4LFAO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfaO00
1J5EO 1DK1A 1I94O 4LFCO 4AQYO 4NXNO 5FLXN 4DV2O 4DR5O 1IBLO 3R66A 4LF6O 2UXBO 3M8AA 1IBMO 1XMQO 3J7AU 1R6TA 2DOSA 1N33O 2UU9O 1IBKO 4DR2O 1HNZO 4K0KO 4DR4O 2VQFO 1YZBA 2JRIA 4DV7O 2ZKOA 4KHPO 1D2DA 1NS1A 4LF8O 4LFAO 4A5UB 1N36O 2Z0AA 3OTOO 4X65O 4YY3O 4DUYO 2UUCO 4JI8O 4JI3O 5IT9N 4JV5O 1HNWO 5A2QN 4B3SO 4DV4O 2LW7A 4JI1O 4LF7O 2HHHO 1FJGO 4LF9O 3F5TA 1KUQA 2F4VO 4JI2O 4LFBO 4DR7O 4X64O 4B3TO 4GKJO 1F7YA 4JI6O 4X66O 5H5NA 3RT3C 4B3MO 3J80N 4GKKO 1A32A 4LF4O 4JI5O 5IWAO 1HNXO 1XEQA 2UUAO 1XNQO 2N74A 4X62O 4DV1O 1G1XB 1N34O 2UXCO 1X59A 4DR6O 3JAMN 4DV6O 4OPHA 1N32O 4DV3O 2VQEO 4DV0O 1XMOO 4OPAA 4DR3O 4OX9O 4YHHO 3T1YO 4JI7O 2DJVA 3O65A 2UUBO 5BR8O 4LF5O 1FYJA 1XNRO 4B3RO 2AGAA 4NXMO 4DR1O 1AILA 4DV5O 5LL6Y 3J81N 5BXZA 1R1BA 1FKAO 5LMNO 2E5LO 4JI0O 5LMUO 4JYAO 2ZM6O 3SDLA 5BY1A 4JI4O 4DUZO 1HR0O 2FKXA 3T1HO 1AB3A 2UXDO
chains in the Genus database with same CATH superfamily
2K9PA 1BQZA 4LFCB 5KHIA 4RWUA 3JALB 2BTQB 2JGDB 2ZE6A 2IJHA 2PZSA 2HHHB 3K5OA 3AG7A 4Q20A 1R6TA 4DR7B 2UU9O 4K8ZA 1XILA 4FK5C 5B1AB 2EILB 1VARA 2E74B 4TV9B 4BIOA 1VQNV 3ZMSA 4PHZA 1R3LC 4X65B 5KHKA 3K57A 1N36O 1Q43A 5ITZB 5IYZB 4JZ2A 5LP6B 2JS3A 5IYZA 2HP8A 5LP6A 4PI2A 4F6RB 1S3JA 4CBCA 4MVZA 4I9WA 3N2GB 4UB8Z 1GKFA 4MVRA 4XBFA 4GX0A 3K79A 1NR1A 3RYIA 3OMNB 4X64B 1QLNA 4LFBO 1BCCH 3ZRXA 4MVUA 3L74H 3RYHA 1OCRB 2L6LA 3H01A 4QE7A 1CXZB 5BMVB 5BMVA 1AI4A 3LSSA 2ATKC 1G8MA 5H6RA 1XMOO 2A06H 5GONA 2RNBA 2HLDG 3CWBH 3E83A 4RQFA 1M9NA 1BHAA 2QTSA 2DWDC 4RUFA 3K59A 1AR5A 1IBLB 2WLKA 3IAYA 4UCRA 2QEXV 2QA4V 4MW8A 4IL6Z 3JATB 1H2KA 4KL1A 2GTAA 4HAMA 5KAIZ 5LMUO 1QVGU 4MW3A 1SQBH 1XHXA 4O4IB 3B09A 5JJEB 1JOYA 1YI2V 3ASNB 3FX7A 4JI8B 3BAAA 3EFFK 4LWSA 3ETEA 4ICGA 1I94O 4O4JA 4DR5O 3RW0A 3GVMA 4EFBA 3EXAA 1Q7YW 2ITDC 4UCUA 3B40A 1N33B 1CP9A 1XMQO 2FYUH 1JJOA 5E1AC 1L0LH 4DV7O 1J95A 3FFQA 2UXNA 3SJQC 2YSUB 2YS8A 3IFXA 2DW4A 4JI5B 5IWAB 2UUCB 3APOA 4K8XA 1T5EA 4CH5A 2UXCB 3OM3B 4DR6B 4B3SO 3SR2C 3SJAC 1GMGA 2YDEA 4PELA 4DO2A 3LUTB 2P90A 2YI8A 5JVDB 2GHYA 3QO5A 4HNAB 3WG7B 4HNAA 5B3SB 2UUAB 1ZX3A 4GX2A 1M1KW 3HKEB 1P84F 1OCZB 1XHZA 2Q7EA 1SQFA 3K9SA 2QGNA 3DXRA 1G1XB 4UVAA 4K3AA 4DRXA 3JASB 2VRZA 1IXBA 2Y4UA 2UXDB 3QNEA 3TJTA 1GM9A 1UFIA 1FYJA 4IT5A 4FLWA 1AR4A 4LBEC 3K9AA 1Q90D 3O9OA 2QWNB 3L73H 4PA6A 2F23A 4R7CA 4I55A 5IYCO 4TT3G 1G4YB 1HP8A 1NH2D 3CPWU 5LGTA 1S5JA 4IYHA 2FL4A 5GW7A 2GBOA 3G67A 3M99B 3KCYA 1DK1A 1GM7A 3BA8A 5EYPB 1Q3EA 2NNUA 2OTLV 1WA8A 2B1IA 1U96A 2FB5A 1BSMA 2AZ2A 2VWJA 2UXBO 4DR2B 2XTAA 3SYPA 2XNDG 4K0KO 4NYKA 2QJ1A 1K4CC 1KKCA 2Z0AA 2OYQA 3HKCA 4YJ2B 1GTOA 1HNWB 4FIPC 3A8TA 1Y66A 4LF9B 1H2LA 4IHJB 1JCHA 4WFHA 2P6JA 4IHJA 1QNMA 4G28B 1AR1B 3RYCB 2E3CA 1PM9A 3RYCA 1F7YA 1L0NH 4MSWC 3ZHVA 5DN6G 2VS0A 1VQMV 1VP7A 3A2FA 4WFFA 3QG5A 3CRAA 4Q6GA 1M5IA 4DV1O 1XUQA 3A0BZ 5KUMA 4UFZA 4DV6O 1N32O 3G6BA 3SYOA 5EK0A 1M90W 2RJZA 1TUEB 4OX9O 1NBMG 4YHHO 4GYCB 2X0LA 3ABMC 1OCCC 4J11A 3OT7A 4DR1O 1PL4A 4CH4A 1TGOA 2QE7G 2YEVB 2ZCEA 4I5SA 2YEVA 5KLVH 2Y48A 3CRRA 2BSKB 3G4SV 2UU9B 1FFXB 3SPJA 2RN9A 2DQ0A 4WF9V 3UO3A 3CXCU 2FKXA 4I7ZB 3T1HO 4XDKA 1SQXH 2ZR2A 3JAKB 3OMIB 4G2KA 2DWEC 1J5EB 1Y74B 3H1IH 1Y74A 1YXBA 3ZRWB 4DYLA 4W4KA 3C90A 2C2AA 3BCCH 3JCUZ 1AI6A 1IBMO 4LFBB 4B08A 3CHXA 4I0XB 2QSAA 3K5LA 2VQFO 4TQFA 1YZBA 1DTOA 5LGUA 2OCHA 4LNUA 3ZJZA 5J2TA 4DXWA 1DF5A 1NS1A 4ZI7B 1PPJH 1QR8A 4WBNA 3HR0A 3B4SA 4YY3B 3T2MA 2AW9A 5J2UB 1K8AW 3OEHG 4FFBB 2XAJA 4BW5A 4FFBA 1YJWV 2O57A 2JEUA 4JYBA 1YJNV 4P30A 1XMOB 4H33A 4IGGA 4B3TB 3AK3A 5K1XA 4D6TH 2YI9A 1KC8W 5LHHA 4LF4B 5B1OA 1A32A 5KMGB 3OMAB 2IW5A 5KMGA 3DSQA 4I9QA 1OJHA 4D7TA 1K3EA 4UCOA 4DR3O 2DN9A 3ZMZA 3O65A 3MDSA 1I94B 3AG1C 3FB8C 4DR5B 1SS3A 4DV5O 4YIPA 2Q5ZA 3RFRA 2LJ2A 3E35A 4X1IA 4MVMA 4KXRA 2E5LO 2GDSA 2KKWA 3CC7V 3JARA 1OCOC 1JQ0A 4DV7B 1KECA 3HKDA 1IXMA 2ADQB 5L3GA 4JI4O 4Z1MG 1AI7A 4BIUA 4GX5A 3R65A 1AB3A 1LUVA 2F93B 2WLIB 1VEWA 1THZA 4N21A 3RYFA 3ZMTA 4DK0A 3K0DA 2EIKC 3RN4A 2P67A 4JASA 1K97A 5EIBD 1FXKC 2PYJA 2ZD9A 5CBHA 5CA0A 3HB3B 1QVFU 5E79Z 1Q6HA 2N04A 3Q4HB 3JD4A 2ZQMA 3K5MA 1PNMA 3OTOB 4OGQB 2QWQB 2ZE5A 1AJQA 3JSLA 4U7NA 2L35A 1AVMA 4UXNA 5C8YB 1Z5WA 1JX9A 