1Q81W

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q81W00
3CC2V 1VQMV 1VQ8V 3CD6V 3CXCU 3G6EV 1VQNV 3CCLV 3G4SV 1VQ9V 4WFBV 4WFAV 1R73A 1Q81W 1VQOV 3CCMV 2D3OW 3CCSV 3CCVV 3CMAV 1KQSU 1YJ9V 2QA4V 1VQKV 1K73W 1K9MW 1M1KW 1VQ4V 3CCRV 4WF9V 3CCUV 1YJWV 1N8RW 1W2BU 2QEXV 3CC4V 1VQLV 1QVGU 1NJIW 1QVFU 1VQPV 3CCJV 1YI2V 3CC7V 3CCEV 2OTJV 4WCEV 1K8AW 1Q86W 1YHQV 1VQ5V 3CPWU 2OTLV 5DM6V 3CCQV 1S72V 1KD1W 1Q82W 1M90W 1YITV 1Q7YW 1JJ2U 3CMEV 1VQ7V 1YJNV 3I56V 1VQ6V 1YIJV 3G71V 3OW2U 3I55V 1KC8W
chains in the Genus database with same CATH superfamily
2ADPA 3CRQA 4I4TB 2QWRB 2K9PA 3HKCA 1RM1C 5KA5A 3E86A 2QKCA 3HKBA 1GO3F 4UB6Z 3VQVA 4DUZB 4Z1VA 4ZI7B 1NH2D 4I9WA 4NXMB 3WB2A 4K35A 4KL1A 1URFA 2ITDC 2KQXA 1MZEA 2F43G 2EIKC 3EFFK 2VWKA 2PI4A 2HHHO 2ZIOA 5L3DA 4JYBA 1AJQA 1QCEA 4GKJB 2YS8A 3MHSC 4MVQA 2A3QA 3AG2C 3FFQA 5D5PA 5EZYB 3OD4A 1HP8A 4UXNA 3UCSC 1AILA 1SQGA 2XAHA 1XNQB 3A2FA 5DM6V 1H2LA 1UFIA 3B8NA 4J42A 1GN3A 1PKXA 4JAUA 2XASA 3LSSA 4KFMA 1HNWO 2E76B 3CMAV 3K58A 1VQ4V 1OCOB 5IYBO 4FFBA 3K08A 3GWOA 4J10A 4RQEA 3RYIB 3ZHSA 5LHGA 2OTLV 2GUZB 2UUBB 1Y66A 4X1IA 5A2QN 3RBZA 1Y76A 4X1YA 4ZIBA 4FM0A 5EBLC 1VARA 3UT5B 4HYOA 1NH2B 1Q5OA 5EC2C 3DC6A 2CE4A 2XT9A 4CC6A 4KUMA 3JARA 1VP7A 4H33A 3OFNG 3BRCA 4LNUB 1N0JA 3TGUH 3S3XA 3SYOA 1AJNA 1Y76B 1WJZA 1KYOF 1IBLO 4YIOA 5CA3A 5CBHA 2HKOA 1J5EO 1QBZA 3FX7A 3JYCA 1JVMA 3FB6C 2UUCO 3SJQC 1IX9A 4PDRA 3KCYA 1K3EA 2M6YA 4GYCB 4EB6A 2UUAO 4IYIA 4JASA 1H2GA 1FS0G 3OMIB 3CRAA 4UUJC 2QDOA 1JQ0A 5IYZA 1IURA 1IXBA 1TUBA 2HLDG 1RP3B 2P67A 4BW5A 4O4IA 4CS3A 1Q43A 3ZBHA 3L72H 1YSCA 3AG3B 2K1EA 5LMNB 1HNXB 1Y4MA 4EEQA 2P4VA 2QM8A 4I50A 4ZHQA 2BTQB 4JI0O 4DV6B 4MVUA 2ETNA 2LGWA 3SYQA 1NR7A 1AP6A 1K97A 1GH6A 2HJFC 1CPYA 3I55V 3IFXA 3K59A 5FPRA 1JR9A 4PA9A 5IJ9B 4X1KA 4DR5B 1QLEC 1Z2GA 2ZXWB 3TXQA 3CB2A 4DR1O 1I5XA 4LF7B 4CH3A 4MVRA 1KB9F 4FLWA 4JI1B 3APQA 2HFEC 5KHGA 3ABTA 1G8MA 2F4VB 1N36O 2YSUB 1SERA 4CS4A 1VQKV 2ZNJA 5FLXN 3F5TA 1Y67A 4DR3O 4DV1O 1MSDA 2DYRC 1JOYA 3O65A 2AXTZ 2Q8VA 4WFEA 2R70A 3CCQV 2YXLA 4LF4O 5GONB 1DGSA 4H37A 3B09A 5C8YA 4QJFB 3G6EV 2N74A 3GB7C 3K03A 4FM2A 5H9CA 4JI4B 3MHHC 3VQXA 4G27B 4DV0B 2VRZA 1B06A 1XEQA 3E8HA 3RYHA 1JA8A 4HZ3A 2GV9A 2DWDC 1S5LZ 2H94A 3RWRD 5JCOA 1QR8A 2UXDB 3BY6A 3SYPA 1J95A 4DUZO 3OGCC 1PNMA 1BHAA 1RM1B 1N8RW 4O2AA 3BAAA 3ZHTA 3W7WA 3M7MX 3FAVB 1VQ5V 4JAVA 1MA1A 1XOUA 3L74H 4DRXB 1L8DA 1THZA 3AEIA 1HNZB 2VQFB 2EIKB 1VMGA 3SDLA 2FB5A 2OT5A 4ABMA 3AK3A 3QF7A 5H5NA 1ZLZA 1XNQO 3BA9A 1QVGU 3AG2B 5EIBC 4BW9A 3RYFA 5EYPB 3LSQA 1GK9A 3VQWA 5B1NA 4MW8A 4FLVA 4FLYA 3ICXA 2CTQA 4LWSA 3R65A 2B1GA 3C3TA 1TA8A 5IJ0A 3ZJZA 4TQDA 3JATB 4DR6O 2V1DA 3CMEV 1JCHA 3WU2Z 1K34A 3BCCH 4BIOA 5H6RA 3OE7G 1V54C 2IJKA 3G4SV 2DWEC 2X7RB 4CH4A 5EBWC 2EZPA 1MSWD 3U11A 1S5HC 2Y4UA 1BE3H 4BWAA 3T2MA 1ZL8A 4ZOLB 2UU9B 4PDLA 4LFCB 2AHZA 1WP8A 3QG5A 5J2TB 1R3KC 2EIMC 2AZ2A 5JH7B 2E74B 2ZE7A 3E83A 3K79A 4DK0A 3KZIZ 3SPHA 1L0NH 3SPCA 2PYLA 3FD9A 1MOFA 4J7JA 4J9ZB 1Q86W 3VQYA 5EC1C 4K8ZA 2PGGA 3RYCA 3JD4A 5KUKA 2YIAA 1NU1H 4NTYA 5KX5A 3A0RA 3G67A 3RT3C 1N4CA 1ZAUA 3ZRVA 4CZZA 4UVAA 3ZRWB 3LDCA 5L3CA 3K5LA 1HNXO 1BT8A 2ZD9A 5AG2A 2P06A 3D3QA 2CH7B 4DR4B 1Q90D 4B3SB 3OM3B 4UCTA 2Z3YA 1NVPD 3D36A 4K8XA 4O4JB 4JI7B 3L71H 5LA6B 1YTFD 4YJ2B 4G2KA 2IH3C 2WLLB 3AK2A 3L75H 5GTIZ 4DW0A 2Y48A 1NBMG 2EILC 1R73A 3E35A 1L0LH 3VOUA 3DXRB 3MAQA 3LNMB 5KLVH 3DSQA 3MD0A 5LGUA 3OTOB 2F93B 4JI1O 1QLEB 4I0XA 1M56C 3SPJA 2WLIA 1H2NA 4F4LA 3K0DA 3APOA 2DE0X 2ZE8A 1R1BA 3DC5A 5JQGB 1FD9A 1EN6A 1JX9A 2QM4A 2Y4TA 3CS5A 4HNAA 3SGIA 4FM1A 1XHZA 4DW1A 3HKEA 2HJDA 4LF8B 2OTJV 2WLMA 4F6RA 4RQFA 4QE9A 2XTAA 2DYRB 2JS5A 1BL8A 1DF5A 3F7YC 5EIBD 1AP5A 5B1OA 4JI4O 4PD4F 4LFAB 3KKYA 4R7CA 1ENVA 4TV9A 1SZTA 1W2BU 4UCSA 4FIPC 3STZC 1F51A 2JJ2G 3HR0A 3B77A 5KHHA 1VIBA 1W0KG 1BZKA 3BFRA 3JSLA 2UXDO 4MVOA 4GLXA 4PA3A 5B3SC 4GX0A 2YIBD 2ZDIA 3CXHF 1VQNV 4GCZA 1GN2A 2JGUA 4O4LA 4MT8A 2D3OW 2Q73A 2IJIA 1M1KW 5KUMA 1QLNA 1HW7A 1GN6A 5CA1A 2KG7B 3OMAB 3ZIAG 3JAKA 1HNZO 5CA0B 2MW2B 4U3JB 1N0NA 2PZSA 1K33A 2OIGA 3RN4A 3WG7C 1YF2A 2Q67A 1JMKC 4QE7A 5JJEB 4RUEA 4TUYB 1UJWB 3RW0A 4J11A 1ORQC 3SPGA 5BR8O 1F23A 1RSOB 4TV8B 1H8EG 2QWNB 4MVMA 4FZ1A 2F66C 4O4HA 3OR7C 4XDJA 3E22B 2LGQA 2FKXA 4J80A 3LDEA 5C93A 3B2EE 3J81N 2LW7A 4JI3O 3WB1A 4H13B 4EFBA 2VS0A 2ZQMA 4NR1A 3QO8A 3PN1A 4NKGB 3QO5A 5LXTA 2N04A 5ITZB 3T1HB 1UPGA 5KMGA 3CCJV 2QTOA 3CC7V 2DQ0A 4CS2A 4B3MB 1I5YA 3G80A 4JTAB 1FPOA 1FXKA 5TISZ 4QPKA 4YHHB 3ZHVA 4YY3O 1ROPA 4JAAA 1BQZA 4WFAV 1V54B 1SS3A 2GTAA 4JI8B 3JASB 5JCOC 3J80N 3JAMN 5HFMA 1VQLV 4IYHA 5JVDB 2UU9O 4LH6A 1N34O 4LFCO 3JD1A 4X20A 2PY5A 4WBNA 2OWOA 3KG2A 3HKCB 2BE3A 3HKBB 5JJJB 3IC9A 1PV0A 4B7KA 1XHXA 3P3PA 4WFGA 2EIMB 1WPXA 2X6CA 2IJHA 5IY5C 2P22C 3OMNB 2IBZH 3SJBC 4MTOA 4OX9B 2H3OA 1SQPH 5K1PA 1SRYA 1VQ7V 1XNRB 1Y74A 1MNGA 1P4RA 4X62B 5LMUB 1XMOO 1KP3A 3ASOC 2JK5C 2JRIA 4IT5A 3STLC 3C90A 5KHJA 2ARHA 3FYIB 1AJPA 1K4DC 4JYAB 4UCRA 4RUFA 3I56V 3TETA 2ZIMA 4NTWA 1N32B 2R9AA 1NTZH 2RNBA 2W0FC 1BSMA 1VF5B 1K5QA 1PPJH 1WLEA 4FFBB 1YXBA 1OJHA 4LFBB 2UXCB 3L73H 3OTOO 2EILB 2JEXA 5IYCO 5LHHA 4X1IB 1QVFU 1NTKH 4X1YB 4DYLA 1PNLA 2Q7HA 3IC7A 1M56B 5LOVA 1FJGB 1XMQB 2NLJC 2EIJB 3JARB 4O2BA 2UXNA 4MS2A 2E5LO 1IVSA 5LYJA 5CBGA 1QHTA 4DV5O 4K0KB 