3A0HZ

Crystal structure of i-substituted photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0hZ00
4PJ0Z 5GTHZ 2AXTZ 4IL6Z 1S5LZ 5TISZ 5KAIZ 5B66Z 3JCUZ 3KZIZ 5B5EZ 5E79Z 3A0BZ 4UB6Z 4UB8Z 3WU2Z 3A0HZ 5GTIZ 5KAFZ 5H2FZ
chains in the Genus database with same CATH superfamily
3H01A 4DR4O 1QVGU 3ICXA 4MVZA 1Q3EA 5BMVA 3CMEV 1GN3A 2GTAA 5K1XA 2ADQB 4U3JB 1RPRA 4DUYB 5J2TA 4G27B 3A8TA 3K59A 1IBMO 1BE3H 3ABLB 1Q6HA 4DV5B 1PL4A 3ABLC 3MHSC 3J81N 3ZHTA 3G71V 1YTFB 4MVUA 5C8YA 2XAJA 4J7ZA 4F6RB 4BIZA 1K9MW 2EIJB 1EM1A 3ZHVA 5IYCO 3K3WA 3M99B 1W0KG 5BY1A 4CC6A 2RCVA 1HP8A 1ROPA 4TV9B 5B1OA 1WA8A 3L71H 3U10A 2HG5C 4CS4A 1FAFA 1SQFA 4I50B 2A06H 2IW5A 3CCSV 3BAAA 4P2ZA 2P4KA 1ENVA 3OR7C 2BTOA 2HFEC 4Q20A 2H3OA 3B8NA 2ZDIC 4H0LB 5LA6A 4LF7B 2E5LO 3CRQA 1BGYH 2F1MA 1PKXA 4TT3G 4FM2A 5KHIA 3WB0A 3CCUV 5CBGA 3ETGA 2F93B 3CYOA 1H2MA 1XQ8A 2YXYA 1T5EA 2QDOA 4X1KB 1OV9A 1EFRG 1IBLO 4HNAA 4X66B 4TOIA 1Y76B 4FFKA 3E89A 4NTYA 4J7JA 3SJQC 1P49A 5CB4B 3N2GB 2MK3A 1BQZA 3FD9A 4NXMB 1R73A 3ZN1A 4K0KO 5CA1A 1H2KA 3K5NA 4UV9A 1R3IC 3ZHUA 2EZPA 1LR1A 4KFMA 2OYQA 4IHJB 4FFBB 1R6KA 4ZI7A 3CSXA 1E1QG 3OD4A 2OTLV 2BOCC 4FVMA 4MVQA 5IYZA 1VQ4V 1H2LA 1Q90D 1QR9A 2DQ3A 1G4YB 1VQPV 4DV0O 3ASNB 1VMGA 1FYJA 3IC7A 4UVCA 3K03A 2P4VA 1Q86W 3ASNC 4I55B 4WFGA 3CCMV 3E2EA 3OR6C 5GW7A 1THZA 5IWAB 3SPGA 1YZBA 1OCRB 1GTOA 5JCOA 4TQDA 2EINB 5HFMA 1OCRC 1VQKV 3DGEA 3RYIB 2EINC 2ZNIA 1EZVH 2QKSA 5DEDA 3ZMVA 1KC8W 3HR0A 3ZCCA 2ARHA 2H94A 3RYFB 4ICGA 4FLZA 1SQXH 5EK0A 2B5UA 1JJOA 1P7GA 1K4DC 4MSWC 1MSWD 1H2SB 5LMNB 1GKFA 1BS3A 3ABTA 1Z5WA 2GUZB 4PV1B 2XAGA 4JYAO 2Y69B 4XBFA 3ABKB 2LFSA 3QO8A 2R9IA 3A0BZ 4UXNA 1KYOF 2ZE5A 4ABMA 4R6ZA 5IJ0B 2WLLA 2WLNA 3APOA 1XMQB 2PTMA 4JZ2A 4RAIA 3DXRB 5IYDO 3K06A 3SJBC 2X6AA 2P06A 2LFRA 1RSOB 3AEIA 4O2AB 5LGTA 4LP8A 2Q6AA 3OEEG 3TCUA 4JI1B 3CHXA 4AQYO 4X65O 2YIBA 4RUEA 1U96A 5DECA 2JJ2G 1G1XB 2YEVB 1XL6A 4X1IA 2CE4A 3ZHQA 3LDEA 3RVZA 4LF9B 2LO1A 1TUEB 3Q4HA 3IFXA 4OX9O 3JCUZ 2Q9LA 4PA7A 1NH2B 1CPYA 5KUMA 3W7XA 1UJWB 4J10A 1H8EG 3RGBA 3JD1A 2ZXWB 4MTOA 2XUMA 4R8CA 3P3PA 3CWBH 2RDCA 1J5EB 1Y74A 4K8XA 2FB5A 4JAUA 2ZXWC 2R72A 1XNQO 2DE0X 3ZRVA 2DYSC 1LUVA 1VF7A 4EFEA 3ETEA 5FNVA 3B77A 4BIOA 4O4JB 2UXDO 1M93A 3OTOB 2UXBB 1HWYA 2DOSA 3UT5A 3K5MA 3MDSA 4NXNO 3U0ZA 3OUFA 3QNEA 3LNNA 3ZX6A 5GTHZ 1FPOA 2YS8A 1XDCA 3ZIAG 2YI9A 1FD9A 1XHZA 1L0NH 2YC0A 4GX2A 2F95B 4WBNA 1F7YA 1VF6C 2QJ1A 3OMAB 1J95A 3ASOC 4LF8B 1Q43A 1WB8A 3SGIA 1FJGB 4J41A 4DV7B 1Q81W 1VIBA 3PN1A 3L9DA 3IJ4A 3ZJZA 5JQGA 5J2UA 1HDJA 4PI0A 4YXWG 2YSUB 4TV8B 5LOVB 3WB2A 4JYCA 3B8MA 1DF4A 3RBZA 4O4LB 1M57C 4YY3B 4DO2A 2Z5UA 1JR9A 4QIWF 4O4HA 5KX5A 3C3TA 1FKAO 1OCZB 1SERA 3OGCC 4I9WA 4J7KA 4B7EA 1N32O 5FPRA 1OCZC 2BE3A 3AG4C 4Z2WA 2HHHO 2PI5A 4KP4A 2QWQB 4WFAV 4LF9O 4LWSA 2UU9B 3APQA 5LYJA 4C7UA 4I4TA 1S5JA 3JD0A 3K0DA 1QR8A 3SYPA 5B1BB 1K5QA 3OEHG 1RFYA 1M56C 5BMVB 1N8RW 4PELA 1NVPB 2VQFO 1P4RA 1J5EO 5J2TB 1WAZA 4DR2B 2GBOA 1NTKH 1GN4A 1AR1B 5BR8B 4B3TB 2WWWA 1KMIZ 1M9NA 4UCSA 4YJ3A 4DUZO 3ZN0A 2VWJA 2P22C 2F4VB 2YUAA 1OZ0A 2Q0OC 5A2QN 1E79G 4F6EA 3OTOO 2LW1A 1SKVA 5L3EA 3D8CA 1M4UA 2Q67A 4RQEA 4JV5O 4JTCB 1FFTB 1XMOB 3MAQA 2ZM6B 4DV1O 1YCIA 4DW1A 2P90A 5DM6V 2DYRB 4GX0A 3O65A 3FB7C 1VQOV 2N04A 5B1NA 1PP9H 4ZHQA 1K34A 2XT9A 4IL6Z 4LF6B 4CS2A 1WJZA 2PF4E 5LA6B 1PM9A 4G2KA 4UVAA 1XOUA 2R9AA 2YICA 4JI8O 3BABA 3QG5A 1VEWA 4DR4B 3HKDA 4GZRB 4YJ2B 2P5OA 4FLVA 2JIZG 4JI6O 2E75B 4HNAB 3OE7G 3CMAV 4WCEV 1BT8A 2CTPA 2EULA 1L8DA 1IBMB 1XNRO 1DTOA 1YVWA 5CA1B 1GK9A 3CCJV 4OPHA 2OIGA 2QKCA 1M90W 4DR1B 1HR0O 4D7SA 2FKXA 1IDSA 3SPCA 1OCOB 5B66Z 4X9QA 2HEPA 3D3IA 4ZI7B 1BZKA 2QWRB 4PHZA 2B1IA 4DV2B 4ASUG 4B3TO 3AG3B 1NJIW 5IYZB 4DW0A 4AI8A 1M1KW 1MA1A 4JI4B 2HLDG 2V7QG 1AI7A 3AG3C 3WG7B 