3A0HZ

Crystal structure of i-substituted photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 18
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0hZ00
4PJ0Z 4UB6Z 5GTIZ 5GTHZ 5H2FZ 5TISZ 3WU2Z 5KAFZ 3KZIZ 3A0BZ 3JCUZ 4UB8Z 5E79Z 5KAIZ 2AXTZ 1S5LZ 3A0HZ 5B66Z 4IL6Z 5B5EZ
chains in the Genus database with same CATH superfamily
1XNQB 1UFIA 3ZMTA 1QNMA 1R1BA 3R66A 1HNZO 4FLZA 5B5EZ 2LO1A 2QWOB 2ZD9A 1OV9A 3EHBB 4LF6O 2WA4A 1I08A 4J7JA 3JD4A 3JSLA 1DF4A 3H1IH 3ZHSA 2V4DA 3E8GA 5IYZB 3LDCA 2QWRB 4B3SO 4O2BA 4WBNB 3RYHB 4NXNB 3PN1A 4X65O 1M9NA 2OWOA 3N2KA 1AI7A 2UXBB 4K8XA 1XREA 3STLC 4DV3O 5HFMA 2WLIA 1D5NA 2F4VO 2YS8A 4TWKA 4I5SA 1FJGO 1PL4A 2XASA 2UXNA 1FFTB 3K3WA 4BIOA 3VQXA 1WB7A 4MVUA 3AG4C 3ZHTA 2KG7B 1OHHG 4LF5O 4GT1A 1M56C 4UV8A 1WN7A 1K8AW 4JV5B 2ZQMA 2UU9O 1SETA 1LUWA 1I5YA 4I0XB 3ZHVA 2ZM6B 4K0KB 3D8CA 4WBNA 1VQOV 1NZ6A 1EN5A 3LNMB 1YITV 1OCOB 3N2GA 1IBKO 4DR1B 4H33A 3CRMA 2RDCA 2GUZA 3VQWA 1FXVA 2P6JA 4RWUA 2QKCA 2YDEA 3B8MA 3UO3A 1YDXA 4DUYO 4DV1B 5LHIA 2KSDA 5JQGB 1AR5A 5LHGA 4NTYA 4UV9A 5KHHA 5ITZB 1XMOB 4ZIBA 1N33B 5LA6B 1XUQA 1OZ0A 1M5IA 4R7CA 1D2DA 2MK3A 1XHXA 3AK1A 3LSSA 1IZ3A 2EULA 1RFYA 2IJJA 4DV1O 4J10A 5D5QA 2QM4A 1OCRC 3IAYA 1Z5WA 3MDSA 3OT7A 1LNQA 1Y74A 2BTQA 2LGQA 3T1YO 5LXTA 4I50A 1IBKB 4JI3B 1SZTA 2IBZH 1M57C 4IHJA 1YXBA 3IC9A 4X62B 1ZX3A 1XILA 2UXCO 1VIBA 2ZXWB 4WFAV 1VQ6V 2X6AA 4CC5A 2WLKA 4DR2B 3JAWB 1N32O 4O4LA 3CC4V 1SF9A 1PPJH 4LFCB 1OCRB 3ABKC 1F4MA 1HWYA 3H1LH 5K1XA 1K5SA 3LSQA 5CBHA 5BMVA 2EIKB 5JJNB 3I56V 2XNDG 2YSUB 1I94B 3B77A 3D3IA 1B06A 3OMNB 3QTCA 3JALA 4LR3A 1GKFA 2ZXWC 5GTIZ 2H8PC 5KHJA 3OTFA 3SGIA 5B66Z 1EZJA 2Y0IA 3D36A 4FLUA 5EK0A 4B7KA 3TETA 4FMTA 2EILB 4MTFA 5CA1A 2BCCH 3N2GB 2P4KA 4BW9A 2W6JG 4LF5B 4DV2O 4O2AA 1XDCA 4ZKIA 1Y76A 1DLBA 1SQXH 4DUZB 4CH4A 3S3WA 1AILA 1LUVA 5JVDB 4J9YB 4X20B 4DRXB 3ZRWB 2X7RB 4DR4O 3K5LA 1HDJA 2A0LA 1W0JG 5KHKA 4O4JA 3JALB 2W6IG 5LGNA 3KCYA 2P4VA 4XDKA 1M90W 1Q5OA 4MS2A 4G28B 4Q20A 4EFBA 3CXCU 1JVMA 2WLIB 4LFBO 1BQ0A 3ZHRA 3VQVA 1K92A 3G6EV 1XL6A 1WB8A 1JMKC 2MW2B 3B40A 2AW9A 4TV8A 2YI8A 5KMGA 4O4JB 1AJPA 1SS3A 5IYCO 5LHHA 1VMGA 2CTWA 5CN0A 3HKCA 4X8AA 1N0NA 4GYCB 2P7TC 1TGOA 1SC5B 4YJ2B 1N33O 3SJBC 4JI6B 4GX2A 2RN9A 5L3GA 5H6RA 4B3TB 2EZPA 3VOUA 1AI6A 1QCEA 2DWEC 4PJ0Z 1JPXA 2Q8VA 1WNSA 3CC2V 5LMNB 2VWKA 3LNNA 1S77D 4X88A 2BTQB 4JYBA 3I5DA 2QA4V 4JI8B 4FVMA 4DR1O 4UVCA 4JAUA 3ZX6A 4FFBA 2WLHA 3T4ZA 3E22A 5LBQA 4MVOA 4JI5B 4R50A 1KYOF 1FAFA 1K4DC 3TJTA 3D3QA 2R70A 4I55B 4JYCA 3U11A 3BABA 5L3FA 1YEWA 3JASB 3RYCB 4JI0O 1NVPD 2PI5A 2DJVA 3RT3C 1GTOA 3E83A 1XNQO 1FPOA 2AHYA 1K4CC 2EIJC 1FJGB 4NB5A 3E8BA 1JQ0A 4J7ZA 5IJ0A 1N34O 5EZYB 5LMUB 3W7TA 2A9HA 2ETNA 3OR6C 3OTOB 4I55A 4IYIA 4G27B 3EXAA 1Q86W 2G38A 1PP9H 2O57A 4X9QA 1AR4A 3SJCC 4LBEC 4DRXA 4WCEV 4QNHB 5CA0B 4O4HA 4TUYB 3FFQA 2HEPA 2CH7A 3SPHA 1K97A 4JI4O 4JI7O 1IX9A 2PYLA 1UJWB 4I0XA 1AROP 4X1YA 4JPRA 3RYIB 1MSWD 2YIDA 1Y76B 3K0GA 2N74A 1L0LH 1V55B 3G71V 1PNMA 2DWDC 4RUEA 1CXZB 5EC1C 4WFFA 4QJFB 4YY3O 4TUYA 2OIGA 2QTSA 2QKSA 5B1AB 2DQ0A 4ICGA 1GN6A 3OUSA 5B1BC 3KG2A 4UVAA 3B2EE 1H2SB 3AG1C 2NNUA 4TSFG 4AILC 1KC8W 2ZIMA 1R6NA 3E2EA 3G6BA 5KUKA 2K1EA 4WFBV 4FM2A 4DR5B 4MTGA 4BIZA 2E75B 2Q4PA 2QM8A 1VQ4V 4PD4F 4QPKA 4F6RB 2UUBB 3PJSK 3K9SA 3OTOO 1E1RG 5EYPB 4L87A 5B1BB 3GVMA 5CA3A 1BGYH 2UXDB 1NVPB 1GH6A 1AJNA 4Z2WA 3E8FA 5JQGA 4KHPO 4JZ2A 4UFZA 2W0FC 4B3RB 4JI6O 5F2VO 2Q0AA 1IVSA 1BHBA 2YI9A 3P32A 3CRQA 2OTJV 3X2QC 3LSUA 4PA4A 4DR3O 3ASOB 3L74H 3ZJZA 3FKSG 3OR7C 4JI5O 4PA7A 2IJIA 2KKWA 4WF9V 2PF4E 5C8YB 5C93A 2Q67A 3MHSC 2F66C 1Y6XA 2JK5C 2CTQA 4E2LA 1S72V 3JAKA 2UUAB 2JEUA 5LMUO 3IC7A 3JAKB 3GB7C 3ETGA 4B3TO 5FNVB 2ZE6A 4UB8Z 1NQTA 5JVDA 2FMLA 4I7ZB 2HKOA 4LF4B 4R8CA 4O2AB 5H5NA 