1Q81W

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q81W00
3CCLV 3OW2U 4WFAV 4WFBV 3CCQV 3G6EV 1VQOV 1QVFU 1S72V 3CCUV 3CMEV 1VQ7V 3CXCU 1K8AW 1M1KW 1R73A 4WCEV 3CCSV 1NJIW 1VQ8V 1YJNV 1JJ2U 1VQ9V 3G71V 3CCEV 1YJ9V 3CCMV 3CCRV 1VQ6V 1M90W 1YI2V 1VQLV 1KQSU 3CCJV 3CMAV 1YJWV 1YIJV 3G4SV 1Q7YW 1VQKV 3I56V 3CC2V 3CC4V 2D3OW 1VQMV 1Q81W 1K73W 3CPWU 1KD1W 1VQPV 1Q82W 1Q86W 1VQ5V 1YHQV 3CD6V 2QA4V 1VQNV 1N8RW 3CCVV 1K9MW 1VQ4V 3CC7V 5DM6V 1YITV 1QVGU 2OTLV 2OTJV 2QEXV 4WF9V 1W2BU 1KC8W 3I55V
chains in the Genus database with same CATH superfamily
1LUWA 2YXHA 3ABKB 2QWQB 3CYOA 4UCRA 2XTAA 5FLXN 3CMEV 4E2LA 3K08A 1IX9A 3VQYA 3K3WA 1N34B 1MMMA 1OCZC 1BZKA 2YUAA 1VF6A 2ITCC 1FJGB 4ZHQB 5JJNB 3JATB 3ZCCA 2OTJV 4BW5A 1Y74B 4MTGA 5CBHA 5H5NA 3WG7C 4LNUA 3P3PA 2P4KA 4O2BB 4K8ZA 5B1AC 1OCCC 1HW7A 1BMFG 1TAEA 2UXCO 1N36B 3VQWA 2B1GA 2KQXA 2UXNA 2HR3A 3K0GA 3CC4V 2Z5UA 2QA4V 3HR0A 5L3CA 5IY5C 5EC1C 2OTLV 2V7QG 3E83A 3WFVA 4I9QA 2ADQB 2ZKOA 2FYUH 2UXDO 1TUEB 4AQYB 2WLNA 1OCZB 1UJWB 3THOA 3ZS8C 1IDSA 2OCCB 3N2KA 1I5YA 1A32A 4P30A 3IFXA 1GAXA 2AHYA 4LF7O 2QM8A 1K92A 1ORQC 1Q43A 1ZAUA 2E5LB 1SETA 4I55B 5C8YA 1H2MA 1FPOA 1OCCB 1PPJH 3SPGA 1FS0G 4FIPC 4UXNA 2EIKC 2WAMA 4HYOA 1Z5WA 2EIMB 3T2MA 4TOIA 5IY5B 3ZBHA 4X8AA 2LJ2A 3ZRWA 3CRQA 1HNWO 1KECA 2ZR2A 4MTXA 3FFQA 3LUTB 4CS4A 1H2LA 1H2SB 2ARHA 2EZOA 5CB4B 5CA3A 2BTOA 4X64O 3DXRA 4GX5A 2LFSA 1ZLZA 3ASOB 4DR2B 5JH7A 4YXWG 2K9PA 2IJJA 3TK1A 3HKEB 4U7NA 4JYCA 1CP9A 2YC0A 2XASA 2DJVA 1AJPA 1WJZA 1BHAA 2KKWA 2HKOA 2Q7HA 4TV9B 1DGSA 5KX5A 3RYFA 3CCMV 4DRXA 5LL6Y 4PDRA 1YCIA 5KAIZ 2PI5A 4DR5B 3B77A 4DR7O 5K1XA 4DUYO 1QLEC 2MK3A 3FB6C 2OT5A 1X59A 3K59A 5K1PA 3ASNC 1OCOC 1JFFB 4IT5A 4UCSA 2UUBO 1JR9A 3DC6A 4D7SA 4XDKA 2ZE7A 4K0KO 1YHQV 4FFBB 2UUAB 3CE2A 3AK2A 5HFLA 4L87A 5B3SC 3ZMSA 2EILB 3RFRA 3A2FA 4AHCA 4PA6A 4FJCC 4Z1VA 2AZ2A 3RYIA 3ABLC 4JTDB 1FXKC 1XQ8A 2W6IG 1RFYA 3UKMA 5JJJB 1FD9A 3TETA 4KL1A 1NU1H 2YXYA 2AZ0A 4JYAO 2PGGA 5CA1A 4D7TA 4CH3A 4LF6B 4TV8B 2JS3A 4J41A 4O4IB 2E75B 1QLEB 2PY5A 3K5MA 2IJKA 1WLEA 2B5UA 4B3MB 1WA8B 1AI7A 3UM7A 2ILMA 4UV9A 4GX1A 2X6CA 3F7YC 4JPRA 2ADPA 2RJZA 4MS2A 1BSMA 3UO2A 4H13B 2Q67A 1IBKB 4NXMO 1JJOA 5J9PC 4PA3A 2BTQA 2N74A 5AG2A 3P3NA 3LDDA 1RP3B 4I50A 5LYJA 1FFTB 2E76B 4NTYA 3ZHVA 4YIOA 4LF5B 2JGDA 1QQCA 3JD1A 2HP8A 3G71V 1VARA 1KB9F 2W0XA 5JJEB 1HNXO 3T1HB 2UXBO 3ZN1A 2PF4E 4O4JB 5B1NA 1THZA 1OV9A 3A0RA 5CBFA 1N8RW 3N2GB 1N0NA 4DR4B 4HNAB 1GMGA 5EBWC 3SPIA 2HJDA 3RYCB 1VMGA 1ENVA 2Z0AA 3BHPA 1D5NA 1R3LC 1B06A 4IYIA 1O9HA 2Q5ZA 1IBLB 3HKBB 2Y0PA 4O2AA 2D3OW 4Z1MG 1VQ5V 4LFCO 1QR9A 2ZM6B 2JGUA 3L74H 3SYOA 2YDEA 3CCVV 4WFGA 1Q5OA 2CUGA 4JI3B 1K34A 3D36A 4B7KA 3ICXA 3L73H 4OGQB 2AHZA 1M1KW 1OZ0A 4IIJB 3E8FA 2P4VA 4FVMA 3CCRV 4X20A 4UVBA 4PD4F 1SQXH 1NBMG 1F7YA 1IURA 5J2UB 1SQGA 3UT5B 2CDYA 1ZWIC 3CRAA 5IJ9A 1TVKB 3FB7C 5LXTA 1OCRB 1GN6A 2KB1A 4PHZA 3BABA 3HKDA 5A9GA 3CMAV 1QBZA 3SYPA 4F6RB 1XNRB 1JOYA 4EFBA 1BHBA 4O4LA 1BQZA 3JYCA 1MABG 1O9GA 3RN4A 2PUSA 3TXSA 2DQ3A 3AG4C 2EBOA 3CEIA 1K4DC 1U97A 1CXZB 4R8CA 2X6BA 4DK1A 3C3TA 4LF8B 5H2FZ 4CBCA 3H1KH 1UFIA 5IWAB 3ZHUA 4LF4O 5BR8O 3JARB 2IH3C 1P7GA 5JCOC 1QR8A 2XAGA 3PJSK 1P4RA 3GWOA 1TUBA 3FAVB 4EB6A 5KHKA 1N33O 1VQ9V 4B3TB 2F93B 3JAKA 3CWBH 3G4SV 2R70A 1L0NH 5IE9A 1VQKV 1LNQA 1SKVA 3ZX6A 1SESA 1QHTA 1BE3H 2QE7G 4DUZO 4CH4A 4GCZA 2EULA 1US6A 3ZRXA 1RSOB 1XDCA 5EYPB 1GM9A 3KCXA 4FM2A 3JSNA 5KHIA 3CCSV 4HBNA 5EBMC 1XL6A 1NR7A 4DXWA 4YJ2A 3JASA 3AG1B 4GKJO 1G6UA 5H9CA 2CK3G 1K33A 4YJ3B 1K5QA 4JZGA 4UVCA 4DV6O 1F4NA 2HG5C 3OTOB 2ZINA 1KC8W 4JI7O 2LFRA 4AILC 4NXNB 1AI5A 1BL8A 3ZJZA 4XBFA 4EEQA 2NLJC 1WAZA 2JEXA 2ZE8A 4I9WA 5FL7G 4JI2B 4X62O 1VF7A 2XAHA 5KUMA 4D6TH 5H6RA 1XNQO 1Y76A 1NI8A 2Q0OC 4Q6GA 2LW7A 3QTCA 3B8MA 2QSAA 4K35A 3QVNA 3KG2A 3CS5A 5EZYB 3QNEA 2EIJC 1MG1A 1B3QA 4DR1B 4ZIBA 2ZDIA 5LGNA 1IBMO 1PM9A 4J11A 4RAIA 4BR6A 4X1IA 4CH6A 3ABTA 3KKYA 4QIWF 4CS2A 3QO7A 1DK1A 5HFMA 4A5UB 3CX5F 1I7FA 2HEPA 2NR5A 3X2QC 1YTFB 1NVPB 2UU9O 4LFBB 3HKCB 3H1HH 2LO1A 2OIGA 3E22B 4WFEA 2FTKA 2ZXWC 4UV8A 5JQGA 3A8TA 4IHJA 4DR3O 5GONA 2RN9A 3JAWA 5FNVA 5JVDA 3ABKC 4UFZA 1NJIW 5ITZB 3LDEA 4NB5A 2IBZH 1KMIZ 5KA5A 4GLXA 2JIZG 4LR3A 1Q3EA 1ROPA 2QWRB 2YI9A 3E89A 3WB0A 1PD3A 3FKSG 4FLZA 5IYBO 5KMGA 4DV4O 3X2QB 5J2TA 4X65B 5D5PA 4DV0B 5KHHA 1DF5A 4DV3O 2ZIMA 3OEEG 4I4TB 4PDMA 2JJ2G 2ZD9A 3VQXA 3OE7G 1BS3A 3GVMA 4X9QA 3DC5A 4WBNB 4GKKB 3SYCA 2A06H 4BW9A 4J9ZB 3CCUV 4LBEC 2KG7B 3LSQA 2FKXA 4I7ZB 4O4HA 3JD2A 5FPOA 4ICGA 5E1AC 4F6EA 2FB5A 1VEWA 3HB3B 3P32A 4F4LA 2OCCC 1JQ0A 1H8EG 1QU7A 4PV1B 2F4VO 2CGNA 4FZ0A 3OW2U 1XUQA 3K5NA 4KHPO 5EBLC 4RQFA 3N27A 4GT1A 5CA0A 1MA1A 4MVOA 2QJ1A 3JD4A 3KZIZ 2EIMC 5BMVA 4RUFA 2AGAA 4PI2A 5E79Z 2PZSA 2Y48A 1JVMA 5IYDO 1FAFA 4FLVA 2R72A 1AJNA 1KKDA 2E3CA 2LQTA 3OUFA 5C93A 3K5LA 1J5EO 4ZKIA 3EXAA 1KP3A 1D5AA 2X7RB 1VQMV 2L35A 3IGAC 3E35A 3K58A 3ASOC 2Y0IA 3Q4HA 3U11A 4KFMA 1AR4A 4KXRA 2E5LO 1V9PA 2WLKA 2UXDB 1Z5VA 2ZQMA 3W7UA 4K3AA 2AXTZ 4X1YA 1XBLA 5L3EA 3ZMTA 3S3WA 2HHHO 1EZJA 4LNUB 2A7WA 4QNHB 2CTQA 3WU2Z 2Y69C 2E74B 3TJTA 2R9AA 4LF7B 2WLMA 4JI6B 2LW1A 4DV7B 1P49A 1JJ2U 2VWKA 5JWPA 1IXBA 2QM4A 2YICA 1M56B 2CTPA 2VQEO 1L0LH 1SF9A 4R7CA 3SJAC 4JI5O 2CH7A 4N23A 5GTIZ 2WLIA 1Q86W 1EN6A 4BIUA 1M4UA 3QO5A 5DM6V 2DWEC 