4LFAO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfaO00
1FKAO 1DK1A 4B3SO 4DR1O 3O65A 5BR8O 1R1BA 5BY1A 4DV0O 5LMUO 4B3TO 5IT9N 3R66A 2FKXA 4JI2O 4JI7O 4X66O 1NS1A 4X62O 3SDLA 2HHHO 1XMOO 4DR3O 4DV3O 1F7YA 4JI6O 4GKJO 1AILA 4LFAO 1IBMO 2UU9O 5FLXN 5A2QN 1IBLO 4AQYO 4DUZO 4NXNO 2VQFO 5LL6Y 2UUCO 4LF5O 2UXCO 1HNXO 4GKKO 4JI8O 5IWAO 4DR2O 4B3RO 3RT3C 4DV6O 1HNZO 4OPAA 3J80N 1G1XB 3T1HO 4LFCO 4DV4O 2JRIA 3OTOO 1XNRO 1N32O 4YHHO 4JV5O 1IBKO 2DOSA 4DR4O 1HR0O 4DUYO 4LFBO 4JI4O 1N36O 1A32A 1N33O 3M8AA 4LF4O 1X59A 4X65O 4DR6O 1R6TA 4JI1O 1YZBA 5LMNO 1D2DA 1J5EO 4KHPO 4LF8O 2LW7A 4DR7O 1XEQA 2UUBO 4DV2O 4A5UB 4X64O 1HNWO 3JAMN 2F4VO 1KUQA 1FYJA 4JYAO 4LF7O 4LF9O 1XMQO 4NXMO 4LF6O 1XNQO 4JI5O 2ZM6O 2UXBO 3J7AU 5BXZA 2UXDO 4YY3O 4JI0O 1I94O 4DV7O 4DR5O 2AGAA 2VQEO 3F5TA 1N34O 4DV5O 5H5NA 2E5LO 4K0KO 1AB3A 2UUAO 4B3MO 4DV1O 2Z0AA 3J81N 2ZKOA 3T1YO 1FJGO 4OX9O 4JI3O 2DJVA 4OPHA 2N74A
chains in the Genus database with same CATH superfamily
5KHGA 4UFZA 1QU7A 2OCCB 3K79A 4YIPA 1R3LC 2ZDIA 3B40A 1PV0A 4RWUA 2ZR2A 1VF7A 1NS1A 3LDCA 2HHHO 2Q68A 4TWKA 4IHJB 3FB7C 3E8BA 3K9AA 5IJ0A 1LNQA 2KB1A 1BCCH 2ZE6A 3JALB 1H2MA 3JAWA 1IBKB 1S5HC 4IIJB 4NXNO 1SERA 1QLEB 3L71H 4JI8O 4E4EA 3SJAC 1H8EG 2ZNJA 4X65B 4LF8B 5BMVB 2AZ0A 1TUBB 4BAYA 5J9PC 1QNMA 2JRIA 2YIBA 5H6QA 4PD4F 2R9AA 1DF4A 1VQ7V 2UUBB 2PI4A 4QE9A 4LF7B 5BZBA 3JATB 3OAAG 5B1BB 4X66B 3VQVA 3GB7C 1N34B 1IURA 2P22C 1K73W 1KKCA 4CH5A 4FFBB 4LH6A 4F6RA 2Q67A 4UVCA 5H9CA 1BS3A 4YXWG 1FXKB 4DR7O 1XEQA 3AG1C 1W0KG 1THZA 3STLC 1FYJA 4DK0A 1S5LZ 2Y48A 5LMUB 2R9IA 2QTOA 4H44B 4TQFA 4YJ3A 5IYCO 3IJ4A 1FXHA 4J42A 4JI2B 4PDRA 4MVMA 4F6EA 2D3OW 3K59A 1XMOB 1GH6A 1GKFA 2Z0AA 4UVAA 2HG5C 3CP1A 3H1JH 3T4DA 2VQFB 2N74A 3P3PA 2F43G 3N2KA 2OWOA 2KQXA 2QE7G 5GTHZ 1JR9A 3A8TA 3ASOB 1OCOC 2EULA 1YJNV 4C7UA 1Q5OA 1XL4A 3HKEB 4Z1VA 4DV3O 4Z1MG 5IJ9A 4DXWA 2PTMA 3SPHA 4AQYO 3AG3C 4JAUA 3ZHSA 2Q4PA 2DWEC 4YJ2B 1QHTA 2YUAA 3J80N 5CN0A 3AG7A 3OGCC 3A0BZ 2RJZA 2ZE8A 3OTOO 3DC6A 4X88A 1HNWB 1XHXA 1XNRO 1XL6A 4JASA 2B1IA 5TISZ 4J7ZA 2QM8A 2EILB 5L3CA 3LNMB 1YZBA 1J5EO 3QVNA 2JGUA 1P4RA 3K06A 2R72A 4UB8Z 4FLZA 2HEPA 3N2GA 4CS3A 4TQDA 2QGNA 1KUQA 5BR8B 1Q7YW 4DV0B 1B06A 4O4LB 1YJWV 3ETQA 2Q7EA 1W2BU 1I94O 3F7VC 3BCCH 1NJIW 4DR5O 3OMIB 1HW7A 5KHJA 4MVOA 1NTKH 4WBNB 4DV1O 4WFHA 3E8HA 3MD0A 3TGUH 1ZAUA 1HNZB 3K0DA 2LFRA 3CXHF 1GMGA 5KA5A 5KAFZ 4EB6B 3ZRXA 4JI6O 2ZE5A 4UCVA 1IZ3A 4LFAO 4EKWA 4DUZO 4FZ0A 2B5UA 2D2CB 2UXCO 4I9WA 1NTZH 3HKBA 5EK0A 3I5DA 3JARA 2Q5ZA 3PJSK 4GT1A 1XREA 3CWBH 3DSQA 1K5QA 4UCRA 3H9VA 4I50B 2QWPB 4E2LA 4X64B 2LGQA 5EYPA 3SYOA 1IBKO 1VQLV 1PP9H 1Y74A 4JPRA 4N21A 4PA4A 5HFMA 1BE3H 3CRQA 3WG7C 3ZMTA 2VQEB 2HP8A 4X65O 1S72V 3H1LH 1NR1A 3N27A 3G6BA 1Q82W 4UV8A 2E5LB 4LF8O 3VQWA 1VEWA 2WLJA 1IX9A 3JAKA 1S0VA 4LNUA 2UUBO 3K03A 1BHBA 3ASNB 4X1YA 2H3OA 3FD9A 4NKGB 4HBNA 4LF7O 4I0XB 3LUTB 2EIJB 1S76D 2ZE7A 4MVZA 1Z5WA 2UXNA 1UPGA 5JVDB 4X62B 2Q69A 2OT5A 5KA6A 5FNVB 1N34O 1F51A 4U3JB 4ASUG 5CB4B 5CBFA 3CJHB 1K7DA 1DLBA 1KD1W 2CDYA 1L8DA 3T1CA 1YTFD 4PJ0Z 3CMAV 1G8MA 1QBZA 4QPKA 5EBMC 3MHSC 1R6NA 4ICGA 5LMUO 3ZMZA 1MOFA 4JI2O 4PA3A 1K33A 1GO3F 1XMOO 4RQFA 1V54C 3TETA 2L6LA 4H33A 4ZHQB 5KHKA 5B1BC 2LJ2A 4O2AB 2YSUB 2VQFO 2YDEA 1N0NA 1RM1C 1FFXA 1KC8W 4CC5A 4ZKIA 4X1KA 2AZ2A 2BE3A 2WPDG 5KAIZ 1FXKC 2IJIA 3AG1B 4JI1B 1HDJA 4PA6A 5LOVB 1XDCA 5F2VO 2A9HA 2BSKA 4WFGA 3K5NA 3FAVB 4JZ2A 4QIWF 1XMQB 1VF6A 2DMXA 1VP7A 1QR8A 1YXBA 3FKSG 5KLVH 1OHHG 1L0LH 4D6TH 3M8AA 4H0LB 2WLIB 3SYAA 4FK5C 2OTLV 1ZLZA 4CS2A 1UJWB 2GSMB 1E1RG 1NVPD 2LW7A 3JD0A 2A06H 2HJFC 3DC5A 5JH7A 4BW5A 1HNWO 4DR1B 4J7KA 3JD3A 2RCVA 5C93A 2OYQA 3P32A 3FYEB 3IC9A 1NI8A 4ZI7A 5EZYA 3F7YC 3CRAA 5DECA 2CH7A 3PN1A 1XUQA 1IBMB 1GM9A 1YSCA 1QVGU 3UO2A 2LFSA 1M5IA 2F1MA 3MAQA 1XQ8A 5BR8O 4DV0O 3ZJZA 1JPXA 4UVBA 2QA4V 3LDDA 2M6YA 4DV4B 1MA1A 3KKYA 1NH2D 1ZSPA 1EZVH 2F93B 5DN6G 4I9QA 2DW4A 1BZKA 5KX5A 4QPJA 5LA6B 1P49A 3E2EA 2P7TC 3OEHG 3L72H 4K3AA 1TVKB 4GX1A 5LP6B 1AJNA 3RN4A 2XAQA 2ITCC 4JI4B 3SJCC 3RT3C 2YEVA 2XASA 1ZUQA 1HNZO 5EIBD 2BTOA 4I55B 1O9GA 3HKDA 3UQ8A 1AP5A 1AI7A 1SQGA 2QM7A 3R65A 1KMIZ 1WB7A 2P4VA 3SPCA 5IE9A 4NXMB 4DRXB 4GX5A 3TJTA 1Q6UA 1H38A 2UXBB 1F23A 4DV7B 