3A0HZ

Crystal structure of i-substituted photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 18
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0hZ00
5B5EZ 4UB6Z 3WU2Z 4PJ0Z 4IL6Z 3JCUZ 2AXTZ 4UB8Z 5TISZ 5GTHZ 5KAIZ 5B66Z 5KAFZ 3A0BZ 1S5LZ 3A0HZ 5E79Z 5H2FZ 3KZIZ 5GTIZ
chains in the Genus database with same CATH superfamily
2VS0A 1WP8A 3TJTA 5LP6A 1BGYH 1VP7A 2ODMA 4LNUB 5LHIA 2XHBA 1IURA 1I7FA 1AROP 2YIAA 2BSKB 3B77A 2YIBA 2MW2B 3MHHC 2CE4A 5KX5B 3A2FA 2ZE5A 4OGQB 1KP3A 2QM8A 3J81N 2OYQA 1JR9A 3FB8C 2OIEA 1NVPB 2PF4E 4D6TH 1ZSPA 1S0VA 3SPHA 3ZN1A 2UUAB 1JA8A 2F66C 5IWAB 2JEXA 3M8AA 3Q4HA 2Q68A 2QR4A 3E89A 1ZTEA 3OTFA 3ZN0A 2PUSA 4IHJB 1Y76B 4DR4O 3AG1C 2UXBO 2ETNA 4DV3B 3JD0A 5EYPA 3CE2A 4DYLA 4TV9A 2CTRA 3SJCC 4Z2WA 1ZL8A 4DR7B 2EINB 3ML0A 1GN2A 4RUEA 4ICGA 3ASNB 3BHPA 3JD1A 1K73W 1AI5A 4WCEV 4PA4A 2AW9A 1AR1B 5CB4A 5ITZB 5KA6A 4JYAO 1AP5A 2GTAA 3FKSG 2RMKB 3F7VC 1S5JA 1HR0O 1VF7A 1KQSU 4D7SA 4O4JB 4TT3G 2WLIB 4CH6A 3E83A 5BZBA 2PY5A 1GN4A 2OTJV 1H2KA 3B2EE 2Q67A 5LP6B 5LMNO 4OX9B 4JAUA 4X88A 4ZBMA 4EFBA 4DR2O 4J7KA 2ADPA 2R70A 2Z5UA 4F6RA 4ASUG 1NU1H 2YICA 3BA8A 1BL8A 3ZHVA 4BAYA 3CXHF 1PM9A 4WBNA 2LW7A 4DV0O 2ZD9A 3CRCA 4MT8A 4FLXA 2FKXA 5BR8O 3DGEA 5F2VO 4X65B 1OCZB 1GM9A 4ZHQB 5KUMA 2YIDA 2KSDA 2ZINA 1B06A 2M6YA 2UU9B 2V4DA 2DJVA 3FYIB 4PA6A 4FLYA 5GONB 2ZIOA 2IM9A 4DV1B 3BA9A 1ZL8B 4MVUA 3ASOC 2QTSA 3P3NA 3K03A 1F4MA 5B1BC 3RYFA 3JCUZ 4HNAA 4OXSA 1ZWIC 3I5DA 2UUAO 5IWAO 1R6KA 4LF6B 2A3QA 1F4NA 3TK1A 4FPPA 2D3OW 4FVMA 4DV3O 4KFMA 1EFRG 2ZNIA 1GN3A 1VQ7V 4DR7O 1FXKC 2M7WA 5GTHZ 2EILB 3OR6C 5A2QN 1BSMA 1O9GA 2B1GA 4MTFA 4UCRA 4JI3B 4PV1B 1VF6C 5B1NA 2CK3G 3OGIB 5B3SC 1YCIA 5JVDA 1TGOA 2B5UA 4H33A 5CN0A 4I5SA 1EBOA 1OJHA 3K79A 5H9CA 4UCUA 3CC7V 3S3XA 1WAZA 5A9GA 1R3KC 1VIBA 2LJ2A 3OUFA 3WFVA 2ZR3A 2E76B 1AI4A 3CMAV 4K8ZA 4AQYB 4OX9O 1WA8B 4EKWA 1SQVH 1D2DA 4FMTA 3ZMVA 3UKMA 1R6NA 4UVCA 2AZ0A 4F4LA 1NTMH 4TOIA 5KAFZ 1IVSA 1YVWA 4CS3A 2H8PC 3WG7C 3E8FA 5JH7A 1Q81W 3K5MA 1O9HA 3N27A 2UUCB 1AB3A 4X65O 4I4TA 3SYOA 1FXHA 5EBMC 3RYFB 4NTYA 2LO1A 3CCUV 2WLNA 2A9HA 1RPOA 4KUMA 4J42A 2JRIA 1EN4A 2N04A 2QKCA 2ATKC 4X66B 2UU9O 1AJQA 3ZHRA 1F51A 2FYUH 5GTIZ 4CH4A 5FL7G 3ZX6A 1VQPV 1YTFD 1YITV 1JMKC 1VQNV 1LR1A 3CRMA 4DV1O 1PD3A 3R65A 2B9ZA 1SQPH 5KHIA 3HKBB 4DK1A 4K8XA 4JTAB 1UFIA 4JI7B 1VQMV 4WFAV 4R8CA 5B66Z 1Q7YW 1GM7A 2EIJC 3J80N 5EC1C 3SYCA 1R1BA 2IJIA 5B1AB 4LF6O 2YI8A 1SETA 4DRXA 3ZIAG 1IBLB 2OCHA 2DWDC 2XAHA 4I7ZB 4MS2A 3G80A 4DV2B 1Q43A 4X62B 1JQ0A 5J9PC 4MVMA 1H2LA 4FIPC 3CS5A 1VF5B 2RCVA 5L3GA 4JI3O 2BTQB 3RYIA 3RWRD 1WPBA 3BABA 2WLLA 2YUAA 1Y4MA 5JWPA 3CCEV 4UCVA 2P7TC 4FLZA 4X1KA 4U7NA 3L72H 3SPCA 4LP8A 4BIZA 1WP7A 1HDJA 1HW7A 4X8AA 5JJNB 4G27B 2NLJC 3T2MA 4EB6A 3HB3B 3CSXA 2NN4A 5KHHA 1FFXA 1G8MA 4R7CA 3I56V 3CCMV 3ZMZA 3H9VA 3CJHA 4I0XA 4JZGA 2Y69C 4PJ0Z 4DUZB 4AQYO 2LFSA 4X20B 3K58A 2VQEB 2LFRA 1NH2D 2Q5ZA 3ZRVA 1OCOB 2G38A 2K1EA 2H94A 1S5LZ 1MZFA 1XL4A 3QG5A 3SYPA 3B4SA 2Q6AA 1V54C 2UUCO 2EIJB 1T5EA 4NKGB 2QJ1A 3N2KA 2RN9A 1KECA 4O2AA 3NR7A 3DSQA 3SPGA 3VQXA 1SF9A 4LF4B 1P7GA 2HLDG 3L9DA 3P3PA 3K9SA 4X66O 1Q6UA 4WFFA 1MA1A 1D5NA 2HHHB 2IH3C 3K0DA 4RAIA 3STLC 1Q90D 2EZOA 1XILA 2UXCB 1JVMA 2QEXV 4FM1A 4GCZA 1ZAUA 4CC6A 4JI7O 4GX1A 1I5YA 1VQ9V 4DV4B 5EBLC 3QO5A 1CP9A 4X1KB 2A0LA 4MW3A 4NR1A 3G71V 1M56B 2F43G 1K4CC 2Q7GA 1CPYA 1PKXA 3GB7C 1IBLO 3C3TA 3K59A 4EB6B 1DLBA 2QWOB 2YS8A 4QJFB 5DM6V 4LF7B 4JI0B 1M57C 2PYJA 4DV2O 2NNUA 4X62O 4FFBB 4D7TA 3ZHTA 4I0XB 2Q8VA 4QE9A 4DXWA 5JCOC 2ZM6B 4YY3B 4BW9A 4B3SB 1EN6A 3ZHSA 1BHBA 4JI4B 2CGNA 4RWUA 2Q0AA 5CA1A 5KX5A 1I0HA 2DN9A 1SQQH 1GK9A 5K1PA 3BY6A 2EZPA 1Z5WA 1EN5A 1XOUA 1K5SA 2Y4UA 2IU0A 1OHHG 5FPOA 4I55B 5L3FA 2FMLA 2XNDG 3T4ZA 1PPJH 5IYZA 2EBOA 3K08A 3EXAA 