4LFAO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfaO00
1R1BA 4JI3O 4GKJO 1FYJA 4X65O 1AILA 4JI7O 2UUBO 4DR2O 2UU9O 4OPHA 2ZKOA 4X64O 3RT3C 1XMQO 4X62O 4OPAA 1HNWO 4DV7O 1FJGO 1N32O 4A5UB 4LFBO 3F5TA 1A32A 4GKKO 1IBKO 4KHPO 1NS1A 4DV3O 4AQYO 2ZM6O 5LMUO 2Z0AA 1FKAO 2UXDO 1I94O 1R6TA 2HHHO 1HR0O 5LL6Y 1IBLO 4LF6O 2UXBO 2N74A 4YHHO 4JI5O 5A2QN 4LF8O 3J7AU 2AGAA 5BY1A 4DUZO 4DR3O 4LF7O 4X66O 2LW7A 4NXNO 1XNRO 4DV6O 4LFCO 4B3RO 5IT9N 4JV5O 1XEQA 2UUAO 4NXMO 3OTOO 4OX9O 2DJVA 1G1XB 5IWAO 2F4VO 4LF9O 4DR1O 2UXCO 4JI1O 4LF4O 4JI2O 4DV1O 2FKXA 4DR7O 1HNZO 2VQEO 5BR8O 4DUYO 1DK1A 4JI0O 3JAMN 1F7YA 4B3SO 5LMNO 4DV4O 5BXZA 1D2DA 1N33O 1J5EO 1N34O 4DR5O 1XMOO 4YY3O 4JYAO 1N36O 4B3TO 4DR4O 3J80N 3J81N 4K0KO 4DV5O 1KUQA 4LFAO 3O65A 2E5LO 5FLXN 3M8AA 4JI6O 4JI8O 1X59A 1IBMO 4JI4O 2VQFO 4B3MO 1HNXO 3T1YO 1YZBA 2JRIA 2DOSA 3R66A 1AB3A 4DR6O 4LF5O 4DV2O 2UUCO 3T1HO 4DV0O 1XNQO 3SDLA 5H5NA
chains in the Genus database with same CATH superfamily
4MVUA 3LNNA 5B1OA 4TV9A 2YSUB 2IW5A 2ZINA 2P4KA 3CMEV 1BSMA 3CPWU 3ZCCA 4KHPO 2Y48A 2QJ1A 4Q6GA 3S3WA 4CZZA 4AILC 2CDYA 3DXRA 2PI4A 2ADPA 4B3TB 2QGNA 1OCZC 2B9ZA 3FYEB 1Y76B 4K0KB 3ZJZA 2GDSA 2R72A 4LWSA 4X62B 3CRCA 2A9HA 1V54C 3ABLB 1QR9A 1QLEC 3BA9A 2EJ7A 2YXYA 2OT5A 5L3FA 3JAKA 4HBNA 4B7EA 4GYCB 3QO5A 3K08A 1SQVH 3MHHC 5EYPB 1XI1A 1VF6C 1SQPH 2LFRA 5DECA 4K8ZA 1HWYA 2DJVA 1F4NA 1XBLA 1WLEA 2GUZA 2ZE7A 5JH7B 4NXNB 1R3JC 4FLVA 4I7ZB 4H13B 1Z5WA 4TQFA 3TCUA 1P4RA 4PA3A 1H8HG 1I08A 1MMMA 3K5LA 3RBZA 4TQDA 2DYSB 3CCMV 2PY5A 4IHJA 4DR5O 5B3SC 3QVNA 4JAVA 2UXXA 4O4HB 1SC5B 5CA0A 3KG2A 4QE7A 3AG2C 4JI6O 4DV4B 5JQGB 3WG7B 1GN3A 2HG5C 3D36A 4JYYA 3DSQA 3BABA 1KC8W 4YY3B 4X1KB 5LHIA 2ZE5A 1S0VA 1WAZA 1XDCA 2A06H 1YF2A 4IYIA 1R1BA 2EIKB 3P3NA 4U3JA 1ZL8A 3OUSA 2YICA 5B1NA 4CC5A 2WPDG 1G8MA 1E79G 2F95B 2QWRB 4P9OA 4PA7A 4MT8A 4LFBO 1Q86W 2Q68A 4AQYO 3ABTA 4I50B 4O4JB 5A9GA 2UXNA 2Q69A 2W0XA 2WAMA 2HHHO 3SPHA 4Z2WA 4BR6A 3OMIB 1GN4A 1AROP 5KLVH 1QR8A 1YVWA 4DRXA 5KHJA 4YHHO 3CSXA 1YTFD 5IYBO 2AZ2A 4X1IB 3T1HB 4HAMA 4X66O 1VEWA 1K5QA 4X20B 5JJEB 3R65A 3BCCH 4K35A 3FB7C 2DYRC 1K34A 4YJ3A 4PI0A 3G4SV 1XOUA 4PV1B 4JTCB 1GMGA 4J7ZA 3E2EA 5IY5B 1VQPV 2M6YA 4I4TB 1OCRC 2Y69B 4PA4A 4MVSA 3SPJA 1G6UA 3K58A 2PUSA 2VQEO 4YXWG 1H8EG 4MTXA 5H6RA 3K0GA 2F4VB 1OCOB 3STLC 2IJHA 1DLBA 5KA6A 3OR7C 2QA4V 1HP8A 1GM8A 2XAHA 3J80N 1WB8A 5CA1B 1D5AA 3FD9A 5JVDB 4W4KA 5FL7G 4FIPC 2QKSA 3UM7A 3GVMA 4PELA 4LF5O 4PA9A 4DV2O 4EFBA 4J7JA 3SDLA 1Y74A 2QWQB 4UV8A 1EBOA 2CH7A 5JJJB 2UXCB 1NH2B 2P22C 3T1YB 2JEXA 2O57A 3ASNC 2UU9O 3CCQV 3G71V 5BMVA 2QR4A 1XMQO 2K9PA 4LNUB 2ZD9A 1VF5B 2JK5C 1J5EB 2H94A 1NS1A 4DV3O 3B09A 3E22B 4KL1A 1YHQV 3BAAA 1M1KW 3EHBB 4GUNA 1I94O 2FL4A 1X4TA 3HKDB 1OCCC 1WA8B 1FJGB 1S5LZ 3W7XA 1IXBA 1OCZB 3LNMB 5FPRA 4CS4A 3K9SA 4J41A 5LYJA 2QSAA 1YEWA 2UXDB 2R9AA 1V54B 1VQLV 1QLEB 2F66C 2LW7A 3K5OA 4JI7B 1Q82W 5L3GA 2YI9A 2OTLV 3IC7A 4IL6Z 4FLYA 3P3PA 4D7SA 4YIOA 1H2GA 3LSUA 4ZHQA 1MOFA 4NXMO 1XL6A 3JSNA 4DUZB 2FMLA 2CAZC 1K3EA 4BW9A 1FFTB 2IU3A 3NXSA 4RUEA 4DV1O 3MDSA 1WJZA 2VS0A 1R3KC 2E74B 1N34O 4JI1B 5KMGB 3UO2A 4LF7B 3MHSC 1KUQA 3FB8C 4JGSA 4EEQA 2IU0A 2AXTZ 5B3SB 1FPOA 1HDJA 3D3QA 2RNBA 1FFXA 4RO2A 1N36B 1B6QA 4XBFA 2ZCEA 1JJOA 3AG2B 3K9AA 3LDCA 3HPLC 4I0XB 2X0LA 4RUFA 4I5SA 1SQQH 1JMKC 2YC0A 4UV9A 4R6ZA 4MVQA 3IGAC 3SJCC 2XAJA 4BW5A 4JTAB 3LDDA 1GK9A 3RVZA 3ZHQA 4LBEC 1IDSA 4DV5B 4RQEA 4LFAB 1GM7A 2H8PC 1Z2GA 3AK1A 3HKEA 2LW1A 3ZRWB 4GCZA 1K33A 2A3QA 1XHXA 2ODMA 4GZRB 4LF8O 2B1IA 4MTOA 4IT5A 3SYQA 1SKVA 2Q0AA 4JYCA 1YDXA 1XNRO 4NYKA 1S72V 2F93B 2N04A 4CH5A 2PGGA 3Q4HA 3JATB 4G27B 4I9QA 1XEQA 4JZ2A 3OTOO 5C8YA 5D5PA 3H9VA 5CMUA 2DYRB 5KUKA 3WB2A 5LOVB 2VRZA 4LF4O 4UB8Z 2HVJC 1JA8A 3D8CA 1JR9A 1FS0G 1GH6A 4IGGA 3AG3C 4DUYO 1R3LC 1Y76A 2YS8A 3SGIA 1GM9A 3FFQA 2B1GA 4JTDB 2IH1C 2IM9A 4CH3A 3SJAC 1S77D 2Q4PA 3ML0A 1FXKC 2N05A 3JCZA 1JVMA 3T4DA 4WCEV 4WBNB 3ZRVA 3R66A 3QO7A 4PJ0Z 4DR6O 2C2AA 1K4CC 5KHGA 5EYPA 4DK0A 4O4IB 2RDCA 1M93A 4F4LA 3JYCA 3ZN0A 3ASOC 1HNXB 2ZNJA 4OPHA 2MW2B 4X64O 1SQFA 3RYCB 5JH7A 2GTSA 1QNMA 2JJ1G 4PHZA 4TV8B 2P7TC 2KG7A 1KQSU 3ASNB 3LDEA 3I56V 4KFMA 3RYHB 4O2AB 4FZ0A 3CCLV 5HFLA 3F7YC 2IJIA 5CB4B 3E89A 2BOBC 