3CRMA 4GUNA 5E79Z 4LF8O 1SKVA 5D5QA 1V55C 2D2CB 2ODMA 3GVMA 4IL6Z 2QJ1A 3B4SA 4UCVA 5EK0A 1CXZB 1YDXA 4LFAO 2YI9A 4C7UA 4EB6B 1KP2A 3K0GA 1XL4A 5CN0A 1IDSA 4PI0A 1AI6A 2P4KA 5IYZB 2XAJA 1TUBB 4XDKA 3FB8C 2ZINA 5LBQA 4O4IB 4I55A 1S76D 1VQ8V 4JGSA 3IAYA 3D36C 1K5SA 4I50B 4ZHQB 5B3SB 1CP9A 4JF3A 3UQ8A 1X59A 2Z0AA 3SYAA 1WN7A 1K7DA 2O57A 5F2VO 2JGDA 4J9YB 3K5MA 1B04A 2IH1C 4X1KB 1IBMB 3WG7B 1BQ0A 4HBNA 1VQOV 2LP7A 1WAZA 2OYQA 1I94B 4JZ2A 5KAIZ 2YIDA 2DJVA 1P49A 4TSFG 3SJAC 1ZUQA 2ZE5A 3HKDA 3VBBA 1JJOA 1R6TA 3ZHRA 4LBEC 3T1HO 1F7YA 4CH6A 1AB3A 1OZ0A 3N2KA 1PM9A 4B3MO 1WNSA 4CBCA 5C8YB 4U3FH 2QWPB 4JV5B 3SR2C 4LR3A 3OUSA 2CTPA 1TAEA 4JI2B 4QIWF 4Q20A 1H2MA 3CRRA 1BS3A 1W0JG 1N33B 3ZRXA 3RYHB 2VQEB 3C3SA 2QA4V 4NXMO 1AROP 2A0LA 4X8AA 2YC0A 2ZDIC 3EHBB 3ZCCA 2IW5A 3H1LH 4GZRB 4GX5A 1OCCC 4DR2B 2XNDG 2H8PC 4DUYB 1FXVA 4GKJO 1SA0A 5B1AC 1VQ9V 3E8FA 4O2AB 2BSKA 4EFEA 3QO7A 3AG7A 1Q3EA 1QR9A 4TT3G 5KA6A 4LF6B 4MTXA 2CTRA 3F7VC 4DV7B 1HDJA 2CAZC 4PI2A 4LC1A 5IY5B 1OCZC 1YJNV 3IGAC 4X64B 4X62O 2EZOA 5LMUO 4JI5B 3A8TA 4WFBV 4B3TB 2IU3A 4D7SA 2Q4PA 3RYFB 4DV2B 2GBOA 4NTXA 3U0ZA 3AG4C 3ASOB 4JI6B 2UUBO 1CEZA 4LWSB 4AQYB 4IHJA 1N32O 5J2UA 3TK1A 1Z5WA 3S3WA 4Z2WA 3ZRSA 5IJ0B 2UXCO 2GSMB 1SESA 3AK1A 1FXKC 5FL7G 5FNVA 4PDVA 2YICA 4IGGA 1RFYA 2L6LA 2BOBC 1FJGO 1PL0A 3K9AA 4JYCA 2CUGA 5CB4A 3B40A 1EZJA 2QKAA 4QPJA 3HB3B 3I5DA 1ZL8B 4MVSA 2BCCH 2QKSA 4LCUC 2WAMA 2B1IA 1XL6A 3JD2A 4BR6A 2ITCC 4WCEV 1K8AW 1FYJA 1JFFA 1V55B 5IYDO 4JPRA 3N2GA 1TGOA 2HHHB 2CGOA 3CX5F 3EXAA 1FFTB 5LMNO 1MMMA 3OUFA 3BA8A 3ZHUA 2QEXV 3RYCB 4DV6O 4NB5A 3JSNA 2ZNIA 5KX5B 3K5NA 3CYOA 4DK1A 1S3JA 3H01A 3WB0A 2EJRA 3D3IA 4FLXA 2F95B 1QU7A 1H8HG 2QTSA 4DR5O 2HVJC 4GT1A 3JD3A 1FAFA 1GM8A 4YJ3A 1TVKA 4WF9V 1NKDA 4LF7O 1D5AA 3JAWA 3FB5C 2XOKG 2RCVA 3L70H 2EIJC 5IT9N 2F4VO 3RVYA 1KU9A 2YEVA 4MSWC 3Q4HA 2LW1A 2Y69B 3JAWB 3CCSV 3BHPA 1XI1A 4I0XB 3JALA 4TOIA 1I94O 4UV9A 2WLIB 4IIJA 4N21A 2WLJA 4J41A 4YIPA 1S5JA 1VQ6V 3CJHA 3H9VA 4FLTA 4KP4A 3CC2V 1G1XB 4FLUA 3R66A 1XUQA 4HNAB 1NS1A 3W7UA 2Y0PA 3HKEB 1B6QA 1SQQH 2UUCB 4F6RB 4DV0O 1AI5A 1NVPB 2X0LA 1KBHA 2FTKA 4OXSA 1YTFB 2MK3A 1D5NA 2UUAB 3W7TA 4KHPB 2NR5A 1FFXA 2OIEA 5EBMC 4HAMA 4ICGA 4JI2O 3G71V 4NXNB 2RQ6A 1AR4A 4TV9B 5KHIA 4DO2A 3T1CA 2CTWA 3OEHG 1MABG 2FMLA 4ASUG 4RAIA 5LL6Y 5GTHZ 4JZGA 3W7SA 3D8CA 1QNMA 4DUYO 3ETDA 3ABMC 4JI0B 2VQFO 4O4LB 4X65B 1OCCB 3ZX6A 2Q0OC 1B3QA 3PJSK 3CCLV 4XDLA 4QNHB 4AHCA 5B1AB 4X9QA 1EN4A 4LF6O 5CA1B 1P7BA 2LQTA 4LP8A 3OAAG 3JAKB 4DV3B 5BMVA 1EM1A 4GKKB 2Q68A 2XAQA 4X64O 3OTFA 2WWWA 1E1RG 4E2LA 1SQVH 2FL4A 2RDCA 4B3TO 3HPLC 1E1QG 3UO3A 1OCZB 3ABLC 2LFRA 4DV2O 1OCRC 2R72A 4I5SA 1EBOA 4JI6O 2FYUH 2QWQB 4O4HB 1ZX3A 1GKFA 2ZR3A 4DR3B 1YI2V 3AG4B 4CC5A 1YHQV 4H44B 4LF9B 2WLHA 4P9PA 4UFZA 3OT7A 3P30A 2IU0A 4UV8A 5LP6A 3TCUA 5JJNB 5LXTB 3ZMTA 3JCUZ 3T4ZA 1QQCA 3LUTB 5KMGB 4D6TH 3L9DA 1L1FA 3U10A 2PTMA 4PDMA 1V9PA 4I4TA 2HP8A 1GMGA 5H6QA 1GM7A 3ASNB 2YDEA 3ZN1A 1FXKB 2AW9A 3BVOA 1LUWA 4ZI7A 1Q6HA 3CEIA 1IBKB 3SJCC 4MTFA 1SF9A 5KAFZ 4J7KA 2QE7G 2B9ZA 3W7XA 2YXHA 2Q7GA 4PELA 2DOSA 3P32A 1M9NA 2ADQB 4KXRA 4X20B 4WBNB 2YUAA 3QNEA 3ETGA 4LH7A 5EZYA 4X89A 4J7ZA 1NT2B 3SPIA 1SC5B 4P2ZA 4PV1B 4ZKIA 1VF7A 3CCMV 1LR1A 3RFRA 4DR4O 5L3GA 4B3SO 2CDYA 5L3BA 2EJ7A 4JI7O 1Y74B 3E8BA 5LHIA 1Q82W 2V7QG 3RYIA 4Z1MG 2HG5C 3H1KH 1I0HA 3OGIB 2GUZA 2EX3A 5DN6G 1BCCH 2LFSA 3UT5A 3FYEB 3H1HH 1G6UA 2UXBB 5DEDA 1SQFA 2NNUA 3H1IH 2W6JG 2AZ0A 1ZTEA 2JJ1G 2Q7EA 1AR1B 4FMTA 3CCEV 4LNUA 4DR6B 1M4UA 1VF6A 4WFHA 1KQSU 3OEEG 2WA4A 1R3JC 4F6EA 3J7AU 2Q0AA 1LNQA 1Y6XA 3N27A 5B5EZ 2QR4A 1XDCA 4N23A 5LOVB 4O2BB 4L8JA 3ZN0A 1AI7A 4FJCC 5LYJB 4UVBA 1NQTA 3OW2U 2QWOB 1H38A 1U96A 2ZKOA 4R50A 3NR7A 3CCVV 4AILC 2YI8A 4MTGA 4KHPO 2F1MA 3H1JH 3CPWU 2PI5A 2Y0IA 4NXNO 2BTQA 2A06H 3KCXA 3ZS8C 3F5WC 2E75B 1G4YB 5HFLA 3CD6V 4B3RB 2QGNA 3BEHA 1T5EA 2ZT9B 1MZFA 4G28B 4U7NA 5H2FZ 3CCRV 4X88A 1H2KA 2IJJA 5IJ9A 4CH5A 4W4KA 4I55B 4FVMA 4FFKA 3WFVA 4X65O 2Q69A 2A79B 3QTCA 2XUMA 3ETQA 3ABMB 2P5OA 2W6IG 1TUEB 3CHXA 3X2QC 2HR3A 5IWAB 2Y69C 4BIZA 2A9HA 1YVWA 4DV3O 4EKWA 2A7WA 2DQ3A 4GKKO 3CCUV 5J9PC 2JGDB 1GAXA 2ZM6B 4MVZA 1R3LC 1Z5VA 2PF4E 2JS3A 1PD3A 4I9QA 5GONA 1GM9A 1PNKA 1ZSPA 3ETEA 3ABLB 4L87A 1DTOA 1GRJA 1I7FA 1OCRB 1XBLA 2CGNA 4PJ0Z 3UKMA 2HEPA 2KB1A 3AG1C 4XBFA 5L3FA 4LF9O 1WPBA 3ZMZA 4TQFA 2Z5UA 3BPZA 5CMUA 4UCOA 4U7OA 2DYSC 3HKDB 2OCCC 4YHHO 4UVCA 2RJZA 2EINC 4JI8O 3N2KB 1IZ3A 1K9MW 3SYCA 2XHBA 3E8GA 1IBKO 5DECA 1PP9H 2Q6AA 2BTOA 3FKSG 1COWG 3FAVA 1WB7A 4DRXA 3K57A 5BZBA 3UO2A 4B08A 3G6BA 1U97A 1SZXA 2WLNA 4P30A 3CC4V 2W0XA 2YXYA 3IJ4A 1E79G 3K9SA 2ATKC 4R8CA 4OX9O 4A5UB 1SA0B 1KD1W 1JJ2U 3ZHQA 4DR7B 1Q7YW 3K06A 1XNRO 1YZBA 1MG1A 1KKCA 2BSKB 3ML0A 5EYPA 3M99B 3T1YB 2JDIG 2AHYA 2L35A 4PHZA 5GW7A 1IXMA 3ABKC 4PA6A 2JVDA 1FKAO 4BAYA 5E1AC 1AR5A 4DV4B 4JTCB 4JTDB 4RWUA 1K4CC 1H2SB 4OGQB 1I08A 5B1BC 5BR8B 2E3CA 4JYAO 3A0HZ 3JATA 3O9OA 1OHHG 2PYJA 1BGYH 4YXWG 3RGBA 4JI3B 1R6NA 4LFBO 1GTOA 2UXBO 4X66B 1O9GA 3ZMUA 3ASNC 5LP6C 4IHJB 2GTSA 4FK5C 2XAGA 1W59A 5J2UB 2WSSG 4LF5B 1VEWA 1M57C 1P84F 3M8AA 1XMQO 2JIZG 4ZOLA 1KC8W 1S0VA 1HR0B 2PUSA 2ZE6A 3LNNA 4K0KO 4YY3B 5FNVB 3RVZA 5J2TA 1XQ8A 5JH7A 4NVPA 5L3EA 5IDJA 3ZEDA 4R6ZA 3THOA 5CB4B 1N34B 1FXHA 3MDSA 1WP7A 3P3NA 1YCIA 