4U3FH 4GX2A 4I50A 4IHJA 1Y76A 1BCCH 3OM3B 2WA3A 5EC2C 3OD4A 4DUZO 1M5IA 1XHXA 3SJQC 2E3CA 2IH1C 3TETA 3ABKC 2VQEO 3APOA 2LW1A 2ADQB 3IJ4A 4Z1VA 3ABLB 1F7YA 1H38A 2A7WA 3SYQA 4TSFG 2PI4A 3X2QC 1EZJA 3L75H 3JD4A 1HNZB 4LFBB 4B08A 1JJOA 2WA4A 3E2EA 5ITZA 5CBGA 3DC5A 4X1IA 1ZX3A 1RFYA 2XTAA 1SERA 2OTLV 4JI2B 4QPJA 3RYHA 5LGNA 3FB6C 1TAEA 3JSLA 5EK0A 2CTPA 4LF4O 3B8NA 4OPHA 1M57B 2XAFA 4BIOA 2HHHO 1XQ8A 1US6A 1I94O 4JV5B 2B1IA 4UB8Z 2GBOA 4J7ZA 1DTOA 2UXCO 5IY5C 1H2MA 3WB2A 5LOVA 3OMIB 4DV4O 4LFAB 5CA1B 4X64B 3K5OA 4LFCB 4C7UA 3WU2Z 2JDIG 2X0LA 3G67A 2BTOA 2EIMB 1NI8A 3ETQA 3U10A 1H8HG 2DOSA 5HFLA 4HYOA 3CC4V 4ZHQA 1YEWA 4LF7O 4JI0O 4PDRA 3OMNB 5E79Z 5IYZB 3IC7A 3AG2B 2HKOA 3EHBB 1P4RA 1KB9F 2ZM6O 1SQXH 4YY3O 4B3SO 2QSAA 4I50B 1XMQB 1IBMB 5GONA 4JI4O 3TXSA 4GYCB 4DK0A 4JAVA 1AJPA 1DF5A 1IX9A 1FYJA 1V55B 1QNMA 3H1KH 4NYKA 2HR3A 4WFEA 3CX5F 4Q20A 4FM0A 1NKDA 2R72A 2ZDIC 1Y6XA 1VQ5V 4CZZA 4JZ2A 3CXCU 2P90A 2FTKA 3J7AU 4X1IB 1DK1A 1Q82W 2X6CA 3CCRV 1WLEA 2FL4A 1AJNA 3RBZA 2X6AA 4XDJA 5D5QA 3RYHB 4H44B 1GRJA 5L3CA 2XAGA 1N0JA 2JGDA 2XUMA 4JI5B 2H3OA 1ENVA 1NZ6A 4W4LA 4R50A 2YDEA 5KHKA 5LXTA 4LFBO 1TUEB 5IY5B 2P06A 5LMUO 3UCSC 3L70H 2QWRB 2ZCEA 4WFHA 5EBWC 2AXTZ 1S72V 2QTOA 1XNQB 2L6LA 2N05A 1JX9A 4JI1B 5LOVB 2A79B 2KKWA 4JI2O 3CYOA 4P30A 4LC1A 3IAYA 2OCCC 1FXVA 3LNNA 1FAFA 1W59A 5JQGA 2BOBC 4Z1MG 1MOFA 2DE0X 1HWYA 2WLKA 3ZMTA 1WA8A 3O65A 4FLTA 2Q0OC 4JV5O 3AG1B 5GW7A 3CCJV 4GKJB 1SZTA 4JTDB 5CBFA 1RP3B 2BE3A 3EVKA 1WB7A 2Q4PA 4CH3A 4OPAA 3H1LH 3OFNG 4LH6A 4WFGA 4LFAO 4X64O 1K92A 2IJHA 3LDDA 4LFCO 4YJ3B 2QWPB 4U7OA 1WPXA 2K9PA 5L3EA 4FFKA 4X1YA 3H1HH 3RT3C 2Y0PA 2IBZH 3BFRA 3THOA 4YXWG 2RDCA 1V9PA 3ZRXA 1FPOA 1RM1C 1PV0A 3CP1A 3MAQA 2CGOA 1WNSA 1E1QG 3ZRWB 4NTXA 1XMQO 2EIKC 2QA4V 1IBMO 4B7KA 2XOKG 4UFZA 1QVGU 2D2CB 3E8GA 4B3TB 2QKAA 4NTWA 1VF6A 2JGDB 3RVZA 1U97A 3HKBA 5BXZA 3W7WA 5LA6A 3A0HZ 3K9AA 5LXTB 1ZLZA 4BR6A 5FNVB 1W0KG 5BMVB 3JD2A 2Q9LA 1HNXB 3L73H 1EM1A 4IL6Z 3SPIA 1MABG 2P4KA 3C90A 1QVFU 2V1DA 5FPRA 4PA9A 2JEUA 3ETDA 2WLJA 2EJRA 5JQGB 3QTCA 4QPKA 2ILMA 4JI5O 2BTQA 1QLNA 4UCTA 2AHZA 2HG5C 4J80A 3SJBC 3OTOB 1GKFA 5JJEB 1IZ3A 3AG3C 4G2KA 1FKAO 4B3MB 3ASOB 4JI1O 4G28B 1QR8A 5B1BB 4LF9B 1MZEA 2WPDG 1JJ2U 3CCVV 1K33A 2W0FC 2JK5C 2CTWA 4CS4A 3FB5C 4DR1B 4X1YB 5EZYA 1G4YB 2VQFB 2JIZG 4DW0A 4X20A 4MTXA 4GKJO 1E1RG 2ZR2A 4CS2A 1Q86W 4UUJC 4J9ZB 1FXKB 1SS3A 2OWOA 2DQ3A 3JAMN 3UQ8A 1LUVA 4B3RB 1AR4A 2YIBD 3JARB 3B8MA 1VQ4V 5B3SB 2QGNA 3AK3A 4HAMA 5LA6B 3GWOA 1BE3H 4YIOA 2X7RB 4NVPA 3CWBH 3TCUA 3T1YB 1WB8A 3BVOA 3MD0A 3H1JH 5IT9N 1JCHA 5KA5A 5LGUA 2DMXA 2P5OA 3K57A 4UV8A 3AG4C 4B3TO 1SQBH 2CH7A 3VQVA 3QF7A 4MVRA 3K0GA 1YJWV 3W7TA 1W0JG 1GN6A 3FB7C 1K3EA 2Y4TA 1NR1A 3JATB 2BOCC 1HNXO 2PTMA 3WG7B 3K3WA 3JAWB 1YJNV 1PNMA 5IE9A 2PGGA 1Y66A 2KB1A 1IDSA 2EX3A 4FFBA 1Z2GA 5EZYB 3C3SA 2V7QG 5H5NA 1OCCC 2X6BA 1QLEC 2HVJC 3CCQV 3L74H 5FLXN 2ZIMA 4QIWF 1FJGB 4B3MO 1SKVA 4XDKA 1QR9A 5KUKA 3M7MX 3K5NA 2DYRC 4I55A 3N2GA 4LF9O 1QBZA 3JD3A 3CPWU 1SQGA 1AVMA 2QE7G 1MG1A 3D36C 3ZEDA 4DR1O 1EZVH 2YXYA 3ZCCA 2F23A 2VQFO 4DR5B 4DR6B 3BPZA 4J11A 5HFMA 4U3JA 2ZXWC 3T1HB 3E86A 2UXNA 3BEHA 2GDSA 1Q5OA 1JPXA 3SPJA 4I9WA 2DQ0A 3AG4B 2CUGA 1KU9A 2P4VA 4AILC 2WSSG 1PNKA 4J7JA 1XMOB 1BZKA 5C8YB 3OGCC 4WFBV 4KHPB 2JVDA 2CH7B 2UUBB 5DEDA 5BY1A 2ZT9B 3QO8A 4NXNB 3A8TA 4NB5A 4LF5B 1S76D 3VQWA 1J95A 1H2GA 1JFFB 3T1YO 3RGBA 3UO2A 1L1FA 2R9RB 1QQCA 3HKDB 1K5QA 2AZ2A 3UT5A 1MMMA 1VQLV 2WWWA 1W2BU 3AEIA 5JCOA 4O4IA 2Y69B 2VWKA 3FYEB 4GLXA 4LR3A 1NS1A 1QLEB 2DW4A 4H37A 4BIUA 4X89A 2PI5A 1AI6A 3P30A 4H13B 1S5HC 2GTSA 4MW8A 1OV9A 4RUFA 4IIJB 2E75B 4P9OA 1V54B 5LHHA 1P7BA 3A0BZ 4GX5A 1XREA 1KUQA 3ABTA 3N2GB 4PA3A 1YZBA 1LNQA 1K9MW 2YI9A 5B5EZ 1R3JC 1B3QA 3CHXA 3OUSA 