3A0HZ

Crystal structure of i-substituted photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3a0hZ00
5KAIZ 4UB6Z 3KZIZ 3A0BZ 5TISZ 5B5EZ 1S5LZ 2AXTZ 5GTHZ 3A0HZ 3WU2Z 4UB8Z 4IL6Z 5KAFZ 4PJ0Z 5B66Z 5H2FZ 5E79Z 5GTIZ 3JCUZ
chains in the Genus database with same CATH superfamily
1FS0G 2EILB 1THZA 2LFSA 4RWUA 3K5NA 5EC1C 3B2EE 5JWPA 1XUQA 2EULA 2RJZA 4O4HB 1NR7A 2YIAA 4JV5B 4NTWA 4UVCA 3JATA 2YUAA 3HKEA 1S5HC 4ZIBA 2Y4TA 1BQZA 3LSSA 3E35A 3JYCA 1P7GA 5KX5A 2P6JA 4O4LB 5K1PA 4JV5O 1YSCA 1AILA 2X6BA 4X9QA 3ABMC 4FLXA 3W7SA 2AZ2A 5LP6C 4IYIA 3P3NA 2RMKB 1PNKA 5FNVB 1PL4A 4YJ3A 1XHZA 1IBLB 4XDJA 4U3JB 3OEHG 3RYCB 2ITDC 2X7RB 4NXNB 1P4RA 4FLUA 3OTOB 2DWEC 4TUYB 1EN5A 5EZYB 5FL7G 4PA6A 1VQ5V 1MA1A 2PF4E 3CCRV 4D7SA 5CB4B 4JI3B 5LA6B 4FFBB 2B5UA 4L8JA 1IBLO 1RPRA 5GTIZ 1CXZB 5B1AB 3EXAA 3L73H 4KUMA 2O57A 2F43G 4G27B 5CA1A 1KECA 4KXRA 4NXNO 2EILC 3ABLB 4B3RB 4LR3A 3OTOO 1DGSA 3ASNB 1NH2B 3ABKB 1B06A 1QVFU 1YJNV 4FJCC 2YXYA 3RYFB 4B7KA 3FB5C 4JI3O 3STLC 3EVKA 4H37A 3SPCA 1QR9A 3ZHQA 3ZMVA 1XNQO 4B3RO 4F4LA 3CE2A 4CBCA 4RO2A 3E22A 1UFIA 1SZXA 2F93B 4EKWA 4NTXA 3CMAV 4DUZB 2JVDA 3G4SV 1FXHA 1TVKA 3JD1A 5JH7B 1U96A 1EM1A 2UXBB 1LUWA 5LHGA 3U0ZA 2HG5C 5B5EZ 4MVQA 3GWOA 2QE7G 5GONA 2Q4PA 1TA8A 3CSXA 3H1KH 3OM3B 4NR1A 1ZLZA 4RQFA 2H94A 3FX7A 4DUZO 2KG7A 1VQ9V 3RYIA 1WB8A 2BOCC 3ZMZA 1JOYA 4J10A 4IGGA 1K5QA 1Z5WA 1YF2A 3GVMA 3HKBB 4UCRA 4LF5B 3OUFA 1MOFA 1XDCA 4TV9A 2Y48A 4PA4A 4YJ3B 2WWWA 3OUSA 4K8ZA 1SESA 3K59A 4B3MO 2IU3A 1H2SB 2W6IG 4I7ZB 4HZ3A 5DEDA 5B1AC 4DR6B 2FTKA 4PD4F 1R6NA 1GM8A 1KU9A 1QCEA 3F7VC 1H8EG 1WNSA 3ASNC 4DO2A 3ABKC 5LBQA 1IBMO 4J9YB 4LF5O 3QF7A 5L3FA 2PZSA 4FLVA 4MW3A 1VQNV 3FD9A 3ZRXA 1N32B 4P30A 1KB9F 5CA1B 4DR6O 1KD1W 2XAGA 4KL1A 4R8CA 3N2GA 4ZKIA 4DR1B 4JI2B 1EZVH 2QM8A 2LW1A 4JYYA 5JJEB 1YJ9V 4GZRB 3K5MA 2Q73A 4FM2A 4HNAA 5CN0A 2EZOA 5KHKA 4G2KA 2HEPA 4MT8A 1R1BA 1PNMA 4DR1O 3K9SA 4JI2O 2HVJC 1JQ0A 2QWOB 4OPAA 2K1EA 2GUZA 1FD9A 5C93A 3I56V 3E8BA 3K9AA 2KQXA 5C8YA 3DC6A 1HW7A 3DSQA 1Q7YW 4I4TA 3P30A 4PHZA 1F7YA 1AB3A 3VQXA 2DMXA 2BTQB 4TQDA 5BR8B 2E5LB 4GKJB 2QSAA 1X4TA 4JI0B 2RN9A 3ZMUA 3CXCU 5KHIA 2V1DA 1S5LZ 3SJQC 4MTGA 1K4DC 1FXVA 3HKCA 1OJHA 5H5NA 2GTSA 2JS5A 1YTFB 5ITZA 1BHBA 5BR8O 1GAXA 4GKJO 1Z2GA 1NH2D 2ZR2A 2WLIA 2X0LA 1QNMA 4JI0O 4J7ZA 2UXXA 5LOVA 5J2TA 2QWQB 5JVDB 2UXDB 3JCZA 5L3EA 3GB7C 3BVOA 1Q5OA 3MHHC 2P4KA 1XILA 5A9GA 1YCIA 3JALA 1B04A 4X1KA 3OT7A 1EN6A 3EHBB 2XHBA 4DK0A 4U7OA 3CX5F 1UPGA 3N2KA 2F4VO 2P22C 4B3TB 2EIMB 4D6TH 4Z1MG 2JS3A 5L3DA 4YY3B 3H1JH 2UXDO 2DJVA 3GWKC 2Z5UA 4LF8B 1MABG 4AQYB 5IWAB 4JAVA 3A0RA 2FL4A 3N2GB 3ZHVA 2YXLA 1H2GA 1NQTA 1COWG 3RW0A 3LSQA 4B3TO 3BAAA 1PD3A 3SGIA 4YY3O 2JRIA 1W0KG 3CPWU 2HHHB 4A5UB 2WLLA 4LF8O 2Y0PA 4AQYO 1L0NH 5IWAO 3C3TA 1S5JA 2H8PC 3JCUZ 3ZIAG 2GUZB 1FFXA 1Q3EA 3CCMV 2IH1C 1YI2V 3ABTA 4DV7B 3W7UA 4I4TB 1H2NA 1SQVH 1JJOA 3D8CA 2HHHO 1SQQH 2A06H 3T1HB 4I55A 4OPHA 2WLJA 4ZI7A 5F2VO 1Y6XA 1IX9A 2YIBA 1J5EB 2DOSA 4N21A 3HKCB 5CBFA 4RUEA 4DV7O 5KMGA 1JR9A 2A9HA 5ITZB 1IVSA 3IC9A 3HKDA 3T1HO 2D2CB 2P4VA 3HB3B 3OAAG 1FFTB 2WLIB 2XAJA 4QJFB 2EIMC 4FFKA 1DF5A 5H2FZ 5LOVB 1J5EO 3OGCC 3THOA 4X88A 3JALB 1H2MA 4X1KB 4IT5A 1MSDA 1DK1A 1FYJA 2QEXV 1YDXA 4X1IA 1P49A 2WAMA 3N2KB 2LO1A 4DW1A 1QR8A 5JQGA 2JEUA 1AJPA 1Y76B 3MAQA 2QDOA 3TXSA 2ZE8A 2NR5A 1M1KW 1F4MA 2OYQA 2H3OA 3CCSV 2VWJA 1M9NA 1VF6A 1ZL8A 3OR7C 1XMOB 2WLLB 3K08A 2OTJV 3LDDA 4CC6A 1YTFD 3JD0A 1GN3A 4H33A 4DXWA 3SDLA 3E8HA 5LMNB 3ZRWA 2E3CA 1XMOO 2QKCA 3F5TA 1W0JG 3B4SA 5IDJA 5LHHA 5HFLA 1YVWA 2B1GA 1HP8A 4WFBV 1SETA 1YIJV 4ZI7B 3LDEA 5LMNO 1MMMA 3UQ8A 3RVZA 3X2QB 4X62B 3R65A 4JZ2A 5KMGB 3D36A 1VARA 4X64B 1GO3F 4J9ZB 4FK5C 1VQKV 3P32A 3IGAC 3WB0A 3HKDB 1NR1A 1KQSU 4DW0A 3K04A 3O65A 3JAMN 