4CS3A 4X9QA 1OCCB 2CGOA 5JQGA 2WLKA 3TXQA 1AR4A 1HR0B 1R6NA 1ENVA 4X1KA 2EZOA 1SA0B 1RFYA 4JI5B 1P7GA 3H1IH 1R6KA 4E2LA 1EZVH 2DMXA 4B7KA 5KHKA 2X6BA 5LMUB 4B3RB 2Q8VA 2QTSA 4DR7O 2R9RB 5BR8O 4FLUA 3FYIB 4JI0O 2CE4A 2YEVB 4I50A 4O4JA 4LF9B 3ETEA 3N2GB 3SYPA 3K04A 3CRQA 4NVPA 2ZIOA 4DR4O 3UCSC 1U97A 2ATKC 3ABKC 4UCUA 5JCOA 2DQ3A 1K97A 4G2KA 5FLXN 3ZRSA 5H9CA 5DM6V 1KECA 1M9NA 2EULA 4JI4O 3T1CA 4FLXA 5IYZB 2AW9A 4L87A 3G67A 4YIPA 4X20A 2R70A 5EIBC 2PI5A 2LGWA 4GX2A 2EIMC 3K0DA 3ICXA 5AG2A 4B3MB 4MVMA 4I4TA 1WPBA 3E8FA 2PZSA 2NN4A 3M7MX 4B08A 3VQVA 4TWKA 1A32A 1IBKO 3A0HZ 2E3CA 1SESA 3TK1A 1FKAO 2LP7A 3OD4A 4TOIA 3SPGA 3U10A 4PDMA 5EBLC 3OGCC 1NTKH 4KHPB 1B06A 1SRYA 4LF6O 2Q7EA 3GWOA 5KX5B 5JJNB 1NR7A 2DWEC 5JVDA 1NU1H 4HYOA 2QTOA 4JI3B 2HKOA 2WA4A 3K3WA 4N21A 4JPRA 1FAFA 3OE7G 4LFCO 2QEXV 3SPIA 4EKWA 2IJKA 3B40A 3P32A 3CC2V 1NVPB 1F23A 1URFA 1OHHG 4LNUA 3TXSA 4WFHA 3E22A 5E79Z 5LMNO 1Y6XA 4XDKA 1IBLB 2Y0PA 1XUQA 1XMOO 1K9MW 4FFKA 1WA8A 3AG3B 5BZBA 4B3TO 3OFNG 3OGIB 4R7CA 4K0KO 2W6JG 3I55V 1JX9A 3M8AA 3L9DA 1VQ7V 1Q7YW 1FD9A 4DR5B 4WFFA 1S76D 2KKWA 1XNQO 5EZYB 1PNLA 1KP2A 1FXKB 3L74H 4JI6B 5LHGA 4UVBA 2GSMB 2OCHA 1QQCA 4FJCC 4H37A 2YUAA 2OWOA 1WP8A 1AI6A 2CUGA 3JD2A 1B3QA 3ASOB 4A5UB 1K92A 3BEHA 3IJ4A 4IYHA 3T4ZA 4I9WA 1TUBA 3I5DA 1BCCH 1VF7A 4WFGA 2DW4A 3W7UA 4LFBB 1AVMA 5KMGA 3SYAA 2VQFB 1Q6HA 4AQYB 1QCEA 3OAAG 1H2LA 2NNUA 2JEUA 4WF9V 4UB6Z 2HHHB 2DQ0A 1NTMH 3A0BZ 1WB7A 2RJZA 2Q6AA 4J7KA 2V7QG 1BT8A 4OX9O 1HW7A 1MNGA 3CCEV 1J95A 3FAVB 4DV7B 1QU7A 5IWAO 4RWUA 3ETQA 1K4DC 5B66Z 4JI2O 3QNEA 3JARB 1AJNA 4LH7A 5IJ0B 2BOCC 1CP9A 5LHHA 3JAMN 3ZMUA 2OTJV 4I55B 3BRCA 1JPXA 2GV9A 3ABUA 4ZOLB 2VQEB 1KP3A 3O65A 2ZDIC 1YXBA 4U7OA 1YIJV 1ZWIC 3LUTB 3KCYA 4P9PA 3OMNB 2Q9LA 3ABKB 3APQA 2QM7A 1H2NA 3RN4A 2EINC 1W59A 2QKAA 1NT2B 3RYIB 4DV0O 3T1HO 2Q5ZA 3JATA 1Y66A 2CK3G 1S5JA 1VQOV 4X1YB 2P06A 4TUYB 4QE9A 4H44B 3BVOA 5GTHZ 2X7RB 2CGNA 2Y0IA 3W7WA 1MABG 3OM3B 4DV2B 2WLJA 1RSOB 4LH6A 2F1MA 3MAQA 3B2EE 2UU9B 3E86A 5LGNA 2V4DA 4G28B 4YJ2B 1XMQB 2E5LB 1YITV 1XQ8A 2ZT9B 2H3OA 1W0JG 4DV3B 2UXBO 1WP7A 5B1BC 2M7WA 3RWRD 1RPRA 1WPXA 3DXRB 4X65B 1F51A 2NR5A 1PNMA 4WBNA 2FYUH 1PD3A 4UCTA 3OW2U 5L3CA 5IT9N 2JS3A 2UUAO 4O4IA 1IURA 2KSDA 5LP6C 1N32B 1AI4A 4R50A 3G80A 1ZX3A 1JQ0A 2GBOA 1I7FA 3K59A 2EILC 2UXCO 3RYCA 2QE7G 1YCIA 1RM1C 4MVZA 4NXMB 1KKCA 3E35A 4TV8A 2YIDA 1KMIZ 1F7YA 4BAYA 4HZ3A 3RYHA 1J5EO 3DTUB 4WFAV 3FKSG 4O2AA 3EVKA 4J42A 3WB0A 3JALB 5CB4A 4GX5A 1N34B 2EBOA 1YZBA 2DOSA 1AB3A 1MG1A 4LP8A 4IHJB 4BIUA 1VQKV 1SA0A 5F2VO 4U3FH 1QLNA 1RP3B 2LFSA 1H2MA 4JI7O 4DR2O 5IJ9B 1I5YA 2KQXA 3A2FA 3B8NA 3JAWB 3ZS8C 3THOA 3DC6A 5H2FZ 1ZSPA 3L70H 2BSKB 1KD1W 2YEVA 1VQ4V 2XAFA 3N2GA 1IBMB 2EZPA 1NVPD 3AG1C 5KHHA 2P6JA 1OJHA 1EN5A 2OIGA 3GB7C 2WLIA 1TUEB 4LF7O 1ORQC 1ZTEA 4OXSA 5KUMA 5IYZA 3CX5F 5KAIZ 1VQ9V 4ZI7A 2L35A 5C93A 4WFBV 3ABMC 4FVMA 4ZBMA 4AI8A 2XAGA 4O2BB 4FFBB 4BIOA 3E83A 2IJJA 4DRXB 4QJFB 5FNVB 1XNRB 2ZM6B 3E8BA 2PYJA 1UPGA 2FKXA 1L0NH 3OTOB 1H2KA 4YJ3B 3W7SA 1AP6A 1UFIA 3SJQC 1EN4A 1D2DA 3AEIA 3CWBH 4JASA 3D3IA 1JFFB 3ZX6A 2WWWA 4DV5O 4LFAO 4DUYB 3L71H 3SYCA 4GLXA 5KX5A 1K7DA 1N0NA 5J9PC 4JZGA 5H6QA 2ZR2A 4PA6A 2JRIA 1VMGA 1OCRB 4CBCA 1MSWD 1T5EA 3BY6A 4RAIA 3SPCA 4GKJO 1Q6IA 2BTOA 4EB6B 1UJWB 2JGUA 4GX1A 2ILMA 2EINB 2RN9A 4H33A 3BPZA 4DR6B 2BE3A 2JGDB 4MVRA 5EBMC 2YXHA 2P4VA 2GHYA 1I5XA 5IYCO 4OPAA 1HNWO 1WN7A 1S5HC 4GKKO 2E76B 3H1JH 4X8AA 3OEHG 4X64B 1XL4A 4E4EA 2OYQA 2DN9A 1QVGU 3K06A 4UUJC 4J11A 3A8TA 4WFEA 2OCCC 3RFRA 1YTFB 2F43G 4QPKA 3PN1A 2YIBD 5EC1C 2AHZA 3JSLA 1BQ0A 4DV6O 3ZN1A 1EFRG 5B1BB 3C3TA 4BWAA 5EZYA 1U96A 1FXKA 2ADQB 1QBZA 4ZKIA 1G1XB 3EXAA 5IYDO 4O4HA 3H01A 4MW8A 4MW3A 2QM8A 5LP6B 1L0LH 1HNZO 1KU9A 4LR3A 2QWNB 3CCSV 2EILB 2CTQA 2ITDC 5DN6G 2FB5A 1RM1B 3IAYA 4FM2A 3ZHVA 3DC5A 1BHAA 4DR7B 1AJPA 1XREA 5BR8B 1W2BU 3TGUH 2YDEA 1PP9H 1PL0A 1CEZA 1GKFA 5JCOC 1V9PA 2IBZH 4DR4B 2UUCO 4UCSA 4QIWF 5CA3A 1TVKB 3HR0A 3OT7A 2XHBA 1MSDA 4N23A 2QDOA 1NH2D 3C90A 2UUBO 4JI4B 5L3EA 4FK5C 2HP8A 1P84F 3FAVA 2LQTA 2ZKOA 1GN2A 4CH6A 4B3SB 4ABMA 4NTXA 4F6RB 3WU2Z 3F5TA 4X1IA 3RW0A 3JARA 5IY5C 2WLNA 5IJ0A 3QF7A 2VWKA 5LMUO 2YIBA 5ITZB 4KUMA 4JI8B 4I55A 1P49A 2EX3A 