3A0HZ

Crystal structure of i-substituted photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0hZ00
4UB8Z 5KAIZ 1S5LZ 5E79Z 4PJ0Z 3KZIZ 3WU2Z 5B66Z 5H2FZ 4UB6Z 4IL6Z 5KAFZ 5GTHZ 5B5EZ 5TISZ 5GTIZ 3JCUZ 3A0BZ 3A0HZ 2AXTZ
chains in the Genus database with same CATH superfamily
1I08A 4XDKA 2QKSA 3RW0A 1YVWA 3C3TA 3HKEA 1SQGA 1JOYA 3SYPA 5KHIA 1W0KG 2N74A 1G8MA 2YIAA 5GTIZ 1ZX3A 1L0NH 1AP5A 4WFAV 2Q7HA 1VQPV 1FKAO 4J7JA 4DYLA 5C8YA 2RQ6A 2CGNA 3T2MA 1I7FA 4JI6O 1NR1A 2LW1A 1FJGB 4U3JA 2RN9A 1JVMA 3Q4HB 4PDMA 4MW8A 4I9WA 3SYQA 2XNDG 4J11A 3ZCCA 4DV7O 3EFFK 2IJIA 1M57B 5BY1A 3AK2A 2KB1A 3CCMV 1ZL8B 3F7VC 2ZE6A 4X89A 4L8JA 4X65B 2DQ0A 5L3BA 2ITCC 4I9QA 5B1AB 2Q4PA 3TXSA 3IFXA 3BABA 2P06A 5JWPA 3EXAA 3QVNA 2JK5C 5EZYB 1XMOB 1KMIZ 2KG7B 3CD6V 4RO2A 1TGOA 5LMUO 3N2GB 3LDCA 4I55A 1JX9A 3AEIA 1AI4A 1XHZA 3OGCC 1JQ0A 2QJ1A 1DF4A 2WLKA 1F7YA 4JF3A 4NTYA 3RYCA 5EIBC 2Q68A 1GAXA 1E1QG 1Q90D 5LP6C 3CJHA 1KKCA 2D2CB 4GX0A 3K5NA 3X2QC 1Q82W 3RYHB 3ETGA 1KD1W 4X66O 1SZTA 1M4UA 2V1DA 1WNSA 5D5QA 3OR7C 2JEUA 4IHJB 4MTGA 1MMMA 4CBCA 3CC7V 5B5EZ 4NXNB 1Z5VA 5JCOC 5KHGA 4CS3A 3E89A 4PA7A 4G27B 1NQTA 3FB7C 3JAKB 5K1XA 4LF4O 1SQPH 1JFFB 1WN7A 1XMOO 2Y0IA 2QTSA 1AR5A 3H1KH 4DRXA 4EFBA 2W6JG 4JV5B 2P90A 4I0XA 4JASA 2EX3A 4I50A 1IZ3A 1Q5OA 4JTAB 4UCVA 1XDCA 3C3SA 3M99B 2KKWA 1N0JA 2PI5A 5BMVA 4DO2A 5B3SC 3K0GA 4B3MB 4LF5B 4X9QA 4WFFA 5IJ0A 2EINB 4O2AA 1N34B 1TUEB 4CZZA 5H6QA 3JD2A 1VMGA 1QU7A 2YI8A 1V9PA 4RQEA 3T4ZA 3CHXA 4DR5B 1KU9A 2ARHA 1AI7A 1F51A 3TJTA 1QVFU 1SQXH 1XMQB 2FL4A 1IDSA 3H1HH 1IXMA 2AXTZ 5J9PC 1K3EA 3SJQC 3ML0A 3D36A 4YJ3B 1B6QA 5KHKA 5JQGA 4H0LB 1GM8A 4TQFA 5CA1B 5JH7A 1M1KW 2ZDIA 1FD9A 2BTQA 4HNAA 3W7TA 3UQ8A 4BIOA 4B3MO 4KXRA 1OCZC 4LF5O 1RFYA 2NN4A 2ZIOA 4O4LB 2HJDA 4KP4A 4X20B 2AW9A 5IY5C 3IC7A 2E5LB 1HR0O 1I94B 3E22B 1IXBA 1EBOA 4D7SA 4DW0A 1N0NA 1FXKA 4K8ZA 1JR9A 1YJWV 1P84F 3MD0A 4IIJB 1X59A 3SYAA 2HG5C 3T1HB 1KBHA 1HP8A 1RM1B 3BVOA 3G71V 2WA4A 3R66A 2QR4A 4UB8Z 1GRJA 3AG4C 3VQYA 1BQ0A 4QNHB 3J80N 1HNZB 4DUZO 3OUFA 1R3KC 5CA0B 3K57A 1WA8A 4PHZA 2PF4E 2EIKC 1ROPA 4YHHB 3OMNB 2W0XA 4FIPC 1K73W 3ZX6A 3FB5C 2OTJV 1HNXO 1R3JC 5HFLA 4B7KA 3DC6A 4QPKA 3ZIAG 3HKBB 4JAVA 4JAAA 4PDRA 1QLNA 3KCXA 4UUJC 3TGUH 4UCOA 1Y76B 2ZE5A 4O4IB 1I94O 1S5JA 2VWKA 1K4CC 4X64O 1J5EO 4JTDB 2UXCB 1Q86W 3ZBHA 4FLXA 2ODMA 3T1HO 2R9AA 4J10A 3HKDA 1H38A 5J2TA 3GWOA 3BHPA 1FFXA 4X1IA 3CCSV 1FPOA 1N4CA 2UU9O 1V54B 4TOIA 3AK1A 3RBZA 1HW7A 4LWSB 3WG7C 4DUYO 2MW2B 3LDEA 5L3DA 5LGUA 4K0KB 2Q67A 2UXDB 1LNQA 3SYCA 4JYAO 4FFBA 4MS2A 2LO1A 2QTOA 4LFCO 1PV0A 3J81N 2XT9A 4MVUA 1QCEA 1ZUQA 4LH7A 3W7WA 2CUGA 4YXWG 2ZXWC 3JCZA 4O4JA 2DYRC 4I4TA 4EB6B 2R9IA 4NXMB 2WAMA 4W4KA 3AG3B 5FPRA 3FYIB 1R6TA 5LGNA 4GX2A 2QDOA 2ZNIA 4ZI7B 5LXTA 1BS3A 5IYCO 2VS0A 1VQ8V 1XUQA 2ADPA 5KHHA 1PPJH 3IC9A 5IYDO 2QWQB 3E8GA 4DW1A 1AJPA 2B1GA 2K1EA 1M56B 4P9PA 4K0KO 4PDVA 4LFBB 1K7DA 2JEXA 3JSNA 4PA3A 3SJCC 3N2KB 4TV8A 1VEWA 1KP3A 3WFVA 3AK3A 3CP1A 4UVAA 1QVGU 2HHHO 4IGGA 3OMIB 4JZGA 4BW5A 1VP7A 1ZTEA 1SS3A 3ABTA 3I56V 1XEQA 1ORQC 1H8HG 3RVZA 3JASB 4LF8O 1M57C 2NLJC 2Q0AA 1OCOB 5IT9N 2PZSA 3ABUA 5EIBD 5LHHA 1NVPB 4NTXA 1TUBB 3L75H 2RJZA 3CXCU 1NTMH 1OV9A 1R6NA 2IJKA 1HWYA 2XAHA 4DV1B 3LNNA 2IH1C 4G28B 5B1AC 4MTXA 3L70H 4UFZA 2RNBA 4IYHA 2PI4A 3DXRA 4LFBO 3WB0A 1F4NA 2LQTA 4J9YB 1EN4A 2P7TC 4AQYB 1YI2V 3OGIB 4NB5A 5H2FZ 4JI0O 1Q6UA 1N36B 5EBWC 4GUNA 1SKVA 4GZRB 1PNLA 2EJ7A 2UUAB 1JCHA 2ZE7A 2PGGA 1SQBH 3UCSC 4DV4B 4F4LA 1R73A 4DV2B 5LP6A 4JI1B 1FS0G 1QR9A 3JSLA 4ZHQA 3ZHTA 4WFGA 3BA9A 1K4DC 4Z2WA 1S0VA 3RYIA 4P30A 2GUZA 2Q9LA 1PL4A 3G80A 3OEEG 2LFSA 1XL6A 5JCOA 5KMGB 3P32A 1Y74A 5L3EA 1KKDA 3F5WC 1K8AW 4CS4A 3L73H 4R7CA 2QWOB 2QM7A 3OW2U 4KHPB 4FPPA 1HDJA 1NJIW 2EIMB 3G6EV 