4LFAO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfaO00
1AB3A 1YZBA 1IBLO 1J5EO 3SDLA 2VQEO 3R66A 2AGAA 4JI8O 4JYAO 2UU9O 5FLXN 2ZM6O 3JAMN 4X65O 4DV0O 1HNXO 1IBKO 3F5TA 4OPHA 2Z0AA 4LF5O 1N34O 4LFAO 4OX9O 4AQYO 2UUBO 3J81N 4DR4O 3O65A 4LF8O 4DUYO 4NXMO 2ZKOA 4DR3O 4JI6O 5LMUO 3J7AU 4DR5O 1X59A 4DR7O 3T1HO 4DV7O 4JI7O 1NS1A 2E5LO 2UXBO 4KHPO 2LW7A 1XEQA 2UUCO 4LF4O 1XMOO 1N33O 4X62O 4DV4O 4OPAA 4DR1O 4DV3O 1IBMO 3RT3C 4GKKO 1R6TA 4X64O 4X66O 4DR6O 4LF6O 4JI2O 1HNWO 4JI4O 4LFCO 2UXDO 5H5NA 4B3TO 4DV2O 1KUQA 3J80N 4DV6O 1F7YA 4LF9O 2HHHO 4DUZO 5BXZA 5IWAO 4JI5O 1G1XB 4DR2O 4GKJO 2JRIA 4LFBO 5A2QN 5LL6Y 4JI3O 1XMQO 2DJVA 1HR0O 4YHHO 5IT9N 4A5UB 4LF7O 4B3MO 1FJGO 4B3RO 1DK1A 4B3SO 3M8AA 1A32A 2DOSA 2F4VO 5BY1A 4JI0O 1FKAO 1R1BA 2FKXA 4DV5O 1D2DA 3T1YO 3OTOO 1XNQO 1HNZO 4DV1O 1N32O 2N74A 4YY3O 5BR8O 5LMNO 2VQFO 1FYJA 1I94O 4K0KO 4JV5O 2UXCO 1AILA 1XNRO 2UUAO 1N36O 4NXNO 4JI1O
chains in the Genus database with same CATH superfamily
4RO2A 1YZBA 4RWUA 4XDKA 2IJHA 3G80A 4JI2B 4LNUA 1RM1B 1J5EO 1YITV 4BIUA 2CE4A 1LUWA 3ZN1A 1TGOA 1HP8A 5J9PC 2ETNA 1LUVA 2HHHB 4FFBA 3AG2C 2ZM6O 3IC9A 2EULA 1Q82W 4TV9B 1GO3F 1K4DC 2KKWA 5JCOC 4OXSA 1AJPA 3CB2A 3CCEV 4B3MB 3FX7A 4NKGB 1DF4A 5KX5B 3STLC 2VQEB 1M57C 2YUAA 2DWEC 3HKBA 4IIJA 2X6CA 3H1IH 1N32B 5IJ0B 1W59A 2UXCB 5B3SC 1P4RA 1XMOO 2CDYA 1IBMO 1NH2D 3L73H 2FL4A 5J2TA 2PUSA 5LGTA 2UU9B 1SERA 1K9MW 1S3JA 3ZIAG 2QM8A 1WP8A 3L9DA 5HFLA 3K5OA 4OX9B 3OFNG 4ASUG 3CRAA 5A2QN 1MNGA 4D6TH 3CS5A 5CA0B 1NR7A 4LH6A 4JI3O 4JPRA 2ITCC 5DEDA 2ZE7A 5LP6C 4FJCC 1P7BA 3WG7C 3FB6C 4JI0O 2F95B 1R1BA 2FKXA 4UCSA 2F1MA 4FMTA 1F4MA 4LNUB 1SETA 5AG2A 1W2BU 1ROPA 3S3XA 1NT2B 4FFBB 2Y0IA 1YTFD 3B8NA 2ZDIC 1AJNA 4R6ZA 4JI1O 3W7WA 5CBHA 1AB3A 3ETEA 1JVMA 3JD4A 4G28B 4I5SA 4PA7A 4O4IA 1G6UA 1IVSA 4DV2B 3SDLA 3MDSA 1VQ9V 4K8XA 2VS0A 2ZD9A 4GX2A 3CC7V 4X65O 3HKBB 4TUYA 1TUEB 1R3LC 4IIJB 1ZLZA 4LF5O 2OIEA 2W0FC 3HR0A 3K57A 1WB8A 1UFIA 2A7WA 1X4TA 1SQVH 3NR7A 4JI7O 2P4VA 5J2TB 1VQOV 4UV8A 2XASA 4K0KB 1FFTB 1ZWIC 4HAMA 2PF4E 2IJIA 3IC7A 1NVPD 2WLNA 4LBEC 5L3DA 4EFEA 4FLTA 4OPAA 4DR1O 3DGEA 4QE9A 4B08A 2H94A 4WFHA 1K73W 5IYZA 2RN9A 2JVDA 2P5OA 1WPXA 1LR1A 1V55B 2QWQB 4JYBA 1BHAA 1AI7A 1Z2GA 2QWNB 2CTPA 4X88A 2JRIA 1WP7A 1IXMA 1JJ2U 1BHBA 3RYHA 1QLNA 1XREA 2HJDA 4X64B 1KQSU 1RPOA 4TOIA 1L0LH 2RQ6A 4B3SO 4HZ3A 4LP8A 3AG4B 1H8EG 4O4IB 1L1FA 3ZS8C 3GB7C 1GH6A 1VF5B 2UUCB 1MA1A 4I50A 1GM9A 4IYIA 1S77D 5C8YA 2KB1A 4GKKB 4TUYB 4UCOA 1Q3EA 1ENVA 3QG5A 5H2FZ 4FLVA 5LGUA 1CP9A 1GTOA 1HWYA 1YF2A 1HNXO 1Q6HA 5EK0A 3ETDA 4LH7A 4FLXA 2PYLA 1YXBA 4HBNA 1N34O 3CHXA 3KCXA 2EILB 4KXRA 4YIOA 4JI6O 3A2FA 2Y4UA 4DV0B 3AK3A 1HNZB 4DV1B 2MK3A 1SS3A 4YIPA 2R9IA 5IYZB 2VRZA 1NZ6A 2AZ0A 1IDSA 4MT8A 4NR1A 1H2LA 1PNLA 1B6QA 2XOKG 2IJJA 3RYHB 1SA0A 2L6LA 4JTAB 1GKFA 2Q0AA 4DYLA 2OIGA 5KA5A 4PDLA 3ABMC 1H2GA 1G8MA 1M93A 4I9QA 1SQXH 4LF4B 1AI5A 1N33B 2YSUB 3K58A 1S72V 1OCOB 4NXMB 1WJZA 1ZUQA 4I50B 1E1RG 2YXYA 1AI6A 1S76D 5C8YB 1DK1A 5B1AB 3M8AA 1WNSA 2OCHA 3CXCU 1OCZC 1M4UA 3QO5A 1VARA 1YI2V 5LOVA 5BZBA 1VQ5V 5LMNO 5IY5C 4AI8A 2EIJB 3M99B 2CTRA 1QNMA 3TK1A 4WF9V 2ARHA 2RCVA 1N4CA 1FXHA 5EBMC 3FD9A 2WSSG 2UXDB 4B3TB 3LSUA 4O4HA 3BA9A 4WFEA 1QLEC 3ZRWA 2AHYA 2KQXA 3K08A 1M5IA 3BHPA 4PI0A 4JI8O 2ZNJA 5FLXN 3JAMN 4KL1A 4GUNA 4BAYA 2GUZA 4FLUA 1Q86W 1ZTEA 5L3FA 2Z0AA 2QE7G 1N0NA 1GM7A 4GX0A 1QCEA 3EHBB 4DUYO 2BSKA 5LMUO 5JJJB 4U3JA 3CYOA 3G6BA 2C2AA 3T1HO 3SJAC 3QO8A 2RDCA 1VF7A 3DC5A 3CCSV 4AQYB 1EBOA 1SA0B 3C90A 3H1HH 3BEHA 5J2UA 1RPRA 2W6IG 3THOA 4MTXA 4O4LA 4X62O 4H37A 5B1BB 3CPWU 4CC6A 1EN6A 1JCHA 2DMXA 3B09A 1B3QA 1H2SB 4UB8Z 1SQFA 2WWWA 2QKCA 2JJ2G 3E35A 3K0DA 2QKAA 4MTOA 1FFXA 5LOVB 3HPLC 3OUFA 1XMQO 2ADPA 1HR0O 4J80A 2H8PC 1RM1C 1YTFB 2LFSA 4B3RO 4J11A 3Q4HA 1K3EA 5EBLC 2DOSA 3WU2Z 3KCYA 3UT5A 2QM4A 2E5LB 3MD0A 2ZINA 3ZRXA 2JS5A 3ZRWB 5IDJA 3FFQA 2YIBD 4LF7B 2EIKB 4Z1MG 3OGIB 3G67A 4J10A 2VWKA 2GUZB 4JZGA 2A0LA 4B7KA 2F4VB 4QPKA 4X66B 1SKVA 1FS0G 4ABMA 4BWAA 4PA9A 3SJBC 4BIZA 4YJ3A 4JYCA 3VQXA 1PKXA 2AGAA 1FD9A 2R9AA 5LA6B 2BSKB 5IWAB 4U3JB 2PZSA 3ASNC 4U3FH 3JCZA 3ZRSA 1DLBA 2QR4A 2QSAA 3A0BZ 4K8ZA 1H2KA 1YEWA 4DR4O 4X1YA 4IGGA 4D7TA 1NVPB 3OMIB 2QM7A 5J2UB 4DR5O 