4DV6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv6O00
4DV5O 1KUQA 4DV0O 1I94O 5BY1A 1HNXO 4LF7O 4B3RO 1R6TA 4DR4O 5IT9N 2UUBO 1XMQO 5FLXN 2JRIA 4DV7O 4DV3O 2DOSA 4JI7O 4LF4O 4DV1O 4LFAO 3R66A 4YHHO 4K0KO 1XNQO 2E5LO 4B3MO 1HNWO 4JI4O 4JI2O 4B3SO 4DR6O 5A2QN 5H5NA 5BXZA 5IWAO 2F4VO 1YZBA 1N33O 1AILA 4B3TO 3OTOO 5LMNO 4JYAO 3J81N 4NXMO 4JV5O 4AQYO 1HNZO 2HHHO 1HR0O 4JI6O 4OPHA 4GKKO 4DUYO 2ZKOA 4DUZO 3O65A 2Z0AA 1AB3A 3SDLA 1IBKO 4JI8O 1FYJA 2LW7A 4DR5O 1FKAO 1IBLO 4LF6O 5BR8O 2UXCO 1D2DA 1DK1A 4LF5O 1R1BA 4X66O 4DR3O 1A32A 4X64O 1XNRO 4DR1O 4YY3O 4KHPO 4DV6O 1F7YA 2FKXA 4JI3O 2UU9O 1N32O 5LL6Y 3J80N 2UXBO 1NS1A 2AGAA 4LFCO 1FJGO 4LF9O 3J7AU 2UUCO 1G1XB 5LMUO 2DJVA 1N34O 4X62O 1X59A 4A5UB 3F5TA 1XEQA 2ZM6O 4JI5O 4OPAA 4DR2O 2UUAO 3T1HO 4DV2O 3T1YO 4OX9O 4DV4O 2UXDO 4NXNO 4LF8O 2VQEO 1XMOO 3JAMN 3M8AA 4X65O 4LFBO 1N36O 4JI1O 1IBMO 4JI0O 2N74A 4DR7O 3RT3C 1J5EO 4GKJO 2VQFO
chains in the Genus database with same CATH superfamily
2RNBA 2YICA 1SA0A 2N05A 2IJKA 3K5OA 2NNUA 5LGUA 4Q20A 5B1AC 5GTIZ 2PI5A 2DOSA 1W59A 2WAMA 5KA6A 3L72H 3QVNA 1M57B 1BHBA 3SYAA 1JPXA 1FFTB 5GTHZ 5ITZA 4ICGA 3W7SA 3AG4C 3ASOB 3S3XA 5JVDB 2Q9LA 1YI2V 4F4LA 4QNHB 2KB1A 1R3LC 1ZL8B 3LUTB 3OGIB 4TQFA 4P30A 4YJ3A 1RM1B 1KB9F 1K97A 1BGYH 4OXSA 4K8XA 2OTLV 2Z5UA 3JATA 1PKXA 2ZDIC 1HNZB 4DV5B 5BR8O 4ZOLB 1O9GA 4FLYA 1MZEA 1HNXB 4LF7B 4X1YA 4B3RB 3SJCC 3X2QC 4DR4B 2L35A 2LFRA 3SYOA 5DN6G 1D5AA 4DV6O 1F7YA 3M7MX 3FYEB 3P32A 5IE9A 1M56C 2WPDG 4LF9O 3WB0A 2JJ1G 2VS0A 5B1BB 4BAYA 1U97A 4X1YB 3KCXA 4MVRA 4MVOA 3LSQA 1EN6A 5B1AB 4GCZA 2QSAA 3HKEA 2HKOA 1SQFA 3K04A 2JVDA 2PI4A 1HWYA 1K34A 3RWRD 4ZIBA 4X65O 3RYFA 3ML0A 1FFXB 3ABLC 4X1IA 4JI0O 1GN4A 4GKJO 3OMAB 2ZE8A 2P6JA 2Q6AA 2GTSA 2R9IA 3DTUB 2A7WA 3PN1A 5IYCO 3RYFB 3THOA 1F23A 1W2BU 4E2LA 3UQ8A 1XL4A 2BSKB 3BA9A 1OCRC 3DGEA 4UXNA 2PYLA 1JJ2U 2YC0A 3OTOO 1RSOA 3X2QB 4F6RB 3IC9A 3LSUA 4X88A 4JV5O 5TISZ 1EM1A 2A79B 3SYCA 1M56B 1DLBA 2P4VA 1GMGA 2DW4A 2ZKOA 4IHJA 3TXQA 4DK0A 4FZ1A 1I7FA 2RDCA 2LW7A 3OT7A 1NT2B 3Q4HB 3E8HA 1Q5OA 2P90A 4R6ZA 2MW2B 1AR4A 1VF5B 1F4MA 3JAWA 1K9MW 1AJPA 1GM8A 1VQ7V 1WNSA 2OCCC 4AI8A 3E2EA 4IYHA 3J80N 1K7DA 4WFBV 1HNWB 1FXKC 3SJBC 4GUNA 3ABLB 1PM9A 3B09A 1KP2A 1G1XB 2HVJC 2DN9A 1FPOA 1FXVA 5IJ9B 2AW9A 1NR7A 4JYAB 4N23A 1ZTEA 2YUAA 3CJHB 1XREA 4NXMB 5FL7G 2Y4UA 3GVMA 5JQGB 1GRJA 1Y67A 3E89A 3W7UA 1XILA 4AHCA 3T1CA 1YHQV 5IYBO 2YIBD 1YIJV 1OCRB 1N36O 1FAFA 3BA8A 2GDSA 2WA3A 3RYIB 5B1OA 1NU1H 2GUZA 1R6TA 2QA4V 3CCMV 4O4IA 3K06A 3T2MA 2X6BA 5CBHA 1JX9A 4LNUA 4X65B 1QBZA 3RYHA 4FLUA 4K8ZA 1FXKA 1MOFA 4IGGA 5KX5A 2E5LO 4JI0B 4JI5B 5IWAO 1YZBA 2R9AA 2JDIG 3MHHC 2CTWA 1BQ0A 4NB5A 3CSXA 4W4KA 1NVPD 1R6NA 4TSFG 3K79A 3RYHB 1SZTA 1FXKB 2XAFA 3N2GB 3B2EE 3A0HZ 3VQXA 3EVKA 4I4TB 4JI8O 1COWG 2PY5A 1N0JA 1J5EB 2CGOA 2YDEA 4FM2A 2QWPB 3GB7C 4ZHQA 5IJ0A 2UUBB 4J42A 1GM9A 2ADPA 4DV7B 4Z2WA 2IH3C 4DXWA 4TUYA 2FTKA 1VEWA 4IIJA 3ZX6A 3CCEV 2XOKG 3CCUV 3OD4A 5EZYA 1AVMA 4LP8A 1SKVA 3K0GA 1K33A 1QQCA 4J9YB 3C90A 3TETA 2H8PC 3ZMUA 4TUYB 4DUYB 4C7UA 5GONA 1GAXA 1CP9A 1YCIA 3BEHA 4GX1A 1K5QA 4PA3A 4U7NA 2JGDA 2Q73A 3SPIA 2VQEO 5CBGA 2B9ZA 3ETGA 2WSSG 1PP9H 3A8TA 1RP3B 4LWSA 4MVSA 4FZ0A 3B8NA 2JS3A 4DRXA 2ZXWC 4DV0O 5BY1A 3D36A 5LHGA 3HR0A 1PL4A 5C8YA 4JI3B 4LC1A 4DV3O 2YXLA 1N36B 3G6BA 2HJFC 4JTCB 4P9OA 4LWSB 5B3SC 4J80A 5H5NA 1XL6A 1HW7A 2QM7A 2UUAB 1P4RA 5C8YB 3AK1A 2ETNA 3TK1A 4GLXA 2HHHO 1VF6C 4I50A 2YS8A 4TV9A 5DM6V 2W0FC 3JSNA 2E5LB 3G80A 2XHBA 5IWAB 5FNVB 5IY5C 3SDLA 4KL1A 4DR7B 1FKAO 1JVMA 3K3WA 1I5XA 2Q7HA 3JARB 3UT5B 2ZIMA 4DR3O 1ENVA 1TA8A 4X64O 4KXRA 4I50B 2QM4A 3ZRXA 4DR1O 1Q90D 1WLEA 4O4HB 4QE9A 3ICXA 3ABTA 1YVWA 4FLTA 1R6KA 2UUCO 1WB7A 4X62O 4UCSA 2G38A 5LMNB 2ZXWB 5JCOA 2IJJA 4YXWG 5B1NA 2BTQB 1JFFA 5L3EA 1R73A 4HAMA 2YEVB 5LP6A 4BR6A 1VF6A 4OX9O 2CTRA 5B3SB 4QJFB 3HKDA 5KMGB 1TVKB 1QR8A 4PA9A 4NR1A 5JJNB 4OGQB 2AXTZ 2N74A 1IVSA 1GTOA 1SQQH 3D3QA 3OR6C 3FB5C 1WPXA 4J10A 3CCJV 1MSDA 4O2BB 3QTCA 1VQOV 2JRIA 2VQEB 1CXZB 2CAZC 1QNMA 2YXYA 4I0XA 3EXAA 5EBWC 5IY5B 4K0KO 4TV8A 4PELA 4TOIA 5KLVH 3P3NA 2F4VO 4O4LB 1VQKV 1E1QG 5CN0A 1S3JA 4DV0B 2FL4A 5HFMA 1F51A 3ABMC 5B5EZ 2V1DA 4CS2A 1P49A 1YJ9V 5L3FA 1DTOA 5C93A 4UCOA 