1PD3A 4BWAA 5K1PA 4DRXA 1AI4A 1MG1A 4YIPA 3WG7C 2D3OW 1W59A 1HNWO 2UXXA 2JS3A 4L87A 2F43G 4JF3A 4JI2O 2RN9A 5L3CA 3T2MA 2E5LB 3I55V 2JGDB 5CBFA 1H38A 4JI0O 1XMOO 3T4DA 3T1HO 4DR7O 2PYJA 1GO3F 1IXMA 2AHZA 5EC1C 1SESA 1NTMH 3CCLV 4PA6A 1VQ8V 2PUSA 3AG2B 2IU3A 1IBLB 1YTFD 3CXHF 3ZHRA 3OAAG 4Q6GA 3AG2C 1ZWIC 4EB6A 3SDLA 4J11A 3KG2A 1XUQA 2BCCH 4K0KB 1JMKC 4UCTA 4NKGB 4DK0A 4UUJC 2ZNJA 1K97A 4UCOA 4NYKA 4DYLA 4TQFA 4MT8A 1UFIA 3A2FA 2XASA 3NXSA 4DK1A 1D5NA 1BCCH 2RQ6A 1N4CA 1Y66A 3RYHA 2WLLB 1EN4A 1WNSA 3WU2Z 1G6UA 1WP8A 3CJHB 2EIMB 1ZLZA 3RFRA 1NU1H 2Y4UA 4DV0B 3ZRSA 5CN0A 4PA4A 2EIMC 4DR1O 4BR6A 2LQTA 1KP3A 4GX1A 3ABUA 3SYOA 2OT5A 4U7OA 3GVMA 4RQFA 3CCQV 2KG7A 3CX5F 4DV2O 2ZKOA 1TGOA 5LHIA 2PZSA 2LGWA 5IJ9B 4JI4O 4LC1A 3JSLA 4MVMA 1NS1A 4LFCB 4LNUA 2C2AA 2OIEA 2W6JG 2OCCB 1DGSA 5AG2A 3KZIZ 1MABG 1LNQA 5EC2C 4DR6O 1H8HG 2OCCC 5H9CA 3GWKC 1Y74B 2MW2B 2CGNA 1PPJH 1QCEA 1I7FA 3LDDA 3TGUH 4J42A 2JRIA 2Q0AA 5FNVB 5IY5B 2NN4A 2VWKA 3K04A 3B09A 4LF4B 4JYAB 3IAYA 3FYIB 5CA0A 5IY5C 3UT5B 1S5HC 3CC2V 1MNGA 3RYCA 4FLYA 3WB1A 5DN6G 2Q68A 3BCCH 1BHBA 4X62O 1H2GA 1WB7A 4WBNB 3LSSA 1NQTA 4AQYB 1N36B 5CA3A 4X65B 1MSDA 2NNUA 4R50A 5KA6A 4XDKA 2QKAA 2Q7GA 3K9AA 2H8PC 2P7TC 3CEIA 1F23A 3AK3A 1XEQA 2JEXA 1BHAA 3JASA 4DV3O 5J2UB 5JQGB 4LFBO 4FM1A 1K92A 4EEQA 3LDCA 2IU0A 4OX9B 4MVSA 3SJAC 2IJJA 2Q73A 4BAYA 3H9VA 2JJ1G 4E4EA 3R66A 3U11A 5KX5B 4O4HB 1GRJA 3FB5C 4QPKA 3UO3A 5LMUO 3FFQA 1XNQB 1R6TA 1FXKC 1YF2A 2FYUH 1GN6A 2ETNA 4LWSB 4GKKO 2GTSA 2QWNB 3OMIB 2M6YA 5LYJB 5JJJB 4I4TB 2UXNA 2CUGA 1K33A 1R3JC 3SR2C 4LFCO 3N27A 3ZHSA 5LP6C 2UXDB 2FTKA 1FFXA 2Y4TA 4GYCB 1YI2V 4NXNB 4L8JA 4K8ZA 1GM7A 1KKDA 2A7WA 2UUAO 1JPXA 1SC5B 1MOFA 1HW7A 2QA4V 2HJFC 1ZUQA 4LF4O 3D3QA 1GN2A 5L3BA 4TWKA 1NH2D 2X7RB 1N0JA 1COWG 1IVSA 5FPOA 2QEXV 1K3EA 2LGQA 2NLJC 1B06A 4H37A 1N34B 2A3QA 3X2QB 1HNZO 3O9OA 3FB6C 3I56V 3ZMUA 4Z1VA 3X2QC 1SQPH 4X88A 2OCHA 1A32A 1L0LH 2HVKC 4MTXA 2WA4A 1N36O 3JYCA 5H6RA 1EZJA 2BTQA 1AILA 4ZHQB 1Q82W 4KL1A 3W7TA 1X4TA 2HP8A 1N32B 2HHHB 3K58A 5JJNB 3JALA 4MTFA 1ZAUA 2EILC 4YIOA 5JH7B 1X59A 2ITCC 2IJHA 3HKDB 1WLEA 2VQEO 3TJTA 3SPIA 2AZ0A 3ZRXA 5EYPA 3CXCU 2VQFB 2DYSB 4GKJO 4I50A 3B4SA 1IURA 4DUZB 4MTGA 4ZOLA 4RUFA 4I0XA 3T4ZA 2WPDG 2M7WA 4NTWA 2HR3A 5LL6Y 1B3QA 4JV5B 2X6BA 1HNXO 3HB3B 2RJZA 4DV1B 1YSCA 3THOA 5EZYA 3CPWU 4LF5O 1N33O 3JARA 3ASOB 5FL7G 3C3SA 1LUWA 3I5DA 1VQ5V 2ZR2A 2EJ7A 4X20A 2YXHA 4LBEC 4NTXA 1NVPD 1KD1W 4MS2A 4IGGA 4J9YB 2ZR3A 1N34O 2HJDA 2X6CA 1K73W 3JAWA 4JI8B 1VQ9V 2Z3YA 3ZEDA 4CC5A 4MVRA 1M57B 2IH3C 4JI6B 2WLIA 3ZMZA 3BA8A 3GWOA 3MHHC 3N2KA 2ILMA 1FXKA 3AG4B 1JX9A 3S3WA 4EB6B 4D6TH 4FZ1A 1PNMA 1PNLA 2ZCEA 2AGAA 1XNRB 1L1FA 1YJ9V 1W2BU 4HYOA 5LP6A 1AVMA 4CH5A 3SPJA 4B3MO 3B2EE 4PA9A 1M56B 4I55A 1CP9A 1TUBA 5CBHA 1AB3A 1HR0B 5EIBD 2ZIOA 1YJWV 1BQ0A 1R6NA 3CC7V 1US6A 1SZXA 2JK5C 1NBMG 3E35A 4CBCA 4E2LA 5HFLA 4JI5O 3HKEA 2XTAA 5GONA 3RYHB 1PL0A 3PJSK 5E1AC 3ETDA 4DR5B 5IT9N 4IYHA 3JATA 2Y0PA 5KHHA 1OHHG 5BXZA 3G67A 1CEZA 2KQXA 2EIKB 5GTIZ 1AR4A 2EIKC 1HNWB 2ZE7A 4FK5C 2DN9A 2XHBA 4GLXA 5C8YB 3UCSC 4O4IA 3L75H 4JI2B 3QF7A 5C93A 2KG7B 3J7AU 3T1YB 4JI0B 4PD4F 4BW9A 3OT7A 3T1HB 4DR7B 4F4LA 1JOYA 5KHKA 4WF9V 1WA8B 1EN6A 1SA0A 2UXCO 1AR5A 4LNUB 3E8FA 2YXLA 2ATKC 3P32A 4GX5A 3QTCA 4CS3A 3HKBA 1QLEB 3ZRWA 4LH6A 4JYBA 3JD2A 1YEWA 2B9ZA 1QLEC 4KHPO 4FLUA 4HBNA 4CH3A 2OTJV 4JI3O 2UUBO 3DSQA 5JWPA 3QVNA 4W4KA 3H1IH 2QWPB 5CA0B 4JTDB 2DMXA 2QM4A 2Q4PA 4PDVA 4QJFB 2UUCO 4X64O 4B7KA 4PA3A 1JCHA 3F7YC 3RYCB 4KUMA 5BZBA 3VOUA 3EFFK 2PI4A 4D7TA 3SYAA 1K7DA 2AXTZ 3D36A 2VS0A 4X8AA 3CC4V 3JD4A 3JD3A 1K8AW 4YHHB 1JFFA 4K3AA 3KKYA 4JGSA 1ZX3A 1OCCC 2GV9A 2YIAA 4DR5O 3BFRA 3JASB 3FKSG 1V54C 2DWDC 2P6JA 4B3SO 1F4MA 1AI5A 1DLBA 2V4DA 4CH4A 4RO2A 