5J2UB 2ZE6A 2XT9A 4NTWA 2AHYA 3CCJV 2RQ6A 2ZIMA 2W6IG 5TISZ 3SJBC 4ZOLA 3JD4A 4DR3O 1GRJA 3AG1B 4J80A 1H38A 4LF6B 3OTFA 3HKEB 3RYIA 4JV5O 1AP5A 3L73H 4X1YA 1MZFA 4TUYA 4DR1O 3ABMB 2CTPA 3OMAB 5CA1A 1VQMV 1TGOA 1NJIW 2WLLB 1RSOA 5GTIZ 3CJHB 5GW7A 1XHZA 5E1AC 1DK1A 1EM1A 3VOUA 2X6AA 2Q67A 1MA1A 3JCUZ 5C8YB 3CC7V 1N33O 1GAXA 4PDLA 4JYAO 4YJ2A 1PPJH 3HB3B 1K73W 5LA6B 2AZ0A 4J10A 4IIJB 1SZTA 5LMNB 5KHIA 3ZHUA 3CCRV 1Q5OA 2D3OW 2VWJA 1XMOB 2JDIG 1W0KG 1DF5A 4FLTA 1Q3EA 1VIBA 1PKXA 4JI3O 4Z1VA 3ZHSA 2PYLA 3HKDA 1VQ5V 3U0ZA 4FM0A 4UVCA 1WNSA 3JASB 2WA3A 1BHBA 3RT3C 1XNQB 4X62O 4H0LB 1M57C 4QNHB 4MTGA 2CTRA 4UXNA 2HJDA 5EC2C 3AK3A 3D36C 4FLZA 1OZ0A 3K79A 3JD3A 5LL6Y 5CBHA 1IBLO 2ARHA 3W7TA 2PF4E 3AK2A 2W0FC 1VF6A 1AI5A 2KG7B 3HKBB 3JALA 2HLDG 3N2KB 5J2TB 1KKDA 1N0JA 2DE0X 4K8XA 3LSQA 4O4LB 2OCCB 4NB5A 4NXNO 2RMKB 4GX0A 5L3DA 1LUWA 1AR5A 1GO3F 3CEIA 2CTWA 4C7UA 4CC6A 1I0HA 3CRRA 5EK0A 2XASA 1E1QG 4LC1A 3NR7A 5IJ9A 3B8MA 2FTKA 4EFEA 1DTOA 5DEDA 3JAWA 2HFEC 3RVYA 5HFMA 4OX9B 5CN0A 2EIJC 1PM9A 4Q20A 2GTAA 5IWAB 4DV4O 3P30A 2YI8A 1Q90D 4YHHB 4K3AA 2BSKA 1GN6A 4JI2B 4YY3O 1GTOA 4QGPA 4I0XA 2MK3A 1O9HA 4X66B 2BTQB 5GONB 4PD4F 4MSWC 4MVOA 3HKCB 2VQFO 1IX9A 3TJTA 1US6A 2PTMA 3PJSK 1S3JA 3JD0A 2R9IA 1JCHA 3CXHF 5LGUA 4ICGA 1ZLZA 3BFRA 3KKYA 5CBGA 4O2BA 4FFBA 4FMTA 2JIZG 3ZBHA 5K1XA 3ZRWA 1JOYA 2KB1A 3BHPA 5FNVA 4DV0B 1IVSA 5KAFZ 1YJWV 4DV7O 1NQTA 2A7WA 2ZXWC 4JAAA 5B5EZ 3CHXA 3RYFB 1DF4A 2LGQA 3VQXA 4XDJA 4HNAB 2XAQA 1BMFG 3F5WC 1Z5VA 4X89A 3UT5B 1VP7A 1JFFA 3BA8A 2N74A 1QVFU 4LF5B 1TA8A 4L8JA 2EIMB 1IZ3A 2QKCA 5LOVA 1EZJA 3STZC 5FPOA 5LXTB 4UVAA 3CCUV 2Z5UA 2YIAA 3DGEA 3K57A 2UXBB 2X6CA 2E75B 2WSSG 2ZDIA 1JJ2U 1THZA 1TAEA 1IXMA 1F4MA 3ZIAG 4EB6A 1MZEA 4TV9B 2F4VO 2YXLA 1AI7A 1ROPA 4UCOA 3VBBA 1YI2V 2JGDA 2XNDG 3GWKC 1I94B 1LUVA 1M4UA 4FLWA 2DWDC 2UUAB 1CPYA 3OEEG 3CRMA 2HVKC 4DO2A 3CB2A 1KYOF 4BIZA 1BGYH 1EN6A 3L75H 4LWSB 3H1KH 1M56C 3E8GA 4XDLA 5K1PA 1AR1B 3J81N 1K8AW 4MS2A 5CBFA 1DGSA 3JAKB 3ZMZA 2E5LO 2Q0OC 3AG4C 4ZIBA 1D5NA 3RGBA 3T1YO 1SZXA 2QWOB 1Y4MA 2Z3YA 1VQ6V 3JD1A 1B04A 5D5QA 1YSCA 3QTCA 4X65O 1N8RW 1NZ6A 3KCXA 2GUZB 4NR1A 4DV1B 2P90A 1BL8A 1FJGO 1N32O 3K5MA 3MD0A 3A0RA 5LP6A 1SF9A 4U7NA 4DR2B 3ZHRA 2Z0AA 2G38A 2UXDO 1M57B 1R6TA 4JAUA 4RQFA 5LGTA 1SQXH 2JJ2G 5CA0B 2F23A 5A2QN 4DUZO 2IH3C 1M5IA 3QG5A 4W4LA 1TUBB 3OR6C 2Q7GA 2B5UA 4U3JB 1ZL8B 3APOA 1TVKA 3O9OA 3X2QC 4AHCA 1KBHA 2JS5A 3IFXA 5B1AC 2OIEA 3KZIZ 1RPOA 3WB1A 2Y4UA 1SS3A 4JI1O 4DW1A 4F6RA 1BZKA 2XOKG 1V55C 3CE2A 1Q6UA 5BXZA 2LO1A 2Q7HA 5ITZA 4ASUG 2QM4A 4FM1A 4LF8B 2ETNA 4UCRA 2EIJB 3OUFA 1N36O 3H1LH 2HR3A 2WLMA 2RCVA 5J2UA 1P7BA 3S3XA 5L3BA 1IBMO 1BS3A 1ZAUA 1L8DA 4TT3G 1VQ8V 3ZHTA 3IC9A 1K5SA 3TETA 3M99B 1AILA 2JVDA 4LF4B 3FX7A 3UQ8A 3H1HH 3FB5C 1LR1A 4P2ZA 1YJNV 1Q43A 3CRAA 2ZE8A 4GKJB 2WLLA 3CJHA 4J9ZB 2ZM6O 3ABLC 4DK1A 3N27A 3VQWA 1KB9F 3E8HA 2L6LA 1SQBH 2ZXWB 4KP4A 1HNWB 4DW0A 3SR2C 5LA6A 4GKKB 4JYBA 4IIJA 2Q73A 2AGAA 5EBWC 3UKMA 2XTAA 3CMAV 1PV0A 1FXVA 3ZMVA 4PI2A 4UCVA 1Y74B 1NI8A 2CH7B 4D7TA 2ZQMA 4Z1MG 3G6BA 1Q81W 1SQGA 2V1DA 1PL4A 3CP1A 1G4YB 5BMVB 3B77A 1CXZB 1OV9A 4DV6B 2ZR3A 1SERA 2ZNIA 3JASA 5LBQA 2WLHA 2DYSC 3FB6C 4D6TH 4QPJA 4R8CA 3CXCU 2A79B 2HJFC 2QWPB 4DXWA 1QHTA 3WG7C 3U11A 1N4CA 4CS2A 3T2MA 1HNZB 3WFVA 5LYJB 3CCVV 1NTZH 1M56B 1NKDA 1X59A 3EFFK 2EIKC 1PNKA 3HKBA 2P5OA 1HNXO 3N2KA 5J2TA 4NTYA 3ETGA 4O4LA 4TSFG 2EJRA 2XUMA 1YJ9V 5H5NA 4ZHQB 3AG4B 1E1RG 1FYJA 4P30A 4PDVA 2LJ2A 2UUCB 5EIBD 4JI0B 4X88A 2Y4TA 4CH4A 5IDJA 2UUBB 2HEPA 3UO3A 3K5NA 3K03A 3CC4V 1NR1A 3B4SA 1H2SB 1Q8IA 3ZMSA 4FZ1A 1HR0O 3CD6V 3F7VC 3VQYA 4JI5O 3J7AU 2BTQA 5GONA 2BCCH 5BY1A 3ZEDA 4KXRA 1NBMG 4J9YB 1FFXB 3HKCA 1SETA 2Y69C 1L1FA 1VQNV 1ZUQA 4B3RO 2A0LA 2P67A 3C3SA 3ETDA 3QO8A 4UFZA 4GT1A 1LNQA 4JF3A 4DR3B 5JWPA 3ZRXA 1IBKB 4LF9O 4OGQB 2WLIB 4F6EA 1O9GA 4FPPA 3AG7A 1AJQA 1OCOC 3X2QB 1COWG 4NKGB 3SYOA 4JV5B 4ZI7B 5B1AB 1R73A 1BQZA 4B3SO 4DYLA 4DR1B 3RYFA 2NLJC 3CS5A 4LCUC 1R3IC 1BE3H 1V55B 1XILA 1Y67A 2ITCC 4HNAA 3UT5A 3CYOA 3ZMTA 4MTFA 2K1EA 1FXHA 4JI8O 4PDRA 2D2CB 1M90W 4LFCB 1N33B 4B3MO 5IE9A 1VARA 3L72H 4JYAB 3LSSA 5LXTA 3G6EV 3Q4HB 5KA5A
chains in the Genus database with same CATH topology