2GTSA 3T1HB 1BQZA 1Z5VA 1LR1A 1Q90D 2CH7B 3LUTB 2F43G 2OIEA 4ZI7B 3CP1A 4QGPA 2E5LB 5IT9N 1MABG 2CE4A 1QLEB 5BR8B 3ZRVA 1GM9A 3CPWU 1SERA 1NBMG 1HW7A 1K33A 3RBZA 2Q0OC 3BEHA 5LGTA 3RYFB 4LWSA 1SZXA 2Q68A 4DR7O 1CEZA 1VQNV 3AK2A 4LF9O 2KQXA 2PGGA 3CMEV 3CYOA 3JATA 4NTWA 3C90A 3MD0A 4H44B 5CA0A 2WLMA 5LGUA 2Y69C 4YHHO 1ZL8B 4RQFA 3ETQA 4LF9B 3K08A 4FM1A 2P06A 3D36C 2WLNA 5JJJB 3OUFA 3WB0A 2YUAA 3JARA 2M7WA 3RGBA 1EN6A 2UUBO 3J7AU 2PI4A 2WLJA 4XBFA 5GTHZ 3G67A 5B1NA 4PDRA 2KG7A 3ABLC 1HR0O 4FFBB 4DV5B 3B09A 1H8EG 5J2UB 3CCRV 4TV8B 1FKAO 1WAZA 4FIPC 1TA8A 1BT8A 2IH1C 3K58A 4DK1A 2YICA 3DGEA 4P30A 1VQKV 4Q6GA 4B3MO 1GM7A 3TK1A 2YXYA 4J80A 2PY5A 2LFRA 1NU1H 1F23A 1VF5B 3QF7A 4B3MB 3H1HH 1SQPH 1BHAA 1US6A 4D7TA 4DR2O 4CBCA 1O9GA 4O4IA 1AR1B 1MNGA 1F51A 1YVWA 2QM7A 4HNAB 1KBHA 3K06A 5L3BA 3H01A 5IYBO 4J7KA 4UB6Z 1AVMA 4HBNA 2WWWA 4A5UB 1AB3A 1B6QA 4FPPA 2R72A 4JI7B 2CK3G 3H1KH 4J9ZB 1FFXB 1ZAUA 2N04A 3AG3B 3BA9A 1VQ8V 3CCSV 1SESA 4ASUG 4O4LB 3ZMSA 4XDLA 3BHPA 5LOVB 5CB4B 4UCSA 4U3JA 3HB3B 3CS5A 4OPAA 5EIBC 4TV9A 3VQYA 1N34B 2HG5C 3OE7G 5GW7A 4DV7O 3M8AA 1QHTA 1P7BA 1BSMA 4OPHA 2LFSA 4HYOA 1V54B 3Q4HB 2A7WA 3DC5A 2IU0A 1DGSA 2EJRA 3FYEB 3ZBHA 4DW0A 1ZSPA 2E5LO 1CP9A 3JD1A 1Q43A 5H6QA 4W4KA 2X6CA 5LYJA 2HP8A 3HKBA 1VQLV 4LWSB 1W0KG 3K57A 4J42A 1F7YA 2VWJA 5BY1A 1EFRG 4I50B 4PELA 3SYOA 4MW8A 1HP8A 1SRYA 2RCVA 5KA6A 3GWKC 1XI1A 1KD1W 1KU9A 4MVSA 2VQFO 1NTZH 5IE9A 1BE3H 1GK9A 3SJQC 4ZI7A 2JDIG 1K3EA 2DYRB 3WFVA 4PV1B 3HKEB 1N8RW 2GHYA 1K9MW 2ATKC 1RPRA 2ZKOA 5EBLC 3TGUH 1Q6UA 2ZNIA 2GSMB 3JCZA 2YEVA 2ZNJA 1H38A 2FB5A 3AG2B 4LH7A 4QPJA 1Z2GA 2FL4A 2H94A 3RYFA 1AJQA 3VBBA 3UCSC 1GMGA 3WG7C 4JI4B 4IGGA 1JR9A 1NT2B 3QO8A 1BS3A 1SQFA 3CXHF 2NLJC 3GWOA 3C3SA 3G80A 2WPDG 2ODMA 4YHHB 3X2QB 4CZZA 1VEWA 5KA5A 2DN9A 3RN4A 5LP6C 4YJ2A 4WFHA 1ZWIC 1OCOC 3A0RA 4NVPA 2W0XA 2A3QA 3ZMZA 1AP6A 2UXBO 4WFEA 2EIMC 4JGSA 3SYCA 2ZR2A 1SA0B 3OMIB 4UCTA 4U7NA 3WG7B 5JCOA 5CB4A 4NKGB 1JOYA 4EB6A 5BR8O 3CJHB 2BSKA 4LC1A 1T5EA 1RSOA 2R9IA 3SYPA 1VP7A 1NI8A 1R6KA 2Z0AA 4CS3A 3OW2U 4PDVA 2LW7A 3F7YC 1FXHA 4NR1A 3CCUV 3I55V 2Z3YA 4LF4O 1G4YB 4JI8O 5FLXN 1SQVH 3IJ4A 1S5LZ 4NXMO 3QNEA 1OCCB 2HVJC 1GRJA 1J5EB 1R3KC 4DV7B 3AK3A 2ZT9B 4DXWA 4EKWA 1CPYA 3F7VC 4QIWF 5B1OA 4PA6A 1QLEC 2VQFB 1R6TA 3SYQA 1THZA 4GX5A 3SPJA 2BE3A 5IJ9B 2YIBA 3OGIB 5J2UA 2OT5A 1HNXB 5CA1B 1QQCA 3ML0A 3P3NA 2Q5ZA 4U3JB 2GTAA 1WJZA 3WB2A 1YSCA 2Z5UA 4CH3A 2ZE8A 3OD4A 1YHQV 4U3FH 1VF7A 3IGAC 4P2ZA 1HNWO 1H2MA 2LQTA 1NH2B 4G2KA 2P67A 3T1CA 1EZVH 4U7OA 1YTFB 4DV6O 5GONB 3RVYA 4LNUB 2ITCC 4MTOA 4K3AA 3UQ8A 3HPLC 1QLNA 2L6LA 1Y66A 3ZRSA 4EB6B 3DTUB 3E86A 5L3CA 1JJ2U 3HKEA 3ZN0A 3JATB 2F93B 4N23A 1VQMV 2GDSA 4P9PA 2HVKC 5FPOA 3SPGA 5LL6Y 1R3IC 5AG2A 4OXSA 3CC7V 1JFFA 2FYUH 4MW3A 4XDJA 2WAMA 5C8YA 2CDYA 4I9WA 4GX1A 4JV5O 4PA9A 4AQYO 5L3DA 1V9PA 3ABKB 2N05A 4YY3B 1S76D 1JX9A 1VARA 2YEVB 1OCZC 3BY6A 4DR6O 2XAFA 5TISZ 2ZCEA 3E8HA 1PV0A 3SYAA 1SA0A 4JI1B 4PDMA 3B8NA 1L0NH 3RFRA 1K73W 2YIAA 4HZ3A 1WA8A 4CS4A 5B3SB 2JGDA 4UCVA 1Q82W 1IBLB 3K9AA 3JCUZ 1I0HA 4ZOLA 2JS5A 3WU2Z 1HR0B 2B1GA 1JJOA 4B3SB 4J41A 1URFA 2EILC 3DC6A 5FL7G 2BTOA 1FYJA 3K03A 4OX9B 3L72H 3L9DA 2ZE7A 4K35A 1RP3B 2RMKB 3RYHA 2NN4A 2AXTZ 4GCZA 1E79G 1XNRO 2Q7GA 2HJDA 1NTKH 4CS2A 3ASNC 2M6YA 1V54C 1SQGA 4DO2A 1KUQA 1M4UA 4GKJB 5E79Z 5KUMA 3LDEA 4C7UA 5B3SC 4RQEA 4JYAO 4FZ1A 4DV4O 4J11A 2Q73A 3JD0A 1TUBB 1X4TA 4DV2B 3EFFK 5IYZA 3CRAA 4FM0A 2A79B 5DEDA 4DR7B 4X64O 3W7WA 2EIJB 3HKCB 4CH6A 2Y4TA 5KX5B 2CTRA 3WB1A 5K1PA 4YXWG 2UUCO 4JYYA 3FYIB 1S5JA 2UUCB 1M93A 3ZMVA 3JARB 5KHIA 3OFNG 1TUBA 1IBMO 1Q81W 4BW5A 3BAAA 1XEQA 3TCUA 4DYLA 3JAMN 3M7MX 4ZHQA 2JJ2G 5KHGA 2JGUA 1MZFA 4JI1O 1MG1A 4FK5C 4KP4A 3THOA 1I7FA 1H8HG 2A06H 4DR6B 2DYSB 1NJIW 