3H1LH 4UB6Z 4UVCA 4KFMA 4AQYO 3M8AA 5IYZA 3MDSA 3ETDA 4TUYA 1N36O 2OCHA 3T1CA 3ETQA 5CB4B 4ZIBA 2WLIB 3AG1B 4OXSA 5CBHA 2DWEC 2UUAO 3CCVV 4CH4A 4YIPA 3OD4A 1NH2D 4MVZA 2YXYA 4L87A 5IJ9A 4O2BB 1WB7A 1VQLV 4JI1O 1NZ6A 2X6BA 4IT5A 5LOVA 4LFAB 3HB3B 2Y4UA 2EINC 1ZLZA 2GHYA 3L74H 2EZOA 4I55B 1TAEA 1BSMA 2H94A 2Q5ZA 2WLMA 3UT5B 5JVDB 4LCUC 2AHYA 3CCRV 1XREA 4GLXA 1YDXA 2RMKB 3CMAV 4DV7B 3JD4A 4BAYA 3ABKB 5K1PA 4PI2A 4CH6A 2DYSB 2OYQA 3BFRA 3ZHUA 2UXBB 4QIWF 3CPWU 1VQMV 3FB8C 4K35A 2Q6AA 2ZR3A 2P6JA 1RSOA 2BE3A 2IM9A 4OPHA 2P4VA 4ZBMA 3ZS8C 1MG1A 4WFHA 2WLLA 2OIEA 1WB8A 5IDJA 2X6AA 3QO8A 1YF2A 2AZ0A 2A7WA 4LFAO 2X0LA 5ITZA 4CH5A 2QWNB 4E4EA 2BCCH 1F23A 4WBNA 4X1KA 2F95B 4FM2A 4PDLA 5H6RA 4X1YB 3W7XA 3VOUA 4I0XB 4EKWA 3NR7A 4I50B 1SA0A 5LMUB 1RM1C 5BMVB 2P5OA 4W4LA 4WFBV 1JPXA 3FD9A 2QSAA 3ZRWA 3JCUZ 2E74B 1DK1A 2UXBO 4XBFA 4ASUG 4TV9A 1QNMA 4X66B 2CE4A 1VARA 3T4DA 2OT5A 2M7WA 1I5XA 4D7TA 2GV9A 3ZHSA 1N8RW 3VQVA 4DK1A 2LW7A 3BY6A 4WCEV 1BT8A 4YJ2A 2ZR2A 2ITDC 5LYJA 3RT3C 1PNMA 4JI3O 2JS3A 4KL1A 4LF4B 3CMEV 1OCRB 4EFEA 4LNUB 5B1BB 2DJVA 2UUCB 1CXZB 4LF9B 4RUFA 4DR7O 1W2BU 4QPJA 1K33A 3BAAA 1S3JA 2EULA 1GM7A 3JARB 2UXNA 3CB2A 4F6RA 2WPDG 1Z2GA 3QG5A 1V54C 4HBNA 3SGIA 4MVSA 2W6IG 1V55B 4UV9A 1FXVA 2ZINA 3GB7C 4RUEA 5CBGA 1NKDA 4JAUA 3B77A 1IX9A 2N04A 5DECA 4U7NA 5L3FA 2GTSA 1YITV 1W0JG 3THOA 2CDYA 4OPAA 1A32A 5BZBA 4P9OA 2B9ZA 3CXHF 3OUSA 4H37A 3AG3C 2JDIG 2UUCO 4B3RO 1UFIA 4LF9O 5GTHZ 3EHBB 3BRCA 4Q6GA 1D5AA 4DV0O 5TISZ 3G4SV 1ZWIC 1H2NA 4DXWA 1AROP 1P49A 1GO3F 2AHZA 1GN4A 4I5SA 1PP9H 1WP7A 3OTOO 3TXQA 3CCEV 4DR1B 1S72V 3ZHVA 2C2AA 3CWBH 1ZAUA 2BSKA 1M56C 4GX1A 1SF9A 1HR0B 1K34A 3I5DA 3B09A 1X4TA 4A5UB 4DR3O 5J2TB 3Q4HA 4G2KA 1Y4MA 3OTFA 1H2MA 5LHGA 3K0DA 4DUZB 4FM1A 1SQVH 3TETA 4O4HB 4PJ0Z 3VQWA 1ZL8A 1GM9A 3CE2A 3K9AA 3KZIZ 2PYJA 3T1YB 4FLYA 1OCOC 2F1MA 1W59A 1YEWA 2ATKC 4PA6A 1P7GA 3H9VA 1M9NA 5FLXN 3ICXA 3A0RA 1HNXB 3BA8A 1EN5A 2OTLV 4J80A 4QJFB 3AG7A 3K3WA 2FTKA 2IU3A 5LHIA 2YICA 4FLUA 1THZA 3AG2B 1XI1A 4DR1O 2RDCA 5EZYA 3DTUB 1FYJA 1H2KA 1BHBA 1GK9A 1H2SB 4WFEA 4X64B 2EBOA 4BWAA 2CK3G 1J5EB 2A3QA 3N2GA 3OAAG 2F4VO 3CSXA 4HAMA 4MVMA 3U11A 4NR1A 2NR5A 3JAMN 5A2QN 3FAVB 2R9RB 1KYOF 4X8AA 2JIZG 1R1BA 5CA3A 3CS5A 3HKCB 2UU9B 3ABLB 3RYFB 3A2FA 3RYHA 4J42A 4LF7O 1NT2B 2QM8A 3T1YO 4DUYB 2LGQA 3B40A 3F7YC 3FFQA 2JJ2G 4BIZA 1VF6C 4JYAB 2V4DA 1WLEA 1GH6A 3A0HZ 4HYOA 4IHJA 4TV8B 5IE9A 1YHQV 4LFCB 4GKKO 2YC0A 5FNVA 4FLTA 3EVKA 4I7ZB 3JAKA 4ICGA 1VQ6V 1JFFA 2R72A 2UXXA 2WWWA 4UV8A 3CC2V 5LMNO 2E3CA 1COWG 2YI9A 1VIBA 2EIMC 2Q69A 3JAWB 4FMTA 1FXHA 1YZBA 3RWRD 5J2UB 4B3TO 3AG1C 4CC5A 3P3PA 4NTWA 2F43G 4J7KA 3WB1A 3DXRB 2FMLA 5IYBO 1I5YA 1L1FA 4R6ZA 4N23A 3ASNC 4RWUA 1Q8IA 1AJQA 2XUMA 2WLHA 4FLVA 3U10A 2XAJA 2HHHB 4FJCC 1B06A 1AR4A 4X88A 2ZE8A 2ZQMA 2JGDB 3ABKC 4YJ3A 2CTQA 4LF8B 3G67A 4X62B 2DYSC 2BOCC 1O9GA 2QKAA 2EIJB 5CA1A 1GN6A 3P30A 2XAFA 3N27A 2F66C 1S77D 3QO7A 4IL6Z 1QLEB 1KB9F 1R3LC 2HLDG 1CEZA 2VWJA 4O4LA 4LF6O 1IVSA 5GONB 2IW5A 4JI8O 1K92A 2VQEO 5EC1C 3K5LA 3E22A 2A06H 3HR0A 5KX5B 1AP6A 2DW4A 1QBZA 1AR1B 4JI0B 3L71H 5EYPB 3APQA 1L8DA 4PA4A 3RN4A 2O57A 3LUTB 4XDJA 1WP8A 3GWKC 5FPOA 5CA0A 2HVJC 4BR6A 1U97A 2F93B 4FM0A 3B2EE 1CP9A 1US6A 1URFA 3QNEA 4X62O 1P7BA 4ZOLB 2CGOA 3KKYA 2Q0OC 3CRAA 1IBMO 4B3SB 3LSUA 2D3OW 1WPXA 3HKBA 2G38A 1OCCB 3APOA 1ENVA 3OMAB 2HVKC 1L0LH 4AI8A 5KLVH 1Y76A 3CCLV 5EK0A 4O4IA 1MNGA 5H9CA 5KA5A 2HP8A 3WB2A 3JALB 5DEDA 1LR1A 2ZCEA 1OCRC 3E2EA 1NH2B 5B1BC 1SRYA 4JI2O 1AJNA 4DR6B 3PJSK 3E83A 4MTOA 3K79A 4CS2A 2NNUA 1EN6A 1VQ5V 2IJJA 2YUAA 3HKEB 4MVRA 1YIJV 1YJ9V 4JYYA 2DMXA 3ZHQA 1VQ7V 3K08A 5ITZB 1RPOA 4LWSA 4UCRA 4WBNB 2QM4A 4MT8A 5D5PA 2ADQB 1M93A 1V55C 3ZMVA 5C8YB 4UVBA 1Y66A 1YSCA 4B3SO 4U3JB 