3CE2A 4K3AA 1SQBH 1AI4A 5B66Z 2QSAA 2XAFA 2KKWA 4MW3A 1EZVH 1F4MA 3K5OA 2DW4A 1JFFB 3ZRWA 3JCZA 5FPOA 1Q6UA 1BHBA 2CH7A 2QM7A 3N2GB 1PL4A 3OR6C 4B3RO 4PA7A 2N05A 3ZMVA 4GX1A 4O4JA 5LA6A 2GHYA 1WA8A 3BABA 1OCOC 3K3WA 4YJ2A 3QVNA 1SQXH 2WLLA 2WLKA 1M93A 1XMOB 3DTUB 1HNWB 2BOCC 3CP1A 3DXRA 4FPPA 4UCUA 1WA8B 4QGPA 5IWAO 1Q6IA 1IBMO 2IM9A 1NZ6A 4YJ3B 4PA4A 1TVKB 2HVKC 2P7TC 3E2EA 1XILA 1US6A 2KSDA 2M7WA 2EBOA 1K92A 2DMXA 4I7ZB 3X2QB 1EN5A 1R6KA 2LJ2A 3GWKC 1K73W 3FB7C 1VF6C 2ZR2A 5JQGA 2ZM6O 1OV9A 1KUQA 1SETA 2P90A 2ZCEA 4OPAA 1S72V 4JYYA 2Q5ZA 1YITV 1P7GA 2YEVB 1NR1A 5K1XA 3DGEA 1IBLB 3Q4HB 1A32A 3EVKA 5BXZA 1VQMV 1ZWIC 3JALB 2VWJA 2ILMA 1J5EB 2E5LB 4W4LA 1Q81W 4IIJB 1YJ9V 4DV5B 1DF4A 3CJHB 2X6BA 5KHKA 4JV5O 3AG1B 1HWYA 2F23A 3LSUA 2DYSB 2UXXA 4BIUA 2OCCB 5BY1A 1N33O 3AG3C 2OCHA 2R9RB 1JPXA 4B7EA 2VQEO 3E89A 1LUVA 4P9OA 1O9HA 2EINB 4ZBMA 4RO2A 1FFXB 4TWKA 1NJIW 4WFFA 3ABUA 2DN9A 1YEWA 4DR2O 3TJTA 1M5IA 1M90W 3CWBH 1R3IC 3K04A 3UM7A 3LDDA 2B5UA 1D2DA 1AVMA 2KG7A 3CSXA 5LGNA 4E4EA 5CA0A 2Q9LA 4U3JA 2NN4A 2WPDG 3T4DA 5IE9A 5CBFA 4H0LB 4UB8Z 3ZMSA 2ZXWC 5JWPA 1KMIZ 4FLZA 1F4NA 3B8MA 4AI8A 1YJWV 4DV7O 4TUYA 2CK3G 5A9GA 2EULA 2AGAA 4DR7O 1DLBA 1WB8A 2G38A 3T1YO 4DR1B 3NXSA 1RSOA 4TV8A 2C2AA 4JI5O 2RN9A 4NYKA 1YIJV 1XREA 1NTMH 5LGTA 3E22A 2R9IA 1RPRA 5BMVB 1N36B 2JEUA 4DV4O 2V4DA 3ABKB 2X6AA 2LO1A 4DXWA 1KECA 1VQPV 3JD0A 4AQYO 1NI8A 4DV1B 1EFRG 5ITZA 1DK1A 5B1BB 1X4TA 1Q8IA 4LF4B 4D7TA 1BMFG 2YIBA 3CXCU 1RPOA 4X66O 4GX2A 1GN4A 2RMKB 1S77D 3TXSA 4LF5O 1KKDA 2P6JA 3A0BZ 2GDSA 3JASA 2WA3A 5LP6B 1HR0O 5JVDA 4OPHA 4Q6GA 1M57B 4FZ0A 3CRCA
chains in the Genus database with same CATH topology
1G4YB 5HFLA 3CD6V 3BEHA 4WFBV 1RM1C 5KA5A 2IU3A 3E86A 4G28B 1GO3F 4U7NA 1JX9A 3CCRV 3AG4C 1NH2D 4X88A 3ASOB 2IJJA 4I9WA 2OTJV 2WLMA 4RQFA 1CEZA 4QE9A 3WFVA 2ITDC 2Q69A 2A79B 2DYRB 2EIKC 2F43G 3EFFK 3TK1A 2PI4A 3ABMB 2W6IG 4JYBA 5L3DA 1BL8A 1DF5A 1TUEB 3F7YC 3X2QC 2HR3A 3ZRSA 2Y69C 1AJQA 1QCEA 4BIZA 5B1OA 3MHSC 2A9HA 4MVQA 4EKWA 3AG2C 2GSMB 2DQ3A 4R7CA 1ENVA 1SESA 1SZTA 3CCUV 1FXKC 5J9PC 1W2BU 4FIPC 4UXNA 3STZC 1F51A 5FL7G 2JJ2G 4PDVA 3B77A 2XAHA 1W0KG 5DM6V 2BOBC 4MVZA 1PL0A 1R3LC 4MVOA 3B8NA 3K9AA 4JYCA 1PKXA 4JAUA 2XASA 1PD3A 4PA3A 5B3SC 4GX0A 2ZDIA 3LSSA 4GCZA 1VQNV 1EZJA 1GM9A 1PNKA 4KFMA 4QPJA 3HB3B 3ETEA 4MT8A 2D3OW 3CMAV 4MVSA 1VQ4V 2IJIA 1M1KW 3ABLB 4L87A 1DTOA 1OCOB 5IYBO 1OCRB 2QKSA 3K08A 5KUMA 3GWOA 1QLNA 4LCUC 2WAMA 3UKMA 4RQEA 2KB1A 3AG1C 2B1IA 4XBFA 1XL6A 3JD2A 5L3FA 2ITCC 3OMAB 3ZMZA 4WCEV 1K8AW 2Z5UA 2OTLV 5LHGA 5CMUA 3ZIAG 4U7OA 2DYSC 1V55B 1Y66A 2OCCC 5IYDO 3RBZA 1K33A 4UVCA 4JPRA 3WG7C 5EBLC 4HYOA 2EINC 2Q67A 1NH2B 4QE7A 4RUEA 5EC2C 1FFTB 4KUMA 3OUFA 1UJWB 4H33A 1K9MW 3SYCA 3RW0A 3OFNG 1ORQC 2QEXV 3SPGA 3SYOA 3E8GA 1AJNA 1F23A 1H8EG 4MVMA 3CYOA 3OR7C 4XDJA 2Q6AA 1S3JA 3H01A 5C93A 3LDEA 5CA3A 2EJRA 5CBHA 2HKOA 3D3IA 3FKSG 1COWG 1QBZA 3JYCA 1H8HG 1JVMA 3FB6C 5BZBA 2ZQMA 2HVJC 4GT1A 3JD3A 3SJQC 3QO8A 2WLNA 1GM8A 3QO5A 4WF9V 1NKDA 4P30A 4PDRA 3CC4V 1K3EA 1E79G 2ATKC 4R8CA 3CCJV 2QTOA 3CC7V 3FB5C 4JASA 2DQ0A 2XOKG 1KD1W 1JJ2U 1H2GA 1Q7YW 1FS0G 3K06A 2EIJC 1I5YA 1MG1A 3OMIB 4JTAB 4UUJC 3ML0A 1JQ0A 3M99B 1FXKA 2JDIG 3RVYA 2AHYA 4QPKA 5GW7A 1ROPA 3ABKC 1IXMA 2HLDG 2YEVA 2P67A 4MSWC 4PA6A 4BW5A 4BAYA 4WFAV 1V54B 2Y69B 3CCSV 5E1AC 1YSCA 3AG3B 4UV9A 2K1EA 2WLIB 1Y4MA 4JTCB 2QM8A 5HFMA 1VQLV 4JTDB 1K4CC 4N21A 2WLJA 5B1BC 3JD1A 4MVUA 3SYQA 1NR7A 3KG2A 1K97A 1OHHG 2HJFC 1VQ6V 1CPYA 3I55V 4KP4A 3IFXA 4YXWG 3CC2V 1R6NA 3W7UA 1GTOA 4PA9A 1B6QA 4WFGA 2EIMB 1QLEC 3ZMUA 1AI5A 1NVPB 3ASNC 2X0LA 1WPXA 2FTKA 4OXSA 2XAGA 4FK5C 2X6CA 2ZXWB 2IJHA 2MK3A 2WSSG 5IY5C 1YTFB 1I5XA 4MVRA 3OMNB 1M57C 4MTOA 3W7TA 1SRYA 5EBMC 1VQ7V 4HAMA 2HFEC 3ABTA 2JIZG 3G71V 1G8MA 1KC8W 2YSUB 1S0VA 1P4RA 1SERA 4DO2A 3T1CA 1KP3A 3ASOC 3OEHG 2JK5C 1MABG 3RVZA 1VQKV 3STLC 4ASUG 4RAIA 5L3EA 5IDJA 2DYRC 3W7SA 1JOYA 4R6ZA 4WFEA 3ETDA 3FYIB 3ABMC 3CCQV 1FXHA 1AJPA 1K4DC 4RUFA 3I56V 4H37A 3TETA 1OCCB 2W0FC 4QJFB 3PJSK 1AI4A 1K5QA 1WLEA 3G6EV 4XDLA 3CCLV 4QNHB 3GB7C 5B1AB 3K03A 1P7BA 2XAFA 4MW3A 5H9CA 1F4MA 2EILB 2JEXA 3MHHC 3OAAG 4LP8A 5IYCO 2DW4A 5LHHA 3ZRWA 4G27B 1QVFU 2Q68A 3JCZA 3E8HA 1BHBA 4HZ3A 2XAQA 1PNLA 2DWDC 3IC7A 2QM7A 2H94A 1M56B 2WWWA 1E1RG 3OR6C 1QR8A 4E2LA 4PA7A 3ZMVA 2NLJC 2EIJB 4GX1A 3BY6A 2UXNA 4MS2A 3SYPA 3HPLC 1E1QG 1OCZB 3ABLC 1J95A 2GHYA 2LFRA 1OCOC 3K3WA 1OCRC 5CBGA 2WLLA 3OGCC 2WLKA 4I5SA 1EBOA 1PNMA 3DTUB 1BHAA 1RM1B 1N8RW 2BOCC 1GKFA 3CP1A 2ZR3A 1V55C 1YI2V 3W7WA 3AG4B 4FPPA 1YHQV 4JAVA 1VQ5V 5EK0A 2WLHA 4P9PA 1THZA 3AEIA 3P30A 2IU0A 4UV8A 3TCUA 2EIKB 4PA4A 2P7TC 2HVKC 3ZMTA 3E2EA 3T4ZA 2OT5A 3LUTB 2M7WA 2EBOA 1K92A 3X2QB 1R6KA 1L1FA 4PDMA 1K73W 3FB7C 2ZR2A 1KP2A 3K0GA 1XL4A 5CN0A 1QVGU 3AG2B 1AI6A 1GMGA 5H6QA 3ASNB 1GM7A 1SETA 2P90A 3LSQA 1GK9A 2XAJA 3ZN1A 1FXKB 1S72V 5B1NA 4MW8A 1YITV 4XDKA 3FB8C 2YEVB 1NR1A 3DGEA 5LBQA 4MTFA 1S76D 2QE7G 1VQMV 1ZWIC 1VQ8V 4JGSA 3R65A 3W7XA 1K5SA 4PELA 1Q81W 2B1GA 5B3SB 1CP9A 3P32A 4JF3A 1YJ9V 1M9NA 3ZJZA 3SYAA 3QNEA 1DF4A 1K7DA 3ETGA 2X6BA 4X89A 3AG1B 1HWYA 2V1DA 3SPIA 3CMEV 1JCHA 4J9YB 1K34A 2IH1C 4P2ZA 5H6RA 2DYSB 2UXXA 1V54C 2OCCB 3OE7G 4BIUA 2IJKA 4ZKIA 3AG3C 2R9RB 3G4SV 1JPXA 2DWEC 3WG7B 3E89A 1VQOV 2X7RB 3CCMV 4P9OA 2LP7A 