3L75H 1HW7A 1K92A 3ABMB 1OCCB 4ASUG 4JI6B 2KB1A 4L8JA 5H5NA 2WA3A 5DM6V 3VOUA 5KHJA 2IJKA 1NJIW 1XEQA 2CGOA 5LXTB 3AG2C 4U3JB 5LXTA 3KG2A 3L72H 1KMIZ 1I5XA 4IIJA 3BY6A 1TUBA 1Q6IA 4U7OA 4EEQA 2UUBO 3LDCA 3SPCA 3LDDA 2JJ1G 5CB4B 1WB7A 1ZSPA 3TK1A 4NVPA 5AG2A 2UXBB 3UT5A 2ZT9B 3ZHUA 3N2KB 1K5SA 3N2KA 4K0KB 1WNSA 4DUZO 5KX5A 5KHGA 2QWRB 1KKDA 2OIGA 4FM0A 1H2SB 5F2VO 4FLZA 1S72V 5LYJA 3OR7C 4O2AB 3OR6C 2Y4TA 1RM1C 4GX1A 2XT9A 3NXSA 3J7AU 2JRIA 2K1EA 1RPOA 2IBZH 4LFAO 3CP1A 1E79G 1WPBA 3FB5C 5IT9N 4BWAA 4DV4B 2HJFC 4JV5O 1FJGB 4R50A 3AG1B 1R3KC 4YHHB 3D3QA 4GKJB 1R6NA 4ZHQA 3M7MX 2ZR3A 5EC1C 4DR1B 3DTUB 4B3MB 2E75B 3ZRSA 4R6ZA 1BL8A 4WFBV 2D3OW 3ZN0A 4X20A 1N0JA 1OCOB 1KB9F 4X8AA 4JGSA 1Z5VA 1XI1A 1EBOA 3CCSV 5EZYA 3RYIB 3E8BA 4CZZA 2DQ3A 2GV9A 1K5QA 1XREA 2XASA 1IX9A 1MSWD 2BOCC 4BIZA 2OIEA 4FM1A 1SETA 2EIKB 3RYHB 2LW1A 3SJCC 1FXKB 1FXKA 4PDVA 5IYBO 5LMNB 4JAAA 1IBMB 3TXQA 1NVPD 4X1YA 4JYAO 5CBFA 2VQFB 3ICXA 3CC4V 1FFTB 1HR0O 3ZMUA 5GONB 3ZIAG 3I55V 4JTDB 1S77D 3LSQA 3H1JH 5FNVA 1AP6A 5B1NA 1NQTA 1JFFB 1JFFA 5LHGA 4BR6A 3JD1A 2YXLA 1IBKB 3E22A 1HNZB 1PKXA 1MMMA 4DR4O 4EFEA 3AG2B 3C3SA 1SQGA 2PTMA 4LWSB 4DUYO 1K9MW 1XL6A 4RUEA 4FZ1A 4O4JB 5JWPA 5FPOA 3AK2A 2RMKB 1VMGA 1AROP 3D36A 1S0VA 3K03A 4LF7B 1AP5A 1D5AA 1KD1W 4CH6A 4FPPA 2B9ZA 2Q8VA 3KKYA 1YTFB 1GN4A 2YXYA 4PDLA 2OWOA 3B8MA 4ZBMA 1YJ9V 1GAXA 1JJ2U 2XOKG 1Q86W 1PNKA 1P4RA 4X1KA 1VQ9V 1AJNA 1WB8A 1X4TA 3GB7C 1RPRA 4FM2A 4H37A 1SA0B 1H8EG 2E5LB 1SA0A 1NT2B 1U97A 1W0JG 4JI4B 1MZFA 4DV3O 3OGCC 1VF6C 2F66C 1H2NA 1XNRB 3VBBA 4MTXA 5BR8O 3BHPA 4B3RO 1QLEC 4PV1B 1RM1B 2DE0X 1JMKC 3JCZA 3W7SA 4BAYA 5B66Z 1QCEA 1K4DC 3OUFA 1NU1H 4DW0A 2XAQA 3I5DA 4WFAV 3DXRB 1SESA 4DRXB 2Y69C 2P06A 1DGSA 1EZJA 2ZDIA 5H2FZ 3DC5A 3B2EE 2MK3A 3DC6A 5JJJB 2YUAA 2ZNIA 3CXHF 4PDMA 2VWKA 1FAFA 1YITV 1OV9A 4NXNB 1P7BA 4AQYO 4GT1A 4DV2B 5D5PA 5IJ9A 1GH6A 1Q81W 2IH3C 3OAAG 4I55B 1H38A 4ABMA 5KUKA 5CA1B 5CA1A 2DOSA 2Q73A 3OE7G 3ZS8C 1S5LZ 5CBGA 2R9RB 1Q6UA 1ZWIC 4LF8O 3CX5F 3C3TA 1WPXA 2WLJA 3G71V 4NB5A 4QJFB 1SQPH 4FLTA 2FTKA 1EN4A 1WA8B 1FXVA 5CMUA 3ETGA 2HFEC 2IH1C 4JI1O 3EVKA 2Q0OC 5B5EZ 2Q7HA 3ETQA 2F4VO 2EJRA 4XDJA 4JI2O 2UUBB 2QWPB 3FYIB 3JD3A 4H0LB 2EIMC 5CN0A 2DYSC 3BFRA 2PYLA 1SF9A 3HKCB 1SRYA 1BS3A 1S76D 2X6AA 1P49A 1M57C 5CA3A 3E8HA 2KQXA 5HFMA 4OPAA 1VQ5V 3PJSK 4LF5O 1KP2A 4PDRA 2PY5A 1WP7A 4MS2A 3ZHQA 4P2ZA 2H8PC 4F6EA 4JTAB 1Q8IA 2ZM6O 3WB2A 3K3WA 2A7WA 4OXSA 4CS4A 2Q4PA 4LFAB 2F95B 1COWG 2JIZG 3OW2U 2HKOA 1CPYA 1MA1A 2PI5A 3A0RA 4LFCO 3ETDA 1MZEA 1VQ8V 1K73W 4LF6O 2NR5A 3M8AA 2XHBA 3QTCA 5LOVA 3JD0A 5L3BA 1FD9A 1XDCA 2G38A 2JDIG 3D8CA 4EKWA 1IURA 3SGIA 3EHBB 2QWOB 1VQ6V 4WCEV 4CC6A 3CD6V 3THOA 4RO2A 2Z3YA 1N36B 3JAWA 3T4DA 4EB6B 4X65O 1NVPB 3QO8A 3ABKC 4EB6A 4I4TB 3ZHSA 4I4TA 5K1PA 1VF6A 3WFVA 4Z1VA 2W0FC 1QLEB 4LH6A 2YC0A 2WWWA 5GTHZ 2CTPA 2ZIMA 2CTWA 4X64O 4LNUB 5J2TB 4KUMA 3QF7A 2JK5C 1I5YA 4B7KA 4PA4A 4WBNB 1EFRG 3N27A 2Y69B 4GZRB 1HNXO 4JTCB 1W59A 1KBHA 4X62O 1S5HC 3IGAC 3ZHRA 4MTFA 2Q6AA 1ENVA 4JAUA 2NN4A 4JPRA 2CDYA 1O9GA 4ZKIA 4GLXA 2JGUA 5IJ0B 5IJ0A 4LR3A 3U11A 4B7EA 3B8NA 2EIJC 2R72A 5LMUB 1L8DA 1QHTA 2Y0IA 4J41A 5B1BC 4DR4B 3T1CA 5BY1A 4TSFG 2W6IG 4KP4A 1WN7A 1SZXA 3AEIA 1MG1A 2LFRA 3ABLC 4NTXA 1BHBA 5D5QA 2FMLA 4X1IB 2EIMB 4X88A 1XMQB 1SQQH 3JARB 5KA6A 2DYSB 5KA5A 1NZ6A 1D5NA 4O2BA 1N33O 3HKDB 2W0XA 1VQKV 1SERA 4FLUA 1YTFD 3ABTA 5EBLC 1M57B 3RYFB 3ZRVA 1Y76A 2HVKC 2UUCO 4FFKA 4B3SB 1VQ4V 4J7ZA 5A2QN 3FYEB 2Q68A 2P4VA 3K5NA 4DV3B 2CE4A 5CA0B 1I7FA 1DF4A 2IJJA 5A9GA 3P3NA 2BE3A 3T4ZA 3TCUA 3J80N 1JPXA 4ZOLA 1AJPA 2UUAO 2X6CA 1W2BU 4YXWG 2WLLA 2HR3A 2QM4A 1WAZA 2QKAA 2LFSA 3FB6C 2CH7A 1MSDA 4DV0O 4UCSA 2YIBA 4UVBA 4TOIA 3SPIA 3T1YO 5L3EA 1W0KG 2R9AA 2AGAA 4MTOA 4MVSA 4CS2A 4PA9A 3ZX6A 1L1FA 1VQOV 2WLMA 1M93A 2EJ7A 2OTJV 2YICA 3CCMV 5HFLA 3GWOA 4IIJB 3OEEG 1PD3A 3D36C 3BRCA 1BGYH 1TUBB 2XAGA 2ILMA 3ABKB 3P3PA 4I50A 3AG4C 4AILC 3OTFA 3ZHTA 1MNGA 2JVDA 1EM1A 3UT5B 5KHHA 3MHSC 1XL4A 1KP3A 5DEDA 2M6YA 4JI2B 4QPKA 4DR2O 3MD0A 1TVKA 5KX5B 1YVWA 2UXXA 4FVMA 5GTIZ 3QVNA 1R6KA 1BMFG 2B5UA 3HPLC 2QKSA 4CS3A 1SZTA 5LYJB 1KYOF 2QM8A 5H9CA 3HKBB 5IDJA 3HKBA 1HNWO 3CCRV 2LW7A 2M7WA 4LF9O 1EN6A 3F5TA 5L3DA 3CJHA 