3G4SV 2ZXWB 1SC5B 1UPGA 1PP9H 2RJZA 1N33B 2ZNJA 4GUNA 1BHAA 4U3JB 4PDVA 4PHZA 1NBMG 2Q7HA 3RYCA 1VQOV 1VQKV 1FJGO 1GM8A 1XHZA 3ABUA 2CAZC 3AK1A 1PNLA 2YSUB 1KMIZ 4L87A 1PL4A 1Z5VA 2JGUA 4ABMA 4LCUC 5LHGA 2HJFC 1G1XB 1KKDA 4DR6O 2EINC 1SQFA 5D5PA 3T1HO 1M9NA 1M4UA 3W7UA 1ORQC 1XBLA 3W7SA 3S3WA 3JASB 4BWAA 5KLVH 3UT5B 1XMOO 4LF8B 4KHPO 4O4IB 3RVYA 2PYLA 2UUBO 5EIBD 3CCLV 3EFFK 2XASA 3LSSA 2R9IA 4NXNO 5DECA 4LF5O 1G6UA 2Y0IA 4RO2A 3ICXA 2F95B 3ABMC 2E5LB 3OEEG 1F23A 4JI8B 4IYHA 4GKKB 2CTQA 3FAVB 2YXHA 5B1OA 5LP6C 2OT5A 4YJ2A 1YHQV 5TISZ 4I9QA 4EEQA 5LYJB 1KP2A 5J2UB 3CEIA 3G6EV 3ABKB 1XNRB 4KL1A 1HP8A 2UXXA 4F6EA 1N0NA 2RNBA 4MVSA 2ZDIA 3X2QB 3RYCB 1Q6IA 1OCZC 4YJ3A 2Q7EA 4TV8A 5KHGA 1Y67A 3DXRB 4JGSA 3CB2A 1SRYA 2WLHA 3HR0A 3LUTB 1HNWB 1BT8A 3SR2C 4ZI7A 2O57A 4FZ0A 3JALA 3U0ZA 4XDLA 3ZRWA 2IJKA 3OT7A 3T4DA 5CMUA 2HFEC 3OEHG 1L8DA 1N33O 1CEZA 4DR3B 1N8RW 3L71H 3HKCA 4UV9A 4EFEA 4UXNA 4HZ3A 2AHYA 1Q3EA 1NR7A 2W6IG 4QGPA 3RN4A 1HNZO 5CA0A 5FNVA 3ZS8C 5BMVA 3ABMB 4KP4A 5IJ9B 5IJ0A 1BMFG 3OW2U 1AP6A 5KAIZ 2LP7A 4J41A 3QVNA 3W7XA 4P9PA 3ZHQA 3B40A 2EILC 1UJWB 1YTFB 3ETGA 3LDCA 4YJ2B 4CBCA 4O2BA 4J10A 4LF8O 2ZE6A 3MHSC 2QDOA 3BCCH 1H8EG 3VBBA 3P32A 1D5AA 3LSUA 4KXRA 1TUBA 3D3QA 2HEPA 2ITCC 4K0KB 2E5LO 4J9YB 4JI8O 4GKKO 3H01A 4TV8B 2KQXA 4DV5B 3Q4HB 3I55V 2VRZA 4N21A 5J2TA 4JASA 4JAAA 2C2AA 1YDXA 2YEVA 4ZI7B 4O4LA 5EYPB 5IYCO 4TV9B 2GHYA 2IU3A 1YI2V 3JALB 1LUWA 1J5EB 3KKYA 1NQTA 3STZC 1XNRO 1FXKA 1AR5A 5AG2A 1KD1W 4JYBA 4GZRB 4PA7A 1VQ6V 1S77D 1NJIW 4XBFA 5IDJA 1OZ0A 4K3AA 4LBEC 3JARA 3ZJZA 5CB4B 3HKCB 2UXDB 4CH5A 2OIGA 4TUYA 4IYIA 4MVZA 4P2ZA 3F5WC 5CA0B 1HNWO 2FB5A 4YHHB 2XT9A 3D3IA 3CRRA 1QHTA 1X59A 4NXMB 2L35A 2ZE7A 5IJ0B 1NVPD 2NR5A 2OCCB 4LH7A 3UO3A 1TVKA 5L3BA 1OCRC 1RPRA 1QCEA 5K1XA 1NH2B 1WJZA 1R3LC 4TQDA 4DR3O 4JTCB 5L3DA 3KZIZ 3LSQA 3VOUA 2JS3A 4UVBA 4F6RB 2MK3A 4O2BB 1MSWD 2P6JA 2ARHA 3NXSA 4WBNB 5B1AC 3JATA 5E1AC 4MTOA 4R6ZA 1M1KW 2Q69A 3JAWA 5H6QA 1H2SB 3VQYA 1XNQO 1TUBB 4DO2A 3LNMB 2EJ7A 4FLWA 4ZOLA 4WF9V 1N36B 3RFRA 1GTOA 1YIJV 2PZSA 2KG7A 1B6QA 4H0LB 4PI2A 2YC0A 1YSCA 3CRQA 4PD4F 5J2TB 1RM1B 3IC9A 3JAKA 4QE7A 4Q6GA 4E4EA 2YEVB 3HPLC 2HP8A 4FZ1A 4HBNA 4O4LB 2EIKB 4DV7B 3QNEA 3ZBHA 1Q8IA 3OMAB 4UB6Z 2P22C 1VQ8V 1IXBA 4K0KO 3SJAC 4HNAB 3PN1A 1KBHA 2EULA 4PDMA 4DV5O 1PL0A 3O9OA 3R66A 3G6BA 1R6TA 1BQZA 4TUYB 2ZE8A 1Q6HA 4YIPA 1MSDA 1KC8W 2WAMA 1THZA 1OCRB 1XI1A 1OCOC 3E8BA 5EIBC 1J5EO 3U11A 4JPRA 1TVKB 2DYSC 3SDLA 3DC6A 2LGQA 3F7YC 4DV6B 3CD6V 4ZIBA 1VEWA 1URFA 5C8YA 4FK5C 1AI7A 2AGAA 1N32B 5JVDB 3TXQA 1H2NA 2JS5A 3ETEA 2UXDO 1Y74A 3K06A 3KG2A 1L0NH 3CC2V 4X9QA 3AG3B 4LWSA 2YXLA 4UCSA 5LGTA 1JFFA 1I08A 2GV9A 4YHHO 4NXMO 3TGUH 3T1CA 3BAAA 3IFXA 3HKDA 1GO3F 4ZOLB 2R9AA 4O4HA 4JYYA 2HJDA 2ZQMA 5IYBO 4FLUA 4JI6B 2KG7B 4B7EA 1SESA 3CCSV 2QKSA 4FLVA 2ZKOA 3JAKB 1NTZH 4UVAA 1M93A 2HVKC 5JH7B 3FX7A 2IW5A 1M56C 2N74A 3OTOO 3E8HA 1TA8A 4UCOA 5KMGA 1R3IC 1IXMA 4IIJA 1FS0G 4I4TB 3FD9A 4GX0A 2XAQA 1B04A 2QWQB 4QNHB 1XUQA 5KHJA 1N36O 3F5TA 3SYAA 1YJ9V 1VARA 3D36A 3AK2A 4IT5A 4DUYB 2QWNB 4JYCA 3K5LA 3FFQA 1K8AW 3APQA 3M99B 1N34B 1E79G 3K04A 1XDCA 4ZKIA 3QO7A 2VWJA 1FFTB 2DYSB 1NT2B 3BRCA 3ZRSA 2W6JG 1IBKB 5H6RA 4DV7O 4MVQA 3DTUB 2RQ6A 3IGAC 3AG7A 1P84F 3RW0A 1X4TA 3E22A 3UM7A 2Z0AA 2LQTA 1YXBA 1S3JA 3MDSA 4B3RO 5JJJB 3CRAA 2F4VB 1P49A 1R73A 1SZXA 4PI0A 5DN6G 2BCCH 3PJSK 1Y74B 3KCYA 4K35A 4DW1A 2DWEC 1AILA 4DRXB 1RSOA 1SA0A 4LWSB 4PELA 3WB1A 3GVMA 3KCXA 5IYDO 3ABLC 2QM4A 2CDYA 1K97A 3D8CA 4PDLA 1VMGA 1I94B 1K4DC 2Z3YA 1M90W 4DV6O 3JASA 3OAAG 2E74B 5C93A 3OE7G 4MSWC 4O4HB 4A5UB 3HKEA 4RQFA 5CA3A 3ZMSA 1XL6A 2GUZA 3RYIB 2A06H 2XAJA 2WLLB 1N32O 1ROPA 1OCCB 2JJ1G 3ZMUA 2P67A 4FM2A 1YF2A 1COWG 1N4CA 4AHCA 3SGIA 4MTGA 3JSNA 2GSMB 4LNUA 