3CRMA 3JCUZ 1HNZO 1HNWB 4QGPA 4CS3A 2BSKA 1JMKC 2EILC 2FL4A 3TGUH 5IYZA 4KP4A 3N2KB 1NS1A 3K06A 3CB2A 4X64B 5LP6C 3FB8C 2Y69B 3ABUA 3CD6V 2P67A 1IZ3A 4JTAB 4J7ZA 3M99B 2IW5A 3CCLV 2IH1C 4P2ZA 1XMQB 1SZXA 1G4YB 3ZRWB 4H44B 4JAAA 5EIBC 4TUYA 4DV1O 4YIPA 1KP2A 2QWNB 1WPXA 2GUZB 1QCEA 5L3DA 2Q8VA 4GX0A 4DR7B 3E8BA 3LDCA 5LOVA 2GHYA 4DUYB 3K04A 2X0LA 3DTUB 3DXRB 4WFBV 2ODMA 3T4ZA 3OEHG 5LP6B 2UUBB 5JH7B 2QM7A 2YS8A 2OYQA 1B6QA 1YSCA 2V4DA 1VQLV 1FXKA 4TT3G 4K0KB 3ETQA 1XEQA 1AR5A 1XHXA 1FYJA 2XOKG 4FLWA 5KX5B 3RYFB 4DRXB 3OUSA 3FB5C 5LHIA 4DV2O 2WWWA 3L72H 4R6ZA 3OMNB 3BY6A 5LBQA 3RYCA 1YI2V 3B4SA 1CEZA 3G67A 5EIBD 1DF4A 3J80N 4JYAB 1NTKH 1H2KA 3EHBB 3QO8A 4BWAA 4PDLA 1IBKO 5B5EZ 1NKDA 1NQTA 4MVMA 2DMXA 3FD9A 1AB3A 4I0XB 2P06A 1V55B 1SZTA 3G6EV 4TWKA 3JAMN 3ZN0A 1Q8IA 1R3KC 4B7EA 3MAQA 3SJQC 1NTZH 4FLTA 3GB7C 3T1HO 4IYHA 4LWSA 3T4DA 4JI0O 3RYIB 2A9HA 4QPKA 4Q20A 3E2EA 3RBZA 1N32O 4NXMB 4DR4O 2HVKC 3GWKC 4U7OA 1FFXA 4W4LA 1BT8A 1H38A 5CA1B 4RO2A 2A3QA 2WLHA 1HNXB 3A0BZ 2UXBB 4OX9O 1OCRC 2YIBD 4JI1O 5FPRA 1MNGA 1GH6A 2M6YA 4J42A 5EC2C 1X4TA 3RGBA 1YDXA 3F5WC 5LMNO 4C7UA 4WF9V 4J9YB 4DV5O 1EBOA 4ZI7A 1DLBA 2PI4A 2YEVA 5F2VO 1SS3A 2PYLA 4P9OA 4NYKA 4G28B 5IYCO 1KQSU 4B3SO 4UVAA 3JALA 2BTQB 2F95B 2XHBA 4I50B 5LYJB 1Q81W 3B2EE 4LFCB 2YIDA 4FFKA 2JGDB 3EVKA 1VQ4V 4X1KA 4W4KA 2F1MA 2EJ7A 2HJFC 4JI4O 5IJ0A 1URFA 3UCSC 3U0ZA 2XAQA 1H8HG 3ZHRA 4X66O 3LSUA 4TQDA 4O2AB 4UCVA 4DR6B 1AILA 5EK0A 1PNMA 3SYQA 2UUCO 3J81N 3CRCA 5D5QA 2Q6AA 3CPWU 3AG1C 1GN4A 3VOUA 5IWAO 4JGSA 1SQPH 4MTFA 2WPDG 5LHHA 3SYAA 3BAAA 4JTCB 2DYSB 1K3EA 5H6QA 1OJHA 4U3JA 2Q0AA 3K03A 1HR0O 1L8DA 3L70H 4JYBA 5JCOA 1KYOF 4H33A 4JV5O 1U96A 1YEWA 1Q7YW 2WLLA 3BEHA 5IJ9B 2WLJA 4YHHO 1YZBA 3B40A 5LXTB 2IM9A 3RYHB 1EFRG 3HKDB 3BA9A 1XILA 5BR8B 3BPZA 3AK1A 2N05A 1AI6A 1R1BA 5BXZA 3JD0A 1NH2B 1EN4A 1N33B 4JI8O 2GBOA 3KCYA 1SA0A 1XREA 4MVUA 4O4LB 4JAVA 4X88A 1NH2D 1PKXA 5DEDA 1SERA 2Q7GA 5B1BB 1YITV 3ETDA 4DUZB 1Q6HA 1VP7A 3OMIB 3OR7C 1WP7A 4TQFA 1RM1B 1K7DA 2VWJA 2CAZC 4GKJB 3AG3B 1K4CC 4LP8A 4Z2WA 5BY1A 2YXLA 1TUBB 1WNSA 3CJHB 1QLNA 4EB6B 3OTFA 1MSDA 2VQFO 4DV6B 3I55V 3JAKB 4PELA 4JI7B 2G38A 1TGOA 2DYRB 3T1YB 4LFAO 4YY3O 1XMOO 3SPCA 4X62B 4ZOLA 1ZL8A 1EM1A 2HLDG 1AP6A 1GKFA 1WB7A 2CGOA 1B04A 1M93A 4LC1A 4H0LB 1J95A 2IJIA 3CSXA 3K0DA 3ZMUA 5A2QN 1P84F 3O65A 5LHGA 3JASB 4MVSA 1JX9A 2X6AA 3S3XA 2A79B 3L75H 3CP1A 4NR1A 2KSDA 3F5TA 1IBMB 1WP8A 2W6JG 2QKSA 2M7WA 1VIBA 1YTFD 1NVPD 1E1QG 3HPLC 1S76D 1Y76B 3DSQA 1HP8A 4PA4A 3NXSA 2PTMA 2BE3A 5CN0A 3QG5A 4MTOA 4WBNA 3ZRVA 2BCCH 2UU9B 3MHSC 4QPJA 4K8XA 3H9VA 2QWPB 1N0JA 2ZNIA 1M9NA 5CBGA 2ZIOA 2WSSG 4MT8A 3B8NA 1IXMA 1I94O 5LMUB 4ZHQA 1VQOV 3JATA 4X65O 4DV0O 2LGWA 1Y74A 4X1IB 3W7XA 2QKCA 2H8PC 1YIJV 4B3RO 3EFFK 5KAFZ 4J7JA 4O2BA 2DE0X 4RUEA 3R66A 1BCCH 3RVYA 3AG2C 4MVRA 3CRRA 4CH5A 2OCHA 3D3IA 1COWG 3B09A 1MZEA 3MDSA 1EZVH 4DV4B 1G1XB 3STZC 1VQ6V 1N34O 4ABMA 4JASA 5JQGB 4DV3B 3SGIA 1FJGO 2QTOA 4IHJB 5GONB 4LF9B 1E79G 3JAWB 5FNVB 2Y4TA 1R6KA 5JVDB 1M57B 1K9MW 2K1EA 1QVGU 4CZZA 2P6JA 4FM1A 1W2BU 3F7VC 1NZ6A 1VF6C 3VQVA 1Y67A 1XHZA 2YSUB 1YJ9V 1N36O 3LNNA 4JYYA 4I55A 3CCJV 4QE7A 4P9PA 1AR1B 3AG2B 5KMGB 2JJ1G 1AVMA 1RPOA 3ZHQA 5J2TB 2F4VB 4OPAA 4FM0A 1Q90D 1R6NA 4KHPB 2JK5C 2VRZA 1PNKA 3SPJA 4AQYO 1NT2B 2UXCB 1PL4A 5LA6B 3M8AA 5KUKA 1YJWV 2OWOA 1MSWD 1M56C 1MZFA 5CB4A 4HZ3A 5L3GA 2ATKC 3JD3A 2QEXV 2W0FC 1SRYA 4O4HB 2P22C 2Q7EA 1J5EB 3BRCA 3OR6C 1Y66A 3HKEA 2Q9LA 4PI0A 4LCUC 3CC2V 2V1DA 1SQFA 1ZUQA 4TV9A 4OXSA 3WG7B 4JI6O 3LNMB 2F43G 1PV0A 3QF7A 5B1AB 5CA0B 4NTXA 1VF5B 4DV7O 1GK9A 4J10A 1Y6XA 5BMVB 2DN9A 1N4CA 2YIAA 2ZT9B 3K9AA 2HHHB 1JFFA 5LGTA 4DR2O 3P30A 2P7TC 2QTSA 4FPPA 2YI8A 1UPGA 2GUZA 1E1RG 4RQEA 3IAYA 4NKGB 2Y4UA 3MHHC 4FFBA 4DYLA 2IU0A 3Q4HB 1CPYA 1ZTEA 4N21A 2VQEB 4JI5B 2R9RB 5TISZ 2DOSA 1JPXA 5LP6A 4DR5O 5C8YB 4IGGA 3TCUA 3APQA 4L8JA 3E8HA 4X1YB 1HNZB 3FYIB 4MW3A 1OHHG 2NN4A 2B9ZA 2EIKB 1BGYH 2RCVA 4TV8A 1XMQO 4O4IA 3G80A 2ZR3A 1S5LZ 4MW8A 1KU9A 3IC9A 1YVWA 3RW0A 3UQ8A 1XL4A 2CTRA 1WA8A 3ABMC 1JCHA 2UUAO 1LUVA 1R3IC 1PNLA 3WB1A 3K57A 3SR2C 2CH7B 5DECA 2WLIB 1V54C 1V55C 4DV1B 4I0XA 3FYEB 4WFHA 2BSKB 1S5HC 5IYZB 5L3FA 1W59A 1SC5B 4LF6O 2EINC 4OPHA 2BOCC 4J80A 1I5XA 4TSFG 1NR1A 2P5OA 2LGQA 1I08A 4FMTA 4O4JA 4DW0A 1S72V 4B3MO 3CXCU 5B1OA 3N2GA 4HNAA 2GSMB 1S0VA 4WFFA 3ABMB 1LR1A 3WB2A 5BZBA 2YIBA 1R3JC 3IC7A 2N04A 3OFNG 3ASNB 1OCOB 2AW9A 5L3BA 3HKBA 4TUYB 2HFEC 4FZ1A 1QNMA 3K9SA 1V54B 1XI1A 2Q69A 3PN1A 4LF5O 3ZMVA 3H01A 4DV2B 1VQ8V 5LOVB 1IVSA 2EINB 5B3SB 2L6LA 4B08A 3T1CA 3M7MX 4BIOA 1S5JA 4IIJA 1VQNV 2ZE5A 1BQ0A 5DN6G 1H2NA 3OGIB 3CC7V 4J7KA 1M5IA 3H1IH 2ZCEA 3ABLB 1FXKB 3CCQV 2QWOB 2RDCA 2GDSA 5J2UA 2DQ0A 4H37A 3RT3C 3UT5A 2QDOA 3W7TA 1IBLO 1AJQA 3ZEDA 3ETGA 2ITDC 1TVKA 4JI0B 2RQ6A 3AK3A 1NTMH 4GYCB 2ZM6O 1WB8A 1N32B 2IU3A 4BAYA 4QE9A 3CHXA 2QKAA 3ML0A 3STLC 1TA8A 4JI3O 4F6RA 4CC5A 4FLXA 1AP5A 2JVDA 1ZX3A 4PJ0Z 4UB6Z 1P7BA 4OX9B 4PDVA 4MSWC 2QGNA 4JI1B 3L71H 3BA8A 2H3OA 3D36C 3L9DA 5LMNB 3LSSA 1T5EA 4DV5B 1GN2A 4LWSB 1GN3A 3OD4A 2DYSC 1S3JA 1K5SA 1KBHA 4JZ2A 4U3FH 2XAJA 3K5OA 3ZHSA 4MVZA 3ZHTA 4B3SB 3JARA 1FFXB 1ZSPA 1PL0A 4HAMA 4LH7A 3FAVA 1XNRO 3ZMZA 2JEUA 4DR6O 3FX7A 2DWDC 2HVJC 3A0HZ 1Q6IA 2F66C 1GRJA 1JA8A 3RYHA 4LH6A 1SQVH 2ETNA 