1KB9F 3SDLA 1IXBA 4JAAA 4GKKB 2F4VB 1H2GA 1VF6C 2E74B 3J81N 5J2TB 1FFXA 3ETDA 3IFXA 2JEXA 1NH2D 4ABMA 5HFLA 1WP8A 2IW5A 2HHHB 5IDJA 3DSQA 2UXCB 5LP6A 4X62O 1NS1A 4O2BB 5LP6B 2YXHA 5H2FZ 2IJHA 1RSOB 1QR9A 1PKXA 1VQ7V 2EJ7A 4GZRB 1DTOA 3AG1B 1N36O 5CBGA 5BZBA 4UVBA 5JWPA 2YIBD 1PNKA 1K5QA 3T1HO 3RYCA 3UO2A 1G8MA 2DYSC 1EN4A 4DR4B 5IJ9A 3O65A 3AG7A 5IWAO 1EM1A 1A32A 4MT8A 1RM1C 4N21A 2R9RB 1QBZA 4R6ZA 4CH5A 4GKJO 4O4IB 4L8JA 4FLXA 2P22C 2VQEO 2LP7A 5IJ0B 4RAIA 1M1KW 1KQSU 1D5AA 2QWNB 4BWAA 2HFEC 4MVZA 1OCCC 1N0JA 3L75H 3SPCA 1P4RA 3ZS8C 3CCLV 3K04A 2XAJA 3STZC 3ZEDA 1NKDA 4K0KO 2FTKA 5LYJB 1P49A 4LF8B 2RJZA 4PDLA 5EZYA 3ABMB 1I5XA 1RM1B 4P9OA 1PL0A 1S3JA 2XAQA 2UU9B 5DM6V 5IY5C 2JGDB 3ASOC 4EFEA 3S3XA 2V7QG 2UXXA 5FPRA 4PI0A 3QG5A 1WP7A 4FZ0A 5CMUA 3FAVB 2X0LA 1QR8A 5DECA 2PYJA 3BFRA 2CUGA 4X1KB 5LA6A 2JRIA 2HR3A 3AEIA 1M57B 1KP3A 4F6RA 1R73A 1JFFB 3CX5F 4ZBMA 4K8ZA 4MVQA 1Q3EA 4JI0B 4FLVA 1SQBH 3C3TA 3ABMC 2QR4A 5IY5B 2CTPA 5BXZA 3JAWA 2F1MA 4TQDA 2WSSG 2DMXA 2ARHA 4JTDB 4D6TH 2FKXA 1E1QG 2QE7G 3CE2A 2Y0PA 2CGNA 1NTMH 1COWG 1WPXA 3HKDB 2XT9A 2AZ2A 1HNZB 4I4TB 1FXKC 4JTCB 4DV6B 3ETEA 2EIKC 1R3LC 1TAEA 2ADPA 2Q9LA 2QDOA 1BMFG 2XOKG 4TOIA 3DXRB 4LFAB 2QEXV 2F95B 2DW4A 3DXRA 2ZDIA 1EBOA 2XTAA 2QTOA 1Y67A 4NXMB 1Q7YW 1S5HC 4RUFA 5KAIZ 1XOUA 2BSKB 5J9PC 2DOSA 5A9GA 3U0ZA 3G4SV 3ZRXA 1OCZB 1RPOA 3MAQA 3OM3B 4DV0O 4UUJC 3JD2A 4DR3B 4FJCC 5L3EA 2Q69A 1FXKA 3UT5B 1G1XB 1P84F 2XAHA 1GN4A 1YI2V 1KKCA 4B3RO 1VQ9V 1XMQB 3F5TA 2QWQB 2HHHO 2OCCB 5LMNO 4LFAO 4YIOA 4BR6A 4DV3B 4FLTA 3ABLB 4Z1VA 2UXDO 1W2BU 1TVKB 1WPBA 2JVDA 1XMQO 3FAVA 3CCEV 2ZIOA 4RO2A 3SPIA 3OEEG 2XAGA 1R3JC 1WLEA 2VS0A 2OCHA 1NR1A 4Z1MG 4JTAB 2Q6AA 1QVFU 4ZHQB 2ITDC 1KMIZ 5JH7A 3CCQV 3A8TA 2ZINA 3T2MA 2IJKA 2JJ1G 3EVKA 4X89A 1DK1A 2AGAA 4IYHA 4F6EA 2Y48A 4BAYA 3QO7A 3R65A 3JD3A 2LGWA 1I94O 2CGOA 2QWPB 3CHXA 4E4EA 1ZLZA 2QKAA 4GX0A 1V55C 4FLYA 3CB2A 2ADQB 4JYAB 1YJWV 4UCOA 1AI4A 1IURA 1GN2A 1ZL8A 3FB7C 1K7DA 5B1AC 4W4LA 3FB5C 3RYIA 5EBMC 2HLDG 2B9ZA 2ZE5A 3APOA 2R9AA 3A0BZ 2RNBA 4LF8O 5E1AC 1KECA 4YJ3B 4JI2B 1GAXA 3TXQA 1GN3A 3CSXA 4X66O 4PI2A 4UCUA 3K5OA 4JI3O 1VF6A 1ZTEA 3W7SA 3T1YB 1QVGU 2AZ0A 1DF5A 5EC2C 4JI2O 3FB8C 3ZCCA 3E22B 2EINC 1ORQC 4GLXA 3ZIAG 4H37A 4KL1A 4H0LB 2PUSA 1MOFA 1B04A 4IT5A 1KKDA 1SQQH 2PTMA 4O4HB 1XMOO 2YXLA 4IIJB 2OYQA 3OGCC 4LH6A 1UPGA 1FS0G 1VQ5V 4LNUA 1JA8A 1KP2A 2NR5A 3RW0A 4AQYB 3CEIA 3K59A 4DV5O 4X1YB 3CMAV 3NR7A 1N36B 2XUMA 4TV9B 4QE9A 4DW1A 2D2CB 2B1IA 1H2LA 2ILMA 3W7UA 2PZSA 2EINB 3ZHQA 4EEQA 3AG3C 4B7EA 3ZRWA 1VQPV 3JASA 4H13B 4JAVA 4X1IB 3AG2C 3BRCA 3FX7A 1PD3A 4JASA 4MVMA 4GKKO 2C2AA 2XHBA 2BOBC 4DV4B 1AP5A 4LFCO 3NXSA 1U96A 3CWBH 4AI8A 1NR7A 3A2FA 1X59A 1O9HA 3JYCA 2Q7EA 2GUZB 1N32B 3H9VA 4LF7B 2E76B 3BPZA 2K9PA 1L8DA 1J95A 2V1DA 4X65B 1XNRB 1IBMB 5JJEB 1BL8A 1G6UA 3T4DA 2GBOA 1GM8A 4X1KA 3H1JH 1YF2A 4QE7A 2DE0X 1YJ9V 3F5WC 2IH3C 3N2KB 4KXRA 4LFBB 3B4SA 2AHZA 4PA3A 5CBFA 4KFMA 1S0VA 5FNVA 4LF6B 3AG4B 3E35A 5LOVA 4WFGA 1M56B 3KKYA 5EBWC 1YTFD 2F23A 3SJAC 3UM7A 1Q6HA 3CCJV 4FLWA 3Q4HA 2WA3A 4DUZO 2DYRC 1OJHA 4KHPB 3CRCA 5JH7B 3RWRD 4BIUA 1FD9A 3K79A 2Q7HA 3JSNA 1FXKB 2D3OW 2Y69B 1Y74B 3SR2C 2ZR3A 5H9CA 1B3QA 5KX5A 1Q8IA 1YZBA 1U97A 2HJFC 2EZOA 2CAZC 3ZHUA 4UCRA 3W7XA 1XBLA 2ZM6O 3U10A 5IYDO 2L35A 4F4LA 4LP8A 2QGNA 1N4CA 1IBLO 5ITZA 1W59A 5EYPA 5A2QN 3TXSA 3UT5A 2JIZG 2BOCC 3FB6C 3QO5A 3CCVV 1P7GA 3HR0A 3ABTA 2EIMB 4AHCA 3KCXA 3ZMUA 4YIPA 1QU7A 5BMVB 2UUAO 2KB1A 3HKDA 2B5UA 2OTLV 2RQ6A 4OX9O 1Q6IA 3M99B 2OCCC 4CC6A 3CJHA 2H3OA 3J80N 4NTXA 4IL6Z 3OAAG 4DV0B 1YCIA 5KAFZ 5EIBD 3K0DA 2X6BA 2EX3A 3KZIZ 4GUNA 4D7SA 1HNXO 4LF7O 3L70H 2JS3A 4NYKA 5LXTB 3LDDA 1MMMA 4I9QA 4IHJB 4MVRA 4DUYB 2VQEB 1IDSA 4MSWC 2IM9A 2QSAA 5KMGB 1WA8B 4X1IA 3ABUA 