1R1BA 4JI3O 4GKJO 1FYJA 4X65O 1AILA 4JI7O 2UUBO 4DR2O 2UU9O 4OPHA 2ZKOA 4X64O 3RT3C 1XMQO 4X62O 4OPAA 1HNWO 4DV7O 1FJGO 1N32O 4A5UB 4LFBO 3F5TA 1A32A 4GKKO 1IBKO 4KHPO 1NS1A 4DV3O 4AQYO 2ZM6O 5LMUO 2Z0AA 1FKAO 2UXDO 1I94O 1R6TA 2HHHO 1HR0O 5LL6Y 1IBLO 4LF6O 2UXBO 2N74A 4YHHO 4JI5O 5A2QN 4LF8O 3J7AU 2AGAA 5BY1A 4DUZO 4DR3O 4LF7O 4X66O 2LW7A 4NXNO 1XNRO 4DV6O 4LFCO 4B3RO 5IT9N 4JV5O 1XEQA 2UUAO 4NXMO 3OTOO 4OX9O 2DJVA 1G1XB 5IWAO 2F4VO 4LF9O 4DR1O 2UXCO 4JI1O 4LF4O 4JI2O 4DV1O 2FKXA 4DR7O 1HNZO 2VQEO 5BR8O 4DUYO 1DK1A 4JI0O 3JAMN 1F7YA 4B3SO 5LMNO 4DV4O 5BXZA 1D2DA 1N33O 1J5EO 1N34O 4DR5O 1XMOO 4YY3O 4JYAO 1N36O 4B3TO 4DR4O 3J80N 3J81N 4K0KO 4DV5O 1KUQA 4LFAO 3O65A 2E5LO 5FLXN 3M8AA 4JI6O 4JI8O 1X59A 1IBMO 4JI4O 2VQFO 4B3MO 1HNXO 3T1YO 1YZBA 2JRIA 2DOSA 3R66A 1AB3A 4DR6O 4LF5O 4DV2O 2UUCO 3T1HO 4DV0O 1XNQO 3SDLA 5H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1B A;  4JI3 O;  4GKJ O;  1FYJ A;  4X65 O;  1AIL A;  4JI7 O;  2UUB O;  4DR2 O;  2UU9 O;  4OPH A;  2ZKO A;  4X64 O;  3RT3 C;  1XMQ O;  4X62 O;  4OPA A;  1HNW O;  4DV7 O;  1FJG O;  1N32 O;  4A5U B;  4LFB O;  3F5T A;  1A32 A;  4GKK O;  1IBK O;  4KHP O;  1NS1 A;  4DV3 O;  4AQY O;  2ZM6 O;  5LMU O;  2Z0A A;  1FKA O;  2UXD O;  1I94 O;  1R6T A;  2HHH O;  1HR0 O;  5LL6 Y;  1IBL O;  4LF6 O;  2UXB O;  2N74 A;  4YHH O;  4JI5 O;  5A2Q N;  4LF8 O;  3J7A U;  2AGA A;  5BY1 A;  4DUZ O;  4DR3 O;  4LF7 O;  4X66 O;  2LW7 A;  4NXN O;  1XNR O;  4DV6 O;  4LFC O;  4B3R O;  5IT9 N;  4JV5 O;  1XEQ A;  2UUA O;  4NXM O;  3OTO O;  4OX9 O;  2DJV A;  1G1X B;  5IWA O;  2F4V O;  4LF9 O;  4DR1 O;  2UXC O;  4JI1 O;  4LF4 O;  4JI2 O;  4DV1 O;  2FKX A;  4DR7 O;  1HNZ O;  2VQE O;  5BR8 O;  4DUY O;  1DK1 A;  4JI0 O;  3JAM N;  1F7Y A;  4B3S O;  5LMN O;  4DV4 O;  5BXZ A;  1D2D A;  1N33 O;  1J5E O;  1N34 O;  4DR5 O;  1XMO O;  4YY3 O;  4JYA O;  1N36 O;  4B3T O;  4DR4 O;  3J80 N;  3J81 N;  4K0K O;  4DV5 O;  1KUQ A;  4LFA O;  3O65 A;  2E5L O;  5FLX N;  3M8A A;  4JI6 O;  4JI8 O;  1X59 A;  1IBM O;  4JI4 O;  2VQF O;  4B3M O;  1HNX O;  3T1Y O;  1YZB A;  2JRI A;  2DOS A;  3R66 A;  1AB3 A;  4DR6 O;  4LF5 O;  4DV2 O;  2UUC O;  3T1H O;  4DV0 O;  1XNQ O;  3SDL A;  5H5N A; 
#chains in the Genus database with same CATH topology
 4MVU A;  3LNN A;  5B1O A;  4TV9 A;  2YSU B;  2IW5 A;  2ZIN A;  2P4K A;  3CME V;  1BSM A;  3CPW U;  3ZCC A;  4KHP O;  2Y48 A;  2QJ1 A;  4Q6G A;  3S3W A;  4CZZ A;  4AIL C;  2CDY A;  3DXR A;  2PI4 A;  2ADP A;  4B3T B;  2QGN A;  1OCZ C;  2B9Z A;  3FYE B;  1Y76 B;  4K0K B;  3ZJZ A;  2GDS A;  2R72 A;  4LWS A;  4X62 B;  3CRC A;  2A9H A;  1V54 C;  3ABL B;  1QR9 A;  1QLE C;  3BA9 A;  2EJ7 A;  2YXY A;  2OT5 A;  5L3F A;  3JAK A;  4HBN A;  4B7E A;  4GYC B;  3QO5 A;  3K08 A;  1SQV H;  3MHH C;  5EYP B;  1XI1 A;  1VF6 C;  1SQP H;  2LFR A;  5DEC A;  4K8Z A;  1HWY A;  2DJV A;  1F4N A;  1XBL A;  1WLE A;  2GUZ A;  2ZE7 A;  5JH7 B;  4NXN B;  1R3J C;  4FLV A;  4I7Z B;  4H13 B;  1Z5W A;  4TQF A;  3TCU A;  1P4R A;  4PA3 A;  1H8H G;  1I08 A;  1MMM A;  3K5L A;  3RBZ A;  4TQD A;  2DYS B;  3CCM V;  2PY5 A;  4IHJ A;  4DR5 O;  5B3S C;  3QVN A;  4JAV A;  2UXX A;  4O4H B;  1SC5 B;  5CA0 A;  3KG2 A;  4QE7 A;  3AG2 C;  4JI6 O;  4DV4 B;  5JQG B;  3WG7 B;  1GN3 A;  2HG5 C;  3D36 A;  4JYY A;  3DSQ A;  3BAB A;  1KC8 W;  4YY3 B;  4X1K B;  5LHI A;  2ZE5 A;  1S0V A;  1WAZ A;  1XDC A;  2A06 H;  1YF2 A;  4IYI A;  1R1B A;  2EIK B;  3P3N A;  4U3J A;  1ZL8 A;  3OUS A;  2YIC A;  5B1N A;  4CC5 A;  2WPD G;  1G8M A;  1E79 G;  2F95 B;  2QWR B;  4P9O A;  4PA7 A;  4MT8 A;  4LFB O;  1Q86 W;  2Q68 A;  4AQY O;  3ABT A;  4I50 B;  4O4J B;  5A9G A;  2UXN A;  2Q69 A;  2W0X A;  2WAM A;  2HHH O;  3SPH A;  4Z2W A;  4BR6 A;  3OMI B;  1GN4 A;  1ARO P;  5KLV H;  1QR8 A;  1YVW A;  4DRX A;  5KHJ A;  4YHH O;  3CSX A;  1YTF D;  5IYB O;  2AZ2 A;  4X1I B;  3T1H B;  4HAM A;  4X66 O;  1VEW A;  1K5Q A;  4X20 B;  5JJE B;  3R65 A;  3BCC H;  4K35 A;  3FB7 C;  2DYR C;  1K34 A;  4YJ3 A;  4PI0 A;  3G4S V;  1XOU A;  4PV1 B;  4JTC B;  1GMG A;  4J7Z A;  3E2E A;  5IY5 B;  1VQP V;  2M6Y A;  4I4T B;  1OCR C;  2Y69 B;  4PA4 A;  4MVS A;  3SPJ A;  1G6U A;  3K58 A;  2PUS A;  2VQE O;  4YXW G;  1H8E G;  