2BOBC 4LF8O 2O57A 1GTOA 2LP7A 1M90W 4CC6A 3NR7A 4JI4B 3O9OA 2JDIG 3C90A 1RSOA 2DW4A 1I0HA 4UCOA 2JRIA 5EYPA 4ZI7B 1WPBA 2YEVB 2CE4A 2PYJA 4PA9A 4X66B 5KA6A 2A0LA 3MD0A 2D2CB 3D3QA 3K79A 3I5DA 3J7AU 1EN5A 2GTAA 3JALB 4X20B 4UCTA 5B1BC 2F23A 2QR4A 4G27B 4DO2A 1GO3F 4YJ3A 4B3TO 1L1FA 4UB8Z 2UUCB 2EX3A 2FMLA 2RNBA 1HWYA 1RM1C 2Q73A 1Z2GA 1MOFA 1KUQA 2EZPA 4X1KB 3AG3C 4UUJC 3OGCC 2P90A 3AG7A 4MVQA 4GZRB 3AEIA 3SPHA 4LF4B 1AI4A 1QVFU 5IJ0B 3CJHA 4NTWA 1K8AW 3BVOA 1HR0B 1F4MA 2DYRC 4JV5B 1FXHA 3D8CA 1GM7A 2MW2B 5EZYA 2WA3A 4YHHB 1KD1W 4ASUG 5KLVH 3AG4B 1G8MA 2R9IA 3RVZA 3H1LH 3OTOO 4PA7A 1AROP 4G2KA 4E4EA 4NXNO 4IL6Z 5GTHZ 4WCEV 1RPRA 4JI8B 4JF3A 2H94A 1PP9H 4JI2O 3ZRSA 2JS5A 2ZNJA 1YXBA 1FXVA 4XDLA 4QJFB 1SQQH 1D2DA 2EJRA 3E8GA 4U3JB 2B1IA 1XOUA 4DW1A 3HKCA 4R50A 2WLLB 3T1YO 1SQBH 3E22A 1Q6UA 3G6BA 2NNUA 2CTWA 1F51A 4DR1O 3OM3B 1XNQB 3TXQA 1H2GA 2C2AA 1KKCA 3C3SA 5ITZA 2VQFB 1SA0B 5CMUA 4YJ2B 2GTSA 2Q68A 2VS0A 4DK0A 4WFAV 4LFAB 3H1JH 2GV9A 2XUMA 4YY3B 2IJHA 5B66Z 1XMOB 1R73A 3RWRD 3VBBA 2ZDIC 3CCEV 3JCZA 3OMAB 4LFBO 3CXHF 4GUNA 3ZIAG 4GX2A 4ZBMA 3ETEA 1WN7A 1R6TA 2WA4A 2Z3YA 4I4TA 3BFRA 4FK5C 4X89A 5GW7A 3W7SA 4AI8A 2ZE6A 4XDJA 1GM8A 1FKAO 3I56V 2RMKB 1K73W 3SJCC 3E86A 1VQPV 4FLYA 1DTOA 4EKWA 2KG7A 4KUMA 4I5SA 1W0JG 3OAAG 4ZOLB 5LMUO 3R65A 1M57C 2XNDG 4UCUA 1ZL8B 1S77D 2EIJB 3OT7A 4DR3B 3IJ4A 3JSLA 5IDJA 2XT9A 3DGEA 5KHJA 1K97A 2OIEA 2XAFA 4NVPA 1I94B 3BCCH 1F23A 1Y4MA 4EFEA 4GKKO 1YF2A 3APOA 1VQ7V 4FLUA 4BIZA 3UO3A 1YJNV 5KHGA 3SDLA 5IT9N 5LGUA 4B3RB 3U10A 3SJBC 4LF9O 1HDJA 2UXXA 2ZXWB 4JAUA 1Q82W 5LA6A 4RWUA 3W7WA 2Q4PA 1W0KG
chains in the Genus database with same CATH topology
2HG5C 1OHHG 3ABKB 2LFRA 2EIKB 1EBOA 3CYOA 1AI5A 1BL8A 3CMEV 1DLBA 3ZJZA 2PI4A 4XBFA 4E2LA 2YEVA 2ZR3A 3K08A 2NLJC 2JEXA 5FL7G 4I9WA 4MW8A 3K3WA 2XAHA 4P9OA 4G28B 5KUMA 3RW0A 1OCZC 5IYCO 1KQSU 4UVAA 5H6RA 2ITCC 1XL4A 1Q81W 3ABMC 1JCHA 1R3IC 1VQ4V 3ZCCA 2OTJV 3B8MA 1PNLA 4MTGA 4BW5A 5CBHA 3WG7C 3KG2A 2WLIB 5B1AC 1V54C 1OCCC 1V55C 3QNEA 1BMFG 2EIJC 3FYEB 4WFHA 1MG1A 2HJFC 2B1GA 3K0GA 2UXNA 1S5HC 2HR3A 3CC4V 2ZDIA 5LGNA 5L3FA 2Z5UA 2EINC 2BOCC 2QA4V 1I5XA 5L3CA 5IY5C 4TSFG 5EC1C 2XAQA 1H8HG 4RAIA 2OTLV 1NR1A 2V7QG 3E83A 3WFVA 3ABTA 4FMTA 4QIWF 3QO7A 1S72V 1TUEB 3CXCU 2WLNA 1OCZB 1UJWB 5B1OA 5HFMA 5EK0A 1PNMA 3SYQA 2GSMB 1S0VA 3X2QC 1YTFB 1NVPB 2OCCB 4WFFA 3ABMB 2Q6AA 5BZBA 1I5YA 3AG1C 4P30A 3CPWU 3VOUA 3IFXA 1R3JC 3IC7A 4JGSA 4WFEA 4MTFA 3OFNG 3ASNB 2FTKA 2AHYA 1OCOB 2WPDG 2QM8A 5LHHA 1K92A 1ORQC 2ZXWC 4UV8A 3SYAA 5L3BA 4JTCB 2HFEC 2DYSB 1SETA 1K3EA 5H6QA 1V54B 1OCCB 2Q69A 3K03A 3SPGA 3ZMVA 3ABKC 1FS0G 3H01A 4FIPC 2EIKC 4UXNA 1NJIW 1VQ8V 2WAMA 3LDEA 4HYOA 4JYBA 4H33A 1Q7YW 2EINB 2EIMB 2WLLA 3T2MA 5B3SB 3BEHA 5KA5A 3T1CA 5IY5B 2WLJA 1VQNV 2JIZG 5DN6G 4X8AA 3ZRWA 3CC7V 1EFRG 1ROPA 3E89A 1KECA 2ZR2A 4MTXA 3ABLB 3LUTB 1FXKB 1AI6A 1PD3A 3FKSG 3CCQV 5IYBO 3JD0A 2EZOA 1NH2B 2DQ0A 4H37A 5CA3A 3X2QB 3W7TA 1KC8W 4MVUA 1AJQA 4JAVA 4GX5A 2LFSA 4X88A 1DF5A 3ASOB 1NH2D 1PKXA 3ETGA 2ITDC 3OEEG 4PDMA 2JJ2G 2ZD9A 4YXWG 1SERA 3OE7G 2IJJA 4J9YB 2IU3A 4BAYA 4QE9A 5B1BB 1YITV 3ML0A 3STLC 3TK1A 3ETDA 4U7NA 4JYCA 1CP9A 2XASA 1AJPA 3SYCA 1BHAA 4J9ZB 3CCUV 4LBEC 3OMIB 3OR7C 2HKOA 1RM1B 1K7DA 3LSQA 3CCMV 1P7BA 3AG3B 4PDRA 4PDVA 3JD2A 2PI5A 1K4CC 4MSWC 5E1AC 4LP8A 3B77A 4F4LA 3HB3B 3P32A 2OCCC 1JQ0A 1QLNA 1H8EG 1QLEC 2MK3A 3FB6C 2OT5A 3LSSA 3I55V 4PELA 3OW2U 3ASNC 1OCOC 2DYRB 5EBLC 3SPCA 2DYSC 1S3JA 1K5SA 4RQFA 2XAJA 4MVZA 4GT1A 2HLDG 4MVOA 1GKFA 4XDKA 3JD4A 1PL0A 4HAMA 1YHQV 2EIMC 4LC1A 5HFLA 4L87A 3ZMZA 4RUFA 1J95A 3ZMSA 5B3SC 2EILB 2IJIA 3K0DA 4PA6A 3ZMUA 2JEUA 5LHGA 2Y48A 1JVMA 4FJCC 5IYDO 2DWDC 2HVJC 4MVSA 1JX9A 2X6AA 3ABLC 1AJNA 1FXKC 2A79B 4JTDB 1KKDA 3OUFA 5C93A 2W6IG 4ZKIA 3UKMA 2BOBC 1GTOA 2LP7A 3CP1A 1M90W 1KP3A 3TETA 2JDIG 2X7RB 2DW4A 1VQMV 3IGAC 3E35A 2W6JG 2QKSA 2M7WA 1QLEB 3ASOC 2YEVB 2IJKA 4KFMA 4PA9A 1YTFD 1WLEA 1NVPD 5KA6A 2B5UA 2A0LA 3MD0A 3K79A 1E1QG 2WLKA 5B1BC 3HPLC 1S76D 2ZQMA 4G27B 1AI7A 4PA4A 4DO2A 3W7UA 1GO3F 3NXSA 3UM7A 5CN0A 1L1FA 4UV9A 5L3EA 3ZMTA 4GX1A 4MTOA 3ZRVA 1HWYA 2X6CA 3F7YC 3MHSC 4QPJA 4JPRA 1RM1C 1MOFA 1EZJA 2EZPA 4MS2A 3AG3C 4UUJC 4QNHB 2Y69C 1M9NA 2P90A 3OGCC 5CBGA 2Q67A 2WSSG 4MVQA 2WLMA 4MT8A 3B8NA 3AEIA 5J9PC 1IXMA 3SPHA 4PA3A 3LDDA 1AI4A 1FFTB 1VQOV 1QVFU 1K8AW 1F4MA 1JJ2U 3JD1A 2DYRC 3G71V 1FXHA 1M56B 3W7XA 4R7CA 1YIJV 2H8PC 3ZN1A 1GM7A 3EFFK 5B1NA 1THZA 4N23A 2WLIA 1KD1W 4RUEA 1Q86W 3A0RA 4ASUG 4BIUA 3RVYA 5CBFA 1N8RW 3AG2C 3QO5A 4MVRA 5DM6V 2DWEC 3D3IA 1GMGA 3AG4B 1G8MA 2R9IA 5EBWC 3RVZA 3SPIA 4PA7A 1COWG 2EILC 4KP4A 1ENVA 1AROP 4G2KA 3K06A 1R3LC 4WCEV 1RPRA 4JF3A 2H94A 3STZC 3ZRSA 1VQ6V 4JASA 3FB8C 1FXVA 4XDLA 4QJFB 2Y69B 2D3OW 2QTOA 2EJRA 4Z1MG 3ABUA 1E79G 3E8GA 1VQ5V 2P67A 4JTAB 3CD6V 1QR9A 1R6KA 2B1IA 3SYOA 1M57B 3CCVV 1K9MW 3M99B 2K1EA 4WFGA 1QVGU 4CZZA 2P6JA 2IW5A 1W2BU 1K34A 3D36A 3CCLV 3F7VC 2IH1C 2WLLB 4P2ZA 4R50A 2AHZA 1M1KW 1G4YB 1OZ0A 3E8FA 2YSUB 3ZRWB 1YJ9V 3CCRV 2NNUA 4UVBA 1KP2A 3CCJV 1F51A 4QE7A 4P9PA 1WPXA 3OM3B 1QCEA 1AR1B 5L3DA 3AG2B 1H2GA 4GX0A 1NBMG 2JJ1G 3E8BA 2C2AA 3LDCA 2GHYA 3K04A 2X0LA 1RPOA 3DTUB 1ZWIC 5CMUA 2Q68A 4WFAV 4WFBV 1R6NA 3FB7C 3T4ZA 3OEHG 2JK5C 2IJHA 1PNKA 3SPJA 1R73A 2QM7A 1OCRB 2KB1A 3VBBA 1B6QA 