2YXLA 1AJPA 3AEIA 1L0NH 3L75H 4GYCB 1Z2GA 1R3JC 4G28B 3RVYA 1PNKA 5CA0B 4X64O 3JAWB 3RYCA 3ZRVA 3ML0A 3CCUV 1TAEA 1PPJH 4D7SA 5J2UB 1HP8A 4H37A 2VQEO 2K1EA 4TV8A 2E5LO 3ABKB 3ABMB 2ZKOA 3CCQV 1QQCA 5ITZA 4JYCA 5EBWC 2AHYA 3SPJA 1K8AW 1NBMG 2FMLA 1DGSA 3FB5C 2QWOB 1ZWIC 2CTPA 3RYFA 4X62O 2FTKA 4MT8A 3W7XA 2WLLB 4PI2A 4FM0A 1F7YA 1ZL8B 1B6QA 3AG4B 3BAAA 1EFRG 2IU3A 4JTDB 4NTYA 3U11A 2NNUA 5IYZA 1YI2V 2AXTZ 3ZRWB 5D5QA 1NQTA 2FL4A 1N36B 1VARA 4CH3A 5LMNB 3OR7C 4FFKA 4JTCB 5JCOA 4OXSA 1JJ2U 2X6CA 3ASNC 2ATKC 3JSLA 2HJDA 4KP4A 2EIJC 4O4JB 3JCZA 1JA8A 3RYIA 5JQGB 4UB6Z 2X6BA 2Q7HA 5LGNA 1XI1A 2WA4A 3U10A 2ZR3A 3APOA 1GTOA 1Q6IA 2IM9A 3NXSA 5KMGA 4W4KA 2DN9A 2UXDB 5JWPA 4JI0B 3D3QA 2E75B 4DYLA 3OUFA 1KB9F 4JI1O 3B4SA 1RPOA 5LHHA 2V7QG 1KP2A 1SQVH 4PHZA 2DWDC 3B8MA 3WB0A 1Q90D 5IJ9B 1PL0A 2GHYA 4B3SB 4WFFA 5KUMA 1XMQO 1V54B 2JK5C 4KL1A 2OTJV 3E35A 2H8PC 2ZNIA 1UFIA 4CZZA 2GTAA 1T5EA 1RM1B 2EBOA 2PUSA 2JS5A 4WCEV 1L1FA 4O2BA 3CB2A 1WPXA 5IDJA 1WN7A 2AW9A 4K8ZA 1HNXB 2LO1A 3CEIA 2P06A 1SQBH 2W0XA 3UO3A 1AI5A 3SJBC 4ZOLA 4DR1O 5C8YB 4DV6B 2Y4TA 3OW2U 1OCCC 2LW1A 3RGBA 1NT2B 5J2TA 4NTWA 5CA3A 2IJHA 2VRZA 1OJHA 3AG2B 2YS8A 1YVWA 3E8FA 1IBMO 3IC7A 3K5LA 3AK1A 1MZFA 3QO7A 5LL6Y 1M9NA 5IY5B 4U7NA 1M1KW 1SQQH 1GN3A 1LR1A 3I56V 1FD9A 2ZIMA 4TOIA 4X89A 3CCSV 2KG7A 1VQKV 4DV4O 3Q4HB 3STZC 4CBCA 4IIJA 3BA8A 1NU1H 2Q7GA 3OR6C 2HFEC 4FZ1A 1XNQB 1PNLA 1ZTEA 4KFMA 2P90A 3W7UA 3W7TA 4ZBMA 4D7TA 1Y76B 2QTSA 4JI4O 4WFBV 5D5PA 5BMVA 3RVZA 3VQYA 4HNAB 1R6TA 5A9GA 2P67A 5CBGA 5GONB 3EHBB 2DYRC 2E74B 1QCEA 2Z3YA 1KECA 4EFEA 1Z5VA 1WJZA 4NXMO 4QJFB 1GRJA 3HKCB 2RN9A 2YXHA 1YCIA 4TSFG 2UXBO 4JI7B 3CCVV 4X8AA 4CC6A 4FFBA 4DV7O 2N05A 3MHHC 1TUEB 1ORQC 3K58A 3AK3A 3ZMSA 2E3CA 5LP6C 4DR3B 1FXKA 2B9ZA 3H01A 1YF2A 4IT5A 3SJQC 3THOA 4IYHA 4L87A 3EFFK 2ITDC 4O4HB 3FB8C 3OTFA 5EC2C 1B3QA 5EYPB 1FKAO 1VQMV 4MSWC 1RSOA 4R8CA 3G67A 4Q6GA 1PNMA 2YIDA 1Q81W 1GN2A 4DV2B 1N32B 1AILA 4YHHB 3G4SV 2YI8A 2WA3A 1IBLO 3MDSA 1IVSA 1MABG 1HR0B 4DO2A 1RPRA 4DUYB 4MVRA 4UV9A 1AVMA 5K1PA 5B5EZ 3W7WA 4KHPB 3HKEA 1E1QG 3RW0A 4GCZA 4HYOA 4K8XA 4BIZA 3ZHTA 4AHCA 1P84F 2AHZA 3A2FA 4MW8A 2WSSG 2F4VB 3ETEA 4YJ2A 1JMKC 3T4ZA 4O4IA 4JF3A 2Y69C 2IJKA 4MTGA 4YY3B 1N0JA 3HR0A 4NVPA 1N36O 3ABKC 4G27B 3VQXA 3ABMC 1SQXH 1H2SB 4DV5B 5LMNO 1M93A 4JYBA 1Y4MA 3KG2A 2CGNA 4JYYA 2NR5A 2N04A 4B08A 4FVMA 1BL8A 2UXXA 1NTMH 1M4UA 4JGSA 2ODMA 2MW2B 3D8CA 4RUEA 3K04A 3JD4A 3WB2A 3OFNG 3AG4C 2R70A 3RYHA 2XNDG 2UXDO 4JI0O 4X20A 2GTSA 2LGWA 4GKJB 3CRCA 3D36A 2UU9B 3CE2A 3H1KH 3UM7A 5GW7A 1WA8B 4OPHA 2FYUH 2ZXWC 4LP8A 2Q73A 4B3SO 4B3RB 4J9ZB 2Q0OC 1K34A 3L9DA 2HR3A 4X66O 4WBNA 3SDLA 3M99B 2BOCC 2CTWA 1WNSA 3ZHVA 4FM2A 2IH3C 3SYQA 1QLNA 1WPBA 2Z5UA 3CYOA 2YIAA 1ENVA 2WLNA 2IH1C 2QSAA 1EN6A 1F4MA 1HNXO 2XAHA 2OCHA 3JASB 3TXSA 2EX3A 3C3SA 2B1GA 1VQ5V 4DR6B 4FLTA 4DV6O 4J7JA 1FS0G 3OT7A 3SPIA 1M57B 5E79Z 2BOBC 4PA9A 1M56B 4AI8A 2CH7B 3CCLV 1KKDA 4QE7A 1KYOF 2WAMA 5JJEB 1TGOA 4FMTA 4CS4A 5B3SB 4JI5B 1AJQA 1VQOV 1WAZA 3WFVA 3WU2Z 4I4TA 5CBHA 5L3GA 3ZIAG 1YITV 4I50A 5B1NA 2EIMB 3E22B 4JAAA 3T1YB 1FJGB 2JGDB 1I5YA 4GX0A 2IU0A 1OCCB 4CH6A 4JI8B 2QEXV 1XNQO 4B3TB 3AG2C 4JTAB 1FXVA 2HVKC 1OV9A 3EVKA 3E89A 2PGGA 1U97A 5IY5C 5LXTB 3OD4A 1AB3A 3K57A 3CHXA 5HFLA 4LWSB 5E1AC 5LYJB 3OMAB 4LF5B 2EJ7A 4WFEA 1XBLA 2LQTA 2GUZB 1ZX3A 5JVDA 3CRMA 5BY1A 4XDJA 3IFXA 3K5OA 2RQ6A 5FNVA 5IT9N 3T1HB 2FKXA 1SZXA 4DW0A 4U3JA 4JI7O 3CJHA 5B1AB 1NR7A 4DR3O 4J11A 2NN4A 2W0FC 1JFFB 2QKCA 4IL6Z 5GTIZ 3OGIB 1I5XA 3RYCB 2XOKG 2DYRB 1NZ6A 3IAYA 2Q0AA 4MS2A 1EN5A 5L3DA 2ILMA 1VQ4V 1Y66A 4ZHQA 2BTQA 4IGGA 4O2AA 3L73H 3ABLB 1N8RW 4JAVA 2F95B 2GBOA 3CPWU 1N32O 4YHHO 3CC4V 5LHIA 3FYIB 2EZPA 5DEDA 1HR0O 1PL4A 5LOVA 4DUYO 4MTXA 3VBBA 1COWG 1X59A 1VQ9V 3LSUA 1R3IC 1SETA 4KHPO 4B3MB 2V4DA 3BPZA 4WFAV 2PYJA 2VWJA 4GZRB 3HB3B 4J10A 1CXZB 2PY5A 4TV9A 2CUGA 2F4VO 2XAGA 4TUYA 2ETNA 2IW5A 1SZTA 4Q20A 3OEEG 3IGAC 5IYZB 2WLIA 1S3JA 3OE7G 1SKVA 4IYIA 4YIOA 4YY3O 1GM7A 4DV5O 1DF5A 3D3IA 4FPPA 2QDOA 3M7MX 3O9OA 3SR2C 1OCZB 3ZEDA 5IJ0B 3RYIB 3KCYA 5H2FZ 1IXMA 3TXQA 4DR2B 1AI4A 1AR4A 3CS5A 2FB5A 3GWOA 1P7BA 2P6JA 1GM8A 2ZT9B 3RFRA 2Y69B 2XAFA 4GKJO 3BRCA 3CCEV 2UU9O 1M90W 4GUNA 1CP9A 