5JQG B;  4QE9 A;  4DV7 B;  1KKC A;  3UT5 B;  3W7S A;  2Q7E A;  1XEQ A;  3LSQ A;  5L3D A;  5LP6 C;  3CYO A;  3I5D A;  4HBN A;  3C90 A;  4LF4 O;  1Y6X A;  3JD2 A;  4NB5 A;  3ZBH A;  4D7S A;  5JVD B;  3RYI A;  3ZCC A;  2BTQ B;  1Q90 D;  2PI5 A;  3L74 H;  4DV2 O;  5KHJ A;  1H2G A;  2XTA A;  4YJ2 A;  5LMN B;  4DR1 B;  3CSX A;  1Q5O A;  1O9G A;  4YY3 O;  3TK1 A;  1YIJ V;  4KHP B;  4UCV A;  2YI8 A;  1YEW A;  4UB6 Z;  3ZHU A;  1R3I C;  2UU9 O;  3VBB A;  4G2K A;  1VIB A;  2ZT9 B;  4DR2 B;  3ASN C;  3SPJ A;  4DUY O;  1IXM A;  2VS0 A;  5JQG A;  3UT5 A;  2N04 A;  3H1L H;  3T4D A;  2OWO A;  2ADP A;  3CME V;  4LBE C;  2JIZ G;  2QKC A;  2A7W A;  5KAF Z;  1PPJ H;  1PKX A;  4FPP A;  4FM1 A;  1TVK B;  5LL6 Y;  2LJ2 A;  1IBL B;  4X65 B;  4JI0 O;  4WFF A;  4I4T B;  3SPH A;  3STZ C;  2JGD B;  4FMT A;  3ZRW B;  4ZIB A;  3GB7 C;  5L3G A;  3DXR B;  5JVD A;  1XMQ O;  2BTQ A;  4NXM O;  2FB5 A;  2XUM A;  3BPZ A;  2HLD G;  4J11 A;  3A2F A;  4IT5 A;  1F23 A;  2UUA B;  1XHZ A;  1N33 O;  4DV0 B;  1YVW A;  3G6B A;  1MOF A;  3SJQ C;  5IY5 C;  4J9Y B;  4DXW A;  4LF7 O;  1JQ0 A;  4DV1 O;  3ASN B;  4L87 A;  3EVK A;  4JI3 B;  2QEX V;  1VF5 B;  3OMI B;  1BE3 H;  4Z1V A;  3SPI A;  2IU0 A;  5EBM C;  2CTP A;  3UM7 A;  2RMK B;  3ABM B;  1TVK A;  1V55 C;  1K9M W;  1QLN A;  3K3W A;  1M93 A;  4I5S A;  4I4T A;  2JGD A;  2GDS A;  2WLN A;  3SYC A;  2H8P C;  3CRQ A;  4ZOL B;  1N8R W;  1KMI Z;  2D3O W;  3K5N A;  4OPH A;  1VMG A;  3DXR A;  1XQ8 A;  1N32 O;  5EK0 A;  4JTC B;  1SZT A;  3CRR A;  2NNU A;  4JI6 O;  3E22 B;  1K4D C;  2ITC C;  1OCO B;  3N2G B;  1FJG B;  4U3F H;  2HR3 A;  4XDK A;  3ZRV A;  1QR8 A;  3D8C A;  1TA8 A;  3P3P A;  3TXQ A;  3UO3 A;  2R9R B;  4IYH A;  2CTR A;  4FZ1 A;  4FLW A;  2X0L A;  1N0N A;  2P4K A;  4MTF A;  5LHH A;  3HKB B;  1PL0 A;  5LXT B;  4JI2 B;  4NXN B;  1V55 B;  2ZQM A;  3BFR A;  2JVD A;  5GTI Z;  3BAB A;  3CCM V;  2V7Q G;  2IJK A;  3AG3 C;  2IBZ H;  2XAQ A;  2KSD A;  3CRC A;  4R50 A;  2A3Q A;  1VP7 A;  4ZOL A;  3CC2 V;  4BIO A;  1M56 C;  3T1Y B;  2XAF A;  1KEC A;  3CC4 V;  1XHX A;  1SQP H;  4JI5 O;  4Z1M G;  4JTD B;  4O2A B;  5B1B C;  4DUZ O;  1R6K A;  1JA8 A;  1WAZ A;  1RSO B;  