2EINB 4ZBMA 5EBWC 2EZPA 5L3GA 1MSWD 1S5HC 4RO2A 4TWKA 1NJIW 5L3BA 4WFFA 3T2MA 3ABUA 3E8BA 5LHIA 1Q82W 2V7QG 1M90W 1R3IC 3K04A 4PDLA 3LDDA 3UM7A 2B5UA 4Z1MG 2HG5C 2AHZA 4TSFG 5LGNA 3VBBA 1R3KC 5DN6G 2EIMC 2LFSA 2WPDG 3T4DA 4LBEC 5CBFA 3E83A 3ZMSA 3FYEB 2ZXWC 3K79A 3SPHA 1F4NA 3B8MA 1YJWV 2NNUA 3SPCA 2W6JG 1OZ0A 2CK3G 2JJ1G 1AR1B 1MOFA 4FMTA 3CCEV 1DLBA 4J9ZB 1Q86W 5EC1C 4CBCA 3NXSA 3JD4A 2C2AA 5KUKA 4WFHA 1YIJV 3OUSA 1KQSU 5LGTA 3OEEG 3A0RA 4QIWF 4CZZA 3ZRVA 1R3JC 2R9IA 1RPRA 4Q20A 4UVAA 3ZRWB 3LDCA 2JEUA 1W0JG 5L3CA 3ZRXA 1LNQA 2ZD9A 3ABKB 2X6AA 2QA4V 1AROP 4DXWA 2A0LA 4X8AA 1KECA 4N23A 3JD0A 3OM3B 2ZDIC 1VQPV 3EHBB 3ZCCA 2IW5A 2Z3YA 1NVPD 1EFRG 3D36A 4GX5A 3ZN0A 1OCCC 2XNDG 1YTFD 2H8PC 1AI7A 4FJCC 2IH3C 4G2KA 5B1BB 4UVBA 2WLLB 1FXVA 1NQTA 3OW2U 5B1AC 1BMFG 1H38A 3CXCU 1RPOA 2Y48A 1NBMG 2EILC 1VQ9V 3E8FA 1R73A 4R50A 3E35A 3VOUA 3CCVV 4GX2A 3QO7A 1QR9A 4TT3G 5KA6A 1S77D 3LNMB 3MD0A 4MTXA 5LGUA 1KKDA 4MTGA 3F7VC 2P6JA 1QLEB 1M56C 3SPJA 4LC1A 3CPWU 2WLIA 2PI5A 4F4LA 5IY5B 3K0DA 1OCZC 1YJNV 3IGAC 1M57B 3F5WC 2EZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  1VQM V;  1VQ8 V;  3CD6 V;  3CXC U;  3G6E V;  1VQN V;  3CCL V;  3G4S V;  1VQ9 V;  4WFB V;  4WFA V;  1R73 A;  1Q81 W;  1VQO V;  3CCM V;  2D3O W;  3CCS V;  3CCV V;  3CMA V;  1KQS U;  1YJ9 V;  2QA4 V;  1VQK V;  1K73 W;  1K9M W;  1M1K W;  1VQ4 V;  3CCR V;  4WF9 V;  3CCU V;  1YJW V;  1N8R W;  1W2B U;  2QEX V;  3CC4 V;  1VQL V;  1QVG U;  1NJI W;  1QVF U;  1VQP V;  3CCJ V;  1YI2 V;  3CC7 V;  3CCE V;  2OTJ V;  4WCE V;  1K8A W;  1Q86 W;  1YHQ V;  1VQ5 V;  3CPW U;  2OTL V;  5DM6 V;  3CCQ V;  1S72 V;  1KD1 W;  1Q82 W;  1M90 W;  1YIT V;  1Q7Y W;  1JJ2 U;  3CME V;  1VQ7 V;  1YJN V;  3I56 V;  1VQ6 V;  1YIJ V;  3G71 V;  3OW2 U;  3I55 V;  1KC8 W; 
#chains in the Genus database with same CATH topology
 2ADP A;  3CRQ A;  4I4T B;  2QWR B;  2K9P A;  3HKC A;  1RM1 C;  5KA5 A;  3E86 A;  2QKC A;  3HKB A;  1GO3 F;  4UB6 Z;  3VQV A;  4DUZ B;  4Z1V A;  4ZI7 B;  1NH2 D;  4I9W A;  4NXM B;  3WB2 A;  4K35 A;  4KL1 A;  1URF A;  2ITD C;  2KQX A;  1MZE A;  2F43 G;  2EIK C;  3EFF K;  2VWK A;  2PI4 A;  2HHH O;  2ZIO A;  5L3D A;  4JYB A;  1AJQ A;  1QCE A;  4GKJ B;  2YS8 A;  3MHS C;  4MVQ A;  2A3Q A;  3AG2 C;  3FFQ A;  5D5P A;  5EZY B;  3OD4 A;  1HP8 A;  4UXN A;  3UCS C;  1AIL A;  1SQG A;  2XAH A;  1XNQ B;  3A2F A;  5DM6 V;  1H2L A;  1UFI A;  3B8N A;  4J42 A;  1GN3 A;  1PKX A;  4JAU A;  2XAS A;  3LSS A;  4KFM A;  1HNW O;  2E76 B;  3CMA V;  3K58 A;  1VQ4 V;  1OCO B;  5IYB O;  4FFB A;  3K08 A;  3GWO A;  4J10 A;  4RQE A;  3RYI B;  3ZHS A;  5LHG A;  2OTL V;  2GUZ B;  2UUB B;  1Y66 A;  4X1I A;  5A2Q N;  3RBZ A;  1Y76 A;  4X1Y A;  4ZIB A;  4FM0 A;  5EBL C;  1VAR A;  3UT5 B;  4HYO A;  1NH2 B;  1Q5O A;  5EC2 C;  3DC6 A;  2CE4 A;  2XT9 A;  4CC6 A;  4KUM A;  3JAR A;  1VP7 A;  4H33 A;  3OFN G;  3BRC A;  4LNU B;  1N0J A;  3TGU H;  3S3X A;  3SYO A;  1AJN A;  1Y76 B;  1WJZ A;  1KYO F;  1IBL O;  4YIO A;  5CA3 A;  5CBH A;  2HKO A;  1J5E O;  1QBZ A;  3FX7 A;  3JYC A;  1JVM A;  3FB6 C;  2UUC O;  3SJQ C;  1IX9 A;  4PDR A;  3KCY A;  1K3E A;  2M6Y A;  4GYC B;  4EB6 A;  2UUA O;  4IYI A;  4JAS A;  1H2G A;  1FS0 G;  3OMI B;  3CRA A;  4UUJ C;  2QDO A;  1JQ0 A;  5IYZ A;  1IUR A;  1IXB A;  1TUB A;  2HLD G;  1RP3 B;  2P67 A;  4BW5 A;  4O4I A;  4CS3 A;  1Q43 A;  3ZBH A;  3L72 H;  1YSC A;  3AG3 B;  2K1E A;  5LMN B;  1HNX B;  1Y4M A;  4EEQ A;  2P4V A;  2QM8 A;  4I50 A;  4ZHQ A;  2BTQ B;  4JI0 O;  4DV6 B;  4MVU A;  2ETN A;  2LGW A;  3SYQ A;  1NR7 A;  1AP6 A;  1K97 A;  1GH6 A;  2HJF C;  1CPY A;  3I55 V;  3IFX A;  3K59 A;  5FPR A;  1JR9 A;  4PA9 A;  5IJ9 B;  4X1K A;  4DR5 B;  1QLE C;  1Z2G A;  2ZXW B;  3TXQ A;  3CB2 A;  4DR1 O;  1I5X A;  4LF7 B;  4CH3 A;  4MVR A;  1KB9 F;  4FLW A;  4JI1 B;  3APQ A;  2HFE C;  5KHG A;  3ABT A;  1G8M A;  2F4V B;  1N36 O;  2YSU B;  1SER A;  4CS4 A;  1VQK V;  2ZNJ A;  5FLX N;  3F5T A;  1Y67 A;  4DR3 O;  4DV1 O;  1MSD A;  2DYR C;  1JOY A;  3O65 A;  2AXT Z;  2Q8V A;  4WFE A;  2R70 A;  3CCQ V;  2YXL A;  4LF4 O;  5GON B;  1DGS A;  4H37 A;  3B09 A;  5C8Y A;  4QJF B;  3G6E V;  2N74 A;  3GB7 C;  3K03 A;  4FM2 A;  5H9C A;  4JI4 B;  3MHH C;  3VQX A;  4G27 B;  4DV0 B;  2VRZ A;  1B06 A;  1XEQ A;  3E8H A;  3RYH A;  1JA8 A;  4HZ3 A;  2GV9 A;  2DWD C;  1S5L Z;  2H94 A;  3RWR D;  5JCO A;  1QR8 A;  2UXD B;  3BY6 A;  3SYP A;  1J95 A;  4DUZ O;  3OGC C;  1PNM A;  1BHA A;  1RM1 B;  1N8R W;  4O2A A;  3BAA A;  3ZHT A;  3W7W A;  3M7M X;  3FAV B;  1VQ5 V;  4JAV A;  1MA1 A;  1XOU A;  3L74 H;  4DRX B;  1L8D A;  1THZ A;  3AEI A;  1HNZ B;  2VQF B;  2EIK B;  1VMG A;  3SDL A;  2FB5 A;  2OT5 A;  4ABM A;  3AK3 A;  3QF7 A;  5H5N A;  1ZLZ A;  1XNQ O;  3BA9 A;  1QVG U;  3AG2 B;  5EIB C;  4BW9 A;  3RYF A;  5EYP B;  3LSQ A;  1GK9 A;  3VQW A;  5B1N A;  4MW8 A;  4FLV A;  4FLY A;  3ICX A;  2CTQ A;  4LWS A;  3R65 A;  2B1G A;  3C3T A;  1TA8 A;  5IJ0 A;  3ZJZ A;  4TQD A;  3JAT B;  4DR6 O;  2V1D A;  3CME V;  1JCH A;  3WU2 Z;  1K34 A;  3BCC H;  4BIO A;  5H6R A;  3OE7 G;  1V54 C;  2IJK A;  3G4S V;  2DWE C;  2X7R B;  4CH4 A;  5EBW C;  2EZP A;  1MSW D;  3U11 A;  1S5H C;  2Y4U A;  1BE3 H;  4BWA A;  3T2M A;  1ZL8 A;  4ZOL B;  2UU9 B;  4PDL A;  4LFC B;  