4FK5C 1URFA 1XMOB 2LQTA 3B8MA 3L75H 1QR9A 2BOCC 4R7CA 3A2FA 3T4ZA 3FD9A 2GHYA 3FB6C 3L9DA 4KFMA 1DK1A 1K5SA 1BCCH 5D5PA 4JASA 1IXMA 4YY3O 2IU3A 1SERA 4UB6Z 2ZE5A 4LFAB 5LL6Y 1NTMH 2Q67A 5J2UB 4BW5A 2JIZG 1Y74A 3QNEA 1N33B 5KA5A 4HBNA 2F23A 1W0KG 4JPRA 4MW3A 4DK1A 1Q86W 3NR7A 3D8CA 4EEQA 2QJ1A 4G2KA 4JI6B 2KG7A 2Y4TA 1US6A 1UJWB 2QGNA 2YI8A 4DUZB 2LO1A 2DYSC 3HKBB 2XT9A 3M8AA 3K5MA 2RMKB 4FJCC 1G8MA 3TGUH 1JJOA 3ABMB 4MS2A 5LYJA 5LGTA 4PA4A 1V54C 4TWKA 2F93B 4D7SA 4OX9B 3JASA 3N2KB 4DW0A 1N32B 1XDCA 2RQ6A 2ZR2A 4UVCA 1QVGU 1RPOA 4JI7O 1H2MA 1OCCC 1VQ4V 3G6EV 2C2AA 4JI2O 4B3SO 4DR6O 3BRCA 4DR2B 1TAEA 4YJ2B 4J7JA 2Q0OC 3JASB 3KKYA 4L8JA 3RYCB 4AQYO 5JVDA 3OGCC 2FMLA 1VP7A 2LP7A 3H1LH 4QE7A 4K0KB 2BTOA 1ZL8A 3VQVA 2EJ7A 3CB2A 1PL0A 3RFRA 5J2TB 3WFVA 4BIUA 2MK3A 4FLXA 1IURA 4DR5O 1NH2B 3JD0A 1AR1B 3OAAG 2EIJC 5LA6B 5KHGA 1I94B 4PDMA 3CCQV 4ZOLA 2X7RB 1Q82W 2UU9O 2DYSB 2VRZA 3E86A 1XNQB 1W0JG 5CA0B 1G6UA 3BVOA 2GBOA 1S5LZ 5K1XA 2QE7G 3LSSA 2ZM6O 1XEQA 2P22C 4JYYA 1V54B 1M5IA 1WP8A 4P2ZA 4R8CA 4HYOA 1Q81W 4GKKB 3OE7G 3T1YO 5KHJA 1OCCB 4NXNO 3LNNA 1IBMO 4P9PA 2CDYA 4I9QA 3WG7C 5CA1A 1FS0G 3HPLC 4X66B 3CHXA 1M1KW 1FFXA 1PD3A 1H2GA 1H2SB 2HR3A 3ZRWB 4FM1A 1B06A 1BSMA 3UCSC 4PA7A 3CRRA 1SQXH 3JD2A 3D3IA 5EK0A 2F66C 1OJHA 2EIJB 5CA1B 3UM7A 1B04A 5KHKA 3SJAC 2Q7GA 2BSKA 2WLJA 2ZDIA 1QHTA 1PV0A 2LJ2A 4U7OA 5CA3A 3LDEA 4F6RA 1HR0O 3KZIZ 3AEIA 4OPHA 3A0BZ 4JI7B 3CE2A 3H1JH 4G27B 3L71H 3ZMSA 2JEXA 1H38A 4DYLA 3E8BA 2DQ3A 1AI5A 3EHBB 2FYUH 5EYPB 1FD9A 2OIEA 3FAVB 1IBLO 1YJNV 1NBMG 4TT3G 3Q4HA 5CB4A 2CH7B 3P3PA 1JOYA 3EFFK 1P7BA 3WG7B 4PDRA 4ZBMA 5CBFA 4A5UB 2XAQA 4CH4A 3DC5A 3OFNG 1R3JC 5CB4B 4E4EA 2A9HA 5IJ9A 3CJHA 4DV2O 1WAZA 2Q0AA 1F4NA 1Q6UA 1OCOC 1K4DC 2QWNB 1VQ5V 5JQGA 4LFBO 4NTYA 3L70H 4XDKA 3MAQA 4J7KA 4FLWA 5BR8B 2YI9A 5JJEB 2UXXA 3RYIA 1KQSU 3IC7A 4DV6B 4JF3A 4WCEV 5KAIZ 2CUGA 1VQ6V 4GX2A 3STZC 2JK5C 4H13B 4LF9B 1THZA 2CE4A 3FB7C 5A2QN 1Z5WA 4NTXA 2PGGA 3BY6A 3K08A 1VQLV 2LFSA 4B7EA 3ZRSA 3RVZA 1Q6IA 2QKCA 2DMXA 1SF9A 3E22B 1BMFG 1GH6A 2IJHA 2PYJA 3CEIA 3CRAA 3N2GA 1AB3A 4HNAB 1FYJA 4GKJB 3LNMB 4I4TA 4O4JB 1V55C 3UO3A 2UXCO 1CPYA 1VQ9V 2IW5A 3FB8C 4I5SA 4R50A 1A32A 1XNRO 1OCOB 2Y48A 3HKCB 4RUFA 1I5YA 1NS1A 1LNQA 1NTZH 1JCHA 1TUBB 5JWPA 1N34O 3K5NA 2E75B 1X59A 3OTOB 2XNDG 4OPAA 1ZLZA 1P7GA 2EJRA 3CC2V 4JV5B 2P4KA 3K58A 2EZPA 4MTFA 4RWUA 4DO2A 4J7ZA 1V9PA 3ZHTA 2Q7EA 2AHZA 2UXDO 5LHIA 4JAVA 1YJWV 5H6QA 1Y76B 4X1KB 4JI1O 1BZKA 4CH6A 2EINC 5IYDO 1KU9A 3N27A 1SESA 3RVYA 2R70A 2EX3A 1QLNA 1XMQO 1JA8A 4PI2A 5KUMA 2QWOB 2XAHA 4LF4O 3ZHRA 3K9SA 4J9ZB 2EULA 1QLEC 3VQWA 1V55B 4WFGA 4L87A 2H3OA 3BHPA 1S76D 4FIPC 2E3CA 3K9AA 1QCEA 4PA6A 2WLLB 5H2FZ 2LGQA 4WBNB 3B4SA 4MVZA 1KYOF 3ZHVA 2HP8A 1SS3A 2YSUB 4MVUA 5B66Z 1IBKO 5LOVB 5EC1C 2ITDC 5FNVA 3CCVV 1JQ0A 4K3AA 4LF6O 3CCRV 3KCYA 1KKDA 1H8EG 2WLNA 4I55B 2YIDA 3CS5A 3JARA 3UT5A 2YIBA 3H9VA 4LBEC 3I55V 3JALB 2ILMA 5EIBD 4O4HA 4NYKA 3UO2A 2EINB 4I9WA 4MTGA 3ZMTA 2IH1C 2ATKC 3H1KH 4CH5A 1GO3F 2BTQA 4NVPA 5KHIA 4UCTA 2BOBC 3OM3B 4LH7A 2YEVA 4U3JB 1QLEB 1SQGA 4JI8B 1T5EA 4UB8Z 5KMGA 1TVKA 1S77D 4IYIA 4EFEA 3E83A 2VQFO 2H94A 5L3GA 2ZE7A 2M6YA 4B7KA 3RW0A 3QO7A 4GZRB 1L8DA 1Z5VA 1NH2D 4O2BA 1VARA 1VQNV 4PHZA 1S72V 5EC2C 4DV1O 4UCUA 1QU7A 4JI1B 4YHHO 4B3MO 4JI4O 3CP1A 2QDOA 1BL8A 1AILA 3CPWU 4B3TO 1QVFU 1AI6A 4O4LA 3CC4V 3J81N 3HB3B 2DWDC 1AR5A 3APQA 4MTXA 2PUSA 3CWBH 2P06A 2HFEC 4FM0A 2IJIA 3O65A 2L6LA 2Z0AA 2CTPA 1YXBA 1KMIZ 1Q6HA 2ZNIA 2P5OA 3JCUZ 3OEEG 2F1MA 1Y6XA 2KQXA 4KHPO 4DV3B 1N4CA 5EIBC 3RN4A 2WA4A 1PPJH 1Q3EA 2ZNJA 3FFQA 4X9QA 5H6RA 3GWOA 5J2UA 1GN6A 5LMUO 4MT8A 1NZ6A 2HHHB 1UFIA 1WB8A 2AZ0A 2B5UA 3CMAV 1DF4A 2DE0X 3U10A 5EBLC 3G4SV 1BHAA 1IX9A 4MVQA 2OT5A 3DXRB 3HKBA 4PV1B 4BWAA 5H9CA 4EB6B 3OUFA 4DR3B 1HNZO 4DV5O 3U0ZA 4X64B 4DR1B 1HNXO 4LF7O 4B3RO 4DR4O 3CX5F 4FFKA 2NR5A 1EZVH 3SPHA 3N2KA 2QEXV 2UUCB 3ZN1A 4EKWA 4X62B 2VQFB 4FFBB 3VOUA 4MVMA 3W7XA 1LUVA 3WU2Z 2GTAA 2A0LA 1DGSA 1PNLA 3CXCU 4YJ2A 2JJ2G 3AG3C 4ZI7B 5L3DA 3RYCA 4NKGB 4FLVA 1KECA 2VWKA 3R65A 1HDJA 3SYQA 2XUMA 1M90W 1M4UA 1NJIW 2EILC 1K92A 5J2TA 2JS5A 4H0LB 5DEDA 3W7WA 1WA8B 2HEPA 3AG2C 5LHHA 3JD4A 1Z2GA 5LA6A 1OV9A 2RCVA 5FPOA 1KBHA 2LGWA 