3FAVA 1FFXB 1KKCA 2DYRB 5KMGB 3OR7C 4N23A 4FJCC 2F1MA 2BSKA 1ZUQA 5CBHA 5LL6Y 4RQEA 3CJHB 1QU7A 3CMEV 4MVOA 5LYJA 3ZHUA 5H2FZ 4DR4B 2UXBB 5J2UA 1K34A 3GWKC 4JI6O 1MNGA 1XEQA 1JOYA 2EIMC 3E35A 5LBQA 3DXRA 4JYAB 1KYOF 3E22B 4AI8A 1I5XA 3H1IH 2W0XA 1HR0B 2JJ2G 3N2KB 4O2AB 1FD9A 1GMGA 4CC5A 4DUYO 3AG2C 4L8JA 1L0LH 1BQ0A 3JYCA 2QM7A 2WLMA 2F93B 1N34O 3JCZA 1RSOB 4TQFA 1SA0B 1U96A 4DR5O 1DF4A 1CXZB 5LMNB 1K7DA 2LGWA 1V55C 2IJJA 3ASNC 5LMUB 4DR2B 1IBKO 4W4KA 3WB0A 1GAXA 1GH6A 2Q73A 4BW5A 3LDEA 4GT1A 2Y48A 1A32A 4JF3A 3HKEB 2GUZB 2F4VO 4IGGA 4DV0B 4O4JA 2WLIA 4E2LA 5IJ9A 3B09A 4TWKA 3A0RA 1NTKH 5BR8B 2ITDC 1BS3A 1WN7A 1DGSA
chains in the Genus database with same CATH topology
5B5EZ 4UB6Z 3WU2Z 4PJ0Z 4IL6Z 3JCUZ 2AXTZ 4UB8Z 5TISZ 5GTHZ 5KAIZ 5B66Z 5KAFZ 3A0BZ 1S5LZ 3A0HZ 5E79Z 5H2FZ 3KZIZ 5GTIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E Z;  4UB6 Z;  3WU2 Z;  4PJ0 Z;  4IL6 Z;  3JCU Z;  2AXT Z;  4UB8 Z;  5TIS Z;  5GTH Z;  5KAI Z;  5B66 Z;  5KAF Z;  3A0B Z;  1S5L Z;  3A0H Z;  5E79 Z;  5H2F Z;  3KZI Z;  5GTI Z; 
#chains in the Genus database with same CATH topology
 2VS0 A;  1WP8 A;  3TJT A;  5LP6 A;  1BGY H;  1VP7 A;  2ODM A;  4LNU B;  5LHI A;  2XHB A;  1IUR A;  1I7F A;  1ARO P;  2YIA A;  2BSK B;  3B77 A;  2YIB A;  2MW2 B;  3MHH C;  2CE4 A;  5KX5 B;  3A2F A;  2ZE5 A;  4OGQ B;  1KP3 A;  2QM8 A;  3J81 N;  2OYQ A;  1JR9 A;  3FB8 C;  2OIE A;  1NVP B;  2PF4 E;  4D6T H;  1ZSP A;  1S0V A;  3SPH A;  3ZN1 A;  2UUA B;  1JA8 A;  2F66 C;  5IWA B;  2JEX A;  3M8A A;  3Q4H A;  2Q68 A;  2QR4 A;  3E89 A;  1ZTE A;  3OTF A;  3ZN0 A;  2PUS A;  4IHJ B;  1Y76 B;  4DR4 O;  3AG1 C;  2UXB O;  2ETN A;  4DV3 B;  3JD0 A;  5EYP A;  3CE2 A;  4DYL A;  4TV9 A;  2CTR A;  3SJC C;  4Z2W A;  1ZL8 A;  4DR7 B;  2EIN B;  3ML0 A;  1GN2 A;  4RUE A;  4ICG A;  3ASN B;  3BHP A;  3JD1 A;  1K73 W;  1AI5 A;  4WCE V;  4PA4 A;  2AW9 A;  1AR1 B;  5CB4 A;  5ITZ B;  5KA6 A;  4JYA O;  1AP5 A;  2GTA A;  3FKS G;  2RMK B;  3F7V C;  1S5J A;  1HR0 O;  1VF7 A;  1KQS U;  4D7S A;  4O4J B;  4TT3 G;  2WLI B;  4CH6 A;  3E83 A;  5BZB A;  2PY5 A;  1GN4 A;  2OTJ V;  1H2K A;  3B2E E;  2Q67 A;  5LP6 B;  5LMN O;  4OX9 B;  4JAU A;  4X88 A;  4ZBM A;  4EFB A;  4DR2 O;  4J7K A;  2ADP A;  2R70 A;  2Z5U A;  4F6R A;  4ASU G;  1NU1 H;  2YIC A;  3BA8 A;  1BL8 A;  3ZHV A;  4BAY A;  3CXH F;  1PM9 A;  4WBN A;  2LW7 A;  4DV0 O;  2ZD9 A;  3CRC A;  4MT8 A;  4FLX A;  2FKX A;  5BR8 O;  3DGE A;  5F2V O;  4X65 B;  1OCZ B;  1GM9 A;  4ZHQ B;  5KUM A;  2YID A;  2KSD A;  2ZIN A;  1B06 A;  2M6Y A;  2UU9 B;  2V4D A;  2DJV A;  3FYI B;  4PA6 A;  4FLY A;  5GON B;  2ZIO A;  2IM9 A;  4DV1 B;  3BA9 A;  1ZL8 B;  4MVU A;  3ASO C;  2QTS A;  3P3N A;  3K03 A;  1F4M A;  5B1B C;  3RYF A;  3JCU Z;  4HNA A;  4OXS A;  1ZWI C;  3I5D A;  2UUA O;  5IWA O;  1R6K A;  4LF6 B;  2A3Q A;  1F4N A;  3TK1 A;  4FPP A;  2D3O W;  4FVM A;  4DV3 O;  4KFM A;  1EFR G;  2ZNI A;  1GN3 A;  1VQ7 V;  4DR7 O;  1FXK C;  2M7W A;  5GTH Z;  2EIL B;  3OR6 C;  5A2Q N;  1BSM A;  1O9G A;  2B1G A;  4MTF A;  4UCR A;  4JI3 B;  4PV1 B;  1VF6 C;  5B1N A;  2CK3 G;  3OGI B;  5B3S C;  1YCI A;  5JVD A;  1TGO A;  2B5U A;  4H33 A;  5CN0 A;  4I5S A;  1EBO A;  1OJH A;  3K79 A;  5H9C A;  4UCU A;  3CC7 V;  3S3X A;  1WAZ A;  5A9G A;  1R3K C;  1VIB A;  2LJ2 A;  3OUF A;  3WFV A;  2ZR3 A;  2E76 B;  1AI4 A;  3CMA V;  4K8Z A;  4AQY B;  4OX9 O;  1WA8 B;  4EKW A;  1SQV H;  1D2D A;  4FMT A;  3ZMV A;  3UKM A;  1R6N A;  4UVC A;  2AZ0 A;  4F4L A;  1NTM H;  4TOI A;  5KAF Z;  1IVS A;  1YVW A;  4CS3 A;  2H8P C;  3WG7 C;  3E8F A;  5JH7 A;  1Q81 W;  3K5M A;  1O9H A;  3N27 A;  2UUC B;  1AB3 A;  4X65 O;  4I4T A;  3SYO A;  1FXH A;  5EBM C;  3RYF B;  4NTY A;  2LO1 A;  3CCU V;  2WLN A;  2A9H A;  