5A9GA 1H2GA 1OJHA 1XNQB 1JA8A 2F23A 2JRIA 3K04A 2VQFB 5KUMA 1B04A 3JD1A 2YXHA 2FYUH 1MOFA 2PYLA 4FVMA 1Z5WA 4LP8A 2Q7EA 3O65A 2B1IA 4JI5O 4DR6O 1I0HA 3H1JH 4U7OA 4ZI7A 4FK5C 3RVYA 1SESA 3E8HA 4J9ZB 1FFTB 2GBOA 4E2LA 2ZM6O 3BCCH 2M6YA 4YJ2B 1XQ8A 5LYJB 3ZRSA 2A9HA 2XOKG 4KUMA 4DV6O 1Q7YW 2DOSA 3J7AU 1Y67A 2EZPA 4CH3A 4NKGB 4DV5O 3ASNB 1IBLB 1GN2A 3N2KA 2OWOA 4CC6A 1XNQO 2VQFO 3QF7A 3K5MA 3RYCB 1BQZA 2KSDA 3JASA 3CJHB 4UXNA 2YS8A 1TUBA 5FL7G 1G1XB 1RPRA 1J95A 5LA6A 2HEPA 1Y6XA 2MK3A 4FZ0A 3BPZA 3CRQA 5GW7A 5EBMC 4OX9O 5B1NA 2AZ2A 2L35A 3OEHG 2RCVA 3MHSC 5C93A 2ZKOA 1BMFG 3DC5A 2FKXA 3AG2C 1YXBA 2GSMB 2HJFC 4GYCB 4JI3B 3K58A 2ILMA 4J7ZA 4JPRA 2DWDC 4DRXB 4QE7A 1IBLO 4MW3A 1GTOA 1WPBA 2UUBB 1XHXA 1MZFA 5IWAB 2FB5A 4LR3A 5LGTA 4DR7B 5E1AC 1YTFD 1QR8A 3QO5A 1N32B 5IJ0B 2BSKB 3SJBC 4O2AB 4OGQB 3ABLC 2GDSA 1N33O 1TA8A 1VF6A 2YEVA 1JJ2U 2KQXA 1MZEA 5KAIZ 1S5LZ 1TVKA 3OT7A 1VQOV 5KMGA 2K9PA 1K5QA 4GT1A 3E8FA 3DGEA 2QA4V 4JGSA 1NR7A 5KUKA 1EZVH 2P22C 3ASOB 1XNRO 3ZMUA 5JQGB 4FLZA 3K03A 4K3AA 2WLJA 3DSQA 5JH7B 3L72H 2VRZA 2IJHA 1EZJA 5CB4A 2WLIA 4B3RB 1KQSU 2L6LA 2UUBO 1LUVA 2BTQB 4HNAB 5IWAO 4DV0B 5LL6Y 1XOUA 2OCCB 3HPLC 2DE0X 1SQFA 2V7QG 4O2BA 4B7EA 4U3FH 1D5NA 1N32O 1YJNV 3JYCA 3OTOB 3UM7A 2XTAA 5CMUA 3A8TA 4PA9A 1NTKH 3SYOA 4TQDA 1FJGO 1FXKB 2A79B 3UT5A 3D3IA 1AI5A 4UCTA 2PUSA 5HFMA 5JVDA 1UJWB 2CH7A 2EJRA 4DR3B 3JATA 2WA3A 1JJOA 2LGWA 1SERA 4GX5A 1NTZH 4PI0A 4FLWA 2ETNA 2PTMA 1M5IA 2HKOA 5JJJB 1WA8B 4Z1VA 4RAIA 2W0FC 3ZEDA 1F4MA 4JI7B 4X65O 3ABMB 3W7SA 2EIJC 2Q7GA 4H44B 4Z1MG 4N21A 3NXSA 3R65A 3CRRA 1AI6A 3CYOA 3ZMTA 1QLEC 5FNVB 3A0BZ 4GKJB 1KC8W 3H01A 4TWKA 1DLBA 2XAGA 1PD3A 2BOBC 4ABMA 2QGNA 4MVQA 2Z5UA 4X1YA 3UKMA 1MSDA 2IBZH 4P2ZA 4TT3G 4YY3B 3CCQV 3HKDB 2F4VB 3S3XA 1R6KA 3CEIA 2JS5A 1FFXB 4X1IB 3RGBA 1QQCA 2AGAA 4K8XA 4AHCA 2EILB 1O9HA 3IGAC 3W7UA 2CTPA 3K06A 2YIBD 3OR6C 2GTAA 4JYCA 1R3IC 3SPIA 4JI7O 1PL0A 3FX7A 3ZMSA 1KECA 4LF7B 3K59A 4FFBB 1QHTA 4Q20A 3ZN0A 3U0ZA 1Q43A 4NXNO 1BE3H 5DN6G 2YSUB 1G6UA 4GKKB 4GKJO 1BGYH 1OCCC 3I55V 5F2VO 4O4JB 3L9DA 4I4TB 3E86A 3ZJZA 3ZRXA 3O9OA 5BR8B 2KG7A 3UO2A 3MAQA 5LMNB 4LNUA 4JV5O 3B4SA 3S3WA 3STLC 1Q6HA 4MVOA 5EC2C 4YY3O 5LXTB 2A0LA 5DM6V 3KG2A 2YIBA 4B3TB 1MSWD 3SDLA 2QKCA 1NU1H 1PNKA 3M7MX 3SJAC 3OE7G 5B1OA 3JARA 1SC5B 4ZKIA 1N34O 4UCSA 5B66Z 1VQNV 4GCZA 1DGSA 3QTCA 2QWRB 1CPYA 4DR5O 1K5SA 3IJ4A 5CN0A 1XMQO 1XBLA 1DTOA 2YDEA 1IBKB 1NBMG 3VBBA 3PN1A 1Q3EA 1VQ4V 1BHAA 3SPGA 1E1RG 1M90W 2OIGA 3K5OA 5BR8O 2Q73A 2XASA 1WJZA 2LJ2A 1SETA 1UPGA 3ETEA 5AG2A 3CRCA 2XHBA 4PELA 2QE7G 4PV1B 1G4YB 2YIDA 4H33A 2QEXV 1B3QA 2H8PC 3CRMA 1PKXA 3RFRA 2Z0AA 2E5LO 4LF6B 1SQQH 4B08A 4JI8B 2VQEB 2IH3C 5CBFA 3CCJV 4DV3B 3JD0A 4PD4F 2P4KA 3GVMA 1VQKV 1IBKO 1DF5A 2Y69C 1HNZO 2N05A 1VF5B 3STZC 4UCUA 2R70A 2Y48A 5LP6B 4JYBA 4O4HA 3X2QB 4YHHO 2Q8VA 1AVMA 4DK0A 3LSSA 4ZHQB 3RYIB 2PY5A 2B5UA 1EM1A 2GUZB 2Y4TA 1MABG 4FZ1A 3FB6C 1GN3A 4JTCB 1IBMB 1S76D 3SPCA 1Y74B 3OM3B 4BIUA 3MHHC 4J41A 4MSWC 2H3OA 3LDDA 4WF9V 1XL4A 4X20A 4IYIA 1S5HC 2UXCO 4DV3O 4LC1A 1OZ0A 5IYZB 3P3NA 4TUYB 2ZNJA 5E79Z 4IIJA 4JI2B 2DN9A 4TSFG 1YCIA 3D8CA 4JI4B 3CC4V 4R8CA 3FAVA 5B3SB 1BL8A 2BTOA 5IJ9B 5LBQA 3HKCA 2CTWA 4YIOA 5LOVB 2JJ1G 2JVDA 3TK1A 3RYFA 3SPHA 3H1IH 3TCUA 2UXDO 4NYKA 1H2LA 4DR4B 4R50A 3FYEB 2P67A 5JJNB 1VQ9V 3CCUV 3B8MA 1H8EG 4XDLA 4BW9A 2E75B 4F6EA 5EBLC 2DQ3A 5KA6A 4EEQA 1T5EA 3VQXA 2ZIMA 4NXMO 3D36C 3ASOC 3JAWA 4MTFA 3G6BA 4RQFA 3WU2Z 5LA6B 3ZN1A 5KAFZ 4JI5B 5J2UA 4NVPA 4QGPA 2ZDIC 1RSOB 3BEHA 4JI4O 2WLNA 2HR3A 3D3QA 2WLLB 2ZM6B 2OCCC 1OCZB 1E79G 5IY5B 3CX5F 1WAZA 1PM9A 4DV6B 5JJEB 5KHJA 1NS1A 4X1KB 2WSSG 4DR4O 3ZMZA 3KCYA 1FXKC 3UO3A 1SA0B 4DV5B 3ZHRA 3AG4B 1BCCH 3IAYA 1MA1A 1AILA 2CTRA 2EIKB 2JGDA 2IU0A 4LBEC 