2HG5C 4MSWC 1SRYA 2ZR3A 1MNGA 2CGNA 3K5LA 1GKFA 3LDCA 4FMTA 2WLIB 1H2KA 1KP3A 2AGAA 4LFCO 1O9HA 1P84F 3SPJA 2F4VB 3J7AU 1S0VA 3SPGA 5CA0A 3CCSV 1OZ0A 1UPGA 1XHXA 5KHHA 4KHPB 1BE3H 2ZE6A 1FXHA 3B40A 2ARHA 3OUSA 1ROPA 2N04A 5EBMC 4DV4O 1MA1A 4G28B 4X20B 5LMUB 2E76B 2WLHA 1I08A 2EIKC 2QKSA 4ASUG 3FKSG 3KG2A 1NTKH 3RT3C 5JH7A 1SA0B 4EFBA 1ZWIC 4FLZA 3AG3B 1VIBA 2BCCH 3RGBA 4YY3B 3CMEV 4GT1A 4JYCA 3W7TA 4NTWA 2XASA 4PDLA 3F5WC 2K9PA 4UV9A 3ZRWA 3H1IH 5ITZB 2EILB 1HNWO 4D6TH 5JH7B 3AG2B 2QTOA 3QG5A 4WFAV 2EIMC 1Y66A 1KC8W 1LR1A 4JYAO 1RFYA 4NXMO 3CRCA 4BIZA 3CRQA 1XQ8A 2UXNA 3MD0A 4YJ3B 3JCZA 1IDSA 1H2NA 1B3QA 3SR2C 1M93A 4PI0A 1EFRG 3JATB 4UUJC 1MMMA 1DF5A 3ZMVA 1BT8A 1PNMA 3OEHG 2RJZA 5EYPA 2NN4A 3FAVA 1R1BA 1SQVH 4WFFA 1EZJA 5HFLA 3OMIB 1IZ3A 2CH7A 1SZXA 2EIKB 3C3TA 2Q69A 4JI2B 4B3SB 4DR6B 3OR7C 2Z3YA 3AG4B 1RPRA 2Y69C 2YXHA 4JI5O 3ZIAG 2X6AA 2RN9A 4QPJA 4UCRA 1WN7A 4DW1A 4AQYB 3NXSA 4X89A 3HKEB 1SC5B 2W6JG 1N0NA 1SETA 3F7VC 1K73W 1Y4MA 3E8FA 1H2LA 4LFCB 1AP6A 1BQZA 4X1IB 1TGOA 5A9GA 2XAGA 3SJQC 4DR5B 4RQFA 2EIMB 2F43G 3ZHQA 2BE3A 4JYBA 4UVAA 1J5EO 3B77A 3VQYA 2ZIOA 3TJTA 1K3EA 4DV4B 2UUBO 2UU9B 2QR4A 5FLXN 5E79Z 2JEUA 4DV7O 1WJZA 3JYCA 2Q68A 3ETDA 1YF2A 2AZ2A 3AG1C 3R66A 4QPKA 1NKDA 2Q8VA 2QTSA 2ZM6B 3P30A 1RSOB 5BXZA 1K8AW 1YITV 1D5NA 4UV8A 2OCHA 4Q6GA 3ZMZA 1L1FA 4LR3A 3T1YB 4KUMA 4NXNB 4DUYO 4IHJB 4I7ZB 2QM8A 4Z1VA 3OTFA 1IXBA 3E22A 1IBMB 2Y69B 2WWWA 3I56V 3FX7A 2WLKA 1GK9A 1JR9A 2KKWA 4HNAA 3JAWB 4LF5O 2Q4PA 4O4JA 2B1GA 5L3CA 1AI7A 3ZRVA 3OW2U 1YTFD 4JTDB 3PJSK 3SYPA 4O2AA 2X6CA 4JI3O 1BS3A 3ZN0A 2EZOA 3HKCA 4CS3A 1R3KC 4LH6A 1FJGO 3JAKA 3IJ4A 3AG7A 1TUBA 2Y0IA 2B1IA 2UUAO 4JZGA 3CC7V 1HR0B 4O2AB 5KAFZ 3L73H 3MHSC 1XI1A 3IGAC 1E79G 3AG1B 3CD6V 4W4LA 2A3QA 5IYZA 1S5JA 3JAKB 1NI8A 3IFXA 3ASNC 1IBLB 4H37A 3BFRA 4GX0A 4DR7O 1Y76A 2GUZB 4X1KA 4IT5A 1XUQA 4O4IB 2HLDG 1KUQA 1VMGA 2OCCB 2R9RB 4LNUB 3RBZA 2ADQB 3BABA 5FPRA 4JAUA 4WF9V 2DWEC 3K57A 1MG1A 5IYZB 5F2VO 1H8HG 1ZAUA 5KX5B 2V7QG 2V4DA 1HP8A 4CS4A 3JSLA 4HZ3A 3SPCA 5CMUA 1I0HA 1N8RW 3O9OA 1NQTA 1YSCA 5LMNO 1AROP 3D36C 4XBFA 4DV2B 3L74H 1ORQC 3ABKC 5K1PA 3JD3A 3STLC 2WLLA 4LFBB 4WBNA 2XAJA 3WB2A 1VQPV 4H33A 3DSQA 4ZHQB 4U3FH 4FVMA 1SQPH 5IJ0B 2D2CB 4J11A 5LOVA 2OYQA 2FB5A 4AILC 2P7TC 1EBOA 1MABG 3G67A 2NLJC 1MSWD 4I55A 3QO5A 2O57A 5E1AC 4X8AA 4IIJB 1M9NA 5L3BA 3ASNB 2QWRB 2IM9A 3ZHSA 5EZYB 1XOUA 4MW8A 3JALA 2QWQB 4JTAB 3F5TA 4LF5B 2JGUA 2EBOA 4LCUC 5GONB 3T1HO 3GWKC 4YIPA 2JGDB 4WFHA 2WLMA 3WB1A 3E8GA 1ZX3A 4LF8O 1FJGB 1XMOO 5KUKA 4U3JA 1YDXA 4WFEA 3VBBA 1MZFA 3H1HH 4DRXB 1U96A 2UXCB 5JCOC 3ZJZA 2R72A 1S5HC 2CK3G 1XNRB 1AJNA 1K4CC 3AK2A 2GSMB 3ABKB 4CBCA 3ZBHA 5LP6C 5IT9N 4CZZA 2LW1A 4GYCB 4LFAO 3ZEDA 1VF7A 1N34B 1YTFB 4UCVA 3CCLV 1N33O 2ZT9B 2E74B 3ZHUA 5JJJB 1SQBH 1JMKC 1ZSPA 3DC6A 5D5QA 4TV9B 3U11A 4CH3A 4JI6O 1KD1W 2UXDB 4F6EA 2PZSA 1OCZC 3C3SA 4PD4F 3BPZA 1YEWA 1EN5A 3FYIB 4DUZO 3BAAA 3K0DA 3CYOA 3QF7A 5IDJA 2QKAA 2X0LA 2OIGA 4PJ0Z 4PDVA 2AHYA 1D2DA 3IAYA 2XTAA 1VQ8V 1XMQB 4MTOA 3K03A 1TUEB 2FKXA 2IBZH 4LF4B 4FPPA 1N32O 2HVKC 2UXBO 2ZQMA 1KKCA 1NR1A 3BCCH 4JAAA 1NVPB 1ZUQA 5AG2A 4CC6A 1WP7A 1WPBA 4RUEA 2OTJV 2HJDA 1JFFB 4CC5A 4RAIA 1PNKA 1GM7A 4DR2O 1Q7YW 5LP6B 5LBQA 3ZS8C 1E1RG 2YIAA 3F7YC 4BIOA 1OHHG 3ZCCA 3HKDB 3M99B 1Q8IA 2GV9A 5BMVA 2ZD9A 1G4YB 1LUWA 5J9PC 4QGPA 2K1EA 1IBKB 4GX5A 3K59A 4LF6B 2D3OW 3DXRA 3S3WA 3T1HB 4H44B 1I94O 1X4TA 3I5DA 4EB6A 4Z1MG 5LGNA 1OCZB 4I0XB 2PTMA 4LF8B 5BMVB 1Q43A 4N21A 4TV8B 3T4DA 2PF4E 2Y0PA 4KP4A 5DECA 1XNQO 2DYRC 5GW7A 4JGSA 4ZKIA 4XDLA 3UKMA 2A06H 2IU0A 3AK3A 2P67A 4FFBA 4RQEA 1AI4A 5LXTA 3CXHF 2F95B 1L0LH 5BZBA 4GKKO 1XHZA 1AJQA 4ZI7A 3CRMA 2OWOA 1L0NH 4UVBA 4RO2A 3LDDA 3OMNB 3JD1A 1XBLA 1M57C 3MDSA 1R3IC 3E35A 4J41A 5LXTB 3ETEA 2W6IG 4X66O 3ASOC 1WA8A 2M7WA 2CTQA 4BW9A 1EN4A 4DV1B 3TCUA 1Y74B 4QIWF 4YHHB 2VWJA 4B3MB 3SGIA 4UFZA 4JI4B 1RM1C 3APOA 1B6QA 4B3TB 2WLIA 2DJVA 3ABUA 1GN2A 4JZ2A 4ABMA 2ITCC 4YIOA 4K35A 1VQMV 3G71V 2KG7B 4TQDA 2ZINA 1GN3A 1J95A 1AP5A 4B08A 2Q5ZA 3A0RA 2UXBB 2ZCEA 4D7TA 3ETQA 4IL6Z 2KSDA 3TXSA 2DYRB 1CEZA 2W0XA 2ODMA 3JAMN 3QO8A 5LYJB 4X20A 2DQ0A 5B1BC 4XDJA 3H01A
chains in the Genus database with same CATH topology