3DGEA 3JD2A 1K9MW 3ZN0A 4B3RO 3QTCA 2RMKB 3BY6A 1YJ9V 2A3QA 5LA6A 4FLXA 4B7KA 5LBQA 1XILA 4ABMA 3CCMV 4LCUC 3DXRA 4F6RB 4UCTA 1XOUA 3ZS8C 4JYAB 2KKWA 4LF6B 2WLKA 2DOSA 4MTOA 2ZM6B 3APQA 1MSDA 4ZOLB 1SQFA 3G6EV 2CGOA 2W6IG 4N23A 4X1IA 4RO2A 1IXBA 3C3TA 4YJ3B 4DR6O 5J2TB 2X6AA 1I08A 2G38A 2ZXWB 1Q43A 1VF6C 2PYLA 5L3EA 4GLXA 1E79G 1WP7A 4MVUA 1RFYA 4UCOA 4FLVA 3B8NA 3N2KB 4JI5O 4LH7A 2CAZC 3LSQA 3ZMUA 3UT5A 1JJOA 4UCSA 3K9SA 1SESA 2YICA 1SRYA 5H5NA 1N4CA 2KG7B 5CA0A 1GAXA 2DE0X 3H1IH 2Q6AA 4B7EA 3T1YO 1FJGO 2DJVA 1JOYA 2ZIOA 5J2UA 1M57C 1S77D 5CA1A 1M56C 2WWWA 3CRRA 4OGQB 4MTFA 4B3TO 1SA0A 4K35A 2F23A 5L3BA 5B3SC 1I0HA 1SQPH 1G4YB 2ZINA 2X0LA 3P3NA 5A2QN 1BHAA 2W6JG 2Y0IA 1OCRB 4LF5O 4LFBB 2EIMC 2QKAA 1VQ6V 1N33B 1CEZA 2EIKB 4H13B 1Q3EA 1FPOA 2WLLA 1Y6XA 4FLUA 3ZMVA 3T1HO 1ZL8A 2ZQMA 1BMFG 1TA8A 4PDMA 3DTUB 1V55B 2OIGA 3ICXA 3G71V 1NKDA 3QNEA 1K92A 3ZRWA 5EC1C 4XBFA 2WLHA 1VQPV 3N2GB 3OMNB 1LUWA 4J41A 1AR1B 2NLJC 4KXRA 2QR4A 1AI6A 3ZHQA 4IHJA 4O4JA 4R6ZA 1RSOB 4J9YB 3JALA 1QVFU 5JQGA 2GDSA 4LBEC 2QWRB 3ZHRA 1EBOA 2ARHA 5B1AC 2ZCEA 5BXZA 1YEWA 3L70H 1TUBA 1S5JA 1EN4A 3UCSC 4X9QA 3H1HH 4B3MO 4R7CA 5FPOA 4WF9V 4XDKA 5KHHA 2UUCB 1VMGA 3JATA 2Y4UA 1BGYH 1DK1A 4O4IB 1WLEA 3GVMA 4U7OA 3HKBB 3ABLC 3AK2A 3BVOA 4LFCB 4PA7A 1VQ8V 4EFBA 2BCCH 4EEQA 1U96A 1Y67A 2K9PA 3JARB 2XTAA 4QGPA 4Z2WA 1DTOA 3NR7A 3QO5A 3K0GA 4GX2A 5EBLC 5FLXN 3ETGA 5C8YA 2QM4A 1K4DC 1MSWD 1R3KC 4DR2O 1URFA 1Y74B 2EINB 3RYHB 3RWRD 4UCUA 4X20B 2M7WA 4UXNA 2ZDIC 5KUKA 3JAKB 3FB6C 4LNUB 4P30A 5JCOC 2V1DA 2XHBA 4X1YB 3X2QB 1OCZC 1GK9A 3JCUZ 2DYSB 1O9HA 3TK1A 3ABTA 3Q4HA 2ADQB 3LDEA 1EZJA 2UUAB 1AROP 4OX9B 4JI3B 2ZD9A 3K3WA 1EM1A 1SS3A 1PKXA 1PM9A 3SYCA 3JAMN 1Y76A 4JYAO 4P2ZA 3EXAA 4LF6O 4ZIBA 4HNAA 1X4TA 2ZM6O 3OUSA 4BWAA 5GONA 4P9PA 1BQ0A 5K1XA 3OM3B 4PDVA 3CXCU 3SYPA 2Q9LA 3CMEV 3HKCA 4PI0A 4GKKB 4HZ3A 1JQ0A 5IWAB 2RDCA 5EIBC 1FFXB 3QG5A 3R66A 4NYKA 4X1KB 3VOUA 4I4TB 1WP8A 2YC0A 2HKOA 3KZIZ 4TT3G 2JEUA 1F4NA 3WB1A 4O4HA 2HLDG 2BSKB 1BT8A 4JV5B 3K5MA 4DR4B 1QR9A 4O4LA 3E8GA 2YI9A 4LF4B 2XAJA 1G1XB 4FLWA 4NR1A 1GN4A 4LC1A 1D5AA 1K4CC 2OCCC 5FPRA 3FFQA 2CTQA 1IDSA 2ADPA 4LF9B 4JZGA 5JH7B 4LFBO 1N33O 1YDXA 5IYDO 3ZRSA 4EB6A 2YXYA 1D2DA 1JCHA 2MK3A 2EZOA 4BR6A 4K0KB 1QLEC 4ZI7B 5EZYB 1K97A 3ZBHA 2A0LA 1XHZA 3BABA 3ZN1A 5FL7G 3B2EE 1US6A 3QO8A 1I7FA 3G80A 3BFRA 1MZEA 2VS0A 3HPLC 1PD3A 3A0RA 3CC7V 2VWKA 1R73A 3ABUA 3J7AU 4R50A 1H2LA 3TCUA 4J80A 1MG1A 3CSXA 2HHHB 3ZCCA 5LHGA 3T2MA 3ZHUA 2PZSA 1OCRC 1B04A 3RBZA 2F66C 2BTQB 2EIKC 4I7ZB 4LR3A 3J81N 4NXNB 5KX5B 2CTRA 4MVSA 3SPGA 3O65A 1R1BA 2DQ3A 1V55C 4FM1A 2PI5A 1K3EA 2YEVB 1JVMA 3HKDB 1WA8A 1Q8IA 1YHQV 2LP7A 4I0XA 2UUCO 1JX9A 1SC5B 4TV9B 2QJ1A 1BSMA 3BHPA 4TUYB 1YTFB 5CB4A 4LFCO 1G6UA 4DR7B 3BA9A 4HAMA 1OCOB 3ASOC 1WB8A 1R6KA 3LNNA 5KHIA 4CH4A 2O57A 3JASA 3A0HZ 3ETDA 1FFTB 4XDLA 1A32A 2JEXA 5AG2A 1AR5A 4FLYA 3AG3B 4BIOA 1D5NA 4UUJC 5IYBO 3JYCA 4RQEA 1GN6A 5LGUA 2Q8VA 2JJ1G 2E76B 4TV8B 4BW9A 1H2KA 4MW3A 4DV2O 4A5UB 2JIZG 2IBZH 3GWKC 4P9OA 1RP3B 3CC2V 5ITZB 2RNBA 2HVJC 4FIPC 1HWYA 1MMMA 5LGTA 1KQSU 2QWQB 3E83A 1LUVA 3E22A 2AGAA 2CK3G 2Y0PA 3L74H 3F5TA 2JGDA 3CX5F 4DV3B 3RYFB 3BEHA 3FAVA 2YIBD 5JJNB 2JDIG 3JD1A 2EILC 3E86A 1OZ0A 2JJ2G 2UUAO 4AQYB 2P5OA 2A7WA 5JJJB 4OX9O 1NVPB 4JI3O 4L8JA 3DXRB 3LSSA 2EINC 5B66Z 1KU9A 3C90A 3W7SA 4QNHB 3D36C 3B09A 5LXTA 2QWNB 4X1IB 2L35A 4RUFA 4LWSA 4NB5A 2H94A 1Q6HA 3OTOB 5LYJA 3X2QC 1W0JG 1XNRB 3CD6V 2A79B 2QKSA 5H6RA 2GUZA 2DYSC 2KSDA 4AILC 2C2AA 4GKKO 5IWAO 1MNGA 1KBHA 3QF7A 5KMGB 4OPAA 1J5EB 3I55V 1CPYA 2WLMA 4PV1B 2GV9A 3JSNA 3UT5B 1JFFA 4MVQA 3KCXA 3CCRV 1BQZA 4G2KA 1NH2B 3SGIA 3UKMA 4NTXA 1VIBA 3S3XA 4JV5O 1KP3A 2OIEA 1V9PA 5L3FA 1K5SA 3S3WA 1H2NA 4DR4O 2R9RB 1I94B 5CA1B 1J95A 3P30A 4DR5B 4LF4O 5B1OA 4I5SA 3ZX6A 2XUMA 1SA0B 2XT9A 4BIUA 4DV1B 4RAIA 1IBLB 4DW1A 4O2BB 1TVKA 5LP6A 1AP6A 5CMUA 2CE4A 3U0ZA 1YIJV 4LF9O 3FX7A 2DQ0A 4PDLA 4W4LA 3K08A 4I55A 1P7GA 4DK1A 3CCJV 1H8HG 1ROPA 3B77A 1W59A 2JS3A 2X7RB 1VQNV 1VF5B 4JI6B 2IJJA 4U3FH 2JVDA 4LFAB 4K0KO 3WG7B 2PF4E 4KUMA 2EJRA 4FJCC 5DM6V 4DUZB 1H2GA 4DRXA 1FAFA 4F4LA 2UXCB 4PELA 2P4KA 1SF9A 3F5WC 1Q86W
chains in the Genus database with same CATH topology