4AILC 1FAFA 3ZRWB 4DR2B 4EB6A 1ZSPA 2YEVB 1BZKA 3ABMC 4TV9B 2HFEC 2X7RB 1K97A 1RP3B 1TVKB 1XILA 4DV1O 2ZT9B 1EFRG 5BXZA 3OFNG 1NVPD 4C7UA 4OX9B 1KP2A 5L3CA 1GKFA 3E8BA 5GONA 1LUWA 1K9MW 1HNWB 5KX5A 2E76B 4JZ2A 1U96A 2ZD9A 5EYPA 3ZRVA 1YTFB 2X6CA 3B8NA 2Y69B 2XAQA 1JMKC 2Y0PA 4DV4O 5H5NA 4DV2O 2Z3YA 1Q6IA 4LH6A 2CAZC 2EILC 2LP7A 1P4RA 3WG7B 1IURA 4DR2O 4F6RB 4HZ3A 1GMGA 4ZOLA 2JGUA 3SR2C 1N33B 4D6TH 2LFRA 4H13B 1NI8A 2YXLA 4JI6B 1Q81W 2CH7B 3K9SA 1AB3A 3JATB 4QE9A 3SPJA 3LSQA 1SZXA 5L3GA 2QWPB 2ZXWB 2DYRB 1KUQA 4KHPO 4FFKA 3JD3A 3JALA 1HNWO 3C90A 1XNRB 3F5TA 3LNMB 3FKSG 1VF7A 1OHHG 1D2DA 3E35A
chains in the Genus database with same CATH topology
4UB8Z 5KAIZ 1S5LZ 5E79Z 4PJ0Z 3KZIZ 3WU2Z 5B66Z 5H2FZ 4UB6Z 4IL6Z 5KAFZ 5GTHZ 5B5EZ 5TISZ 5GTIZ 3JCUZ 3A0BZ 3A0HZ 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 Z;  5KAI Z;  1S5L Z;  5E79 Z;  4PJ0 Z;  3KZI Z;  3WU2 Z;  5B66 Z;  5H2F Z;  4UB6 Z;  4IL6 Z;  5KAF Z;  5GTH Z;  5B5E Z;  5TIS Z;  5GTI Z;  3JCU Z;  3A0B Z;  3A0H Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 1I08 A;  4XDK A;  2QKS A;  3RW0 A;  1YVW A;  3C3T A;  3HKE A;  1SQG A;  1JOY A;  3SYP A;  5KHI A;  1W0K G;  2N74 A;  1G8M A;  2YIA A;  5GTI Z;  1ZX3 A;  1L0N H;  1AP5 A;  4WFA V;  2Q7H A;  1VQP V;  1FKA O;  4J7J A;  4DYL A;  5C8Y A;  2RQ6 A;  2CGN A;  3T2M A;  1I7F A;  4JI6 O;  1NR1 A;  2LW1 A;  1FJG B;  4U3J A;  2RN9 A;  1JVM A;  3Q4H B;  4PDM A;  4MW8 A;  4I9W A;  3SYQ A;  2XND G;  4J11 A;  3ZCC A;  4DV7 O;  3EFF K;  2IJI A;  1M57 B;  5BY1 A;  3AK2 A;  2KB1 A;  3CCM V;  1ZL8 B;  3F7V C;  2ZE6 A;  4X89 A;  4L8J A;  4X65 B;  2DQ0 A;  5L3B A;  2ITC C;  4I9Q A;  5B1A B;  2Q4P A;  3TXS A;  3IFX A;  3BAB A;  2P06 A;  5JWP A;  3EXA A;  3QVN A;  2JK5 C;  5EZY B;  1XMO B;  1KMI Z;  2KG7 B;  3CD6 V;  4RO2 A;  1TGO A;  5LMU O;  3N2G B;  3LDC A;  4I55 A;  1JX9 A;  3AEI A;  1AI4 A;  1XHZ A;  3OGC C;  1JQ0 A;  2QJ1 A;  1DF4 A;  2WLK A;  1F7Y A;  4JF3 A;  4NTY A;  3RYC A;  5EIB C;  2Q68 A;  1GAX A;  1E1Q G;  1Q90 D;  5LP6 C;  3CJH A;  1KKC A;  2D2C B;  4GX0 A;  3K5N A;  3X2Q C;  1Q82 W;  3RYH B;  3ETG A;  1KD1 W;  4X66 O;  1SZT A;  1M4U A;  2V1D A;  1WNS A;  5D5Q A;  3OR7 C;  2JEU A;  4IHJ B;  4MTG A;  1MMM A;  4CBC A;  3CC7 V;  5B5E Z;  4NXN B;  1Z5V A;  5JCO C;  5KHG A;  4CS3 A;  3E89 A;  4PA7 A;  4G27 B;  1NQT A;  3FB7 C;  3JAK B;  5K1X A;  4LF4 O;  1SQP H;  1JFF B;  1WN7 A;  1XMO O;  2Y0I A;  2QTS A;  1AR5 A;  3H1K H;  4DRX A;  4EFB A;  2W6J G;  4JV5 B;  2P90 A;  4I0X A;  4JAS A;  2EX3 A;  4I50 A;  1IZ3 A;  1Q5O A;  4JTA B;  4UCV A;  1XDC A;  3C3S A;  3M99 B;  2KKW A;  1N0J A;  2PI5 A;  5BMV A;  4DO2 A;  5B3S C;  3K0G A;  4B3M B;  4LF5 B;  4X9Q A;  4WFF A;  5IJ0 A;  2EIN B;  4O2A A;  1N34 B;  1TUE B;  4CZZ A;  5H6Q A;  3JD2 A;  1VMG A;  1QU7 A;  2YI8 A;  1V9P A;  4RQE A;  3T4Z A;  3CHX A;  4DR5 B;  1KU9 A;  2ARH A;  1AI7 A;  1F51 A;  3TJT A;  1QVF U;  1SQX H;  1XMQ B;  2FL4 A;  1IDS A;  3H1H H;  1IXM A;  2AXT Z;  5J9P C;  1K3E A;  3SJQ C;  3ML0 A;  3D36 A;  4YJ3 B;  1B6Q A;  5KHK A;  5JQG A;  4H0L B;  1GM8 A;  4TQF A;  5CA1 B;  5JH7 A;  1M1K W;  2ZDI A;  1FD9 A;  2BTQ A;  4HNA A;  3W7T A;  3UQ8 A;  4BIO A;  4B3M O;  4KXR A;  1OCZ C;  4LF5 O;  1RFY A;  2NN4 A;  2ZIO A;  4O4L B;  2HJD A;  4KP4 A;  4X20 B;  2AW9 A;  5IY5 C;  3IC7 A;  2E5L B;  1HR0 O;  1I94 B;  3E22 B;  1IXB A;  1EBO A;  4D7S A;  4DW0 A;  1N0N A;  1FXK A;  4K8Z A;  1JR9 A;  1YJW V;  1P84 F;  3MD0 A;  4IIJ B;  1X59 A;  3SYA A;  2HG5 C;  3T1H B;  1KBH A;  1HP8 A;  1RM1 B;  3BVO A;  3G71 V;  2WA4 A;  3R66 A;  2QR4 A;  4UB8 Z;  1GRJ A;  3AG4 C;  3VQY A;  1BQ0 A;  4QNH B;  3J80 N;  1HNZ B;  4DUZ O;  3OUF A;  1R3K C;  5CA0 B;  3K57 A;  1WA8 A;  