2WLHA 3NR7A 4XDLA 4HZ3A 3K57A 4DR6B 5B1AB 1S77D 4TUYA 4MVOA 2OWOA 2QM8A 3T1YO 5B1AC 2Y0IA 3BPZA 3EHBB 4JAAA 4DV6B 4I5SA 5H5NA 1JQ0A 1SETA 5KHGA 2CTQA 3ZBHA 3CP1A 4UCRA 1KP2A 4R7CA 4DV4O 1FFXB 2YIBD 4H44B 3G4SV 2ZIMA 2VRZA 5E79Z 5L3FA 1S76D 1Y67A 3H1JH 3LSQA 4A5UB 5LXTA 3ABMB 4Z1MG 2ODMA 4UV8A 4X62B 4JTAB 2PY5A 3ABMC 5KA5A 3GB7C 1RM1B 4W4LA 3HKCA 1AJPA 3RN4A 2Y48A 4FMTA 3FAVA 1RM1C 1FS0G 2E74B 4GUNA 1V55B 4DV3B 4FJCC 4LFBB 1DK1A 2CGOA 1V55C 2A0LA 1Y6XA 2GHYA 5IYBO 1ZL8A 2KSDA 3JAMN 3CE2A 2BOBC 3T1CA 2BSKA 3IGAC 3DTUB 1KUQA 1JVMA 2V1DA 2CAZC 2BTQB 4YHHO 4DXWA 1D2DA 5L3GA 5LMUB 2CTWA 4X1IB 3ML0A 3DC5A 4OGQB 3JALB 1SS3A 1JJ2U 5A9GA 3FX7A 4GKKB 3Q4HB 4NVPA 2AW9A 1WN7A 3HPLC 4BW5A 5ITZA 3F7VC 1BSMA 4OPAA 5EYPB 2G38A 3OFNG 3P30A 4X1YA 3BVOA 5EBWC 4PDLA 2EIJC 1AP6A 2UUAB 4EKWA 3FYEB 2IM9A 1UPGA 4ZBMA 1WPXA 3E86A 4DV6O 1R3LC 2CH7A 3AK2A 3BEHA 1Z2GA 3SYCA 4UVBA 4ZOLB 3W7WA 4I0XB 2O57A 4FIPC 1NKDA 3J80N 2EZOA 1B6QA 1VF5B 2ZINA 4LR3A 4JYYA 1SQQH 2WLKA 4O2BA 2Q5ZA 4QPJA 5KMGA 4QNHB 2N05A 4FLXA 4LCUC 4CH6A 4YJ2A 1HNZB 5EZYB 2ZD9A 1XL4A 1E1RG 3JARB 1I94O 2AZ2A 3S3XA 2QSAA 4H33A 3CD6V 4MW3A 1XHXA 1NTZH 4B3RO 4X20B 1SQVH 1AROP 4TSFG 1GH6A 2ZE8A 3CCEV 2QGNA 1VARA 2CK3G 3TETA 4NB5A 3RVYA 4U7NA 1K4CC 3JAWB 1YHQV 3QO5A 1VP7A 1CXZB 1TVKA 4DR3B 4LFAB 2VQEB 1I0HA 4WFHA 3EXAA 1QLNA 4IYIA 4DUYO 1AJNA 2WLIB 1KQSU 1JA8A 5J9PC 3N2KB 1SQBH 3OUSA 1FXKB 3A0RA 2Q8VA 1I5XA 2CDYA 4GKJB 4DV5O 4IT5A 5TISZ 1R1BA 5LP6B 3STLC 3TXQA 4UCUA 2ITDC 3SJCC 1NI8A 1TUBB 3STZC 1SF9A 4UFZA 2QM7A 4NR1A 3JAKA 1IZ3A 4UB6Z 4IIJA 2JGDA 1WPBA 3W7SA 3BY6A 3E83A 1QBZA 1HNXB 2DWEC 1Q7YW 3HKEB 3K0GA 5GONB 4WFEA 4G28B 5D5PA 3L72H 1TAEA 3JATB 4LF5B 4YJ3B 1N33B 3BHPA 4QE9A 4LH7A 4J9ZB 1KBHA 1IX9A 1N0NA 1YDXA 2E3CA 4CZZA 4PI2A 3OGIB 4BIUA 3E22A 2HKOA 4LF7O 3A0HZ 2D2CB 3M7MX 2Q69A 4O4IB 2P67A 5JJEB 5JVDA 3LNMB 3R65A 4KXRA 5KLVH 2E76B 1V9PA 3LUTB 3TXSA 2WLJA 2K1EA 4X66O 3UO2A 1SA0B 4U3JA 2RMKB 2Y69C 1O9HA 3AK1A 3ABKC 1GMGA 1M5IA 3WFVA 2HVJC 5KHJA 3BA9A 3CJHA 4NXMO 2JVDA 4J80A 3HKBB 3K79A 2EILB 3ZRWB 1FXHA 1P84F 1YJNV 1DF5A 4PDMA 2QTSA 5F2VO 3H1HH 4B3MB 2FL4A 1EN5A 4DR3O 4LFAO 1XILA 4F6RA 3ZS8C 2B1GA 3E8HA 4P30A 4JI5B 4TV9A 1KKCA 1S5LZ 3OMNB 2L35A 5KAIZ 2NR5A 5IJ9A 3JCZA 3CB2A 2IH1C 4U3FH 4MW8A 2ZDIA 1QNMA 4RWUA 4H13B 2XNDG 3FB8C 5IWAO 3M8AA 4AILC 3VBBA 4JI7B 1BL8A 1JFFB 1QVFU 3CRRA 2GDSA 3D36C 5IDJA 3G80A 1GAXA 1MMMA 3QO7A 4X1KA 4FLWA 1W0JG 4I9QA 4AHCA 3F5WC 3TK1A 4UCVA 3CS5A 1Y76A 2UXCB 4DRXB 3BRCA 1KECA 2EX3A 3K5LA 1OJHA 2ZQMA 4B08A 5CB4A 3LSUA 3N2GA 1F51A 3L74H 1H2NA 1XREA 2RNBA 4TUYB 2LP7A 1IBKB 5LMNO 3ETQA 1PV0A 5EBLC 1Z5VA 2PYLA 3KCYA 4JAVA 4KHPB 1B04A 1MZEA 4IHJA 4JI3B 2UUBB 3RW0A 4FFBA 2LJ2A 3RWRD 2A9HA 2EBOA 1D5AA 1VQ6V 1VQNV 1Q6UA 2UUCB 1XMQO 2XAQA 4X64B 1O9GA 2XOKG 5FLXN 3JSNA 5LGUA 5EBMC 2JGUA 3G6EV 1AJQA 2F23A 4K35A 5LXTB 4JI1O 2JDIG 3ZMSA 5L3DA 1KU9A 1BMFG 1ZSPA 1KB9F 4FZ0A 3C90A 2WAMA 3G6BA 2F66C 3HKCB 4GCZA 1YXBA 3E8BA 2EJRA 3FAVB 1YIJV 2W0FC 2XAFA 1QHTA 2Z0AA 4ZKIA 1SQGA 5B5EZ 3RYIA 4EFBA 3P3NA 1SZTA 4B3SB 4FLTA 1IXBA 1RPOA 4ZIBA 3CRMA 3RT3C 1ZL8B 2WLMA 5B1BC 1R3KC 2BSKB 2CTRA 3RYFA 1Q8IA 3CRAA 4N21A 1Q6IA 4XDJA 4JI7O 3K9SA 2W0XA 2QE7G 2ZE6A 2X0LA 1EBOA 3IC9A 2L6LA 2GUZA 5LHGA 4WFFA 2KKWA 1GM9A 1NR1A 3OW2U 2UXBO 3H1LH 5ITZB 1Q5OA 2ZT9B 4DV4B 4JASA 5IJ0A 2QWOB 4X1YB 2DW4A 3DXRA 1VQ7V 3E8GA 1URFA 1G8MA 1IBKO 1RSOA 1AI6A 4O2AA 4QE7A 2GSMB 2PGGA 2QR4A 2AHYA 3KCXA 2Q7EA 2CH7B 1RP3B 1VQMV 4LF8O 2DYRC 5EIBC 4WFBV 1VQLV 2YEVA 4JZGA 1FJGO 2W6IG 2WA3A 4DV7O 3SYQA 5LHHA 2JEUA 1I5YA 1XBLA 1FXVA 2Q7HA 2WSSG 4O2BB 3VQXA 2LW7A 3K5OA 1QQCA 5JH7A 5KMGB 4GT1A 2R70A 4X89A 2FMLA 2YDEA 3VQWA 1AP5A 3F5TA 4P9PA 3L73H 3UQ8A 1MZFA 5KUKA 1XI1A 3CCRV 4YY3O 3AG7A 3VQYA 4FPPA 2YI8A 