2AHZ A;  1WP8 A;  3QG5 A;  5J2T B;  1R3K C;  2EIM C;  2AZ2 A;  5JH7 B;  2E74 B;  2ZE7 A;  3E83 A;  3K79 A;  4DK0 A;  3KZI Z;  3SPH A;  1L0N H;  3SPC A;  2PYL A;  3FD9 A;  1MOF A;  4J7J A;  4J9Z B;  1Q86 W;  3VQY A;  5EC1 C;  4K8Z A;  2PGG A;  3RYC A;  3JD4 A;  5KUK A;  2YIA A;  1NU1 H;  4NTY A;  5KX5 A;  3A0R A;  3G67 A;  3RT3 C;  1N4C A;  1ZAU A;  3ZRV A;  4CZZ A;  4UVA A;  3ZRW B;  3LDC A;  5L3C A;  3K5L A;  1HNX O;  1BT8 A;  2ZD9 A;  5AG2 A;  2P06 A;  3D3Q A;  2CH7 B;  4DR4 B;  1Q90 D;  4B3S B;  3OM3 B;  4UCT A;  2Z3Y A;  1NVP D;  3D36 A;  4K8X A;  4O4J B;  4JI7 B;  3L71 H;  5LA6 B;  1YTF D;  4YJ2 B;  4G2K A;  2IH3 C;  2WLL B;  3AK2 A;  3L75 H;  5GTI Z;  4DW0 A;  2Y48 A;  1NBM G;  2EIL C;  1R73 A;  3E35 A;  1L0L H;  3VOU A;  3DXR B;  3MAQ A;  3LNM B;  5KLV H;  3DSQ A;  3MD0 A;  5LGU A;  3OTO B;  2F93 B;  4JI1 O;  1QLE B;  4I0X A;  1M56 C;  3SPJ A;  2WLI A;  1H2N A;  4F4L A;  3K0D A;  3APO A;  2DE0 X;  2ZE8 A;  1R1B A;  3DC5 A;  5JQG B;  1FD9 A;  1EN6 A;  1JX9 A;  2QM4 A;  2Y4T A;  3CS5 A;  4HNA A;  3SGI A;  4FM1 A;  1XHZ A;  4DW1 A;  3HKE A;  2HJD A;  4LF8 B;  2OTJ V;  2WLM A;  4F6R A;  4RQF A;  4QE9 A;  2XTA A;  2DYR B;  2JS5 A;  1BL8 A;  1DF5 A;  3F7Y C;  5EIB D;  1AP5 A;  5B1O A;  4JI4 O;  4PD4 F;  4LFA B;  3KKY A;  4R7C A;  1ENV A;  4TV9 A;  1SZT A;  1W2B U;  4UCS A;  4FIP C;  3STZ C;  1F51 A;  2JJ2 G;  3HR0 A;  3B77 A;  5KHH A;  1VIB A;  1W0K G;  1BZK A;  3BFR A;  3JSL A;  2UXD O;  4MVO A;  4GLX A;  4PA3 A;  5B3S C;  4GX0 A;  2YIB D;  2ZDI A;  3CXH F;  1VQN V;  4GCZ A;  1GN2 A;  2JGU A;  4O4L A;  4MT8 A;  2D3O W;  2Q73 A;  2IJI A;  1M1K W;  5KUM A;  1QLN A;  1HW7 A;  1GN6 A;  5CA1 A;  2KG7 B;  3OMA B;  3ZIA G;  3JAK A;  1HNZ O;  5CA0 B;  2MW2 B;  4U3J B;  1N0N A;  2PZS A;  1K33 A;  2OIG A;  3RN4 A;  3WG7 C;  1YF2 A;  2Q67 A;  1JMK C;  4QE7 A;  5JJE B;  4RUE A;  4TUY B;  1UJW B;  3RW0 A;  4J11 A;  1ORQ C;  3SPG A;  5BR8 O;  1F23 A;  1RSO B;  4TV8 B;  1H8E G;  2QWN B;  4MVM A;  4FZ1 A;  2F66 C;  4O4H A;  3OR7 C;  4XDJ A;  3E22 B;  2LGQ A;  2FKX A;  4J80 A;  3LDE A;  5C93 A;  3B2E E;  3J81 N;  2LW7 A;  4JI3 O;  3WB1 A;  4H13 B;  4EFB A;  2VS0 A;  2ZQM A;  4NR1 A;  3QO8 A;  3PN1 A;  4NKG B;  3QO5 A;  5LXT A;  2N04 A;  5ITZ B;  3T1H B;  1UPG A;  5KMG A;  3CCJ V;  2QTO A;  3CC7 V;  2DQ0 A;  4CS2 A;  4B3M B;  1I5Y A;  3G80 A;  4JTA B;  1FPO A;  1FXK A;  5TIS Z;  4QPK A;  4YHH B;  3ZHV A;  4YY3 O;  1ROP A;  4JAA A;  1BQZ A;  4WFA V;  1V54 B;  1SS3 A;  2GTA A;  4JI8 B;  3JAS B;  5JCO C;  3J80 N;  3JAM N;  5HFM A;  1VQL V;  4IYH A;  5JVD B;  2UU9 O;  4LH6 A;  1N34 O;  4LFC O;  3JD1 A;  4X20 A;  2PY5 A;  4WBN A;  2OWO A;  3KG2 A;  3HKC B;  2BE3 A;  3HKB B;  5JJJ B;  3IC9 A;  1PV0 A;  4B7K A;  1XHX A;  3P3P A;  4WFG A;  2EIM B;  1WPX A;  2X6C A;  2IJH A;  5IY5 C;  2P22 C;  3OMN B;  2IBZ H;  3SJB C;  4MTO A;  4OX9 B;  2H3O A;  1SQP H;  5K1P A;  1SRY A;  1VQ7 V;  1XNR B;  1Y74 A;  1MNG A;  1P4R A;  4X62 B;  5LMU B;  1XMO O;  1KP3 A;  3ASO C;  2JK5 C;  2JRI A;  4IT5 A;  3STL C;  3C90 A;  5KHJ A;  2ARH A;  3FYI B;  1AJP A;  1K4D C;  4JYA B;  4UCR A;  4RUF A;  3I56 V;  3TET A;  2ZIM A;  4NTW A;  1N32 B;  2R9A A;  1NTZ H;  2RNB A;  2W0F C;  1BSM A;  1VF5 B;  1K5Q A;  1PPJ H;  1WLE A;  4FFB B;  1YXB A;  1OJH A;  4LFB B;  2UXC B;  3L73 H;  3OTO O;  2EIL B;  2JEX A;  5IYC O;  5LHH A;  4X1I B;  1QVF U;  1NTK H;  4X1Y B;  4DYL A;  1PNL A;  2Q7H A;  3IC7 A;  1M56 B;  5LOV A;  1FJG B;  1XMQ B;  2NLJ C;  2EIJ B;  3JAR B;  4O2B A;  2UXN A;  4MS2 A;  2E5L O;  1IVS A;  5LYJ A;  5CBG A;  1QHT A;  4DV5 O;  4K0K B;  3CRM A;  4GUN A;  5E79 Z;  4LF8 O;  1SKV A;  5D5Q A;  1V55 C;  2D2C B;  2ODM A;  3GVM A;  4IL6 Z;  2QJ1 A;  3B4S A;  4UCV A;  5EK0 A;  1CXZ B;  1YDX A;  4LFA O;  2YI9 A;  4C7U A;  4EB6 B;  1KP2 A;  3K0G A;  1XL4 A;  5CN0 A;  1IDS A;  4PI0 A;  1AI6 A;  2P4K A;  5IYZ B;  2XAJ A;  1TUB B;  4XDK A;  3FB8 C;  2ZIN A;  5LBQ A;  4O4I B;  4I55 A;  1S76 D;  1VQ8 V;  4JGS A;  3IAY A;  3D36 C;  1K5S A;  4I50 B;  4ZHQ B;  5B3S B;  1CP9 A;  4JF3 A;  3UQ8 A;  1X59 A;  2Z0A A;  3SYA A;  1WN7 A;  1K7D A;  2O57 A;  5F2V O;  2JGD A;  4J9Y B;  3K5M A;  1B04 A;  2IH1 C;  4X1K B;  1IBM B;  3WG7 B;  1BQ0 A;  4HBN A;  1VQO V;  2LP7 A;  1WAZ A;  2OYQ A;  1I94 B;  4JZ2 A;  5KAI Z;  2YID A;  2DJV A;  1P49 A;  4TSF G;  3SJA C;  1ZUQ A;  2ZE5 A;  3HKD A;  3VBB A;  1JJO A;  1R6T A;  3ZHR A;  4LBE C;  3T1H O;  1F7Y A;  4CH6 A;  1AB3 A;  1OZ0 A;  3N2K A;  1PM9 A;  4B3M O;  1WNS A;  4CBC A;  5C8Y B;  4U3F H;  2QWP B;  4JV5 B;  3SR2 C;  4LR3 A;  3OUS A;  2CTP A;  1TAE A;  4JI2 B;  4QIW F;  4Q20 A;  1H2M A;  3CRR A;  1BS3 A;  1W0J G;  1N33 B;  3ZRX A;  3RYH B;  2VQE B;  3C3S A;  2QA4 V;  4NXM O;  1ARO P;  2A0L A;  4X8A A;  2YC0 A;  2ZDI C;  3EHB B;  3ZCC A;  2IW5 A;  3H1L H;  4GZR B;  4GX5 A;  1OCC C;  4DR2 B;  2XND G;  2H8P C;  4DUY B;  1FXV A;  4GKJ O;  1SA0 A;  5B1A C;  1VQ9 V;  3E8F A;  4O2A B;  2BSK A;  4EFE A;  3QO7 A;  3AG7 A;  1Q3E A;  1QR9 A;  4TT3 G;  5KA6 A;  4LF6 B;  4MTX A;  2CTR A;  3F7V C;  4DV7 B;  1HDJ A;  2CAZ C;  4PI2 A;  4LC1 A;  5IY5 B;  1OCZ C;  1YJN V;  3IGA C;  4X64 B;  4X62 O;  2EZO A;  5LMU O;  4JI5 B;  3A8T A;  4WFB V;  4B3T B;  2IU3 A;  4D7S A;  2Q4P A;  3RYF B;  4DV2 B;  2GBO A;  4NTX A;  3U0Z A;  3AG4 C;  3ASO B;  4JI6 B;  2UUB O;  1CEZ A;  4LWS B;  4AQY B;  4IHJ A;  1N32 O;  5J2U A;  3TK1 A;  1Z5W A;  3S3W A;  4Z2W A;  3ZRS A;  5IJ0 B;  2UXC O;  2GSM B;  1SES A;  3AK1 A;  1FXK C;  5FL7 G;  5FNV A;  4PDV A;  2YIC A;  4IGG A;  1RFY A;  2L6L A;  2BOB C;  1FJG O;  1PL0 A;  3K9A A;  4JYC A;  2CUG A;  5CB4 A;  3B40 A;  1EZJ A;  2QKA A;  4QPJ A;  3HB3 B;  3I5D A;  1ZL8 B;  4MVS A;  2BCC H;  2QKS A;  4LCU C;  2WAM A;  2B1I A;  1XL6 A;  3JD2 A;  4BR6 A;  2ITC C;  4WCE V;  1K8A W;  1FYJ A;  1JFF A;  1V55 B;  5IYD O;  4JPR A;  3N2G A;  1TGO A;  2HHH B;  2CGO A;  3CX5 F;  3EXA A;  1FFT B;  5LMN O;  1MMM A;  3OUF A;  3BA8 A;  3ZHU A;  2QEX V;  3RYC B;  4DV6 O;  4NB5 A;  3JSN A;  2ZNI A;  5KX5 B;  3K5N A;  3CYO A;  4DK1 A;  1S3J A;  3H01 A;  3WB0 A;  2EJR A;  3D3I A;  4FLX A;  2F95 B;  1QU7 A;  1H8H G;  2QTS A;  4DR5 O;  2HVJ C;  4GT1 A;  3JD3 A;  1FAF A;  1GM8 A;  4YJ3 A;  1TVK A;  4WF9 V;  1NKD A;  4LF7 O;  1D5A A;  3JAW A;  3FB5 C;  2XOK G;  2RCV A;  3L70 H;  2EIJ C;  5IT9 N;  2F4V O;  3RVY A;  1KU9 A;  2YEV A;  4MSW C;  3Q4H A;  2LW1 A;  2Y69 B;  3JAW B;  3CCS V;  3BHP A;  1XI1 A;  4I0X B;  3JAL A;  4TOI A;  1I94 O;  4UV9 A;  2WLI B;  4IIJ A;  4N21 A;  2WLJ A;  4J41 A;  4YIP A;  1S5J A;  1VQ6 V;  3CJH A;  3H9V A;  4FLT A;  4KP4 A;  3CC2 V;  1G1X B;  4FLU A;  3R66 A;  1XUQ A;  4HNA B;  1NS1 A;  3W7U A;  2Y0P A;  3HKE B;  1B6Q A;  1SQQ H;  2UUC B;  4F6R B;  4DV0 O;  1AI5 A;  1NVP B;  2X0L A;  1KBH A;  2FTK A;  4OXS A;  1YTF B;  2MK3 A;  1D5N A;  2UUA B;  3W7T A;  4KHP B;  2NR5 A;  1FFX A;  2OIE A;  5EBM C;  4HAM A;  4ICG A;  4JI2 O;  3G71 V;  4NXN B;  2RQ6 A;  1AR4 A;  4TV9 B;  5KHI A;  4DO2 A;  3T1C A;  2CTW A;  3OEH G;  1MAB G;  2FML A;  4ASU G;  4RAI A;  5LL6 Y;  5GTH Z;  4JZG A;  3W7S A;  3D8C A;  1QNM A;  4DUY O;  3ETD A;  3ABM C;  4JI0 B;  2VQF O;  4O4L B;  4X65 B;  1OCC B;  3ZX6 A;  2Q0O C;  1B3Q A;  3PJS K;  3CCL V;  4XDL A;  4QNH B;  4AHC A;  5B1A B;  4X9Q A;  1EN4 A;  4LF6 O;  5CA1 B;  1P7B A;  2LQT A;  4LP8 A;  3OAA G;  3JAK B;  4DV3 B;  5BMV A;  1EM1 A;  4GKK B;  2Q68 A;  2XAQ A;  4X64 O;  3OTF A;  2WWW A;  1E1R G;  4E2L A;  1SQV H;  2FL4 A;  2RDC A;  4B3T O;  3HPL C;  1E1Q G;  3UO3 A;  1OCZ B;  3ABL C;  2LFR A;  4DV2 O;  1OCR C;  2R72 A;  4I5S A;  1EBO A;  4JI6 O;  2FYU H;  2QWQ B;  4O4H B;  1ZX3 A;  1GKF A;  2ZR3 A;  4DR3 B;  1YI2 V;  3AG4 B;  4CC5 A;  1YHQ V;  4H44 B;  4LF9 B;  2WLH A;  4P9P A;  4UFZ A;  3OT7 A;  3P30 A;  2IU0 A;  4UV8 A;  5LP6 A;  3TCU A;  5JJN B;  5LXT B;  3ZMT A;  3JCU Z;  3T4Z A;  1QQC A;  3LUT B;  5KMG B;  4D6T H;  3L9D A;  1L1F A;  3U10 A;  2PTM A;  4PDM A;  1V9P A;  4I4T A;  2HP8 A;  1GMG A;  5H6Q A;  1GM7 A;  3ASN B;  2YDE A;  3ZN1 A;  1FXK B;  2AW9 A;  3BVO A;  1LUW A;  4ZI7 A;  1Q6H A;  3CEI A;  1IBK B;  3SJC C;  4MTF A;  1SF9 A;  5KAF Z;  4J7K A;  2QE7 G;  2B9Z A;  3W7X A;  2YXH A;  2Q7G A;  4PEL A;  2DOS A;  3P32 A;  1M9N A;  2ADQ B;  4KXR A;  4X20 B;  4WBN B;  2YUA A;  3QNE A;  3ETG A;  4LH7 A;  5EZY A;  4X89 A;  4J7Z A;  1NT2 B;  3SPI A;  1SC5 B;  4P2Z A;  4PV1 B;  4ZKI A;  1VF7 A;  3CCM V;  1LR1 A;  3RFR A;  4DR4 O;  5L3G A;  4B3S O;  2CDY A;  5L3B A;  2EJ7 A;  4JI7 O;  1Y74 B;  3E8B A;  5LHI A;  1Q82 W;  2V7Q G;  3RYI A;  4Z1M G;  2HG5 C;  3H1K H;  1I0H A;  3OGI B;  2GUZ A;  2EX3 A;  5DN6 G;  1BCC H;  2LFS A;  3UT5 A;  3FYE B;  3H1H H;  1G6U A;  2UXB B;  5DED A;  1SQF A;  2NNU A;  3H1I H;  2W6J G;  2AZ0 A;  1ZTE A;  2JJ1 G;  2Q7E A;  1AR1 B;  4FMT A;  3CCE V;  4LNU A;  4DR6 B;  1M4U A;  1VF6 A;  4WFH A;  1KQS U;  3OEE G;  2WA4 A;  1R3J C;  4F6E A;  3J7A U;  2Q0A A;  1LNQ A;  1Y6X A;  3N27 A;  5B5E Z;  2QR4 A;  1XDC A;  4N23 A;  5LOV B;  4O2B B;  4L8J A;  3ZN0 A;  1AI7 A;  4FJC C;  5LYJ B;  4UVB A;  1NQT A;  3OW2 U;  2QWO B;  1H38 A;  1U96 A;  2ZKO A;  4R50 A;  3NR7 A;  3CCV V;  4AIL C;  2YI8 A;  4MTG A;  4KHP O;  2F1M A;  3H1J H;  3CPW U;  2PI5 A;  2Y0I A;  4NXN O;  2BTQ A;  2A06 H;  3KCX A;  3ZS8 C;  3F5W C;  2E75 B;  1G4Y B;  5HFL A;  3CD6 V;  4B3R B;  2QGN A;  3BEH A;  1T5E A;  2ZT9 B;  1MZF A;  4G28 B;  4U7N A;  5H2F Z;  3CCR V;  4X88 A;  1H2K A;  2IJJ A;  5IJ9 A;  4CH5 A;  4W4K A;  4I55 B;  4FVM A;  4FFK A;  3WFV A;  4X65 O;  2Q69 A;  2A79 B;  3QTC A;  2XUM A;  3ETQ A;  3ABM B;  2P5O A;  2W6I G;  1TUE B;  3CHX A;  3X2Q C;  2HR3 A;  5IWA B;  2Y69 C;  4BIZ A;  2A9H A;  1YVW A;  4DV3 O;  4EKW A;  2A7W A;  2DQ3 A;  4GKK O;  3CCU V;  5J9P C;  2JGD B;  1GAX A;  2ZM6 B;  4MVZ A;  1R3L C;  1Z5V A;  2PF4 E;  2JS3 A;  1PD3 A;  4I9Q A;  5GON A;  1GM9 A;  1PNK A;  1ZSP A;  3ETE A;  3ABL B;  4L87 A;  1DTO A;  1GRJ A;  1I7F A;  1OCR B;  1XBL A;  2CGN A;  4PJ0 Z;  3UKM A;  2HEP A;  2KB1 A;  3AG1 C;  4XBF A;  5L3F A;  4LF9 O;  1WPB A;  3ZMZ A;  4TQF A;  2Z5U A;  3BPZ A;  5CMU A;  4UCO A;  4U7O A;  2DYS C;  3HKD B;  2OCC C;  4YHH O;  4UVC A;  2RJZ A;  2EIN C;  4JI8 O;  3N2K B;  1IZ3 A;  1K9M W;  3SYC A;  2XHB A;  3E8G A;  1IBK O;  5DEC A;  1PP9 H;  2Q6A A;  2BTO A;  3FKS G;  1COW G;  3FAV A;  1WB7 A;  4DRX A;  3K57 A;  5BZB A;  3UO2 A;  4B08 A;  3G6B A;  1U97 A;  1SZX A;  2WLN A;  4P30 A;  3CC4 V;  2W0X A;  2YXY A;  3IJ4 A;  1E79 G;  