1ZAUA 3KKYA 3T1YB 4TV8B 1SS3A 1FXKA 2JK5C 4MVZA 4X62O 3M99B 3DXRA 3CCLV 2QR4A 5KAIZ 3JARA 4X64O 4MW8A 3BPZA 1K5SA 4J7KA 1PKXA 4DR4B 1R73A 4X1IB 3MHSC 2JIZG 1J95A 1HWYA 1WA8A 2DW4A 2BSKA 5JQGB 2YI9A 3T1YO 3ZRVA 1VQOV 4GKKB 3K5OA 2FB5A 5IJ0B 5E1AC 4DR4O 4MVRA 4P2ZA 5IJ9B 2BE3A 3L74H 4B3SB 1VP7A 4UFZA 1ZL8B 1I94B 3PN1A 5CBHA 4RUFA 1F4NA 1R6TA 1HNWB 4I0XB 5K1XA 4GKKO 3AG3B 2QM7A 2ZKOA 4O4IB 2P67A 4YIPA 2R72A 3IFXA 3ZRWB 3LNMB 4B3SO 4QGPA 3X2QC 2HLDG 2W0FC 1I94O 4MTOA 5EBLC 4J11A 1JA8A 1N33B 1HNWO 3K06A 4CH6A 3K57A 1PP9H 2DWDC 4EB6A 2GTAA 3AK1A 2UUCO 1YHQV 3CJHA 2FYUH 4WBNB 3CYOA 3G67A 5CA0A 3F5WC 4UCOA 4UCTA 2XAHA 5TISZ 4DV5B 2XUMA 2N74A 1TUEB 1N33O 1EZJA 3F7YC 2Q7HA 5H9CA 3KCYA 4XDLA 2ZNIA 1V55B 2QA4V 2Z0AA 4I9WA 1FXKB 2Y4UA 2QTSA 2P06A 2EIKB 4DV5O 1M56B 1VF7A 2CTPA 1M90W 4FZ1A 3FB8C 1SQFA 2D3OW 1ROPA 1S0VA 2OTLV 4CC5A 1E1QG 3QVNA 4LP8A 2BSKB 1Y4MA 1GN2A 2Q0OC 3JD2A 3OR6C 3FKSG 2ZE6A 3AG3C 1US6A 1GM9A 1R3JC 2QM4A 1YXBA 4UCUA 4JTCB 4L87A 2CUGA 4K35A 2Q0AA 4I9QA 3N27A 2YIBD 3ZN0A 1OCZB 1L0LH 3BRCA 3UT5A 3CCEV 4DV6B 5B1BB 3CCVV 5IYZA 4JYAB 4QPKA 3ZBHA 2CTWA 3OW2U 1HDJA 4TOIA 1GRJA 1PPJH 1Q81W 1I5YA 4EB6B 3H1HH 1V54B 4DR7B 4DV6O 3CJHB 2EJRA 1AP5A 2EJ7A 3S3WA 2RNBA 1F23A 4JYAO 2Z3YA 1V55C 3SPGA 3FFQA 3RYHA 4PDLA 4UCVA 2LJ2A 1FXKC 2ITCC 1L1FA 2GSMB 1X59A 2EIKC 5H6QA 5KUMA 4O2AA 1M56C 3DGEA 1N0NA 2Q7EA 4DR7O 3JATB 1QHTA 3L75H 3MD0A 3CEIA 5KA6A 1W59A 4PELA 4F6RA 3HKEB 5CA3A 5CMUA 3JD3A 4X1YA 2JJ2G 5KX5B 1HNXB 3E86A 4N23A 4X8AA 1K97A 1D2DA 4FMTA 2Y0IA 5AG2A 4JI6B 3JD4A 1WN7A 1YJWV 1H38A 3BY6A 5DN6G 1M4UA 1XL6A 4QIWF 1OCZC 1I0HA 1FJGB 1B6QA 4MVUA 1GKFA 2OT5A 4FLWA 2F23A 2IH3C 1VQ8V 1TUBA 5L3BA 4JYBA 3ZHUA 1HNXO 2UXBO 2JEXA 2YXHA 3OMIB 1MNGA 1JFFA 3BA9A 5B1BC 5KUKA 1KMIZ 2HVKC 2UUAB 2NLJC 1WP7A 4JI6O 3HR0A 1KKDA 1N36B 4PDRA 1NVPB 3L72H 3UT5B 3G71V 1FJGO 1FPOA 5FPRA 2L6LA 1Q82W 4NYKA 1NBMG 2ZDIC 3AEIA 4U3FH 1V54C 4FLYA 1VIBA 3WB2A 3E83A 2UUAO 1JPXA 3JAWA 2ZIOA 2RCVA 4JPRA 3ABUA 1N36O 2EBOA 1GTOA 2Q7GA 5GTHZ 1K7DA 4CS2A 4AI8A 2QJ1A 2ARHA 5L3GA 1SQBH 4GCZA 2E75B 3BA8A 3RYHB 1N32O 1VQLV 1ENVA 2B1IA 2RDCA 2VQFB 1BS3A 2R9IA 3A2FA 4QNHB 2HP8A 1DTOA 4J41A 1R6KA 3E22B 5GW7A 3Q4HA 2L35A 3RBZA 4PDVA 1K4CC 5KHJA 3CHXA 4JYCA 1BMFG 1TVKB 4X1YB 1K8AW 3ZS8C 2ZIMA 2W6JG 3L71H 3NXSA 2E76B 3JSNA 4DUYB 1PL0A 5GONB 5B1NA 4AILC 1PM9A 2KG7B 4X20A 3RYIB 3CB2A 4PI2A 1MSWD 2E5LO 5J9PC 4TV9B 3LNNA 4GYCB 3OD4A 2UU9B 5IYCO 4CS3A 1JFFB 1YITV 3PJSK 4DV2B 1Z5VA 4UB6Z 1KP2A 2QWPB 1AI7A 3UCSC 2XASA 3VQVA 1YZBA 1SC5B 5IE9A 3CS5A 4MVSA 1O9GA 1HNZB 3J7AU 5J2UA 4P9PA 1SERA 3SYCA 2K9PA 2RQ6A 1V9PA 1K73W 2UU9O 3ZCCA 5BMVA 2UUBB 1QLEB 4DV2O 3JAWB 3ZHTA 1HNZO 2DQ0A 3UO2A 2XOKG 3D3QA 1SKVA 4WFAV 1AJNA 4PV1B 2OIGA 4RQEA 2ZCEA 1NT2B 1SRYA 4MTXA 4HNAB 1IURA 2UUBO 1GMGA 1QVGU 2YEVA 1ZWIC 4XBFA 1Q90D 4DR2B 1GM7A 3LSUA 1JX9A 2WPDG 1UJWB 1BQ0A 5C8YB 1GN6A 4O4JA 4TSFG 4BAYA 2Q6AA 4F6EA 4NXMB 4O2BA 4LF7B 1NJIW 5B1OA 3J81N 1NVPD 2Q9LA 2CTQA 2AW9A 2Y69B 4ZOLA 5E79Z 4CZZA 4DR2O 3OGIB 4B08A 2GBOA 5DM6V 3M7MX 3SPJA 3E89A 3U10A 4ASUG 5B3SB 4NXMO 4K8XA 3MDSA 4X20B 5LHIA 4UXNA 4LF7O 3QO5A 2GHYA 2AGAA 2NN4A 1ZX3A 3IJ4A 3OEEG 4CH4A 1XBLA 1KBHA 3AG1B 4MS2A 3BCCH 3IAYA 3L9DA 5J2TB 1VF5B 4UCSA 1Q86W 4IIJA 2XNDG 1QLEC 5BZBA 3VQYA 4HBNA 1DLBA 5A2QN 2M6YA 1G6UA 1IBKB 4H44B 5J2UB 4WFEA 4LFAB 4AHCA 3K03A 2PYLA 2F66C 2WSSG 4PA3A 2DE0X 3CRMA 3VQWA 3CXHF 1RFYA 2CH7A 2ILMA 2QKAA 2ZQMA 1IBKO 2ZM6B 2HFEC 4LFAO 5LL6Y 3G80A 1XNRB 5LXTA 1AI4A 1H2LA 4Z2WA 2QGNA 3CRRA 3W7WA 2P90A 3CC7V 3H01A 2IBZH 1D5NA 1E79G 1R3KC 1Y74A 4X65B 2ZM6O 4P9OA 2WA4A 2Y69C 3BFRA 1FFXB 2AHZA 2JGDA 3U11A 1XNRO 1N0JA 1Q6IA 2LW7A 5IYDO 4O2BB 5B3SC 4YXWG 4JI8B 2EX3A 1N8RW 4ZOLB 4I55B 1XQ8A 3AG1C 3RN4A 2XAQA 2IW5A 2OCHA 1TAEA 