1JCHA 4X20A 3L73H 3CRRA 1ENVA 1MA1A 1L1FA 4MTXA 1XQ8A 1K34A 1HNWB 2VRZA 1Y4MA 2QJ1A 5IWAB 1H2NA 2ZDIC 4TQFA 3N27A 2E3CA 2EBOA 4HAMA 5J2TA 3HKBB 4DK0A 1PM9A 1XHZA 3L71H 4YJ3A 4ZOLB 2WLLB 2LW1A 4LCUC 2P5OA 3UKMA 2LJ2A 3K5MA 1BZKA 1IXMA 3MHHC 3P3PA 3A0HZ 1AI5A 5KLVH 1MSDA 4OGQB 1YJNV 4JF3A 1XL4A 1H2KA 1YIJV 3QVNA 1PNLA 5D5PA 1ROPA 4NXNO 1MZEA 4IIJA 3ASNB 4JZGA 1TUEB 2WLLA 5DN6G 4FFKA 4X66B 3OEHG 3RVZA 3BCCH 4DR5O 3BVOA 4I4TA 3O9OA 3E89A 5JCOC 4KUMA 2Y4UA 4TT3G 4B08A 3P30A 3K5NA 1F4NA 1GO3F 2YC0A 1SKVA 3ZN1A 5GONA 4HNAA 3CD6V 4PHZA 3OMAB 4UXNA 4X64B 1BCCH 2DQ3A 3FD9A 3CCMV 2GV9A 3BA8A 1TVKA 3ICXA 2IU3A 3APQA 1ZUQA 1J5EO 2P90A
chains in the Genus database with same CATH topology
4PJ0Z 4UB6Z 5GTIZ 5GTHZ 5H2FZ 5TISZ 3WU2Z 5KAFZ 3KZIZ 3A0BZ 3JCUZ 4UB8Z 5E79Z 5KAIZ 2AXTZ 1S5LZ 3A0HZ 5B66Z 4IL6Z 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 Z;  4UB6 Z;  5GTI Z;  5GTH Z;  5H2F Z;  5TIS Z;  3WU2 Z;  5KAF Z;  3KZI Z;  3A0B Z;  3JCU Z;  4UB8 Z;  5E79 Z;  5KAI Z;  2AXT Z;  1S5L Z;  3A0H Z;  5B66 Z;  4IL6 Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 1XNQ B;  1UFI A;  3ZMT A;  1QNM A;  1R1B A;  3R66 A;  1HNZ O;  4FLZ A;  5B5E Z;  2LO1 A;  2QWO B;  2ZD9 A;  1OV9 A;  3EHB B;  4LF6 O;  2WA4 A;  1I08 A;  4J7J A;  3JD4 A;  3JSL A;  1DF4 A;  3H1I H;  3ZHS A;  2V4D A;  3E8G A;  5IYZ B;  3LDC A;  2QWR B;  4B3S O;  4O2B A;  4WBN B;  3RYH B;  4NXN B;  3PN1 A;  4X65 O;  1M9N A;  2OWO A;  3N2K A;  1AI7 A;  2UXB B;  4K8X A;  1XRE A;  3STL C;  4DV3 O;  5HFM A;  2WLI A;  1D5N A;  2F4V O;  2YS8 A;  4TWK A;  4I5S A;  1FJG O;  1PL4 A;  2XAS A;  2UXN A;  1FFT B;  3K3W A;  4BIO A;  3VQX A;  1WB7 A;  4MVU A;  3AG4 C;  3ZHT A;  2KG7 B;  1OHH G;  4LF5 O;  4GT1 A;  1M56 C;  4UV8 A;  1WN7 A;  1K8A W;  4JV5 B;  2ZQM A;  2UU9 O;  1SET A;  1LUW A;  1I5Y A;  4I0X B;  3ZHV A;  2ZM6 B;  4K0K B;  3D8C A;  4WBN A;  1VQO V;  1NZ6 A;  1EN5 A;  3LNM B;  1YIT V;  1OCO B;  3N2G A;  1IBK O;  4DR1 B;  4H33 A;  3CRM A;  2RDC A;  2GUZ A;  3VQW A;  1FXV A;  2P6J A;  4RWU A;  2QKC A;  2YDE A;  3B8M A;  3UO3 A;  1YDX A;  4DUY O;  4DV1 B;  5LHI A;  2KSD A;  5JQG B;  1AR5 A;  5LHG A;  4NTY A;  4UV9 A;  5KHH A;  5ITZ B;  1XMO B;  4ZIB A;  1N33 B;  5LA6 B;  1XUQ A;  1OZ0 A;  1M5I A;  4R7C A;  1D2D A;  2MK3 A;  1XHX A;  3AK1 A;  3LSS A;  1IZ3 A;  2EUL A;  1RFY A;  2IJJ A;  4DV1 O;  4J10 A;  5D5Q A;  2QM4 A;  1OCR C;  3IAY A;  1Z5W A;  3MDS A;  3OT7 A;  1LNQ A;  1Y74 A;  2BTQ A;  2LGQ A;  3T1Y O;  5LXT A;  4I50 A;  1IBK B;  4JI3 B;  1SZT A;  2IBZ H;  1M57 C;  4IHJ A;  1YXB A;  3IC9 A;  4X62 B;  1ZX3 A;  1XIL A;  2UXC O;  1VIB A;  2ZXW B;  4WFA V;  1VQ6 V;  2X6A A;  4CC5 A;  2WLK A;  4DR2 B;  3JAW B;  1N32 O;  4O4L A;  3CC4 V;  1SF9 A;  1PPJ H;  4LFC B;  1OCR B;  3ABK C;  1F4M A;  1HWY A;  3H1L H;  5K1X A;  1K5S A;  3LSQ A;  5CBH A;  5BMV A;  2EIK B;  5JJN B;  3I56 V;  2XND G;  2YSU B;  1I94 B;  3B77 A;  3D3I A;  1B06 A;  3OMN B;  3QTC A;  3JAL A;  4LR3 A;  1GKF A;  2ZXW C;  5GTI Z;  2H8P C;  5KHJ A;  3OTF A;  3SGI A;  5B66 Z;  1EZJ A;  2Y0I A;  3D36 A;  4FLU A;  5EK0 A;  4B7K A;  3TET A;  4FMT A;  2EIL B;  4MTF A;  5CA1 A;  2BCC H;  3N2G B;  2P4K A;  4BW9 A;  2W6J G;  4LF5 B;  4DV2 O;  4O2A A;  1XDC A;  4ZKI A;  1Y76 A;  1DLB A;  1SQX H;  4DUZ B;  4CH4 A;  3S3W A;  1AIL A;  1LUV A;  5JVD B;  4J9Y B;  4X20 B;  4DRX B;  3ZRW B;  2X7R B;  4DR4 O;  3K5L A;  1HDJ A;  2A0L A;  1W0J G;  5KHK A;  4O4J A;  3JAL B;  2W6I G;  5LGN A;  3KCY A;  2P4V A;  4XDK A;  1M90 W;  1Q5O A;  4MS2 A;  4G28 B;  4Q20 A;  4EFB A;  3CXC U;  1JVM A;  2WLI B;  4LFB O;  1BQ0 A;  3ZHR A;  3VQV A;  1K92 A;  3G6E V;  1XL6 A;  1WB8 A;  1JMK C;  2MW2 B;  3B40 A;  2AW9 A;  4TV8 A;  2YI8 A;  5KMG