3K9S A;  2ATK C;  4R8C A;  4OX9 O;  4A5U B;  1SA0 B;  1KD1 W;  1JJ2 U;  3ZHQ A;  4DR7 B;  1Q7Y W;  3K06 A;  1XNR O;  1YZB A;  1MG1 A;  1KKC A;  2BSK B;  3ML0 A;  5EYP A;  3M99 B;  3T1Y B;  2JDI G;  2AHY A;  2L35 A;  4PHZ A;  5GW7 A;  1IXM A;  3ABK C;  4PA6 A;  2JVD A;  1FKA O;  4BAY A;  5E1A C;  1AR5 A;  4DV4 B;  4JTC B;  4JTD B;  4RWU A;  1K4C C;  1H2S B;  4OGQ B;  1I08 A;  5B1B C;  5BR8 B;  2E3C A;  4JYA O;  3A0H Z;  3JAT A;  3O9O A;  1OHH G;  2PYJ A;  1BGY H;  4YXW G;  3RGB A;  4JI3 B;  1R6N A;  4LFB O;  1GTO A;  2UXB O;  4X66 B;  1O9G A;  3ZMU A;  3ASN C;  5LP6 C;  4IHJ B;  2GTS A;  4FK5 C;  2XAG A;  1W59 A;  5J2U B;  2WSS G;  4LF5 B;  1VEW A;  1M57 C;  1P84 F;  3M8A A;  1XMQ O;  2JIZ G;  4ZOL A;  1KC8 W;  1S0V A;  1HR0 B;  2PUS A;  2ZE6 A;  3LNN A;  4K0K O;  4YY3 B;  5FNV B;  3RVZ A;  5J2T A;  1XQ8 A;  5JH7 A;  4NVP A;  5L3E A;  5IDJ A;  3ZED A;  4R6Z A;  3THO A;  5CB4 B;  1N34 B;  1FXH A;  3MDS A;  1WP7 A;  3P3N A;  1YCI A;  3CE2 A;  4K3A A;  1SQB H;  1AI4 A;  5B66 Z;  2QSA A;  2XAF A;  2KKW A;  4MW3 A;  1EZV H;  1F4M A;  3K5O A;  2DW4 A;  1JFF B;  3ZRW A;  3JCZ A;  5FPO A;  1Q6U A;  1BHB A;  2CH7 A;  2QM7 A;  3N2G B;  1PL4 A;  3OR6 C;  4B3R O;  4PA7 A;  2N05 A;  3ZMV A;  4GX1 A;  4O4J A;  5LA6 A;  2GHY A;  1WA8 A;  3BAB A;  1OCO C;  3K3W A;  4YJ2 A;  3QVN A;  1SQX H;  2WLL A;  2WLK A;  1M93 A;  1XMO B;  3DTU B;  1HNW B;  2BOC C;  3CP1 A;  3DXR A;  4FPP A;  4UCU A;  1WA8 B;  4QGP A;  5IWA O;  1Q6I A;  1IBM O;  2IM9 A;  1NZ6 A;  4YJ3 B;  4PA4 A;  1TVK B;  2HVK C;  2P7T C;  3E2E A;  1XIL A;  1US6 A;  2KSD A;  2M7W A;  2EBO A;  1K92 A;  2DMX A;  4I7Z B;  3X2Q B;  1EN5 A;  1R6K A;  2LJ2 A;  3GWK C;  1K73 W;  3FB7 C;  1VF6 C;  2ZR2 A;  5JQG A;  2ZM6 O;  1OV9 A;  1KUQ A;  1SET A;  2P90 A;  2ZCE A;  4OPA A;  1S72 V;  4JYY A;  2Q5Z A;  1YIT V;  1P7G A;  2YEV B;  1NR1 A;  5K1X A;  3DGE A;  1IBL B;  3Q4H B;  1A32 A;  3EVK A;  5BXZ A;  1VQM V;  1ZWI C;  3JAL B;  2VWJ A;  2ILM A;  1J5E B;  2E5L B;  4W4L A;  1Q81 W;  4IIJ B;  1YJ9 V;  4DV5 B;  1DF4 A;  3CJH B;  2X6B A;  5KHK A;  4JV5 O;  3AG1 B;  1HWY A;  2F23 A;  3LSU A;  2DYS B;  2UXX A;  4BIU A;  2OCC B;  5BY1 A;  1N33 O;  3AG3 C;  2OCH A;  2R9R B;  1JPX A;  4B7E A;  2VQE O;  3E89 A;  1LUV A;  4P9O A;  1O9H A;  2EIN B;  4ZBM A;  4RO2 A;  1FFX B;  4TWK A;  1NJI W;  4WFF A;  3ABU A;  2DN9 A;  1YEW A;  4DR2 O;  3TJT A;  1M5I A;  1M90 W;  3CWB H;  1R3I C;  3K04 A;  3UM7 A;  3LDD A;  2B5U A;  1D2D A;  1AVM A;  2KG7 A;  3CSX A;  5LGN A;  4E4E A;  5CA0 A;  2Q9L A;  4U3J A;  2NN4 A;  2WPD G;  3T4D A;  5IE9 A;  5CBF A;  4H0L B;  4UB8 Z;  3ZMS A;  2ZXW C;  5JWP A;  1KMI Z;  4FLZ A;  1F4N A;  3B8M A;  4AI8 A;  1YJW V;  4DV7 O;  4TUY A;  2CK3 G;  5A9G A;  2EUL A;  2AGA A;  4DR7 O;  1DLB A;  1WB8 A;  2G38 A;  3T1Y O;  4DR1 B;  3NXS A;  1RSO A;  4TV8 A;  2C2A A;  4JI5 O;  2RN9 A;  4NYK A;  1YIJ V;  1XRE A;  1NTM H;  5LGT A;  3E22 A;  2R9I A;  1RPR A;  5BMV B;  1N36 B;  2JEU A;  4DV4 O;  2V4D A;  3ABK B;  2X6A A;  2LO1 A;  4DXW A;  1KEC A;  1VQP V;  3JD0 A;  4AQY O;  1NI8 A;  4DV1 B;  1EFR G;  5ITZ A;  1DK1 A;  5B1B B;  1X4T A;  1Q8I A;  4LF4 B;  4D7T A;  1BMF G;  2YIB A;  3CXC U;  1RPO A;  4X66 O;  4GX2 A;  1GN4 A;  2RMK B;  1S77 D;  3TXS A;  4LF5 O;  1KKD A;  2P6J A;  3A0B Z;  2GDS A;  3JAS A;  2WA3 A;  5LP6 B;  1HR0 O;  5JVD A;  4OPH A;  4Q6G A;  1M57 B;  4FZ0 A;  3CRC A; 
#chains in the Genus database with same CATH homology
 1G4Y B;  5HFL A;  3CD6 V;  3BEH A;  4WFB V;  1RM1 C;  5KA5 A;  2IU3 A;  3E86 A;  4G28 B;  1GO3 F;  4U7N A;  1JX9 A;  3CCR V;  3AG4 C;  1NH2 D;  4X88 A;  3ASO B;  2IJJ A;  4I9W A;  2OTJ V;  2WLM A;  4RQF A;  1CEZ A;  4QE9 A;  3WFV A;  2ITD C;  2Q69 A;  2A79 B;  2DYR B;  2EIK C;  2F43 G;  3EFF K;  3TK1 A;  2PI4 A;  3ABM B;  2W6I G;  4JYB A;  5L3D A;  1BL8 A;  1DF5 A;  1TUE B;  3F7Y C;  3X2Q C;  2HR3 A;  3ZRS A;  2Y69 C;  1AJQ A;  1QCE A;  4BIZ A;  5B1O A;  3MHS C;  2A9H A;  4MVQ A;  4EKW A;  3AG2 C;  2GSM B;  2DQ3 A;  4R7C A;  1ENV A;  1SES A;  1SZT A;  3CCU V;  1FXK C;  5J9P C;  1W2B U;  4FIP C;  4UXN A;  3STZ C;  1F51 A;  5FL7 G;  2JJ2 G;  4PDV A;  3B77 A;  2XAH A;  1W0K G;  5DM6 V;  2BOB C;  4MVZ A;  1PL0 A;  1R3L C;  4MVO A;  3B8N A;  3K9A A;  4JYC A;  1PKX A;  4JAU A;  2XAS A;  1PD3 A;  4PA3 A;  5B3S C;  4GX0 A;  2ZDI A;  3LSS A;  4GCZ A;  1VQN V;  1EZJ A;  1GM9 A;  1PNK A;  4KFM A;  4QPJ A;  3HB3 B;  3ETE A;  4MT8 A;  2D3O W;  3CMA V;  4MVS A;  1VQ4 V;  2IJI A;  1M1K W;  3ABL B;  4L87 A;  1DTO A;  1OCO B;  5IYB O;  1OCR B;  2QKS A;  3K08 A;  5KUM A;  3GWO A;  1QLN A;  4LCU C;  2WAM A;  3UKM A;  4RQE A;  2KB1 A;  3AG1 C;  2B1I A;  4XBF A;  1XL6 A;  3JD2 A;  5L3F A;  2ITC C;  3OMA B;  3ZMZ A;  4WCE V;  1K8A W;  2Z5U A;  2OTL V;  5LHG A;  5CMU A;  3ZIA G;  4U7O A;  2DYS C;  1V55 B;  1Y66 A;  2OCC C;  5IYD O;  3RBZ A;  1K33 A;  4UVC A;  4JPR A;  3WG7 C;  5EBL C;  4HYO A;  2EIN C;  2Q67 A;  1NH2 B;  4QE7 A;  4RUE A;  5EC2 C;  1FFT B;  4KUM A;  3OUF A;  1UJW B;  4H33 A;  1K9M W;  3SYC A;  3RW0 A;  3OFN G;  1ORQ C;  2QEX V;  3SPG A;  3SYO A;  3E8G A;  1AJN A;  1F23 A;  1H8E G;  4MVM A;  3CYO A;  3OR7 C;  4XDJ A;  2Q6A A;  1S3J A;  3H01 A;  5C93 A;  3LDE A;  5CA3 A;  