1X59A 4O4LB 1SZTA 4GZRB 4H0LB 3E2EA 4PELA 4CH6A 1OZ0A 3SYAA 4IHJA 1B04A 2WLIA 2E74B 3E83A 4FIPC 3RT3C 1W0KG 1YHQV 4F4LA 5LHHA 3IJ4A 4JI2O 1T5EA 3CX5F 4X9QA 2ODMA 2OCCC 3HB3B 2WLLA 4JYYA 3ZHRA 3Q4HB 2HHHO 4QNHB 3BVOA 3PN1A 5KX5A 1U97A 3UT5B 4WCEV 3EVKA 3JD0A 1NJIW 1KC8W 5IT9N 2Q69A 2YI8A 3ZMSA 4B3MO 1VQMV 1S5HC 3WB2A 3ZEDA 1I08A 1MOFA 3CRRA 4DR7B 2HJFC 2Q73A 2R9RB 1M56B 3CCJV 4W4LA 3LSSA 4DW1A 3L75H 1FXKA 2WLKA 4MW3A 4YJ3B 1U96A 1N32O 3HKCA 2VQFO 3DSQA 4FLWA 5GONA 3MAQA 4JV5O 2UXCO 2JEUA 3SYCA 1OCRC 3KKYA 2HVKC 4LF6B 2Y0PA 3I5DA 2K1EA 3I55V 2A79B 3ABLB 2JGDA 1W0JG 1KBHA 4X1YB 3H1JH 1S5LZ 2UU9O 2F66C 4JI5B 3TETA 3WFVA 3FAVA 4LFBB 4CS2A 4P30A 1AVMA 2EZOA 2O57A 3T2MA 3STZC 4OX9O 3J81N 3G6EV 4D7SA 3G71V 4IHJB 1KYOF 2WLIB 2BTQA 3QTCA 3CE2A 5L3CA 3T1CA 4NB5A 4UFZA 3A8TA 1QR8A 5KHJA 4JTDB 4I4TB 5LHGA 2UUAB 2UXBO 3BAAA 2Q8VA 2WLLB 1CXZB 5EC1C 4I9WA 5A9GA 3D3QA 3AG4C 3P30A 2DYSC 3N27A 4DV2O 1AR5A 2ZE8A 4LC1A 4G2KA 4LF9O 4I0XB 1JOYA 5E79Z 3K5LA 3JARA 3K9AA 2OTJV 3DTUB 1FXKB 5LL6Y 3WB1A 4EFBA 3BY6A 1BS3A 3HKCB 2DYRB 1HNWB 2Q6AA 4LFCB 5GONB 4WFGA 4PDMA 1K8AW 3X2QB 2AW9A 1IX9A 4FM2A 5FNVA 2BCCH 2JGDB 3K3WA 2YIBA 1KKDA 1YJNV 4K0KO 2EILC 5IYCO 2LJ2A 2QWPB 3FAVB 4FZ1A 5JVDA 1WB7A 3RVYA 4DR6B 3QO7A 2ZNIA 5KMGA 1P49A 2X6BA 2B1IA 1ZX3A 2ZE6A 2QA4V 1H2NA 1GN2A 2BTQB 1N36B 1EZJA 3CXHF 2XAFA 3ML0A 4PDVA 2IH3C 1VMGA 3AK1A 5KA6A 1YSCA 4FLZA 2N05A 2ZM6B 4JGSA 4UVBA 3K03A 5JCOA 4MVUA 4JF3A 2PI4A 1ORQC 4FLYA 3CWBH 4UCVA 4MVQA 2UUCO 3JARB 3B2EE 4X1IA 4GKKO 5B1AC 4YXWG 4EB6A 4JYAB 1GN6A 1H8HG 2QWOB 4FVMA 3VQWA 3ZHTA 3DXRA 4PHZA 2YXHA 3RVZA 5FPOA 2EIJC 1ZAUA 2QTSA 4LFAB 3OMAB 1Y4MA 1PV0A 5FNVB 1V54C 4UB6Z 3SPGA 2DWDC 3H01A 4Q20A 4R50A 4DV7B 2QWRB 4WFAV 2P67A 4CH4A 1WA8A 5JVDB 4PA3A 3OD4A 1XNQO 2EZPA 1HNZO 1I0HA 4DV1O 4JI3B 5KMGB 2B5UA 4H44B 1AILA 3T4DA 4DK0A 4NXNO 5B1NA 1EN4A 1VF6A 2EIMB 3SYPA 2WLJA 1GN4A 3CC2V 3L74H 3LDEA 4JAAA 2ATKC 4ZHQA 5EYPB 2IJKA 2XAQA 1SQPH 5K1PA 3W7TA 3AG2B 2Q7HA 3BRCA 4OPHA 3IAYA 3E86A 2OT5A 4JI1B 1KP2A 2ZIOA 4BW9A 3B4SA 1R6NA 4NXMO 1M57B 4TQDA 2YI9A 2EINC 2Q5ZA 1TUBA 3OTOB 2P7TC 3CJHA 4FFKA 4X1IB 2VWJA 4UV9A 1NR1A 2QGNA 2EJRA 4EB6B 5IE9A 4QJFB 2JIZG 3OW2U 3DXRB 3RBZA 4KHPO 4QPJA 4PA4A 4N23A 1NTZH 2GDSA 1XOUA 3CMEV 4DV4O 3ZJZA 4ZI7A 4CH3A 1JQ0A 5KHHA 1R6TA 1GRJA 1VQPV 4HYOA 1XQ8A 5H5NA 4B3TO 2UXDO 2UXXA 1IBKB 1US6A 5GTHZ 3E8GA 1JMKC 5GW7A 4C7UA 1WA8B 1OCCC 1L0NH 2GSMB 2UUBB 2XUMA 4TV8A 4DR1B 4LF8B 2IM9A 3S3WA 5KAFZ 2HR3A 2CGNA 2M6YA 5JWPA 2HEPA 3OGCC 1D5AA 3WG7B 1K5SA 4TSFG 4GCZA 1Y66A 5KHGA 5EIBC 4ZHQB 1XL4A 3K0GA 1EFRG 2GV9A 4J9YB 1FYJA 1M90W 4IL6Z 1QVGU 2K9PA 4W4KA 2Q9LA 4R8CA 4DV3B 2BOCC 1Q5OA 4GLXA 3TCUA 4QIWF 4PJ0Z 3SJCC 5EC2C 1XHZA 3K5NA 3CCUV 3ABUA 3AG1B 1FPOA 1NBMG 2DQ3A 2GBOA 3K59A 3QNEA 4RUFA 3F5TA 4RAIA 3LDCA 2WLHA 1TUBB 3SR2C 3JD2A 1Q43A 3ZBHA 3CJHB 2MW2B 3LDDA 1RP3B 1S0VA 3GWKC 3CCQV 3SGIA 1YDXA 2A3QA 1FJGB 3O65A 1K5QA 4QGPA 5FL7G 1I7FA 4DV5B 3JYCA 5LBQA 3K9SA 1HNXB 4ZI7B 1TA8A 4TT3G 4YY3B 4N21A 1I94B 2E5LO 4MTGA 4CBCA 1SRYA 5HFMA 1KMIZ 4CC5A 4UCRA 2E76B 1AROP 2X6AA 4CH5A 1IXBA 3APOA 1JPXA 5EZYA 1M56C 5LA6A 4TV8B 4NYKA 4X66O 1NI8A 4Z1VA 1MSWD 3GVMA 2QTOA 4UXNA 4DV6O 1F7YA 2XT9A 4KFMA 2CH7A 1QR9A 5IWAO 1NKDA 2RNBA 1G1XB 4DR2O 3ZMVA 4BR6A 1KB9F 2JGUA 3FYEB 1CPYA 1Q6IA 1PNMA 4YHHO 4TWKA 2XTAA 1BT8A 4AILC 3CRQA 3ABLC 1FAFA 2ITDC 3L72H 1M9NA 1YJ9V 1JFFA 1K92A 2QJ1A 3E22A 2P4KA 3W7XA 3FKSG 2ZXWC 5FPRA 3U11A 3VQVA 2P90A 1HW7A 1O9GA 4MVZA 1URFA 1H38A 3R66A 2BE3A 2GTAA 4DUZB 1K4CC 3ZN0A 4GKJB 3RWRD 1K34A 3CCLV 4X8AA 2DW4A 3ETGA 4UUJC 1K97A 2PTMA 4LWSA 2AZ2A 3JAWA 2W6JG 3CSXA 3KZIZ 2YS8A 3ZHVA 5KHIA 2G38A 3T1YB 4DR7O 3FYIB 1VQ4V 3ICXA 3N2GA 1R73A 5EZYB 2HKOA 2HVJC 1GM8A 3SPJA 1VQ8V 2GHYA 1NS1A 4XDLA 2DE0X 1FXKC 1KU9A 1ZSPA 3HKEA 4DUYB 2DYRC 2CH7B 5LMUB 1UJWB 4I7ZB 3LNNA 4MS2A 3T1HB 1MMMA 3K04A 2GTSA 4NVPA 2ZE5A 3VOUA 4AHCA 4LF6O 3X2QC 1BL8A 3U10A 1BE3H 1GN3A 4ZIBA 4J7ZA 1JFFB 4JI5O 1Z5WA 3E22B 5EBWC 4LFBO 1MZEA 2WAMA 4GT1A 1E1QG 2HFEC 1H2MA 2YEVB 3FB8C 3QVNA 2AHZA 2Q68A 3UQ8A 4I4TA 5JJEB 1OCZB 1TVKA 4P9PA 3BPZA 1VQKV 3H1KH 3FB7C 3C3SA 2YICA 2UUAO 3OEEG 2YIAA 1SZXA 2WPDG 4LWSB 5ITZA 4I0XA 2VQEO 1UPGA 3DC6A 3JAWB 4FK5C 2X7RB 3H1LH 1PPJH 