A;  4O4J B;  1AJP A;  1SS3 A;  5IYC O;  5LHH A;  1VMG A;  2CTW A;  5CN0 A;  3HKC A;  4X8A A;  1N0N A;  4GYC B;  2P7T C;  1TGO A;  1SC5 B;  4YJ2 B;  1N33 O;  3SJB C;  4JI6 B;  4GX2 A;  2RN9 A;  5L3G A;  5H6R A;  4B3T B;  2EZP A;  3VOU A;  1AI6 A;  1QCE A;  2DWE C;  4PJ0 Z;  1JPX A;  2Q8V A;  1WNS A;  3CC2 V;  5LMN B;  2VWK A;  3LNN A;  1S77 D;  4X88 A;  2BTQ B;  4JYB A;  3I5D A;  2QA4 V;  4JI8 B;  4FVM A;  4DR1 O;  4UVC A;  4JAU A;  3ZX6 A;  4FFB A;  2WLH A;  3T4Z A;  3E22 A;  5LBQ A;  4MVO A;  4JI5 B;  4R50 A;  1KYO F;  1FAF A;  1K4D C;  3TJT A;  3D3Q A;  2R70 A;  4I55 B;  4JYC A;  3U11 A;  3BAB A;  5L3F A;  1YEW A;  3JAS B;  3RYC B;  4JI0 O;  1NVP D;  2PI5 A;  2DJV A;  3RT3 C;  1GTO A;  3E83 A;  1XNQ O;  1FPO A;  2AHY A;  1K4C C;  2EIJ C;  1FJG B;  4NB5 A;  3E8B A;  1JQ0 A;  4J7Z A;  5IJ0 A;  1N34 O;  5EZY B;  5LMU B;  3W7T A;  2A9H A;  2ETN A;  3OR6 C;  3OTO B;  4I55 A;  4IYI A;  4G27 B;  3EXA A;  1Q86 W;  2G38 A;  1PP9 H;  2O57 A;  4X9Q A;  1AR4 A;  3SJC C;  4LBE C;  4DRX A;  4WCE V;  4QNH B;  5CA0 B;  4O4H A;  4TUY B;  3FFQ A;  2HEP A;  2CH7 A;  3SPH A;  1K97 A;  4JI4 O;  4JI7 O;  1IX9 A;  2PYL A;  1UJW B;  4I0X A;  1ARO P;  4X1Y A;  4JPR A;  3RYI B;  1MSW D;  2YID A;  1Y76 B;  3K0G A;  2N74 A;  1L0L H;  1V55 B;  3G71 V;  1PNM A;  2DWD C;  4RUE A;  1CXZ B;  5EC1 C;  4WFF A;  4QJF B;  4YY3 O;  4TUY A;  2OIG A;  2QTS A;  2QKS A;  5B1A B;  2DQ0 A;  4ICG A;  1GN6 A;  3OUS A;  5B1B C;  3KG2 A;  4UVA A;  3B2E E;  1H2S B;  3AG1 C;  2NNU A;  4TSF G;  4AIL C;  1KC8 W;  2ZIM A;  1R6N A;  3E2E A;  3G6B A;  5KUK A;  2K1E A;  4WFB V;  4FM2 A;  4DR5 B;  4MTG A;  4BIZ A;  2E75 B;  2Q4P A;  2QM8 A;  1VQ4 V;  4PD4 F;  4QPK A;  4F6R B;  2UUB B;  3PJS K;  3K9S A;  3OTO O;  1E1R G;  5EYP B;  4L87 A;  5B1B B;  3GVM A;  5CA3 A;  1BGY H;  2UXD B;  1NVP B;  1GH6 A;  1AJN A;  4Z2W A;  3E8F A;  5JQG A;  4KHP O;  4JZ2 A;  4UFZ A;  2W0F C;  4B3R B;  4JI6 O;  5F2V O;  2Q0A A;  1IVS A;  1BHB A;  2YI9 A;  3P32 A;  3CRQ A;  2OTJ V;  3X2Q C;  3LSU A;  4PA4 A;  4DR3 O;  3ASO B;  3L74 H;  3ZJZ A;  3FKS G;  3OR7 C;  4JI5 O;  4PA7 A;  2IJI A;  2KKW A;  4WF9 V;  2PF4 E;  5C8Y B;  5C93 A;  2Q67 A;  3MHS C;  2F66 C;  1Y6X A;  2JK5 C;  2CTQ A;  4E2L A;  1S72 V;  3JAK A;  2UUA B;  2JEU A;  5LMU O;  3IC7 A;  3JAK B;  3GB7 C;  3ETG A;  4B3T O;  5FNV B;  2ZE6 A;  4UB8 Z;  1NQT A;  5JVD A;  2FML A;  4I7Z B;  2HKO A;  4LF4 B;  4R8C A;  4O2A B;  5H5N A;  2GTS A;  3T1H B;  1BQZ A;  1Z5V A;  1LR1 A;  1Q90 D;  2CH7 B;  3LUT B;  2F43 G;  2OIE A;  4ZI7 B;  3CP1 A;  4QGP A;  2E5L B;  5IT9 N;  1MAB G;  2CE4 A;  1QLE B;  5BR8 B;  3ZRV A;  1GM9 A;  3CPW U;  1SER A;  1NBM G;  1HW7 A;  1K33 A;  3RBZ A;  2Q0O C;  3BEH A;  5LGT A;  3RYF B;  4LWS A;  1SZX A;  2Q68 A;  4DR7 O;  1CEZ A;  1VQN V;  3AK2 A;  4LF9 O;  2KQX A;  2PGG A;  3CME V;  3CYO A;  3JAT A;  4NTW A;  3C90 A;  3MD0 A;  4H44 B;  5CA0 A;  2WLM A;  5LGU A;  2Y69 C;  4YHH O;  1ZL8 B;  4RQF A;  3ETQ A;  4LF9 B;  3K08 A;  4FM1 A;  2P06 A;  3D36 C;  2WLN A;  5JJJ B;  3OUF A;  3WB0 A;  2YUA A;  3JAR A;  2M7W A;  3RGB A;  1EN6 A;  2UUB O;  3J7A U;  2PI4 A;  2WLJ A;  4XBF A;  5GTH Z;  3G67 A;  5B1N A;  4PDR A;  2KG7 A;  3ABL C;  1HR0 O;  4FFB B;  4DV5 B;  3B09 A;  1H8E G;  5J2U B;  3CCR V;  4TV8 B;  1FKA O;  1WAZ A;  4FIP C;  1TA8 A;  1BT8 A;  2IH1 C;  3K58 A;  4DK1 A;  2YIC A;  3DGE A;  4P30 A;  1VQK V;  4Q6G A;  4B3M O;  1GM7 A;  3TK1 A;  2YXY A;  4J80 A;  2PY5 A;  2LFR A;  1NU1 H;  1F23 A;  1VF5 B;  3QF7 A;  4B3M B;  3H1H H;  1SQP H;  1BHA A;  1US6 A;  4D7T A;  4DR2 O;  4CBC A;  1O9G A;  4O4I A;  1AR1 B;  1MNG A;  1F51 A;  1YVW A;  2QM7 A;  4HNA B;  1KBH A;  3K06 A;  5L3B A;  3H01 A;  5IYB O;  4J7K A;  4UB6 Z;  