3L70H 1SRYA 1OCCB 2DQ0A 4PDRA 2IJKA 5LBQA 2IJIA 4P9OA 1V54B 2UU9O 4UB8Z 3UM7A 4O4JA 2DJVA 4OXSA 2IBZH 5H2FZ 4PJ0Z 2ADPA 1TVKB 5B3SB 2K9PA 5CMUA 5IE9A 4HAMA 3H1KH 5B3SC 1OCOC 4DR2O 4QGPA 3MD0A 1QU7A 1ORQC 5BR8O 1S0VA 1VF6A 3OM3B 3UKMA 3ZMTA 1Y4MA 1PNKA 5D5QA 1TA8A 3W7UA 2F4VO 1YITV 4I7ZB 3OTFA 2N74A 1ZTEA 1NZ6A 5H6QA 4N23A 3JAKB 5LGNA 2KB1A 4IIJB 2ZM6O 4FM0A 3CCVV 1NR7A 3K08A 4TV8A 5LOVA 5JCOC 1S72V 1WP7A 1F4NA 1U97A 1GM8A 1I94B 4O4LA 1S3JA 1P7BA 1I08A 2R9RB 2XAHA 3SPHA 4LF6O 3AG1B 1K5SA 2YIDA 2JS5A 3E22B 3AG1C 4B3RB 4JPRA 2QTOA 3B40A 2A79B 3DC6A 3VQVA 3CRCA 3EVKA 5JVDB 5KAFZ 1NT2B
chains in the Genus database with same CATH topology
4PJ0Z 5GTHZ 2AXTZ 4IL6Z 1S5LZ 5TISZ 5KAIZ 5B66Z 3JCUZ 3KZIZ 5B5EZ 5E79Z 3A0BZ 4UB6Z 4UB8Z 3WU2Z 3A0HZ 5GTIZ 5KAFZ 5H2FZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 Z;  5GTH Z;  2AXT Z;  4IL6 Z;  1S5L Z;  5TIS Z;  5KAI Z;  5B66 Z;  3JCU Z;  3KZI Z;  5B5E Z;  5E79 Z;  3A0B Z;  4UB6 Z;  4UB8 Z;  3WU2 Z;  3A0H Z;  5GTI Z;  5KAF Z;  5H2F Z; 
#chains in the Genus database with same CATH topology
 3H01 A;  4DR4 O;  1QVG U;  3ICX A;  4MVZ A;  1Q3E A;  5BMV A;  3CME V;  1GN3 A;  2GTA A;  5K1X A;  2ADQ B;  4U3J B;  1RPR A;  4DUY B;  5J2T A;  4G27 B;  3A8T A;  3K59 A;  1IBM O;  1BE3 H;  3ABL B;  1Q6H A;  4DV5 B;  1PL4 A;  3ABL C;  3MHS C;  3J81 N;  3ZHT A;  3G71 V;  1YTF B;  4MVU A;  5C8Y A;  2XAJ A;  4J7Z A;  4F6R B;  4BIZ A;  1K9M W;  2EIJ B;  1EM1 A;  3ZHV A;  5IYC O;  3K3W A;  3M99 B;  1W0K G;  5BY1 A;  4CC6 A;  2RCV A;  1HP8 A;  1ROP A;  4TV9 B;  5B1O A;  1WA8 A;  3L71 H;  3U10 A;  2HG5 C;  4CS4 A;  1FAF A;  1SQF A;  4I50 B;  2A06 H;  2IW5 A;  3CCS V;  3BAA A;  4P2Z A;  2P4K A;  1ENV A;  3OR7 C;  2BTO A;  2HFE C;  4Q20 A;  2H3O A;  3B8N A;  2ZDI C;  4H0L B;  5LA6 A;  4LF7 B;  2E5L O;  3CRQ A;  1BGY H;  2F1M A;  1PKX A;  4TT3 G;  4FM2 A;  5KHI A;  3WB0 A;  3CCU V;  5CBG A;  3ETG A;  2F93 B;  3CYO A;  1H2M A;  1XQ8 A;  2YXY A;  1T5E A;  2QDO A;  4X1K B;  1OV9 A;  1EFR G;  1IBL O;  4HNA A;  4X66 B;  4TOI A;  1Y76 B;  4FFK A;  3E89 A;  4NTY A;  4J7J A;  3SJQ C;  1P49 A;  5CB4 B;  3N2G B;  2MK3 A;  1BQZ A;  3FD9 A;  4NXM B;  1R73 A;  3ZN1 A;  4K0K O;  5CA1 A;  1H2K A;  3K5N A;  4UV9 A;  1R3I C;  3ZHU A;  2EZP A;  1LR1 A;  4KFM A;  2OYQ A;  4IHJ B;  4FFB B;  1R6K A;  4ZI7 A;  3CSX A;  1E1Q G;  3OD4 A;  2OTL V;  2BOC C;  4FVM A;  4MVQ A;  5IYZ A;  1VQ4 V;  1H2L A;  1Q90 D;  1QR9 A;  2DQ3 A;  1G4Y B;  1VQP V;  4DV0 O;  3ASN B;  1VMG A;  1FYJ A;  3IC7 A;  4UVC A;  3K03 A;  2P4V A;  1Q86 W;  3ASN C;  4I55 B;  4WFG A;  3CCM V;  3E2E A;  3OR6 C;  5GW7 A;  1THZ A;  5IWA B;  3SPG A;  1YZB A;  1OCR B;  1GTO A;  5JCO A;  4TQD A;  2EIN B;  5HFM A;  1OCR C;  1VQK V;  3DGE A;  3RYI B;  2EIN C;  2ZNI A;  1EZV H;  2QKS A;  5DED A;  3ZMV A;  1KC8 W;  3HR0 A;  3ZCC A;  2ARH A;  2H94 A;  3RYF B;  4ICG A;  4FLZ A;  1SQX H;  5EK0 A;  2B5U A;  1JJO A;  1P7G A;  1K4D C;  4MSW C;  1MSW D;  1H2S B;  5LMN B;  1GKF A;  1BS3 A;  3ABT A;  1Z5W A;  2GUZ B;  4PV1 B;  2XAG A;  4JYA O;  2Y69 B;  4XBF A;  3ABK B;  2LFS A;  3QO8 A;  2R9I A;  3A0B Z;  4UXN A;  1KYO F;  2ZE5 A;  4ABM A;  4R6Z A;  5IJ0 B;  2WLL A;  2WLN A;  3APO A;  1XMQ B;  2PTM A;  4JZ2 A;  4RAI A;  3DXR B;  5IYD O;  3K06 A;  3SJB C;  2X6A A;  2P06 A;  2LFR A;  1RSO B;  3AEI A;  4O2A B;  5LGT A;  4LP8 A;  2Q6A A;  3OEE G;  3TCU A;  4JI1 B;  3CHX A;  4AQY O;  4X65 O;  2YIB A;  4RUE A;  1U96 A;  5DEC A;  2JJ2 G;  1G1X B;  2YEV B;  1XL6 A;  4X1I A;  2CE4 A;  3ZHQ A;  3LDE A;  3RVZ A;  4LF9 B;  2LO1 A;  1TUE B;  3Q4H A;  3IFX A;  4OX9 O;  3JCU Z;  2Q9L A;  4PA7 A;  1NH2 B;  1CPY A;  5KUM A;  3W7X A;  1UJW B;  4J10 A;  1H8E G;  3RGB A;  3JD1 A;  2ZXW B;  