4PHZ A;  2PF4 E;  2EIK C;  1ROP A;  4YHH B;  3OMN B;  2W0X A;  4FIP C;  1K73 W;  3ZX6 A;  3FB5 C;  2OTJ V;  1HNX O;  1R3J C;  5HFL A;  4B7K A;  3DC6 A;  4QPK A;  3ZIA G;  3HKB B;  4JAV A;  4JAA A;  4PDR A;  1QLN A;  3KCX A;  4UUJ C;  3TGU H;  4UCO A;  1Y76 B;  2ZE5 A;  4O4I B;  1I94 O;  1S5J A;  2VWK A;  1K4C C;  4X64 O;  1J5E O;  4JTD B;  2UXC B;  1Q86 W;  3ZBH A;  4FLX A;  2ODM A;  3T1H O;  2R9A A;  4J10 A;  3HKD A;  1H38 A;  5J2T A;  3GWO A;  3BHP A;  1FFX A;  4X1I A;  3CCS V;  1FPO A;  1N4C A;  2UU9 O;  1V54 B;  4TOI A;  3AK1 A;  3RBZ A;  1HW7 A;  4LWS B;  3WG7 C;  4DUY O;  2MW2 B;  3LDE A;  5L3D A;  5LGU A;  4K0K B;  2Q67 A;  2UXD B;  1LNQ A;  3SYC A;  4JYA O;  4FFB A;  4MS2 A;  2LO1 A;  2QTO A;  4LFC O;  1PV0 A;  3J81 N;  2XT9 A;  4MVU A;  1QCE A;  1ZUQ A;  4LH7 A;  3W7W A;  2CUG A;  4YXW G;  2ZXW C;  3JCZ A;  4O4J A;  2DYR C;  4I4T A;  4EB6 B;  2R9I A;  4NXM B;  2WAM A;  4W4K A;  3AG3 B;  5FPR A;  3FYI B;  1R6T A;  5LGN A;  4GX2 A;  2QDO A;  2ZNI A;  4ZI7 B;  5LXT A;  1BS3 A;  5IYC O;  2VS0 A;  1VQ8 V;  1XUQ A;  2ADP A;  5KHH A;  1PPJ H;  3IC9 A;  5IYD O;  2QWQ B;  3E8G A;  4DW1 A;  1AJP A;  2B1G A;  2K1E A;  1M56 B;  4P9P A;  4K0K O;  4PDV A;  4LFB B;  1K7D A;  2JEX A;  3JSN A;  4PA3 A;  3SJC C;  3N2K B;  4TV8 A;  1VEW A;  1KP3 A;  3WFV A;  3AK3 A;  3CP1 A;  4UVA A;  1QVG U;  2HHH O;  4IGG A;  3OMI B;  4JZG A;  4BW5 A;  1VP7 A;  1ZTE A;  1SS3 A;  3ABT A;  3I56 V;  1XEQ A;  1ORQ C;  1H8H G;  3RVZ A;  3JAS B;  4LF8 O;  1M57 C;  2NLJ C;  2Q0A A;  1OCO B;  5IT9 N;  2PZS A;  3ABU A;  5EIB D;  5LHH A;  1NVP B;  4NTX A;  1TUB B;  3L75 H;  2RJZ A;  3CXC U;  1NTM H;  1OV9 A;  1R6N A;  2IJK A;  1HWY A;  2XAH A;  4DV1 B;  3LNN A;  2IH1 C;  4G28 B;  5B1A C;  4MTX A;  3L70 H;  4UFZ A;  2RNB A;  4IYH A;  2PI4 A;  3DXR A;  4LFB O;  3WB0 A;  1F4N A;  2LQT A;  4J9Y B;  1EN4 A;  2P7T C;  4AQY B;  1YI2 V;  3OGI B;  4NB5 A;  5H2F Z;  4JI0 O;  1Q6U A;  1N36 B;  5EBW C;  4GUN A;  1SKV A;  4GZR B;  1PNL A;  2EJ7 A;  2UUA B;  1JCH A;  2ZE7 A;  2PGG A;  1SQB H;  3UCS C;  4DV4 B;  4F4L A;  1R73 A;  4DV2 B;  5LP6 A;  4JI1 B;  1FS0 G;  1QR9 A;  3JSL A;  4ZHQ A;  3ZHT A;  4WFG A;  3BA9 A;  1K4D C;  4Z2W A;  1S0V A;  3RYI A;  4P30 A;  2GUZ A;  2Q9L A;  1PL4 A;  3G80 A;  3OEE G;  2LFS A;  1XL6 A;  5JCO A;  5KMG B;  3P32 A;  1Y74 A;  5L3E A;  1KKD A;  3F5W C;  1K8A W;  4CS4 A;  3L73 H;  4R7C A;  2QWO B;  2QM7 A;  3OW2 U;  4KHP B;  4FPP A;  1HDJ A;  1NJI W;  2EIM B;  3G6E V;  3H1L H;  4UB6 Z;  4UVC A;  4KFM A;  4AQY O;  3M8A A;  5IYZ A;  3MDS A;  3ETD A;  4TUY A;  1N36 O;  2OCH A;  3T1C A;  3ETQ A;  5CB4 B;  4ZIB A;  2WLI B;  3AG1 B;  4OXS A;  5CBH A;  2DWE C;  2UUA O;  3CCV V;  4CH4 A;  4YIP A;  3OD4 A;  1NH2 D;  4MVZ A;  2YXY A;  4L87 A;  5IJ9 A;  4O2B B;  1WB7 A;  1VQL V;  4JI1 O;  1NZ6 A;  2X6B A;  4IT5 A;  5LOV A;  4LFA B;  3HB3 B;  2Y4U A;  2EIN C;  1ZLZ A;  2GHY A;  3L74 H;  2EZO A;  4I55 B;  1TAE A;  1BSM A;  2H94 A;  2Q5Z A;  2WLM A;  3UT5 B;  5JVD B;  4LCU C;  2AHY A;  3CCR V;  1XRE A;  4GLX A;  1YDX A;  2RMK B;  3CMA V;  4DV7 B;  3JD4 A;  4BAY A;  3ABK B;  5K1P A;  4PI2 A;  4CH6 A;  2DYS B;  2OYQ A;  3BFR A;  3ZHU A;  2UXB B;  4QIW F;  3CPW U;  1VQM V;  3FB8 C;  4K35 A;  2Q6A A;  2ZR3 A;  2P6J A;  1RSO A;  2BE3 A;  2IM9 A;  4OPH A;  2P4V A;  4ZBM A;  3ZS8 C;  1MG1 A;  4WFH A;  2WLL A;  2OIE A;  1WB8 A;  5IDJ A;  2X6A A;  3QO8 A;  1YF2 A;  2AZ0 A;  2A7W A;  4LFA O;  2X0L A;  5ITZ A;  4CH5 A;  2QWN B;  4E4E A;  2BCC H;  1F23 A;  4WBN A;  4X1K A;  2F95 B;  4FM2 A;  4PDL A;  5H6R A;  4X1Y B;  3W7X A;  3VOU A;  4I0X B;  4EKW A;  3NR7 A;  4I50 B;  1SA0 A;  5LMU B;  1RM1 C;  5BMV B;  2P5O A;  4W4L A;  4WFB V;  1JPX A;  3FD9 