1YSCA 2ZDIC 3CCEV 1VQLV 5KUKA 1FXKA 3CMAV 1QBZA 3JCZA 3OMAB 1YJWV 4TT3G 3ZIAG 1MSWD 3SYPA 4GX2A 4ZBMA 1M56C 3ETEA 1JOYA 4HZ3A 5L3GA 2XOKG 2ATKC 3JD3A 1BHBA 3JYCA 2QEXV 1MABG 2Z3YA 2W0FC 1SRYA 2DQ3A 3FB5C 3OUSA 4FK5C 4X89A 5GW7A 3AG4C 2EBOA 3W7SA 5LHIA 1K4DC 4R8CA 2X6BA 3OR6C 2WWWA 1Y66A 4R6ZA 4CBCA 3OMNB 3BY6A 5LBQA 1YI2V 1CEZA 4XDJA 1GM8A 1DF4A 4LCUC 3I56V 3CC2V 2V1DA 1K73W 3E86A 1VQPV 3EHBB 1DTOA 3QO8A 4OXSA 4PDLA 3WG7B 4EKWA 4KUMA 1NKDA 3LNMB 2F43G 1NQTA 4I5SA 1W0JG 3OAAG 4MVMA 3R65A 1M57C 2XNDG 5B1AB 1S77D 1V55B 2IH3C 1SZTA 3G6EV 1QR8A 2EIJB 4TWKA 3ZN0A 1GK9A 2XAGA 3PJSK 1R3KC 1P4RA 3GWOA 3SJQC 5IDJA 1VQ9V 3GB7C 3DGEA 3G4SV 3K9AA 1VQKV 1LNQA 3T4DA 1K97A 5LGTA 2XAFA 3P30A 2A9HA 4QPKA 2P7TC 4Q20A 3RBZA 3E2EA 4FPPA 1SESA 2HVKC 4U7OA 2QE7G 1F23A 1E1RG 1Y4MA 4GCZA 4RQEA 1H38A 3ZRXA 3MHHC 1VQ7V 1GM9A 4BIZA 3CCSV 4RO2A 2IU0A 5EBMC 1YJNV 1XL6A 1CPYA 1NR7A 4DXWA 2WLHA 4N21A 3AG1B 1OCRC 2R9RB 5LGUA 1JPXA 5H9CA 2UXXA 2ZXWB 2CK3G 4JAUA 5EC2C 1Q82W 1K33A 3TCUA 3F5WC 1K5QA 3E8HA 3W7WA 4WF9V 3FYIB 1W0KG 4UVCA 4MW3A 1F4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  3OW2 U;  4WFA V;  4WFB V;  3CCQ V;  3G6E V;  1VQO V;  1QVF U;  1S72 V;  3CCU V;  3CME V;  1VQ7 V;  3CXC U;  1K8A W;  1M1K W;  1R73 A;  4WCE V;  3CCS V;  1NJI W;  1VQ8 V;  1YJN V;  1JJ2 U;  1VQ9 V;  3G71 V;  3CCE V;  1YJ9 V;  3CCM V;  3CCR V;  1VQ6 V;  1M90 W;  1YI2 V;  1VQL V;  1KQS U;  3CCJ V;  3CMA V;  1YJW V;  1YIJ V;  3G4S V;  1Q7Y W;  1VQK V;  3I56 V;  3CC2 V;  3CC4 V;  2D3O W;  1VQM V;  1Q81 W;  1K73 W;  3CPW U;  1KD1 W;  1VQP V;  1Q82 W;  1Q86 W;  1VQ5 V;  1YHQ V;  3CD6 V;  2QA4 V;  1VQN V;  1N8R W;  3CCV V;  1K9M W;  1VQ4 V;  3CC7 V;  5DM6 V;  1YIT V;  1QVG U;  2OTL V;  2OTJ V;  2QEX V;  4WF9 V;  1W2B U;  1KC8 W;  3I55 V; 
#chains in the Genus database with same CATH topology
 1LUW A;  2YXH A;  3ABK B;  2QWQ B;  3CYO A;  4UCR A;  2XTA A;  5FLX N;  3CME V;  4E2L A;  3K08 A;  1IX9 A;  3VQY A;  3K3W A;  1N34 B;  1MMM A;  1OCZ C;  1BZK A;  2YUA A;  1VF6 A;  2ITC C;  1FJG B;  4ZHQ B;  5JJN B;  3JAT B;  3ZCC A;  2OTJ V;  4BW5 A;  1Y74 B;  4MTG A;  5CBH A;  5H5N A;  3WG7 C;  4LNU A;  3P3P A;  2P4K A;  4O2B B;  4K8Z A;  5B1A C;  1OCC C;  1HW7 A;  1BMF G;  1TAE A;  2UXC O;  1N36 B;  3VQW A;  2B1G A;  2KQX A;  2UXN A;  2HR3 A;  3K0G A;  3CC4 V;  2Z5U A;  2QA4 V;  3HR0 A;  5L3C A;  5IY5 C;  5EC1 C;  2OTL V;  2V7Q G;  3E83 A;  3WFV A;  4I9Q A;  2ADQ B;  2ZKO A;  2FYU H;  2UXD O;  1TUE B;  4AQY B;  2WLN A;  1OCZ B;  1UJW B;  3THO A;  3ZS8 C;  1IDS A;  2OCC B;  3N2K A;  1I5Y A;  1A32 A;  4P30 A;  3IFX A;  1GAX A;  2AHY A;  4LF7 O;  2QM8 A;  1K92 A;  1ORQ C;  1Q43 A;  1ZAU A;  2E5L B;  1SET A;  4I55 B;  5C8Y A;  1H2M A;  1FPO A;  1OCC B;  1PPJ H;  3SPG A;  1FS0 G;  4FIP C;  4UXN A;  2EIK C;  2WAM A;  4HYO A;  1Z5W A;  2EIM B;  3T2M A;  4TOI A;  5IY5 B;  3ZBH A;  4X8A A;  2LJ2 A;  3ZRW A;  3CRQ A;  1HNW O;  1KEC A;  2ZR2 A;  4MTX A;  3FFQ A;  3LUT B;  4CS4 A;  1H2L A;  1H2S B;  2ARH A;  2EZO A;  5CB4 B;  5CA3 A;  2BTO A;  4X64 O;  3DXR A;  4GX5 A;  2LFS A;  1ZLZ A;  3ASO B;  4DR2 B;  5JH7 A;  4YXW G;  2K9P A;  2IJJ A;  3TK1 A;  3HKE B;  4U7N A;  4JYC A;  1CP9 A;  2YC0 A;  2XAS A;  2DJV A;  1AJP A;  1WJZ A;  1BHA A;  2KKW A;  2HKO A;  2Q7H A;  4TV9 B;  1DGS A;  5KX5 A;  3RYF A;  3CCM V;  4DRX A;  5LL6 Y;  4PDR A;  1YCI A;  5KAI Z;  2PI5 A;  4DR5 B;  3B77 A;  4DR7 O;  5K1X A;  4DUY O;  1QLE C;  2MK3 A;  3FB6 C;  2OT5 A;  1X59 A;  3K59 A;  5K1P A;  3ASN C;  1OCO C;  1JFF B;  4IT5 A;  4UCS A;  2UUB O;  1JR9 A;  3DC6 A;  4D7S A;  4XDK A;  2ZE7 A;  4K0K O;  1YHQ V;  4FFB B;  2UUA B;  3CE2 A;  3AK2 A;  5HFL A;  4L87 A;  5B3S C;  3ZMS A;  2EIL B;  3RFR A;  3A2F A;  4AHC A;  4PA6 A;  4FJC C;  4Z1V A;  2AZ2 A;  3RYI A;  3ABL C;  4JTD B;  1FXK C;  1XQ8 A;  2W6I G;  1RFY A;  3UKM A;  5JJJ B;  1FD9 A;  3TET A;  4KL1 A;  1NU1 H;  2YXY A;  2AZ0 A;  4JYA O;  2PGG A;  5CA1 A;  4D7T A;  4CH3 A;  4LF6 B;  4TV8 B;  2JS3 A;  4J41 A;  4O4I B;  2E75 B;  1QLE B;  2PY5 A;  3K5M A;  2IJK A;  1WLE A;  2B5U A;  4B3M B;  1WA8 B;  1AI7 A;  3UM7 A;  2ILM A;  4UV9 A;  4GX1 A;  2X6C A;  3F7Y C;  4JPR A;  2ADP A;  2RJZ A;  4MS2 A;  1BSM A;  3UO2 A;  4H13 B;  2Q67 A;  1IBK B;  4NXM O;  1JJO A;  5J9P C;  4PA3 A;  2BTQ A;  2N74 A;  5AG2 A;  3P3N A;  3LDD A;  1RP3 B;  4I50 A;  5LYJ A;  1FFT B;  2E76 B;  4NTY A;  3ZHV A;  4YIO A;  4LF5 B;  2JGD A;  1QQC A;  3JD1 A;  2HP8 A;  3G71 V;  1VAR A;  1KB9 F;  2W0X A;  5JJE B;  1HNX O;  3T1H B;  2UXB O;  3ZN1 A;  2PF4 E;  4O4J B;  5B1N A;  1THZ A;  1OV9 A;  3A0R A;  5CBF A;  1N8R W;  3N2G B;  1N0N A;  4DR4 B;  4HNA B;  1GMG A;  5EBW C;  3SPI A;  2HJD A;  3RYC B;  1VMG A;  1ENV A;  2Z0A A;  3BHP A;  1D5N A;  1R3L C;  1B06 A;  4IYI A;  1O9H A;  2Q5Z A;  1IBL B;  3HKB B;  2Y0P A;  4O2A A;  2D3O W;  4Z1M G;  1VQ5 V;  4LFC O;  1QR9 A;  2ZM6 B;  2JGU A;  3L74 H;  3SYO A;  2YDE A;  3CCV V;  4WFG A;  1Q5O A;  2CUG A;  4JI3 B;  1K34 A;  3D36 A;  4B7K A;  3ICX A;  3L73 H;  4OGQ B;  2AHZ A;  1M1K W;  1OZ0 A;  4IIJ B;  3E8F A;  2P4V A;  4FVM A;  3CCR V;  4X20 A;  4UVB A;  4PD4 F;  1SQX H;  1NBM G;  1F7Y A;  1IUR A;  5J2U B;  1SQG A;  3UT5 B;  2CDY A;  1ZWI C;  3CRA A;  5IJ9 A;  