4MTO A;  2XUM A;  4R8C A;  3P3P A;  3CWB H;  2RDC A;  1J5E B;  1Y74 A;  4K8X A;  2FB5 A;  4JAU A;  2ZXW C;  2R72 A;  1XNQ O;  2DE0 X;  3ZRV A;  2DYS C;  1LUV A;  1VF7 A;  4EFE A;  3ETE A;  5FNV A;  3B77 A;  4BIO A;  4O4J B;  2UXD O;  1M93 A;  3OTO B;  2UXB B;  1HWY A;  2DOS A;  3UT5 A;  3K5M A;  3MDS A;  4NXN O;  3U0Z A;  3OUF A;  3QNE A;  3LNN A;  3ZX6 A;  5GTH Z;  1FPO A;  2YS8 A;  1XDC A;  3ZIA G;  2YI9 A;  1FD9 A;  1XHZ A;  1L0N H;  2YC0 A;  4GX2 A;  2F95 B;  4WBN A;  1F7Y A;  1VF6 C;  2QJ1 A;  3OMA B;  1J95 A;  3ASO C;  4LF8 B;  1Q43 A;  1WB8 A;  3SGI A;  1FJG B;  4J41 A;  4DV7 B;  1Q81 W;  1VIB A;  3PN1 A;  3L9D A;  3IJ4 A;  3ZJZ A;  5JQG A;  5J2U A;  1HDJ A;  4PI0 A;  4YXW G;  2YSU B;  4TV8 B;  5LOV B;  3WB2 A;  4JYC A;  3B8M A;  1DF4 A;  3RBZ A;  4O4L B;  1M57 C;  4YY3 B;  4DO2 A;  2Z5U A;  1JR9 A;  4QIW F;  4O4H A;  5KX5 A;  3C3T A;  1FKA O;  1OCZ B;  1SER A;  3OGC C;  4I9W A;  4J7K A;  4B7E A;  1N32 O;  5FPR A;  1OCZ C;  2BE3 A;  3AG4 C;  4Z2W A;  2HHH O;  2PI5 A;  4KP4 A;  2QWQ B;  4WFA V;  4LF9 O;  4LWS A;  2UU9 B;  3APQ A;  5LYJ A;  4C7U A;  4I4T A;  1S5J A;  3JD0 A;  3K0D A;  1QR8 A;  3SYP A;  5B1B B;  1K5Q A;  3OEH G;  1RFY A;  1M56 C;  5BMV B;  1N8R W;  4PEL A;  1NVP B;  2VQF O;  1P4R A;  1J5E O;  5J2T B;  1WAZ A;  4DR2 B;  2GBO A;  1NTK H;  1GN4 A;  1AR1 B;  5BR8 B;  4B3T B;  2WWW A;  1KMI Z;  1M9N A;  4UCS A;  4YJ3 A;  4DUZ O;  3ZN0 A;  2VWJ A;  2P22 C;  2F4V B;  2YUA A;  1OZ0 A;  2Q0O C;  5A2Q N;  1E79 G;  4F6E A;  3OTO O;  2LW1 A;  1SKV A;  5L3E A;  3D8C A;  1M4U A;  2Q67 A;  4RQE A;  4JV5 O;  4JTC B;  1FFT B;  1XMO B;  3MAQ A;  2ZM6 B;  4DV1 O;  1YCI A;  4DW1 A;  2P90 A;  5DM6 V;  2DYR B;  4GX0 A;  3O65 A;  3FB7 C;  1VQO V;  2N04 A;  5B1N A;  1PP9 H;  4ZHQ A;  1K34 A;  2XT9 A;  4IL6 Z;  4LF6 B;  4CS2 A;  1WJZ A;  2PF4 E;  5LA6 B;  1PM9 A;  4G2K A;  4UVA A;  1XOU A;  2R9A A;  2YIC A;  4JI8 O;  3BAB A;  3QG5 A;  1VEW A;  4DR4 B;  3HKD A;  4GZR B;  4YJ2 B;  2P5O A;  4FLV A;  2JIZ G;  4JI6 O;  2E75 B;  4HNA B;  3OE7 G;  3CMA V;  4WCE V;  1BT8 A;  2CTP A;  2EUL A;  1L8D A;  1IBM B;  1XNR O;  1DTO A;  1YVW A;  5CA1 B;  1GK9 A;  3CCJ V;  4OPH A;  2OIG A;  2QKC A;  1M90 W;  4DR1 B;  1HR0 O;  4D7S A;  2FKX A;  1IDS A;  3SPC A;  1OCO B;  5B66 Z;  4X9Q A;  2HEP A;  3D3I A;  4ZI7 B;  1BZK A;  2QWR B;  4PHZ A;  2B1I A;  4DV2 B;  4ASU G;  4B3T O;  3AG3 B;  1NJI W;  5IYZ B;  4DW0 A;  4AI8 A;  1M1K W;  1MA1 A;  4JI4 B;  2HLD G;  2V7Q G;  1AI7 A;  3AG3 C;  3WG7 B;  1PD3 A;  4BWA A;  5K1P A;  4DRX A;  1AI4 A;  1MG1 A;  4YIP A;  3WG7 C;  2D3O W;  1W59 A;  1HNW O;  2UXX A;  2JS3 A;  4L87 A;  2F43 G;  4JF3 A;  4JI2 O;  2RN9 A;  5L3C A;  3T2M A;  2E5L B;  3I55 V;  2JGD B;  5CBF A;  1H38 A;  4JI0 O;  1XMO O;  3T4D A;  3T1H O;  4DR7 O;  2PYJ A;  1GO3 F;  1IXM A;  2AHZ A;  5EC1 C;  1SES A;  1NTM H;  3CCL V;  4PA6 A;  1VQ8 V;  2PUS A;  3AG2 B;  2IU3 A;  1IBL B;  1YTF D;  3CXH F;  3ZHR A;  3OAA G;  4Q6G A;  3AG2 C;  1ZWI C;  4EB6 A;  3SDL A;  4J11 A;  3KG2 A;  1XUQ A;  2BCC H;  4K0K B;  1JMK C;  4UCT A;  4NKG B;  4DK0 A;  4UUJ C;  2ZNJ A;  1K97 A;  4UCO A;  4NYK A;  4DYL A;  4TQF A;  4MT8 A;  1UFI A;  3A2F A;  2XAS A;  3NXS A;  4DK1 A;  1D5N A;  1BCC H;  2RQ6 A;  1N4C A;  1Y66 A;  3RYH A;  2WLL B;  1EN4 A;  1WNS A;  3WU2 Z;  1G6U A;  1WP8 A;  3CJH B;  2EIM B;  1ZLZ A;  3RFR A;  1NU1 H;  2Y4U A;  4DV0 B;  3ZRS A;  5CN0 A;  4PA4 A;  2EIM C;  4DR1 O;  4BR6 A;  2LQT A;  1KP3 A;  4GX1 A;  3ABU A;  3SYO A;  2OT5 A;  4U7O A;  3GVM A;  4RQF A;  3CCQ V;  2KG7 A;  3CX5 F;  4DV2 O;  2ZKO A;  1TGO A;  5LHI A;  2PZS A;  2LGW A;  5IJ9 B;  4JI4 O;  4LC1 A;  3JSL A;  4MVM A;  1NS1 A;  4LFC B;  4LNU A;  2C2A A;  2OIE A;  2W6J G;  2OCC