2WLMA 2DQ0A 3A0HZ 4K3AA 3N2GB 1DGSA 1BQZA 4RQEA 4RUEA 4NTWA 5DM6V 1QU7A 3HKEB 1F51A 1Y67A 1AR4A 5GTIZ 1CEZA 4MVOA 1KD1W 5IJ9A 1DF5A 3AG3B 2JEXA 5CBGA 1XNRB 2ZCEA 1R6KA 2LGQA 4EEQA 2EX3A 1IBLB 4X20A 4O2BA 1YVWA 1PP9H 2LFRA 4DR6O 2IU0A 4JASA 1V55C 3BA8A 3BFRA 4KP4A 2XNDG 3J80N 1R3JC 2BOBC 3D36A 4PDRA 2UXNA 5BXZA 1N8RW 4J42A 1Q6UA 3JATA 1TVKB 1N0JA 1D5NA 3F7VC 1RFYA 4DR3B 5CB4A 3ABKB 3CC4V 3BABA 3OMNB 1YIJV 4FPPA 3CD6V 2WA4A 1K33A 3KG2A 2Q7EA 4MVMA 3R65A 5ITZB 2N74A 1GAXA 2X0LA 2CUGA 4HNAB 3B8MA 3TXQA 4P9OA 3RYCA 4DRXA 3L70H 3UO3A 2Y4TA 4JI4B 3ASOB 3QF7A 3JSNA 3VBBA 4P2ZA 5L3BA 4JYAO 2XAGA 2IBZH 2VQFB 4FM0A 1AR1B 1GMGA 4JV5B 2CTQA 3ASNB 1LNQA 4LFAO 1G4YB 5IJ9B 3CP1A 2E75B 1AP6A 1M1KW 3JASA 4JAVA 4I55A 2IW5A 4DV7O 1R3IC 4X20B 2YC0A 4O2BB 3APQA 5BR8B 4O2AA 1Q81W 1RSOA 2Q4PA 5DN6G 1KP3A 2LW7A 1WN7A 4MSWC 3I56V 5EYPA 1J5EB 3JATB 3N2KA 2IH1C 4X64O 1VF6C 1XDCA 3BCCH 1XI1A 4MVSA 2EBOA 2QEXV 5CB4B 3ZRVA 1KECA 1JA8A 1COWG 3OAAG 1NQTA 2OCCB 4LCUC 3SYQA 2UXBB 1SF9A 4JTCB 1OCOC 4GX1A 1PD3A 5LHIA 1I5YA 1J95A 1SQBH 2Y69B 4WFBV 4QE7A 2E3CA 1PM9A 3AG1C 2V1DA 3U0ZA 3RYCB 1VQLV 4LF9B 4DRXB 1D2DA 1JR9A 4FM1A 3VQYA 3OTOO 1B06A 2R70A 2HP8A 3T4ZA 2NN4A 1XMOB 2DN9A 1IBMB 4Z2WA 4GX5A 3SJQC 5CMUA 5CN0A 2Z3YA 3UM7A 1OCRB 2CTWA 5F2VO 2FB5A 2RMKB 2KSDA 2P6JA 3D8CA 1XILA 5EIBD 4K35A 2PYJA 2QDOA 3AG7A 4DV0O 1IBKO 3K5MA 1ZL8A 4J9ZB 1P7GA 2XAJA 3WB0A 1Y74A 1PL4A 3JASB 4I55B 4UVCA 3JSLA 1MZFA 1VP7A 5JH7A 2H3OA 5H6QA 2UUBO 5LP6A 4LF8O 2HLDG 4O2AB 1RSOB 4JI0B 1MABG 2CK3G 5BMVA 1V9PA 1F4NA 2JDIG 3N2KB 3E89A 2Q7GA 4X89A 2ZDIA 3RYIA 4GYCB 4ZKIA 4LF4O 3TJTA 5B1BC 1N33O 4J7JA 4DV3O 1VIBA 3E8BA 4ZBMA 3TGUH 2Q0OC 3OTFA 4X65B 2DYSB 1AJQA 2JJ1G 3ZMZA 2D3OW 3OUSA 3UKMA 1XUQA 4LF5B 2ILMA 4ZOLA 1MG1A 3B40A 1OV9A 1Y6XA 2F93B 1BCCH 2KG7A 3O9OA 5B3SB 2ZT9B 3SPHA 4UVAA 1NTMH 2R72A 1FJGO 2P22C 4JI7B 3JCUZ 2LP7A 4DV5O 5TISZ 1Q8IA 3AEIA 2ZR2A 3RW0A 2F23A 2N04A 1YCIA 1JX9A 1AI4A 1OJHA 4YY3O 3JALA 2EIKC 3ZCCA 1I94O 2OWOA 2V4DA 1ZL8B 4JZ2A 1Y74B 2NNUA 1QBZA 3K79A 5JH7B 4J7KA 1E79G 1XNQB 2JS3A 5LP6B 4H33A 3MHHC 1WPBA 4BW5A 1QQCA 4R7CA 3RYFA 1BMFG 1SC5B 2B9ZA 5BMVB 4NXNB 3H9VA 1XBLA 3M7MX 5IYDO 4AQYO 2D2CB 1BZKA 3RYIB 5D5QA 4B3SB 1IZ3A 4UCTA 1BSMA 3P3NA 4F6RA 3P3PA 5CA3A 5B1OA 1TAEA 4L8JA 2BTOA 2LW1A 4CS4A 5KAIZ 1AP5A 5LYJA 4MVRA 1MSDA 1XEQA 3ZX6A 4ZOLB 2ADQB 4F6EA 1EN5A 1BGYH 2KG7B 1O9HA 4IYHA 4YJ2A 1NU1H 1Q7YW 4WBNA 1I5XA 3ZMUA 1KUQA 4NTXA 2ZIMA 3D3IA 4KHPB 3IGAC 4WFFA 4DUZO 1N34B 5B66Z 4GKJO 2LGWA 4DV4B 5DECA 3F7YC 1WAZA 1F23A 3EXAA 4EKWA 3CEIA 4JI6B 4A5UB 4LF7O 1FXVA 4TQFA 4O4JA 1V54B 3JALB 2LO1A 2F4VO 3ZMTA 1FKAO 4DXWA 3T1YO 3K06A 3L71H 5JQGA 1KKCA 3C3TA 5H6RA 3CCVV 2CAZC 3RYFB 3GWOA 1HDJA 5IYBO 4CS3A 3OEHG 3NXSA 3SPCA 3SYOA 2XHBA 1NH2B 3CCMV 4NTYA 1SESA 1VQNV 2Q67A 3AG3C 2YIDA 2YXLA 1L8DA 3OT7A 3SPIA 1BQ0A 4F6RB 4U7OA 2OYQA 5H9CA 2YEVA 3F5WC 1IURA 3JAKA 3IFXA 2Y48A 2ZKOA 5LYJB 3E8HA 4U7NA 2YDEA 2EINB 3B77A 2QKSA 2RJZA 5LXTA 3CMAV 5L3EA 5LMNB 4YJ2B 4WBNB 1THZA 1P84F 1K7DA 5JJNB 3CRMA 4KUMA 4RQFA 3ABKC 3UO2A 1S5JA 3G4SV 3OR7C 4JI8B 3UCSC 4O4JB 1EM1A 1Y76A 4O4HB 2B1GA 5CA1A 1VQ6V 2CGOA 5E1AC 3HKDA 1R3KC 4ICGA 3TXSA 1OCCB 4CZZA 4E4EA 4PV1B 3OE7G 5JQGB 1VEWA 2ZR3A 3ASOC 1QVFU 5KHKA 2FMLA 5KUMA 4DV6B 1A32A 2PGGA 3LUTB 4JAUA 4DW0A 4DR2B 3W7SA 4XDJA 3P32A 5B5EZ 3ABMB 4YHHB 1Z5VA 4X62B 5L3GA 1XNRO 4H13B 2NR5A 3CRCA 4PD4F 5CBFA 1IBLO 2OTLV 4DO2A 3JAKB 4LR3A 2W0XA 2ZQMA 4XBFA 4FZ0A 5LGNA 4OGQB 1SQGA 3EFFK 4X1KA 1DTOA 1QHTA 2LQTA 2Z5UA 4J41A 1XL6A 3ZHSA 1XMQB 2WA3A 1HR0B 5LXTB 3D36C 5IY5B 4Q6GA 4B3RB 4DR3O 1FFXB 1WLEA 3J7AU 2A9HA 3JD3A 2PY5A 4TV9A 2HG5C 3E8FA 2A06H 4MTFA 1QLEB 4HNAA 4UCUA 4B7EA 1Q90D 3RFRA 3W7UA 4DK1A 3MHSC 3ZHQA 1Y76B 2IU3A 4BIOA 3ETQA 2PI5A 3OR6C 5CA1B 3AK2A 5KUKA 4G27B 1JJOA 2Y69C 4L87A 2F43G 1NTKH 1EZVH 3HKDB 5K1XA 4PA6A 5IJ0A 1PL0A 1HNWO 4JI4O 4LFCO 2EJ7A 3PJSK 2L35A 2JK5C 2AXTZ 3OM3B 1SQQH 1OHHG 1XHXA 3JD1A 4DR4B 1GK9A 2DJVA 4IT5A 2P06A 3CCRV 3A0RA 3ABTA 4MW8A 3ZHUA 4DR5B 5C93A 3RN4A 2M7WA 3FB5C 2FTKA 3RGBA 5BY1A 2V7QG 3LSQA 3LNMB 5CA0A 1YJWV 2XAHA 2NLJC 4E2LA 2FYUH 2ZXWB 1PNKA 5BR8O 1VQ7V 5D5PA 5KLVH 4X1KB 4PI2A 1N36O 2EIMC
chains in the Genus database with same CATH topology