1FKAO 1DK1A 4B3SO 4DR1O 3O65A 5BR8O 1R1BA 5BY1A 4DV0O 5LMUO 4B3TO 5IT9N 3R66A 2FKXA 4JI2O 4JI7O 4X66O 1NS1A 4X62O 3SDLA 2HHHO 1XMOO 4DR3O 4DV3O 1F7YA 4JI6O 4GKJO 1AILA 4LFAO 1IBMO 2UU9O 5FLXN 5A2QN 1IBLO 4AQYO 4DUZO 4NXNO 2VQFO 5LL6Y 2UUCO 4LF5O 2UXCO 1HNXO 4GKKO 4JI8O 5IWAO 4DR2O 4B3RO 3RT3C 4DV6O 1HNZO 4OPAA 3J80N 1G1XB 3T1HO 4LFCO 4DV4O 2JRIA 3OTOO 1XNRO 1N32O 4YHHO 4JV5O 1IBKO 2DOSA 4DR4O 1HR0O 4DUYO 4LFBO 4JI4O 1N36O 1A32A 1N33O 3M8AA 4LF4O 1X59A 4X65O 4DR6O 1R6TA 4JI1O 1YZBA 5LMNO 1D2DA 1J5EO 4KHPO 4LF8O 2LW7A 4DR7O 1XEQA 2UUBO 4DV2O 4A5UB 4X64O 1HNWO 3JAMN 2F4VO 1KUQA 1FYJA 4JYAO 4LF7O 4LF9O 1XMQO 4NXMO 4LF6O 1XNQO 4JI5O 2ZM6O 2UXBO 3J7AU 5BXZA 2UXDO 4YY3O 4JI0O 1I94O 4DV7O 4DR5O 2AGAA 2VQEO 3F5TA 1N34O 4DV5O 5H5NA 2E5LO 4K0KO 1AB3A 2UUAO 4B3MO 4DV1O 2Z0AA 3J81N 2ZKOA 3T1YO 1FJGO 4OX9O 4JI3O 2DJVA 4OPHA 2N74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA O;  1DK1 A;  4B3S O;  4DR1 O;  3O65 A;  5BR8 O;  1R1B A;  5BY1 A;  4DV0 O;  5LMU O;  4B3T O;  5IT9 N;  3R66 A;  2FKX A;  4JI2 O;  4JI7 O;  4X66 O;  1NS1 A;  4X62 O;  3SDL A;  2HHH O;  1XMO O;  4DR3 O;  4DV3 O;  1F7Y A;  4JI6 O;  4GKJ O;  1AIL A;  4LFA O;  1IBM O;  2UU9 O;  5FLX N;  5A2Q N;  1IBL O;  4AQY O;  4DUZ O;  4NXN O;  2VQF O;  5LL6 Y;  2UUC O;  4LF5 O;  2UXC O;  1HNX O;  4GKK O;  4JI8 O;  5IWA O;  4DR2 O;  4B3R O;  3RT3 C;  4DV6 O;  1HNZ O;  4OPA A;  3J80 N;  1G1X B;  3T1H O;  4LFC O;  4DV4 O;  2JRI A;  3OTO O;  1XNR O;  1N32 O;  4YHH O;  4JV5 O;  1IBK O;  2DOS A;  4DR4 O;  1HR0 O;  4DUY O;  4LFB O;  4JI4 O;  1N36 O;  1A32 A;  1N33 O;  3M8A A;  4LF4 O;  1X59 A;  4X65 O;  4DR6 O;  1R6T A;  4JI1 O;  1YZB A;  5LMN O;  1D2D A;  1J5E O;  4KHP O;  4LF8 O;  2LW7 A;  4DR7 O;  1XEQ A;  2UUB O;  4DV2 O;  4A5U B;  4X64 O;  1HNW O;  3JAM N;  2F4V O;  1KUQ A;  1FYJ A;  4JYA O;  4LF7 O;  4LF9 O;  1XMQ O;  4NXM O;  4LF6 O;  1XNQ O;  4JI5 O;  2ZM6 O;  2UXB O;  3J7A U;  5BXZ A;  2UXD O;  4YY3 O;  4JI0 O;  1I94 O;  4DV7 O;  4DR5 O;  2AGA A;  2VQE O;  3F5T A;  1N34 O;  4DV5 O;  5H5N A;  2E5L O;  4K0K O;  1AB3 A;  2UUA O;  4B3M O;  4DV1 O;  2Z0A A;  3J81 N;  2ZKO A;  3T1Y O;  1FJG O;  4OX9 O;  4JI3 O;  2DJV A;  4OPH A;  2N74 A; 
#chains in the Genus database with same CATH topology
 5KHG A;  4UFZ A;  1QU7 A;  2OCC B;  3K79 A;  4YIP A;  1R3L C;  2ZDI A;  3B40 A;  1PV0 A;  4RWU A;  2ZR2 A;  1VF7 A;  1NS1 A;  3LDC A;  2HHH O;  2Q68 A;  4TWK A;  4IHJ B;  3FB7 C;  3E8B A;  3K9A A;  5IJ0 A;  1LNQ A;  2KB1 A;  1BCC H;  2ZE6 A;  3JAL B;  1H2M A;  3JAW A;  1IBK B;  1S5H C;  4IIJ B;  4NXN O;  1SER A;  1QLE B;  3L71 H;  4JI8 O;  4E4E A;  3SJA C;  1H8E G;  2ZNJ A;  4X65 B;  4LF8 B;  5BMV B;  2AZ0 A;  1TUB B;  4BAY A;  5J9P C;  1QNM A;  2JRI A;  2YIB A;  5H6Q A;  4PD4 F;  2R9A A;  1DF4 A;  1VQ7 V;  2UUB B;  2PI4 A;  4QE9 A;  4LF7 B;  5BZB A;  3JAT B;  3OAA G;  5B1B B;  4X66 B;  3VQV A;  3GB7 C;  1N34 B;  1IUR A;  2P22 C;  1K73 W;  1KKC A;  4CH5 A;  4FFB B;  4LH6 A;  4F6R A;  2Q67 A;  4UVC A;  5H9C A;  1BS3 A;  4YXW G;  1FXK B;  4DR7 O;  1XEQ A;  3AG1 C;  1W0K G;  1THZ A;  3STL C;  1FYJ A;  4DK0 A;  1S5L Z;  2Y48 A;  5LMU B;  2R9I A;  2QTO A;  4H44 B;  4TQF A;  4YJ3 A;  5IYC O;  3IJ4 A;  1FXH A;  4J42 A;  4JI2 B;  4PDR A;  4MVM A;  4F6E A;  2D3O W;  3K59 A;  1XMO B;  1GH6 A;  1GKF A;  2Z0A A;  4UVA A;  2HG5 C;  3CP1 A;  3H1J H;  3T4D A;  2VQF B;  2N74 A;  3P3P A;  2F43 G;  3N2K A;  2OWO A;  2KQX A;  2QE7 G;  5GTH Z;  1JR9 A;  3A8T A;  3ASO B;  1OCO C;  2EUL A;  1YJN V;  4C7U A;  1Q5O A;  1XL4 A;  3HKE B;  4Z1V A;  4DV3 O;  4Z1M G;  5IJ9 A;  4DXW A;  2PTM A;  3SPH A;  4AQY O;  3AG3 C;  4JAU A;  3ZHS A;  2Q4P A;  2DWE C;  4YJ2 B;  1QHT A;  2YUA A;  3J80 N;  5CN0 A;  3AG7 A;  3OGC C;  3A0B Z;  2RJZ A;  2ZE8 A;  3OTO O;  3DC6 A;  4X88 A;  1HNW B;  1XHX A;  1XNR O;  1XL6 A;  4JAS A;  2B1I A;  5TIS Z;  4J7Z A;  2QM8 A;  2EIL B;  5L3C A;  3LNM B;  1YZB A;  1J5E O;  3QVN A;  2JGU A;  1P4R A;  3K06 A;  2R72 A;  4UB8 Z;  4FLZ A;  2HEP A;  3N2G A;  4CS3 A;  4TQD A;  2QGN A;  1KUQ A;  5BR8 B;  1Q7Y W;  4DV0 B;  1B06 A;  4O4L B;  1YJW V;  3ETQ A;  2Q7E A;  1W2B U;  1I94 O;  3F7V C;  3BCC H;  1NJI W;  4DR5 O;  3OMI B;  