4MTX A;  5H6R A;  3K0G A;  2F4V B;  1OCO B;  3STL C;  2IJH A;  1DLB A;  5KA6 A;  3OR7 C;  2QA4 V;  1HP8 A;  1GM8 A;  2XAH A;  3J80 N;  1WB8 A;  5CA1 B;  1D5A A;  3FD9 A;  5JVD B;  4W4K A;  5FL7 G;  4FIP C;  2QKS A;  3UM7 A;  3GVM A;  4PEL A;  4LF5 O;  4PA9 A;  4DV2 O;  4EFB A;  4J7J A;  3SDL A;  1Y74 A;  2QWQ B;  4UV8 A;  1EBO A;  2CH7 A;  5JJJ B;  2UXC B;  1NH2 B;  2P22 C;  3T1Y B;  2JEX A;  2O57 A;  3ASN C;  2UU9 O;  3CCQ V;  3G71 V;  5BMV A;  2QR4 A;  1XMQ O;  2K9P A;  4LNU B;  2ZD9 A;  1VF5 B;  2JK5 C;  1J5E B;  2H94 A;  1NS1 A;  4DV3 O;  3B09 A;  3E22 B;  4KL1 A;  1YHQ V;  3BAA A;  1M1K W;  3EHB B;  4GUN A;  1I94 O;  2FL4 A;  1X4T A;  3HKD B;  1OCC C;  1WA8 B;  1FJG B;  1S5L Z;  3W7X A;  1IXB A;  1OCZ B;  3LNM B;  5FPR A;  4CS4 A;  3K9S A;  4J41 A;  5LYJ A;  2QSA A;  1YEW A;  2UXD B;  2R9A A;  1V54 B;  1VQL V;  1QLE B;  2F66 C;  2LW7 A;  3K5O A;  4JI7 B;  1Q82 W;  5L3G A;  2YI9 A;  2OTL V;  3IC7 A;  4IL6 Z;  4FLY A;  3P3P A;  4D7S A;  4YIO A;  1H2G A;  3LSU A;  4ZHQ A;  1MOF A;  4NXM O;  1XL6 A;  3JSN A;  4DUZ B;  2FML A;  2CAZ C;  1K3E A;  4BW9 A;  1FFT B;  2IU3 A;  3NXS A;  4RUE A;  4DV1 O;  3MDS A;  1WJZ A;  2VS0 A;  1R3K C;  2E74 B;  1N34 O;  4JI1 B;  5KMG B;  3UO2 A;  4LF7 B;  3MHS C;  1KUQ A;  3FB8 C;  4JGS A;  4EEQ A;  2IU0 A;  2AXT Z;  5B3S B;  1FPO A;  1HDJ A;  3D3Q A;  2RNB A;  1FFX A;  4RO2 A;  1N36 B;  1B6Q A;  4XBF A;  2ZCE A;  1JJO A;  3AG2 B;  3K9A A;  3LDC A;  3HPL C;  4I0X B;  2X0L A;  4RUF A;  4I5S A;  1SQQ H;  1JMK C;  2YC0 A;  4UV9 A;  4R6Z A;  4MVQ A;  3IGA C;  3SJC C;  2XAJ A;  4BW5 A;  4JTA B;  3LDD A;  1GK9 A;  3RVZ A;  3ZHQ A;  4LBE C;  1IDS A;  4DV5 B;  4RQE A;  4LFA B;  1GM7 A;  2H8P C;  1Z2G A;  3AK1 A;  3HKE A;  2LW1 A;  3ZRW B;  4GCZ A;  1K33 A;  2A3Q A;  1XHX A;  2ODM A;  4GZR B;  4LF8 O;  2B1I A;  4MTO A;  4IT5 A;  3SYQ A;  1SKV A;  2Q0A A;  4JYC A;  1YDX A;  1XNR O;  4NYK A;  1S72 V;  2F93 B;  2N04 A;  4CH5 A;  2PGG A;  3Q4H A;  3JAT B;  4G27 B;  4I9Q A;  1XEQ A;  4JZ2 A;  3OTO O;  5C8Y A;  5D5P A;  3H9V A;  5CMU A;  2DYR B;  5KUK A;  3WB2 A;  5LOV B;  2VRZ A;  4LF4 O;  4UB8 Z;  2HVJ C;  1JA8 A;  3D8C A;  1JR9 A;  1FS0 G;  1GH6 A;  4IGG A;  3AG3 C;  4DUY O;  1R3L C;  1Y76 A;  2YS8 A;  3SGI A;  1GM9 A;  3FFQ A;  2B1G A;  4JTD B;  2IH1 C;  2IM9 A;  4CH3 A;  3SJA C;  1S77 D;  2Q4P A;  3ML0 A;  1FXK C;  2N05 A;  3JCZ A;  1JVM A;  3T4D A;  4WCE V;  4WBN B;  3ZRV A;  3R66 A;  3QO7 A;  4PJ0 Z;  4DR6 O;  2C2A A;  1K4C C;  5KHG A;  5EYP A;  4DK0 A;  4O4I B;  2RDC A;  1M93 A;  4F4L A;  3JYC A;  3ZN0 A;  3ASO C;  1HNX B;  2ZNJ A;  4OPH A;  2MW2 B;  4X64 O;  1SQF A;  3RYC B;  5JH7 A;  2GTS A;  1QNM A;  2JJ1 G;  4PHZ A;  4TV8 B;  2P7T C;  2KG7 A;  1KQS U;  3ASN B;  3LDE A;  3I56 V;  4KFM A;  3RYH B;  4O2A B;  4FZ0 A;  3CCL V;  5HFL A;  3F7Y C;  2IJI A;  5CB4 B;  3E89 A;  2BOB C;  4CS3 A;  4X9Q A;  1OCC B;  2CGO A;  5JQG A;  2WLK A;  3TXQ A;  1AR4 A;  1HR0 B;  1R6N A;  1ENV A;  4X1K A;  2EZO A;  1SA0 B;  1RFY A;  4JI5 B;  1P7G A;  3H1I H;  1R6K A;  4E2L A;  1EZV H;  2DMX A;  4B7K A;  5KHK A;  2X6B A;  5LMU B;  4B3R B;  2Q8V A;  2QTS A;  4DR7 O;  2R9R B;  5BR8 O;  4FLU A;  3FYI B;  4JI0 O;  2CE4 A;  2YEV B;  4I50 A;  4O4J A;  4LF9 B;  3ETE A;  3N2G B;  3SYP A;  3K04 A;  3CRQ A;  4NVP A;  2ZIO A;  4DR4 O;  3UCS C;  1U97 A;  2ATK C;  3ABK C;  4UCU A;  5JCO A;  2DQ3 A;  1K97 A;  4G2K A;  5FLX N;  3ZRS A;  5H9C A;  5DM6 V;  1KEC A;  1M9N A;  2EUL A;  4JI4 O;  3T1C A;  4FLX A;  5IYZ B;  2AW9 A;  4L87 A;  3G67 A;  4YIP A;  4X20 A;  2R70 A;  5EIB C;  2PI5 A;  2LGW A;  4GX2 A;  2EIM C;  3K0D A;  3ICX A;  5AG2 A;  4B3M B;  4MVM A;  4I4T A;  1WPB A;  3E8F A;  2PZS A;  2NN4 A;  3M7M X;  4B08 A;  3VQV A;  4TWK A;  1A32 A;  1IBK O;  3A0H Z;  2E3C A;  1SES A;  3TK1 A;  1FKA O;  2LP7 A;  3OD4 A;  4TOI A;  3SPG A;  3U10 A;  4PDM A;  5EBL C;  3OGC C;  1NTK H;  4KHP B;  1B06 A;  1SRY A;  4LF6 O;  2Q7E A;  3GWO A;  5KX5 B;  5JJN B;  1NR7 A;  2DWE C;  5JVD A;  1NU1 H;  4HYO A;  2QTO A;  4JI3 B;  2HKO A;  2WA4 A;  3K3W A;  4N21 A;  4JPR A;  1FAF A;  3OE7 G;  4LFC O;  2QEX V;  3SPI A;  4EKW A;  2IJK A;  3B40 A;  3P32 A;  3CC2 V;  1NVP