1AB3A 1YZBA 1IBLO 1J5EO 3SDLA 2VQEO 3R66A 2AGAA 4JI8O 4JYAO 2UU9O 5FLXN 2ZM6O 3JAMN 4X65O 4DV0O 1HNXO 1IBKO 3F5TA 4OPHA 2Z0AA 4LF5O 1N34O 4LFAO 4OX9O 4AQYO 2UUBO 3J81N 4DR4O 3O65A 4LF8O 4DUYO 4NXMO 2ZKOA 4DR3O 4JI6O 5LMUO 3J7AU 4DR5O 1X59A 4DR7O 3T1HO 4DV7O 4JI7O 1NS1A 2E5LO 2UXBO 4KHPO 2LW7A 1XEQA 2UUCO 4LF4O 1XMOO 1N33O 4X62O 4DV4O 4OPAA 4DR1O 4DV3O 1IBMO 3RT3C 4GKKO 1R6TA 4X64O 4X66O 4DR6O 4LF6O 4JI2O 1HNWO 4JI4O 4LFCO 2UXDO 5H5NA 4B3TO 4DV2O 1KUQA 3J80N 4DV6O 1F7YA 4LF9O 2HHHO 4DUZO 5BXZA 5IWAO 4JI5O 1G1XB 4DR2O 4GKJO 2JRIA 4LFBO 5A2QN 5LL6Y 4JI3O 1XMQO 2DJVA 1HR0O 4YHHO 5IT9N 4A5UB 4LF7O 4B3MO 1FJGO 4B3RO 1DK1A 4B3SO 3M8AA 1A32A 2DOSA 2F4VO 5BY1A 4JI0O 1FKAO 1R1BA 2FKXA 4DV5O 1D2DA 3T1YO 3OTOO 1XNQO 1HNZO 4DV1O 1N32O 2N74A 4YY3O 5BR8O 5LMNO 2VQFO 1FYJA 1I94O 4K0KO 4JV5O 2UXCO 1AILA 1XNRO 2UUAO 1N36O 4NXNO 4JI1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB3 A;  1YZB A;  1IBL O;  1J5E O;  3SDL A;  2VQE O;  3R66 A;  2AGA A;  4JI8 O;  4JYA O;  2UU9 O;  5FLX N;  2ZM6 O;  3JAM N;  4X65 O;  4DV0 O;  1HNX O;  1IBK O;  3F5T A;  4OPH A;  2Z0A A;  4LF5 O;  1N34 O;  4LFA O;  4OX9 O;  4AQY O;  2UUB O;  3J81 N;  4DR4 O;  3O65 A;  4LF8 O;  4DUY O;  4NXM O;  2ZKO A;  4DR3 O;  4JI6 O;  5LMU O;  3J7A U;  4DR5 O;  1X59 A;  4DR7 O;  3T1H O;  4DV7 O;  4JI7 O;  1NS1 A;  2E5L O;  2UXB O;  4KHP O;  2LW7 A;  1XEQ A;  2UUC O;  4LF4 O;  1XMO O;  1N33 O;  4X62 O;  4DV4 O;  4OPA A;  4DR1 O;  4DV3 O;  1IBM O;  3RT3 C;  4GKK O;  1R6T A;  4X64 O;  4X66 O;  4DR6 O;  4LF6 O;  4JI2 O;  1HNW O;  4JI4 O;  4LFC O;  2UXD O;  5H5N A;  4B3T O;  4DV2 O;  1KUQ A;  3J80 N;  4DV6 O;  1F7Y A;  4LF9 O;  2HHH O;  4DUZ O;  5BXZ A;  5IWA O;  4JI5 O;  1G1X B;  4DR2 O;  4GKJ O;  2JRI A;  4LFB O;  5A2Q N;  5LL6 Y;  4JI3 O;  1XMQ O;  2DJV A;  1HR0 O;  4YHH O;  5IT9 N;  4A5U B;  4LF7 O;  4B3M O;  1FJG O;  4B3R O;  1DK1 A;  4B3S O;  3M8A A;  1A32 A;  2DOS A;  2F4V O;  5BY1 A;  4JI0 O;  1FKA O;  1R1B A;  2FKX A;  4DV5 O;  1D2D A;  3T1Y O;  3OTO O;  1XNQ O;  1HNZ O;  4DV1 O;  1N32 O;  2N74 A;  4YY3 O;  5BR8 O;  5LMN O;  2VQF O;  1FYJ A;  1I94 O;  4K0K O;  4JV5 O;  2UXC O;  1AIL A;  1XNR O;  2UUA O;  1N36 O;  4NXN O;  4JI1 O; 
#chains in the Genus database with same CATH topology
 4RO2 A;  1YZB A;  4RWU A;  4XDK A;  2IJH A;  3G80 A;  4JI2 B;  4LNU A;  1RM1 B;  1J5E O;  1YIT V;  4BIU A;  2CE4 A;  1LUW A;  3ZN1 A;  1TGO A;  1HP8 A;  5J9P C;  2ETN A;  1LUV A;  2HHH B;  4FFB A;  3AG2 C;  2ZM6 O;  3IC9 A;  2EUL A;  1Q82 W;  4TV9 B;  1GO3 F;  1K4D C;  2KKW A;  5JCO C;  4OXS A;  1AJP A;  3CB2 A;  3CCE V;  4B3M B;  3FX7 A;  4NKG B;  1DF4 A;  5KX5 B;  3STL C;  2VQE B;  1M57 C;  2YUA A;  2DWE C;  3HKB A;  4IIJ A;  2X6C A;  3H1I H;  1N32 B;  5IJ0 B;  1W59 A;  2UXC B;  5B3S C;  1P4R A;  1XMO O;  2CDY A;  1IBM O;  1NH2 D;  3L73 H;  2FL4 A;  5J2T A;  2PUS A;  5LGT A;  2UU9 B;  1SER A;  1K9M W;  1S3J A;  3ZIA G;  2QM8 A;  1WP8 A;  3L9D A;  5HFL A;  3K5O A;  4OX9 B;  3OFN G;  4ASU G;  3CRA A;  5A2Q N;  1MNG A;  4D6T H;  3CS5 A;  5CA0 B;  1NR7 A;  4LH6 A;  4JI3 O;  4JPR A;  2ITC C;  5DED A;  2ZE7 A;  5LP6 C;  4FJC C;  1P7B A;  3WG7 C;  3FB6 C;  4JI0 O;  2F95 B;  1R1B A;  2FKX A;  4UCS A;  2F1M A;  4FMT A;  1F4M A;  4LNU B;  1SET A;  5AG2 A;  1W2B U;  1ROP A;  3S3X A;  1NT2 B;  4FFB B;  2Y0I A;  1YTF D;  3B8N A;  2ZDI C;  1AJN A;  4R6Z A;  4JI1 O;  3W7W A;  5CBH A;  1AB3 A;  3ETE A;  1JVM A;  3JD4 A;  4G28 B;  4I5S A;  4PA7 A;  4O4I A;  1G6U A;  1IVS A;  4DV2 B;  3SDL A;  3MDS A;  1VQ9 V;  4K8X A;  2VS0 A;  2ZD9 A;  4GX2 A;  3CC7 V;  4X65 O;  3HKB B;  4TUY A;  1TUE B;  1R3L C;  4IIJ B;  1ZLZ A;  4LF5 O;  2OIE A;  2W0F C;  3HR0 A;  3K57 A;  1WB8 A;  1UFI A;  2A7W A;  1X4T A;  1SQV H;  3NR7 A;  4JI7 O;  2P4V A;  5J2T B;  1VQO V;  4UV8 A;  2XAS A;  4K0K B;  1FFT B;  1ZWI C;  4HAM A;  2PF4 E;  2IJI A;  3IC7 A;  1NVP D;  2WLN A;  4LBE C;  5L3D A;  4EFE A;  4FLT A;  4OPA A;  4DR1 O;  3DGE A;  4QE9 A;  4B08 A;  2H94 A;  4WFH A;  1K73 W;  5IYZ A;  2RN9 A;  2JVD A;  2P5O A;  1WPX A;  1LR1 A;  1V55 B;  2QWQ B;  4JYB A;  1BHA A;  1AI7 A;  1Z2G A;  2QWN B;  2CTP A;  4X88 A;  2JRI A;  1WP7 A;  1IXM A;  1JJ2 U;  1BHB A;  