4DV6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv6O00
2F4VO 3O65A 4X66O 2FKXA 1G1XB 4K0KO 2LW7A 5FLXN 4JYAO 2UUAO 5LL6Y 1AILA 5LMUO 4DV3O 1D2DA 4X62O 1F7YA 4LF4O 4DV7O 3M8AA 4LFAO 3JAMN 2JRIA 1I94O 3SDLA 4LF7O 4DR7O 4OX9O 5IT9N 1N32O 1XEQA 4JV5O 4A5UB 1XMOO 4B3TO 4OPAA 4DV1O 4NXNO 4X65O 4JI8O 1HNZO 4DR5O 3RT3C 5A2QN 2N74A 4DR2O 1N34O 4X64O 2DOSA 3J81N 2HHHO 3J7AU 1HR0O 4OPHA 1KUQA 2VQEO 4JI2O 4KHPO 4LFCO 1DK1A 4DR6O 1XMQO 4DV5O 1XNRO 1X59A 2UXCO 4JI5O 5BR8O 3T1YO 1FKAO 4AQYO 2VQFO 2UU9O 3T1HO 4NXMO 4JI6O 3F5TA 4LF9O 4YHHO 4JI0O 1R6TA 4DUZO 4DR3O 1HNXO 1N33O 3OTOO 4JI7O 4DR1O 4DV4O 4DR4O 2UXDO 5LMNO 2UUCO 4LFBO 2Z0AA 1J5EO 2UUBO 1N36O 5BXZA 4LF5O 1IBLO 2E5LO 1AB3A 4GKKO 4DV6O 1FJGO 4YY3O 4DV0O 2DJVA 1FYJA 3R66A 4JI3O 5BY1A 4DUYO 2UXBO 1YZBA 1IBMO 2ZKOA 4JI1O 4B3MO 5IWAO 4JI4O 4DV2O 1R1BA 2ZM6O 1HNWO 4GKJO 2AGAA 1XNQO 5H5NA 4LF8O 4B3RO 4LF6O 4B3SO 1IBKO 1NS1A 3J80N 1A32A
chains in the Genus database with same CATH superfamily
3NXSA 3AG1C 1B04A 4I50B 1G6UA 3E8GA 1ROPA 3MHSC 3CS5A 4O4IB 3JYCA 5KHHA 1NVPD 1B06A 3JAWA 4PHZA 1ZL8B 3F7YC 1B3QA 1Y4MA 1SQGA 4LF7O 1H8EG 4R7CA 4YY3B 5J2TB 2CTQA 4DUYB 2IH3C 2ODMA 5CBFA 2XHBA 4FJCC 2EBOA 3RN4A 2V1DA 3OE7G 3PN1A 2PI5A 1CEZA 4J80A 2YIAA 3CJHA 2M7WA 3T1CA 4HAMA 4O2AB 2IJJA 1D5NA 2Q69A 5B3SC 1FKAO 1E79G 4RO2A 2EIKB 5JCOA 1VF6C 1VF5B 2RCVA 1SC5B 4NYKA 2KKWA 1O9HA 1M5IA 2JS3A 1UPGA 4B7KA 4JZ2A 2FB5A 3ZHTA 1S77D 1BS3A 1FXKC 4JASA 4LFCB 1FYJA 3ZRWA 1YIJV 2WLKA 5BY1A 4JI1O 1Y74A 2DWEC 5IWAO 2P4VA 3CCJV 3DC5A 3ZMTA 3UKMA 2P4KA 3L72H 2JGDB 4PDVA 3OR7C 1PD3A 4O4LA 3OGIB 4J7JA 2W6IG 4MTFA 4MVSA 4UVBA 3CCVV 2FKXA 2JIZG 4YJ3A 4DR1B 5J9PC 3QO5A 3ZHSA 4LF4O 2K9PA 2HVKC 1MSWD 1WA8B 2HJFC 1OCZC 2XAHA 2JK5C 3P30A 1SA0A 3X2QC 3H1IH 3E83A 3OD4A 1FFXB 5D5QA 2N74A 2EJ7A 3KG2A 5IJ9B 2DYSC 3JD1A 2PGGA 4KHPO 5LYJA 1W59A 2F93B 3ZS8C 3ZIAG 3SR2C 1XNRO 1IURA 2P06A 5B1BC 1M1KW 1OJHA 1WPXA 3CPWU 2P7TC 5B3SB 3D3IA 1Y76A 2DWDC 2W0XA 2VQFO 1XNQB 4NXMO 2ZE7A 1Q6HA 3SYAA 5LOVA 4JI8B 5JJJB 2DMXA 3WG7B 1D5AA 2HR3A 1L0NH 3BABA 3D8CA 4DR4O 4RQFA 2UUAB 2UUCO 3TK1A 5B1NA 2VQEB 