1HW7 A;  5KHJ A;  4MVO A;  1NTK H;  4WBN B;  4DV1 O;  4WFH A;  3E8H A;  3MD0 A;  3TGU H;  1ZAU A;  1HNZ B;  3K0D A;  2LFR A;  3CXH F;  1GMG A;  5KA5 A;  5KAF Z;  4EB6 B;  3ZRX A;  4JI6 O;  2ZE5 A;  4UCV A;  1IZ3 A;  4LFA O;  4EKW A;  4DUZ O;  4FZ0 A;  2B5U A;  2D2C B;  2UXC O;  4I9W A;  1NTZ H;  3HKB A;  5EK0 A;  3I5D A;  3JAR A;  2Q5Z A;  3PJS K;  4GT1 A;  1XRE A;  3CWB H;  3DSQ A;  1K5Q A;  4UCR A;  3H9V A;  4I50 B;  2QWP B;  4E2L A;  4X64 B;  2LGQ A;  5EYP A;  3SYO A;  1IBK O;  1VQL V;  1PP9 H;  1Y74 A;  4JPR A;  4N21 A;  4PA4 A;  5HFM A;  1BE3 H;  3CRQ A;  3WG7 C;  3ZMT A;  2VQE B;  2HP8 A;  4X65 O;  1S72 V;  3H1L H;  1NR1 A;  3N27 A;  3G6B A;  1Q82 W;  4UV8 A;  2E5L B;  4LF8 O;  3VQW A;  1VEW A;  2WLJ A;  1IX9 A;  3JAK A;  1S0V A;  4LNU A;  2UUB O;  3K03 A;  1BHB A;  3ASN B;  4X1Y A;  2H3O A;  3FD9 A;  4NKG B;  4HBN A;  4LF7 O;  4I0X B;  3LUT B;  2EIJ B;  1S76 D;  2ZE7 A;  4MVZ A;  1Z5W A;  2UXN A;  1UPG A;  5JVD B;  4X62 B;  2Q69 A;  2OT5 A;  5KA6 A;  5FNV B;  1N34 O;  1F51 A;  4U3J B;  4ASU G;  5CB4 B;  5CBF A;  3CJH B;  1K7D A;  1DLB A;  1KD1 W;  2CDY A;  1L8D A;  3T1C A;  1YTF D;  4PJ0 Z;  3CMA V;  1G8M A;  1QBZ A;  4QPK A;  5EBM C;  3MHS C;  1R6N A;  4ICG A;  5LMU O;  3ZMZ A;  1MOF A;  4JI2 O;  4PA3 A;  1K33 A;  1GO3 F;  1XMO O;  4RQF A;  1V54 C;  3TET A;  2L6L A;  4H33 A;  4ZHQ B;  5KHK A;  5B1B C;  2LJ2 A;  4O2A B;  2YSU B;  2VQF O;  2YDE A;  1N0N A;  1RM1 C;  1FFX A;  1KC8 W;  4CC5 A;  4ZKI A;  4X1K A;  2AZ2 A;  2BE3 A;  2WPD G;  5KAI Z;  1FXK C;  2IJI A;  3AG1 B;  4JI1 B;  1HDJ A;  4PA6 A;  5LOV B;  1XDC A;  5F2V O;  2A9H A;  2BSK A;  4WFG A;  3K5N A;  3FAV B;  4JZ2 A;  4QIW F;  1XMQ B;  1VF6 A;  2DMX A;  1VP7 A;  1QR8 A;  1YXB A;  3FKS G;  5KLV H;  1OHH G;  1L0L H;  4D6T H;  3M8A A;  4H0L B;  2WLI B;  3SYA A;  4FK5 C;  2OTL V;  1ZLZ A;  4CS2 A;  1UJW B;  2GSM B;  1E1R G;  1NVP D;  2LW7 A;  3JD0 A;  2A06 H;  2HJF C;  3DC5 A;  5JH7 A;  4BW5 A;  1HNW O;  4DR1 B;  4J7K A;  3JD3 A;  2RCV A;  5C93 A;  2OYQ A;  3P32 A;  3FYE B;  3IC9 A;  1NI8 A;  4ZI7 A;  5EZY A;  3F7Y C;  3CRA A;  5DEC A;  2CH7 A;  3PN1 A;  1XUQ A;  1IBM B;  1GM9 A;  1YSC A;  1QVG U;  3UO2 A;  2LFS A;  1M5I A;  2F1M A;  3MAQ A;  1XQ8 A;  5BR8 O;  4DV0 O;  3ZJZ A;  1JPX A;  4UVB A;  2QA4 V;  3LDD A;  2M6Y A;  4DV4 B;  1MA1 A;  3KKY A;  1NH2 D;  1ZSP A;  1EZV H;  2F93 B;  5DN6 G;  4I9Q A;  2DW4 A;  1BZK A;  5KX5 A;  4QPJ A;  5LA6 B;  1P49 A;  3E2E A;  2P7T C;  3OEH G;  3L72 H;  4K3A A;  1TVK B;  4GX1 A;  5LP6 B;  1AJN A;  3RN4 A;  2XAQ A;  2ITC C;  4JI4 B;  3SJC C;  3RT3 C;  2YEV A;  2XAS A;  1ZUQ A;  1HNZ O;  5EIB D;  2BTO A;  4I55 B;  1O9G A;  3HKD A;  3UQ8 A;  1AP5 A;  1AI7 A;  1SQG A;  2QM7 A;  3R65 A;  1KMI Z;  1WB7 A;  2P4V A;  3SPC A;  5IE9 A;  4NXM B;  4DRX B;  4GX5 A;  3TJT A;  1Q6U A;  1H38 A;  2UXB B;  1F23 A;  4DV7 B;  2YXL A;  1AJP A;  3AEI A;  1L0N H;  3L75 H;  4GYC B;  1Z2G A;  1R3J C;  4G28 B;  3RVY A;  1PNK A;  5CA0 B;  4X64 O;  3JAW B;  3RYC A;  3ZRV A;  3ML0 A;  3CCU V;  1TAE A;  1PPJ H;  4D7S A;  5J2U B;  1HP8 A;  4H37 A;  2VQE O;  2K1E A;  4TV8 A;  2E5L O;  3ABK B;  3ABM B;  2ZKO A;  3CCQ V;  1QQC A;  5ITZ A;  4JYC A;  5EBW C;  2AHY A;  3SPJ A;  1K8A W;  1NBM G;  2FML A;  1DGS A;  3FB5 C;  2QWO B;  1ZWI C;  2CTP A;  3RYF A;  4X62 O;  2FTK A;  4MT8 A;  3W7X A;  2WLL B;  4PI2 A;  4FM0 A;  1F7Y A;  1ZL8 B;  1B6Q A;  3AG4 B;  3BAA A;  1EFR G;  2IU3 A;  4JTD B;  4NTY A;  3U11 A;  2NNU A;  5IYZ A;  1YI2 V;  2AXT Z;  3ZRW B;  5D5Q A;  1NQT A;  2FL4 A;  1N36 B;  1VAR A;  4CH3 A;  5LMN B;  3OR7 C;  4FFK A;  4JTC B;  5JCO A;  4OXS A;  1JJ2 U;  2X6C A;  3ASN C;  2ATK C;  3JSL A;  2HJD A;  4KP4 A;  2EIJ C;  4O4J B;  3JCZ A;  1JA8 A;  3RYI A;  5JQG B;  4UB6 Z;  2X6B A;  2Q7H A;  5LGN A;  1XI1 A;  2WA4 A;  3U10 A;  2ZR3 A;  3APO A;  1GTO A;  1Q6I A;  2IM9 A;  3NXS A;  5KMG A;  4W4K A;  2DN9 A;  2UXD B;  5JWP A;  4JI0 B;  3D3Q A;  2E75 B;  4DYL A;  3OUF A;  1KB9 F;  4JI1 O;  3B4S A;  1RPO A;  5LHH A;  2V7Q G;  1KP2 A;  1SQV H;  4PHZ A;  2DWD C;  3B8M A;  3WB0 A;  1Q90 D;  5IJ9 B;  1PL0 A;  2GHY A;  4B3S B;  4WFF A;  5KUM A;  1XMQ O;  1V54 B;  2JK5 C;  4KL1 