B;  1DGS A;  5AG2 A;  3KZI Z;  1MAB G;  1LNQ A;  5EC2 C;  4DR6 O;  1H8H G;  2OCC C;  5H9C A;  3GWK C;  1Y74 B;  2MW2 B;  2CGN A;  1PPJ H;  1QCE A;  1I7F A;  3LDD A;  3TGU H;  4J42 A;  2JRI A;  2Q0A A;  5FNV B;  5IY5 B;  2NN4 A;  2VWK A;  3K04 A;  3B09 A;  4LF4 B;  4JYA B;  3IAY A;  3FYI B;  5CA0 A;  5IY5 C;  3UT5 B;  1S5H C;  3CC2 V;  1MNG A;  3RYC A;  4FLY A;  3WB1 A;  5DN6 G;  2Q68 A;  3BCC H;  1BHB A;  4X62 O;  1H2G A;  1WB7 A;  4WBN B;  3LSS A;  1NQT A;  4AQY B;  1N36 B;  5CA3 A;  4X65 B;  1MSD A;  2NNU A;  4R50 A;  5KA6 A;  4XDK A;  2QKA A;  2Q7G A;  3K9A A;  2H8P C;  2P7T C;  3CEI A;  1F23 A;  3AK3 A;  1XEQ A;  2JEX A;  1BHA A;  3JAS A;  4DV3 O;  5J2U B;  5JQG B;  4LFB O;  4FM1 A;  1K92 A;  4EEQ A;  3LDC A;  2IU0 A;  4OX9 B;  4MVS A;  3SJA C;  2IJJ A;  2Q73 A;  4BAY A;  3H9V A;  2JJ1 G;  4E4E A;  3R66 A;  3U11 A;  5KX5 B;  4O4H B;  1GRJ A;  3FB5 C;  4QPK A;  3UO3 A;  5LMU O;  3FFQ A;  1XNQ B;  1R6T A;  1FXK C;  1YF2 A;  2FYU H;  1GN6 A;  2ETN A;  4LWS B;  4GKK O;  2GTS A;  2QWN B;  3OMI B;  2M6Y A;  5LYJ B;  5JJJ B;  4I4T B;  2UXN A;  2CUG A;  1K33 A;  1R3J C;  3SR2 C;  4LFC O;  3N27 A;  3ZHS A;  5LP6 C;  2UXD B;  2FTK A;  1FFX A;  2Y4T A;  4GYC B;  1YI2 V;  4NXN B;  4L8J A;  4K8Z A;  1GM7 A;  1KKD A;  2A7W A;  2UUA O;  1JPX A;  1SC5 B;  1MOF A;  1HW7 A;  2QA4 V;  2HJF C;  1ZUQ A;  4LF4 O;  3D3Q A;  1GN2 A;  5L3B A;  4TWK A;  1NH2 D;  2X7R B;  1N0J A;  1COW G;  1IVS A;  5FPO A;  2QEX V;  1K3E A;  2LGQ A;  2NLJ C;  1B06 A;  4H37 A;  1N34 B;  2A3Q A;  3X2Q B;  1HNZ O;  3O9O A;  3FB6 C;  3I56 V;  3ZMU A;  4Z1V A;  3X2Q C;  1SQP H;  4X88 A;  2OCH A;  1A32 A;  1L0L H;  2HVK C;  4MTX A;  2WA4 A;  1N36 O;  3JYC A;  5H6R A;  1EZJ A;  2BTQ A;  1AIL A;  4ZHQ B;  1Q82 W;  4KL1 A;  3W7T A;  1X4T A;  2HP8 A;  1N32 B;  2HHH B;  3K58 A;  5JJN B;  3JAL A;  4MTF A;  1ZAU A;  2EIL C;  4YIO A;  5JH7 B;  1X59 A;  2ITC C;  2IJH A;  3HKD B;  1WLE A;  2VQE O;  3TJT A;  3SPI A;  2AZ0 A;  3ZRX A;  5EYP A;  3CXC U;  2VQF B;  2DYS B;  4GKJ O;  4I50 A;  3B4S A;  1IUR A;  4DUZ B;  4MTG A;  4ZOL A;  4RUF A;  4I0X A;  3T4Z A;  2WPD G;  2M7W A;  4NTW A;  2HR3 A;  5LL6 Y;  1B3Q A;  4JV5 B;  2X6B A;  1HNX O;  3HB3 B;  2RJZ A;  4DV1 B;  1YSC A;  3THO A;  5EZY A;  3CPW U;  4LF5 O;  1N33 O;  3JAR A;  3ASO B;  5FL7 G;  3C3S A;  1LUW A;  3I5D A;  1VQ5 V;  2ZR2 A;  2EJ7 A;  4X20 A;  2YXH A;  4LBE C;  4NTX A;  1NVP D;  1KD1 W;  4MS2 A;  4IGG A;  4J9Y B;  2ZR3 A;  1N34 O;  2HJD A;  2X6C A;  1K73 W;  3JAW A;  4JI8 B;  1VQ9 V;  2Z3Y A;  3ZED A;  4CC5 A;  4MVR A;  1M57 B;  2IH3 C;  4JI6 B;  2WLI A;  3ZMZ A;  3BA8 A;  3GWO A;  3MHH C;  3N2K A;  2ILM A;  1FXK A;  3AG4 B;  1JX9 A;  3S3W A;  4EB6 B;  4D6T H;  4FZ1 A;  1PNM A;  1PNL A;  2ZCE A;  2AGA A;  1XNR B;  1L1F A;  1YJ9 V;  1W2B U;  4HYO A;  5LP6 A;  1AVM A;  4CH5 A;  3SPJ A;  4B3M O;  3B2E E;  4PA9 A;  1M56 B;  4I55 A;  1CP9 A;  1TUB A;  5CBH A;  1AB3 A;  1HR0 B;  5EIB D;  2ZIO A;  1YJW V;  1BQ0 A;  1R6N A;  3CC7 V;  1US6 A;  1SZX A;  2JK5 C;  1NBM G;  3E35 A;  4CBC A;  4E2L A;  5HFL A;  4JI5 O;  3HKE A;  2XTA A;  5GON A;  3RYH B;  1PL0 A;  3PJS K;  5E1A C;  3ETD A;  4DR5 B;  5IT9 N;  4IYH A;  3JAT A;  2Y0P A;  5KHH A;  1OHH G;  5BXZ A;  3G67 A;  1CEZ A;  2KQX A;  2EIK B;  5GTI Z;  1AR4 A;  2EIK C;  1HNW B;  2ZE7 A;  4FK5 C;  2DN9 A;  2XHB A;  4GLX A;  5C8Y B;  3UCS C;  4O4I A;  3L75 H;  4JI2 B;  3QF7 A;  5C93 A;  2KG7 B;  3J7A U;  3T1Y B;  4JI0 B;  4PD4 F;  4BW9 A;  3OT7 A;  3T1H B;  4DR7 B;  4F4L A;  1JOY A;  5KHK A;  4WF9 V;  1WA8 B;  1EN6 A;  1SA0 A;  2UXC O;  1AR5 A;  4LNU B;  3E8F A;  2YXL A;  2ATK C;  3P32 A;  4GX5 A;  3QTC A;  4CS3 A;  3HKB A;  1QLE B;  3ZRW A;  4LH6 A;  4JYB A;  3JD2 