3OR7 C;  2ZCE A;  2XAG A;  4B3M B;  4LF9 O;  2UXC O;  4CS4 A;  2BTO A;  4JI7 O;  4MSW C;  2DYS C;  4WFE A;  2R9A A;  1OHH G;  3KZI Z;  3HKB A;  1WB8 A;  5LXT A;  4LF8 O;  2W6J G;  1R3J C;  3OTF A;  3ICX A;  5BMV B;  4BW5 A;  2PF4 E;  2LFR A;  3OFN G;  1R6N A;  4ABM A;  1MA1 A;  3SPG A;  1HP8 A;  5HFL A;  1PP9 H;  3ETG A;  3EHB B;  1LR1 A;  1AR1 B;  4UCU A;  3WB2 A;  5KHI A;  1M57 C;  3B09 A;  1PNL A;  3L71 H;  2N05 A;  1N0J A;  3FFQ A;  4I9W A;  4X9Q A;  1KU9 A;  1YSC A;  2EZO A;  5B1B B;  3JD1 A;  2XOK G;  3RVZ A;  2E5L O;  5FLX N;  1P84 F;  4O4L B;  4WFA V;  1UJW B;  3ABK C;  3LUT B;  3O9O A;  4O4J B;  1W2B U;  1RSO A;  2UU9 B;  1G4Y B;  2ARH A;  4R7C A;  2XND G;  4DUY B;  2JDI G;  4AI8 A;  3OE7 G;  1SF9 A;  3OTO O;  2O57 A;  5CA3 A;  1VQ9 V;  4K8X A;  2B9Z A;  4FM2 A;  2XAH A;  4CC6 A;  5BMV A;  3ZN0 A;  2HVK C;  4QNH B;  4JI0 B;  5J9P C;  1SA0 B;  1M57 B;  3FB5 C;  4LF5 B;  3CHX A;  4RAI A;  1VQL V;  3TJT A;  1XMQ B;  4KXR A;  5JCO A;  5KUK A;  2HFE C;  3CCV V;  4DV7 O;  4MW8 A;  1VQP V;  1IVS A;  2QGN A;  3JCZ A;  1GMG A;  3ABK B;  1ARO P;  3LDC A;  5FPR A;  3X2Q B;  1DLB A;  2KKW A;  2EIL B;  1QLE B;  2EIJ C;  4U3J A;  2Y69 B;  1L0N H;  2X7R B;  5FL7 G;  2EIN C;  1B04 A;  4O4L A;  4CBC A;  1SES A;  4O4J A;  5CB4 B;  1JFF B;  3MHH C;  2JK5 C;  3K59 A;  4BWA A;  2UUB O;  2LP7 A;  1MZF A;  3JD0 A;  3QNE A;  1ROP A;  1WA8 B;  3IGA C;  3CCE V;  3DGE A;  1BL8 A;  2H3O A;  2NN4 A;  4QPK A;  3FB6 C;  4XDL A;  3ASO C;  5HFM A;  3JD4 A;  5B3S C;  4JI1 B;  1VQ4 V;  3KG2 A;  4K8Z A;  1MNG A;  4WBN B;  4MVS A;  1SKV A;  4AIL C;  4MVQ A;  2F4V B;  4KHP O;  3E2E A;  4TUY A;  2GHY A;  4DR2 O;  4TT3 G;  3M8A A;  2EIJ B;  2NLJ C;  5B66 Z;  5KX5 B;  1FS0 G;  2EIN B;  3LNM B;  4TV8 B;  3BRC A;  3B4S A;  3TCU A;  3VOU A;  4GUN A;  1M1K W;  3OEH G;  2E3C A;  1IBL O;  3G4S V;  1R3L C;  1FAF A;  1Y76 B;  3DTU B;  2WLJ A;  1JJO A;  5LHI A;  1JFF A;  1S76 D;  2MW2 B;  3K57 A;  5JJJ B;  1WA8 A;  1CEZ A;  1OCC C;  3VQV A;  4GZR B;  4UV8 A;  2RQ6 A;  4FLT A;  1I08 A;  1AIL A;  2UUA O;  1CPY A;  2UXD O;  1MSD A;  5EYP B;  2CUG A;  4FLZ A;  3ZS8 C;  4WBN A;  4MVZ A;  1IX9 A;  5H6R A;  