A;  2OTJ V;  3E35 A;  2H8P C;  2ZNI A;  1UFI A;  4CZZ A;  2GTA A;  1T5E A;  1RM1 B;  2EBO A;  2PUS A;  2JS5 A;  4WCE V;  1L1F A;  4O2B A;  3CB2 A;  1WPX A;  5IDJ A;  1WN7 A;  2AW9 A;  4K8Z A;  1HNX B;  2LO1 A;  3CEI A;  2P06 A;  1SQB H;  2W0X A;  3UO3 A;  1AI5 A;  3SJB C;  4ZOL A;  4DR1 O;  5C8Y B;  4DV6 B;  2Y4T A;  3OW2 U;  1OCC C;  2LW1 A;  3RGB A;  1NT2 B;  5J2T A;  4NTW A;  5CA3 A;  2IJH A;  2VRZ A;  1OJH A;  3AG2 B;  2YS8 A;  1YVW A;  3E8F A;  1IBM O;  3IC7 A;  3K5L A;  3AK1 A;  1MZF A;  3QO7 A;  5LL6 Y;  1M9N A;  5IY5 B;  4U7N A;  1M1K W;  1SQQ H;  1GN3 A;  1LR1 A;  3I56 V;  1FD9 A;  2ZIM A;  4TOI A;  4X89 A;  3CCS V;  2KG7 A;  1VQK V;  4DV4 O;  3Q4H B;  3STZ C;  4CBC A;  4IIJ A;  3BA8 A;  1NU1 H;  2Q7G A;  3OR6 C;  2HFE C;  4FZ1 A;  1XNQ B;  1PNL A;  1ZTE A;  4KFM A;  2P90 A;  3W7U A;  3W7T A;  4ZBM A;  4D7T A;  1Y76 B;  2QTS A;  4JI4 O;  4WFB V;  5D5P A;  5BMV A;  3RVZ A;  3VQY A;  4HNA B;  1R6T A;  5A9G A;  2P67 A;  5CBG A;  5GON B;  3EHB B;  2DYR C;  2E74 B;  1QCE A;  2Z3Y A;  1KEC A;  4EFE A;  1Z5V A;  1WJZ A;  4NXM O;  4QJF B;  1GRJ A;  3HKC B;  2RN9 A;  2YXH A;  1YCI A;  4TSF G;  2UXB O;  4JI7 B;  3CCV V;  4X8A A;  4CC6 A;  4FFB A;  4DV7 O;  2N05 A;  3MHH C;  1TUE B;  1ORQ C;  3K58 A;  3AK3 A;  3ZMS A;  2E3C A;  5LP6 C;  4DR3 B;  1FXK A;  2B9Z A;  3H01 A;  1YF2 A;  4IT5 A;  3SJQ C;  3THO A;  4IYH A;  4L87 A;  3EFF K;  2ITD C;  4O4H B;  3FB8 C;  3OTF A;  5EC2 C;  1B3Q A;  5EYP B;  1FKA O;  1VQM V;  4MSW C;  1RSO A;  4R8C A;  3G67 A;  4Q6G A;  1PNM A;  2YID A;  1Q81 W;  1GN2 A;  4DV2 B;  1N32 B;  1AIL A;  4YHH B;  3G4S V;  2YI8 A;  2WA3 A;  1IBL O;  3MDS A;  1IVS A;  1MAB G;  1HR0 B;  4DO2 A;  1RPR A;  4DUY B;  4MVR A;  4UV9 A;  1AVM A;  5K1P A;  5B5E Z;  3W7W A;  4KHP B;  3HKE A;  1E1Q G;  3RW0 A;  4GCZ A;  4HYO A;  4K8X A;  4BIZ A;  3ZHT A;  4AHC A;  1P84 F;  2AHZ A;  3A2F A;  4MW8 A;  2WSS G;  2F4V B;  3ETE A;  4YJ2 A;  1JMK C;  3T4Z A;  4O4I A;  4JF3 A;  2Y69 C;  2IJK A;  4MTG A;  4YY3 B;  1N0J A;  3HR0 A;  4NVP A;  1N36 O;  3ABK C;  4G27 B;  3VQX A;  3ABM C;  1SQX H;  1H2S B;  4DV5 B;  5LMN O;  1M93 A;  4JYB A;  1Y4M A;  3KG2 A;  2CGN A;  4JYY A;  2NR5 A;  2N04 A;  4B08 A;  4FVM A;  1BL8 A;  2UXX A;  1NTM H;  1M4U A;  4JGS A;  2ODM A;  2MW2 B;  3D8C A;  4RUE A;  3K04 A;  3JD4 A;  3WB2 A;  3OFN G;  3AG4 C;  2R70 A;  3RYH A;  2XND G;  2UXD O;  4JI0 O;  4X20 A;  2GTS A;  2LGW A;  4GKJ B;  3CRC A;  3D36 A;  2UU9 B;  3CE2 A;  3H1K H;  3UM7 A;  5GW7 A;  1WA8 B;  4OPH A;  2FYU H;  2ZXW C;  4LP8 A;  2Q73 A;  4B3S O;  4B3R B;  4J9Z B;  2Q0O C;  1K34 A;  3L9D A;  2HR3 A;  4X66 O;  4WBN A;  3SDL A;  3M99 B;  2BOC C;  2CTW A;  1WNS A;  3ZHV A;  4FM2 A;  2IH3 C;  3SYQ A;  1QLN A;  1WPB A;  2Z5U A;  3CYO A;  2YIA A;  1ENV A;  2WLN A;  2IH1 C;  2QSA A;  1EN6 A;  1F4M A;  1HNX O;  2XAH A;  2OCH A;  3JAS B;  3TXS A;  2EX3 A;  3C3S A;  2B1G A;  1VQ5 V;  4DR6 B;  4FLT A;  4DV6 O;  4J7J A;  1FS0 G;  3OT7 A;  3SPI A;  1M57 B;  5E79 Z;  2BOB C;  4PA9 A;  1M56 B;  4AI8 A;  2CH7 B;  3CCL V;  1KKD A;  4QE7 A;  1KYO F;  2WAM A;  5JJE B;  1TGO A;  4FMT A;  4CS4 A;  5B3S B;  4JI5 B;  1AJQ A;  1VQO V;  1WAZ A;  3WFV A;  3WU2 Z;  4I4T A;  5CBH A;  5L3G A;  3ZIA G;  1YIT V;  4I50 A;  5B1N A;  2EIM B;  3E22 B;  4JAA A;  3T1Y B;  1FJG B;  2JGD B;  1I5Y A;  4GX0 A;  2IU0 A;  1OCC B;  4CH6 A;  4JI8 B;  2QEX V;  1XNQ O;  4B3T B;  3AG2 C;  4JTA B;  1FXV A;  2HVK C;  1OV9 A;  3EVK A;  3E89 A;  2PGG A;  1U97 A;  5IY5 C;  5LXT B;  3OD4 A;  1AB3 A;  3K57 A;  3CHX A;  5HFL A;  4LWS B;  5E1A C;  5LYJ B;  3OMA B;  4LF5 B;  2EJ7 A;  4WFE A;  1XBL A;  2LQT A;  2GUZ B;  1ZX3 A;  5JVD A;  3CRM A;  5BY1 A;  4XDJ A;  3IFX A;  3K5O A;  2RQ6 A;  5FNV A;  5IT9 N;  3T1H B;  2FKX A;  1SZX A;  4DW0 A;  4U3J A;  4JI7 O;  3CJH A;  5B1A B;  1NR7 A;  4DR3 O;  4J11 A;  2NN4 A;  2W0F C;  1JFF B;  2QKC A;  4IL6 Z;  5GTI Z;  3OGI B;  1I5X A;  3RYC B;  2XOK G;  2DYR B;  1NZ6 A;  3IAY A;  2Q0A A;  4MS2 A;  1EN5 A;  5L3D A;  2ILM A;  1VQ4 V;  1Y66 A;  4ZHQ A;  2BTQ A;  4IGG A;  4O2A A;  3L73 H;  3ABL B;  1N8R W;  4JAV A;  2F95 B;  2GBO A;  3CPW U;  1N32 O;  4YHH O;  3CC4 V;  5LHI A;  3FYI