1TVK B;  3FB7 C;  5LXT A;  1OCR B;  1GN6 A;  2KB1 A;  4PHZ A;  3BAB A;  3HKD A;  5A9G A;  3CMA V;  1QBZ A;  3SYP A;  4F6R B;  1XNR B;  1JOY A;  4EFB A;  1BHB A;  4O4L A;  1BQZ A;  3JYC A;  1MAB G;  1O9G A;  3RN4 A;  2PUS A;  3TXS A;  2DQ3 A;  3AG4 C;  2EBO A;  3CEI A;  1K4D C;  1U97 A;  1CXZ B;  4R8C A;  2X6B A;  4DK1 A;  3C3T A;  4LF8 B;  5H2F Z;  4CBC A;  3H1K H;  1UFI A;  5IWA B;  3ZHU A;  4LF4 O;  5BR8 O;  3JAR B;  2IH3 C;  1P7G A;  5JCO C;  1QR8 A;  2XAG A;  3PJS K;  1P4R A;  3GWO A;  1TUB A;  3FAV B;  4EB6 A;  5KHK A;  1N33 O;  1VQ9 V;  4B3T B;  2F93 B;  3JAK A;  3CWB H;  3G4S V;  2R70 A;  1L0N H;  5IE9 A;  1VQK V;  1LNQ A;  1SKV A;  3ZX6 A;  1SES A;  1QHT A;  1BE3 H;  2QE7 G;  4DUZ O;  4CH4 A;  4GCZ A;  2EUL A;  1US6 A;  3ZRX A;  1RSO B;  1XDC A;  5EYP B;  1GM9 A;  3KCX A;  4FM2 A;  3JSN A;  5KHI A;  3CCS V;  4HBN A;  5EBM C;  1XL6 A;  1NR7 A;  4DXW A;  4YJ2 A;  3JAS A;  3AG1 B;  4GKJ O;  1G6U A;  5H9C A;  2CK3 G;  1K33 A;  4YJ3 B;  1K5Q A;  4JZG A;  4UVC A;  4DV6 O;  1F4N A;  2HG5 C;  3OTO B;  2ZIN A;  1KC8 W;  4JI7 O;  2LFR A;  4AIL C;  4NXN B;  1AI5 A;  1BL8 A;  3ZJZ A;  4XBF A;  4EEQ A;  2NLJ C;  1WAZ A;  2JEX A;  2ZE8 A;  4I9W A;  5FL7 G;  4JI2 B;  4X62 O;  1VF7 A;  2XAH A;  5KUM A;  4D6T H;  5H6R A;  1XNQ O;  1Y76 A;  1NI8 A;  2Q0O C;  4Q6G A;  2LW7 A;  3QTC A;  3B8M A;  2QSA A;  4K35 A;  3QVN A;  3KG2 A;  3CS5 A;  5EZY B;  3QNE A;  2EIJ C;  1MG1 A;  1B3Q A;  4DR1 B;  4ZIB A;  2ZDI A;  5LGN A;  1IBM O;  1PM9 A;  4J11 A;  4RAI A;  4BR6 A;  4X1I A;  4CH6 A;  3ABT A;  3KKY A;  4QIW F;  4CS2 A;  3QO7 A;  1DK1 A;  5HFM A;  4A5U B;  3CX5 F;  1I7F A;  2HEP A;  2NR5 A;  3X2Q C;  1YTF B;  1NVP B;  2UU9 O;  4LFB B;  3HKC B;  3H1H H;  2LO1 A;  2OIG A;  3E22 B;  4WFE A;  2FTK A;  2ZXW C;  4UV8 A;  5JQG A;  3A8T A;  4IHJ A;  4DR3 O;  5GON A;  2RN9 A;  3JAW A;  5FNV A;  5JVD A;  3ABK C;  4UFZ A;  1NJI W;  5ITZ B;  3LDE A;  4NB5 A;  2IBZ H;  1KMI Z;  5KA5 A;  4GLX A;  2JIZ G;  4LR3 A;  1Q3E A;  1ROP A;  2QWR B;  2YI9 A;  3E89 A;  3WB0 A;  1PD3 A;  3FKS G;  4FLZ A;  5IYB O;  5KMG A;  4DV4 O;  3X2Q B;  5J2T A;  4X65 B;  5D5P A;  4DV0 B;  5KHH A;  1DF5 A;  4DV3 O;  2ZIM A;  3OEE G;  4I4T B;  4PDM A;  2JJ2 G;  2ZD9 A;  3VQX A;  3OE7 G;  1BS3 A;  3GVM A;  4X9Q A;  3DC5 A;  4WBN B;  4GKK B;  3SYC A;  2A06 H;  4BW9 A;  4J9Z B;  3CCU V;  4LBE C;  2KG7 B;  3LSQ A;  2FKX A;  4I7Z B;  4O4H A;  3JD2 A;  5FPO A;  4ICG A;  5E1A C;  4F6E A;  2FB5 A;  1VEW A;  3HB3 B;  3P32 A;  4F4L A;  2OCC C;  1JQ0 A;  1H8E G;  1QU7 A;  4PV1 B;  2F4V O;  2CGN A;  4FZ0 A;  3OW2 U;  1XUQ A;  3K5N A;  4KHP O;  5EBL C;  4RQF A;  3N27 A;  4GT1 A;  5CA0 A;  1MA1 A;  4MVO A;  2QJ1 A;  3JD4 A;  3KZI Z;  2EIM C;  5BMV A;  4RUF A;  2AGA A;  4PI2 A;  5E79 Z;  2PZS A;  2Y48 A;  1JVM A;  5IYD O;  1FAF A;  4FLV A;  2R72 A;  1AJN A;  1KKD A;  2E3C A;  2LQT A;  3OUF A;  5C93 A;  3K5L A;  1J5E O;  4ZKI A;  3EXA A;  1KP3 A;  1D5A A;  2X7R B;  1VQM V;  2L35 A;  3IGA C;  3E35 A;  3K58 A;  3ASO C;  2Y0I A;  3Q4H A;  3U11 A;  4KFM A;  1AR4 A;  4KXR A;  2E5L O;  1V9P A;  2WLK A;  2UXD B;  1Z5V A;  2ZQM A;  3W7U A;  4K3A A;  2AXT Z;  4X1Y A;  1XBL A;  5L3E A;  3ZMT A;  3S3W A;  2HHH O;  1EZJ A;  4LNU B;  2A7W A;  4QNH B;  2CTQ A;  3WU2 Z;  2Y69 C;  2E74 B;  3TJT A;  2R9A A;  4LF7 B;  2WLM A;  4JI6 B;  2LW1 A;  4DV7 B;  1P49 A;  1JJ2 U;  2VWK A;  5JWP A;  1IXB A;  2QM4 A;  2YIC A;  1M56 B;  2CTP A;  2VQE O;  1L0L H;  1SF9 A;  4R7C A;  3SJA C;  4JI5 O;  2CH7 A;  4N23 A;  5GTI Z;  2WLI A;  1Q86 W;  1EN6 A;  4BIU A;  1M4U A;  3QO5 A;  5DM6 V;  2DWE C;  3CRM A;  3JCU Z;  1HNZ O;  1HNW B;  4QGP A;  4CS3 A;  2BSK A;  1JMK C;  2EIL C;  2FL4 A;  3TGU H;  5IYZ A;  4KP4 A;  3N2K B;  1NS1 A;  3K06 A;  3CB2 A;  4X64 B;  5LP6 C;  3FB8 C;  2Y69 B;  3ABU A;  3CD6 V;  2P67 A;  1IZ3 A;  4JTA B;  4J7Z A;  3M99 B;  2IW5 A;  3CCL V;  2IH1 C;  4P2Z A;  1XMQ B;  1SZX A;  1G4Y B;  3ZRW B;  4H44 B;  4JAA A;  5EIB C;  4TUY A;  4DV1 O;  4YIP A;  1KP2 A;  2QWN B;  1WPX A;  2GUZ B;  1QCE A;  5L3D A;  2Q8V A;  4GX0 A;  4DR7 B;  3E8B A;  3LDC A;  5LOV A;  2GHY A;  4DUY B;  3K04 A;  2X0L A;  3DTU B;  3DXR B;  4WFB V;  2ODM A;  3T4Z A;  3OEH G;  5LP6 B;  2UUB B;  5JH7 B;  2QM7 A;  2YS8 A;  2OYQ A;  1B6Q A;  1YSC A;  2V4D A;  1VQL V;  1FXK A;  4TT3 G;  4K0K B;  3ETQ A;  1XEQ A;  1AR5 A;  1XHX A;  1FYJ A;  2XOK G;  4FLW A;  5KX5 B;  3RYF B;  4DRX B;  3OUS A;  3FB5 C;  5LHI A;  4DV2 O;  2WWW A;  3L72 H;  4R6Z A;  3OMN B;  3BY6 A;  5LBQ A;  3RYC A;  1YI2 V;  3B4S A;  1CEZ A;  3G67 A;  5EIB D;  1DF4 A;  3J80 N;  4JYA B;  1NTK H;  1H2K A;  3EHB B;  3QO8 A;  4BWA A;  4PDL A;  1IBK O;  5B5E Z;  1NKD A;  1NQT A;  4MVM A;  2DMX A;  3FD9 A;  1AB3 A;  4I0X B;  2P06 A;  1V55 B;  1SZT A;  3G6E V;  4TWK A;  3JAM N;  3ZN0 A;  1Q8I A;  1R3K C;  4B7E A;  3MAQ A;  3SJQ C;  1NTZ H;  4FLT A;  3GB7 C;  3T1H O;  4IYH A;  4LWS A;  3T4D A;  4JI0 O;  3RYI B;  2A9H A;  4QPK A;  4Q20 A;  3E2E A;  3RBZ A;  1N32 O;  4NXM B;  4DR4 O;  2HVK C;  3GWK C;  4U7O A;  1FFX A;  4W4L A;  1BT8 A;  1H38 A;  5CA1 B;  4RO2 A;  2A3Q A;  2WLH A;  1HNX B;  3A0B Z;  2UXB B;  4OX9 O;  1OCR C;  2YIB D;  4JI1 O;  5FPR A;  1MNG A;  1GH6 A;  2M6Y A;  4J42 A;  5EC2 