3RYH A;  1QLN A;  1XRE A;  2HJD A;  4X64 B;  1KQS U;  1RPO A;  4TOI A;  1L0L H;  2RQ6 A;  4B3S O;  4HZ3 A;  4LP8 A;  3AG4 B;  1H8E G;  4O4I B;  1L1F A;  3ZS8 C;  3GB7 C;  1GH6 A;  1VF5 B;  2UUC B;  1MA1 A;  4I50 A;  1GM9 A;  4IYI A;  1S77 D;  5C8Y A;  2KB1 A;  4GKK B;  4TUY B;  4UCO A;  1Q3E A;  1ENV A;  3QG5 A;  5H2F Z;  4FLV A;  5LGU A;  1CP9 A;  1GTO A;  1HWY A;  1YF2 A;  1HNX O;  1Q6H A;  5EK0 A;  3ETD A;  4LH7 A;  4FLX A;  2PYL A;  1YXB A;  4HBN A;  1N34 O;  3CHX A;  3KCX A;  2EIL B;  4KXR A;  4YIO A;  4JI6 O;  3A2F A;  2Y4U A;  4DV0 B;  3AK3 A;  1HNZ B;  4DV1 B;  2MK3 A;  1SS3 A;  4YIP A;  2R9I A;  5IYZ B;  2VRZ A;  1NZ6 A;  2AZ0 A;  1IDS A;  4MT8 A;  4NR1 A;  1H2L A;  1PNL A;  1B6Q A;  2XOK G;  2IJJ A;  3RYH B;  1SA0 A;  2L6L A;  4JTA B;  1GKF A;  2Q0A A;  4DYL A;  2OIG A;  5KA5 A;  4PDL A;  3ABM C;  1H2G A;  1G8M A;  1M93 A;  4I9Q A;  1SQX H;  4LF4 B;  1AI5 A;  1N33 B;  2YSU B;  3K58 A;  1S72 V;  1OCO B;  4NXM B;  1WJZ A;  1ZUQ A;  4I50 B;  1E1R G;  2YXY A;  1AI6 A;  1S76 D;  5C8Y B;  1DK1 A;  5B1A B;  3M8A A;  1WNS A;  2OCH A;  3CXC U;  1OCZ C;  1M4U A;  3QO5 A;  1VAR A;  1YI2 V;  5LOV A;  5BZB A;  1VQ5 V;  5LMN O;  5IY5 C;  4AI8 A;  2EIJ B;  3M99 B;  2CTR A;  1QNM A;  3TK1 A;  4WF9 V;  2ARH A;  2RCV A;  1N4C A;  1FXH A;  5EBM C;  3FD9 A;  2WSS G;  2UXD B;  4B3T B;  3LSU A;  4O4H A;  3BA9 A;  4WFE A;  1QLE C;  3ZRW A;  2AHY A;  2KQX A;  3K08 A;  1M5I A;  3BHP A;  4PI0 A;  4JI8 O;  2ZNJ A;  5FLX N;  3JAM N;  4KL1 A;  4GUN A;  4BAY A;  2GUZ A;  4FLU A;  1Q86 W;  1ZTE A;  5L3F A;  2Z0A A;  2QE7 G;  1N0N A;  1GM7 A;  4GX0 A;  1QCE A;  3EHB B;  4DUY O;  2BSK A;  5LMU O;  5JJJ B;  4U3J A;  3CYO A;  3G6B A;  2C2A A;  3T1H O;  3SJA C;  3QO8 A;  2RDC A;  1VF7 A;  3DC5 A;  3CCS V;  4AQY B;  1EBO A;  1SA0 B;  3C90 A;  3H1H H;  3BEH A;  5J2U A;  1RPR A;  2W6I G;  3THO A;  4MTX A;  4O4L A;  4X62 O;  4H37 A;  5B1B B;  3CPW U;  4CC6 A;  1EN6 A;  1JCH A;  2DMX A;  3B09 A;  1B3Q A;  1H2S B;  4UB8 Z;  1SQF A;  2WWW A;  2QKC A;  2JJ2 G;  3E35 A;  3K0D A;  2QKA A;  4MTO A;  1FFX A;  5LOV B;  3HPL C;  3OUF A;  1XMQ O;  2ADP A;  1HR0 O;  4J80 A;  2H8P C;  1RM1 C;  1YTF B;  2LFS A;  4B3R O;  4J11 A;  3Q4H A;  1K3E A;  5EBL C;  2DOS A;  3WU2 Z;  3KCY A;  3UT5 A;  2QM4 A;  2E5L B;  3MD0 A;  2ZIN A;  3ZRX A;  2JS5 A;  3ZRW B;  5IDJ A;  3FFQ A;  2YIB D;  4LF7 B;  2EIK B;  4Z1M G;  3OGI B;  3G67 A;  4J10 A;  2VWK A;  2GUZ B;  4JZG A;  2A0L A;  4B7K A;  2F4V B;  4QPK A;  4X66 B;  1SKV A;  1FS0 G;  4ABM A;  4BWA A;  4PA9 A;  3SJB C;  4BIZ A;  4YJ3 A;  4JYC A;  3VQX A;  1PKX A;  2AGA A;  1FD9 A;  2R9A A;  5LA6 B;  2BSK B;  5IWA B;  4U3J B;  2PZS A;  3ASN C;  4U3F H;  3JCZ A;  3ZRS A;  1DLB A;  2QR4 A;  2QSA A;  3A0B Z;  4K8Z A;  1H2K A;  1YEW A;  4DR4 O;  4X1Y A;  4IGG A;  4D7T A;  1NVP B;  3OMI B;  2QM7 A;  5J2U B;  4DR5 O;  1X59 A;  4O4L B;  1SZT A;  4GZR B;  4H0L B;  3E2E A;  4PEL A;  4CH6 A;  1OZ0 A;  3SYA A;  4IHJ A;  1B04 A;  2WLI A;  2E74 B;  3E83 A;  4FIP C;  3RT3 C;  1W0K G;  1YHQ V;  4F4L A;  5LHH A;  3IJ4 A;  4JI2 O;  1T5E A;  3CX5 F;  4X9Q A;  2ODM A;  2OCC C;  3HB3 B;  2WLL A;  4JYY A;  3ZHR A;  3Q4H B;  2HHH O;  4QNH B;  3BVO A;  3PN1 A;  5KX5 A;  1U97 A;  3UT5 B;  4WCE V;  3EVK A;  3JD0 A;  1NJI W;  1KC8 W;  5IT9 N;  2Q69 A;  2YI8 A;  3ZMS A;  4B3M O;  1VQM V;  1S5H C;  3WB2 A;  3ZED A;  1I08 A;  1MOF A;  3CRR A;  4DR7 B;  2HJF C;  2Q73 A;  2R9R B;  1M56 B;  3CCJ V;  4W4L A;  3LSS A;  4DW1 A;  3L75 H;  1FXK A;  2WLK A;  4MW3 A;  4YJ3 B;  1U96 A;  1N32 O;  3HKC A;  2VQF O;  3DSQ A;  4FLW A;  5GON A;  3MAQ A;  4JV5 O;  2UXC O;  2JEU A;  3SYC A;  1OCR C;  3KKY A;  2HVK C;  4LF6 B;  2Y0P A;  3I5D A;  2K1E A;  3I55 V;  2A79 B;  3ABL B;  2JGD A;  1W0J G;  1KBH A;  4X1Y B;  3H1J H;  1S5L Z;  2UU9 O;  2F66 C;  4JI5 B;  3TET A;  3WFV A;  3FAV A;  4LFB B;  4CS2 A;  4P30 A;  1AVM A;  2EZO A;  2O57 A;  3T2M A;  3STZ C;  4OX9 O;  3J81 N;  3G6E V;  4D7S A;  3G71 V;  4IHJ B;  1KYO F;  2WLI B;  2BTQ A;  3QTC A;  3CE2 A;  5L3C A;  3T1C A;  4NB5 A;  4UFZ A;  3A8T A;  1QR8 A;  5KHJ A;  4JTD B;  4I4T B;  5LHG A;  2UUA B;  2UXB O;  3BAA A;  2Q8V A;  2WLL B;  1CXZ B;  5EC1 C;  4I9W A;  5A9G A;  3D3Q A;  3AG4 C;  3P30 A;  2DYS C;  3N27 A;  4DV2 O;  1AR5 A;  2ZE8 A;  4LC1 A;  4G2K A;  4LF9 O;  4I0X B;  1JOY A;  5E79 Z;  3K5L A;  3JAR A;  3K9A A;  2OTJ V;  3DTU B;  1FXK B;  5LL6 Y;  3WB1 A;  4EFB A;  3BY6 A;  1BS3 A;  3HKC B;  2DYR B;  1HNW B;  2Q6A A;  4LFC B;  5GON B;  4WFG A;  4PDM A;  1K8A W;  3X2Q B;  2AW9 A;  1IX9 A;  4FM2 A;  5FNV A;  2BCC H;  2JGD B;  3K3W A;  2YIB A;  1KKD A;  1YJN V;  4K0K O;  2EIL C;  5IYC O;  2LJ2 A;  2QWP B;  3FAV B;  4FZ1 A;  5JVD A;  1WB7 A;  3RVY A;  4DR6 B;  3QO7 A;  2ZNI A;  5KMG A;  1P49 A;  2X6B A;  2B1I A;  1ZX3 A;  2ZE6 A;  2QA4 V;  1H2N A;  1GN2 A;  2BTQ B;  1N36 B;  1EZJ A;  3CXH F;  2XAF A;  3ML0 A;  4PDV A;  2IH3 C;  1VMG A;  3AK1 A;  5KA6 A;  1YSC A;  4FLZ A;  2N05 A;  2ZM6 B;  4JGS A;  4UVB A;  3K03 A;  5JCO A;  4MVU A;  4JF3 A;  2PI4 A;  1ORQ C;  4FLY A;  3CWB H;  4UCV A;  4MVQ A;  2UUC O;  3JAR B;  3B2E E;  4X1I A;  4GKK O;  5B1A C;  4YXW G;  4EB6 A;  4JYA B;  1GN6 A;  1H8H G;  2QWO B;  4FVM A;  3VQW A;  3ZHT A;  3DXR A;  4PHZ A;  2YXH A;  3RVZ A;  5FPO A;  2EIJ C;  1ZAU A;  2QTS A;  4LFA B;  3OMA B;  1Y4M A;  1PV0 A;  5FNV B;  1V54 C;  4UB6 Z;  3SPG A;  2DWD C;  3H01 A;  4Q20 A;  4R50 A;  4DV7 B;  2QWR B;  4WFA V;  2P67 A;  4CH4 A;  1WA8 A;  5JVD B;  4PA3 A;  3OD4 A;  1XNQ O;  2EZP A;  1HNZ O;  1I0H A;  4DV1 O;  4JI3 B;  5KMG B;  2B5U A;  4H44 B;  1AIL A;  3T4D A;  4DK0 A;  4NXN O;  5B1N A;  1EN4 A;  1VF6 A;  2EIM B;  3SYP A;  2WLJ A;  1GN4 A;  3CC2 V;  3L74 H;  3LDE A;  4JAA A;  2ATK C;  4ZHQ A;  5EYP B;  2IJK A;  2XAQ A;  1SQP H;  5K1P A;  3W7T A;  3AG2 B;  2Q7H A;  3BRC A;  4OPH A;  3IAY A;  3E86 A;  2OT5 A;  4JI1 B;  1KP2 A;  2ZIO A;  4BW9 A;  3B4S A;  1R6N A;  4NXM O;  1M57 B;  4TQD A;  2YI9 A;  2EIN C;  2Q5Z A;  1TUB A;  3OTO B;  2P7T C;  3CJH A;  4FFK A;  4X1I B;  2VWJ A;  4UV9 A;  1NR1 A;  2QGN A;  2EJR A;  4EB6 B;  5IE9 A;  4QJF B;  2JIZ G;  3OW2 U;  3DXR B;  3RBZ A;  4KHP O;  4QPJ A;  4PA4 A;  4N23 A;  1NTZ H;  2GDS A;  1XOU A;  3CME V;  4DV4 O;  3ZJZ A;  4ZI7 A;  4CH3 A;  1JQ0 A;  5KHH A;  1R6T A;  1GRJ A;  1VQP V;  4HYO A;  1XQ8 A;  5H5N A;  4B3T O;  2UXD O;  2UXX A;  1IBK B;  1US6 A;  5GTH Z;  3E8G A;  1JMK C;  5GW7 A;  4C7U A;  1WA8 B;  1OCC C;  1L0N H;  2GSM B;  2UUB B;  2XUM A;  4TV8 A;  4DR1 B;  4LF8 B;  2IM9 A;  3S3W A;  5KAF Z;  2HR3 A;  2CGN A;  2M6Y A;  5JWP A;  2HEP A;  3OGC C;  1D5A A;  3WG7 B;  1K5S A;  4TSF G;  4GCZ A;  1Y66 A;  5KHG A;  5EIB C;  4ZHQ B;  1XL4 A;  3K0G A;  1EFR G;  2GV9 A;  4J9Y B;  1FYJ A;  1M90 W;  4IL6 Z;  1QVG U;  2K9P A;  4W4K A;  2Q9L A;  4R8C A;  4DV3 B;  2BOC C;  1Q5O A;  4GLX A;  3TCU A;  4QIW F;  4PJ0 Z;  3SJC C;  5EC2 C;  1XHZ A;  3K5N A;  3CCU V;  3ABU A;  3AG1 B;  1FPO A;  1NBM G;  2DQ3 A;  2GBO A;  3K59 A;  3QNE A;  4RUF A;  3F5T A;  4RAI A;  3LDC A;  2WLH A;  1TUB B;  3SR2 C;  3JD2 A;  1Q43 A;  3ZBH A;  3CJH B;  2MW2 B;  3LDD A;  1RP3 B;  1S0V A;  3GWK C;  3CCQ V;  3SGI A;  1YDX A;  2A3Q A;  1FJG B;  3O65 A;  1K5Q A;  4QGP A;  5FL7 G;  1I7F A;  4DV5 B;  3JYC A;  5LBQ A;  3K9S A;  1HNX B;  4ZI7 B;  1TA8 A;  4TT3 G;  4YY3 B;  4N21 A;  1I94 B;  2E5L O;  4MTG A;  4CBC A;  1SRY A;  5HFM A;  1KMI Z;  4CC5 A;  4UCR A;  2E76 B;  1ARO P;  2X6A A;  4CH5 A;  1IXB A;  3APO A;  1JPX A;  5EZY A;  1M56 C;  5LA6 A;  4TV8 B;  4NYK A;  4X66 O;  1NI8 A;  4Z1V A;  1MSW D;  3GVM A;  2QTO A;  4UXN A;  4DV6 O;  1F7Y A;  2XT9 A;  4KFM A;  2CH7 A;  1QR9 A;  5IWA O;  1NKD A;  2RNB A;  1G1X B;  4DR2 O;  3ZMV A;  4BR6 A;  1KB9 F;  2JGU A;  3FYE B;  1CPY A;  1Q6I A;  1PNM A;  4YHH O;  4TWK A;  2XTA A;  1BT8 A;  4AIL C;  3CRQ A;  3ABL C;  1FAF A;  2ITD C;  3L72 H;  1M9N A;  1YJ9 V;  1JFF A;  1K92 A;  2QJ1 A;  3E22 A;  2P4K A;  3W7X A;  3FKS G;  2ZXW C;  5FPR A;  3U11 A;  3VQV A;  2P90 A;  1HW7 A;  1O9G A;  4MVZ A;  1URF A;  1H38 A;  3R66 A;  2BE3 A;  2GTA A;  4DUZ B;  1K4C C;  3ZN0 A;  4GKJ B;  3RWR D;  1K34 A;  3CCL V;  4X8A A;  2DW4 A;  3ETG A;  4UUJ C;  1K97 A;  2PTM A;  4LWS A;  2AZ2 A;  3JAW A;  2W6J G;  3CSX A;  3KZI Z;  2YS8 A;  3ZHV A;  5KHI A;  2G38 A;  3T1Y B;  4DR7 O;  3FYI B;  1VQ4 V;  3ICX A;  3N2G A;  1R73 A;  5EZY