A;  1YEW A;  2B9Z A;  1QLE C;  4KHP O;  4FLU A;  4HBN A;  4CH3 A;  2OTJ V;  4JI3 O;  2UUB O;  3DSQ A;  5JWP A;  3QVN A;  4W4K A;  3H1I H;  2QWP B;  5CA0 B;  4JTD B;  2DMX A;  2QM4 A;  2Q4P A;  4PDV A;  4QJF B;  2UUC O;  4X64 O;  4B7K A;  4PA3 A;  1JCH A;  3F7Y C;  3RYC B;  4KUM A;  5BZB A;  3VOU A;  3EFF K;  2PI4 A;  4D7T A;  3SYA A;  1K7D A;  2AXT Z;  3D36 A;  2VS0 A;  4X8A A;  3CC4 V;  3JD4 A;  3JD3 A;  1K8A W;  4YHH B;  1JFF A;  4K3A A;  3KKY A;  4JGS A;  1ZX3 A;  1OCC C;  2GV9 A;  2YIA A;  4DR5 O;  3BFR A;  3JAS B;  3FKS G;  1V54 C;  2DWD C;  2P6J A;  4B3S O;  1F4M A;  1AI5 A;  1DLB A;  2V4D A;  4CH4 A;  4RO2 A;  2WLH A;  3NR7 A;  4XDL A;  4HZ3 A;  3K57 A;  4DR6 B;  5B1A B;  1S77 D;  4TUY A;  4MVO A;  2OWO A;  2QM8 A;  3T1Y O;  5B1A C;  2Y0I A;  3BPZ A;  3EHB B;  4JAA A;  4DV6 B;  4I5S A;  5H5N A;  1JQ0 A;  1SET A;  5KHG A;  2CTQ A;  3ZBH A;  3CP1 A;  4UCR A;  1KP2 A;  4R7C A;  4DV4 O;  1FFX B;  2YIB D;  4H44 B;  3G4S V;  2ZIM A;  2VRZ A;  5E79 Z;  5L3F A;  1S76 D;  1Y67 A;  3H1J H;  3LSQ A;  4A5U B;  5LXT A;  3ABM B;  4Z1M G;  2ODM A;  4UV8 A;  4X62 B;  4JTA B;  2PY5 A;  3ABM C;  5KA5 A;  3GB7 C;  1RM1 B;  4W4L A;  3HKC A;  1AJP A;  3RN4 A;  2Y48 A;  4FMT A;  3FAV A;  1RM1 C;  1FS0 G;  2E74 B;  4GUN A;  1V55 B;  4DV3 B;  4FJC C;  4LFB B;  1DK1 A;  2CGO A;  1V55 C;  2A0L A;  1Y6X A;  2GHY A;  5IYB O;  1ZL8 A;  2KSD A;  3JAM N;  3CE2 A;  2BOB C;  3T1C A;  2BSK A;  3IGA C;  3DTU B;  1KUQ A;  1JVM A;  2V1D A;  2CAZ C;  2BTQ B;  4YHH O;  4DXW A;  1D2D A;  5L3G A;  5LMU B;  2CTW A;  4X1I B;  3ML0 A;  3DC5 A;  4OGQ B;  3JAL B;  1SS3 A;  1JJ2 U;  5A9G A;  3FX7 A;  4GKK B;  3Q4H B;  4NVP A;  2AW9 A;  1WN7 A;  3HPL C;  4BW5 A;  5ITZ A;  3F7V C;  1BSM A;  4OPA A;  5EYP B;  2G38 A;  3OFN G;  3P30 A;  4X1Y A;  3BVO A;  5EBW C;  4PDL A;  2EIJ C;  1AP6 A;  2UUA B;  4EKW A;  3FYE B;  2IM9 A;  1UPG A;  4ZBM A;  1WPX A;  3E86 A;  4DV6 O;  1R3L C;  2CH7 A;  3AK2 A;  3BEH A;  1Z2G A;  3SYC A;  4UVB A;  4ZOL B;  3W7W A;  4I0X B;  2O57 A;  4FIP C;  1NKD A;  3J80 N;  2EZO A;  1B6Q A;  1VF5 B;  2ZIN A;  4LR3 A;  4JYY A;  1SQQ H;  2WLK A;  4O2B A;  2Q5Z A;  4QPJ A;  5KMG A;  4QNH B;  2N05 A;  4FLX A;  4LCU C;  4CH6 A;  4YJ2 A;  1HNZ B;  5EZY B;  2ZD9 A;  1XL4 A;  1E1R G;  3JAR B;  1I94 O;  2AZ2 A;  3S3X A;  2QSA A;  4H33 A;  3CD6 V;  4MW3 A;  1XHX A;  1NTZ H;  4B3R O;  4X20 B;  1SQV H;  1ARO P;  4TSF G;  1GH6 A;  2ZE8 A;  3CCE V;  2QGN A;  1VAR A;  2CK3 G;  3TET A;  4NB5 A;  3RVY A;  4U7N A;  1K4C C;  3JAW B;  1YHQ V;  3QO5 A;  1VP7 A;  1CXZ B;  1TVK A;  4DR3 B;  4LFA B;  2VQE B;  1I0H A;  4WFH A;  3EXA A;  1QLN A;  4IYI A;  4DUY O;  1AJN A;  2WLI B;  1KQS U;  1JA8 A;  5J9P C;  3N2K B;  1SQB H;  3OUS A;  1FXK B;  3A0R A;  2Q8V A;  1I5X A;  2CDY A;  4GKJ B;  4DV5 O;  4IT5 A;  5TIS Z;  1R1B A;  5LP6 B;  3STL C;  3TXQ A;  4UCU A;  2ITD C;  3SJC C;  1NI8 A;  1TUB B;  3STZ C;  1SF9 A;  4UFZ A;  2QM7 A;  4NR1 A;  3JAK A;  1IZ3 A;  4UB6 Z;  4IIJ A;  2JGD A;  1WPB A;  3W7S A;  3BY6 A;  3E83 A;  1QBZ A;  1HNX B;  2DWE C;  1Q7Y W;  3HKE B;  3K0G A;  5GON B;  4WFE A;  4G28 B;  5D5P A;  3L72 H;  1TAE A;  3JAT B;  4LF5 B;  4YJ3 B;  1N33 B;  3BHP A;  4QE9 A;  4LH7 A;  4J9Z B;  1KBH A;  1IX9 A;  1N0N A;  1YDX A;  2E3C A;  4CZZ A;  4PI2 A;  3OGI B;  4BIU A;  3E22 A;  2HKO A;  4LF7 O;  3A0H Z;  2D2C B;  3M7M X;  2Q69 A;  4O4I B;  2P67 A;  5JJE B;  5JVD A;  3LNM B;  3R65 A;  4KXR A;  5KLV H;  2E76 B;  1V9P A;  3LUT B;  3TXS A;  2WLJ A;  2K1E A;  4X66 O;  3UO2 A;  1SA0 B;  4U3J A;  2RMK B;  2Y69 C;  1O9H A;  3AK1 A;  3ABK C;  1GMG A;  1M5I A;  3WFV A;  2HVJ C;  5KHJ A;  3BA9 A;  3CJH A;  4NXM O;  2JVD A;  4J80 A;  3HKB B;  3K79 A;  2EIL B;  3ZRW