C;  1X4T A;  3RGB A;  1YDX A;  3F5W C;  5LMN O;  4C7U A;  4WF9 V;  4J9Y B;  4DV5 O;  1EBO A;  4ZI7 A;  1DLB A;  2PI4 A;  2YEV A;  5F2V O;  1SS3 A;  2PYL A;  4P9O A;  4NYK A;  4G28 B;  5IYC O;  1KQS U;  4B3S O;  4UVA A;  3JAL A;  2BTQ B;  2F95 B;  2XHB A;  4I50 B;  5LYJ B;  1Q81 W;  3B2E E;  4LFC B;  2YID A;  4FFK A;  2JGD B;  3EVK A;  1VQ4 V;  4X1K A;  4W4K A;  2F1M A;  2EJ7 A;  2HJF C;  4JI4 O;  5IJ0 A;  1URF A;  3UCS C;  3U0Z A;  2XAQ A;  1H8H G;  3ZHR A;  4X66 O;  3LSU A;  4TQD A;  4O2A B;  4UCV A;  4DR6 B;  1AIL A;  5EK0 A;  1PNM A;  3SYQ A;  2UUC O;  3J81 N;  3CRC A;  5D5Q A;  2Q6A A;  3CPW U;  3AG1 C;  1GN4 A;  3VOU A;  5IWA O;  4JGS A;  1SQP H;  4MTF A;  2WPD G;  5LHH A;  3SYA A;  3BAA A;  4JTC B;  2DYS B;  1K3E A;  5H6Q A;  1OJH A;  4U3J A;  2Q0A A;  3K03 A;  1HR0 O;  1L8D A;  3L70 H;  4JYB A;  5JCO A;  1KYO F;  4H33 A;  4JV5 O;  1U96 A;  1YEW A;  1Q7Y W;  2WLL A;  3BEH A;  5IJ9 B;  2WLJ A;  4YHH O;  1YZB A;  3B40 A;  5LXT B;  2IM9 A;  3RYH B;  1EFR G;  3HKD B;  3BA9 A;  1XIL A;  5BR8 B;  3BPZ A;  3AK1 A;  2N05 A;  1AI6 A;  1R1B A;  5BXZ A;  3JD0 A;  1NH2 B;  1EN4 A;  1N33 B;  4JI8 O;  2GBO A;  3KCY A;  1SA0 A;  1XRE A;  4MVU A;  4O4L B;  4JAV A;  4X88 A;  1NH2 D;  1PKX A;  5DED A;  1SER A;  2Q7G A;  5B1B B;  1YIT V;  3ETD A;  4DUZ B;  1Q6H A;  1VP7 A;  3OMI B;  3OR7 C;  1WP7 A;  4TQF A;  1RM1 B;  1K7D A;  2VWJ A;  2CAZ C;  4GKJ B;  3AG3 B;  1K4C C;  4LP8 A;  4Z2W A;  5BY1 A;  2YXL A;  1TUB B;  1WNS A;  3CJH B;  1QLN A;  4EB6 B;  3OTF A;  1MSD A;  2VQF O;  4DV6 B;  3I55 V;  3JAK B;  4PEL A;  4JI7 B;  2G38 A;  1TGO A;  2DYR B;  3T1Y B;  4LFA O;  4YY3 O;  1XMO O;  3SPC A;  4X62 B;  4ZOL A;  1ZL8 A;  1EM1 A;  2HLD G;  1AP6 A;  1GKF A;  1WB7 A;  2CGO A;  1B04 A;  1M93 A;  4LC1 A;  4H0L B;  1J95 A;  2IJI A;  3CSX A;  3K0D A;  3ZMU A;  5A2Q N;  1P84 F;  3O65 A;  5LHG A;  3JAS B;  4MVS A;  1JX9 A;  2X6A A;  3S3X A;  2A79 B;  3L75 H;  3CP1 A;  4NR1 A;  2KSD A;  3F5T A;  1IBM B;  1WP8 A;  2W6J G;  2QKS A;  2M7W A;  1VIB A;  1YTF D;  1NVP D;  1E1Q G;  3HPL C;  1S76 D;  1Y76 B;  3DSQ A;  1HP8 A;  4PA4 A;  3NXS A;  2PTM A;  2BE3 A;  5CN0 A;  3QG5 A;  4MTO A;  4WBN A;  3ZRV A;  2BCC H;  2UU9 B;  3MHS C;  4QPJ A;  4K8X A;  3H9V A;  2QWP B;  1N0J A;  2ZNI A;  1M9N A;  5CBG A;  2ZIO A;  2WSS G;  4MT8 A;  3B8N A;  1IXM A;  1I94 O;  5LMU B;  4ZHQ A;  1VQO V;  3JAT A;  4X65 O;  4DV0 O;  2LGW A;  1Y74 A;  4X1I B;  3W7X A;  2QKC A;  2H8P C;  1YIJ V;  4B3R O;  3EFF K;  5KAF Z;  4J7J A;  4O2B A;  2DE0 X;  4RUE A;  3R66 A;  1BCC H;  3RVY A;  3AG2 C;  4MVR A;  3CRR A;  4CH5 A;  2OCH A;  3D3I A;  1COW G;  3B09 A;  1MZE A;  3MDS A;  1EZV H;  4DV4 B;  1G1X B;  3STZ C;  1VQ6 V;  1N34 O;  4ABM A;  4JAS A;  5JQG B;  4DV3 B;  3SGI A;  1FJG O;  2QTO A;  4IHJ B;  5GON B;  4LF9 B;  1E79 G;  3JAW B;  5FNV B;  2Y4T A;  1R6K A;  5JVD B;  1M57 B;  1K9M W;  2K1E A;  1QVG U;  4CZZ A;  2P6J A;  4FM1 A;  1W2B U;  3F7V C;  1NZ6 A;  1VF6 C;  3VQV A;  1Y67 A;  1XHZ A;  2YSU B;  1YJ9 V;  1N36 O;  3LNN A;  4JYY A;  4I55 A;  3CCJ V;  4QE7 A;  4P9P A;  1AR1 B;  3AG2 B;  5KMG B;  2JJ1 G;  1AVM A;  1RPO A;  3ZHQ A;  5J2T B;  2F4V B;  4OPA A;  4FM0 A;  1Q90 D;  1R6N A;  4KHP B;  2JK5 C;  2VRZ A;  1PNK A;  3SPJ A;  4AQY O;  1NT2 B;  2UXC B;  1PL4 A;  5LA6 B;  3M8A A;  5KUK A;  1YJW V;  2OWO A;  1MSW D;  1M56 C;  1MZF A;  5CB4 A;  4HZ3 A;  5L3G A;  2ATK C;  3JD3 A;  2QEX V;  2W0F C;  1SRY A;  4O4H B;  2P22 C;  2Q7E A;  1J5E B;  3BRC A;  3OR6 C;  1Y66 A;  3HKE A;  2Q9L A;  4PI0 A;  4LCU C;  3CC2 V;  2V1D A;  1SQF A;  1ZUQ A;  4TV9 A;  4OXS A;  3WG7 B;  4JI6 O;  3LNM B;  2F43 G;  1PV0 A;  3QF7 A;  5B1A B;  5CA0 B;  4NTX A;  1VF5 B;  4DV7 O;  1GK9 A;  4J10 A;  1Y6X A;  5BMV B;  2DN9 A;  1N4C A;  2YIA A;  2ZT9 B;  3K9A A;  2HHH B;  1JFF A;  5LGT A;  4DR2 O;  3P30 A;  2P7T C;  2QTS A;  4FPP A;  2YI8 A;  1UPG A;  2GUZ A;  1E1R G;  4RQE A;  3IAY A;  4NKG B;  2Y4U A;  3MHH C;  4FFB A;  4DYL A;  2IU0 A;  3Q4H B;  1CPY A;  1ZTE A;  4N21 A;  2VQE B;  4JI5 B;  2R9R B;  5TIS Z;  2DOS A;  1JPX A;  5LP6 A;  4DR5 O;  5C8Y B;  4IGG A;  3TCU A;  3APQ A;  4L8J A;  3E8H A;  4X1Y B;  1HNZ B;  3FYI B;  4MW3 A;  1OHH G;  2NN4 A;  2B9Z A;  2EIK B;  1BGY H;  2RCV A;  4TV8 A;  1XMQ O;  4O4I A;  3G80 A;  2ZR3 A;  1S5L Z;  4MW8 A;  1KU9 A;  3IC9 A;  1YVW A;  3RW0 A;  3UQ8 A;  1XL4 A;  2CTR A;  1WA8 A;  3ABM C;  1JCH A;  2UUA O;  1LUV A;  1R3I C;  1PNL A;  3WB1 A;  3K57 A;  3SR2 C;  2CH7 B;  5DEC A;  2WLI B;  1V54 C;  1V55 C;  4DV1 B;  4I0X A;  3FYE B;  4WFH A;  2BSK B;  1S5H C;  5IYZ B;  5L3F A;  1W59 A;  1SC5 B;  4LF6 O;  2EIN C;  4OPH A;  2BOC C;  4J80 A;  1I5X A;  4TSF G;  1NR1 A;  2P5O A;  2LGQ A;  1I08 A;  4FMT A;  4O4J A;  4DW0 A;  1S72 V;  4B3M O;  3CXC U;  5B1O A;  3N2G A;  4HNA A;  2GSM B;  1S0V A;  4WFF A;  3ABM B;  1LR1 A;  3WB2 A;  5BZB A;  2YIB A;  1R3J C;  3IC7 A;  2N04 A;  3OFN G;  3ASN B;  1OCO B;  2AW9 A;  5L3B A;  3HKB A;  4TUY B;  2HFE C;  4FZ1 A;  1QNM A;  3K9S A;  1V54 B;  1XI1 A;  2Q69 A;  3PN1 A;  4LF5 O;  3ZMV A;  3H01 A;  4DV2 B;  1VQ8 V;  5LOV B;  1IVS A;  2EIN B;  5B3S B;  2L6L A;  4B08 A;  3T1C A;  3M7M X;  4BIO A;  1S5J A;  4IIJ A;  1VQN V;  2ZE5 A;  1BQ0 A;  5DN6 G;  