3CMEV 1ZSPA 1N4CA 1NZ6A 3BEHA 1YEWA 4JI8O 2VQEB 3ASOB 3QTCA 3WU2Z 1XI1A 5LYJA 1NTMH 3CRCA 1DF4A 1G1XB 3C3SA 4FIPC 4D7TA 2N05A 4UUJC 1AI6A 2OCCB 4GX1A 1U97A 2HR3A 4GX0A 4R7CA 3G6BA 5DECA 1S76D 2Q8VA 3FYIB 2VQEO 4O4HA 3UO3A 2N04A 4FPPA 4JF3A 3K0DA 2IJIA 5IYBO 4WFHA 2HJFC 2ODMA 4H0LB 4LFBB 2GV9A 1G4YB 2QWNB 2WLMA 1Q6HA 1K33A 2CH7B 1NI8A 4LF9B 4NVPA 4J7JA 1VQMV 1NU1H 3K3WA 3E8FA 4DV3B 1R3IC 4QPJA 1RSOA 3JSLA 5EYPA 4KHPB 4J42A 3B77A 1T5EA 1K92A 4CH3A 4LFBO 3FB7C 3AK3A 3QO8A 4LF9O 2R9AA 4PA7A 5B66Z 1OHHG 4LH6A 4DV3O 2UXCB 2FMLA 1AI5A 4KHPO 2PY5A 1BHAA 4LF6B 3B8MA 2ZINA 1O9HA 1Q43A 1PNLA 1VEWA 4GX5A 4TUYA 2Q67A 1VQ7V 2HJDA 2W0XA 4PA9A 3CCJV 3ASOC 3AG2B 1MZFA 2UXCO 3CD6V 2ETNA 4LF6O 2QKSA 4KFMA 3ZMTA 3CC4V 4BIOA 2OCCC 4YJ2A 4GX2A 1XMQB 1JCHA 1XEQA 2CE4A 5LYJB 2F1MA 3FAVA 1L8DA 5KAFZ 1BL8A 4NB5A 3TGUH 2AHYA 1JMKC 3DXRB 3OTFA 3JARB 5IT9N 1XMQO 2YC0A 1LUVA 2HKOA 4LNUA 3K79A 3I55V 2JGUA 1WA8B 2ZT9B 4W4KA 4JAUA 1VF6C 2DYSB 3LUTB 4RAIA 5JH7A 2BTOA 4DV1B 3WB1A 4FLTA 2YIDA 4R50A 5JJJB 1RSOB 5EYPB 1OCRB 3SJBC 4ABMA 3SPIA 4TWKA 4CH5A 2ADQB 4MSWC 4PDMA 1OCOB 3H1IH 4JI4B 3DTUB 3HKBA 1TGOA 5KHHA 1Q8IA 4DV1O 4NTYA 2PUSA 3AG2C 3B40A 3ML0A 3UKMA 3K0GA 2OWOA 2V7QG 3A0BZ 4K0KB 1EN4A 3APQA 1KP3A 3D36C 1B3QA 5H6RA 2R70A 4JI4O 3L70H 4JTAB 5IY5B 5JJNB 3TXQA 1WJZA 3D3IA 4LCUC 4UVBA 5CA0B 1WPXA 3BHPA 2YS8A 3EFFK 3M8AA 4K0KO 4YJ2B 4UV8A 1XNQB 2A0LA 1HR0B 3JASA 2A7WA 3ETDA 2QWRB 1GN4A 4OXSA 1QBZA 2PTMA 1A32A 2CGOA 3FAVB 2VRZA 4JASA 2LP7A 3SYOA 2DYSC 4WFGA 3STZC 3JAKA 1GK9A 1AR5A 1P7BA 4WCEV 1HR0O 4TQFA 2WLKA 4LNUB 3SJCC 1OCRC 2EZPA 1QLNA 3KCXA 1OZ0A 1BCCH 2ZR3A 1RPOA 1OCOC 2IJJA 2BTQA 1AROP 4FVMA 1OV9A 4B3MB 3E8GA 2YSUB 3ZHRA 2KKWA 1NS1A 1FKAO 1ORQC 3T4DA 3ETGA 3TETA 4DV0B 2XTAA 1IBMB 4PJ0Z 5IY5C 3ZJZA 5IYZB 1H2KA 5JVDA 3OMNB 3RWRD 4Q6GA 3SJAC 1SQGA 2CTRA 1AR4A 4BW5A 3ABLC 2NNUA 4DV0O 1VQPV 4J80A 2CK3G 2CGNA 4BIUA 2E74B 4JZGA 5EC2C 4KP4A 4JI5B 3RVYA 4HYOA 4LBEC 2YI8A 2PI5A 3NR7A 4YHHB 1BT8A 3KZIZ 1BSMA 3JASB 4O2AB 4ZHQA 4BIZA 3G6EV 1IXBA 1P84F 1NKDA 5LGTA 4BWAA 4F6RB 2JDIG 2P5OA 5D5QA 4JI5O 1SZTA 2XAFA 3B09A 5EBWC 3WFVA 3JAKB 1W2BU 1RP3B 2M7WA 2QTOA 4YHHO 2Q5ZA 2F95B 2VQFO 4LC1A 1KKCA 4YIOA 5JCOA 3T1CA 2KSDA 3ZMSA 2V4DA 5KA5A 3CRQA 1SF9A 2XT9A 1M57B 1JVMA 1IXMA 1D5AA 4LWSA 4I5SA 1AP6A 1S3JA 1TUBB 3RFRA 3HPLC 3ICXA 2MW2B 1WAZA 1NTKH 2ADPA 4FLZA 1OCCB 4LF4B 1Q6UA 3VOUA 4DUYO 4JTDB 2PYJA 4Z1VA 2C2AA 4GLXA 5KLVH 3B8NA 1SA0A 3RGBA 1RM1B 3SPHA 3CCQV 2P7TC 3K5LA 2F4VB 1IZ3A 4DR3B 4TT3G 3FYEB 4LF4O 4DYLA 4EFEA 5CBGA 2LFRA 5LGUA 5LMUB 2ZE5A 1EBOA 4UV9A 1E1RG 2A3QA 2KB1A 1K9MW 1NTZH 4GT1A 3BABA 4DR3O 4Q20A 3WG7B 4K3AA 1Y76A 3O9OA 5LMUO 4IHJA 1MG1A 2ZNJA 3QO7A 2LGQA 4ZHQB 3I5DA 2CAZC 3Q4HB 1BZKA 3TK1A 1F51A 3H9VA 2YICA 2GDSA 3A0HZ 5KHGA 4PI0A 4UB8Z 4DK1A 4OX9B 1MZEA 1M57C 4U7NA 1H8HG 2IJKA 1VQ6V 2G38A 4G28B 3H1LH 1URFA 2DYRB 1XOUA 5BXZA 3QG5A 3ZN1A 1OCCC 3OE7G 2BCCH 3FB6C 2R9RB 2JJ1G 4OX9O 4X89A 4C7UA 1RM1C 3IC7A 4LWSB 1KUQA 2FKXA 3KG2A 3TCUA 1CP9A 5L3CA 1BGYH 1I5XA 4E4EA 4MVOA 1AR1B 1SA0B 2IU0A 4H13B 1SQXH 3ZHSA 1ZUQA 3W7XA 2YDEA 4X66B 3ZX6A 1JJ2U 5BMVB 3AG4B 4DR5B 4MVMA 3WG7C 4TV8A 4WFFA 2VS0A 2PGGA 2IM9A 4IYHA 4EFBA 1XHXA 3AK2A 4EEQA 1VQ4V 1CPYA 4FM0A 1CEZA 4DRXA 4DV4B 4X66O 2AZ0A 3T2MA 3W7TA 3S3XA 4DR5O 3AG7A 3T4ZA 5LGNA 1M5IA 1LNQA 3CRAA 1I08A 4IHJB 2YEVB 3K58A 5IJ0A 4R6ZA 1I7FA 3QNEA 3CP1A 1EFRG 5IJ9A 5JCOC 1XREA 3DC5A 4O4JB 2EIJB 2DYRC 1GH6A 1XL4A 4DV4O 4XDKA 5LP6A 2ZXWB 3OFNG 4I0XA 1G8MA 3OMAB 2MK3A 2X6CA 4X65O 4O4IA 3R66A 2UXNA 1VMGA 1ZTEA 2WLNA 5EIBC 4MTFA 2ATKC 1WB7A 3ZRSA 4JI7B 1BE3H 2OIEA 2WA3A 1Y66A 2EINB 4WBNA 5EBMC 3CC2V 3APOA 4LFCB 3ZEDA 1WLEA 4IIJB 5HFMA 4I50A 2B9ZA 3AG4C 2ZE7A 4JI7O 3SYAA 4HAMA 3UM7A 5D5PA 3J80N 2X6AA 4ICGA 4BW9A 