B;  2HKO A;  2HVJ C;  1GM8 A;  3SPJ A;  1VQ8 V;  2GHY A;  1NS1 A;  4XDL A;  2DE0 X;  1FXK C;  1KU9 A;  1ZSP A;  3HKE A;  4DUY B;  2DYR C;  2CH7 B;  5LMU B;  1UJW B;  4I7Z B;  3LNN A;  4MS2 A;  3T1H B;  1MMM A;  3K04 A;  2GTS A;  4NVP A;  2ZE5 A;  3VOU A;  4AHC A;  4LF6 O;  3X2Q C;  1BL8 A;  3U10 A;  1BE3 H;  1GN3 A;  4ZIB A;  4J7Z A;  1JFF B;  4JI5 O;  1Z5W A;  3E22 B;  5EBW C;  4LFB O;  1MZE A;  2WAM A;  4GT1 A;  1E1Q G;  2HFE C;  1H2M A;  2YEV B;  3FB8 C;  3QVN A;  2AHZ A;  2Q68 A;  3UQ8 A;  4I4T A;  5JJE B;  1OCZ B;  1TVK A;  4P9P A;  3BPZ A;  1VQK V;  3H1K H;  3FB7 C;  3C3S A;  2YIC A;  2UUA O;  3OEE G;  2YIA A;  1SZX A;  2WPD G;  4LWS B;  5ITZ A;  4I0X A;  2VQE O;  1UPG A;  3DC6 A;  3JAW B;  4FK5 C;  2X7R B;  3H1L H;  1PPJ H;  2WLM A;  2DQ0 A;  3A0H Z;  4K3A A;  3N2G B;  1DGS A;  1BQZ A;  4RQE A;  4RUE A;  4NTW A;  5DM6 V;  1QU7 A;  3HKE B;  1F51 A;  1Y67 A;  1AR4 A;  5GTI Z;  1CEZ A;  4MVO A;  1KD1 W;  5IJ9 A;  1DF5 A;  3AG3 B;  2JEX A;  5CBG A;  1XNR B;  2ZCE A;  1R6K A;  2LGQ A;  4EEQ A;  2EX3 A;  1IBL B;  4X20 A;  4O2B A;  1YVW A;  1PP9 H;  2LFR A;  4DR6 O;  2IU0 A;  4JAS A;  1V55 C;  3BA8 A;  3BFR A;  4KP4 A;  2XND G;  3J80 N;  1R3J C;  2BOB C;  3D36 A;  4PDR A;  2UXN A;  5BXZ A;  1N8R W;  4J42 A;  1Q6U A;  3JAT A;  1TVK B;  1N0J A;  1D5N A;  3F7V C;  1RFY A;  4DR3 B;  5CB4 A;  3ABK B;  3CC4 V;  3BAB A;  3OMN B;  1YIJ V;  4FPP A;  3CD6 V;  2WA4 A;  1K33 A;  3KG2 A;  2Q7E A;  4MVM A;  3R65 A;  5ITZ B;  2N74 A;  1GAX A;  2X0L A;  2CUG A;  4HNA B;  3B8M A;  3TXQ A;  4P9O A;  3RYC A;  4DRX A;  3L70 H;  3UO3 A;  2Y4T A;  4JI4 B;  3ASO B;  3QF7 A;  3JSN A;  3VBB A;  4P2Z A;  5L3B A;  4JYA O;  2XAG A;  2IBZ H;  2VQF B;  4FM0 A;  1AR1 B;  1GMG A;  4JV5 B;  2CTQ A;  3ASN B;  1LNQ A;  4LFA O;  1G4Y B;  5IJ9 B;  3CP1 A;  2E75 B;  1AP6 A;  1M1K W;  3JAS A;  4JAV A;  4I55 A;  2IW5 A;  4DV7 O;  1R3I C;  4X20 B;  2YC0 A;  4O2B B;  3APQ A;  5BR8 B;  4O2A A;  1Q81 W;  1RSO A;  2Q4P A;  5DN6 G;  1KP3 A;  2LW7 A;  1WN7 A;  4MSW C;  3I56 V;  5EYP A;  1J5E B;  3JAT B;  3N2K A;  2IH1 C;  4X64 O;  1VF6 C;  1XDC A;  3BCC H;  1XI1 A;  4MVS A;  2EBO A;  2QEX V;  5CB4 B;  3ZRV A;  1KEC A;  1JA8 A;  1COW G;  3OAA G;  1NQT A;  2OCC B;  4LCU C;  3SYQ A;  2UXB B;  1SF9 A;  4JTC B;  1OCO C;  4GX1 A;  1PD3 A;  5LHI A;  1I5Y A;  1J95 A;  1SQB H;  2Y69 B;  4WFB V;  4QE7 A;  2E3C A;  1PM9 A;  3AG1 C;  2V1D A;  3U0Z A;  3RYC B;  1VQL V;  4LF9 B;  4DRX B;  1D2D A;  1JR9 A;  4FM1 A;  3VQY A;  3OTO O;  1B06 A;  2R70 A;  2HP8 A;  3T4Z A;  2NN4 A;  1XMO B;  2DN9 A;  1IBM B;  4Z2W A;  4GX5 A;  3SJQ C;  5CMU A;  5CN0 A;  2Z3Y A;  3UM7 A;  1OCR B;  2CTW A;  5F2V O;  2FB5 A;  2RMK B;  2KSD A;  2P6J A;  3D8C A;  1XIL A;  5EIB D;  4K35 A;  2PYJ A;  2QDO A;  3AG7 A;  4DV0 O;  1IBK O;  3K5M A;  1ZL8 A;  4J9Z B;  1P7G A;  2XAJ A;  3WB0 A;  1Y74 A;  1PL4 A;  3JAS B;  4I55 B;  4UVC A;  3JSL A;  1MZF A;  1VP7 A;  5JH7 A;  2H3O A;  5H6Q A;  2UUB O;  5LP6 A;  4LF8 O;  2HLD G;  4O2A B;  1RSO B;  4JI0 B;  1MAB G;  2CK3 G;  5BMV A;  1V9P A;  1F4N A;  2JDI G;  3N2K B;  3E89 A;  2Q7G A;  4X89 A;  2ZDI A;  3RYI A;  4GYC B;  4ZKI A;  4LF4 O;  3TJT A;  5B1B C;  1N33 O;  4J7J A;  4DV3 O;  1VIB A;  3E8B A;  4ZBM A;  3TGU H;  2Q0O C;  3OTF A;  4X65 B;  2DYS B;  1AJQ A;  2JJ1 G;  3ZMZ A;  2D3O W;  3OUS A;  3UKM A;  1XUQ A;  4LF5 B;  2ILM A;  4ZOL A;  1MG1 A;  3B40 A;  1OV9 A;  1Y6X A;  2F93 B;  1BCC H;  2KG7 A;  3O9O A;  5B3S B;  2ZT9 B;  3SPH A;  4UVA A;  1NTM H;  2R72 A;  1FJG O;  2P22 C;  4JI7 B;  3JCU Z;  2LP7 A;  4DV5 O;  5TIS Z;  1Q8I A;  3AEI A;  2ZR2 A;  3RW0 A;  2F23 A;  2N04 A;  1YCI A;  1JX9 A;  1AI4 A;  1OJH A;  4YY3 O;  3JAL A;  2EIK C;  3ZCC A;  1I94 O;  2OWO A;  2V4D A;  1ZL8 B;  4JZ2 A;  1Y74 B;  2NNU A;  1QBZ A;  3K79 A;  5JH7 B;  4J7K A;  1E79 G;  1XNQ B;  2JS3 A;  5LP6 B;  4H33 A;  3MHH C;  1WPB A;  4BW5 A;  1QQC A;  4R7C A;  3RYF A;  1BMF G;  1SC5 B;  2B9Z A;  5BMV B;  4NXN B;  3H9V A;  1XBL A;  3M7M X;  5IYD O;  4AQY O;  2D2C B;  1BZK A;  3RYI B;  5D5Q A;  4B3S B;  1IZ3 A;  4UCT A;  1BSM A;  3P3N A;  4F6R A;  3P3P A;  5CA3 A;  5B1O A;  1TAE A;  4L8J A;  2BTO A;  2LW1 A;  