3UM7A 4LF5B 1GN6A 3JD2A 3K0GA 2Z5UA 2GTSA 1N0NA 2EIJB 2ZDIC 2QM7A 1GK9A 2KSDA 2KG7A 2F43G 3B77A 5B1BB 4DV1B 2N74A 1I0HA 1LNQA 2IU0A 2ZM6B 4DV6B 1N32B 1EZVH 1VF7A 3CCVV 2RDCA 2VQEO 4OX9B 4GCZA 2EZPA 4R8CA 3ABLB 3KZIZ 3K58A 4ZHQB 3E86A 3P32A 3SPHA 4HZ3A 4X20B 4LF6B 3JALA 4TV8B 2BTQA 2JGDA 4UCTA 4TV8A 5TISZ 1HDJA 3CCLV 4DK1A 1OZ0A 2HEPA 5EZYB 4JI0O 1TA8A 1JA8A 1N4CA 3T1HB 4TV9A 1V54C 1B06A 4KFMA 1NI8A 2ZE8A 1YEWA 1PL0A 1J5EO 1ROPA 5ITZA 4J9ZB 3LNMB 1GN2A 5FLXN 2JJ2G 4F6RA 1K7DA 3I56V 3IJ4A 3H9VA 2BOBC 4X1YB 1GN3A 3N2GA 3SJBC 2V4DA 1R73A 3CEIA 3STLC 3G6EV 3CSXA 1YHQV 1RSOB 3K06A 1RSOA 4WFEA 3FAVB 3FAVA 4O4HB 4FLVA 4O4HA 1HNXB 1PP9H 5FNVB 4YY3O 4X62B 2B1GA 2A79B 4PD4F 4MVOA 3FD9A 1UPGA 2QTOA 3WU2Z 3P30A 4UB6Z 4GUNA 3E22B 2YXHA 1KUQA 4FLYA 3CMEV 4B3TO 3ZBHA 4LC1A 3CRMA 4QPJA 4UVCA 4GKKO 4LF4O 2ZIOA 5L3FA 3IC9A 1IVSA 1BQ0A 1QQCA 3ZCCA 3E8GA 3VQVA 2ETNA 3W7WA 4AI8A 1X59A 3JATA 5C93A 3QO7A 4NKGB 5JH7B 2EBOA 5JH7A 4DR3B 3AG4B 1FS0G 3JSNA 2A0LA 2H94A 3X2QC 1E1QG 4O4IA 4JI7O 3G80A 5KAFZ 4X1KB 2AHZA 4DV5B 3BVOA 4O4LB 4O4LA 4X9QA 2HJDA 1Y67A 5EBMC 4BW9A 3SYCA 1M56C 1US6A 3SPGA 4X89A 1YDXA 2NLJC 2WLNA 1BT8A 4JYCA 1P7GA 4FMTA 3ASOC 3AG3C 1GRJA 5JQGB 4YIOA 5JQGA 2DYRC 2ZE7A 3R66A 1YF2A 4C7UA 2ZINA 2PUSA 3CCJV 3CE2A 4CC5A 2EX3A 3WB1A 1URFA 5JVDA 4AHCA 3ML0A 1F51A 3TXSA 3OTOO 2W6JG 5IJ9B 1R3IC 1QU7A 4JI3O 3HKEA 1LR1A 2V7QG 3JASA 4DV0B 3STZC 3T1YB 1AI5A 5JJNB 2EINC 4FLXA 1HWYA 1RFYA 2RQ6A 1SKVA 4JI6O 3RVZA 4X66O 2YIBD 4XDLA 3CRQA 1ZLZA 2F1MA 1XNQO 4YJ3B 3VQYA 4YJ3A 1N34O 1V54B 3MHHC 2LO1A 3JAMN 3ZN1A 1ZL8B 1V55C 3BA9A 1ZL8A 1R3JC 3RBZA 3OFNG 1IDSA 4D7SA 5LHIA 3WB0A 2LGQA 1I08A 4FJCC 1NKDA 2LP7A 1ZTEA 4CH3A 4NXMO 1FXHA 4PA7A 5EYPA 2WAMA 2MW2B 1B04A 1FPOA 5IY5C 3S3WA 2QR4A 1MOFA 4JF3A 1VF5B 4DUZB 2CAZC 1BZKA 3F7VC 3CS5A 2AZ0A 2WSSG 2ODMA 1N8RW 2EZOA 1O9HA 2ZNJA 2QKCA 4YJ2A 1TAEA 3UO2A 3LNNA 5EBWC 3CCEV 5JCOC 1JR9A 4E2LA 5IYDO 2CK3G 4NTWA 3S3XA 4UV8A 3CRCA 4KHPO 5IE9A 1D2DA 3CCQV 4H13B 1E1RG 1K34A 1NR7A 1Z2GA 2Q67A 4H44B 4K35A 2AHYA 4JV5B 1PV0A 1CEZA 1WJZA 3X2QB 4FZ0A 4DV4O 2VQEB 3FB7C 2HHHO 2A9HA 1FJGO 1G6UA 5LOVB 2D2CB 5H6QA 1V9PA 4JZGA 4QGPA 4LCUC 4DR7O 1SQVH 2RCVA 3RWRD 4GKJO 1XQ8A 4JYYA 4MTGA 3JAWB 2LQTA 4B3MO 2Q7GA 2WLHA 1YSCA 1M56B 4DW1A 1VQ7V 3GWKC 4JI0B 1XBLA 2BSKA 4OPHA 1YCIA 1FFXA 2BCCH 2P5OA 3CYOA 1Q82W 1UJWB 3ASOB 3AG3B 3MAQA 1YIJV 2DYRB 3JAKA 4LH7A 1M4UA 3BPZA 3L71H 3W7TA 4UCVA 1AILA 1F4MA 1WLEA 3BABA 3ABUA 3PN1A 3ZRWA 2E76B 1NTMH 1MABG 4NTYA 1R1BA 2N05A 5LMNO 3APQA 4JYAB 1F4NA 1JVMA 2BTOA 2ARHA 3SDLA 1HR0B 3JYCA 4I0XA 5LA6B 4ZI7A 1VQLV 5J9PC 5LA6A 3E2EA 1KU9A 2XAHA 2Y0PA 1IZ3A 1VQPV 2OCCC 1LUWA 1DLBA 4HYOA 1QR9A 5J2UA 2EINB 1IBLO 2A3QA 2Q69A 4QE9A 3OD4A 3CCUV 4J80A 1IBKO 1HNZO 4MVQA 3AK1A 2Q9LA 2Q0AA 4GKKB 2P4KA 4A5UB 1H2GA 4Z2WA 4DUYB 2YIAA 4JI8O 4JAVA 3E89A 3K08A 4UV9A 5EC2C 2HVJC 1V55B 2ZXWC 3K04A 4MT8A 2ADPA 1NTKH 2CTQA 4LF7O 4TWKA 4O2BB 3ZMVA 3L70H 4JI7B 1K33A 2PF4E 2CGNA 3H1KH 1SC5B 3CMAV 5IY5B 4G27B 1EN5A 3RT3C 1WP8A 2X7RB 1Y76B 4J42A 4W4LA 5B1AC 3UQ8A 2EILC 4JI5O 5IWAO 1RP3B 2UXCO 3F7YC 2CTRA 4DR6O 2WA4A 4WFGA 5LP6C 3FKSG 5LBQA 5BR8B 4B3RB 1QBZA 2GUZB 2DJVA 2GUZA 1XNRO 2WLIA 2ITCC 2HG5C 5L3CA 3W7UA 4NR1A 4QNHB 3W7XA 4J7JA 5JCOA 3IC7A 4ZOLB 3J81N 1KQSU 5BXZA 3KCXA 2JS5A 1FKAO 3VQWA 2WLLB 3F5WC 2WPDG 1OCRC 2R9IA 2CH7B 2XAFA 4IYIA 2P22C 4PJ0Z 5BZBA 3Q4HA 1VIBA 2UXDO 1ZUQA 3ZEDA 4AQYB 3OGIB 1PNLA 4TQDA 4JI3B 4L87A 4ZIBA 3TETA 2OT5A 4J10A 2QDOA 4NXNO 5FL7G 4DV2O 1NH2B 5FPRA 3E8FA 5C8YA 3H1HH 3RGBA 3CC2V 3SYAA 2P7TC 1Y6XA 1GM8A 1Y4MA 4F4LA 1NTZH 1GO3F 3H1LH 2XUMA 4X66B 2PGGA 4LF8B 1XOUA 4J7KA 2ZKOA 3LDEA 1OHHG 4I50B 2CUGA 4RAIA 3D3IA 3TGUH 1XNQB 2IJIA 3RVYA 3LSUA 3OUSA 4PA3A 4LP8A 1N34B 3BEHA 2H3OA 4HBNA 1BE3H 3ASNC 4U3JA 1H2MA 4JI1B 4PI0A 3VQXA 2JEXA 1F23A 4N23A 2F4VB 2LGWA 1TVKB 3DGEA 1ORQC 4NXMB 5LGNA 5CB4A 4RQEA 3SYQA 2DMXA 2IU3A 2PI4A 4QIWF 4P9PA 3U0ZA 1H8HG 1ZAUA 5EIBC 3CJHB 2GSMB 4TUYB 2OCCB 2X6BA 4TUYA 5DECA 3UKMA 3L9DA 2AXTZ 2KG7B 5LL6Y 3NR7A 1B6QA 2R70A 4J9YB 4O2AA 2V1DA 3A0HZ 3WG7C 4P9OA 4E4EA 2YIDA 3U10A 4U3FH 2IM9A 5B3SC 3UCSC 2EULA 1OCZC 4KHPB 1Q5OA 2ZXWB 1B3QA 4UUJC 3CB2A
chains in the Genus database with same CATH topology