1AVM A;  4HBN A;  2WWW A;  4A5U B;  1AB3 A;  1B6Q A;  4FPP A;  2R72 A;  4JI7 B;  2CK3 G;  3H1K H;  4J9Z B;  1FFX B;  1ZAU A;  2N04 A;  3AG3 B;  3BA9 A;  1VQ8 V;  3CCS V;  1SES A;  4ASU G;  4O4L B;  3ZMS A;  4XDL A;  3BHP A;  5LOV B;  5CB4 B;  4UCS A;  4U3J A;  3HB3 B;  3CS5 A;  4OPA A;  5EIB C;  4TV9 A;  3VQY A;  1N34 B;  2HG5 C;  3OE7 G;  5GW7 A;  4DV7 O;  3M8A A;  1QHT A;  1P7B A;  1BSM A;  4OPH A;  2LFS A;  4HYO A;  1V54 B;  3Q4H B;  2A7W A;  3DC5 A;  2IU0 A;  1DGS A;  2EJR A;  3FYE B;  3ZBH A;  4DW0 A;  1ZSP A;  2E5L O;  1CP9 A;  3JD1 A;  1Q43 A;  5H6Q A;  4W4K A;  2X6C A;  5LYJ A;  2HP8 A;  3HKB A;  1VQL V;  4LWS B;  1W0K G;  3K57 A;  4J42 A;  1F7Y A;  2VWJ A;  5BY1 A;  1EFR G;  4I50 B;  4PEL A;  3SYO A;  4MW8 A;  1HP8 A;  1SRY A;  2RCV A;  5KA6 A;  3GWK C;  1XI1 A;  1KD1 W;  1KU9 A;  4MVS A;  2VQF O;  1NTZ H;  5IE9 A;  1BE3 H;  1GK9 A;  3SJQ C;  4ZI7 A;  2JDI G;  1K3E A;  2DYR B;  3WFV A;  4PV1 B;  3HKE B;  1N8R W;  2GHY A;  1K9M W;  2ATK C;  1RPR A;  2ZKO A;  5EBL C;  3TGU H;  1Q6U A;  2ZNI A;  2GSM B;  3JCZ A;  2YEV A;  2ZNJ A;  1H38 A;  2FB5 A;  3AG2 B;  4LH7 A;  4QPJ A;  1Z2G A;  2FL4 A;  2H94 A;  3RYF A;  1AJQ A;  3VBB A;  3UCS C;  1GMG A;  3WG7 C;  4JI4 B;  4IGG A;  1JR9 A;  1NT2 B;  3QO8 A;  1BS3 A;  1SQF A;  3CXH F;  2NLJ C;  3GWO A;  3C3S A;  3G80 A;  2WPD G;  2ODM A;  4YHH B;  3X2Q B;  4CZZ A;  1VEW A;  5KA5 A;  2DN9 A;  3RN4 A;  5LP6 C;  4YJ2 A;  4WFH A;  1ZWI C;  1OCO C;  3A0R A;  4NVP A;  2W0X A;  2A3Q A;  3ZMZ A;  1AP6 A;  2UXB O;  4WFE A;  2EIM C;  4JGS A;  3SYC A;  2ZR2 A;  1SA0 B;  3OMI B;  4UCT A;  4U7N A;  3WG7 B;  5JCO A;  5CB4 A;  4NKG B;  1JOY A;  4EB6 A;  5BR8 O;  3CJH B;  2BSK A;  4LC1 A;  1T5E A;  1RSO A;  2R9I A;  3SYP A;  1VP7 A;  1NI8 A;  1R6K A;  2Z0A A;  4CS3 A;  3OW2 U;  4PDV A;  2LW7 A;  3F7Y C;  1FXH A;  4NR1 A;  3CCU V;  3I55 V;  2Z3Y A;  4LF4 O;  1G4Y B;  4JI8 O;  5FLX N;  1SQV H;  3IJ4 A;  1S5L Z;  4NXM O;  3QNE A;  1OCC B;  2HVJ C;  1GRJ A;  1J5E B;  1R3K C;  4DV7 B;  3AK3 A;  2ZT9 B;  4DXW A;  4EKW A;  1CPY A;  3F7V C;  4QIW F;  5B1O A;  4PA6 A;  1QLE C;  2VQF B;  1R6T A;  3SYQ A;  1THZ A;  4GX5 A;  3SPJ A;  2BE3 A;  5IJ9 B;  2YIB A;  3OGI B;  5J2U A;  2OT5 A;  1HNX B;  5CA1 B;  1QQC A;  3ML0 A;  3P3N A;  2Q5Z A;  4U3J B;  2GTA A;  1WJZ A;  3WB2 A;  1YSC A;  2Z5U A;  4CH3 A;  2ZE8 A;  3OD4 A;  1YHQ V;  4U3F H;  1VF7 A;  3IGA C;  4P2Z A;  1HNW O;  1H2M A;  2LQT A;  1NH2 B;  4G2K A;  2P67 A;  3T1C A;  1EZV H;  4U7O A;  1YTF B;  4DV6 O;  5GON B;  3RVY A;  4LNU B;  2ITC C;  4MTO A;  4K3A A;  3UQ8 A;  3HPL C;  1QLN A;  2L6L A;  1Y66 A;  3ZRS A;  4EB6 B;  3DTU B;  3E86 A;  5L3C A;  1JJ2 U;  3HKE A;  3ZN0 A;  3JAT B;  2F93 B;  4N23 A;  1VQM V;  2GDS A;  4P9P A;  2HVK C;  5FPO A;  3SPG A;  5LL6 Y;  1R3I C;  5AG2 A;  4OXS A;  3CC7 V;  1JFF A;  2FYU H;  4MW3 A;  4XDJ A;  2WAM A;  5C8Y A;  2CDY A;  4I9W A;  4GX1 A;  4JV5 O;  4PA9 A;  4AQY O;  5L3D A;  1V9P A;  3ABK B;  2N05 A;  4YY3 B;  1S76 D;  1JX9 A;  1VAR A;  2YEV B;  1OCZ C;  3BY6 A;  4DR6 O;  2XAF A;  5TIS Z;  2ZCE A;  3E8H A;  1PV0 A;  3SYA A;  1SA0 A;  4JI1 B;  4PDM A;  3B8N A;  1L0N H;  3RFR A;  1K73 W;  2YIA A;  4HZ3 A;  1WA8 A;  4CS4 A;  5B3S B;  2JGD A;  4UCV A;  1Q82 W;  1IBL B;  3K9A A;  3JCU Z;  1I0H A;  4ZOL A;  2JS5 A;  3WU2 Z;  1HR0 B;  2B1G A;  1JJO A;  4B3S B;  4J41 A;  1URF A;  2EIL C;  3DC6 A;  5FL7 G;  2BTO A;  1FYJ A;  3K03 A;  4OX9 B;  3L72 H;  3L9D A;  2ZE7 A;  4K35 A;  1RP3 B;  2RMK B;  3RYH A;  2NN4 A;  2AXT Z;  4GCZ A;  1E79 G;  1XNR O;  2Q7G A;  2HJD A;  1NTK H;  4CS2 A;  3ASN C;  2M6Y A;  1V54 C;  1SQG A;  4DO2 A;  1KUQ A;  1M4U A;  4GKJ B;  5E79 Z;  5KUM A;  3LDE A;  4C7U A;  5B3S C;  4RQE A;  4JYA O;  