4E2LA 2BOBC 4LFCO 1LR1A 1Y67A 1SQPH 4UVAA 1FAFA 2WLHA 3ETQA 4FM1A 2DQ3A 2AXTZ 4ZBMA 1S72V 4O4LA 4NKGB 5LXTB 3CWBH 3RT3C 4DRXB 3SR2C 5EK0A 1K3EA 2EIJC 3A8TA 3SYQA 4WF9V 4IL6Z 1AJQA 2Q69A 1KC8W 3E2EA 1QU7A 4QE9A 2ZXWC 1QQCA 1IDSA 5FNVA 1S77D 1Y74B 4FZ0A 4B7EA 2VWKA 1KYOF 4CS4A 4W4LA 3VBBA 3ETEA 4U3JA 2JGDB 2LQTA 1AVMA 5EIBD 1WP8A 3RYCA 3ABMB 2Q68A 4JAAA 5LP6B 5EZYA 4JGSA 1N34B 3C90A 2UUCB 1PV0A 5CB4A 2CDYA 5FPOA 2EINC 5LA6A 4FFBA 4LH7A 3CCUV 4JI1B 4GUNA 2ZD9A 4QE7A 2LGWA 1M93A 1R3LC 2DN9A 1N34O 2ZDIA 1WPBA 3LDCA 3RYFA 2PI4A 2A79B 5BY1A 4OGQB 3SYPA 5FLXN 4JI1O 3TJTA 1K34A 2IJHA 3P3PA 4I50B 4BR6A
chains in the Genus database with same CATH topology
5KAIZ 4UB6Z 3KZIZ 3A0BZ 5TISZ 5B5EZ 1S5LZ 2AXTZ 5GTHZ 3A0HZ 3WU2Z 4UB8Z 4IL6Z 5KAFZ 4PJ0Z 5B66Z 5H2FZ 5E79Z 5GTIZ 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI Z;  4UB6 Z;  3KZI Z;  3A0B Z;  5TIS Z;  5B5E Z;  1S5L Z;  2AXT Z;  5GTH Z;  3A0H Z;  3WU2 Z;  4UB8 Z;  4IL6 Z;  5KAF Z;  4PJ0 Z;  5B66 Z;  5H2F Z;  5E79 Z;  5GTI Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 1FS0 G;  2EIL B;  1THZ A;  2LFS A;  4RWU A;  3K5N A;  5EC1 C;  3B2E E;  5JWP A;  1XUQ A;  2EUL A;  2RJZ A;  4O4H B;  1NR7 A;  2YIA A;  4JV5 B;  4NTW A;  4UVC A;  3JAT A;  2YUA A;  3HKE A;  1S5H C;  4ZIB A;  2Y4T A;  1BQZ A;  3LSS A;  3E35 A;  3JYC A;  1P7G A;  5KX5 A;  2P6J A;  4O4L B;  5K1P A;  4JV5 O;  1YSC A;  1AIL A;  2X6B A;  4X9Q A;  3ABM C;  4FLX A;  3W7S A;  2AZ2 A;  5LP6 C;  4IYI A;  3P3N A;  2RMK B;  1PNK A;  5FNV B;  1PL4 A;  4YJ3 A;  1XHZ A;  1IBL B;  4XDJ A;  4U3J B;  3OEH G;  3RYC B;  2ITD C;  2X7R B;  4NXN B;  1P4R A;  4FLU A;  3OTO B;  2DWE C;  4TUY B;  1EN5 A;  5EZY B;  5FL7 G;  4PA6 A;  1VQ5 V;  1MA1 A;  2PF4 E;  3CCR V;  4D7S A;  5CB4 B;  4JI3 B;  5LA6 B;  4FFB B;  2B5U A;  4L8J A;  1IBL O;  1RPR A;  5GTI Z;  1CXZ B;  5B1A B;  3EXA A;  3L73 H;  4KUM A;  2O57 A;  2F43 G;  4G27 B;  5CA1 A;  1KEC A;  4KXR A;  4NXN O;  2EIL C;  3ABL B;  4B3R B;  4LR3 A;  3OTO O;  1DGS A;  3ASN B;  1NH2 B;  3ABK B;  1B06 A;  1QVF U;  1YJN V;  4FJC C;  2YXY A;  3RYF B;  4B7K A;  3FB5 C;  4JI3 O;  3STL C;  3EVK A;  4H37 A;  3SPC A;  1QR9 A;  3ZHQ A;  3ZMV A;  1XNQ O;  4B3R O;  4F4L A;  3CE2 A;  4CBC A;  4RO2 A;  3E22 A;  1UFI A;  1SZX A;  2F93 B;  4EKW A;  4NTX A;  3CMA V;  4DUZ B;  2JVD A;  3G4S V;  1FXH A;  1TVK A;  3JD1 A;  5JH7 B;  1U96 A;  1EM1 A;  2UXB B;  1LUW A;  5LHG A;  3U0Z A;  2HG5 C;  5B5E Z;  4MVQ A;  3GWO A;  2QE7 G;  5GON A;  2Q4P A;  1TA8 A;  3CSX A;  3H1K H;  3OM3 B;  4NR1 A;  1ZLZ A;  4RQF A;  2H94 A;  3FX7 A;  4DUZ O;  2KG7 A;  1VQ9 V;  3RYI A;  1WB8 A;  2BOC C;  3ZMZ A;  1JOY A;  4J10 A;  4IGG A;  1K5Q A;  1Z5W A;  1YF2 A;  3GVM A;  3HKB B;  4UCR A;  4LF5 B;  3OUF A;  1MOF A;  1XDC A;  4TV9 A;  2Y48 A;  4PA4 A;  4YJ3 B;  2WWW A;  3OUS A;  4K8Z A;  1SES A;  3K59 A;  4B3M O;  2IU3 A;  1H2S B;  2W6I G;  4I7Z B;  4HZ3 A;  5DED A;  5B1A C;  4DR6 B;  2FTK A;  4PD4 F;  1R6N A;  1GM8 A;  1KU9 A;  1QCE A;  3F7V C;  1H8E G;  1WNS A;  3ASN C;  4DO2 A;  3ABK C;  5LBQ A;  1IBM O;  4J9Y B;  4LF5 O;  3QF7 A;  5L3F A;  2PZS A;  4FLV A;  4MW3 A;  1VQN V;  3FD9 A;  3ZRX A;  1N32 B;  4P30 A;  1KB9 F;  5CA1 B;  4DR6 O;  1KD1 W;  2XAG A;  4KL1 A;  4R8C A;  3N2G A;  4ZKI A;  4DR1 B;  4JI2 B;  1EZV H;  2QM8 A;  2LW1 A;  4JYY A;  5JJE B;  1YJ9 V;  4GZR B;  3K5M A;  2Q73 A;  4FM2 A;  4HNA A;  5CN0 A;  2EZO A;  5KHK A;  4G2K A;  2HEP A;  4MT8 A;  1R1B A;  1PNM A;  4DR1 O;  3K9S A;  4JI2 O;  2HVJ C;  1JQ0 A;  2QWO B;  4OPA A;  2K1E A;  2GUZ A;  1FD9 A;  5C93 A;  3I56 V;  3E8B A;  3K9A A;  2KQX A;  5C8Y A;  3DC6 A;  1HW7 A;  3DSQ A;  1Q7Y W;  4I4T A;  3P30 A;  4PHZ A;  1F7Y A;  1AB3 A;  3VQX A;  2DMX