1J5EO 1DK1A 1I94O 4LFCO 4AQYO 4NXNO 5FLXN 4DV2O 4DR5O 1IBLO 3R66A 4LF6O 2UXBO 3M8AA 1IBMO 1XMQO 3J7AU 1R6TA 2DOSA 1N33O 2UU9O 1IBKO 4DR2O 1HNZO 4K0KO 4DR4O 2VQFO 1YZBA 2JRIA 4DV7O 2ZKOA 4KHPO 1D2DA 1NS1A 4LF8O 4LFAO 4A5UB 1N36O 2Z0AA 3OTOO 4X65O 4YY3O 4DUYO 2UUCO 4JI8O 4JI3O 5IT9N 4JV5O 1HNWO 5A2QN 4B3SO 4DV4O 2LW7A 4JI1O 4LF7O 2HHHO 1FJGO 4LF9O 3F5TA 1KUQA 2F4VO 4JI2O 4LFBO 4DR7O 4X64O 4B3TO 4GKJO 1F7YA 4JI6O 4X66O 5H5NA 3RT3C 4B3MO 3J80N 4GKKO 1A32A 4LF4O 4JI5O 5IWAO 1HNXO 1XEQA 2UUAO 1XNQO 2N74A 4X62O 4DV1O 1G1XB 1N34O 2UXCO 1X59A 4DR6O 3JAMN 4DV6O 4OPHA 1N32O 4DV3O 2VQEO 4DV0O 1XMOO 4OPAA 4DR3O 4OX9O 4YHHO 3T1YO 4JI7O 2DJVA 3O65A 2UUBO 5BR8O 4LF5O 1FYJA 1XNRO 4B3RO 2AGAA 4NXMO 4DR1O 1AILA 4DV5O 5LL6Y 3J81N 5BXZA 1R1BA 1FKAO 5LMNO 2E5LO 4JI0O 5LMUO 4JYAO 2ZM6O 3SDLA 5BY1A 4JI4O 4DUZO 1HR0O 2FKXA 3T1HO 1AB3A 2UXDO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E O;  1DK1 A;  1I94 O;  4LFC O;  4AQY O;  4NXN O;  5FLX N;  4DV2 O;  4DR5 O;  1IBL O;  3R66 A;  4LF6 O;  2UXB O;  3M8A A;  1IBM O;  1XMQ O;  3J7A U;  1R6T A;  2DOS A;  1N33 O;  2UU9 O;  1IBK O;  4DR2 O;  1HNZ O;  4K0K O;  4DR4 O;  2VQF O;  1YZB A;  2JRI A;  4DV7 O;  2ZKO A;  4KHP O;  1D2D A;  1NS1 A;  4LF8 O;  4LFA O;  4A5U B;  1N36 O;  2Z0A A;  3OTO O;  4X65 O;  4YY3 O;  4DUY O;  2UUC O;  4JI8 O;  4JI3 O;  5IT9 N;  4JV5 O;  1HNW O;  5A2Q N;  4B3S O;  4DV4 O;  2LW7 A;  4JI1 O;  4LF7 O;  2HHH O;  1FJG O;  4LF9 O;  3F5T A;  1KUQ A;  2F4V O;  4JI2 O;  4LFB O;  4DR7 O;  4X64 O;  4B3T O;  4GKJ O;  1F7Y A;  4JI6 O;  4X66 O;  5H5N A;  3RT3 C;  4B3M O;  3J80 N;  4GKK O;  1A32 A;  4LF4 O;  4JI5 O;  5IWA O;  1HNX O;  1XEQ A;  2UUA O;  1XNQ O;  2N74 A;  4X62 O;  4DV1 O;  1G1X B;  1N34 O;  2UXC O;  1X59 A;  4DR6 O;  3JAM N;  4DV6 O;  4OPH A;  1N32 O;  4DV3 O;  2VQE O;  4DV0 O;  1XMO O;  4OPA A;  4DR3 O;  4OX9 O;  4YHH O;  3T1Y O;  4JI7 O;  2DJV A;  3O65 A;  2UUB O;  5BR8 O;  4LF5 O;  1FYJ A;  1XNR O;  4B3R O;  2AGA A;  4NXM O;  4DR1 O;  1AIL A;  4DV5 O;  5LL6 Y;  3J81 N;  5BXZ A;  1R1B A;  1FKA O;  5LMN O;  2E5L O;  4JI0 O;  5LMU O;  4JYA O;  2ZM6 O;  3SDL A;  5BY1 A;  4JI4 O;  4DUZ O;  1HR0 O;  2FKX A;  3T1H O;  1AB3 A;  2UXD O; 
#chains in the Genus database with same CATH topology
 2K9P A;  1BQZ A;  4LFC B;  5KHI A;  4RWU A;  3JAL B;  2BTQ B;  2JGD B;  2ZE6 A;  2IJH A;  2PZS A;  2HHH B;  3K5O A;  3AG7 A;  4Q20 A;  1R6T A;  4DR7 B;  2UU9 O;  4K8Z A;  1XIL A;  4FK5 C;  5B1A B;  2EIL B;  1VAR A;  2E74 B;  4TV9 B;  4BIO A;  1VQN V;  3ZMS A;  4PHZ A;  1R3L C;  4X65 B;  5KHK A;  3K57 A;  1N36 O;  1Q43 A;  5ITZ B;  5IYZ B;  4JZ2 A;  5LP6 B;  2JS3 A;  5IYZ A;  2HP8 A;  5LP6 A;  4PI2 A;  4F6R B;  1S3J A;  4CBC A;  4MVZ A;  4I9W A;  3N2G B;  4UB8 Z;  1GKF A;  4MVR A;  4XBF A;  4GX0 A;  3K79 A;  1NR1 A;  3RYI A;  3OMN B;  4X64 B;  1QLN A;  4LFB O;  1BCC H;  3ZRX A;  4MVU A;  3L74 H;  3RYH A;  1OCR B;  2L6L A;  3H01 A;  4QE7 A;  1CXZ B;  5BMV B;  5BMV A;  1AI4 A;  3LSS A;  2ATK C;  1G8M A;  5H6R A;  1XMO O;  2A06 H;  5GON A;  2RNB A;  2HLD G;  3CWB H;  3E83 A;  4RQF A;  1M9N A;  1BHA A;  2QTS A;  2DWD C;  4RUF A;  3K59 A;  1AR5 A;  1IBL B;  2WLK A;  3IAY A;  4UCR A;  2QEX V;  2QA4 V;  4MW8 A;  4IL6 Z;  3JAT B;  1H2K A;  4KL1 A;  2GTA A;  4HAM A;  5KAI Z;  5LMU O;  1QVG U;  4MW3 A;  1SQB H;  1XHX A;  4O4I B;  3B09 A;  5JJE B;  1JOY A;  1YI2 V;  3ASN B;  3FX7 A;  4JI8 B;  3BAA A;  3EFF K;  4LWS A;  3ETE A;  4ICG A;  1I94 O;  4O4J A;  4DR5 O;  3RW0 A;  3GVM A;  4EFB A;  3EXA A;  1Q7Y W;  2ITD C;  4UCU A;  3B40 A;  1N33 B;  1CP9 A;  1XMQ O;  2FYU H;  1JJO A;  5E1A C;  1L0L H;  4DV7 O;  1J95 A;  3FFQ A;  2UXN A;  3SJQ C;  2YSU B;  2YS8 A;  3IFX A;  2DW4 A;  4JI5 B;  5IWA B;  2UUC B;  3APO A;  4K8X A;  1T5E A;  4CH5 A;  2UXC B;  3OM3 B;  4DR6 B;  4B3S O;  3SR2 C;  3SJA C;  1GMG A;  2YDE A;  4PEL A;  4DO2 A;  3LUT B;  2P90 A;  2YI8 A;  5JVD B;  2GHY A;  3QO5 A;  4HNA B;  3WG7 B;  4HNA A;  5B3S B;  2UUA B;  1ZX3 A;  4GX2 A;  1M1K W;  3HKE B;  1P84 F;  1OCZ B;  1XHZ A;  2Q7E A;  1SQF A;  3K9S A;  2QGN A;  3DXR A;  1G1X B;  4UVA A;  4K3A A;  4DRX A;  3JAS B;  2VRZ A;  1IXB A;  2Y4U A;  2UXD B;  3QNE A;  3TJT A;  