A;  2QSA A;  3ZRW A;  3JCU Z;  2E74 B;  1DK1 A;  2UXB O;  4XBF A;  4ASU G;  4TV9 A;  1QNM A;  4X66 B;  2CE4 A;  1VAR A;  3T4D A;  2OT5 A;  2M7W A;  1I5X A;  4D7T A;  2GV9 A;  3ZHS A;  1N8R W;  3VQV A;  4DK1 A;  2LW7 A;  3BY6 A;  4WCE V;  1BT8 A;  4YJ2 A;  2ZR2 A;  2ITD C;  5LYJ A;  3RT3 C;  1PNM A;  4JI3 O;  2JS3 A;  4KL1 A;  4LF4 B;  3CME V;  1OCR B;  4EFE A;  4LNU B;  5B1B B;  2DJV A;  2UUC B;  1CXZ B;  4LF9 B;  4RUF A;  4DR7 O;  1W2B U;  4QPJ A;  1K33 A;  3BAA A;  1S3J A;  2EUL A;  1GM7 A;  3JAR B;  2UXN A;  3CB2 A;  4F6R A;  2WPD G;  1Z2G A;  3QG5 A;  1V54 C;  4HBN A;  3SGI A;  4MVS A;  2W6I G;  1V55 B;  4UV9 A;  1FXV A;  2ZIN A;  3GB7 C;  4RUE A;  5CBG A;  1NKD A;  4JAU A;  3B77 A;  1IX9 A;  2N04 A;  5DEC A;  4U7N A;  5L3F A;  2GTS A;  1YIT V;  1W0J G;  3THO A;  2CDY A;  4OPA A;  1A32 A;  5BZB A;  4P9O A;  2B9Z A;  3CXH F;  3OUS A;  4H37 A;  3AG3 C;  2JDI G;  2UUC O;  4B3R O;  1UFI A;  4LF9 O;  5GTH Z;  3EHB B;  3BRC A;  4Q6G A;  1D5A A;  4DV0 O;  5TIS Z;  3G4S V;  1ZWI C;  1H2N A;  4DXW A;  1ARO P;  1P49 A;  1GO3 F;  2AHZ A;  1GN4 A;  4I5S A;  1PP9 H;  1WP7 A;  3OTO O;  3TXQ A;  3CCE V;  4DR1 B;  1S72 V;  3ZHV A;  2C2A A;  3CWB H;  1ZAU A;  2BSK A;  1M56 C;  4GX1 A;  1SF9 A;  1HR0 B;  1K34 A;  3I5D A;  3B09 A;  1X4T A;  4A5U B;  4DR3 O;  5J2T B;  3Q4H A;  4G2K A;  1Y4M A;  3OTF A;  1H2M A;  5LHG A;  3K0D A;  4DUZ B;  4FM1 A;  1SQV H;  3TET A;  4O4H B;  4PJ0 Z;  3VQW A;  1ZL8 A;  1GM9 A;  3CE2 A;  3K9A A;  3KZI Z;  2PYJ A;  3T1Y B;  4FLY A;  1OCO C;  2F1M A;  1W59 A;  1YEW A;  2ATK C;  4PA6 A;  1P7G A;  3H9V A;  1M9N A;  5FLX N;  3ICX A;  3A0R A;  1HNX B;  3BA8 A;  1EN5 A;  2OTL V;  4J80 A;  4QJF B;  3AG7 A;  3K3W A;  2FTK A;  2IU3 A;  5LHI A;  2YIC A;  4FLU A;  1THZ A;  3AG2 B;  1XI1 A;  4DR1 O;  2RDC A;  5EZY A;  3DTU B;  1FYJ A;  1H2K A;  1BHB A;  1GK9 A;  1H2S B;  4WFE A;  4X64 B;  2EBO A;  4BWA A;  2CK3 G;  1J5E B;  2A3Q A;  3N2G A;  3OAA G;  2F4V O;  3CSX A;  4HAM A;  4MVM A;  3U11 A;  4NR1 A;  2NR5 A;  3JAM N;  5A2Q N;  3FAV B;  2R9R B;  1KYO F;  4X8A A;  2JIZ G;  1R1B A;  5CA3 A;  3CS5 A;  3HKC B;  2UU9 B;  3ABL B;  3RYF B;  3A2F A;  3RYH A;  4J42 A;  4LF7 O;  1NT2 B;  2QM8 A;  3T1Y O;  4DUY B;  2LGQ A;  3B40 A;  3F7Y C;  3FFQ A;  2JJ2 G;  4BIZ A;  1VF6 C;  4JYA B;  2V4D A;  1WLE A;  1GH6 A;  3A0H Z;  4HYO A;  4IHJ A;  4TV8 B;  5IE9 A;  1YHQ V;  4LFC B;  4GKK O;  2YC0 A;  5FNV A;  4FLT A;  3EVK A;  4I7Z B;  3JAK A;  4ICG A;  1VQ6 V;  1JFF A;  2R72 A;  2UXX A;  2WWW A;  4UV8 A;  3CC2 V;  5LMN O;  2E3C A;  1COW G;  2YI9 A;  1VIB A;  2EIM C;  2Q69 A;  3JAW B;  4FMT A;  1FXH A;  1YZB A;  3RWR D;  5J2U B;  4B3T O;  3AG1 C;  4CC5 A;  3P3P A;  4NTW A;  2F43 G;  4J7K A;  3WB1 A;  3DXR B;  2FML A;  5IYB O;  1I5Y A;  1L1F A;  4R6Z A;  4N23 A;  3ASN C;  4RWU A;  1Q8I A;  1AJQ A;  2XUM A;  2WLH A;  4FLV A;  3U10 A;  2XAJ A;  2HHH B;  4FJC C;  1B06 A;  1AR4 A;  4X88 A;  2ZE8 A;  2ZQM A;  2JGD B;  3ABK C;  4YJ3 A;  2CTQ A;  4LF8 B;  3G67 A;  4X62 B;  2DYS C;  2BOC C;  1O9G A;  2QKA A;  2EIJ B;  5CA1 A;  1GN6 A;  3P30 A;  2XAF A;  3N27 A;  2F66 C;  1S77 D;  3QO7 A;  4IL6 Z;  1QLE B;  1KB9 F;  1R3L C;  2HLD G;  1CEZ A;  2VWJ A;  4O4L A;  4LF6 O;  1IVS A;  5GON B;  2IW5 A;  4JI8 O;  1K92 A;  2VQE O;  5EC1 C;  3K5L A;  3E22 A;  2A06 H;  3HR0 A;  5KX5 B;  1AP6 A;  2DW4 A;  1QBZ A;  1AR1 B;  4JI0 B;  3L71 H;  5EYP B;  3APQ A;  1L8D A;  4PA4 A;  3RN4 A;  2O57 A;  3LUT B;  4XDJ A;  1WP8 A;  3GWK C;  5FPO A;  5CA0 A;  2HVJ C;  4BR6 A;  1U97 A;  2F93 B;  4FM0 A;  3B2E E;  1CP9 A;  1US6 A;  1URF A;  3QNE A;  4X62 O;  1P7B A;  4ZOL B;  2CGO A;  3KKY A;  2Q0O C;  3CRA A;  1IBM O;  4B3S B;  3LSU A;  2D3O W;  1WPX A;  3HKB