A;  2BTQ B;  4TQD A;  5BR8 B;  2E5L B;  4GKJ B;  2QSA A;  1X4T A;  4JI0 B;  2RN9 A;  3ZMU A;  3CXC U;  5KHI A;  2V1D A;  1S5L Z;  3SJQ C;  4MTG A;  1K4D C;  1FXV A;  3HKC A;  1OJH A;  5H5N A;  2GTS A;  2JS5 A;  1YTF B;  5ITZ A;  1BHB A;  5BR8 O;  1GAX A;  4GKJ O;  1Z2G A;  1NH2 D;  2ZR2 A;  2WLI A;  2X0L A;  1QNM A;  4JI0 O;  4J7Z A;  2UXX A;  5LOV A;  5J2T A;  2QWQ B;  5JVD B;  2UXD B;  3JCZ A;  5L3E A;  3GB7 C;  3BVO A;  1Q5O A;  3MHH C;  2P4K A;  1XIL A;  5A9G A;  1YCI A;  3JAL A;  1B04 A;  4X1K A;  3OT7 A;  1EN6 A;  3EHB B;  2XHB A;  4DK0 A;  4U7O A;  3CX5 F;  1UPG A;  3N2K A;  2F4V O;  2P22 C;  4B3T B;  2EIM B;  4D6T H;  4Z1M G;  2JS3 A;  5L3D A;  4YY3 B;  3H1J H;  2UXD O;  2DJV A;  3GWK C;  2Z5U A;  4LF8 B;  1MAB G;  4AQY B;  5IWA B;  4JAV A;  3A0R A;  2FL4 A;  3N2G B;  3ZHV A;  2YXL A;  1H2G A;  1NQT A;  1COW G;  3RW0 A;  3LSQ A;  4B3T O;  3BAA A;  1PD3 A;  3SGI A;  4YY3 O;  2JRI A;  1W0K G;  3CPW U;  2HHH B;  4A5U B;  2WLL A;  4LF8 O;  2Y0P A;  4AQY O;  1L0N H;  5IWA O;  3C3T A;  1S5J A;  2H8P C;  3JCU Z;  3ZIA G;  2GUZ B;  1FFX A;  1Q3E A;  3CCM V;  2IH1 C;  1YI2 V;  3ABT A;  4DV7 B;  3W7U A;  4I4T B;  1H2N A;  1SQV H;  1JJO A;  3D8C A;  2HHH O;  1SQQ H;  2A06 H;  3T1H B;  4I55 A;  4OPH A;  2WLJ A;  4ZI7 A;  5F2V O;  1Y6X A;  1IX9 A;  2YIB A;  1J5E B;  2DOS A;  4N21 A;  3HKC B;  5CBF A;  4RUE A;  4DV7 O;  5KMG A;  1JR9 A;  2A9H A;  5ITZ B;  1IVS A;  3IC9 A;  3HKD A;  3T1H O;  2D2C B;  2P4V A;  3HB3 B;  3OAA G;  1FFT B;  2WLI B;  2XAJ A;  4QJF B;  2EIM C;  4FFK A;  1DF5 A;  5H2F Z;  5LOV B;  1J5E O;  3OGC C;  3THO A;  4X88 A;  3JAL B;  1H2M A;  4X1K B;  4IT5 A;  1MSD A;  1DK1 A;  1FYJ A;  2QEX V;  1YDX A;  4X1I A;  1P49 A;  2WAM A;  3N2K B;  2LO1 A;  4DW1 A;  1QR8 A;  5JQG A;  2JEU A;  1AJP A;  1Y76 B;  3MAQ A;  2QDO A;  3TXS A;  2ZE8 A;  2NR5 A;  1M1K W;  1F4M A;  2OYQ A;  2H3O A;  3CCS V;  2VWJ A;  1M9N A;  1VF6 A;  1ZL8 A;  3OR7 C;  1XMO B;  2WLL B;  3K08 A;  2OTJ V;  3LDD A;  4CC6 A;  1YTF D;  3JD0 A;  1GN3 A;  4H33 A;  4DXW A;  3SDL A;  3E8H A;  5LMN B;  3ZRW A;  2E3C A;  1XMO O;  2QKC A;  3F5T A;  1W0J G;  3B4S A;  5IDJ A;  5LHH A;  5HFL A;  1YVW A;  2B1G A;  1HP8 A;  4WFB V;  1SET A;  1YIJ V;  4ZI7 B;  3LDE A;  5LMN O;  1MMM A;  3UQ8 A;  3RVZ A;  3X2Q B;  4X62 B;  3R65 A;  4JZ2 A;  5KMG B;  3D36 A;  1VAR A;  4X64 B;  1GO3 F;  4J9Z B;  4FK5 C;  1VQK V;  3P32 A;  3IGA C;  3WB0 A;  3HKD B;  1NR1 A;  1KQS U;  4DW0 A;  3K04 A;  3O65 A;  3JAM N;  1ZAU A;  3KKY A;  3T1Y B;  4TV8 B;  1SS3 A;  1FXK A;  2JK5 C;  4MVZ A;  4X62 O;  3M99 B;  3DXR A;  3CCL V;  2QR4 A;  5KAI Z;  3JAR A;  4X64 O;  4MW8 A;  3BPZ A;  1K5S A;  4J7K A;  1PKX A;  4DR4 B;  1R73 A;  4X1I B;  3MHS C;  2JIZ G;  1J95 A;  1HWY A;  1WA8 A;  2DW4 A;  2BSK A;  5JQG B;  2YI9 A;  3T1Y O;  3ZRV A;  1VQO V;  4GKK B;  3K5O A;  2FB5 A;  5IJ0 B;  5E1A C;  4DR4 O;  4MVR A;  4P2Z A;  5IJ9 B;  2BE3 A;  3L74 H;  4B3S B;  1VP7 A;  4UFZ A;  1ZL8 B;  1I94 B;  3PN1 A;  5CBH A;  4RUF A;  1F4N A;  1R6T A;  1HNW B;  4I0X B;  5K1X A;  4GKK O;  3AG3 B;  2QM7 A;  2ZKO A;  4O4I B;  2P67 A;  4YIP A;  2R72 A;  3IFX A;  3ZRW B;  3LNM B;  4B3S O;  4QGP A;  3X2Q C;  2HLD G;  2W0F C;  1I94 O;  4MTO A;  5EBL C;  4J11 A;  1JA8 A;  1N33 B;  1HNW O;  3K06 A;  4CH6 A;  3K57 A;  1PP9 H;  2DWD C;  4EB6 A;  2GTA A;  3AK1 A;  2UUC O;  1YHQ V;  3CJH A;  2FYU H;  4WBN B;  3CYO A;  3G67 A;  5CA0 A;  3F5W C;  4UCO A;  4UCT A;  2XAH A;  5TIS Z;  4DV5 B;  2XUM A;  2N74 A;  1TUE B;  1N33 O;  1EZJ A;  3F7Y C;  2Q7H A;  5H9C A;  3KCY A;  4XDL A;  2ZNI A;  1V55 B;  2QA4 V;  2Z0A A;  4I9W A;  1FXK B;  2Y4U A;  2QTS A;  2P06 A;  2EIK B;  4DV5 O;  1M56 B;  1VF7 A;  2CTP A;  1M90 W;  4FZ1 