1GM9 A;  1UFI A;  1FYJ A;  4IT5 A;  4FLW A;  1AR4 A;  4LBE C;  3K9A A;  1Q90 D;  3O9O A;  2QWN B;  3L73 H;  4PA6 A;  2F23 A;  4R7C A;  4I55 A;  5IYC O;  4TT3 G;  1G4Y B;  1HP8 A;  1NH2 D;  3CPW U;  5LGT A;  1S5J A;  4IYH A;  2FL4 A;  5GW7 A;  2GBO A;  3G67 A;  3M99 B;  3KCY A;  1DK1 A;  1GM7 A;  3BA8 A;  5EYP B;  1Q3E A;  2NNU A;  2OTL V;  1WA8 A;  2B1I A;  1U96 A;  2FB5 A;  1BSM A;  2AZ2 A;  2VWJ A;  2UXB O;  4DR2 B;  2XTA A;  3SYP A;  2XND G;  4K0K O;  4NYK A;  2QJ1 A;  1K4C C;  1KKC A;  2Z0A A;  2OYQ A;  3HKC A;  4YJ2 B;  1GTO A;  1HNW B;  4FIP C;  3A8T A;  1Y66 A;  4LF9 B;  1H2L A;  4IHJ B;  1JCH A;  4WFH A;  2P6J A;  4IHJ A;  1QNM A;  4G28 B;  1AR1 B;  3RYC B;  2E3C A;  1PM9 A;  3RYC A;  1F7Y A;  1L0N H;  4MSW C;  3ZHV A;  5DN6 G;  2VS0 A;  1VQM V;  1VP7 A;  3A2F A;  4WFF A;  3QG5 A;  3CRA A;  4Q6G A;  1M5I A;  4DV1 O;  1XUQ A;  3A0B Z;  5KUM A;  4UFZ A;  4DV6 O;  1N32 O;  3G6B A;  3SYO A;  5EK0 A;  1M90 W;  2RJZ A;  1TUE B;  4OX9 O;  1NBM G;  4YHH O;  4GYC B;  2X0L A;  3ABM C;  1OCC C;  4J11 A;  3OT7 A;  4DR1 O;  1PL4 A;  4CH4 A;  1TGO A;  2QE7 G;  2YEV B;  2ZCE A;  4I5S A;  2YEV A;  5KLV H;  2Y48 A;  3CRR A;  2BSK B;  3G4S V;  2UU9 B;  1FFX B;  3SPJ A;  2RN9 A;  2DQ0 A;  4WF9 V;  3UO3 A;  3CXC U;  2FKX A;  4I7Z B;  3T1H O;  4XDK A;  1SQX H;  2ZR2 A;  3JAK B;  3OMI B;  4G2K A;  2DWE C;  1J5E B;  1Y74 B;  3H1I H;  1Y74 A;  1YXB A;  3ZRW B;  4DYL A;  4W4K A;  3C90 A;  2C2A A;  3BCC H;  3JCU Z;  1AI6 A;  1IBM O;  4LFB B;  4B08 A;  3CHX A;  4I0X B;  2QSA A;  3K5L A;  2VQF O;  4TQF A;  1YZB A;  1DTO A;  5LGU A;  2OCH A;  4LNU A;  3ZJZ A;  5J2T A;  4DXW A;  1DF5 A;  1NS1 A;  4ZI7 B;  1PPJ H;  1QR8 A;  4WBN A;  3HR0 A;  3B4S A;  4YY3 B;  3T2M A;  2AW9 A;  5J2U B;  1K8A W;  3OEH G;  4FFB B;  2XAJ A;  4BW5 A;  4FFB A;  1YJW V;  2O57 A;  2JEU A;  4JYB A;  1YJN V;  4P30 A;  1XMO B;  4H33 A;  4IGG A;  4B3T B;  3AK3 A;  5K1X A;  4D6T H;  2YI9 A;  1KC8 W;  5LHH A;  4LF4 B;  5B1O A;  1A32 A;  5KMG B;  3OMA B;  2IW5 A;  5KMG A;  3DSQ A;  4I9Q A;  1OJH A;  4D7T A;  1K3E A;  4UCO A;  4DR3 O;  2DN9 A;  3ZMZ A;  3O65 A;  3MDS A;  1I94 B;  3AG1 C;  3FB8 C;  4DR5 B;  1SS3 A;  4DV5 O;  4YIP A;  2Q5Z A;  3RFR A;  2LJ2 A;  3E35 A;  4X1I A;  4MVM A;  4KXR A;  2E5L O;  2GDS A;  2KKW A;  3CC7 V;  3JAR A;  1OCO C;  1JQ0 A;  4DV7 B;  1KEC A;  3HKD A;  1IXM A;  2ADQ B;  5L3G A;  4JI4 O;  4Z1M G;  1AI7 A;  4BIU A;  4GX5 A;  3R65 A;  1AB3 A;  1LUV A;  2F93 B;  2WLI B;  1VEW A;  1THZ A;  4N21 A;  3RYF A;  3ZMT A;  4DK0 A;  3K0D A;  2EIK C;  3RN4 A;  2P67 A;  4JAS A;  1K97 A;  5EIB D;  1FXK C;  2PYJ A;  2ZD9 A;  5CBH A;  5CA0 A;  3HB3 B;  1QVF U;  5E79 Z;  1Q6H A;  2N04 A;  3Q4H B;  3JD4 A;  2ZQM A;  3K5M A;  1PNM A;  3OTO B;  4OGQ B;  2QWQ B;  2ZE5 A;  1AJQ A;  3JSL A;  4U7N A;  2L35 A;  1AVM A;  4UXN A;  5C8Y B;  1Z5W A;  1JX9 A;  3L75 H;  1HW7 A;  1K92 A;  3ABM B;  1OCC B;  4ASU G;  4JI6 B;  2KB1 A;  4L8J A;  5H5N A;  2WA3 A;  5DM6 V;  3VOU A;  5KHJ A;  2IJK A;  1NJI W;  1XEQ A;  2CGO A;  5LXT B;  3AG2 C;  4U3J B;  5LXT A;  3KG2 A;  3L72 H;  1KMI Z;  1I5X A;  4IIJ A;  3BY6 A;  1TUB A;  1Q6I A;  4U7O A;  4EEQ A;  2UUB O;  3LDC A;  3SPC A;  3LDD A;  2JJ1 G;  5CB4 B;  1WB7 A;  1ZSP A;  3TK1 A;  4NVP A;  5AG2 A;  2UXB B;  3UT5 A;  2ZT9 B;  3ZHU A;  3N2K B;  1K5S A;  3N2K A;  4K0K B;  1WNS A;  4DUZ O;  5KX5 A;  5KHG A;  2QWR B;  1KKD A;  2OIG A;  4FM0 A;  1H2S B;  5F2V O;  4FLZ A;  1S72 V;  5LYJ A;  3OR7 C;  4O2A B;  3OR6 C;  2Y4T A;  1RM1 C;  4GX1 A;  2XT9 A;  3NXS A;  3J7A U;  2JRI A;  2K1E A;  1RPO A;  2IBZ H;  4LFA O;  3CP1 A;  1E79 G;  1WPB A;  3FB5 C;  5IT9 N;  4BWA A;  4DV4 B;  2HJF C;  4JV5 O;  1FJG B;  4R50 A;  3AG1 B;  1R3K C;  4YHH B;  3D3Q A;  4GKJ B;  1R6N A;  4ZHQ A;  3M7M X;  2ZR3 A;  5EC1 C;  4DR1 B;  3DTU B;  4B3M B;  2E75 B;  3ZRS A;  4R6Z A;  1BL8 A;  4WFB V;  2D3O W;  3ZN0 A;  4X20 A;  1N0J A;  1OCO B;  1KB9 F;  4X8A A;  4JGS A;  1Z5V A;  1XI1 A;  1EBO A;  3CCS V;  5EZY A;  3RYI B;  3E8B A;  4CZZ A;  2DQ3 A;  2GV9 A;  1K5Q A;  1XRE A;  2XAS A;  1IX9 A;  1MSW D;  2BOC C;  4BIZ A;  2OIE A;  4FM1 A;  1SET A;  2EIK B;  3RYH B;  2LW1 A;  3SJC C;  1FXK