3B8N A;  4Q6G A;  3WB0 A;  1OCR C;  4K35 A;  4U7N A;  4LFB B;  1THZ A;  2ZE5 A;  1BHB A;  1PNK A;  1K34 A;  3RW0 A;  4J7Z A;  1EBO A;  4F6E A;  1K7D A;  1P7G A;  1DF5 A;  5KX5 A;  4AQY O;  4JGS A;  1HNX B;  1NBM G;  2GSM B;  4TV8 A;  3IC7 A;  4N21 A;  3D36 A;  4DO2 A;  4FFB B;  1QBZ A;  3W7W A;  3ETE A;  4L8J A;  1FPO A;  2ZE8 A;  4UCO A;  1XDC A;  4U7O A;  4RUE A;  4AHC A;  2P4V A;  3UKM A;  4BR6 A;  1BCC H;  4X1I A;  3BCC H;  1YI2 V;  4PDL A;  2KG7 B;  1YHQ V;  2IJI A;  3U11 A;  3L72 H;  3M7M X;  1QVG U;  4I50 A;  3F5T A;  2R70 A;  4EB6 B;  1KUQ A;  4GX0 A;  3CXH F;  2E75 B;  1OCR B;  1ZWI C;  5EYP A;  2Q7G A;  1FJG O;  3BAA A;  4GT1 A;  3ETQ A;  1MZE A;  4R8C A;  2VQF O;  4IGG A;  2A0L A;  1JX9 A;  3QG5 A;  2VRZ A;  2YIA A;  2QWP B;  1Q3E A;  4K3A A;  3JD3 A;  1VQ8 V;  1XL4 A;  4JI2 O;  4NXN O;  4X66 B;  4LC1 A;  2E5L B;  1BSM A;  3CCQ V;  2YUA A;  4FFB A;  3C3T A;  3ETD A;  3CC7 V;  2F1M A;  1I94 B;  4JI8 B;  2WA4 A;  3L75 H;  4ASU G;  5EZY B;  2JJ1 G;  1SQV H;  1YCI A;  3H1H H;  3R65 A;  1SS3 A;  3OTO B;  2X6C A;  2KG7 A;  4LR3 A;  5H2F Z;  1FFT B;  2QR4 A;  1KP2 A;  3T1Y O;  1W0J G;  1LNQ A;  1AJP A;  2ADQ B;  4GKK B;  2ILM A;  2QDO A;  4EB6 A;  3OMA B;  4OGQ B;  1GO3 F;  4O4I A;  1R6T A;  3RVY A;  1I5Y A;  3FD9 A;  3OGC C;  5LGN A;  4H33 A;  4B3M O;  2F43 G;  2OCC C;  2AXT Z;  1N36 O;  4JV5 B;  2DYR B;  3BA8 A;  4I0X B;  3HKD A;  4YHH B;  1QU7 A;  1MMM A;  2LQT A;  3VQW A;  1FYJ A;  4MVO A;  2G38 A;  1KQS U;  3SYP A;  4IYI A;  2R72 A;  4JZG A;  5IJ0 B;  3GVM A;  3LSS A;  1GM8 A;  3ZMT A;  4D6T H;  2GV9 A;  1JR9 A;  2UUB B;  5EZY A;  2WA3 A;  4JYB A;  1H2S B;  2QWR B;  3H1K H;  2P06 A;  3ZHR A;  2B5U A;  2EJ7 A;  2LFS A;  1YZB A;  3AK1 A;  4DW0 A;  3TXS A;  2WLI B;  3JYC A;  2K1E A;  1NH2 B;  4YIO A;  1KKD A;  4GCZ A;  1XL6 A;  3CJH B;  2OCC B;  1QNM A;  3K06 A;  2H94 A;  1JOY A;  3QO8 A;  1EZJ A;  1IBK O;  5KLV H;  2P90 A;  3THO A;  2AGA A;  4I0X A;  4OPA A;  1X4T A;  2CH7 B;  2ZM6 B;  1YXB A;  1AB3 A;  1E1Q G;  4JYY A;  2Y48 A;  1CP9 A;  4DYL A;  5IJ0 A;  2Q69 A;  5GON B;  2V4D A;  3IJ4 A;  4WFG A;  1NKD A;  3L9D A;  4PDM A;  4LF5 O;  3ABM C;  3FB7 C;  