4CS4 A;  5KAI Z;  1AP5 A;  5LYJ A;  4MVR A;  1MSD A;  1XEQ A;  3ZX6 A;  4ZOL B;  2ADQ B;  4F6E A;  1EN5 A;  1BGY H;  2KG7 B;  1O9H A;  4IYH A;  4YJ2 A;  1NU1 H;  1Q7Y W;  4WBN A;  1I5X A;  3ZMU A;  1KUQ A;  4NTX A;  2ZIM A;  3D3I A;  4KHP B;  3IGA C;  4WFF A;  4DUZ O;  1N34 B;  5B66 Z;  4GKJ O;  2LGW A;  4DV4 B;  5DEC A;  3F7Y C;  1WAZ A;  1F23 A;  3EXA A;  4EKW A;  3CEI A;  4JI6 B;  4A5U B;  4LF7 O;  1FXV A;  4TQF A;  4O4J A;  1V54 B;  3JAL B;  2LO1 A;  2F4V O;  3ZMT A;  1FKA O;  4DXW A;  3T1Y O;  3K06 A;  3L71 H;  5JQG A;  1KKC A;  3C3T A;  5H6R A;  3CCV V;  2CAZ C;  3RYF B;  3GWO A;  1HDJ A;  5IYB O;  4CS3 A;  3OEH G;  3NXS A;  3SPC A;  3SYO A;  2XHB A;  1NH2 B;  3CCM V;  4NTY A;  1SES A;  1VQN V;  2Q67 A;  3AG3 C;  2YID A;  2YXL A;  1L8D A;  3OT7 A;  3SPI A;  1BQ0 A;  4F6R B;  4U7O A;  2OYQ A;  5H9C A;  2YEV A;  3F5W C;  1IUR A;  3JAK A;  3IFX A;  2Y48 A;  2ZKO A;  5LYJ B;  3E8H A;  4U7N A;  2YDE A;  2EIN B;  3B77 A;  2QKS A;  2RJZ A;  5LXT A;  3CMA V;  5L3E A;  5LMN B;  4YJ2 B;  4WBN B;  1THZ A;  1P84 F;  1K7D A;  5JJN B;  3CRM A;  4KUM A;  4RQF A;  3ABK C;  3UO2 A;  1S5J A;  3G4S V;  3OR7 C;  4JI8 B;  3UCS C;  4O4J B;  1EM1 A;  1Y76 A;  4O4H B;  2B1G A;  5CA1 A;  1VQ6 V;  2CGO A;  5E1A C;  3HKD A;  1R3K C;  4ICG A;  3TXS A;  1OCC B;  4CZZ A;  4E4E A;  4PV1 B;  3OE7 G;  5JQG B;  1VEW A;  2ZR3 A;  3ASO C;  1QVF U;  5KHK A;  2FML A;  5KUM A;  4DV6 B;  1A32 A;  2PGG A;  3LUT B;  4JAU A;  4DW0 A;  4DR2 B;  3W7S A;  4XDJ A;  3P32 A;  5B5E Z;  3ABM B;  4YHH B;  1Z5V A;  4X62 B;  5L3G A;  1XNR O;  4H13 B;  2NR5 A;  3CRC A;  4PD4 F;  5CBF A;  1IBL O;  2OTL V;  4DO2 A;  3JAK B;  4LR3 A;  2W0X A;  2ZQM A;  4XBF A;  4FZ0 A;  5LGN A;  4OGQ B;  1SQG A;  3EFF K;  4X1K A;  1DTO A;  1QHT A;  2LQT A;  2Z5U A;  4J41 A;  1XL6 A;  3ZHS A;  1XMQ B;  2WA3 A;  1HR0 B;  5LXT B;  3D36 C;  5IY5 B;  4Q6G A;  4B3R B;  4DR3 O;  1FFX B;  1WLE A;  3J7A U;  2A9H A;  3JD3 A;  2PY5 A;  4TV9 A;  2HG5 C;  3E8F A;  2A06 H;  4MTF A;  1QLE B;  4HNA A;  4UCU A;  4B7E A;  1Q90 D;  3RFR A;  3W7U A;  4DK1 A;  3MHS C;  3ZHQ A;  1Y76 B;  2IU3 A;  4BIO A;  3ETQ A;  2PI5 A;  3OR6 C;  5CA1 B;  3AK2 A;  5KUK A;  4G27 B;  1JJO A;  2Y69 C;  4L87 A;  2F43 G;  1NTK H;  1EZV H;  3HKD B;  5K1X A;  4PA6 A;  5IJ0 A;  1PL0 A;  1HNW O;  4JI4 O;  4LFC O;  2EJ7 A;  3PJS K;  2L35 A;  2JK5 C;  2AXT Z;  3OM3 B;  1SQQ H;  1OHH G;  1XHX A;  3JD1 A;  4DR4 B;  1GK9 A;  2DJV A;  4IT5 A;  2P06 A;  3CCR V;  3A0R A;  3ABT A;  4MW8 A;  3ZHU A;  4DR5 B;  5C93 A;  3RN4 A;  2M7W A;  3FB5 C;  2FTK A;  3RGB A;  5BY1 A;  2V7Q G;  3LSQ A;  3LNM B;  5CA0 A;  1YJW V;  2XAH A;  2NLJ C;  4E2L A;  2FYU H;  2ZXW B;  1PNK A;  5BR8 O;  1VQ7 V;  5D5P A;  5KLV H;  4X1K B;  4PI2 A;  1N36 O;  2EIM C; 
#chains in the Genus database with same CATH homology
 1AB3 A;  1YZB A;  1IBL O;  1J5E O;  3SDL A;  2VQE O;  3R66 A;  2AGA A;  4JI8 O;  4JYA O;  2UU9 O;  5FLX N;  2ZM6 O;  3JAM N;  4X65 O;  4DV0 O;  1HNX O;  1IBK O;  3F5T A;  4OPH A;  2Z0A A;  4LF5 O;  1N34 O;  4LFA O;  4OX9 O;  4AQY O;  2UUB O;  3J81 N;  4DR4 O;  3O65 A;  4LF8 O;  4DUY O;  4NXM O;  2ZKO A;  4DR3 O;  4JI6 O;  5LMU O;  3J7A U;  4DR5 O;  1X59 A;  4DR7 O;  3T1H O;  4DV7 O;  4JI7 O;  1NS1 A;  2E5L O;  2UXB O;  4KHP O;  2LW7 A;  1XEQ A;  2UUC O;  4LF4 O;  1XMO O;  1N33 O;  4X62 O;  4DV4 O;  4OPA A;  4DR1 O;  4DV3 O;  1IBM O;  3RT3 C;  4GKK O;  1R6T A;  4X64 O;  4X66 O;  4DR6 O;  4LF6 O;  4JI2 O;  1HNW O;  4JI4 O;  4LFC O;  2UXD O;  5H5N A;  4B3T O;  4DV2 O;  1KUQ A;  3J80 N;  4DV6 O;  1F7Y A;  4LF9 O;  2HHH O;  4DUZ O;  5BXZ A;  5IWA O;  4JI5 O;  1G1X B;  4DR2 O;  4GKJ O;  2JRI A;  4LFB O;  5A2Q N;  5LL6 Y;  4JI3 O;  1XMQ O;  2DJV A;  1HR0 O;  4YHH O;  5IT9 N;  4A5U B;  4LF7 O;  4B3M O;  1FJG O;  4B3R O;  1DK1 A;  4B3S O;  3M8A A;  1A32 A;  2DOS A;  2F4V O;  5BY1 A;  4JI0 O;  1FKA O;  1R1B A;  2FKX A;  4DV5 O;  1D2D A;  3T1Y O;  3OTO O;  1XNQ O;  1HNZ O;  4DV1 O;  1N32 O;  2N74 A;  4YY3 O;  5BR8 O;  5LMN O;  2VQF O;  1FYJ A;  1I94 O;  4K0K O;  4JV5 O;  2UXC O;  1AIL A;  1XNR O;  2UUA O;  1N36 O;  4NXN O;  4JI1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...