B;  1FXK A;  4PDV A;  5IYB O;  5LMN B;  4JAA A;  1IBM B;  3TXQ A;  1NVP D;  4X1Y A;  4JYA O;  5CBF A;  2VQF B;  3ICX A;  3CC4 V;  1FFT B;  1HR0 O;  3ZMU A;  5GON B;  3ZIA G;  3I55 V;  4JTD B;  1S77 D;  3LSQ A;  3H1J H;  5FNV A;  1AP6 A;  5B1N A;  1NQT A;  1JFF B;  1JFF A;  5LHG A;  4BR6 A;  3JD1 A;  2YXL A;  1IBK B;  3E22 A;  1HNZ B;  1PKX A;  1MMM A;  4DR4 O;  4EFE A;  3AG2 B;  3C3S A;  1SQG A;  2PTM A;  4LWS B;  4DUY O;  1K9M W;  1XL6 A;  4RUE A;  4FZ1 A;  4O4J B;  5JWP A;  5FPO A;  3AK2 A;  2RMK B;  1VMG A;  1ARO P;  3D36 A;  1S0V A;  3K03 A;  4LF7 B;  1AP5 A;  1D5A A;  1KD1 W;  4CH6 A;  4FPP A;  2B9Z A;  2Q8V A;  3KKY A;  1YTF B;  1GN4 A;  2YXY A;  4PDL A;  2OWO A;  3B8M A;  4ZBM A;  1YJ9 V;  1GAX A;  1JJ2 U;  2XOK G;  1Q86 W;  1PNK A;  1P4R A;  4X1K A;  1VQ9 V;  1AJN A;  1WB8 A;  1X4T A;  3GB7 C;  1RPR A;  4FM2 A;  4H37 A;  1SA0 B;  1H8E G;  2E5L B;  1SA0 A;  1NT2 B;  1U97 A;  1W0J G;  4JI4 B;  1MZF A;  4DV3 O;  3OGC C;  1VF6 C;  2F66 C;  1H2N A;  1XNR B;  3VBB A;  4MTX A;  5BR8 O;  3BHP A;  4B3R O;  1QLE C;  4PV1 B;  1RM1 B;  2DE0 X;  1JMK C;  3JCZ A;  3W7S A;  4BAY A;  5B66 Z;  1QCE A;  1K4D C;  3OUF A;  1NU1 H;  4DW0 A;  2XAQ A;  3I5D A;  4WFA V;  3DXR B;  1SES A;  4DRX B;  2Y69 C;  2P06 A;  1DGS A;  1EZJ A;  2ZDI A;  5H2F Z;  3DC5 A;  3B2E E;  2MK3 A;  3DC6 A;  5JJJ B;  2YUA A;  2ZNI A;  3CXH F;  4PDM A;  2VWK A;  1FAF A;  1YIT V;  1OV9 A;  4NXN B;  1P7B A;  4AQY O;  4GT1 A;  4DV2 B;  5D5P A;  5IJ9 A;  1GH6 A;  1Q81 W;  2IH3 C;  3OAA G;  4I55 B;  1H38 A;  4ABM A;  5KUK A;  5CA1 B;  5CA1 A;  2DOS A;  2Q73 A;  3OE7 G;  3ZS8 C;  1S5L Z;  5CBG A;  2R9R B;  1Q6U A;  1ZWI C;  4LF8 O;  3CX5 F;  3C3T A;  1WPX A;  2WLJ A;  3G71 V;  4NB5 A;  4QJF B;  1SQP H;  4FLT A;  2FTK A;  1EN4 A;  1WA8 B;  1FXV A;  5CMU A;  3ETG A;  2HFE C;  2IH1 C;  4JI1 O;  3EVK A;  2Q0O C;  5B5E Z;  2Q7H A;  3ETQ A;  2F4V O;  2EJR A;  4XDJ A;  4JI2 O;  2UUB B;  2QWP B;  3FYI B;  3JD3 A;  4H0L B;  2EIM C;  5CN0 A;  2DYS C;  3BFR A;  2PYL A;  1SF9 A;  3HKC B;  1SRY A;  1BS3 A;  1S76 D;  2X6A A;  1P49 A;  1M57 C;  5CA3 A;  3E8H A;  2KQX A;  5HFM A;  4OPA A;  1VQ5 V;  3PJS K;  4LF5 O;  1KP2 A;  4PDR A;  2PY5 A;  1WP7 A;  4MS2 A;  3ZHQ A;  4P2Z A;  2H8P C;  4F6E A;  4JTA B;  1Q8I A;  2ZM6 O;  3WB2 A;  3K3W A;  2A7W A;  4OXS A;  4CS4 A;  2Q4P A;  4LFA B;  2F95 B;  1COW G;  2JIZ G;  3OW2 U;  2HKO A;  1CPY A;  1MA1 A;  2PI5 A;  3A0R A;  4LFC O;  3ETD A;  1MZE A;  1VQ8 V;  1K73 W;  4LF6 O;  2NR5 A;  3M8A A;  2XHB A;  3QTC A;  5LOV A;  3JD0 A;  5L3B A;  1FD9 A;  1XDC A;  2G38 A;  2JDI G;  3D8C A;  4EKW A;  1IUR A;  3SGI A;  3EHB B;  2QWO B;  1VQ6 V;  4WCE V;  4CC6 A;  3CD6 V;  3THO A;  4RO2 A;  2Z3Y A;  1N36 B;  3JAW A;  3T4D A;  4EB6 B;  4X65 O;  1NVP B;  3QO8 A;  3ABK C;  4EB6 A;  4I4T B;  3ZHS A;  4I4T A;  5K1P A;  1VF6 A;  3WFV A;  4Z1V A;  2W0F C;  1QLE B;  4LH6 A;  2YC0 A;  2WWW A;  5GTH Z;  2CTP A;  2ZIM A;  2CTW A;  4X64 O;  4LNU B;  5J2T B;  4KUM A;  3QF7 A;  2JK5 C;  1I5Y A;  4B7K A;  4PA4 A;  4WBN B;  1EFR G;  3N27 A;  2Y69 B;  4GZR B;  1HNX O;  4JTC B;  1W59 A;  1KBH A;  4X62 O;  1S5H C;  3IGA C;  3ZHR A;  4MTF A;  2Q6A A;  1ENV A;  4JAU A;  2NN4 A;  4JPR A;  2CDY A;  1O9G A;  4ZKI A;  4GLX A;  2JGU A;  5IJ0 B;  5IJ0 A;  4LR3 A;  3U11 A;  4B7E A;  3B8N A;  2EIJ C;  2R72 A;  5LMU B;  1L8D A;  1QHT A;  2Y0I A;  4J41 A;  5B1B C;  4DR4 B;  3T1C A;  5BY1 A;  4TSF G;  2W6I G;  4KP4 A;  1WN7 A;  1SZX A;  3AEI A;  1MG1 A;  2LFR A;  3ABL C;  4NTX A;  1BHB A;  5D5Q A;  2FML A;  4X1I B;  2EIM B;  4X88 A;  1XMQ B;  1SQQ H;  3JAR B;  5KA6 A;  2DYS B;  5KA5 A;  1NZ6 A;  1D5N A;  4O2B A;  1N33 O;  3HKD B;  2W0X A;  1VQK V;  1SER A;  4FLU A;  1YTF D;  3ABT A;  5EBL C;  1M57 B;  3RYF B;  3ZRV A;  1Y76 A;  2HVK C;  2UUC O;  4FFK A;  4B3S B;  1VQ4 V;  4J7Z A;  5A2Q N;  3FYE B;  2Q68 A;  2P4V A;  3K5N A;  4DV3 B;  2CE4 A;  5CA0 B;  1I7F A;  1DF4 A;  2IJJ A;  5A9G A;  3P3N A;  2BE3 A;  3T4Z A;  3TCU A;  3J80 N;  1JPX A;  4ZOL A;  1AJP A;  2UUA O;  2X6C A;  1W2B U;  4YXW G;  2WLL A;  2HR3 A;  2QM4 A;  1WAZ A;  2QKA A;  2LFS A;  3FB6 C;  2CH7 A;  1MSD A;  4DV0 O;  4UCS A;  2YIB A;  4UVB