1H2N A;  3OGI B;  3CC7 V;  4J7K A;  1M5I A;  3H1I H;  2ZCE A;  3ABL B;  1FXK B;  3CCQ V;  2QWO B;  2RDC A;  2GDS A;  5J2U A;  2DQ0 A;  4H37 A;  3RT3 C;  3UT5 A;  2QDO A;  3W7T A;  1IBL O;  1AJQ A;  3ZED A;  3ETG A;  2ITD C;  1TVK A;  4JI0 B;  2RQ6 A;  3AK3 A;  1NTM H;  4GYC B;  2ZM6 O;  1WB8 A;  1N32 B;  2IU3 A;  4BAY A;  4QE9 A;  3CHX A;  2QKA A;  3ML0 A;  3STL C;  1TA8 A;  4JI3 O;  4F6R A;  4CC5 A;  4FLX A;  1AP5 A;  2JVD A;  1ZX3 A;  4PJ0 Z;  4UB6 Z;  1P7B A;  4OX9 B;  4PDV A;  4MSW C;  2QGN A;  4JI1 B;  3L71 H;  3BA8 A;  2H3O A;  3D36 C;  3L9D A;  5LMN B;  3LSS A;  1T5E A;  4DV5 B;  1GN2 A;  4LWS B;  1GN3 A;  3OD4 A;  2DYS C;  1S3J A;  1K5S A;  1KBH A;  4JZ2 A;  4U3F H;  2XAJ A;  3K5O A;  3ZHS A;  4MVZ A;  3ZHT A;  4B3S B;  3JAR A;  1FFX B;  1ZSP A;  1PL0 A;  4HAM A;  4LH7 A;  3FAV A;  1XNR O;  3ZMZ A;  2JEU A;  4DR6 O;  3FX7 A;  2DWD C;  2HVJ C;  3A0H Z;  1Q6I A;  2F66 C;  1GRJ A;  1JA8 A;  3RYH A;  4LH6 A;  1SQV H;  2ETN A;  2BOB C;  4LF8 O;  2O57 A;  1GTO A;  2LP7 A;  1M90 W;  4CC6 A;  3NR7 A;  4JI4 B;  3O9O A;  2JDI G;  3C90 A;  1RSO A;  2DW4 A;  1I0H A;  4UCO A;  2JRI A;  5EYP A;  4ZI7 B;  1WPB A;  2YEV B;  2CE4 A;  2PYJ A;  4PA9 A;  4X66 B;  5KA6 A;  2A0L A;  3MD0 A;  2D2C B;  3D3Q A;  3K79 A;  3I5D A;  3J7A U;  1EN5 A;  2GTA A;  3JAL B;  4X20 B;  4UCT A;  5B1B C;  2F23 A;  2QR4 A;  4G27 B;  4DO2 A;  1GO3 F;  4YJ3 A;  4B3T O;  1L1F A;  4UB8 Z;  2UUC B;  2EX3 A;  2FML A;  2RNB A;  1HWY A;  1RM1 C;  2Q73 A;  1Z2G A;  1MOF A;  1KUQ A;  2EZP A;  4X1K B;  3AG3 C;  4UUJ C;  3OGC C;  2P90 A;  3AG7 A;  4MVQ A;  4GZR B;  3AEI A;  3SPH A;  4LF4 B;  1AI4 A;  1QVF U;  5IJ0 B;  3CJH A;  4NTW A;  1K8A W;  3BVO A;  1HR0 B;  1F4M A;  2DYR C;  4JV5 B;  1FXH A;  3D8C A;  1GM7 A;  2MW2 B;  5EZY A;  2WA3 A;  4YHH B;  1KD1 W;  4ASU G;  5KLV H;  3AG4 B;  1G8M A;  2R9I A;  3RVZ A;  3H1L H;  3OTO O;  4PA7 A;  1ARO P;  4G2K A;  4E4E A;  4NXN O;  4IL6 Z;  5GTH Z;  4WCE V;  1RPR A;  4JI8 B;  4JF3 A;  2H94 A;  1PP9 H;  4JI2 O;  3ZRS A;  2JS5 A;  2ZNJ A;  1YXB A;  1FXV A;  4XDL A;  4QJF B;  1SQQ H;  1D2D A;  2EJR A;  3E8G A;  4U3J B;  2B1I A;  1XOU A;  4DW1 A;  3HKC A;  4R50 A;  2WLL B;  3T1Y O;  1SQB H;  3E22 A;  1Q6U A;  3G6B A;  2NNU A;  2CTW A;  1F51 A;  4DR1 O;  3OM3 B;  1XNQ B;  3TXQ A;  1H2G A;  2C2A A;  1KKC A;  3C3S A;  5ITZ A;  2VQF B;  1SA0 B;  5CMU A;  4YJ2 B;  2GTS A;  2Q68 A;  2VS0 A;  4DK0 A;  4WFA V;  4LFA B;  3H1J H;  2GV9 A;  2XUM A;  4YY3 B;  2IJH A;  5B66 Z;  1XMO B;  1R73 A;  3RWR D;  3VBB A;  2ZDI C;  3CCE V;  3JCZ A;  3OMA B;  4LFB O;  3CXH F;  4GUN A;  3ZIA G;  4GX2 A;  4ZBM A;  3ETE A;  1WN7 A;  1R6T A;  2WA4 A;  2Z3Y A;  4I4T A;  3BFR A;  4FK5 C;  4X89 A;  5GW7 A;  3W7S A;  4AI8 A;  2ZE6 A;  4XDJ A;  1GM8 A;  1FKA O;  3I56 V;  2RMK B;  1K73 W;  3SJC C;  3E86 A;  1VQP V;  4FLY A;  1DTO A;  4EKW A;  2KG7 A;  4KUM A;  4I5S A;  1W0J G;  3OAA G;  4ZOL B;  5LMU O;  3R65 A;  1M57 C;  2XND G;  4UCU A;  1ZL8 B;  1S77 D;  2EIJ B;  3OT7 A;  4DR3 B;  3IJ4 A;  3JSL A;  5IDJ A;  2XT9 A;  3DGE A;  5KHJ A;  1K97 A;  2OIE A;  2XAF A;  4NVP A;  1I94 B;  3BCC H;  1F23 A;  1Y4M A;  4EFE A;  4GKK O;  1YF2 A;  3APO A;  1VQ7 V;  4FLU A;  4BIZ A;  3UO3 A;  1YJN V;  5KHG A;  3SDL A;  5IT9 N;  5LGU A;  4B3R B;  3U10 A;  3SJB C;  4LF9 O;  1HDJ A;  2UXX A;  2ZXW B;  4JAU A;  1Q82 W;  5LA6 A;  4RWU A;  3W7W A;  2Q4P A;  1W0K G; 
#chains in the Genus database with same CATH homology
 2HG5 C;  1OHH G;  3ABK B;  2LFR A;  2EIK B;  1EBO A;  3CYO A;  1AI5 A;  1BL8 A;  3CME V;  1DLB A;  3ZJZ A;  2PI4 A;  4XBF A;  4E2L A;  2YEV A;  2ZR3 A;  3K08 A;  2NLJ C;  2JEX A;  5FL7 G;  4I9W A;  4MW8 A;  3K3W A;  2XAH A;  4P9O A;  4G28 B;  5KUM A;  3RW0 A;  1OCZ C;  5IYC O;  1KQS U;  4UVA A;  5H6R A;  2ITC C;  1XL4 A;  1Q81 W;  3ABM C;  1JCH A;  1R3I C;  1VQ4 V;  3ZCC A;  2OTJ V;  3B8M A;  1PNL A;  4MTG A;  4BW5 A;  5CBH A;  3WG7 C;  3KG2 A;  2WLI B;  5B1A C;  1V54 C;  1OCC C;  1V55 C;  3QNE A;  1BMF G;  2EIJ C;  3FYE B;  4WFH A;  1MG1 A;  2HJF C;  2B1G A;  3K0G A;  2UXN A;  1S5H C;  2HR3 A;  3CC4 V;  2ZDI A;  5LGN A;  5L3F A;  2Z5U A;  2EIN C;  2BOC C;  2QA4 V;  1I5X A;  5L3C A;  5IY5 C;  4TSF G;  5EC1 C;  2XAQ A;  1H8H G;  4RAI A;  2OTL V;  1NR1 A;  2V7Q G;  3E83 A;  3WFV A;  3ABT A;  4FMT A;  4QIW F;  3QO7 A;  1S72 V;  1TUE B;  3CXC U;  2WLN A;  1OCZ B;  1UJW B;  5B1O A;  5HFM A;  5EK0 A;  1PNM A;  3SYQ A;  2GSM B;  1S0V A;  3X2Q C;  1YTF B;  1NVP B;  2OCC B;  4WFF A;  3ABM B;  2Q6A A;  5BZB A;  1I5Y A;  3AG1 C;  4P30 A;  3CPW U;  3VOU A;  3IFX A;  1R3J C;  3IC7 A;  4JGS A;  4WFE A;  4MTF A;  3OFN G;  3ASN B;  2FTK A;  2AHY A;  1OCO B;  2WPD G;  2QM8 A;  5LHH A;  1K92 A;  1ORQ C;  2ZXW C;  4UV8 A;  3SYA A;  5L3B A;  4JTC B;  2HFE C;  2DYS B;  1SET A;  1K3E A;  5H6Q A;  1V54 B;  1OCC B;  2Q69 A;  3K03 A;  3SPG A;  3ZMV A;  3ABK C;  1FS0 G;  3H01 A;  4FIP C;  2EIK C;  4UXN A;  1NJI W;  1VQ8 V;  2WAM A;  3LDE A;  4HYO A;  4JYB A;  4H33 A;  1Q7Y W;  2EIN B;  2EIM B;  2WLL A;  3T2M A;  5B3S B;  3BEH A;  5KA5 A;  3T1C A;  5IY5 B;  2WLJ A;  1VQN V;  2JIZ G;  5DN6 G;  4X8A A;  3ZRW A;  3CC7 V;  1EFR G;  1ROP A;  3E89 A;  1KEC A;  2ZR2 A;  4MTX A;  3ABL B;  3LUT B;  