B;  1F23 A;  1URF A;  1OHH G;  4LNU A;  3TXS A;  4WFH A;  3E22 A;  5E79 Z;  5LMN O;  1Y6X A;  4XDK A;  1IBL B;  2Y0P A;  1XUQ A;  1XMO O;  1K9M W;  4FFK A;  1WA8 A;  3AG3 B;  5BZB A;  4B3T O;  3OFN G;  3OGI B;  4R7C A;  4K0K O;  2W6J G;  3I55 V;  1JX9 A;  3M8A A;  3L9D A;  1VQ7 V;  1Q7Y W;  1FD9 A;  4DR5 B;  4WFF A;  1S76 D;  2KKW A;  1XNQ O;  5EZY B;  1PNL A;  1KP2 A;  1FXK B;  3L74 H;  4JI6 B;  5LHG A;  4UVB A;  2GSM B;  2OCH A;  1QQC A;  4FJC C;  4H37 A;  2YUA A;  2OWO A;  1WP8 A;  1AI6 A;  2CUG A;  3JD2 A;  1B3Q A;  3ASO B;  4A5U B;  1K92 A;  3BEH A;  3IJ4 A;  4IYH A;  3T4Z A;  4I9W A;  1TUB A;  3I5D A;  1BCC H;  1VF7 A;  4WFG A;  2DW4 A;  3W7U A;  4LFB B;  1AVM A;  5KMG A;  3SYA A;  2VQF B;  1Q6H A;  4AQY B;  1QCE A;  3OAA G;  1H2L A;  2NNU A;  2JEU A;  4WF9 V;  4UB6 Z;  2HHH B;  2DQ0 A;  1NTM H;  3A0B Z;  1WB7 A;  2RJZ A;  2Q6A A;  4J7K A;  2V7Q G;  1BT8 A;  4OX9 O;  1HW7 A;  1MNG A;  3CCE V;  1J95 A;  3FAV B;  4DV7 B;  1QU7 A;  5IWA O;  4RWU A;  3ETQ A;  1K4D C;  5B66 Z;  4JI2 O;  3QNE A;  3JAR B;  1AJN A;  4LH7 A;  5IJ0 B;  2BOC C;  1CP9 A;  5LHH A;  3JAM N;  3ZMU A;  2OTJ V;  4I55 B;  3BRC A;  1JPX A;  2GV9 A;  3ABU A;  4ZOL B;  2VQE B;  1KP3 A;  3O65 A;  2ZDI C;  1YXB A;  4U7O A;  1YIJ V;  1ZWI C;  3LUT B;  3KCY A;  4P9P A;  3OMN B;  2Q9L A;  3ABK B;  3APQ A;  2QM7 A;  1H2N A;  3RN4 A;  2EIN C;  1W59 A;  2QKA A;  1NT2 B;  3RYI B;  4DV0 O;  3T1H O;  2Q5Z A;  3JAT A;  1Y66 A;  2CK3 G;  1S5J A;  1VQO V;  4X1Y B;  2P06 A;  4TUY B;  4QE9 A;  4H44 B;  3BVO A;  5GTH Z;  2X7R B;  2CGN A;  2Y0I A;  3W7W A;  1MAB G;  3OM3 B;  4DV2 B;  2WLJ A;  1RSO B;  4LH6 A;  2F1M A;  3MAQ A;  3B2E E;  2UU9 B;  3E86 A;  5LGN A;  2V4D A;  4G28 B;  4YJ2 B;  1XMQ B;  2E5L B;  1YIT V;  1XQ8 A;  2ZT9 B;  2H3O A;  1W0J G;  4DV3 B;  2UXB O;  1WP7 A;  5B1B C;  2M7W A;  3RWR D;  1RPR A;  1WPX A;  3DXR B;  4X65 B;  1F51 A;  2NR5 A;  1PNM A;  4WBN A;  2FYU H;  1PD3 A;  4UCT A;  3OW2 U;  5L3C A;  5IT9 N;  2JS3 A;  2UUA O;  4O4I A;  1IUR A;  2KSD A;  5LP6 C;  1N32 B;  1AI4 A;  4R50 A;  3G80 A;  1ZX3 A;  1JQ0 A;  2GBO A;  1I7F A;  3K59 A;  2EIL C;  2UXC O;  3RYC A;  2QE7 G;  1YCI A;  1RM1 C;  4MVZ A;  4NXM B;  1KKC A;  3E35 A;  4TV8 A;  2YID A;  1KMI Z;  1F7Y A;  4BAY A;  4HZ3 A;  3RYH A;  1J5E O;  3DTU B;  4WFA V;  3FKS G;  4O2A A;  3EVK A;  4J42 A;  3WB0 A;  3JAL B;  5CB4 A;  4GX5 A;  1N34 B;  2EBO A;  1YZB A;  2DOS A;  1AB3 A;  1MG1 A;  4LP8 A;  4IHJ B;  4BIU A;  1VQK V;  1SA0 A;  5F2V O;  4U3F H;  1QLN A;  1RP3 B;  2LFS A;  1H2M A;  4JI7 O;  4DR2 O;  5IJ9 B;  1I5Y A;  2KQX A;  3A2F A;  3B8N A;  3JAW B;  3ZS8 C;  3THO A;  3DC6 A;  5H2F Z;  1ZSP A;  3L70 H;  2BSK B;  1KD1 W;  2YEV A;  1VQ4 V;  2XAF A;  3N2G A;  1IBM B;  2EZP A;  1NVP D;  3AG1 C;  5KHH A;  2P6J A;  1OJH A;  1EN5 A;  2OIG A;  3GB7 C;  2WLI A;  1TUE B;  4LF7 O;  1ORQ C;  1ZTE A;  4OXS A;  5KUM A;  5IYZ A;  3CX5 F;  5KAI Z;  1VQ9 V;  4ZI7 A;  2L35 A;  5C93 A;  4WFB V;  3ABM C;  4FVM A;  4ZBM A;  4AI8 A;  2XAG A;  4O2B B;  4FFB B;  4BIO A;  3E83 A;  2IJJ A;  4DRX B;  4QJF B;  5FNV B;  1XNR B;  2ZM6 B;  3E8B A;  2PYJ A;  1UPG A;  2FKX A;  1L0N H;  3OTO B;  1H2K A;  4YJ3 B;  3W7S A;  1AP6 A;  1UFI A;  3SJQ C;  1EN4 A;  1D2D A;  3AEI A;  3CWB H;  4JAS A;  3D3I A;  1JFF B;  3ZX6 A;  2WWW A;  4DV5 O;  4LFA O;  4DUY B;  3L71 H;  3SYC A;  4GLX A;  5KX5 A;  1K7D A;  1N0N A;  5J9P C;  4JZG A;  5H6Q A;  2ZR2 A;  4PA6 A;  2JRI A;  1VMG A;  1OCR B;  4CBC A;  1MSW D;  1T5E A;  3BY6 A;  4RAI A;  3SPC A;  4GKJ O;  1Q6I A;  2BTO A;  4EB6 B;  1UJW B;  2JGU A;  4GX1 A;  2ILM A;  2EIN B;  2RN9 A;  4H33 A;  3BPZ A;  4DR6 B;  2BE3 A;  2JGD B;  4MVR A;  5EBM C;  2YXH A;  2P4V A;  2GHY A;  1I5X A;  5IYC O;  4OPA A;  1HNW O;  1WN7 A;  1S5H C;  4GKK O;  2E76 B;  3H1J H;  4X8A A;  3OEH G;  4X64 B;  1XL4 A;  4E4E A;  2OYQ A;  2DN9 A;  1QVG U;  3K06 A;  4UUJ C;  4J11 A;  3A8T A;  4WFE A;  2OCC C;  3RFR A;  1YTF B;  2F43 G;  4QPK A;  3PN1 A;  2YIB D;  5EC1 C;  2AHZ A;  3JSL A;  1BQ0 A;  4DV6 O;  3ZN1 A;  1EFR G;  5B1B B;  3C3T A;  4BWA A;  5EZY A;  1U96 A;  1FXK A;  2ADQ B;  1QBZ A;  4ZKI A;  1G1X B;  3EXA A;  5IYD O;  4O4H A;  