A;  4TOI A;  3SPI A;  3T1Y O;  5L3E A;  1W0K G;  2R9A A;  2AGA A;  4MTO A;  4MVS A;  4CS2 A;  4PA9 A;  3ZX6 A;  1L1F A;  1VQO V;  2WLM A;  1M93 A;  2EJ7 A;  2OTJ V;  2YIC A;  3CCM V;  5HFL A;  3GWO A;  4IIJ B;  3OEE G;  1PD3 A;  3D36 C;  3BRC A;  1BGY H;  1TUB B;  2XAG A;  2ILM A;  3ABK B;  3P3P A;  4I50 A;  3AG4 C;  4AIL C;  3OTF A;  3ZHT A;  1MNG A;  2JVD A;  1EM1 A;  3UT5 B;  5KHH A;  3MHS C;  1XL4 A;  1KP3 A;  5DED A;  2M6Y A;  4JI2 B;  4QPK A;  4DR2 O;  3MD0 A;  1TVK A;  5KX5 B;  1YVW A;  2UXX A;  4FVM A;  5GTI Z;  3QVN A;  1R6K A;  1BMF G;  2B5U A;  3HPL C;  2QKS A;  4CS3 A;  1SZT A;  5LYJ B;  1KYO F;  2QM8 A;  5H9C A;  3HKB B;  5IDJ A;  3HKB A;  1HNW O;  3CCR V;  2LW7 A;  2M7W A;  4LF9 O;  1EN6 A;  3F5T A;  5L3D A;  3CJH A;  3UM7 A;  4LF5 B;  1GN6 A;  3JD2 A;  3K0G A;  2Z5U A;  2GTS A;  1N0N A;  2EIJ B;  2ZDI C;  2QM7 A;  1GK9 A;  2KSD A;  2KG7 A;  2F43 G;  3B77 A;  5B1B B;  4DV1 B;  2N74 A;  1I0H A;  1LNQ A;  2IU0 A;  2ZM6 B;  4DV6 B;  1N32 B;  1EZV H;  1VF7 A;  3CCV V;  2RDC A;  2VQE O;  4OX9 B;  4GCZ A;  2EZP A;  4R8C A;  3ABL B;  3KZI Z;  3K58 A;  4ZHQ B;  3E86 A;  3P32 A;  3SPH A;  4HZ3 A;  4X20 B;  4LF6 B;  3JAL A;  4TV8 B;  2BTQ A;  2JGD A;  4UCT A;  4TV8 A;  5TIS Z;  1HDJ A;  3CCL V;  4DK1 A;  1OZ0 A;  2HEP A;  5EZY B;  4JI0 O;  1TA8 A;  1JA8 A;  1N4C A;  3T1H B;  4TV9 A;  1V54 C;  1B06 A;  4KFM A;  1NI8 A;  2ZE8 A;  1YEW A;  1PL0 A;  1J5E O;  1ROP A;  5ITZ A;  4J9Z B;  3LNM B;  1GN2 A;  5FLX N;  2JJ2 G;  4F6R A;  1K7D A;  3I56 V;  3IJ4 A;  3H9V A;  2BOB C;  4X1Y B;  1GN3 A;  3N2G A;  3SJB C;  2V4D A;  1R73 A;  3CEI A;  3STL C;  3G6E V;  3CSX A;  1YHQ V;  1RSO B;  3K06 A;  1RSO A;  4WFE A;  3FAV B;  3FAV A;  4O4H B;  4FLV A;  4O4H A;  1HNX B;  1PP9 H;  5FNV B;  4YY3 O;  4X62 B;  2B1G A;  2A79 B;  4PD4 F;  4MVO A;  3FD9 A;  1UPG A;  2QTO A;  3WU2 Z;  3P30 A;  4UB6 Z;  4GUN A;  3E22 B;  2YXH A;  1KUQ A;  4FLY A;  3CME V;  4B3T O;  3ZBH A;  4LC1 A;  3CRM A;  4QPJ A;  4UVC A;  4GKK O;  4LF4 O;  2ZIO A;  5L3F A;  3IC9 A;  1IVS A;  1BQ0 A;  1QQC A;  3ZCC A;  3E8G A;  3VQV A;  2ETN A;  3W7W A;  4AI8 A;  1X59 A;  3JAT A;  5C93 A;  3QO7 A;  4NKG B;  5JH7 B;  2EBO A;  5JH7 A;  4DR3 B;  3AG4 B;  1FS0 G;  3JSN A;  2A0L A;  2H94 A;  3X2Q C;  1E1Q G;  4O4I A;  4JI7 O;  3G80 A;  5KAF Z;  4X1K B;  2AHZ A;  4DV5 B;  3BVO A;  4O4L B;  4O4L A;  4X9Q A;  2HJD A;  1Y67 A;  5EBM C;  4BW9 A;  3SYC A;  1M56 C;  1US6 A;  3SPG A;  4X89 A;  1YDX A;  2NLJ C;  2WLN A;  1BT8 A;  4JYC A;  1P7G A;  4FMT A;  3ASO C;  3AG3 C;  1GRJ A;  5JQG B;  4YIO A;  5JQG A;  2DYR C;  2ZE7 A;  3R66 A;  1YF2 A;  4C7U A;  2ZIN A;  2PUS A;  3CCJ V;  3CE2 A;  4CC5 A;  2EX3 A;  3WB1 A;  1URF A;  5JVD A;  4AHC A;  3ML0 A;  1F51 A;  3TXS A;  3OTO O;  2W6J G;  5IJ9 B;  1R3I C;  1QU7 A;  4JI3 O;  3HKE A;  1LR1 A;  2V7Q G;  3JAS A;  4DV0 B;  3STZ C;  3T1Y B;  1AI5 A;  5JJN B;  2EIN C;  4FLX A;  1HWY A;  1RFY A;  2RQ6 A;  1SKV A;  4JI6 O;  3RVZ A;  4X66 O;  2YIB D;  4XDL A;  3CRQ A;  1ZLZ A;  2F1M A;  1XNQ O;  4YJ3 B;  3VQY A;  4YJ3 A;  1N34 O;  1V54 B;  3MHH C;  2LO1 A;  3JAM N;  3ZN1 A;  1ZL8 B;  1V55 C;  3BA9 A;  1ZL8 A;  1R3J C;  3RBZ A;  3OFN G;  1IDS A;  4D7S A;  5LHI A;  3WB0 A;  2LGQ A;  1I08 A;  4FJC C;  1NKD A;  2LP7 A;  1ZTE A;  4CH3 A;  4NXM O;  1FXH A;  4PA7 A;  5EYP A;  2WAM A;  2MW2 B;  1B04 A;  1FPO A;  5IY5 C;  3S3W A;  2QR4 A;  1MOF A;  4JF3 A;  1VF5 B;  4DUZ B;  2CAZ C;  1BZK A;  3F7V C;  3CS5 A;  2AZ0 A;  2WSS G;  2ODM A;  1N8R W;  2EZO A;  1O9H A;  2ZNJ A;  2QKC A;  4YJ2 A;  1TAE A;  3UO2 A;  3LNN A;  5EBW C;  3CCE V;  5JCO C;  1JR9 A;  4E2L A;  5IYD O;  2CK3 G;  4NTW A;  3S3X A;  4UV8 A;  3CRC A;  4KHP O;  5IE9 A;  1D2D A;  3CCQ V;  4H13 B;  1E1R G;  1K34 A;  1NR7 A;  1Z2G A;  2Q67 A;  4H44 B;  4K35 A;  2AHY A;  4JV5 B;  1PV0 A;  1CEZ A;  1WJZ A;  3X2Q B;  4FZ0 A;  4DV4 O;  2VQE B;  3FB7 C;  2HHH O;  2A9H A;  1FJG O;  1G6U A;  5LOV B;  2D2C B;  5H6Q A;  1V9P A;  4JZG A;  4QGP A;  4LCU C;  4DR7 O;  1SQV H;  2RCV A;  3RWR D;  4GKJ O;  1XQ8 A;  4JYY A;  4MTG A;  3JAW B;  2LQT A;  4B3M O;  2Q7G A;  2WLH A;  1YSC A;  1M56 B;  4DW1 A;  1VQ7 V;  3GWK C;  4JI0 B;  