A;  3FB8 C;  1SQF A;  2D3O W;  1ROP A;  1S0V A;  2OTL V;  4CC5 A;  1E1Q G;  3QVN A;  4LP8 A;  2BSK B;  1Y4M A;  1GN2 A;  2Q0O C;  3JD2 A;  3OR6 C;  3FKS G;  2ZE6 A;  3AG3 C;  1US6 A;  1GM9 A;  1R3J C;  2QM4 A;  1YXB A;  4UCU A;  4JTC B;  4L87 A;  2CUG A;  4K35 A;  2Q0A A;  4I9Q A;  3N27 A;  2YIB D;  3ZN0 A;  1OCZ B;  1L0L H;  3BRC A;  3UT5 A;  3CCE V;  4DV6 B;  5B1B B;  3CCV V;  5IYZ A;  4JYA B;  4QPK A;  3ZBH A;  2CTW A;  3OW2 U;  1HDJ A;  4TOI A;  1GRJ A;  1PPJ H;  1Q81 W;  1I5Y A;  4EB6 B;  3H1H H;  1V54 B;  4DR7 B;  4DV6 O;  3CJH B;  2EJR A;  1AP5 A;  2EJ7 A;  3S3W A;  2RNB A;  1F23 A;  4JYA O;  2Z3Y A;  1V55 C;  3SPG A;  3FFQ A;  3RYH A;  4PDL A;  4UCV A;  2LJ2 A;  1FXK C;  2ITC C;  1L1F A;  2GSM B;  1X59 A;  2EIK C;  5H6Q A;  5KUM A;  4O2A A;  1M56 C;  3DGE A;  1N0N A;  2Q7E A;  4DR7 O;  3JAT B;  1QHT A;  3L75 H;  3MD0 A;  3CEI A;  5KA6 A;  1W59 A;  4PEL A;  4F6R A;  3HKE B;  5CA3 A;  5CMU A;  3JD3 A;  4X1Y A;  2JJ2 G;  5KX5 B;  1HNX B;  3E86 A;  4N23 A;  4X8A A;  1K97 A;  1D2D A;  4FMT A;  2Y0I A;  5AG2 A;  4JI6 B;  3JD4 A;  1WN7 A;  1YJW V;  1H38 A;  3BY6 A;  5DN6 G;  1M4U A;  1XL6 A;  4QIW F;  1OCZ C;  1I0H A;  1FJG B;  1B6Q A;  4MVU A;  1GKF A;  2OT5 A;  4FLW A;  2F23 A;  2IH3 C;  1VQ8 V;  1TUB A;  5L3B A;  4JYB A;  3ZHU A;  1HNX O;  2UXB O;  2JEX A;  2YXH A;  3OMI B;  1MNG A;  1JFF A;  3BA9 A;  5B1B C;  5KUK A;  1KMI Z;  2HVK C;  2UUA B;  2NLJ C;  1WP7 A;  4JI6 O;  3HR0 A;  1KKD A;  1N36 B;  4PDR A;  1NVP B;  3L72 H;  3UT5 B;  3G71 V;  1FJG O;  1FPO A;  5FPR A;  2L6L A;  1Q82 W;  4NYK A;  1NBM G;  2ZDI C;  3AEI A;  4U3F H;  1V54 C;  4FLY A;  1VIB A;  3WB2 A;  3E83 A;  2UUA O;  1JPX A;  3JAW A;  2ZIO A;  2RCV A;  4JPR A;  3ABU A;  1N36 O;  2EBO A;  1GTO A;  2Q7G A;  5GTH Z;  1K7D A;  4CS2 A;  4AI8 A;  2QJ1 A;  2ARH A;  5L3G A;  1SQB H;  4GCZ A;  2E75 B;  3BA8 A;  3RYH B;  1N32 O;  1VQL V;  1ENV A;  2B1I A;  2RDC A;  2VQF B;  1BS3 A;  2R9I A;  3A2F A;  4QNH B;  2HP8 A;  1DTO A;  4J41 A;  1R6K A;  3E22 B;  5GW7 A;  3Q4H A;  2L35 A;  3RBZ A;  4PDV A;  1K4C C;  5KHJ A;  3CHX A;  4JYC A;  1BMF G;  1TVK B;  4X1Y B;  1K8A W;  3ZS8 C;  2ZIM A;  2W6J G;  3L71 H;  3NXS A;  2E76 B;  3JSN A;  4DUY B;  1PL0 A;  5GON B;  5B1N A;  4AIL C;  1PM9 A;  2KG7 B;  4X20 A;  3RYI B;  3CB2 A;  4PI2 A;  1MSW D;  2E5L O;  5J9P C;  4TV9 B;  3LNN A;  4GYC B;  3OD4 A;  2UU9 B;  5IYC O;  4CS3 A;  1JFF B;  1YIT V;  3PJS K;  4DV2 B;  1Z5V A;  4UB6 Z;  1KP2 A;  2QWP B;  1AI7 A;  3UCS C;  2XAS A;  3VQV A;  1YZB A;  1SC5 B;  5IE9 A;  3CS5 A;  4MVS A;  1O9G A;  1HNZ B;  3J7A U;  5J2U A;  4P9P A;  1SER A;  3SYC A;  2K9P A;  2RQ6 A;  1V9P A;  1K73 W;  2UU9 O;  3ZCC A;  5BMV A;  2UUB B;  1QLE B;  4DV2 O;  3JAW B;  3ZHT A;  1HNZ O;  2DQ0 A;  3UO2 A;  2XOK G;  3D3Q A;  1SKV A;  4WFA V;  1AJN A;  4PV1 B;  2OIG A;  4RQE A;  2ZCE A;  1NT2 B;  1SRY A;  4MTX A;  4HNA B;  1IUR A;  2UUB O;  1GMG A;  1QVG U;  2YEV A;  1ZWI C;  4XBF A;  1Q90 D;  4DR2 B;  1GM7 A;  3LSU A;  1JX9 A;  2WPD G;  1UJW B;  1BQ0 A;  5C8Y B;  1GN6 A;  4O4J A;  4TSF G;  4BAY A;  2Q6A A;  4F6E A;  4NXM B;  4O2B A;  4LF7 B;  1NJI W;  5B1O A;  3J81 N;  1NVP D;  2Q9L A;  2CTQ A;  2AW9 A;  2Y69 B;  4ZOL A;  5E79 Z;  4CZZ A;  4DR2 O;  3OGI B;  4B08 A;  2GBO A;  5DM6 V;  3M7M X;  3SPJ A;  3E89 A;  3U10 A;  4ASU G;  5B3S B;  4NXM O;  4K8X A;  3MDS A;  4X20 B;  5LHI A;  4UXN A;  4LF7 O;  3QO5 A;  2GHY A;  2AGA A;  2NN4 A;  1ZX3 A;  3IJ4 A;  3OEE G;  4CH4 A;  1XBL A;  1KBH A;  3AG1 B;  4MS2 A;  3BCC H;  3IAY A;  3L9D A;  5J2T B;  1VF5 B;  4UCS A;  1Q86 W;  4IIJ A;  2XND G;  1QLE C;  5BZB A;  3VQY A;  4HBN A;  1DLB A;  5A2Q N;  2M6Y A;  1G6U A;  1IBK B;  4H44 B;  5J2U B;  4WFE A;  