2PTM A;  1H2K A;  1F7Y A;  5J2U B;  2NR5 A;  1H2L A;  4P9O A;  3NR7 A;  1WNS A;  4X64 O;  2UXD B;  5B1A B;  2DQ3 A;  3BHP A;  3NXS A;  1SQB H;  2WLI A;  3MDS A;  3SPC A;  2WLL B;  3BY6 A;  1ZTE A;  3OEE G;  5EBW C;  1OZ0 A;  1EFR G;  3T1C A;  3CJH A;  1OCO C;  1B3Q A;  4X1K B;  4IIJ A;  3SYO A;  5CBF A;  3H1J H;  4UV9 A;  3L73 H;  3BA9 A;  1KBH A;  3A0H Z;  1K5Q A;  2Q68 A;  2Z3Y A;  4JAA A;  1GKF A;  4AQY B;  1IBM B;  3K5O A;  4WFH A;  4UCT A;  4JI1 O;  2F95 B;  3J80 N;  2CH7 A;  2XAJ A;  5DED A;  1XRE A;  4O2B B;  4TQD A;  4PV1 B;  4BAY A;  3ABT A;  2F4V O;  4H13 B;  5GON A;  3SJC C;  4DR3 B;  3LNN A;  4GYC B;  1Q6U A;  4ZBM A;  3CWB H;  3CPW U;  2JJ2 G;  3CRA A;  2W0F C;  1PL4 A;  5GW7 A;  1Z5V A;  3JSL A;  5J2U A;  3K9S A;  3MD0 A;  4BW9 A;  4GX1 A;  2P67 A;  4LWS B;  1BZK A;  1H8E G;  1GN4 A;  5KMG B;  1KD1 W;  4EKW A;  1GN6 A;  1Z2G A;  2WLM A;  5H9C A;  4J41 A;  2VQF B;  1J5E O;  2WLL A;  1GM9 A;  3HKE A;  5F2V O;  3P3N A;  3SYQ A;  5LGT A;  2GTA A;  2QSA A;  1NVP B;  5L3F A;  4GKJ B;  1WP8 A;  5IYC O;  4X1K A;  2LO1 A;  1VQK V;  1W0K G;  3DSQ A;  4ICG A;  1Q6H A;  1TUB B;  2YIC A;  1VF7 A;  4B3T B;  3K04 A;  1FFX B;  4FLV A;  4O2B A;  1XI1 A;  1EN6 A;  2OCH A;  2YS8 A;  4TOI A;  2VQE B;  4LFB O;  1E79 G;  3G80 A;  2UXB B;  3ZX6 A;  5JCO C;  4FM0 A;  5CN0 A;  3K0G A;  4GX2 A;  3ZMV A;  4QPJ A;  3PJS K;  4LWS A;  1HNX O;  5LOV B;  2PUS A;  4NTY A;  4X8A A;  1HNZ O;  5KMG A;  4J7K A;  4NR1 A;  3K03 A;  2HEP A;  4W4L A;  2Y4U A;  1SQX H;  3E8F A;  1NTZ H;  1ZUQ A;  1N36 B;  1F4M A;  2A06 H;  2ATK C;  3S3W A;  5DM6 V;  2JS5 A;  5LGU A;  1NH2 D;  3W7T A;  4N23 A;  4QJF B;  3RBZ A;  3T2M A;  2YID A;  1BMF G;  1US6 A;  5B1N A;  1TUB A;  4Z2W A;  1FFX A;  2ZDI A;  2F66 C;  1BT8 A;  4LCU C;  4X62 B;  1XNR B;  2B1G A;  1G1X B;  3RYF B;  3EXA A;  3W7U A;  2FKX A;  3J7A U;  2MK3 A;  4DK0 A;  1VQ7 V;  2UXN A;  3P32 A;  4PA9 A;  1FXH A; 
#chains in the Genus database with same CATH homology
 1WP8 A;  1WP7 A;  4NTY A;  3IJ4 A;  2L35 A;  4FZ1 A;  4NTW A;  2FB5 A;  4FZ0 A;  4NYK A;  4NTX A;  3S3X A;  3S3W A;  2QTS A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...