3H01 A;  4MW8 A;  4MW3 A;  2QM8 A;  5LP6 B;  1L0L H;  1HNZ O;  1KU9 A;  4LR3 A;  2QWN B;  3CCS V;  2EIL B;  2CTQ A;  2ITD C;  5DN6 G;  2FB5 A;  1RM1 B;  3IAY A;  4FM2 A;  3ZHV A;  3DC5 A;  1BHA A;  4DR7 B;  1AJP A;  1XRE A;  5BR8 B;  1W2B U;  3TGU H;  2YDE A;  1PP9 H;  1PL0 A;  1CEZ A;  1GKF A;  5JCO C;  1V9P A;  2IBZ H;  4DR4 B;  2UUC O;  4UCS A;  4QIW F;  5CA3 A;  1TVK B;  3HR0 A;  3OT7 A;  2XHB A;  1MSD A;  4N23 A;  2QDO A;  1NH2 D;  3C90 A;  2UUB O;  4JI4 B;  5L3E A;  4FK5 C;  2HP8 A;  1P84 F;  3FAV A;  2LQT A;  2ZKO A;  1GN2 A;  4CH6 A;  4B3S B;  4ABM A;  4NTX A;  4F6R B;  3WU2 Z;  3F5T A;  4X1I A;  3RW0 A;  3JAR A;  5IY5 C;  2WLN A;  5IJ0 A;  3QF7 A;  2VWK A;  5LMU O;  2YIB A;  5ITZ B;  4KUM A;  4JI8 B;  4I55 A;  1P49 A;  2EX3 A;  5J2U B;  2ZE6 A;  2XT9 A;  4NTW A;  2AHY A;  3CCJ V;  2RQ6 A;  2ZIM A;  2W6I G;  5TIS Z;  3SJB C;  4ZOL A;  3JD4 A;  4DR3 O;  1GRJ A;  3AG1 B;  4J80 A;  1H38 A;  4LF6 B;  3OTF A;  3HKE B;  3RYI A;  4JV5 O;  1AP5 A;  3L73 H;  4X1Y A;  1MZF A;  4TUY A;  4DR1 O;  3ABM B;  2CTP A;  3OMA B;  5CA1 A;  1VQM V;  1TGO A;  1NJI W;  2WLL B;  1RSO A;  5GTI Z;  3CJH B;  5GW7 A;  1XHZ A;  5E1A C;  1DK1 A;  1EM1 A;  3VOU A;  2X6A A;  2Q67 A;  1MA1 A;  3JCU Z;  5C8Y B;  3CC7 V;  1N33 O;  1GAX A;  4PDL A;  4JYA O;  4YJ2 A;  1PPJ H;  3HB3 B;  1K73 W;  5LA6 B;  2AZ0 A;  4J10 A;  4IIJ B;  1SZT A;  5LMN B;  5KHI A;  3ZHU A;  3CCR V;  1Q5O A;  2D3O W;  2VWJ A;  1XMO B;  2JDI G;  1W0K G;  1DF5 A;  4FLT A;  1Q3E A;  1VIB A;  1PKX A;  4JI3 O;  4Z1V A;  3ZHS A;  2PYL A;  3HKD A;  1VQ5 V;  3U0Z A;  4FM0 A;  4UVC A;  1WNS A;  3JAS B;  2WA3 A;  1BHB A;  3RT3 C;  1XNQ B;  4X62 O;  4H0L B;  1M57 C;  4QNH B;  4MTG A;  2CTR A;  4UXN A;  2HJD A;  5EC2 C;  3AK3 A;  3D36 C;  4FLZ A;  1OZ0 A;  3K79 A;  3JD3 A;  5LL6 Y;  5CBH A;  1IBL O;  2ARH A;  3W7T A;  2PF4 E;  3AK2 A;  2W0F C;  1VF6 A;  1AI5 A;  2KG7 B;  3HKB B;  3JAL A;  2HLD G;  3N2K B;  5J2T B;  1KKD A;  1N0J A;  2DE0 X;  4K8X A;  3LSQ A;  4O4L B;  2OCC B;  4NB5 A;  4NXN O;  2RMK B;  4GX0 A;  5L3D A;  1LUW A;  1AR5 A;  1GO3 F;  3CEI A;  2CTW A;  4C7U A;  4CC6 A;  1I0H A;  3CRR A;  5EK0 A;  2XAS A;  1E1Q G;  4LC1 A;  3NR7 A;  5IJ9 A;  3B8M A;  2FTK A;  4EFE A;  1DTO A;  5DED A;  3JAW A;  2HFE C;  3RVY A;  5HFM A;  4OX9 B;  5CN0 A;  2EIJ C;  1PM9 A;  4Q20 A;  2GTA A;  5IWA B;  4DV4 O;  3P30 A;  2YI8 A;  1Q90 D;  4YHH B;  4K3A A;  2BSK A;  1GN6 A;  4JI2 B;  4YY3 O;  1GTO A;  4QGP A;  4I0X A;  2MK3 A;  1O9H A;  4X66 B;  2BTQ B;  5GON B;  4PD4 F;  4MSW C;  4MVO A;  3HKC B;  2VQF O;  1IX9 A;  3TJT A;  1US6 A;  2PTM A;  3PJS K;  1S3J A;  3JD0 A;  2R9I A;  1JCH A;  3CXH F;  5LGU A;  4ICG A;  1ZLZ A;  3BFR A;  3KKY A;  5CBG A;  4O2B A;  4FFB A;  4FMT A;  2JIZ G;  3ZBH A;  5K1X A;  3ZRW A;  1JOY A;  2KB1 A;  3BHP A;  5FNV A;  4DV0 B;  1IVS A;  5KAF Z;  1YJW V;  4DV7 O;  1NQT A;  2A7W A;  2ZXW C;  4JAA A;  5B5E Z;  3CHX A;  3RYF B;  1DF4 A;  2LGQ A;  3VQX A;  4XDJ A;  4HNA B;  2XAQ A;  1BMF G;  3F5W C;  1Z5V A;  4X89 A;  3UT5 B;  1VP7 A;  1JFF A;  3BA8 A;  2N74 A;  1QVF U;  4LF5 B;  1TA8 A;  4L8J A;  2EIM B;  1IZ3 A;  2QKC A;  5LOV A;  1EZJ A;  3STZ C;  5FPO A;  5LXT B;  4UVA A;  3CCU V;  2Z5U A;  2YIA A;  3DGE A;  3K57 A;  2UXB B;  2X6C A;  2E75 B;  2WSS G;  2ZDI A;  1JJ2 U;  1THZ A;  1TAE A;  1IXM A;  1F4M A;  3ZIA G;  4EB6 A;  1MZE A;  4TV9 B;  2F4V O;  2YXL A;  1AI7 A;  1ROP A;  4UCO A;  3VBB A;  1YI2 V;  2JGD A;  2XND G;  3GWK C;  1I94 B;  1LUV A;  1M4U A;  4FLW A;  2DWD C;  2UUA B;  1CPY A;  3OEE G;  3CRM A;  2HVK C;  4DO2 A;  3CB2 A;  1KYO F;  4BIZ A;  1BGY H;  1EN6 A;  3L75 H;  4LWS B;  3H1K H;  1M56 C;  3E8G A;  4XDL A;  5K1P A;  1AR1 B;  3J81 N;  1K8A W;  4MS2 A;  5CBF A;  1DGS A;  3JAK B;  3ZMZ A;  2E5L O;  2Q0O C;  3AG4 C;  4ZIB A;  1D5N A;  3RGB A;  3T1Y O;  1SZX A;  2QWO B;  1Y4M A;  2Z3Y A;  1VQ6 V;  3JD1 A;  1B04 A;  5D5Q A;  1YSC A;  3QTC A;  4X65 O;  1N8R W;  1NZ6 A;  3KCX A;  2GUZ B;  4NR1 A;  4DV1 B;  2P90 A;  1BL8 A;  1FJG O;  1N32 O;  3K5M A;  3MD0 A;  3A0R A;  5LP6 A;  1SF9 A;  4U7N A;  4DR2 B;  3ZHR A;  2Z0A A;  2G38 A;  2UXD O;  1M57 B;  1R6T A;  4JAU A;  4RQF A;  5LGT A;  