4DV5O 1KUQA 4DV0O 1I94O 5BY1A 1HNXO 4LF7O 4B3RO 1R6TA 4DR4O 5IT9N 2UUBO 1XMQO 5FLXN 2JRIA 4DV7O 4DV3O 2DOSA 4JI7O 4LF4O 4DV1O 4LFAO 3R66A 4YHHO 4K0KO 1XNQO 2E5LO 4B3MO 1HNWO 4JI4O 4JI2O 4B3SO 4DR6O 5A2QN 5H5NA 5BXZA 5IWAO 2F4VO 1YZBA 1N33O 1AILA 4B3TO 3OTOO 5LMNO 4JYAO 3J81N 4NXMO 4JV5O 4AQYO 1HNZO 2HHHO 1HR0O 4JI6O 4OPHA 4GKKO 4DUYO 2ZKOA 4DUZO 3O65A 2Z0AA 1AB3A 3SDLA 1IBKO 4JI8O 1FYJA 2LW7A 4DR5O 1FKAO 1IBLO 4LF6O 5BR8O 2UXCO 1D2DA 1DK1A 4LF5O 1R1BA 4X66O 4DR3O 1A32A 4X64O 1XNRO 4DR1O 4YY3O 4KHPO 4DV6O 1F7YA 2FKXA 4JI3O 2UU9O 1N32O 5LL6Y 3J80N 2UXBO 1NS1A 2AGAA 4LFCO 1FJGO 4LF9O 3J7AU 2UUCO 1G1XB 5LMUO 2DJVA 1N34O 4X62O 1X59A 4A5UB 3F5TA 1XEQA 2ZM6O 4JI5O 4OPAA 4DR2O 2UUAO 3T1HO 4DV2O 3T1YO 4OX9O 4DV4O 2UXDO 4NXNO 4LF8O 2VQEO 1XMOO 3JAMN 3M8AA 4X65O 4LFBO 1N36O 4JI1O 1IBMO 4JI0O 2N74A 4DR7O 3RT3C 1J5EO 4GKJO 2VQFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  1KUQ A;  4DV0 O;  1I94 O;  5BY1 A;  1HNX O;  4LF7 O;  4B3R O;  1R6T A;  4DR4 O;  5IT9 N;  2UUB O;  1XMQ O;  5FLX N;  2JRI A;  4DV7 O;  4DV3 O;  2DOS A;  4JI7 O;  4LF4 O;  4DV1 O;  4LFA O;  3R66 A;  4YHH O;  4K0K O;  1XNQ O;  2E5L O;  4B3M O;  1HNW O;  4JI4 O;  4JI2 O;  4B3S O;  4DR6 O;  5A2Q N;  5H5N A;  5BXZ A;  5IWA O;  2F4V O;  1YZB A;  1N33 O;  1AIL A;  4B3T O;  3OTO O;  5LMN O;  4JYA O;  3J81 N;  4NXM O;  4JV5 O;  4AQY O;  1HNZ O;  2HHH O;  1HR0 O;  4JI6 O;  4OPH A;  4GKK O;  4DUY O;  2ZKO A;  4DUZ O;  3O65 A;  2Z0A A;  1AB3 A;  3SDL A;  1IBK O;  4JI8 O;  1FYJ A;  2LW7 A;  4DR5 O;  1FKA O;  1IBL O;  4LF6 O;  5BR8 O;  2UXC O;  1D2D A;  1DK1 A;  4LF5 O;  1R1B A;  4X66 O;  4DR3 O;  1A32 A;  4X64 O;  1XNR O;  4DR1 O;  4YY3 O;  4KHP O;  4DV6 O;  1F7Y A;  2FKX A;  4JI3 O;  2UU9 O;  1N32 O;  5LL6 Y;  3J80 N;  2UXB O;  1NS1 A;  2AGA A;  4LFC O;  1FJG O;  4LF9 O;  3J7A U;  2UUC O;  1G1X B;  5LMU O;  2DJV A;  1N34 O;  4X62 O;  1X59 A;  4A5U B;  3F5T A;  1XEQ A;  2ZM6 O;  4JI5 O;  4OPA A;  4DR2 O;  2UUA O;  3T1H O;  4DV2 O;  3T1Y O;  4OX9 O;  4DV4 O;  2UXD O;  4NXN O;  4LF8 O;  2VQE O;  1XMO O;  3JAM N;  3M8A A;  4X65 O;  4LFB O;  1N36 O;  4JI1 O;  1IBM O;  4JI0 O;  2N74 A;  4DR7 O;  3RT3 C;  1J5E O;  4GKJ O;  2VQF O; 
#chains in the Genus database with same CATH topology
 2RNB A;  2YIC A;  1SA0 A;  2N05 A;  2IJK A;  3K5O A;  2NNU A;  5LGU A;  4Q20 A;  5B1A C;  5GTI Z;  2PI5 A;  2DOS A;  1W59 A;  2WAM A;  5KA6 A;  3L72 H;  3QVN A;  1M57 B;  1BHB A;  3SYA A;  1JPX A;  1FFT B;  5GTH Z;  5ITZ A;  4ICG A;  3W7S A;  3AG4 C;  3ASO B;  3S3X A;  5JVD B;  2Q9L A;  1YI2 V;  4F4L A;  4QNH B;  2KB1 A;  1R3L C;  1ZL8 B;  3LUT B;  3OGI B;  4TQF A;  4P30 A;  4YJ3 A;  1RM1 B;  1KB9 F;  1K97 A;  1BGY H;  4OXS A;  4K8X A;  2OTL V;  2Z5U A;  3JAT A;  1PKX A;  2ZDI C;  1HNZ B;  4DV5 B;  5BR8 O;  4ZOL B;  1O9G A;  4FLY A;  1MZE A;  1HNX B;  4LF7 B;  4X1Y A;  4B3R B;  3SJC C;  3X2Q C;  4DR4 B;  2L35 A;  2LFR A;  3SYO A;  5DN6 G;  1D5A A;  4DV6 O;  1F7Y A;  3M7M X;  3FYE B;  3P32 A;  5IE9 A;  1M56 C;  2WPD G;  4LF9 O;  3WB0 A;  2JJ1 G;  2VS0 A;  5B1B B;  4BAY A;  1U97 A;  4X1Y B;  3KCX A;  4MVR A;  4MVO A;  3LSQ A;  1EN6 A;  5B1A B;  4GCZ A;  2QSA A;  3HKE A;  2HKO A;  1SQF A;  3K04 A;  2JVD A;  2PI4 A;  1HWY A;  1K34 A;  3RWR D;  4ZIB A;  4X65 O;  3RYF A;  3ML0 A;  1FFX B;  3ABL C;  4X1I A;  4JI0 O;  1GN4 A;  4GKJ O;  3OMA B;  2ZE8 A;  2P6J A;  2Q6A A;  2GTS A;  2R9I A;  3DTU B;  2A7W A;  3PN1 A;  5IYC O;  3RYF B;  3THO A;  1F23 A;  1W2B U;  4E2L A;  3UQ8 A;  1XL4 A;  2BSK B;  3BA9 A;  1OCR C;  3DGE A;  4UXN A;  2PYL A;  1JJ2 U;  2YC0 A;  3OTO O;  1RSO A;  3X2Q B;  4F6R B;  3IC9 A;  3LSU A;  4X88 A;  4JV5 O;  5TIS Z;  1EM1 A;  2A79 B;  3SYC A;  1M56 B;  1DLB A;  2P4V A;  1GMG A;  2DW4 A;  2ZKO A;  4IHJ A;  3TXQ A;  4DK0 A;  4FZ1 A;  1I7F A;  2RDC A;  2LW7 A;  3OT7 A;  1NT2 B;  3Q4H B;  3E8H A;  1Q5O A;  2P90 A;  4R6Z A;  2MW2 B;  1AR4 A;  1VF5 B;  1F4M A;  3JAW A;  1K9M W;  1AJP A;  1GM8 A;  1VQ7 V;  1WNS A;  2OCC C;  4AI8 A;  3E2E A;  4IYH A;  3J80 N;  1K7D A;  4WFB V;  1HNW B;  1FXK C;  3SJB C;  4GUN A;  3ABL B;  1PM9 A;  3B09 A;  1KP2 A;  1G1X B;  2HVJ C;  2DN9 A;  1FPO A;  1FXV A;  5IJ9 B;  2AW9 A;  