2EJR A;  5CBH A;  2HKO A;  3D3I A;  3FKS G;  1COW G;  1QBZ A;  3JYC A;  1H8H G;  1JVM A;  3FB6 C;  5BZB A;  2ZQM A;  2HVJ C;  4GT1 A;  3JD3 A;  3SJQ C;  3QO8 A;  2WLN A;  1GM8 A;  3QO5 A;  4WF9 V;  1NKD A;  4P30 A;  4PDR A;  3CC4 V;  1K3E A;  1E79 G;  2ATK C;  4R8C A;  3CCJ V;  2QTO A;  3CC7 V;  3FB5 C;  4JAS A;  2DQ0 A;  2XOK G;  1KD1 W;  1JJ2 U;  1H2G A;  1Q7Y W;  1FS0 G;  3K06 A;  2EIJ C;  1I5Y A;  1MG1 A;  3OMI B;  4JTA B;  4UUJ C;  3ML0 A;  1JQ0 A;  3M99 B;  1FXK A;  2JDI G;  3RVY A;  2AHY A;  4QPK A;  5GW7 A;  1ROP A;  3ABK C;  1IXM A;  2HLD G;  2YEV A;  2P67 A;  4MSW C;  4PA6 A;  4BW5 A;  4BAY A;  4WFA V;  1V54 B;  2Y69 B;  3CCS V;  5E1A C;  1YSC A;  3AG3 B;  4UV9 A;  2K1E A;  2WLI B;  1Y4M A;  4JTC B;  2QM8 A;  5HFM A;  1VQL V;  4JTD B;  1K4C C;  4N21 A;  2WLJ A;  5B1B C;  3JD1 A;  4MVU A;  3SYQ A;  1NR7 A;  3KG2 A;  1K97 A;  1OHH G;  2HJF C;  1VQ6 V;  1CPY A;  3I55 V;  4KP4 A;  3IFX A;  4YXW G;  3CC2 V;  1R6N A;  3W7U A;  1GTO A;  4PA9 A;  1B6Q A;  4WFG A;  2EIM B;  1QLE C;  3ZMU A;  1AI5 A;  1NVP B;  3ASN C;  2X0L A;  1WPX A;  2FTK A;  4OXS A;  2XAG A;  4FK5 C;  2X6C A;  2ZXW B;  2IJH A;  2MK3 A;  2WSS G;  5IY5 C;  1YTF B;  1I5X A;  4MVR A;  3OMN B;  1M57 C;  4MTO A;  3W7T A;  1SRY A;  5EBM C;  1VQ7 V;  4HAM A;  2HFE C;  3ABT A;  2JIZ G;  3G71 V;  1G8M A;  1KC8 W;  2YSU B;  1S0V A;  1P4R A;  1SER A;  4DO2 A;  3T1C A;  1KP3 A;  3ASO C;  3OEH G;  2JK5 C;  1MAB G;  3RVZ A;  1VQK V;  3STL C;  4ASU G;  4RAI A;  5L3E A;  5IDJ A;  2DYR C;  3W7S A;  1JOY A;  4R6Z A;  4WFE A;  3ETD A;  3FYI B;  3ABM C;  3CCQ V;  1FXH A;  1AJP A;  1K4D C;  4RUF A;  3I56 V;  4H37 A;  3TET A;  1OCC B;  2W0F C;  4QJF B;  3PJS K;  1AI4 A;  1K5Q A;  1WLE A;  3G6E V;  4XDL A;  3CCL V;  4QNH B;  3GB7 C;  5B1A B;  3K03 A;  1P7B A;  2XAF A;  4MW3 A;  5H9C A;  1F4M A;  2EIL B;  2JEX A;  3MHH C;  3OAA G;  4LP8 A;  5IYC O;  2DW4 A;  5LHH A;  3ZRW A;  4G27 B;  1QVF U;  2Q68 A;  3JCZ A;  3E8H A;  1BHB A;  4HZ3 A;  2XAQ A;  1PNL A;  2DWD C;  3IC7 A;  2QM7 A;  2H94 A;  1M56 B;  2WWW A;  1E1R G;  3OR6 C;  1QR8 A;  4E2L A;  4PA7 A;  3ZMV A;  2NLJ C;  2EIJ B;  4GX1 A;  3BY6 A;  2UXN A;  4MS2 A;  3SYP A;  3HPL C;  1E1Q G;  1OCZ B;  3ABL C;  1J95 A;  2GHY A;  2LFR A;  1OCO C;  3K3W A;  1OCR C;  5CBG A;  2WLL A;  3OGC C;  2WLK A;  4I5S A;  1EBO A;  1PNM A;  3DTU B;  1BHA A;  1RM1 B;  1N8R W;  2BOC C;  1GKF A;  3CP1 A;  2ZR3 A;  1V55 C;  1YI2 V;  3W7W A;  3AG4 B;  4FPP A;  1YHQ V;  4JAV A;  1VQ5 V;  5EK0 A;  2WLH A;  4P9P A;  1THZ A;  3AEI A;  3P30 A;  2IU0 A;  4UV8 A;  3TCU A;  2EIK B;  4PA4 A;  2P7T C;  2HVK C;  3ZMT A;  3E2E A;  3T4Z A;  2OT5 A;  3LUT B;  2M7W A;  2EBO A;  1K92 A;  3X2Q B;  1R6K A;  1L1F A;  4PDM A;  1K73 W;  3FB7 C;  2ZR2 A;  1KP2 A;  3K0G A;  1XL4 A;  5CN0 A;  1QVG U;  3AG2 B;  1AI6 A;  1GMG A;  5H6Q A;  3ASN B;  1GM7 A;  1SET A;  2P90 A;  3LSQ A;  1GK9 A;  2XAJ A;  3ZN1 A;  1FXK B;  1S72 V;  5B1N A;  4MW8 A;  1YIT V;  4XDK A;  3FB8 C;  2YEV B;  1NR1 A;  3DGE A;  5LBQ A;  4MTF A;  1S76 D;  2QE7 G;  1VQM V;  1ZWI C;  1VQ8 V;  4JGS A;  3R65 A;  3W7X A;  1K5S A;  4PEL A;  1Q81 W;  2B1G A;  5B3S B;  1CP9 A;  3P32 A;  4JF3 A;  1YJ9 V;  1M9N A;  3ZJZ A;  3SYA A;  3QNE A;  1DF4 A;  1K7D A;  3ETG A;  2X6B A;  4X89 A;  3AG1 B;  1HWY A;  2V1D A;  3SPI A;  3CME V;  1JCH A;  4J9Y B;  1K34 A;  2IH1 C;  4P2Z A;  5H6R A;  2DYS B;  2UXX A;  1V54 C;  2OCC B;  3OE7 G;  4BIU A;  2IJK A;  4ZKI A;  3AG3 C;  2R9R B;  3G4S V;  1JPX A;  2DWE C;  3WG7 B;  3E89 A;  1VQO V;  2X7R B;  3CCM V;  4P9O A;  2LP7 A;  2EIN B;  4ZBM A;  5EBW C;  2EZP A;  5L3G A;  1MSW D;  1S5H C;  4RO2 A;  4TWK A;  1NJI W;  5L3B A;  4WFF A;  3T2M A;  3ABU A;  3E8B A;  5LHI A;  1Q82 W;  2V7Q G;  1M90 W;  1R3I C;  3K04 A;  4PDL A;  3LDD A;  3UM7 A;  2B5U A;  4Z1M G;  2HG5 C;  2AHZ A;  4TSF G;  5LGN A;  3VBB A;  1R3K C;  5DN6 G;  2EIM C;  2LFS A;  2WPD G;  3T4D A;  4LBE C;  5CBF A;  3E83 A;  3ZMS A;  3FYE B;  2ZXW C;  3K79 A;  3SPH A;  1F4N A;  3B8M A;  1YJW V;  2NNU A;  3SPC A;  2W6J G;  1OZ0 A;  2CK3 G;  2JJ1 G;  1AR1 B;  1MOF A;  4FMT A;  3CCE V;  1DLB A;  4J9Z B;  1Q86 W;  5EC1 C;  4CBC A;  3NXS A;  3JD4 A;  2C2A A;  5KUK A;  4WFH A;  1YIJ V;  3OUS A;  1KQS U;  5LGT A;  3OEE G;  3A0R A;  4QIW F;  4CZZ A;  3ZRV A;  1R3J C;  2R9I A;  1RPR A;  4Q20 A;  4UVA A;  3ZRW B;  3LDC A;  2JEU A;  1W0J G;  5L3C A;  3ZRX A;  1LNQ A;  2ZD9 A;  3ABK B;  2X6A A;  2QA4 V;  1ARO P;  4DXW A;  2A0L A;  4X8A A;  1KEC A;  4N23 A;  3JD0 A;  3OM3 B;  2ZDI C;  1VQP V;  3EHB B;  3ZCC A;  2IW5 A;  2Z3Y A;  1NVP D;  1EFR G;  3D36 A;  4GX5 A;  3ZN0 A;  1OCC C;  2XND G;  1YTF D;  2H8P C;  1AI7 A;  4FJC C;  2IH3 C;  4G2K A;  5B1B B;  4UVB A;  2WLL B;  1FXV A;  1NQT A;  3OW2 U;  5B1A C;  1BMF G;  1H38 A;  3CXC U;  1RPO A;  2Y48 A;  1NBM G;  2EIL C;  1VQ9 V;  3E8F A;  1R73 A;  4R50 A;  3E35 A;  3VOU A;  3CCV V;  4GX2 A;  3QO7 A;  1QR9 A;  4TT3 G;  5KA6 A;  1S77 D;  3LNM B;  3MD0 A;  4MTX A;  5LGU A;  1KKD A;  4MTG A;  3F7V C;  2P6J A;  1QLE B;  1M56 C;  3SPJ A;  4LC1 A;  3CPW U;  2WLI A;  2PI5 A;  4F4L A;  5IY5 B;  3K0D A;  1OCZ C;  1YJN V;  3IGA C;  1M57 B;  3F5W C;  2EZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...