4LFA B;  4AHC A;  3K03 A;  2PYL A;  2F66 C;  2WSS G;  4PA3 A;  2DE0 X;  3CRM A;  3VQW A;  3CXH F;  1RFY A;  2CH7 A;  2ILM A;  2QKA A;  2ZQM A;  1IBK O;  2ZM6 B;  2HFE C;  4LFA O;  5LL6 Y;  3G80 A;  1XNR B;  5LXT A;  1AI4 A;  1H2L A;  4Z2W A;  2QGN A;  3CRR A;  3W7W A;  2P90 A;  3CC7 V;  3H01 A;  2IBZ H;  1D5N A;  1E79 G;  1R3K C;  1Y74 A;  4X65 B;  2ZM6 O;  4P9O A;  2WA4 A;  2Y69 C;  3BFR A;  1FFX B;  2AHZ A;  2JGD A;  3U11 A;  1XNR O;  1N0J A;  1Q6I A;  2LW7 A;  5IYD O;  4O2B B;  5B3S C;  4YXW G;  4JI8 B;  2EX3 A;  1N8R W;  4ZOL B;  4I55 B;  1XQ8 A;  3AG1 C;  3RN4 A;  2XAQ A;  2IW5 A;  2OCH A;  1TAE A;  3CME V;  1ZSP A;  1N4C A;  1NZ6 A;  3BEH A;  1YEW A;  4JI8 O;  2VQE B;  3ASO B;  3QTC A;  3WU2 Z;  1XI1 A;  5LYJ A;  1NTM H;  3CRC A;  1DF4 A;  1G1X B;  3C3S A;  4FIP C;  4D7T A;  2N05 A;  4UUJ C;  1AI6 A;  2OCC B;  4GX1 A;  1U97 A;  2HR3 A;  4GX0 A;  4R7C A;  3G6B A;  5DEC A;  1S76 D;  2Q8V A;  3FYI B;  2VQE O;  4O4H A;  3UO3 A;  2N04 A;  4FPP A;  4JF3 A;  3K0D A;  2IJI A;  5IYB O;  4WFH A;  2HJF C;  2ODM A;  4H0L B;  4LFB B;  2GV9 A;  1G4Y B;  2QWN B;  2WLM A;  1Q6H A;  1K33 A;  2CH7 B;  1NI8 A;  4LF9 B;  4NVP A;  4J7J A;  1VQM V;  1NU1 H;  3K3W A;  3E8F A;  4DV3 B;  1R3I C;  4QPJ A;  1RSO A;  3JSL A;  5EYP A;  4KHP B;  4J42 A;  3B77 A;  1T5E A;  1K92 A;  4CH3 A;  4LFB O;  3FB7 C;  3AK3 A;  3QO8 A;  4LF9 O;  2R9A A;  4PA7 A;  5B66 Z;  1OHH G;  4LH6 A;  4DV3 O;  2UXC B;  2FML A;  1AI5 A;  4KHP O;  2PY5 A;  1BHA A;  4LF6 B;  3B8M A;  2ZIN A;  1O9H A;  1Q43 A;  1PNL A;  1VEW A;  4GX5 A;  4TUY A;  2Q67 A;  1VQ7 V;  2HJD A;  2W0X A;  4PA9 A;  3CCJ V;  3ASO C;  3AG2 B;  1MZF A;  2UXC O;  3CD6 V;  2ETN A;  4LF6 O;  2QKS A;  4KFM A;  3ZMT A;  3CC4 V;  4BIO A;  2OCC C;  4YJ2 A;  4GX2 A;  1XMQ B;  1JCH A;  1XEQ A;  2CE4 A;  5LYJ B;  2F1M A;  3FAV A;  1L8D A;  5KAF Z;  1BL8 A;  4NB5 A;  3TGU H;  2AHY A;  1JMK C;  3DXR B;  3OTF A;  3JAR B;  5IT9 N;  1XMQ O;  2YC0 A;  1LUV A;  2HKO A;  4LNU A;  3K79 A;  3I55 V;  2JGU A;  1WA8 B;  2ZT9 B;  4W4K A;  4JAU A;  1VF6 C;  2DYS B;  3LUT B;  4RAI A;  5JH7 A;  2BTO A;  4DV1 B;  3WB1 A;  4FLT A;  2YID A;  4R50 A;  5JJJ B;  1RSO B;  5EYP B;  1OCR B;  3SJB C;  4ABM A;  3SPI A;  4TWK A;  4CH5 A;  2ADQ B;  4MSW C;  4PDM A;  1OCO B;  3H1I H;  4JI4 B;  3DTU B;  3HKB A;  1TGO A;  5KHH A;  1Q8I A;  4DV1 O;  4NTY A;  2PUS A;  3AG2 C;  3B40 A;  3ML0 A;  3UKM A;  3K0G A;  2OWO A;  2V7Q G;  3A0B Z;  4K0K B;  1EN4 A;  3APQ A;  1KP3 A;  3D36 C;  1B3Q A;  5H6R A;  2R70 A;  4JI4 O;  3L70 H;  4JTA B;  5IY5 B;  5JJN B;  3TXQ A;  1WJZ A;  3D3I A;  4LCU C;  4UVB A;  5CA0 B;  1WPX A;  3BHP A;  2YS8 A;  3EFF K;  3M8A A;  4K0K O;  4YJ2 B;  4UV8 A;  1XNQ B;  2A0L A;  1HR0 B;  3JAS A;  2A7W A;  3ETD A;  2QWR B;  1GN4 A;  4OXS A;  1QBZ A;  2PTM A;  1A32 A;  2CGO A;  3FAV B;  2VRZ A;  4JAS A;  2LP7 A;  3SYO A;  2DYS C;  4WFG A;  3STZ C;  3JAK A;  1GK9 A;  1AR5 A;  1P7B A;  4WCE V;  1HR0 O;  4TQF A;  2WLK A;  4LNU B;  3SJC C;  1OCR C;  2EZP A;  1QLN A;  3KCX A;  1OZ0 A;  1BCC H;  2ZR3 A;  1RPO A;  1OCO C;  2IJJ A;  2BTQ A;  1ARO P;  4FVM A;  1OV9 A;  4B3M B;  3E8G A;  2YSU B;  3ZHR A;  2KKW A;  1NS1 A;  1FKA O;  1ORQ C;  3T4D A;  3ETG A;  3TET A;  4DV0 B;  2XTA A;  1IBM B;  4PJ0 Z;  5IY5 C;  3ZJZ A;  5IYZ B;  1H2K A;  5JVD A;  3OMN B;  3RWR D;  4Q6G A;  3SJA C;  1SQG A;  2CTR A;  1AR4 A;  4BW5 A;  3ABL C;  2NNU A;  4DV0 O;  1VQP V;  4J80 A;  2CK3 G;  2CGN A;  4BIU A;  2E74 B;  4JZG A;  5EC2 C;  4KP4 A;  4JI5 B;  3RVY A;  4HYO A;  4LBE C;  2YI8 A;  2PI5 A;  3NR7 A;  4YHH B;  1BT8 A;  3KZI Z;  1BSM A;  3JAS B;  4O2A B;  4ZHQ A;  4BIZ A;  3G6E V;  1IXB A;  1P84 F;  1NKD A;  5LGT A;  4BWA A;  4F6R B;  2JDI G;  