1FXK B;  1AI6 A;  1PD3 A;  3FKS G;  3CCQ V;  5IYB O;  3JD0 A;  2EZO A;  1NH2 B;  2DQ0 A;  4H37 A;  5CA3 A;  3X2Q B;  3W7T A;  1KC8 W;  4MVU A;  1AJQ A;  4JAV A;  4GX5 A;  2LFS A;  4X88 A;  1DF5 A;  3ASO B;  1NH2 D;  1PKX A;  3ETG A;  2ITD C;  3OEE G;  4PDM A;  2JJ2 G;  2ZD9 A;  4YXW G;  1SER A;  3OE7 G;  2IJJ A;  4J9Y B;  2IU3 A;  4BAY A;  4QE9 A;  5B1B B;  1YIT V;  3ML0 A;  3STL C;  3TK1 A;  3ETD A;  4U7N A;  4JYC A;  1CP9 A;  2XAS A;  1AJP A;  3SYC A;  1BHA A;  4J9Z B;  3CCU V;  4LBE C;  3OMI B;  3OR7 C;  2HKO A;  1RM1 B;  1K7D A;  3LSQ A;  3CCM V;  1P7B A;  3AG3 B;  4PDR A;  4PDV A;  3JD2 A;  2PI5 A;  1K4C C;  4MSW C;  5E1A C;  4LP8 A;  3B77 A;  4F4L A;  3HB3 B;  3P32 A;  2OCC C;  1JQ0 A;  1QLN A;  1H8E G;  1QLE C;  2MK3 A;  3FB6 C;  2OT5 A;  3LSS A;  3I55 V;  4PEL A;  3OW2 U;  3ASN C;  1OCO C;  2DYR B;  5EBL C;  3SPC A;  2DYS C;  1S3J A;  1K5S A;  4RQF A;  2XAJ A;  4MVZ A;  4GT1 A;  2HLD G;  4MVO A;  1GKF A;  4XDK A;  3JD4 A;  1PL0 A;  4HAM A;  1YHQ V;  2EIM C;  4LC1 A;  5HFL A;  4L87 A;  3ZMZ A;  4RUF A;  1J95 A;  3ZMS A;  5B3S C;  2EIL B;  2IJI A;  3K0D A;  4PA6 A;  3ZMU A;  2JEU A;  5LHG A;  2Y48 A;  1JVM A;  4FJC C;  5IYD O;  2DWD C;  2HVJ C;  4MVS A;  1JX9 A;  2X6A A;  3ABL C;  1AJN A;  1FXK C;  2A79 B;  4JTD B;  1KKD A;  3OUF A;  5C93 A;  2W6I G;  4ZKI A;  3UKM A;  2BOB C;  1GTO A;  2LP7 A;  3CP1 A;  1M90 W;  1KP3 A;  3TET A;  2JDI G;  2X7R B;  2DW4 A;  1VQM V;  3IGA C;  3E35 A;  2W6J G;  2QKS A;  2M7W A;  1QLE B;  3ASO C;  2YEV B;  2IJK A;  4KFM A;  4PA9 A;  1YTF D;  1WLE A;  1NVP D;  5KA6 A;  2B5U A;  2A0L A;  3MD0 A;  3K79 A;  1E1Q G;  2WLK A;  5B1B C;  3HPL C;  1S76 D;  2ZQM A;  4G27 B;  1AI7 A;  4PA4 A;  4DO2 A;  3W7U A;  1GO3 F;  3NXS A;  3UM7 A;  5CN0 A;  1L1F A;  4UV9 A;  5L3E A;  3ZMT A;  4GX1 A;  4MTO A;  3ZRV A;  1HWY A;  2X6C A;  3F7Y C;  3MHS C;  4QPJ A;  4JPR A;  1RM1 C;  1MOF A;  1EZJ A;  2EZP A;  4MS2 A;  3AG3 C;  4UUJ C;  4QNH B;  2Y69 C;  1M9N A;  2P90 A;  3OGC C;  5CBG A;  2Q67 A;  2WSS G;  4MVQ A;  2WLM A;  4MT8 A;  3B8N A;  3AEI A;  5J9P C;  1IXM A;  3SPH A;  4PA3 A;  3LDD A;  1AI4 A;  1FFT B;  1VQO V;  1QVF U;  1K8A W;  1F4M A;  1JJ2 U;  3JD1 A;  2DYR C;  3G71 V;  1FXH A;  1M56 B;  3W7X A;  4R7C A;  1YIJ V;  2H8P C;  3ZN1 A;  1GM7 A;  3EFF K;  5B1N A;  1THZ A;  4N23 A;  2WLI A;  1KD1 W;  4RUE A;  1Q86 W;  3A0R A;  4ASU G;  4BIU A;  3RVY A;  5CBF A;  1N8R W;  3AG2 C;  3QO5 A;  4MVR A;  5DM6 V;  2DWE C;  3D3I A;  1GMG A;  3AG4 B;  1G8M A;  2R9I A;  5EBW C;  3RVZ A;  3SPI A;  4PA7 A;  1COW G;  2EIL C;  4KP4 A;  1ENV A;  1ARO P;  4G2K A;  3K06 A;  1R3L C;  4WCE V;  1RPR A;  4JF3 A;  2H94 A;  3STZ C;  3ZRS A;  1VQ6 V;  4JAS A;  3FB8 C;  1FXV A;  4XDL A;  4QJF B;  2Y69 B;  2D3O W;  2QTO A;  2EJR A;  4Z1M G;  3ABU A;  1E79 G;  3E8G A;  1VQ5 V;  2P67 A;  4JTA B;  3CD6 V;  1QR9 A;  1R6K A;  2B1I A;  3SYO A;  1M57 B;  3CCV V;  1K9M W;  3M99 B;  2K1E A;  4WFG A;  1QVG U;  4CZZ A;  2P6J A;  2IW5 A;  1W2B U;  1K34 A;  3D36 A;  3CCL V;  3F7V C;  2IH1 C;  2WLL B;  4P2Z A;  4R50 A;  2AHZ A;  1M1K W;  1G4Y B;  1OZ0 A;  3E8F A;  2YSU B;  3ZRW B;  1YJ9 V;  3CCR V;  2NNU A;  4UVB A;  1KP2 A;  3CCJ V;  1F51 A;  4QE7 A;  4P9P A;  1WPX A;  3OM3 B;  1QCE A;  1AR1 B;  5L3D A;  3AG2 B;  1H2G A;  4GX0 A;  1NBM G;  2JJ1 G;  3E8B A;  2C2A A;  3LDC A;  2GHY A;  3K04 A;  2X0L A;  1RPO A;  3DTU B;  1ZWI C;  5CMU A;  2Q68 A;  4WFA V;  4WFB V;  1R6N A;  3FB7 C;  3T4Z A;  3OEH G;  2JK5 C;  2IJH A;  1PNK A;  3SPJ A;  1R73 A;  2QM7 A;  1OCR B;  2KB1 A;  3VBB A;  1B6Q A;  1YSC A;  2ZDI C;  3CCE V;  1VQL V;  5KUK A;  1FXK A;  3CMA V;  1QBZ A;  3JCZ A;  3OMA B;  1YJW V;  4TT3 G;  3ZIA G;  1MSW D;  3SYP A;  4GX2 A;  4ZBM A;  1M56 C;  3ETE A;  1JOY A;  4HZ3 A;  5L3G A;  2XOK G;  2ATK C;  3JD3 A;  1BHB A;  3JYC A;  2QEX V;  1MAB G;  2Z3Y A;  2W0F C;  1SRY A;  2DQ3 A;  3FB5 C;  3OUS A;  4FK5 C;  4X89 A;  5GW7 A;  3AG4 C;  2EBO A;  3W7S A;  5LHI A;  1K4D C;  4R8C A;  2X6B A;  3OR6 C;  2WWW A;  1Y66 A;  4R6Z A;  4CBC A;  3OMN B;  3BY6 A;  5LBQ A;  1YI2 V;  1CEZ A;  4XDJ A;  1GM8 A;  1DF4 A;  4LCU C;  3I56 V;  3CC2 V;  2V1D A;  1K73 W;  3E86 A;  1VQP V;  3EHB B;  1DTO A;  3QO8 A;  4OXS A;  4PDL A;  3WG7 B;  4EKW A;  4KUM A;  1NKD A;  3LNM B;  2F43 G;  1NQT A;  4I5S A;  1W0J G;  3OAA G;  4MVM A;  3R65 A;  1M57 C;  2XND G;  5B1A B;  1S77 D;  1V55 B;  2IH3 C;  1SZT A;  3G6E V;  1QR8 A;  2EIJ B;  4TWK A;  3ZN0 A;  1GK9 A;  2XAG A;  3PJS K;  1R3K C;  1P4R A;  3GWO A;  3SJQ C;  5IDJ A;  1VQ9 V;  3GB7 C;  3DGE A;  3G4S V;  3K9A A;  1VQK V;  1LNQ A;  3T4D A;  1K97 A;  5LGT A;  2XAF A;  3P30 A;  2A9H A;  4QPK A;  2P7T C;  4Q20 A;  3RBZ A;  3E2E A;  4FPP A;  1SES A;  2HVK C;  4U7O A;  2QE7 G;  1F23 A;  1E1R G;  1Y4M A;  4GCZ A;  4RQE A;  1H38 A;  3ZRX A;  3MHH C;  1VQ7 V;  1GM9 A;  4BIZ A;  3CCS V;  4RO2 A;  2IU0 A;  5EBM C;  1YJN V;  1XL6 A;  1CPY A;  1NR7 A;  4DXW A;  2WLH A;  4N21 A;  3AG1 B;  1OCR C;  2R9R B;  5LGU A;  1JPX A;  5H9C A;  2UXX A;  2ZXW B;  2CK3 G;  4JAU A;  5EC2 C;  1Q82 W;  1K33 A;  3TCU A;  3F5W C;  1K5Q A;  3E8H A;  3W7W A;  4WF9 V;  3FYI B;  1W0K G;  4UVC A;  4MW3 A;  1F4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...