4FZ1 A;  4DV4 O;  4J11 A;  2Q73 A;  3JD0 A;  1TUB B;  1X4T A;  4DV2 B;  3EFF K;  5IYZ A;  3CRA A;  4FM0 A;  2A79 B;  5DED A;  4DR7 B;  4X64 O;  3W7W A;  2EIJ B;  3HKC B;  4CH6 A;  2Y4T A;  5KX5 B;  2CTR A;  3WB1 A;  5K1P A;  4YXW G;  2UUC O;  4JYY A;  3FYI B;  1S5J A;  2UUC B;  1M93 A;  3ZMV A;  3JAR B;  5KHI A;  3OFN G;  1TUB A;  1IBM O;  1Q81 W;  4BW5 A;  3BAA A;  1XEQ A;  3TCU A;  4DYL A;  3JAM N;  3M7M X;  4ZHQ A;  2JJ2 G;  5KHG A;  2JGU A;  1MZF A;  4JI1 O;  1MG1 A;  4FK5 C;  4KP4 A;  3THO A;  1I7F A;  1H8H G;  2A06 H;  4DR6 B;  2DYS B;  1NJI W;  1KB9 F;  3SDL A;  1IXB A;  4JAA A;  4GKK B;  2F4V B;  1H2G A;  1VF6 C;  2E74 B;  3J81 N;  5J2T B;  1FFX A;  3ETD A;  3IFX A;  2JEX A;  1NH2 D;  4ABM A;  5HFL A;  1WP8 A;  2IW5 A;  2HHH B;  5IDJ A;  3DSQ A;  2UXC B;  5LP6 A;  4X62 O;  1NS1 A;  4O2B B;  5LP6 B;  2YXH A;  5H2F Z;  2IJH A;  1RSO B;  1QR9 A;  1PKX A;  1VQ7 V;  2EJ7 A;  4GZR B;  1DTO A;  3AG1 B;  1N36 O;  5CBG A;  5BZB A;  4UVB A;  5JWP A;  2YIB D;  1PNK A;  1K5Q A;  3T1H O;  3RYC A;  3UO2 A;  1G8M A;  2DYS C;  1EN4 A;  4DR4 B;  5IJ9 A;  3O65 A;  3AG7 A;  5IWA O;  1EM1 A;  1A32 A;  4MT8 A;  1RM1 C;  4N21 A;  2R9R B;  1QBZ A;  4R6Z A;  4CH5 A;  4GKJ O;  4O4I B;  4L8J A;  4FLX A;  2P22 C;  2VQE O;  2LP7 A;  5IJ0 B;  4RAI A;  1M1K W;  1KQS U;  1D5A A;  2QWN B;  4BWA A;  2HFE C;  4MVZ A;  1OCC C;  1N0J A;  3L75 H;  3SPC A;  1P4R A;  3ZS8 C;  3CCL V;  3K04 A;  2XAJ A;  3STZ C;  3ZED A;  1NKD A;  4K0K O;  2FTK A;  5LYJ B;  1P49 A;  4LF8 B;  2RJZ A;  4PDL A;  5EZY A;  3ABM B;  1I5X A;  1RM1 B;  4P9O A;  1PL0 A;  1S3J A;  2XAQ A;  2UU9 B;  5DM6 V;  5IY5 C;  2JGD B;  3ASO C;  4EFE A;  3S3X A;  2V7Q G;  2UXX A;  5FPR A;  4PI0 A;  3QG5 A;  1WP7 A;  4FZ0 A;  5CMU A;  3FAV B;  2X0L A;  1QR8 A;  5DEC A;  2PYJ A;  3BFR A;  2CUG A;  4X1K B;  5LA6 A;  2JRI A;  2HR3 A;  3AEI A;  1M57 B;  1KP3 A;  4F6R A;  1R73 A;  1JFF B;  3CX5 F;  4ZBM A;  4K8Z A;  4MVQ A;  1Q3E A;  4JI0 B;  4FLV A;  1SQB H;  3C3T A;  3ABM C;  2QR4 A;  5IY5 B;  2CTP A;  5BXZ A;  3JAW A;  2F1M A;  4TQD A;  2WSS G;  2DMX A;  2ARH A;  4JTD B;  4D6T H;  2FKX A;  1E1Q G;  2QE7 G;  3CE2 A;  2Y0P A;  2CGN A;  1NTM H;  1COW G;  1WPX A;  3HKD B;  2XT9 A;  2AZ2 A;  1HNZ B;  4I4T B;  1FXK C;  4JTC B;  4DV6 B;  3ETE A;  2EIK C;  1R3L C;  1TAE A;  2ADP A;  2Q9L A;  2QDO A;  1BMF G;  2XOK G;  4TOI A;  3DXR B;  4LFA B;  2QEX V;  2F95 B;  2DW4 A;  3DXR A;  2ZDI A;  1EBO A;  2XTA A;  2QTO A;  1Y67 A;  4NXM B;  1Q7Y W;  1S5H C;  4RUF A;  5KAI Z;  1XOU A;  2BSK B;  5J9P C;  2DOS A;  5A9G A;  3U0Z A;  3G4S V;  3ZRX A;  1OCZ B;  1RPO A;  3MAQ A;  3OM3 B;  4DV0 O;  4UUJ C;  3JD2 A;  4DR3 B;  4FJC C;  5L3E A;  2Q69 A;  1FXK A;  3UT5 B;  1G1X B;  1P84 F;  2XAH A;  1GN4 A;  1YI2 V;  1KKC A;  4B3R O;  1VQ9 V;  1XMQ B;  3F5T A;  2QWQ B;  2HHH O;  2OCC B;  5LMN O;  4LFA O;  4YIO A;  4BR6 A;  4DV3 B;  4FLT A;  3ABL B;  4Z1V A;  2UXD O;  1W2B U;  1TVK B;  1WPB A;  2JVD A;  1XMQ O;  3FAV A;  3CCE V;  2ZIO A;  4RO2 A;  3SPI A;  3OEE G;  2XAG A;  1R3J C;  1WLE A;  2VS0 A;  2OCH A;  1NR1 A;  4Z1M G;  4JTA B;  2Q6A A;  1QVF U;  4ZHQ B;  2ITD C;  1KMI Z;  5JH7 A;  3CCQ V;  3A8T A;  2ZIN A;  3T2M A;  2IJK A;  2JJ1 G;  3EVK A;  4X89 A;  1DK1 A;  2AGA A;  4IYH A;  4F6E A;  2Y48 A;  4BAY A;  3QO7 A;  3R65 A;  3JD3 A;  2LGW A;  1I94 O;  2CGO A;  2QWP B;  3CHX A;  4E4E A;  1ZLZ A;  2QKA A;  4GX0 A;  1V55 C;  4FLY A;  3CB2 A;  2ADQ B;  4JYA B;  1YJW V;  4UCO A;  1AI4 A;  1IUR A;  1GN2 A;  1ZL8 A;  3FB7 C;  1K7D A;  5B1A C;  4W4L A;  3FB5 C;  3RYI A;  5EBM C;  2HLD G;  2B9Z A;  2ZE5 A;  3APO A;  2R9A A;  3A0B Z;  2RNB A;  4LF8 O;  5E1A C;  1KEC A;  4YJ3 B;  4JI2 B;  1GAX A;  3TXQ A;  1GN3 A;  3CSX