A;  2G38 A;  1OCC B;  3APO A;  1ENV A;  3OMA B;  2HVK C;  1L0L H;  4AI8 A;  5KLV H;  1Y76 A;  3CCL V;  5EK0 A;  4O4I A;  1MNG A;  5H9C A;  5KA5 A;  2HP8 A;  3WB2 A;  3JAL B;  5DED A;  1LR1 A;  2ZCE A;  1OCR C;  3E2E A;  1NH2 B;  5B1B C;  1SRY A;  4JI2 O;  1AJN A;  4DR6 B;  3PJS K;  3E83 A;  4MTO A;  3K79 A;  4CS2 A;  2NNU A;  1EN6 A;  1VQ5 V;  2IJJ A;  2YUA A;  3HKE B;  4MVR A;  1YIJ V;  1YJ9 V;  4JYY A;  2DMX A;  3ZHQ A;  1VQ7 V;  3K08 A;  5ITZ B;  1RPO A;  4LWS A;  4UCR A;  4WBN B;  2QM4 A;  4MT8 A;  5D5P A;  2ADQ B;  1M93 A;  1V55 C;  3ZMV A;  5C8Y B;  4UVB A;  1Y66 A;  1YSC A;  4B3S O;  4U3J B;  5A9G A;  1H2G A;  1OJH A;  1XNQ B;  1JA8 A;  2F23 A;  2JRI A;  3K04 A;  2VQF B;  5KUM A;  1B04 A;  3JD1 A;  2YXH A;  2FYU H;  1MOF A;  2PYL A;  4FVM A;  1Z5W A;  4LP8 A;  2Q7E A;  3O65 A;  2B1I A;  4JI5 O;  4DR6 O;  1I0H A;  3H1J H;  4U7O A;  4ZI7 A;  4FK5 C;  3RVY A;  1SES A;  3E8H A;  4J9Z B;  1FFT B;  2GBO A;  4E2L A;  2ZM6 O;  3BCC H;  2M6Y A;  4YJ2 B;  1XQ8 A;  5LYJ B;  3ZRS A;  2A9H A;  2XOK G;  4KUM A;  4DV6 O;  1Q7Y W;  2DOS A;  3J7A U;  1Y67 A;  2EZP A;  4CH3 A;  4NKG B;  4DV5 O;  3ASN B;  1IBL B;  1GN2 A;  3N2K A;  2OWO A;  4CC6 A;  1XNQ O;  2VQF O;  3QF7 A;  3K5M A;  3RYC B;  1BQZ A;  2KSD A;  3JAS A;  3CJH B;  4UXN A;  2YS8 A;  1TUB A;  5FL7 G;  1G1X B;  1RPR A;  1J95 A;  5LA6 A;  2HEP A;  1Y6X A;  2MK3 A;  4FZ0 A;  3BPZ A;  3CRQ A;  5GW7 A;  5EBM C;  4OX9 O;  5B1N A;  2AZ2 A;  2L35 A;  3OEH G;  2RCV A;  3MHS C;  5C93 A;  2ZKO A;  1BMF G;  3DC5 A;  2FKX A;  3AG2 C;  1YXB A;  2GSM B;  2HJF C;  4GYC B;  4JI3 B;  3K58 A;  2ILM A;  4J7Z A;  4JPR A;  2DWD C;  4DRX B;  4QE7 A;  1IBL O;  4MW3 A;  1GTO A;  1WPB A;  2UUB B;  1XHX A;  1MZF A;  5IWA B;  2FB5 A;  4LR3 A;  5LGT A;  4DR7 B;  5E1A C;  1YTF D;  1QR8 A;  3QO5 A;  1N32 B;  5IJ0 B;  2BSK B;  3SJB C;  4O2A B;  4OGQ B;  3ABL C;  2GDS A;  1N33 O;  1TA8 A;  1VF6 A;  2YEV A;  1JJ2 U;  2KQX A;  1MZE A;  5KAI Z;  1S5L Z;  1TVK A;  3OT7 A;  1VQO V;  5KMG A;  2K9P A;  1K5Q A;  4GT1 A;  3E8F A;  3DGE A;  2QA4 V;  4JGS A;  1NR7 A;  5KUK A;  1EZV H;  2P22 C;  3ASO B;  1XNR O;  3ZMU A;  5JQG B;  4FLZ A;  3K03 A;  4K3A A;  2WLJ A;  3DSQ A;  5JH7 B;  3L72 H;  2VRZ A;  2IJH A;  1EZJ A;  5CB4 A;  2WLI A;  4B3R B;  1KQS U;  2L6L A;  2UUB O;  1LUV A;  2BTQ B;  4HNA B;  5IWA O;  4DV0 B;  5LL6 Y;  1XOU A;  2OCC B;  3HPL C;  2DE0 X;  1SQF A;  2V7Q G;  4O2B A;  4B7E A;  4U3F H;  1D5N A;  1N32 O;  1YJN V;  3JYC A;  3OTO B;  3UM7 A;  2XTA A;  5CMU A;  3A8T A;  4PA9 A;  1NTK H;  3SYO A;  4TQD A;  1FJG O;  1FXK B;  2A79 B;  3UT5 A;  3D3I A;  1AI5 A;  4UCT A;  2PUS A;  5HFM A;  5JVD A;  1UJW B;  2CH7 A;  2EJR A;  4DR3 B;  3JAT A;  2WA3 A;  1JJO A;  2LGW A;  1SER A;  4GX5 A;  1NTZ H;  4PI0 A;  4FLW A;  2ETN A;  2PTM A;  1M5I A;  2HKO A;  5JJJ B;  1WA8 B;  4Z1V A;  4RAI A;  2W0F C;  3ZED A;  1F4M A;  4JI7 B;  4X65 O;  3ABM B;  3W7S A;  2EIJ C;  2Q7G A;  4H44 B;  4Z1M G;  4N21 A;  3NXS A;  3R65 A;  3CRR A;  1AI6 A;  3CYO A;  3ZMT A;  1QLE C;  5FNV B;  3A0B Z;  4GKJ B;  1KC8 W;  3H01 A;  4TWK A;  1DLB A;  2XAG A;  1PD3 A;  2BOB C;  4ABM A;  2QGN A;  4MVQ A;  2Z5U A;  4X1Y A;  3UKM A;  1MSD A;  2IBZ H;  4P2Z A;  4TT3 G;  4YY3 B;  3CCQ V;  3HKD B;  2F4V B;  3S3X A;  1R6K A;  3CEI A;  2JS5 A;  1FFX B;  4X1I B;  3RGB A;  1QQC A;  2AGA A;  4K8X A;  4AHC A;  2EIL B;  1O9H A;  3IGA C;  3W7U A;  2CTP A;  3K06 A;  2YIB D;  3OR6 C;  2GTA A;  4JYC A;  1R3I C;  3SPI A;  4JI7 O;  1PL0 A;  3FX7 A;  3ZMS A;  1KEC A;  4LF7 B;  3K59 A;  4FFB B;  1QHT A;  4Q20 A;  3ZN0 A;  3U0Z A;  1Q43 A;  4NXN O;  1BE3 H;  5DN6 G;  2YSU B;  1G6U A;  4GKK B;  4GKJ O;  1BGY H;  1OCC C;  3I55 V;  5F2V O;  4O4J B;  