1RPO A;  4KUM A;  4J42 A;  2JRI A;  1EN4 A;  2N04 A;  2QKC A;  2ATK C;  4X66 B;  2UU9 O;  1AJQ A;  3ZHR A;  1F51 A;  2FYU H;  5GTI Z;  4CH4 A;  5FL7 G;  3ZX6 A;  1VQP V;  1YTF D;  1YIT V;  1JMK C;  1VQN V;  1LR1 A;  3CRM A;  4DV1 O;  1PD3 A;  3R65 A;  2B9Z A;  1SQP H;  5KHI A;  3HKB B;  4DK1 A;  4K8X A;  4JTA B;  1UFI A;  4JI7 B;  1VQM V;  4WFA V;  4R8C A;  5B66 Z;  1Q7Y W;  1GM7 A;  2EIJ C;  3J80 N;  5EC1 C;  3SYC A;  1R1B A;  2IJI A;  5B1A B;  4LF6 O;  2YI8 A;  1SET A;  4DRX A;  3ZIA G;  1IBL B;  2OCH A;  2DWD C;  2XAH A;  4I7Z B;  4MS2 A;  3G80 A;  4DV2 B;  1Q43 A;  4X62 B;  1JQ0 A;  5J9P C;  4MVM A;  1H2L A;  4FIP C;  3CS5 A;  1VF5 B;  2RCV A;  5L3G A;  4JI3 O;  2BTQ B;  3RYI A;  3RWR D;  1WPB A;  3BAB A;  2WLL A;  2YUA A;  1Y4M A;  5JWP A;  3CCE V;  4UCV A;  2P7T C;  4FLZ A;  4X1K A;  4U7N A;  3L72 H;  3SPC A;  4LP8 A;  4BIZ A;  1WP7 A;  1HDJ A;  1HW7 A;  4X8A A;  5JJN B;  4G27 B;  2NLJ C;  3T2M A;  4EB6 A;  3HB3 B;  3CSX A;  2NN4 A;  5KHH A;  1FFX A;  1G8M A;  4R7C A;  3I56 V;  3CCM V;  3ZMZ A;  3H9V A;  3CJH A;  4I0X A;  4JZG A;  2Y69 C;  4PJ0 Z;  4DUZ B;  4AQY O;  2LFS A;  4X20 B;  3K58 A;  2VQE B;  2LFR A;  1NH2 D;  2Q5Z A;  3ZRV A;  1OCO B;  2G38 A;  2K1E A;  2H94 A;  1S5L Z;  1MZF A;  1XL4 A;  3QG5 A;  3SYP A;  3B4S A;  2Q6A A;  1V54 C;  2UUC O;  2EIJ B;  1T5E A;  4NKG B;  2QJ1 A;  3N2K A;  2RN9 A;  1KEC A;  4O2A A;  3NR7 A;  3DSQ A;  3SPG A;  3VQX A;  1SF9 A;  4LF4 B;  1P7G A;  2HLD G;  3L9D A;  3P3P A;  3K9S A;  4X66 O;  1Q6U A;  4WFF A;  1MA1 A;  1D5N A;  2HHH B;  2IH3 C;  3K0D A;  4RAI A;  3STL C;  1Q90 D;  2EZO A;  1XIL A;  2UXC B;  1JVM A;  2QEX V;  4FM1 A;  4GCZ A;  1ZAU A;  4CC6 A;  4JI7 O;  4GX1 A;  1I5Y A;  1VQ9 V;  4DV4 B;  5EBL C;  3QO5 A;  1CP9 A;  4X1K B;  2A0L A;  4MW3 A;  4NR1 A;  3G71 V;  1M56 B;  2F43 G;  1K4C C;  2Q7G A;  1CPY A;  1PKX A;  3GB7 C;  1IBL O;  3C3T A;  3K59 A;  4EB6 B;  1DLB A;  2QWO B;  2YS8 A;  4QJF B;  5DM6 V;  4LF7 B;  4JI0 B;  1M57 C;  2PYJ A;  4DV2 O;  2NNU A;  4X62 O;  4FFB B;  4D7T A;  3ZHT A;  4I0X B;  2Q8V A;  4QE9 A;  4DXW A;  5JCO C;  2ZM6 B;  4YY3 B;  4BW9 A;  4B3S B;  1EN6 A;  3ZHS A;  1BHB A;  4JI4 B;  2CGN A;  4RWU A;  2Q0A A;  5CA1 A;  5KX5 A;  1I0H A;  2DN9 A;  1SQQ H;  1GK9 A;  5K1P A;  3BY6 A;  2EZP A;  1Z5W A;  1EN5 A;  1XOU A;  1K5S A;  2Y4U A;  2IU0 A;  1OHH G;  5FPO A;  4I55 B;  5L3F A;  2FML A;  2XND G;  3T4Z A;  1PPJ H;  5IYZ A;  2EBO A;  3K08 A;  3EXA A;  4U3F H;  4GX2 A;  4I50 A;  4IHJ A;  1Y76 A;  1BCC H;  3OM3 B;  2WA3 A;  5EC2 C;  3OD4 A;  4DUZ O;  1M5I A;  1XHX A;  3SJQ C;  2E3C A;  2IH1 C;  3TET A;  3ABK C;  2VQE O;  3APO A;  2LW1 A;  2ADQ B;  3IJ4 A;  4Z1V A;  3ABL B;  1F7Y A;  1H38 A;  2A7W A;  3SYQ A;  4TSF G;  2PI4 A;  3X2Q C;  1EZJ A;  3L75 H;  3JD4 A;  1HNZ B;  4LFB B;  4B08 A;  1JJO A;  2WA4 A;  3E2E A;  5ITZ A;  5CBG A;  3DC5 A;  4X1I A;  1ZX3 A;  1RFY A;  2XTA A;  1SER A;  2OTL V;  4JI2 B;  4QPJ A;  3RYH A;  5LGN A;  3FB6 C;  1TAE A;  3JSL A;  5EK0 A;  2CTP A;  4LF4 O;  3B8N A;  4OPH A;  1M57 B;  2XAF A;  4BIO A;  2HHH O;  1XQ8 A;  1US6 A;  1I94 O;  4JV5 B;  2B1I A;  4UB8 Z;  2GBO A;  4J7Z A;  1DTO A;  2UXC O;  5IY5 C;  1H2M A;  3WB2 A;  5LOV A;  3OMI B;  4DV4 O;  4LFA B;  5CA1 B;  4X64 B;  3K5O A;  4LFC B;  4C7U A;  3WU2 Z;  2JDI G;  2X0L A;  3G67 A;  2BTO A;  2EIM B;  1NI8 A;  3ETQ A;  3U10 A;  1H8H G;  2DOS A;  5HFL A;  4HYO A;  3CC4 V;  4ZHQ A;  1YEW A;  4LF7 O;  4JI0 O;  4PDR A;  3OMN B;  5E79 Z;  5IYZ B;  3IC7 A;  3AG2 B;  2HKO A;  3EHB B;  1P4R A;  1KB9 F;  2ZM6 O;  1SQX H;  4YY3 O;  4B3S O;  2QSA A;  4I50 B;  1XMQ B;  1IBM B;  5GON A;  4JI4 O;  3TXS A;  4GYC B;  4DK0 A;  4JAV A;  1AJP A;  1DF5 A;  1IX9 A;  1FYJ A;  1V55 B;  