1NR7 A;  4JYA B;  4N23 A;  1ZTE A;  2YUA A;  3CJH B;  1XRE A;  4NXM B;  5FL7 G;  2Y4U A;  3GVM A;  5JQG B;  1GRJ A;  1Y67 A;  3E89 A;  3W7U A;  1XIL A;  4AHC A;  3T1C A;  1YHQ V;  5IYB O;  2YIB D;  1YIJ V;  1OCR B;  1N36 O;  1FAF A;  3BA8 A;  2GDS A;  2WA3 A;  3RYI B;  5B1O A;  1NU1 H;  2GUZ A;  1R6T A;  2QA4 V;  3CCM V;  4O4I A;  3K06 A;  3T2M A;  2X6B A;  5CBH A;  1JX9 A;  4LNU A;  4X65 B;  1QBZ A;  3RYH A;  4FLU A;  4K8Z A;  1FXK A;  1MOF A;  4IGG A;  5KX5 A;  2E5L O;  4JI0 B;  4JI5 B;  5IWA O;  1YZB A;  2R9A A;  2JDI G;  3MHH C;  2CTW A;  1BQ0 A;  4NB5 A;  3CSX A;  4W4K A;  1NVP D;  1R6N A;  4TSF G;  3K79 A;  3RYH B;  1SZT A;  1FXK B;  2XAF A;  3N2G B;  3B2E E;  3A0H Z;  3VQX A;  3EVK A;  4I4T B;  4JI8 O;  1COW G;  2PY5 A;  1N0J A;  1J5E B;  2CGO A;  2YDE A;  4FM2 A;  2QWP B;  3GB7 C;  4ZHQ A;  5IJ0 A;  2UUB B;  4J42 A;  1GM9 A;  2ADP A;  4DV7 B;  4Z2W A;  2IH3 C;  4DXW A;  4TUY A;  2FTK A;  1VEW A;  4IIJ A;  3ZX6 A;  3CCE V;  2XOK G;  3CCU V;  3OD4 A;  5EZY A;  1AVM A;  4LP8 A;  1SKV A;  3K0G A;  1K33 A;  1QQC A;  4J9Y B;  3C90 A;  3TET A;  2H8P C;  3ZMU A;  4TUY B;  4DUY B;  4C7U A;  5GON A;  1GAX A;  1CP9 A;  1YCI A;  3BEH A;  4GX1 A;  1K5Q A;  4PA3 A;  4U7N A;  2JGD A;  2Q73 A;  3SPI A;  2VQE O;  5CBG A;  2B9Z A;  3ETG A;  2WSS G;  1PP9 H;  3A8T A;  1RP3 B;  4LWS A;  4MVS A;  4FZ0 A;  3B8N A;  2JS3 A;  4DRX A;  2ZXW C;  4DV0 O;  5BY1 A;  3D36 A;  5LHG A;  3HR0 A;  1PL4 A;  5C8Y A;  4JI3 B;  4LC1 A;  4DV3 O;  2YXL A;  1N36 B;  3G6B A;  2HJF C;  4JTC B;  4P9O A;  4LWS B;  5B3S C;  4J80 A;  5H5N A;  1XL6 A;  1HW7 A;  2QM7 A;  2UUA B;  1P4R A;  5C8Y B;  3AK1 A;  2ETN A;  3TK1 A;  4GLX A;  2HHH O;  1VF6 C;  4I50 A;  2YS8 A;  4TV9 A;  5DM6 V;  2W0F C;  3JSN A;  2E5L B;  3G80 A;  2XHB A;  5IWA B;  5FNV B;  5IY5 C;  3SDL A;  4KL1 A;  4DR7 B;  1FKA O;  1JVM A;  3K3W A;  1I5X A;  2Q7H A;  3JAR B;  3UT5 B;  2ZIM A;  4DR3 O;  1ENV A;  1TA8 A;  4X64 O;  4KXR A;  4I50 B;  2QM4 A;  3ZRX A;  4DR1 O;  1Q90 D;  1WLE A;  4O4H B;  4QE9 A;  3ICX A;  3ABT A;  1YVW A;  4FLT A;  1R6K A;  2UUC O;  1WB7 A;  4X62 O;  4UCS A;  2G38 A;  5LMN B;  2ZXW B;  5JCO A;  2IJJ A;  4YXW G;  5B1N A;  2BTQ B;  1JFF A;  5L3E A;  1R73 A;  4HAM A;  2YEV B;  5LP6 A;  4BR6 A;  1VF6 A;  4OX9 O;  2CTR A;  5B3S B;  4QJF B;  3HKD A;  5KMG B;  1TVK B;  1QR8 A;  4PA9 A;  4NR1 A;  5JJN B;  4OGQ B;  2AXT Z;  2N74 A;  1IVS A;  1GTO A;  1SQQ H;  3D3Q A;  3OR6 C;  3FB5 C;  1WPX A;  4J10 A;  3CCJ V;  1MSD A;  4O2B B;  3QTC A;  1VQO V;  2JRI A;  2VQE B;  1CXZ B;  2CAZ C;  1QNM A;  2YXY A;  4I0X A;  3EXA A;  5EBW C;  5IY5 B;  4K0K O;  4TV8 A;  4PEL A;  4TOI A;  5KLV H;  3P3N A;  2F4V O;  4O4L B;  1VQK V;  1E1Q G;  5CN0 A;  1S3J A;  4DV0 B;  2FL4 A;  5HFM A;  1F51 A;  3ABM C;  5B5E Z;  2V1D A;  4CS2 A;  1P49 A;  1YJ9 V;  5L3F A;  1DTO A;  5C93 A;  4UCO A;  4FK5 C;  1URF A;  1XMO B;  2LQT A;  3B8M A;  3L75 H;  1QR9 A;  2BOC C;  4R7C A;  3A2F A;  3T4Z A;  3FD9 A;  2GHY A;  3FB6 C;  3L9D A;  4KFM A;  1DK1 A;  1K5S A;  1BCC H;  5D5P A;  4JAS A;  1IXM A;  4YY3 O;  2IU3 A;  1SER A;  4UB6 Z;  2ZE5 A;  4LFA B;  5LL6 Y;  1NTM H;  2Q67 A;  5J2U B;  4BW5 A;  2JIZ G;  1Y74 A;  3QNE A;  1N33 B;  5KA5 A;  4HBN A;  2F23 A;  1W0K G;  4JPR A;  4MW3 A;  4DK1 A;  1Q86 W;  3NR7 A;  3D8C A;  4EEQ A;  2QJ1 A;  4G2K A;  4JI6 B;  2KG7 A;  2Y4T A;  1US6 A;  1UJW B;  2QGN A;  2YI8 A;  4DUZ B;  2LO1 A;  2DYS C;  3HKB B;  2XT9 A;  3M8A A;  3K5M A;  2RMK B;  4FJC C;  1G8M A;  3TGU H;  1JJO A;  3ABM B;  4MS2 A;  5LYJ A;  5LGT A;  4PA4 A;  1V54 C;  4TWK A;  2F93 B;  4D7S A;  4OX9 B;  3JAS A;  3N2K B;  4DW0 A;  1N32 B;  1XDC A;  2RQ6 A;  2ZR2 A;  4UVC A;  1QVG U;  1RPO A;  4JI7 O;  1H2M A;  1OCC C;  1VQ4 V;  3G6E V;  2C2A A;  4JI2 O;  4B3S O;  4DR6 O;  3BRC A;  4DR2 B;  1TAE A;  4YJ2 B;  4J7J A;  2Q0O C;  3JAS B;  3KKY A;  4L8J A;  3RYC B;  4AQY O;  5JVD A;  3OGC C;  2FML A;  1VP7 A;  2LP7 A;  3H1L H;  4QE7 A;  4K0K B;  2BTO A;  1ZL8 A;  3VQV A;  2EJ7 A;  3CB2 A;  1PL0 A;  3RFR A;  5J2T B;  3WFV A;  4BIU A;  2MK3 A;  4FLX A;  1IUR A;  4DR5 O;  1NH2 B;  3JD0 A;  1AR1 B;  3OAA G;  2EIJ C;  5LA6 B;  5KHG A;  1I94 B;  4PDM A;  