3L9D A;  4I4T B;  3E86 A;  3ZJZ A;  3ZRX A;  3O9O A;  5BR8 B;  2KG7 A;  3UO2 A;  3MAQ A;  5LMN B;  4LNU A;  4JV5 O;  3B4S A;  3S3W A;  3STL C;  1Q6H A;  4MVO A;  5EC2 C;  4YY3 O;  5LXT B;  2A0L A;  5DM6 V;  3KG2 A;  2YIB A;  4B3T B;  1MSW D;  3SDL A;  2QKC A;  1NU1 H;  1PNK A;  3M7M X;  3SJA C;  3OE7 G;  5B1O A;  3JAR A;  1SC5 B;  4ZKI A;  1N34 O;  4UCS A;  5B66 Z;  1VQN V;  4GCZ A;  1DGS A;  3QTC A;  2QWR B;  1CPY A;  4DR5 O;  1K5S A;  3IJ4 A;  5CN0 A;  1XMQ O;  1XBL A;  1DTO A;  2YDE A;  1IBK B;  1NBM G;  3VBB A;  3PN1 A;  1Q3E A;  1VQ4 V;  1BHA A;  3SPG A;  1E1R G;  1M90 W;  2OIG A;  3K5O A;  5BR8 O;  2Q73 A;  2XAS A;  1WJZ A;  2LJ2 A;  1SET A;  1UPG A;  3ETE A;  5AG2 A;  3CRC A;  2XHB A;  4PEL A;  2QE7 G;  4PV1 B;  1G4Y B;  2YID A;  4H33 A;  2QEX V;  1B3Q A;  2H8P C;  3CRM A;  1PKX A;  3RFR A;  2Z0A A;  2E5L O;  4LF6 B;  1SQQ H;  4B08 A;  4JI8 B;  2VQE B;  2IH3 C;  5CBF A;  3CCJ V;  4DV3 B;  3JD0 A;  4PD4 F;  2P4K A;  3GVM A;  1VQK V;  1IBK O;  1DF5 A;  2Y69 C;  1HNZ O;  2N05 A;  1VF5 B;  3STZ C;  4UCU A;  2R70 A;  2Y48 A;  5LP6 B;  4JYB A;  4O4H A;  3X2Q B;  4YHH O;  2Q8V A;  1AVM A;  4DK0 A;  3LSS A;  4ZHQ B;  3RYI B;  2PY5 A;  2B5U A;  1EM1 A;  2GUZ B;  2Y4T A;  1MAB G;  4FZ1 A;  3FB6 C;  1GN3 A;  4JTC B;  1IBM B;  1S76 D;  3SPC A;  1Y74 B;  3OM3 B;  4BIU A;  3MHH C;  4J41 A;  4MSW C;  2H3O A;  3LDD A;  4WF9 V;  1XL4 A;  4X20 A;  4IYI A;  1S5H C;  2UXC O;  4DV3 O;  4LC1 A;  1OZ0 A;  5IYZ B;  3P3N A;  4TUY B;  2ZNJ A;  5E79 Z;  4IIJ A;  4JI2 B;  2DN9 A;  4TSF G;  1YCI A;  3D8C A;  4JI4 B;  3CC4 V;  4R8C A;  3FAV A;  5B3S B;  1BL8 A;  2BTO A;  5IJ9 B;  5LBQ A;  3HKC A;  2CTW A;  4YIO A;  5LOV B;  2JJ1 G;  2JVD A;  3TK1 A;  3RYF A;  3SPH A;  3H1I H;  3TCU A;  2UXD O;  4NYK A;  1H2L A;  4DR4 B;  4R50 A;  3FYE B;  2P67 A;  5JJN B;  1VQ9 V;  3CCU V;  3B8M A;  1H8E G;  4XDL A;  4BW9 A;  2E75 B;  4F6E A;  5EBL C;  2DQ3 A;  5KA6 A;  4EEQ A;  1T5E A;  3VQX A;  2ZIM A;  4NXM O;  3D36 C;  3ASO C;  3JAW A;  4MTF A;  3G6B A;  4RQF A;  3WU2 Z;  5LA6 B;  3ZN1 A;  5KAF Z;  4JI5 B;  5J2U A;  4NVP A;  4QGP A;  2ZDI C;  1RSO B;  3BEH A;  4JI4 O;  2WLN A;  2HR3 A;  3D3Q A;  2WLL B;  2ZM6 B;  2OCC C;  1OCZ B;  1E79 G;  5IY5 B;  3CX5 F;  1WAZ A;  1PM9 A;  4DV6 B;  5JJE B;  5KHJ A;  1NS1 A;  4X1K B;  2WSS G;  4DR4 O;  3ZMZ A;  3KCY A;  1FXK C;  3UO3 A;  1SA0 B;  4DV5 B;  3ZHR A;  3AG4 B;  1BCC H;  3IAY A;  1MA1 A;  1AIL A;  2CTR A;  2EIK B;  2JGD A;  2IU0 A;  4LBE C;  4AIL C;  1FAF A;  3ZRW B;  4DR2 B;  4EB6 A;  1ZSP A;  2YEV B;  1BZK A;  3ABM C;  4TV9 B;  2HFE C;  2X7R B;  1K97 A;  1RP3 B;  1TVK B;  1XIL A;  4DV1 O;  2ZT9 B;  1EFR G;  5BXZ A;  3OFN G;  1NVP D;  4C7U A;  4OX9 B;  1KP2 A;  5L3C A;  1GKF A;  3E8B A;  5GON A;  1LUW A;  1K9M W;  1HNW B;  5KX5 A;  2E76 B;  4JZ2 A;  1U96 A;  2ZD9 A;  5EYP A;  3ZRV A;  1YTF B;  2X6C A;  3B8N A;  2Y69 B;  2XAQ A;  1JMK C;  2Y0P A;  4DV4 O;  5H5N A;  4DV2 O;  2Z3Y A;  1Q6I A;  4LH6 A;  2CAZ C;  2EIL C;  2LP7 A;  1P4R A;  3WG7 B;  1IUR A;  4DR2 O;  4F6R B;  4HZ3 A;  1GMG A;  4ZOL A;  2JGU A;  3SR2 C;  1N33 B;  4D6T H;  2LFR A;  4H13 B;  1NI8 A;  2YXL A;  4JI6 B;  1Q81 W;  2CH7 B;  3K9S A;  1AB3 A;  3JAT B;  4QE9 A;  3SPJ A;  3LSQ A;  1SZX A;  5L3G A;  2QWP B;  2ZXW B;  2DYR B;  1KUQ A;  4KHP O;  4FFK A;  3JD3 A;  3JAL A;  1HNW O;  3C90 A;  1XNR B;  3F5T A;  3LNM B;  3FKS G;  1VF7 A;  1OHH G;  1D2D A;  3E35 A; 
#chains in the Genus database with same CATH homology
 4UB8 Z;  5KAI Z;  1S5L Z;  5E79 Z;  4PJ0 Z;  3KZI Z;  3WU2 Z;  5B66 Z;  5H2F Z;  4UB6 Z;  4IL6 Z;  5KAF Z;  5GTH Z;  5B5E Z;  5TIS Z;  5GTI Z;  3JCU Z;  3A0B Z;  3A0H Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...