2P5O A;  5D5Q A;  4JI5 O;  1SZT A;  2XAF A;  3B09 A;  5EBW C;  3WFV A;  3JAK B;  1W2B U;  1RP3 B;  2M7W A;  2QTO A;  4YHH O;  2Q5Z A;  2F95 B;  2VQF O;  4LC1 A;  1KKC A;  4YIO A;  5JCO A;  3T1C A;  2KSD A;  3ZMS A;  2V4D A;  5KA5 A;  3CRQ A;  1SF9 A;  2XT9 A;  1M57 B;  1JVM A;  1IXM A;  1D5A A;  4LWS A;  4I5S A;  1AP6 A;  1S3J A;  1TUB B;  3RFR A;  3HPL C;  3ICX A;  2MW2 B;  1WAZ A;  1NTK H;  2ADP A;  4FLZ A;  1OCC B;  4LF4 B;  1Q6U A;  3VOU A;  4DUY O;  4JTD B;  2PYJ A;  4Z1V A;  2C2A A;  4GLX A;  5KLV H;  3B8N A;  1SA0 A;  3RGB A;  1RM1 B;  3SPH A;  3CCQ V;  2P7T C;  3K5L A;  2F4V B;  1IZ3 A;  4DR3 B;  4TT3 G;  3FYE B;  4LF4 O;  4DYL A;  4EFE A;  5CBG A;  2LFR A;  5LGU A;  5LMU B;  2ZE5 A;  1EBO A;  4UV9 A;  1E1R G;  2A3Q A;  2KB1 A;  1K9M W;  1NTZ H;  4GT1 A;  3BAB A;  4DR3 O;  4Q20 A;  3WG7 B;  4K3A A;  1Y76 A;  3O9O A;  5LMU O;  4IHJ A;  1MG1 A;  2ZNJ A;  3QO7 A;  2LGQ A;  4ZHQ B;  3I5D A;  2CAZ C;  3Q4H B;  1BZK A;  3TK1 A;  1F51 A;  3H9V A;  2YIC A;  2GDS A;  3A0H Z;  5KHG A;  4PI0 A;  4UB8 Z;  4DK1 A;  4OX9 B;  1MZE A;  1M57 C;  4U7N A;  1H8H G;  2IJK A;  1VQ6 V;  2G38 A;  4G28 B;  3H1L H;  1URF A;  2DYR B;  1XOU A;  5BXZ A;  3QG5 A;  3ZN1 A;  1OCC C;  3OE7 G;  2BCC H;  3FB6 C;  2R9R B;  2JJ1 G;  4OX9 O;  4X89 A;  4C7U A;  1RM1 C;  3IC7 A;  4LWS B;  1KUQ A;  2FKX A;  3KG2 A;  3TCU A;  1CP9 A;  5L3C A;  1BGY H;  1I5X A;  4E4E A;  4MVO A;  1AR1 B;  1SA0 B;  2IU0 A;  4H13 B;  1SQX H;  3ZHS A;  1ZUQ A;  3W7X A;  2YDE A;  4X66 B;  3ZX6 A;  1JJ2 U;  5BMV B;  3AG4 B;  4DR5 B;  4MVM A;  3WG7 C;  4TV8 A;  4WFF A;  2VS0 A;  2PGG A;  2IM9 A;  4IYH A;  4EFB A;  1XHX A;  3AK2 A;  4EEQ A;  1VQ4 V;  1CPY A;  4FM0 A;  1CEZ A;  4DRX A;  4DV4 B;  4X66 O;  2AZ0 A;  3T2M A;  3W7T A;  3S3X A;  4DR5 O;  3AG7 A;  3T4Z A;  5LGN A;  1M5I A;  1LNQ A;  3CRA A;  1I08 A;  4IHJ B;  2YEV B;  3K58 A;  5IJ0 A;  4R6Z A;  1I7F A;  3QNE A;  3CP1 A;  1EFR G;  5IJ9 A;  5JCO C;  1XRE A;  3DC5 A;  4O4J B;  2EIJ B;  2DYR C;  1GH6 A;  1XL4 A;  4DV4 O;  4XDK A;  5LP6 A;  2ZXW B;  3OFN G;  4I0X A;  1G8M A;  3OMA B;  2MK3 A;  2X6C A;  4X65 O;  4O4I A;  3R66 A;  2UXN A;  1VMG A;  1ZTE A;  2WLN A;  5EIB C;  4MTF A;  2ATK C;  1WB7 A;  3ZRS A;  4JI7 B;  1BE3 H;  2OIE A;  2WA3 A;  1Y66 A;  2EIN B;  4WBN A;  5EBM C;  3CC2 V;  3APO A;  4LFC B;  3ZED A;  1WLE A;  4IIJ B;  5HFM A;  4I50 A;  2B9Z A;  3AG4 C;  2ZE7 A;  4JI7 O;  3SYA A;  4HAM A;  3UM7 A;  5D5P A;  3J80 N;  2X6A A;  4ICG A;  4BW9 A;  4E2L A;  2BOB C;  4LFC O;  1LR1 A;  1Y67 A;  1SQP H;  4UVA A;  1FAF A;  2WLH A;  3ETQ A;  4FM1 A;  2DQ3 A;  2AXT Z;  4ZBM A;  1S72 V;  4O4L A;  4NKG B;  5LXT B;  3CWB H;  3RT3 C;  4DRX B;  3SR2 C;  5EK0 A;  1K3E A;  2EIJ C;  3A8T A;  3SYQ A;  4WF9 V;  4IL6 Z;  1AJQ A;  2Q69 A;  1KC8 W;  3E2E A;  1QU7 A;  4QE9 A;  2ZXW C;  1QQC A;  1IDS A;  5FNV A;  1S77 D;  1Y74 B;  4FZ0 A;  4B7E A;  2VWK A;  1KYO F;  4CS4 A;  4W4L A;  3VBB A;  3ETE A;  4U3J A;  2JGD B;  2LQT A;  1AVM A;  5EIB D;  1WP8 A;  3RYC A;  3ABM B;  2Q68 A;  4JAA A;  5LP6 B;  5EZY A;  4JGS A;  1N34 B;  3C90 A;  2UUC B;  1PV0 A;  5CB4 A;  2CDY A;  5FPO A;  2EIN C;  5LA6 A;  4FFB A;  4LH7 A;  3CCU V;  4JI1 B;  4GUN A;  2ZD9 A;  4QE7 A;  2LGW A;  1M93 A;  1R3L C;  2DN9 A;  1N34 O;  2ZDI A;  1WPB A;  3LDC A;  3RYF A;  2PI4 A;  2A79 B;  5BY1 A;  4OGQ B;  3SYP A;  5FLX N;  4JI1 O;  3TJT A;  1K34 A;  2IJH A;  3P3P A;  4I50 B;  4BR6 A; 
#chains in the Genus database with same CATH homology
 5KAI Z;  4UB6 Z;  3KZI Z;  3A0B Z;  5TIS Z;  5B5E Z;  1S5L Z;  2AXT Z;  5GTH Z;  3A0H Z;  3WU2 Z;  4UB8 Z;  4IL6 Z;  5KAF Z;  4PJ0 Z;  5B66 Z;  5H2F Z;  5E79 Z;  5GTI Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...