3CCQ V;  4ZOL A;  2X7R B;  1Q82 W;  2UU9 O;  2DYS B;  2VRZ A;  3E86 A;  1XNQ B;  1W0J G;  5CA0 B;  1G6U A;  3BVO A;  2GBO A;  1S5L Z;  5K1X A;  2QE7 G;  3LSS A;  2ZM6 O;  1XEQ A;  2P22 C;  4JYY A;  1V54 B;  1M5I A;  1WP8 A;  4P2Z A;  4R8C A;  4HYO A;  1Q81 W;  4GKK B;  3OE7 G;  3T1Y O;  5KHJ A;  1OCC B;  4NXN O;  3LNN A;  1IBM O;  4P9P A;  2CDY A;  4I9Q A;  3WG7 C;  5CA1 A;  1FS0 G;  3HPL C;  4X66 B;  3CHX A;  1M1K W;  1FFX A;  1PD3 A;  1H2G A;  1H2S B;  2HR3 A;  3ZRW B;  4FM1 A;  1B06 A;  1BSM A;  3UCS C;  4PA7 A;  3CRR A;  1SQX H;  3JD2 A;  3D3I A;  5EK0 A;  2F66 C;  1OJH A;  2EIJ B;  5CA1 B;  3UM7 A;  1B04 A;  5KHK A;  3SJA C;  2Q7G A;  2BSK A;  2WLJ A;  2ZDI A;  1QHT A;  1PV0 A;  2LJ2 A;  4U7O A;  5CA3 A;  3LDE A;  4F6R A;  1HR0 O;  3KZI Z;  3AEI A;  4OPH A;  3A0B Z;  4JI7 B;  3CE2 A;  3H1J H;  4G27 B;  3L71 H;  3ZMS A;  2JEX A;  1H38 A;  4DYL A;  3E8B A;  2DQ3 A;  1AI5 A;  3EHB B;  2FYU H;  5EYP B;  1FD9 A;  2OIE A;  3FAV B;  1IBL O;  1YJN V;  1NBM G;  4TT3 G;  3Q4H A;  5CB4 A;  2CH7 B;  3P3P A;  1JOY A;  3EFF K;  1P7B A;  3WG7 B;  4PDR A;  4ZBM A;  5CBF A;  4A5U B;  2XAQ A;  4CH4 A;  3DC5 A;  3OFN G;  1R3J C;  5CB4 B;  4E4E A;  2A9H A;  5IJ9 A;  3CJH A;  4DV2 O;  1WAZ A;  2Q0A A;  1F4N A;  1Q6U A;  1OCO C;  1K4D C;  2QWN B;  1VQ5 V;  5JQG A;  4LFB O;  4NTY A;  3L70 H;  4XDK A;  3MAQ A;  4J7K A;  4FLW A;  5BR8 B;  2YI9 A;  5JJE B;  2UXX A;  3RYI A;  1KQS U;  3IC7 A;  4DV6 B;  4JF3 A;  4WCE V;  5KAI Z;  2CUG A;  1VQ6 V;  4GX2 A;  3STZ C;  2JK5 C;  4H13 B;  4LF9 B;  1THZ A;  2CE4 A;  3FB7 C;  5A2Q N;  1Z5W A;  4NTX A;  2PGG A;  3BY6 A;  3K08 A;  1VQL V;  2LFS A;  4B7E A;  3ZRS A;  3RVZ A;  1Q6I A;  2QKC A;  2DMX A;  1SF9 A;  3E22 B;  1BMF G;  1GH6 A;  2IJH A;  2PYJ A;  3CEI A;  3CRA A;  3N2G A;  1AB3 A;  4HNA B;  1FYJ A;  4GKJ B;  3LNM B;  4I4T A;  4O4J B;  1V55 C;  3UO3 A;  2UXC O;  1CPY A;  1VQ9 V;  2IW5 A;  3FB8 C;  4I5S A;  4R50 A;  1A32 A;  1XNR O;  1OCO B;  2Y48 A;  3HKC B;  4RUF A;  1I5Y A;  1NS1 A;  1LNQ A;  1NTZ H;  1JCH A;  1TUB B;  5JWP A;  1N34 O;  3K5N A;  2E75 B;  1X59 A;  3OTO B;  2XND G;  4OPA A;  1ZLZ A;  1P7G A;  2EJR A;  3CC2 V;  4JV5 B;  2P4K A;  3K58 A;  2EZP A;  4MTF A;  4RWU A;  4DO2 A;  4J7Z A;  1V9P A;  3ZHT A;  2Q7E A;  2AHZ A;  2UXD O;  5LHI A;  4JAV A;  1YJW V;  5H6Q A;  1Y76 B;  4X1K B;  4JI1 O;  1BZK A;  4CH6 A;  2EIN C;  5IYD O;  1KU9 A;  3N27 A;  1SES A;  3RVY A;  2R70 A;  2EX3 A;  1QLN A;  1XMQ O;  1JA8 A;  4PI2 A;  5KUM A;  2QWO B;  2XAH A;  4LF4 O;  3ZHR A;  3K9S A;  4J9Z B;  2EUL A;  1QLE C;  3VQW A;  1V55 B;  4WFG A;  4L87 A;  2H3O A;  3BHP A;  1S76 D;  4FIP C;  2E3C A;  3K9A A;  1QCE A;  4PA6 A;  2WLL B;  5H2F Z;  2LGQ A;  4WBN B;  3B4S A;  4MVZ A;  1KYO F;  3ZHV A;  2HP8 A;  1SS3 A;  2YSU B;  4MVU A;  5B66 Z;  1IBK O;  5LOV B;  5EC1 C;  2ITD C;  5FNV A;  3CCV V;  1JQ0 A;  4K3A A;  4LF6 O;  3CCR V;  3KCY A;  1KKD A;  1H8E G;  2WLN A;  4I55 B;  2YID A;  3CS5 A;  3JAR A;  3UT5 A;  2YIB A;  3H9V A;  4LBE C;  3I55 V;  3JAL B;  2ILM A;  5EIB D;  4O4H A;  4NYK A;  3UO2 A;  2EIN B;  4I9W A;  4MTG A;  3ZMT A;  2IH1 C;  2ATK C;  3H1K H;  4CH5 A;  1GO3 F;  2BTQ A;  4NVP A;  5KHI A;  4UCT A;  2BOB C;  3OM3 B;  4LH7 A;  2YEV A;  4U3J B;  1QLE B;  1SQG A;  4JI8 B;  1T5E A;  4UB8 Z;  5KMG A;  1TVK A;  1S77 D;  4IYI A;  4EFE A;  3E83 A;  2VQF O;  2H94 A;  5L3G A;  2ZE7 A;  2M6Y A;  4B7K A;  3RW0 A;  3QO7 A;  4GZR B;  1L8D A;  1Z5V A;  1NH2 D;  4O2B A;  1VAR A;  1VQN V;  4PHZ A;  1S72 V;  5EC2 C;  4DV1 O;  4UCU A;  1QU7 A;  4JI1 B;  4YHH O;  4B3M O;  4JI4 O;  3CP1 A;  2QDO A;  1BL8 A;  1AIL A;  3CPW U;  4B3T O;  1QVF U;  1AI6 A;  4O4L A;  3CC4 V;  3J81 N;  3HB3 B;  2DWD C;  1AR5 A;  3APQ A;  4MTX A;  2PUS A;  3CWB H;  2P06 A;  2HFE C;  4FM0 A;  2IJI A;  3O65 A;  2L6L A;  2Z0A A;  2CTP A;  1YXB A;  1KMI Z;  1Q6H A;  2ZNI A;  2P5O A;  3JCU Z;  3OEE G;  2F1M A;  1Y6X A;  2KQX A;  4KHP O;  4DV3 B;  1N4C A;  5EIB C;  3RN4 A;  2WA4 A;  1PPJ H;  1Q3E A;  2ZNJ A;  3FFQ A;  4X9Q A;  5H6R A;  3GWO A;  5J2U A;  1GN6 A;  5LMU O;  4MT8 A;  1NZ6 A;  2HHH B;  1UFI A;  1WB8 A;  2AZ0 A;  2B5U A;  3CMA V;  1DF4 A;  2DE0 X;  3U10 