A;  4X66 O;  4PI2 A;  4UCU A;  3K5O A;  4JI3 O;  1VF6 A;  1ZTE A;  3W7S A;  3T1Y B;  1QVG U;  2AZ0 A;  1DF5 A;  5EC2 C;  4JI2 O;  3FB8 C;  3ZCC A;  3E22 B;  2EIN C;  1ORQ C;  4GLX A;  3ZIA G;  4H37 A;  4KL1 A;  4H0L B;  2PUS A;  1MOF A;  1B04 A;  4IT5 A;  1KKD A;  1SQQ H;  2PTM A;  4O4H B;  1XMO O;  2YXL A;  4IIJ B;  2OYQ A;  3OGC C;  4LH6 A;  1UPG A;  1FS0 G;  1VQ5 V;  4LNU A;  1JA8 A;  1KP2 A;  2NR5 A;  3RW0 A;  4AQY B;  3CEI A;  3K59 A;  4DV5 O;  4X1Y B;  3CMA V;  3NR7 A;  1N36 B;  2XUM A;  4TV9 B;  4QE9 A;  4DW1 A;  2D2C B;  2B1I A;  1H2L A;  2ILM A;  3W7U A;  2PZS A;  2EIN B;  3ZHQ A;  4EEQ A;  3AG3 C;  4B7E A;  3ZRW A;  1VQP V;  3JAS A;  4H13 B;  4JAV A;  4X1I B;  3AG2 C;  3BRC A;  3FX7 A;  1PD3 A;  4JAS A;  4MVM A;  4GKK O;  2C2A A;  2XHB A;  2BOB C;  4DV4 B;  1AP5 A;  4LFC O;  3NXS A;  1U96 A;  3CWB H;  4AI8 A;  1NR7 A;  3A2F A;  1X59 A;  1O9H A;  3JYC A;  2Q7E A;  2GUZ B;  1N32 B;  3H9V A;  4LF7 B;  2E76 B;  3BPZ A;  2K9P A;  1L8D A;  1J95 A;  2V1D A;  4X65 B;  1XNR B;  1IBM B;  5JJE B;  1BL8 A;  1G6U A;  3T4D A;  2GBO A;  1GM8 A;  4X1K A;  3H1J H;  1YF2 A;  4QE7 A;  2DE0 X;  1YJ9 V;  3F5W C;  2IH3 C;  3N2K B;  4KXR A;  4LFB B;  3B4S A;  2AHZ A;  4PA3 A;  5CBF A;  4KFM A;  1S0V A;  5FNV A;  4LF6 B;  3AG4 B;  3E35 A;  5LOV A;  4WFG A;  1M56 B;  3KKY A;  5EBW C;  1YTF D;  2F23 A;  3SJA C;  3UM7 A;  1Q6H A;  3CCJ V;  4FLW A;  3Q4H A;  2WA3 A;  4DUZ O;  2DYR C;  1OJH A;  4KHP B;  3CRC A;  5JH7 B;  3RWR D;  4BIU A;  1FD9 A;  3K79 A;  2Q7H A;  3JSN A;  1FXK B;  2D3O W;  2Y69 B;  1Y74 B;  3SR2 C;  2ZR3 A;  5H9C A;  1B3Q A;  5KX5 A;  1Q8I A;  1YZB A;  1U97 A;  2HJF C;  2EZO A;  2CAZ C;  3ZHU A;  4UCR A;  3W7X A;  1XBL A;  2ZM6 O;  3U10 A;  5IYD O;  2L35 A;  4F4L A;  4LP8 A;  2QGN A;  1N4C A;  1IBL O;  5ITZ A;  1W59 A;  5EYP A;  5A2Q N;  3TXS A;  3UT5 A;  2JIZ G;  2BOC C;  3FB6 C;  3QO5 A;  3CCV V;  1P7G A;  3HR0 A;  3ABT A;  2EIM B;  4AHC A;  3KCX A;  3ZMU A;  4YIP A;  1QU7 A;  5BMV B;  2UUA O;  2KB1 A;  3HKD A;  2B5U A;  2OTL V;  2RQ6 A;  4OX9 O;  1Q6I A;  3M99 B;  2OCC C;  4CC6 A;  3CJH A;  2H3O A;  3J80 N;  4NTX A;  4IL6 Z;  3OAA G;  4DV0 B;  1YCI A;  5KAF Z;  5EIB D;  3K0D A;  2X6B A;  2EX3 A;  3KZI Z;  4GUN A;  4D7S A;  1HNX O;  4LF7 O;  3L70 H;  2JS3 A;  4NYK A;  5LXT B;  3LDD A;  1MMM A;  4I9Q A;  4IHJ B;  4MVR A;  4DUY B;  2VQE B;  1IDS A;  4MSW C;  2IM9 A;  2QSA A;  5KMG B;  1WA8 B;  4X1I A;  3ABU A;  1JCH A;  4X20 A;  3L73 H;  3CRR A;  1ENV A;  1MA1 A;  1L1F A;  4MTX A;  1XQ8 A;  1K34 A;  1HNW B;  2VRZ A;  1Y4M A;  2QJ1 A;  5IWA B;  1H2N A;  2ZDI C;  4TQF A;  3N27 A;  2E3C A;  2EBO A;  4HAM A;  5J2T A;  3HKB B;  4DK0 A;  1PM9 A;  1XHZ A;  3L71 H;  4YJ3 A;  4ZOL B;  2WLL B;  2LW1 A;  4LCU C;  2P5O A;  3UKM A;  2LJ2 A;  3K5M A;  1BZK A;  1IXM A;  3MHH C;  3P3P A;  3A0H Z;  1AI5 A;  5KLV H;  1MSD A;  4OGQ B;  1YJN V;  4JF3 A;  1XL4 A;  1H2K A;  1YIJ V;  3QVN A;  1PNL A;  5D5P A;  1ROP A;  4NXN O;  1MZE A;  4IIJ A;  3ASN B;  4JZG A;  1TUE B;  2WLL A;  5DN6 G;  4FFK A;  4X66 B;  3OEH G;  3RVZ A;  3BCC H;  4DR5 O;  3BVO A;  4I4T A;  3O9O A;  3E89 A;  5JCO C;  4KUM A;  2Y4U A;  4TT3 G;  4B08 A;  3P30 A;  3K5N A;  1F4N A;  1GO3 F;  2YC0 A;  1SKV A;  3ZN1 A;  5GON A;  4HNA A;  3CD6 V;  4PHZ A;  3OMA B;  4UXN A;  4X64 B;  1BCC H;  2DQ3 A;  3FD9 A;  3CCM V;  2GV9 A;  3BA8 A;  1TVK A;  3ICX A;  2IU3 A;  3APQ A;  1ZUQ A;  1J5E O;  2P90 A; 
#chains in the Genus database with same CATH homology
 4PJ0 Z;  4UB6 Z;  5GTI Z;  5GTH Z;  5H2F Z;  5TIS Z;  3WU2 Z;  5KAF Z;  3KZI Z;  3A0B Z;  3JCU Z;  4UB8 Z;  5E79 Z;  5KAI Z;  2AXT Z;  1S5L Z;  3A0H Z;  5B66 Z;  4IL6 Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...