1QNM A;  3H1K H;  4NYK A;  2HR3 A;  4WFE A;  3CX5 F;  4Q20 A;  4FM0 A;  1NKD A;  2R72 A;  2ZDI C;  1Y6X A;  1VQ5 V;  4CZZ A;  4JZ2 A;  3CXC U;  2P90 A;  2FTK A;  3J7A U;  4X1I B;  1DK1 A;  1Q82 W;  2X6C A;  3CCR V;  1WLE A;  2FL4 A;  1AJN A;  3RBZ A;  2X6A A;  4XDJ A;  5D5Q A;  3RYH B;  4H44 B;  1GRJ A;  5L3C A;  2XAG A;  1N0J A;  2JGD A;  2XUM A;  4JI5 B;  2H3O A;  1ENV A;  1NZ6 A;  4W4L A;  4R50 A;  2YDE A;  5KHK A;  5LXT A;  4LFB O;  1TUE B;  5IY5 B;  2P06 A;  5LMU O;  3UCS C;  3L70 H;  2QWR B;  2ZCE A;  4WFH A;  5EBW C;  2AXT Z;  1S72 V;  2QTO A;  1XNQ B;  2L6L A;  2N05 A;  1JX9 A;  4JI1 B;  5LOV B;  2A79 B;  2KKW A;  4JI2 O;  3CYO A;  4P30 A;  4LC1 A;  3IAY A;  2OCC C;  1FXV A;  3LNN A;  1FAF A;  1W59 A;  5JQG A;  2BOB C;  4Z1M G;  1MOF A;  2DE0 X;  1HWY A;  2WLK A;  3ZMT A;  1WA8 A;  3O65 A;  4FLT A;  2Q0O C;  4JV5 O;  3AG1 B;  5GW7 A;  3CCJ V;  4GKJ B;  1SZT A;  4JTD B;  5CBF A;  1RP3 B;  2BE3 A;  3EVK A;  1WB7 A;  2Q4P A;  4CH3 A;  4OPA A;  3H1L H;  3OFN G;  4LH6 A;  4WFG A;  4LFA O;  4X64 O;  1K92 A;  2IJH A;  3LDD A;  4LFC O;  4YJ3 B;  2QWP B;  4U7O A;  1WPX A;  2K9P A;  5L3E A;  4FFK A;  4X1Y A;  3H1H H;  3RT3 C;  2Y0P A;  2IBZ H;  3BFR A;  3THO A;  4YXW G;  2RDC A;  1V9P A;  3ZRX A;  1FPO A;  1RM1 C;  1PV0 A;  3CP1 A;  3MAQ A;  2CGO A;  1WNS A;  1E1Q G;  3ZRW B;  4NTX A;  1XMQ O;  2EIK C;  2QA4 V;  1IBM O;  4B7K A;  2XOK G;  4UFZ A;  1QVG U;  2D2C B;  3E8G A;  4B3T B;  2QKA A;  4NTW A;  1VF6 A;  2JGD B;  3RVZ A;  1U97 A;  3HKB A;  5BXZ A;  3W7W A;  5LA6 A;  3A0H Z;  3K9A A;  5LXT B;  1ZLZ A;  4BR6 A;  5FNV B;  1W0K G;  5BMV B;  3JD2 A;  2Q9L A;  1HNX B;  3L73 H;  1EM1 A;  4IL6 Z;  3SPI A;  1MAB G;  2P4K A;  3C90 A;  1QVF U;  2V1D A;  5FPR A;  4PA9 A;  2JEU A;  3ETD A;  2WLJ A;  2EJR A;  5JQG B;  3QTC A;  4QPK A;  2ILM A;  4JI5 O;  2BTQ A;  1QLN A;  4UCT A;  2AHZ A;  2HG5 C;  4J80 A;  3SJB C;  3OTO B;  1GKF A;  5JJE B;  1IZ3 A;  3AG3 C;  4G2K A;  1FKA O;  4B3M B;  3ASO B;  4JI1 O;  4G28 B;  1QR8 A;  5B1B B;  4LF9 B;  1MZE A;  2WPD G;  1JJ2 U;  3CCV V;  1K33 A;  2W0F C;  2JK5 C;  2CTW A;  4CS4 A;  3FB5 C;  4DR1 B;  4X1Y B;  5EZY A;  1G4Y B;  2VQF B;  2JIZ G;  4DW0 A;  4X20 A;  4MTX A;  4GKJ O;  1E1R G;  2ZR2 A;  4CS2 A;  1Q86 W;  4UUJ C;  4J9Z B;  1FXK B;  1SS3 A;  2OWO A;  2DQ3 A;  3JAM N;  3UQ8 A;  1LUV A;  4B3R B;  1AR4 A;  2YIB D;  3JAR B;  3B8M A;  1VQ4 V;  5B3S B;  2QGN A;  3AK3 A;  4HAM A;  5LA6 B;  3GWO A;  1BE3 H;  4YIO A;  2X7R B;  4NVP A;  3CWB H;  3TCU A;  3T1Y B;  1WB8 A;  3BVO A;  3MD0 A;  3H1J H;  5IT9 N;  1JCH A;  5KA5 A;  5LGU A;  2DMX A;  2P5O A;  3K57 A;  4UV8 A;  3AG4 C;  4B3T O;  1SQB H;  2CH7 A;  3VQV A;  3QF7 A;  4MVR A;  3K0G A;  1YJW V;  3W7T A;  1W0J G;  1GN6 A;  3FB7 C;  1K3E A;  2Y4T A;  1NR1 A;  3JAT B;  2BOC C;  1HNX O;  2PTM A;  3WG7 B;  3K3W A;  3JAW B;  1YJN V;  1PNM A;  5IE9 A;  2PGG A;  1Y66 A;  2KB1 A;  1IDS A;  2EX3 A;  4FFB A;  1Z2G A;  5EZY B;  3C3S A;  2V7Q G;  5H5N A;  1OCC C;  2X6B A;  1QLE C;  2HVJ C;  3CCQ V;  3L74 H;  5FLX N;  2ZIM A;  4QIW F;  1FJG B;  4B3M O;  1SKV A;  4XDK A;  1QR9 A;  5KUK A;  3M7M X;  3K5N A;  2DYR C;  4I55 A;  3N2G A;  4LF9 O;  1QBZ A;  3JD3 A;  3CPW U;  1SQG A;  1AVM A;  2QE7 G;  1MG1 A;  3D36 C;  3ZED A;  4DR1 O;  1EZV H;  2YXY A;  3ZCC A;  2F23 A;  2VQF O;  4DR5 B;  4DR6 B;  3BPZ A;  4J11 A;  5HFM A;  4U3J A;  2ZXW C;  3T1H B;  3E86 A;  2UXN A;  3BEH A;  2GDS A;  1Q5O A;  1JPX A;  3SPJ A;  4I9W A;  2DQ0 A;  3AG4 B;  2CUG A;  1KU9 A;  2P4V A;  4AIL C;  2WSS G;  1PNK A;  4J7J A;  1XMO B;  1BZK A;  5C8Y B;  3OGC C;  4WFB V;  4KHP B;  2JVD A;  2CH7 B;  2UUB B;  5DED A;  5BY1 A;  2ZT9 B;  3QO8 A;  4NXN B;  3A8T A;  4NB5 A;  4LF5 B;  1S76 D;  