A;  5EBL C;  3G4S V;  1BHA A;  1IX9 A;  4MVQ A;  2OT5 A;  3DXR B;  3HKB A;  4PV1 B;  4BWA A;  5H9C A;  4EB6 B;  3OUF A;  4DR3 B;  1HNZ O;  4DV5 O;  3U0Z A;  4X64 B;  4DR1 B;  1HNX O;  4LF7 O;  4B3R O;  4DR4 O;  3CX5 F;  4FFK A;  2NR5 A;  1EZV H;  3SPH A;  3N2K A;  2QEX V;  2UUC B;  3ZN1 A;  4EKW A;  4X62 B;  2VQF B;  4FFB B;  3VOU A;  4MVM A;  3W7X A;  1LUV A;  3WU2 Z;  2GTA A;  2A0L A;  1DGS A;  1PNL A;  3CXC U;  4YJ2 A;  2JJ2 G;  3AG3 C;  4ZI7 B;  5L3D A;  3RYC A;  4NKG B;  4FLV A;  1KEC A;  2VWK A;  3R65 A;  1HDJ A;  3SYQ A;  2XUM A;  1M90 W;  1M4U A;  1NJI W;  2EIL C;  1K92 A;  5J2T A;  2JS5 A;  4H0L B;  5DED A;  3W7W A;  1WA8 B;  2HEP A;  3AG2 C;  5LHH A;  3JD4 A;  1Z2G A;  5LA6 A;  1OV9 A;  2RCV A;  5FPO A;  1KBH A;  2LGW A;  2HG5 C;  4MSW C;  1SRY A;  2ZR3 A;  1MNG A;  2CGN A;  3K5L A;  1GKF A;  3LDC A;  4FMT A;  2WLI B;  1H2K A;  1KP3 A;  2AGA A;  4LFC O;  1O9H A;  1P84 F;  3SPJ A;  2F4V B;  3J7A U;  1S0V A;  3SPG A;  5CA0 A;  3CCS V;  1OZ0 A;  1UPG A;  1XHX A;  5KHH A;  4KHP B;  1BE3 H;  2ZE6 A;  1FXH A;  3B40 A;  2ARH A;  3OUS A;  1ROP A;  2N04 A;  5EBM C;  4DV4 O;  1MA1 A;  4G28 B;  4X20 B;  5LMU B;  2E76 B;  2WLH A;  1I08 A;  2EIK C;  2QKS A;  4ASU G;  3FKS G;  3KG2 A;  1NTK H;  3RT3 C;  5JH7 A;  1SA0 B;  4EFB A;  1ZWI C;  4FLZ A;  3AG3 B;  1VIB A;  2BCC H;  3RGB A;  4YY3 B;  3CME V;  4GT1 A;  4JYC A;  3W7T A;  4NTW A;  2XAS A;  4PDL A;  3F5W C;  2K9P A;  4UV9 A;  3ZRW A;  3H1I H;  5ITZ B;  2EIL B;  1HNW O;  4D6T H;  5JH7 B;  3AG2 B;  2QTO A;  3QG5 A;  4WFA V;  2EIM C;  1Y66 A;  1KC8 W;  1LR1 A;  4JYA O;  1RFY A;  4NXM O;  3CRC A;  4BIZ A;  3CRQ A;  1XQ8 A;  2UXN A;  3MD0 A;  4YJ3 B;  3JCZ A;  1IDS A;  1H2N A;  1B3Q A;  3SR2 C;  1M93 A;  4PI0 A;  1EFR G;  3JAT B;  4UUJ C;  1MMM A;  1DF5 A;  3ZMV A;  1BT8 A;  1PNM A;  3OEH G;  2RJZ A;  5EYP A;  2NN4 A;  3FAV A;  1R1B A;  1SQV H;  4WFF A;  1EZJ A;  5HFL A;  3OMI B;  1IZ3 A;  2CH7 A;  1SZX A;  2EIK B;  3C3T A;  2Q69 A;  4JI2 B;  4B3S B;  4DR6 B;  3OR7 C;  2Z3Y A;  3AG4 B;  1RPR A;  2Y69 C;  2YXH A;  4JI5 O;  3ZIA G;  2X6A A;  2RN9 A;  4QPJ A;  4UCR A;  1WN7 A;  4DW1 A;  4AQY B;  3NXS A;  4X89 A;  3HKE B;  1SC5 B;  2W6J G;  1N0N A;  1SET A;  3F7V C;  1K73 W;  1Y4M A;  3E8F A;  1H2L A;  4LFC B;  1AP6 A;  1BQZ A;  4X1I B;  1TGO A;  5A9G A;  2XAG A;  3SJQ C;  4DR5 B;  4RQF A;  2EIM B;  2F43 G;  3ZHQ A;  2BE3 A;  4JYB A;  4UVA A;  1J5E O;  3B77 A;  3VQY A;  2ZIO A;  3TJT A;  1K3E A;  4DV4 B;  2UUB O;  2UU9 B;  2QR4 A;  5FLX N;  5E79 Z;  2JEU A;  4DV7 O;  1WJZ A;  3JYC A;  2Q68 A;  3ETD A;  1YF2 A;  2AZ2 A;  3AG1 C;  3R66 A;  4QPK A;  1NKD A;  2Q8V A;  2QTS A;  2ZM6 B;  3P30 A;  1RSO B;  5BXZ A;  1K8A W;  1YIT V;  1D5N A;  4UV8 A;  2OCH A;  4Q6G A;  3ZMZ A;  1L1F A;  4LR3 A;  3T1Y B;  4KUM A;  4NXN B;  4DUY O;  4IHJ B;  4I7Z B;  2QM8 A;  4Z1V A;  3OTF A;  1IXB A;  3E22 A;  1IBM B;  2Y69 B;  2WWW A;  3I56 V;  3FX7 A;  2WLK A;  1GK9 A;  1JR9 A;  2KKW A;  4HNA A;  3JAW B;  4LF5 O;  2Q4P A;  4O4J A;  2B1G A;  5L3C A;  1AI7 A;  3ZRV A;  3OW2 U;  1YTF D;  4JTD B;  3PJS K;  3SYP A;  4O2A A;  2X6C A;  4JI3 O;  1BS3 A;  3ZN0 A;  2EZO A;  3HKC A;  4CS3 A;  1R3K C;  4LH6 A;  1FJG O;  3JAK A;  3IJ4 A;  3AG7 A;  1TUB A;  2Y0I A;  2B1I A;  2UUA O;  4JZG A;  3CC7 V;  1HR0 B;  4O2A B;  5KAF Z;  3L73 H;  3MHS C;  1XI1 A;  3IGA C;  1E79 G;  3AG1 B;  3CD6 V;  4W4L A;  2A3Q A;  5IYZ A;  1S5J A;  3JAK B;  1NI8 A;  3IFX A;  3ASN C;  1IBL B;  4H37 A;  3BFR A;  4GX0 A;  4DR7 O;  1Y76 A;  2GUZ B;  4X1K A;  4IT5 A;  1XUQ A;  4O4I B;  2HLD G;  1KUQ A;  1VMG A;  2OCC B;  2R9R B;  4LNU B;  3RBZ A;  2ADQ B;  3BAB A;  5FPR A;  4JAU A;  4WF9 V;  2DWE C;  3K57 A;  1MG1 A;  5IYZ B;  5F2V O;  1H8H G;  1ZAU A;  5KX5 B;  2V7Q G;  2V4D A;  1HP8 A;  4CS4 A;  3JSL A;  4HZ3 A;  3SPC A;  5CMU A;  1I0H A;  1N8R W;  3O9O A;  1NQT A;  1YSC A;  5LMN O;  1ARO P;  3D36 C;  4XBF A;  4DV2 B;  3L74 H;  1ORQ C;  3ABK C;  5K1P A;  3JD3 A;  3STL C;  2WLL A;  4LFB B;  4WBN A;  2XAJ A;  3WB2 A;  1VQP V;  4H33 A;  3DSQ A;  4ZHQ B;  4U3F H;  4FVM A;  1SQP H;  5IJ0 B;  2D2C B;  4J11 A;  5LOV A;  2OYQ A;  2FB5 A;  4AIL C;  2P7T C;  1EBO A;  