1XBL A;  2BSK A;  4OPH A;  1YCI A;  1FFX A;  2BCC H;  2P5O A;  3CYO A;  1Q82 W;  1UJW B;  3ASO B;  3AG3 B;  3MAQ A;  1YIJ V;  2DYR B;  3JAK A;  4LH7 A;  1M4U A;  3BPZ A;  3L71 H;  3W7T A;  4UCV A;  1AIL A;  1F4M A;  1WLE A;  3BAB A;  3ABU A;  3PN1 A;  3ZRW A;  2E76 B;  1NTM H;  1MAB G;  4NTY A;  1R1B A;  2N05 A;  5LMN O;  3APQ A;  4JYA B;  1F4N A;  1JVM A;  2BTO A;  2ARH A;  3SDL A;  1HR0 B;  3JYC A;  4I0X A;  5LA6 B;  4ZI7 A;  1VQL V;  5J9P C;  5LA6 A;  3E2E A;  1KU9 A;  2XAH A;  2Y0P A;  1IZ3 A;  1VQP V;  2OCC C;  1LUW A;  1DLB A;  4HYO A;  1QR9 A;  5J2U A;  2EIN B;  1IBL O;  2A3Q A;  2Q69 A;  4QE9 A;  3OD4 A;  3CCU V;  4J80 A;  1IBK O;  1HNZ O;  4MVQ A;  3AK1 A;  2Q9L A;  2Q0A A;  4GKK B;  2P4K A;  4A5U B;  1H2G A;  4Z2W A;  4DUY B;  2YIA A;  4JI8 O;  4JAV A;  3E89 A;  3K08 A;  4UV9 A;  5EC2 C;  2HVJ C;  1V55 B;  2ZXW C;  3K04 A;  4MT8 A;  2ADP A;  1NTK H;  2CTQ A;  4LF7 O;  4TWK A;  4O2B B;  3ZMV A;  3L70 H;  4JI7 B;  1K33 A;  2PF4 E;  2CGN A;  3H1K H;  1SC5 B;  3CMA V;  5IY5 B;  4G27 B;  1EN5 A;  3RT3 C;  1WP8 A;  2X7R B;  1Y76 B;  4J42 A;  4W4L A;  5B1A C;  3UQ8 A;  2EIL C;  4JI5 O;  5IWA O;  1RP3 B;  2UXC O;  3F7Y C;  2CTR A;  4DR6 O;  2WA4 A;  4WFG A;  5LP6 C;  3FKS G;  5LBQ A;  5BR8 B;  4B3R B;  1QBZ A;  2GUZ B;  2DJV A;  2GUZ A;  1XNR O;  2WLI A;  2ITC C;  2HG5 C;  5L3C A;  3W7U A;  4NR1 A;  4QNH B;  3W7X A;  4J7J A;  5JCO A;  3IC7 A;  4ZOL B;  3J81 N;  1KQS U;  5BXZ A;  3KCX A;  2JS5 A;  1FKA O;  3VQW A;  2WLL B;  3F5W C;  2WPD G;  1OCR C;  2R9I A;  2CH7 B;  2XAF A;  4IYI A;  2P22 C;  4PJ0 Z;  5BZB A;  3Q4H A;  1VIB A;  2UXD O;  1ZUQ A;  3ZED A;  4AQY B;  3OGI B;  1PNL A;  4TQD A;  4JI3 B;  4L87 A;  4ZIB A;  3TET A;  2OT5 A;  4J10 A;  2QDO A;  4NXN O;  5FL7 G;  4DV2 O;  1NH2 B;  5FPR A;  3E8F A;  5C8Y A;  3H1H H;  3RGB A;  3CC2 V;  3SYA A;  2P7T C;  1Y6X A;  1GM8 A;  1Y4M A;  4F4L A;  1NTZ H;  1GO3 F;  3H1L H;  2XUM A;  4X66 B;  2PGG A;  4LF8 B;  1XOU A;  4J7K A;  2ZKO A;  3LDE A;  1OHH G;  4I50 B;  2CUG A;  4RAI A;  3D3I A;  3TGU H;  1XNQ B;  2IJI A;  3RVY A;  3LSU A;  3OUS A;  4PA3 A;  4LP8 A;  1N34 B;  3BEH A;  2H3O A;  4HBN A;  1BE3 H;  3ASN C;  4U3J A;  1H2M A;  4JI1 B;  4PI0 A;  3VQX A;  2JEX A;  1F23 A;  4N23 A;  2F4V B;  2LGW A;  1TVK B;  3DGE A;  1ORQ C;  4NXM B;  5LGN A;  5CB4 A;  4RQE A;  3SYQ A;  2DMX A;  2IU3 A;  2PI4 A;  4QIW F;  4P9P A;  3U0Z A;  1H8H G;  1ZAU A;  5EIB C;  3CJH B;  2GSM B;  4TUY B;  2OCC B;  2X6B A;  4TUY A;  5DEC A;  3UKM A;  3L9D A;  2AXT Z;  2KG7 B;  5LL6 Y;  3NR7 A;  1B6Q A;  2R70 A;  4J9Y B;  4O2A A;  2V1D A;  3A0H Z;  3WG7 C;  4P9O A;  4E4E A;  2YID A;  3U10 A;  4U3F H;  2IM9 A;  5B3S C;  3UCS C;  2EUL A;  1OCZ C;  4KHP B;  1Q5O A;  2ZXW B;  1B3Q A;  4UUJ C;  3CB2 A; 
#chains in the Genus database with same CATH homology
 1J5E O;  1DK1 A;  1I94 O;  4LFC O;  4AQY O;  4NXN O;  5FLX N;  4DV2 O;  4DR5 O;  1IBL O;  3R66 A;  4LF6 O;  2UXB O;  3M8A A;  1IBM O;  1XMQ O;  3J7A U;  1R6T A;  2DOS A;  1N33 O;  2UU9 O;  1IBK O;  4DR2 O;  1HNZ O;  4K0K O;  4DR4 O;  2VQF O;  1YZB A;  2JRI A;  4DV7 O;  2ZKO A;  4KHP O;  1D2D A;  1NS1 A;  4LF8 O;  4LFA O;  4A5U B;  1N36 O;  2Z0A A;  3OTO O;  4X65 O;  4YY3 O;  4DUY O;  2UUC O;  4JI8 O;  4JI3 O;  5IT9 N;  4JV5 O;  1HNW O;  5A2Q N;  4B3S O;  4DV4 O;  2LW7 A;  4JI1 O;  4LF7 O;  2HHH O;  1FJG O;  4LF9 O;  3F5T A;  1KUQ A;  2F4V O;  4JI2 O;  4LFB O;  4DR7 O;  4X64 O;  4B3T O;  4GKJ O;  1F7Y A;  4JI6 O;  4X66 O;  5H5N A;  3RT3 C;  4B3M O;  3J80 N;  4GKK O;  1A32 A;  4LF4 O;  4JI5 O;  5IWA O;  1HNX O;  1XEQ A;  2UUA O;  1XNQ O;  2N74 A;  4X62 O;  4DV1 O;  1G1X B;  1N34 O;  2UXC O;  1X59 A;  4DR6 O;  3JAM N;  4DV6 O;  4OPH A;  1N32 O;  4DV3 O;  2VQE O;  4DV0 O;  1XMO O;  4OPA A;  4DR3 O;  4OX9 O;  4YHH O;  3T1Y O;  4JI7 O;  2DJV A;  3O65 A;  2UUB O;  5BR8 O;  4LF5 O;  1FYJ A;  1XNR O;  4B3R O;  2AGA A;  4NXM O;  4DR1 O;  1AIL A;  4DV5 O;  5LL6 Y;  3J81 N;  5BXZ A;  1R1B A;  1FKA O;  5LMN O;  2E5L O;  4JI0 O;  5LMU O;  4JYA O;  2ZM6 O;  3SDL A;  5BY1 A;  4JI4 O;  4DUZ O;  1HR0 O;  2FKX A;  3T1H O;  1AB3 A;  2UXD O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...