3VQW A;  1J95 A;  1H2G A;  1JFF B;  3T1Y O;  3RGB A;  3UO2 A;  1L1F A;  2R9R B;  1QQC A;  3HKD B;  1K5Q A;  2AZ2 A;  3UT5 A;  1MMM A;  1VQL V;  2WWW A;  1W2B U;  3AEI A;  5JCO A;  4O4I A;  2Y69 B;  2VWK A;  3FYE B;  4GLX A;  4LR3 A;  1NS1 A;  1QLE B;  2DW4 A;  4H37 A;  4BIU A;  4X89 A;  2PI5 A;  1AI6 A;  3P30 A;  4H13 B;  1S5H C;  2GTS A;  4MW8 A;  1OV9 A;  4RUF A;  4IIJ B;  2E75 B;  4P9O A;  1V54 B;  5LHH A;  1P7B A;  3A0B Z;  4GX5 A;  1XRE A;  1KUQ A;  3ABT A;  3N2G B;  4PA3 A;  1YZB A;  1LNQ A;  1K9M W;  2YI9 A;  5B5E Z;  1R3J C;  1B3Q A;  3CHX A;  3OUS A;  3G4S V;  2ZXW B;  1SC5 B;  1UPG A;  1PP9 H;  2RJZ A;  1N33 B;  2ZNJ A;  4GUN A;  1BHA A;  4U3J B;  4PDV A;  4PHZ A;  1NBM G;  2Q7H A;  3RYC A;  1VQO V;  1VQK V;  1FJG O;  1GM8 A;  1XHZ A;  3ABU A;  2CAZ C;  3AK1 A;  1PNL A;  2YSU B;  1KMI Z;  4L87 A;  1PL4 A;  1Z5V A;  2JGU A;  4ABM A;  4LCU C;  5LHG A;  2HJF C;  1G1X B;  1KKD A;  4DR6 O;  2EIN C;  1SQF A;  5D5P A;  3T1H O;  1M9N A;  1M4U A;  3W7U A;  1ORQ C;  1XBL A;  3W7S A;  3S3W A;  3JAS B;  4BWA A;  5KLV H;  3UT5 B;  1XMO O;  4LF8 B;  4KHP O;  4O4I B;  3RVY A;  2PYL A;  2UUB O;  5EIB D;  3CCL V;  3EFF K;  2XAS A;  3LSS A;  2R9I A;  4NXN O;  5DEC A;  4LF5 O;  1G6U A;  2Y0I A;  4RO2 A;  3ICX A;  2F95 B;  3ABM C;  2E5L B;  3OEE G;  1F23 A;  4JI8 B;  4IYH A;  4GKK B;  2CTQ A;  3FAV B;  2YXH A;  5B1O A;  5LP6 C;  2OT5 A;  4YJ2 A;  1YHQ V;  5TIS Z;  4I9Q A;  4EEQ A;  5LYJ B;  1KP2 A;  5J2U B;  3CEI A;  3G6E V;  3ABK B;  1XNR B;  4KL1 A;  1HP8 A;  2UXX A;  4F6E A;  1N0N A;  2RNB A;  4MVS A;  2ZDI A;  3X2Q B;  3RYC B;  1Q6I A;  1OCZ C;  4YJ3 A;  2Q7E A;  4TV8 A;  5KHG A;  1Y67 A;  3DXR B;  4JGS A;  3CB2 A;  1SRY A;  2WLH A;  3HR0 A;  3LUT B;  1HNW B;  1BT8 A;  3SR2 C;  4ZI7 A;  2O57 A;  4FZ0 A;  3JAL A;  3U0Z A;  4XDL A;  3ZRW A;  2IJK A;  3OT7 A;  3T4D A;  5CMU A;  2HFE C;  3OEH G;  1L8D A;  1N33 O;  1CEZ A;  4DR3 B;  1N8R W;  3L71 H;  3HKC A;  4UV9 A;  4EFE A;  4UXN A;  4HZ3 A;  2AHY A;  1Q3E A;  1NR7 A;  2W6I G;  4QGP A;  3RN4 A;  1HNZ O;  5CA0 A;  5FNV A;  3ZS8 C;  5BMV A;  3ABM B;  4KP4 A;  5IJ9 B;  5IJ0 A;  1BMF G;  3OW2 U;  1AP6 A;  5KAI Z;  2LP7 A;  4J41 A;  3QVN A;  3W7X A;  4P9P A;  3ZHQ A;  3B40 A;  2EIL C;  1UJW B;  1YTF B;  3ETG A;  3LDC A;  4YJ2 B;  4CBC A;  4O2B A;  4J10 A;  4LF8 O;  2ZE6 A;  3MHS C;  2QDO A;  3BCC H;  1H8E G;  3VBB A;  3P32 A;  1D5A A;  3LSU A;  4KXR A;  1TUB A;  3D3Q A;  2HEP A;  2ITC C;  4K0K B;  2E5L O;  4J9Y B;  4JI8 O;  4GKK O;  3H01 A;  4TV8 B;  2KQX A;  4DV5 B;  3Q4H B;  3I55 V;  2VRZ A;  4N21 A;  5J2T A;  4JAS A;  4JAA A;  2C2A A;  1YDX A;  2YEV A;  4ZI7 B;  4O4L A;  5EYP B;  5IYC O;  4TV9 B;  2GHY A;  2IU3 A;  1YI2 V;  3JAL B;  1LUW A;  1J5E B;  3KKY A;  1NQT A;  3STZ C;  1XNR O;  1FXK A;  1AR5 A;  5AG2 A;  1KD1 W;  4JYB A;  4GZR B;  4PA7 A;  1VQ6 V;  1S77 D;  1NJI W;  4XBF A;  5IDJ A;  1OZ0 A;  4K3A A;  4LBE C;  3JAR A;  3ZJZ A;  5CB4 B;  3HKC B;  2UXD B;  4CH5 A;  2OIG A;  4TUY A;  4IYI A;  4MVZ A;  4P2Z A;  3F5W C;  5CA0 B;  1HNW O;  2FB5 A;  4YHH B;  2XT9 A;  3D3I A;  3CRR A;  1QHT A;  1X59 A;  4NXM B;  2L35 A;  2ZE7 A;  5IJ0 B;  1NVP D;  2NR5 A;  2OCC B;  4LH7 A;  3UO3 A;  1TVK A;  5L3B A;  1OCR C;  1RPR A;  1QCE A;  5K1X A;  1NH2 B;  1WJZ A;  1R3L C;  4TQD A;  4DR3 O;  4JTC B;  5L3D A;  3KZI Z;  3LSQ A;  3VOU A;  2JS3 A;  4UVB A;  4F6R B;  2MK3 A;  4O2B B;  1MSW D;  2P6J A;  2ARH A;  3NXS A;  4WBN B;  5B1A C;  3JAT A;  5E1A C;  4MTO A;  4R6Z A;  1M1K W;  2Q69 A;  3JAW A;  5H6Q A;  1H2S B;  3VQY A;  1XNQ O;  1TUB B;  4DO2 A;  3LNM B;  2EJ7 A;  4FLW A;  4ZOL A;  4WF9 V;  1N36 B;  3RFR A;  1GTO A;  1YIJ V;  2PZS A;  2KG7 A;  1B6Q A;  4H0L B;  4PI2 A;  2YC0 A;  1YSC A;  