B;  2EZP A;  5DED A;  1HR0 O;  1PL4 A;  5LOV A;  4DUY O;  4MTX A;  3VBB A;  1COW G;  1X59 A;  1VQ9 V;  3LSU A;  1R3I C;  1SET A;  4KHP O;  4B3M B;  2V4D A;  3BPZ A;  4WFA V;  2PYJ A;  2VWJ A;  4GZR B;  3HB3 B;  4J10 A;  1CXZ B;  2PY5 A;  4TV9 A;  2CUG A;  2F4V O;  2XAG A;  4TUY A;  2ETN A;  2IW5 A;  1SZT A;  4Q20 A;  3OEE G;  3IGA C;  5IYZ B;  2WLI A;  1S3J A;  3OE7 G;  1SKV A;  4IYI A;  4YIO A;  4YY3 O;  1GM7 A;  4DV5 O;  1DF5 A;  3D3I A;  4FPP A;  2QDO A;  3M7M X;  3O9O A;  3SR2 C;  1OCZ B;  3ZED A;  5IJ0 B;  3RYI B;  3KCY A;  5H2F Z;  1IXM A;  3TXQ A;  4DR2 B;  1AI4 A;  1AR4 A;  3CS5 A;  2FB5 A;  3GWO A;  1P7B A;  2P6J A;  1GM8 A;  2ZT9 B;  3RFR A;  2Y69 B;  2XAF A;  4GKJ O;  3BRC A;  3CCE V;  2UU9 O;  1M90 W;  4GUN A;  1CP9 A;  3DGE A;  3JD2 A;  1K9M W;  3ZN0 A;  4B3R O;  3QTC A;  2RMK B;  3BY6 A;  1YJ9 V;  2A3Q A;  5LA6 A;  4FLX A;  4B7K A;  5LBQ A;  1XIL A;  4ABM A;  3CCM V;  4LCU C;  3DXR A;  4F6R B;  4UCT A;  1XOU A;  3ZS8 C;  4JYA B;  2KKW A;  4LF6 B;  2WLK A;  2DOS A;  4MTO A;  2ZM6 B;  3APQ A;  1MSD A;  4ZOL B;  1SQF A;  3G6E V;  2CGO A;  2W6I G;  4N23 A;  4X1I A;  4RO2 A;  1IXB A;  3C3T A;  4YJ3 B;  4DR6 O;  5J2T B;  2X6A A;  1I08 A;  2G38 A;  2ZXW B;  1Q43 A;  1VF6 C;  2PYL A;  5L3E A;  4GLX A;  1E79 G;  1WP7 A;  4MVU A;  1RFY A;  4UCO A;  4FLV A;  3B8N A;  3N2K B;  4JI5 O;  4LH7 A;  2CAZ C;  3LSQ A;  3ZMU A;  3UT5 A;  1JJO A;  4UCS A;  3K9S A;  1SES A;  2YIC A;  1SRY A;  5H5N A;  1N4C A;  2KG7 B;  5CA0 A;  1GAX A;  2DE0 X;  3H1I H;  2Q6A A;  4B7E A;  3T1Y O;  1FJG O;  2DJV A;  1JOY A;  2ZIO A;  5J2U A;  1M57 C;  1S77 D;  5CA1 A;  1M56 C;  2WWW A;  3CRR A;  4OGQ B;  4MTF A;  4B3T O;  1SA0 A;  4K35 A;  2F23 A;  5L3B A;  5B3S C;  1I0H A;  1SQP H;  1G4Y B;  2ZIN A;  2X0L A;  3P3N A;  5A2Q N;  1BHA A;  2W6J G;  2Y0I A;  1OCR B;  4LF5 O;  4LFB B;  2EIM C;  2QKA A;  1VQ6 V;  1N33 B;  1CEZ A;  2EIK B;  4H13 B;  1Q3E A;  1FPO A;  2WLL A;  1Y6X A;  4FLU A;  3ZMV A;  3T1H O;  1ZL8 A;  2ZQM A;  1BMF G;  1TA8 A;  4PDM A;  3DTU B;  1V55 B;  2OIG A;  3ICX A;  3G71 V;  1NKD A;  3QNE A;  1K92 A;  3ZRW A;  5EC1 C;  4XBF A;  2WLH A;  1VQP V;  3N2G B;  3OMN B;  1LUW A;  4J41 A;  1AR1 B;  2NLJ C;  4KXR A;  2QR4 A;  1AI6 A;  3ZHQ A;  4IHJ A;  4O4J A;  4R6Z A;  1RSO B;  4J9Y B;  3JAL A;  1QVF U;  5JQG A;  2GDS A;  4LBE C;  2QWR B;  3ZHR A;  1EBO A;  2ARH A;  5B1A C;  2ZCE A;  5BXZ A;  1YEW A;  3L70 H;  1TUB A;  1S5J A;  1EN4 A;  3UCS C;  4X9Q A;  3H1H H;  4B3M O;  4R7C A;  5FPO A;  4WF9 V;  4XDK A;  5KHH A;  2UUC B;  1VMG A;  3JAT A;  2Y4U A;  1BGY H;  1DK1 A;  4O4I B;  1WLE A;  3GVM A;  4U7O A;  3HKB B;  3ABL C;  3AK2 A;  3BVO A;  4LFC B;  4PA7 A;  1VQ8 V;  4EFB A;  2BCC H;  4EEQ A;  1U96 A;  1Y67 A;  2K9P A;  3JAR B;  2XTA A;  4QGP A;  4Z2W A;  1DTO A;  3NR7 A;  3QO5 A;  3K0G A;  4GX2 A;  5EBL C;  5FLX N;  3ETG A;  5C8Y A;  2QM4 A;  1K4D C;  1MSW D;  1R3K C;  4DR2 O;  1URF A;  1Y74 B;  2EIN B;  3RYH B;  3RWR D;  4UCU A;  4X20 B;  2M7W A;  4UXN A;  2ZDI C;  5KUK A;  3JAK B;  3FB6 C;  4LNU B;  4P30 A;  5JCO C;  2V1D A;  2XHB A;  4X1Y B;  3X2Q B;  1OCZ C;  1GK9 A;  3JCU Z;  2DYS B;  1O9H A;  3TK1 A;  3ABT A;  3Q4H A;  2ADQ B;  3LDE A;  1EZJ A;  2UUA B;  1ARO P;  4OX9 B;  4JI3 B;  2ZD9 A;  3K3W A;  1EM1 A;  1SS3 A;  1PKX A;  1PM9 A;  3SYC A;  3JAM N;  1Y76 A;  4JYA O;  4P2Z A;  3EXA A;  4LF6 O;  4ZIB A;  4HNA A;  1X4T A;  2ZM6 O;  3OUS A;  4BWA A;  5GON A;  4P9P A;  1BQ0 A;  5K1X A;  3OM3 B;  4PDV A;  3CXC U;  3SYP A;  2Q9L A;  3CME V;  3HKC A;  4PI0 A;  4GKK B;  4HZ3 A;  1JQ0 A;  5IWA B;  2RDC A;  5EIB C;  1FFX B;  3QG5 A;  3R66 A;  4NYK A;  4X1K B;  3VOU A;  4I4T B;  1WP8 A;  2YC0 A;  2HKO A;  3KZI Z;  4TT3 G;  2JEU A;  1F4N A;  3WB1 A;  4O4H A;  2HLD G;  2BSK B;  1BT8 A;  4JV5 B;  3K5M A;  4DR4 B;  1QR9 A;  4O4L A;  3E8G A;  2YI9 A;  4LF4 B;  2XAJ A;  1G1X B;  4FLW A;  4NR1 A;  1GN4 A;  4LC1 A;  1D5A A;  1K4C C;  2OCC C;  5FPR A;  3FFQ A;  2CTQ A;  1IDS A;  2ADP A;  4LF9 B;  4JZG A;  5JH7 B;  4LFB O;  1N33 O;  1YDX A;  5IYD O;  3ZRS A;  4EB6 A;  2YXY A;  1D2D A;  1JCH A;  2MK3 A;  2EZO A;  4BR6 A;  4K0K B;  1QLE C;  4ZI7 B;  5EZY B;  1K97 A;  