B;  1FXH A;  1P84 F;  1YJN V;  1DF5 A;  4PDM A;  2QTS A;  5F2V O;  3H1H H;  4B3M B;  2FL4 A;  1EN5 A;  4DR3 O;  4LFA O;  1XIL A;  4F6R A;  3ZS8 C;  2B1G A;  3E8H A;  4P30 A;  4JI5 B;  4TV9 A;  1KKC A;  1S5L Z;  3OMN B;  2L35 A;  5KAI Z;  2NR5 A;  5IJ9 A;  3JCZ A;  3CB2 A;  2IH1 C;  4U3F H;  4MW8 A;  2ZDI A;  1QNM A;  4RWU A;  4H13 B;  2XND G;  3FB8 C;  5IWA O;  3M8A A;  4AIL C;  3VBB A;  4JI7 B;  1BL8 A;  1JFF B;  1QVF U;  3CRR A;  2GDS A;  3D36 C;  5IDJ A;  3G80 A;  1GAX A;  1MMM A;  3QO7 A;  4X1K A;  4FLW A;  1W0J G;  4I9Q A;  4AHC A;  3F5W C;  3TK1 A;  4UCV A;  3CS5 A;  1Y76 A;  2UXC B;  4DRX B;  3BRC A;  1KEC A;  2EX3 A;  3K5L A;  1OJH A;  2ZQM A;  4B08 A;  5CB4 A;  3LSU A;  3N2G A;  1F51 A;  3L74 H;  1H2N A;  1XRE A;  2RNB A;  4TUY B;  2LP7 A;  1IBK B;  5LMN O;  3ETQ A;  1PV0 A;  5EBL C;  1Z5V A;  2PYL A;  3KCY A;  4JAV A;  4KHP B;  1B04 A;  1MZE A;  4IHJ A;  4JI3 B;  2UUB B;  3RW0 A;  4FFB A;  2LJ2 A;  3RWR D;  2A9H A;  2EBO A;  1D5A A;  1VQ6 V;  1VQN V;  1Q6U A;  2UUC B;  1XMQ O;  2XAQ A;  4X64 B;  1O9G A;  2XOK G;  5FLX N;  3JSN A;  5LGU A;  5EBM C;  2JGU A;  3G6E V;  1AJQ A;  2F23 A;  4K35 A;  5LXT B;  4JI1 O;  2JDI G;  3ZMS A;  5L3D A;  1KU9 A;  1BMF G;  1ZSP A;  1KB9 F;  4FZ0 A;  3C90 A;  2WAM A;  3G6B A;  2F66 C;  3HKC B;  4GCZ A;  1YXB A;  3E8B A;  2EJR A;  3FAV B;  1YIJ V;  2W0F C;  2XAF A;  1QHT A;  2Z0A A;  4ZKI A;  1SQG A;  5B5E Z;  3RYI A;  4EFB A;  3P3N A;  1SZT A;  4B3S B;  4FLT A;  1IXB A;  1RPO A;  4ZIB A;  3CRM A;  3RT3 C;  1ZL8 B;  2WLM A;  5B1B C;  1R3K C;  2BSK B;  2CTR A;  3RYF A;  1Q8I A;  3CRA A;  4N21 A;  1Q6I A;  4XDJ A;  4JI7 O;  3K9S A;  2W0X A;  2QE7 G;  2ZE6 A;  2X0L A;  1EBO A;  3IC9 A;  2L6L A;  2GUZ A;  5LHG A;  4WFF A;  2KKW A;  1GM9 A;  1NR1 A;  3OW2 U;  2UXB O;  3H1L H;  5ITZ B;  1Q5O A;  2ZT9 B;  4DV4 B;  4JAS A;  5IJ0 A;  2QWO B;  4X1Y B;  2DW4 A;  3DXR A;  1VQ7 V;  3E8G A;  1URF A;  1G8M A;  1IBK O;  1RSO A;  1AI6 A;  4O2A A;  4QE7 A;  2GSM B;  2PGG A;  2QR4 A;  2AHY A;  3KCX A;  2Q7E A;  2CH7 B;  1RP3 B;  1VQM V;  4LF8 O;  2DYR C;  5EIB C;  4WFB V;  1VQL V;  2YEV A;  4JZG A;  1FJG O;  2W6I G;  2WA3 A;  4DV7 O;  3SYQ A;  5LHH A;  2JEU A;  1I5Y A;  1XBL A;  1FXV A;  2Q7H A;  2WSS G;  4O2B B;  3VQX A;  2LW7 A;  3K5O A;  1QQC A;  5JH7 A;  5KMG B;  4GT1 A;  2R70 A;  4X89 A;  2FML A;  2YDE A;  3VQW A;  1AP5 A;  3F5T A;  4P9P A;  3L73 H;  3UQ8 A;  1MZF A;  5KUK A;  1XI1 A;  3CCR V;  4YY3 O;  3AG7 A;  3VQY A;  4FPP A;  2YI8 A;  3L70 H;  1SRY A;  1OCC B;  2DQ0 A;  4PDR A;  2IJK A;  5LBQ A;  2IJI A;  4P9O A;  1V54 B;  2UU9 O;  4UB8 Z;  3UM7 A;  4O4J A;  2DJV A;  4OXS A;  2IBZ H;  5H2F Z;  4PJ0 Z;  2ADP A;  1TVK B;  5B3S B;  2K9P A;  5CMU A;  5IE9 A;  4HAM A;  3H1K H;  5B3S C;  1OCO C;  4DR2 O;  4QGP A;  3MD0 A;  1QU7 A;  1ORQ C;  5BR8 O;  1S0V A;  1VF6 A;  3OM3 B;  3UKM A;  3ZMT A;  1Y4M A;  1PNK A;  5D5Q A;  1TA8 A;  3W7U A;  2F4V O;  1YIT V;  4I7Z B;  3OTF A;  2N74 A;  1ZTE A;  1NZ6 A;  5H6Q A;  4N23 A;  3JAK B;  5LGN A;  2KB1 A;  4IIJ B;  2ZM6 O;  4FM0 A;  3CCV V;  1NR7 A;  3K08 A;  4TV8 A;  5LOV A;  5JCO C;  1S72 V;  1WP7 A;  1F4N A;  1U97 A;  1GM8 A;  1I94 B;  4O4L A;  1S3J A;  1P7B A;  1I08 A;  2R9R B;  2XAH A;  3SPH A;  4LF6 O;  3AG1 B;  1K5S A;  2YID A;  2JS5 A;  3E22 B;  3AG1 C;  4B3R B;  4JPR A;  2QTO A;  3B40 A;  2A79 B;  3DC6 A;  3VQV A;  3CRC A;  3EVK A;  5JVD B;  5KAF Z;  1NT2 B; 
#chains in the Genus database with same CATH homology
 4PJ0 Z;  5GTH Z;  2AXT Z;  4IL6 Z;  1S5L Z;  5TIS Z;  5KAI Z;  5B66 Z;  3JCU Z;  3KZI Z;  5B5E Z;  5E79 Z;  3A0B Z;  4UB6 Z;  4UB8 Z;  3WU2 Z;  3A0H Z;  5GTI Z;  5KAF Z;  5H2F Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...