3CRQ A;  4PD4 F;  5J2T B;  1RM1 B;  3IC9 A;  3JAK A;  4QE7 A;  4Q6G A;  4E4E A;  2YEV B;  3HPL C;  2HP8 A;  4FZ1 A;  4HBN A;  4O4L B;  2EIK B;  4DV7 B;  3QNE A;  3ZBH A;  1Q8I A;  3OMA B;  4UB6 Z;  2P22 C;  1VQ8 V;  1IXB A;  4K0K O;  3SJA C;  4HNA B;  3PN1 A;  1KBH A;  2EUL A;  4PDM A;  4DV5 O;  1PL0 A;  3O9O A;  3R66 A;  3G6B A;  1R6T A;  1BQZ A;  4TUY B;  2ZE8 A;  1Q6H A;  4YIP A;  1MSD A;  1KC8 W;  2WAM A;  1THZ A;  1OCR B;  1XI1 A;  1OCO C;  3E8B A;  5EIB C;  1J5E O;  3U11 A;  4JPR A;  1TVK B;  2DYS C;  3SDL A;  3DC6 A;  2LGQ A;  3F7Y C;  4DV6 B;  3CD6 V;  4ZIB A;  1VEW A;  1URF A;  5C8Y A;  4FK5 C;  1AI7 A;  2AGA A;  1N32 B;  5JVD B;  3TXQ A;  1H2N A;  2JS5 A;  3ETE A;  2UXD O;  1Y74 A;  3K06 A;  3KG2 A;  1L0N H;  3CC2 V;  4X9Q A;  3AG3 B;  4LWS A;  2YXL A;  4UCS A;  5LGT A;  1JFF A;  1I08 A;  2GV9 A;  4YHH O;  4NXM O;  3TGU H;  3T1C A;  3BAA A;  3IFX A;  3HKD A;  1GO3 F;  4ZOL B;  2R9A A;  4O4H A;  4JYY A;  2HJD A;  2ZQM A;  5IYB O;  4FLU A;  4JI6 B;  2KG7 B;  4B7E A;  1SES A;  3CCS V;  2QKS A;  4FLV A;  2ZKO A;  3JAK B;  1NTZ H;  4UVA A;  1M93 A;  2HVK C;  5JH7 B;  3FX7 A;  2IW5 A;  1M56 C;  2N74 A;  3OTO O;  3E8H A;  1TA8 A;  4UCO A;  5KMG A;  1R3I C;  1IXM A;  4IIJ A;  1FS0 G;  4I4T B;  3FD9 A;  4GX0 A;  2XAQ A;  1B04 A;  2QWQ B;  4QNH B;  1XUQ A;  5KHJ A;  1N36 O;  3F5T A;  3SYA A;  1YJ9 V;  1VAR A;  3D36 A;  3AK2 A;  4IT5 A;  4DUY B;  2QWN B;  4JYC A;  3K5L A;  3FFQ A;  1K8A W;  3APQ A;  3M99 B;  1N34 B;  1E79 G;  3K04 A;  1XDC A;  4ZKI A;  3QO7 A;  2VWJ A;  1FFT B;  2DYS B;  1NT2 B;  3BRC A;  3ZRS A;  2W6J G;  1IBK B;  5H6R A;  4DV7 O;  4MVQ A;  3DTU B;  2RQ6 A;  3IGA C;  3AG7 A;  1P84 F;  3RW0 A;  1X4T A;  3E22 A;  3UM7 A;  2Z0A A;  2LQT A;  1YXB A;  1S3J A;  3MDS A;  4B3R O;  5JJJ B;  3CRA A;  2F4V B;  1P49 A;  1R73 A;  1SZX A;  4PI0 A;  5DN6 G;  2BCC H;  3PJS K;  1Y74 B;  3KCY A;  4K35 A;  4DW1 A;  2DWE C;  1AIL A;  4DRX B;  1RSO A;  1SA0 A;  4LWS B;  4PEL A;  3WB1 A;  3GVM A;  3KCX A;  5IYD O;  3ABL C;  2QM4 A;  2CDY A;  1K97 A;  3D8C A;  4PDL A;  1VMG A;  1I94 B;  1K4D C;  2Z3Y A;  1M90 W;  4DV6 O;  3JAS A;  3OAA G;  2E74 B;  5C93 A;  3OE7 G;  4MSW C;  4O4H B;  4A5U B;  3HKE A;  4RQF A;  5CA3 A;  3ZMS A;  1XL6 A;  2GUZ A;  3RYI B;  2A06 H;  2XAJ A;  2WLL B;  1N32 O;  1ROP A;  1OCC B;  2JJ1 G;  3ZMU A;  2P67 A;  4FM2 A;  1YF2 A;  1COW G;  1N4C A;  4AHC A;  3SGI A;  4MTG A;  3JSN A;  2GSM B;  4LNU A;  3FAV A;  1FFX B;  1KKC A;  2DYR B;  5KMG B;  3OR7 C;  4N23 A;  4FJC C;  2F1M A;  2BSK A;  1ZUQ A;  5CBH A;  5LL6 Y;  4RQE A;  3CJH B;  1QU7 A;  3CME V;  4MVO A;  5LYJ A;  3ZHU A;  5H2F Z;  4DR4 B;  2UXB B;  5J2U A;  1K34 A;  3GWK C;  4JI6 O;  1MNG A;  1XEQ A;  1JOY A;  2EIM C;  3E35 A;  5LBQ A;  3DXR A;  4JYA B;  1KYO F;  3E22 B;  4AI8 A;  1I5X A;  3H1I H;  2W0X A;  1HR0 B;  2JJ2 G;  3N2K B;  4O2A B;  1FD9 A;  1GMG A;  4CC5 A;  4DUY O;  3AG2 C;  4L8J A;  1L0L H;  1BQ0 A;  3JYC A;  2QM7 A;  2WLM A;  2F93 B;  1N34 O;  3JCZ A;  1RSO B;  4TQF A;  1SA0 B;  1U96 A;  4DR5 O;  1DF4 A;  1CXZ B;  5LMN B;  1K7D A;  2LGW A;  1V55 C;  2IJJ A;  3ASN C;  5LMU B;  4DR2 B;  1IBK O;  4W4K A;  3WB0 A;  1GAX A;  1GH6 A;  2Q73 A;  4BW5 A;  3LDE A;  4GT1 A;  2Y48 A;  1A32 A;  4JF3 A;  3HKE B;  2GUZ B;  2F4V O;  4IGG A;  4DV0 B;  4O4J A;  2WLI A;  4E2L A;  5IJ9 A;  3B09 A;  4TWK A;  3A0R A;  1NTK H;  5BR8 B;  2ITD C;  1BS3 A;  1WN7 A;  1DGS A; 
#chains in the Genus database with same CATH homology
 5B5E Z;  4UB6 Z;  3WU2 Z;  4PJ0 Z;  4IL6 Z;  3JCU Z;  2AXT Z;  4UB8 Z;  5TIS Z;  5GTH Z;  5KAI Z;  5B66 Z;  5KAF Z;  3A0B Z;  1S5L Z;  3A0H Z;  5E79 Z;  5H2F Z;  3KZI Z;  5GTI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...