3ZBH A;  2A0L A;  1XHZ A;  3BAB A;  3ZN1 A;  5FL7 G;  3B2E E;  1US6 A;  3QO8 A;  1I7F A;  3G80 A;  3BFR A;  1MZE A;  2VS0 A;  3HPL C;  1PD3 A;  3A0R A;  3CC7 V;  2VWK A;  1R73 A;  3ABU A;  3J7A U;  4R50 A;  1H2L A;  3TCU A;  4J80 A;  1MG1 A;  3CSX A;  2HHH B;  3ZCC A;  5LHG A;  3T2M A;  3ZHU A;  2PZS A;  1OCR C;  1B04 A;  3RBZ A;  2F66 C;  2BTQ B;  2EIK C;  4I7Z B;  4LR3 A;  3J81 N;  4NXN B;  5KX5 B;  2CTR A;  4MVS A;  3SPG A;  3O65 A;  1R1B A;  2DQ3 A;  1V55 C;  4FM1 A;  2PI5 A;  1K3E A;  2YEV B;  1JVM A;  3HKD B;  1WA8 A;  1Q8I A;  1YHQ V;  2LP7 A;  4I0X A;  2UUC O;  1JX9 A;  1SC5 B;  4TV9 B;  2QJ1 A;  1BSM A;  3BHP A;  4TUY B;  1YTF B;  5CB4 A;  4LFC O;  1G6U A;  4DR7 B;  3BA9 A;  4HAM A;  1OCO B;  3ASO C;  1WB8 A;  1R6K A;  3LNN A;  5KHI A;  4CH4 A;  2O57 A;  3JAS A;  3A0H Z;  3ETD A;  1FFT B;  4XDL A;  1A32 A;  2JEX A;  5AG2 A;  1AR5 A;  4FLY A;  3AG3 B;  4BIO A;  1D5N A;  4UUJ C;  5IYB O;  3JYC A;  4RQE A;  1GN6 A;  5LGU A;  2Q8V A;  2JJ1 G;  2E76 B;  4TV8 B;  4BW9 A;  1H2K A;  4MW3 A;  4DV2 O;  4A5U B;  2JIZ G;  2IBZ H;  3GWK C;  4P9O A;  1RP3 B;  3CC2 V;  5ITZ B;  2RNB A;  2HVJ C;  4FIP C;  1HWY A;  1MMM A;  5LGT A;  1KQS U;  2QWQ B;  3E83 A;  1LUV A;  3E22 A;  2AGA A;  2CK3 G;  2Y0P A;  3L74 H;  3F5T A;  2JGD A;  3CX5 F;  4DV3 B;  3RYF B;  3BEH A;  3FAV A;  2YIB D;  5JJN B;  2JDI G;  3JD1 A;  2EIL C;  3E86 A;  1OZ0 A;  2JJ2 G;  2UUA O;  4AQY B;  2P5O A;  2A7W A;  5JJJ B;  4OX9 O;  1NVP B;  4JI3 O;  4L8J A;  3DXR B;  3LSS A;  2EIN C;  5B66 Z;  1KU9 A;  3C90 A;  3W7S A;  4QNH B;  3D36 C;  3B09 A;  5LXT A;  2QWN B;  4X1I B;  2L35 A;  4RUF A;  4LWS A;  4NB5 A;  2H94 A;  1Q6H A;  3OTO B;  5LYJ A;  3X2Q C;  1W0J G;  1XNR B;  3CD6 V;  2A79 B;  2QKS A;  5H6R A;  2GUZ A;  2DYS C;  2KSD A;  4AIL C;  2C2A A;  4GKK O;  5IWA O;  1MNG A;  1KBH A;  3QF7 A;  5KMG B;  4OPA A;  1J5E B;  3I55 V;  1CPY A;  2WLM A;  4PV1 B;  2GV9 A;  3JSN A;  3UT5 B;  1JFF A;  4MVQ A;  3KCX A;  3CCR V;  1BQZ A;  4G2K A;  1NH2 B;  3SGI A;  3UKM A;  4NTX A;  1VIB A;  3S3X A;  4JV5 O;  1KP3 A;  2OIE A;  1V9P A;  5L3F A;  1K5S A;  3S3W A;  1H2N A;  4DR4 O;  2R9R B;  1I94 B;  5CA1 B;  1J95 A;  3P30 A;  4DR5 B;  4LF4 O;  5B1O A;  4I5S A;  3ZX6 A;  2XUM A;  1SA0 B;  2XT9 A;  4BIU A;  4DV1 B;  4RAI A;  1IBL B;  4DW1 A;  4O2B B;  1TVK A;  5LP6 A;  1AP6 A;  5CMU A;  2CE4 A;  3U0Z A;  1YIJ V;  4LF9 O;  3FX7 A;  2DQ0 A;  4PDL A;  4W4L A;  3K08 A;  4I55 A;  1P7G A;  4DK1 A;  3CCJ V;  1H8H G;  1ROP A;  3B77 A;  1W59 A;  2JS3 A;  2X7R B;  1VQN V;  1VF5 B;  4JI6 B;  2IJJ A;  4U3F H;  2JVD A;  4LFA B;  4K0K O;  3WG7 B;  2PF4 E;  4KUM A;  2EJR A;  4FJC C;  5DM6 V;  4DUZ B;  1H2G A;  4DRX A;  1FAF A;  4F4L A;  2UXC B;  4PEL A;  2P4K A;  1SF9 A;  3F5W C;  1Q86 W; 
#chains in the Genus database with same CATH homology
 1FKA O;  1DK1 A;  4B3S O;  4DR1 O;  3O65 A;  5BR8 O;  1R1B A;  5BY1 A;  4DV0 O;  5LMU O;  4B3T O;  5IT9 N;  3R66 A;  2FKX A;  4JI2 O;  4JI7 O;  4X66 O;  1NS1 A;  4X62 O;  3SDL A;  2HHH O;  1XMO O;  4DR3 O;  4DV3 O;  1F7Y A;  4JI6 O;  4GKJ O;  1AIL A;  4LFA O;  1IBM O;  2UU9 O;  5FLX N;  5A2Q N;  1IBL O;  4AQY O;  4DUZ O;  4NXN O;  2VQF O;  5LL6 Y;  2UUC O;  4LF5 O;  2UXC O;  1HNX O;  4GKK O;  4JI8 O;  5IWA O;  4DR2 O;  4B3R O;  3RT3 C;  4DV6 O;  1HNZ O;  4OPA A;  3J80 N;  1G1X B;  3T1H O;  4LFC O;  4DV4 O;  2JRI A;  3OTO O;  1XNR O;  1N32 O;  4YHH O;  4JV5 O;  1IBK O;  2DOS A;  4DR4 O;  1HR0 O;  4DUY O;  4LFB O;  4JI4 O;  1N36 O;  1A32 A;  1N33 O;  3M8A A;  4LF4 O;  1X59 A;  4X65 O;  4DR6 O;  1R6T A;  4JI1 O;  1YZB A;  5LMN O;  1D2D A;  1J5E O;  4KHP O;  4LF8 O;  2LW7 A;  4DR7 O;  1XEQ A;  2UUB O;  4DV2 O;  4A5U B;  4X64 O;  1HNW O;  3JAM N;  2F4V O;  1KUQ A;  1FYJ A;  4JYA O;  4LF7 O;  4LF9 O;  1XMQ O;  4NXM O;  4LF6 O;  1XNQ O;  4JI5 O;  2ZM6 O;  2UXB O;  3J7A U;  5BXZ A;  2UXD O;  4YY3 O;  4JI0 O;  1I94 O;  4DV7 O;  4DR5 O;  2AGA A;  2VQE O;  3F5T A;  1N34 O;  4DV5 O;  5H5N A;  2E5L O;  4K0K O;  1AB3 A;  2UUA O;  4B3M O;  4DV1 O;  2Z0A A;  3J81 N;  2ZKO A;  3T1Y O;  1FJG O;  4OX9 O;  4JI3 O;  2DJV A;  4OPH A;  2N74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...