1MAB G;  3G67 A;  2NLJ C;  1MSW D;  4I55 A;  3QO5 A;  2O57 A;  5E1A C;  4X8A A;  4IIJ B;  1M9N A;  5L3B A;  3ASN B;  2QWR B;  2IM9 A;  3ZHS A;  5EZY B;  1XOU A;  4MW8 A;  3JAL A;  2QWQ B;  4JTA B;  3F5T A;  4LF5 B;  2JGU A;  2EBO A;  4LCU C;  5GON B;  3T1H O;  3GWK C;  4YIP A;  2JGD B;  4WFH A;  2WLM A;  3WB1 A;  3E8G A;  1ZX3 A;  4LF8 O;  1FJG B;  1XMO O;  5KUK A;  4U3J A;  1YDX A;  4WFE A;  3VBB A;  1MZF A;  3H1H H;  4DRX B;  1U96 A;  2UXC B;  5JCO C;  3ZJZ A;  2R72 A;  1S5H C;  2CK3 G;  1XNR B;  1AJN A;  1K4C C;  3AK2 A;  2GSM B;  3ABK B;  4CBC A;  3ZBH A;  5LP6 C;  5IT9 N;  4CZZ A;  2LW1 A;  4GYC B;  4LFA O;  3ZED A;  1VF7 A;  1N34 B;  1YTF B;  4UCV A;  3CCL V;  1N33 O;  2ZT9 B;  2E74 B;  3ZHU A;  5JJJ B;  1SQB H;  1JMK C;  1ZSP A;  3DC6 A;  5D5Q A;  4TV9 B;  3U11 A;  4CH3 A;  4JI6 O;  1KD1 W;  2UXD B;  4F6E A;  2PZS A;  1OCZ C;  3C3S A;  4PD4 F;  3BPZ A;  1YEW A;  1EN5 A;  3FYI B;  4DUZ O;  3BAA A;  3K0D A;  3CYO A;  3QF7 A;  5IDJ A;  2QKA A;  2X0L A;  2OIG A;  4PJ0 Z;  4PDV A;  2AHY A;  1D2D A;  3IAY A;  2XTA A;  1VQ8 V;  1XMQ B;  4MTO A;  3K03 A;  1TUE B;  2FKX A;  2IBZ H;  4LF4 B;  4FPP A;  1N32 O;  2HVK C;  2UXB O;  2ZQM A;  1KKC A;  1NR1 A;  3BCC H;  4JAA A;  1NVP B;  1ZUQ A;  5AG2 A;  4CC6 A;  1WP7 A;  1WPB A;  4RUE A;  2OTJ V;  2HJD A;  1JFF B;  4CC5 A;  4RAI A;  1PNK A;  1GM7 A;  4DR2 O;  1Q7Y W;  5LP6 B;  5LBQ A;  3ZS8 C;  1E1R G;  2YIA A;  3F7Y C;  4BIO A;  1OHH G;  3ZCC A;  3HKD B;  3M99 B;  1Q8I A;  2GV9 A;  5BMV A;  2ZD9 A;  1G4Y B;  1LUW A;  5J9P C;  4QGP A;  2K1E A;  1IBK B;  4GX5 A;  3K59 A;  4LF6 B;  2D3O W;  3DXR A;  3S3W A;  3T1H B;  4H44 B;  1I94 O;  1X4T A;  3I5D A;  4EB6 A;  4Z1M G;  5LGN A;  1OCZ B;  4I0X B;  2PTM A;  4LF8 B;  5BMV B;  1Q43 A;  4N21 A;  4TV8 B;  3T4D A;  2PF4 E;  2Y0P A;  4KP4 A;  5DEC A;  1XNQ O;  2DYR C;  5GW7 A;  4JGS A;  4ZKI A;  4XDL A;  3UKM A;  2A06 H;  2IU0 A;  3AK3 A;  2P67 A;  4FFB A;  4RQE A;  1AI4 A;  5LXT A;  3CXH F;  2F95 B;  1L0L H;  5BZB A;  4GKK O;  1XHZ A;  1AJQ A;  4ZI7 A;  3CRM A;  2OWO A;  1L0N H;  4UVB A;  4RO2 A;  3LDD A;  3OMN B;  3JD1 A;  1XBL A;  1M57 C;  3MDS A;  1R3I C;  3E35 A;  4J41 A;  5LXT B;  3ETE A;  2W6I G;  4X66 O;  3ASO C;  1WA8 A;  2M7W A;  2CTQ A;  4BW9 A;  1EN4 A;  4DV1 B;  3TCU A;  1Y74 B;  4QIW F;  4YHH B;  2VWJ A;  4B3M B;  3SGI A;  4UFZ A;  4JI4 B;  1RM1 C;  3APO A;  1B6Q A;  4B3T B;  2WLI A;  2DJV A;  3ABU A;  1GN2 A;  4JZ2 A;  4ABM A;  2ITC C;  4YIO A;  4K35 A;  1VQM V;  3G71 V;  2KG7 B;  4TQD A;  2ZIN A;  1GN3 A;  1J95 A;  1AP5 A;  4B08 A;  2Q5Z A;  3A0R A;  2UXB B;  2ZCE A;  4D7T A;  3ETQ A;  4IL6 Z;  2KSD A;  3TXS A;  2DYR B;  1CEZ A;  2W0X A;  2ODM A;  3JAM N;  3QO8 A;  5LYJ B;  4X20 A;  2DQ0 A;  5B1B C;  4XDJ A;  3H01 A; 
#chains in the Genus database with same CATH homology
 4DV5 O;  1KUQ A;  4DV0 O;  1I94 O;  5BY1 A;  1HNX O;  4LF7 O;  4B3R O;  1R6T A;  4DR4 O;  5IT9 N;  2UUB O;  1XMQ O;  5FLX N;  2JRI A;  4DV7 O;  4DV3 O;  2DOS A;  4JI7 O;  4LF4 O;  4DV1 O;  4LFA O;  3R66 A;  4YHH O;  4K0K O;  1XNQ O;  2E5L O;  4B3M O;  1HNW O;  4JI4 O;  4JI2 O;  4B3S O;  4DR6 O;  5A2Q N;  5H5N A;  5BXZ A;  5IWA O;  2F4V O;  1YZB A;  1N33 O;  1AIL A;  4B3T O;  3OTO O;  5LMN O;  4JYA O;  3J81 N;  4NXM O;  4JV5 O;  4AQY O;  1HNZ O;  2HHH O;  1HR0 O;  4JI6 O;  4OPH A;  4GKK O;  4DUY O;  2ZKO A;  4DUZ O;  3O65 A;  2Z0A A;  1AB3 A;  3SDL A;  1IBK O;  4JI8 O;  1FYJ A;  2LW7 A;  4DR5 O;  1FKA O;  1IBL O;  4LF6 O;  5BR8 O;  2UXC O;  1D2D A;  1DK1 A;  4LF5 O;  1R1B A;  4X66 O;  4DR3 O;  1A32 A;  4X64 O;  1XNR O;  4DR1 O;  4YY3 O;  4KHP O;  4DV6 O;  1F7Y A;  2FKX A;  4JI3 O;  2UU9 O;  1N32 O;  5LL6 Y;  3J80 N;  2UXB O;  1NS1 A;  2AGA A;  4LFC O;  1FJG O;  4LF9 O;  3J7A U;  2UUC O;  1G1X B;  5LMU O;  2DJV A;  1N34 O;  4X62 O;  1X59 A;  4A5U B;  3F5T A;  1XEQ A;  2ZM6 O;  4JI5 O;  4OPA A;  4DR2 O;  2UUA O;  3T1H O;  4DV2 O;  3T1Y O;  4OX9 O;  4DV4 O;  2UXD O;  4NXN O;  4LF8 O;  2VQE O;  1XMO O;  3JAM N;  3M8A A;  4X65 O;  4LFB O;  1N36 O;  4JI1 O;  1IBM O;  4JI0 O;  2N74 A;  4DR7 O;  3RT3 C;  1J5E O;  4GKJ O;  2VQF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...