1SQX H;  2JJ2 G;  5CA0 B;  2F23 A;  5A2Q N;  4DUZ O;  2IH3 C;  1M5I A;  3QG5 A;  4W4L A;  1TUB B;  3OR6 C;  2Q7G A;  2B5U A;  4U3J B;  1ZL8 B;  3APO A;  1TVK A;  3O9O A;  3X2Q C;  4AHC A;  1KBH A;  2JS5 A;  3IFX A;  5B1A C;  2OIE A;  3KZI Z;  1RPO A;  3WB1 A;  2Y4U A;  1SS3 A;  4JI1 O;  4DW1 A;  4F6R A;  1BZK A;  2XOK G;  1V55 C;  3CE2 A;  1Q6U A;  5BXZ A;  2LO1 A;  2Q7H A;  5ITZ A;  4ASU G;  2QM4 A;  4FM1 A;  4LF8 B;  2ETN A;  4UCR A;  2EIJ B;  3OUF A;  1N36 O;  3H1L H;  2HR3 A;  2WLM A;  2RCV A;  5J2U A;  1P7B A;  3S3X A;  5L3B A;  1IBM O;  1BS3 A;  1ZAU A;  1L8D A;  4TT3 G;  1VQ8 V;  3ZHT A;  3IC9 A;  1K5S A;  3TET A;  3M99 B;  1AIL A;  2JVD A;  4LF4 B;  3FX7 A;  3UQ8 A;  3H1H H;  3FB5 C;  1LR1 A;  4P2Z A;  1YJN V;  1Q43 A;  3CRA A;  2ZE8 A;  4GKJ B;  2WLL A;  3CJH A;  4J9Z B;  2ZM6 O;  3ABL C;  4DK1 A;  3N27 A;  3VQW A;  1KB9 F;  3E8H A;  2L6L A;  1SQB H;  2ZXW B;  4KP4 A;  1HNW B;  4DW0 A;  3SR2 C;  5LA6 A;  4GKK B;  4JYB A;  4IIJ A;  2Q73 A;  2AGA A;  5EBW C;  3UKM A;  2XTA A;  3CMA V;  1PV0 A;  1FXV A;  3ZMV A;  4PI2 A;  4UCV A;  1Y74 B;  1NI8 A;  2CH7 B;  4D7T A;  2ZQM A;  4Z1M G;  3G6B A;  1Q81 W;  1SQG A;  2V1D A;  1PL4 A;  3CP1 A;  1G4Y B;  5BMV B;  3B77 A;  1CXZ B;  1OV9 A;  4DV6 B;  2ZR3 A;  1SER A;  2ZNI A;  3JAS A;  5LBQ A;  2WLH A;  2DYS C;  3FB6 C;  4D6T H;  4QPJ A;  4R8C A;  3CXC U;  2A79 B;  2HJF C;  2QWP B;  4DXW A;  1QHT A;  3WG7 C;  3U11 A;  1N4C A;  4CS2 A;  3T2M A;  1HNZ B;  3WFV A;  5LYJ B;  3CCV V;  1NTZ H;  1M56 B;  1NKD A;  1X59 A;  3EFF K;  2EIK C;  1PNK A;  3HKB A;  2P5O A;  1HNX O;  3N2K A;  5J2T A;  4NTY A;  3ETG A;  4O4L A;  4TSF G;  2EJR A;  2XUM A;  1YJ9 V;  5H5N A;  4ZHQ B;  3AG4 B;  1E1R G;  1FYJ A;  4P30 A;  4PDV A;  2LJ2 A;  2UUC B;  5EIB D;  4JI0 B;  4X88 A;  2Y4T A;  4CH4 A;  5IDJ A;  2UUB B;  2HEP A;  3UO3 A;  3K5N A;  3K03 A;  3CC4 V;  1NR1 A;  3B4S A;  1H2S B;  1Q8I A;  3ZMS A;  4FZ1 A;  1HR0 O;  3CD6 V;  3F7V C;  3VQY A;  4JI5 O;  3J7A U;  2BTQ A;  5GON A;  2BCC H;  5BY1 A;  3ZED A;  4KXR A;  1NBM G;  4J9Y B;  1FFX B;  3HKC A;  1SET A;  2Y69 C;  1L1F A;  1VQN V;  1ZUQ A;  4B3R O;  2A0L A;  2P67 A;  3C3S A;  3ETD A;  3QO8 A;  4UFZ A;  4GT1 A;  1LNQ A;  4JF3 A;  4DR3 B;  5JWP A;  3ZRX A;  1IBK B;  4LF9 O;  4OGQ B;  2WLI B;  4F6E A;  1O9G A;  4FPP A;  3AG7 A;  1AJQ A;  1OCO C;  3X2Q B;  1COW G;  4NKG B;  3SYO A;  4JV5 B;  4ZI7 B;  5B1A B;  1R73 A;  1BQZ A;  4B3S O;  4DYL A;  4DR1 B;  3RYF A;  2NLJ C;  3CS5 A;  4LCU C;  1R3I C;  1BE3 H;  1V55 B;  1XIL A;  1Y67 A;  2ITC C;  4HNA A;  3UT5 A;  3CYO A;  3ZMT A;  4MTF A;  2K1E A;  1FXH A;  4JI8 O;  4PDR A;  2D2C B;  1M90 W;  4LFC B;  1N33 B;  4B3M O;  5IE9 A;  1VAR A;  3L72 H;  4JYA B;  3LSS A;  5LXT A;  3G6E V;  3Q4H B;  5KA5 A; 
#chains in the Genus database with same CATH homology
 1R1B A;  4JI3 O;  4GKJ O;  1FYJ A;  4X65 O;  1AIL A;  4JI7 O;  2UUB O;  4DR2 O;  2UU9 O;  4OPH A;  2ZKO A;  4X64 O;  3RT3 C;  1XMQ O;  4X62 O;  4OPA A;  1HNW O;  4DV7 O;  1FJG O;  1N32 O;  4A5U B;  4LFB O;  3F5T A;  1A32 A;  4GKK O;  1IBK O;  4KHP O;  1NS1 A;  4DV3 O;  4AQY O;  2ZM6 O;  5LMU O;  2Z0A A;  1FKA O;  2UXD O;  1I94 O;  1R6T A;  2HHH O;  1HR0 O;  5LL6 Y;  1IBL O;  4LF6 O;  2UXB O;  2N74 A;  4YHH O;  4JI5 O;  5A2Q N;  4LF8 O;  3J7A U;  2AGA A;  5BY1 A;  4DUZ O;  4DR3 O;  4LF7 O;  4X66 O;  2LW7 A;  4NXN O;  1XNR O;  4DV6 O;  4LFC O;  4B3R O;  5IT9 N;  4JV5 O;  1XEQ A;  2UUA O;  4NXM O;  3OTO O;  4OX9 O;  2DJV A;  1G1X B;  5IWA O;  2F4V O;  4LF9 O;  4DR1 O;  2UXC O;  4JI1 O;  4LF4 O;  4JI2 O;  4DV1 O;  2FKX A;  4DR7 O;  1HNZ O;  2VQE O;  5BR8 O;  4DUY O;  1DK1 A;  4JI0 O;  3JAM N;  1F7Y A;  4B3S O;  5LMN O;  4DV4 O;  5BXZ A;  1D2D A;  1N33 O;  1J5E O;  1N34 O;  4DR5 O;  1XMO O;  4YY3 O;  4JYA O;  1N36 O;  4B3T O;  4DR4 O;  3J80 N;  3J81 N;  4K0K O;  4DV5 O;  1KUQ A;  4LFA O;  3O65 A;  2E5L O;  5FLX N;  3M8A A;  4JI6 O;  4JI8 O;  1X59 A;  1IBM O;  4JI4 O;  2VQF O;  4B3M O;  1HNX O;  3T1Y O;  1YZB A;  2JRI A;  2DOS A;  3R66 A;  1AB3 A;  4DR6 O;  4LF5 O;  4DV2 O;  2UUC O;  3T1H O;  4DV0 O;  1XNQ O;  3SDL A;  5H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...