2IM9A 1Q7YW 4NTYA 2HKOA 1IBMO 2XAJA 3GB7C 4CC6A 3SJQC 4ASUG 2ZE5A 1VARA 3HKEA 5DEDA 1F51A 3DSQA 1QQCA 2QM4A 1PM9A 3EHBB 1GN6A 2YI9A 4PDLA 1EZVH 1HR0B 1XL4A 2OCCC 1YTFD 1VQ9V 2R9RB 5KHIA 4J41A 3APOA 1AP5A 2B1GA 3D36C 3Q4HB 2OWOA 2KB1A 1WP8A 2XT9A 3CRAA 1OCZB 2ZE8A 5IJ0B 4DR7O 4GT1A 3K59A 2WLIB 1VQ6V 3K04A 4MW3A 4DUZB 4DRXB 3SPHA 2RNBA 5A2QN 1IVSA 3WB2A 4JI7B 1QLEC 1TAEA 4JZGA 2H3OA 4O2BB 3FB6C 1VEWA 4I55B 3SPIA 3E2EA 1XMQO 5B1BB 4D7TA 4CH4A 3K58A 3T1YO 4W4LA 4K8XA 1AR5A 1SQFA 1MA1A 1VF7A 5JJEB 2UXXA 4B3TB 4I7ZB 1ENVA 2IU0A 3ZMUA 3CD6V 2C2AA 3MD0A 3SYQA 4JF3A 4DYLA 1RFYA 3I55V 2OT5A 3G71V 2E5LO 3DGEA 3CCQV 4YY3O 4WFFA 4DUYO 4LNUB 3CXHF 2ZKOA 4QIWF 2N05A 3LSUA 4UB6Z 3RWRD 4C7UA 3G67A 2BTQA 5B1AC 3B09A 1UJWB 1EBOA 2WLNA 1WLEA 4ZHQB 3T1HB 2A0LA 5KMGA 4FVMA 5L3EA 2P22C 5EIBD 2Q9LA 2BE3A 2OCCB 5GTIZ 4OGQB 1BGYH 3I5DA 4YJ2A 2CGNA 4YIPA 1OV9A 2UUBB 3JAMN 3STLC 3C90A 3BAAA 4GKKB 4QPJA 4UCSA 2Q4PA 4LH6A 1XEQA 2XTAA 1PNMA 4GZRB 5LA6A 1RM1C 2ZINA 1F23A 3P3NA 2EX3A 2Q5ZA 3FB5C 3QNEA 2YIBD 4FM0A 2A06H 4GKJB 1ZLZA 1PNLA 2XAGA 4MSWC 2HP8A 4DW1A 1QLEB 3ZRWB 1H2MA 4OPHA 2F4VB 5JWPA 2F95B 4LFCO 4WBNB 1Y74B 4LR3A 1G8MA 2YS8A 3R65A 4JI1B 1RPRA 2P6JA 2UXCO 1BMFG 1R6NA 4BIUA 2L35A 4NTWA 5CMUA 3CSXA 1HP8A 3OEEG 4GYCB 3N2GA 4HZ3A 2ZDIA 4LP8A 1I08A 1VQ7V 4JV5B 4OXSA 1H2GA 4JTDB 1JJOA 2RMKB 1EN6A 4P9OA 1Q8IA 2YXYA 2DQ0A 4QPKA 3T4ZA 4DR1O 3CCEV 2HJDA 3L75H 1THZA 1IDSA 3HKDB 2YIBA 5BXZA 4UVAA 2QE7G 1SA0B 1RP3B 3TJTA 3IC7A 2FYUH 2QM8A 3TXQA 2JEXA 4O4JA 1BL8A 2AGAA 5B1AB 1GN2A 1Q3EA 2WPDG 5AG2A 3RYIB 2F23A 1OCCB 1Y67A 4N21A 4GX0A 1Q5OA 2N04A 3JASA 3K08A 3HKBB 5H6QA 3LSSA 2ZQMA 1W0KG 3A0BZ 5IE9A 1EN5A 2LW7A 3DTUB 2MK3A 1Y76B 5C8YA 1YJWV 4X1IA 4PA4A 1M57C 5CA1A 3JARA 1K5SA 2JRIA 4WFHA 4J7KA 3DC6A 4GUNA 1RM1B 2PYJA 1K4CC 1I5XA 3JAKA 4D7SA 2RDCA 4FFKA 3ZRXA 4X20B 3WB1A 4H44B 1KB9F 2X6AA 4JI8O 3RYHA 1AVMA 1MABG 1XHXA 2QTSA 1COWG 1MNGA 3JSLA 2RJZA 1DF4A 2F66C 4GX5A 3UT5B 2VQEO 4LWSA 2CTRA 4RUFA 2F1MA 3FYEB 4J7ZA 1TVKB 3HKEB 2CUGA 2ARHA 2RQ6A 3LSQA 1XHZA 1N32B 4IIJA 1NH2D 3WB0A 3G6EV 1US6A 1PPJH 2JS5A 3B2EE 4CBCA 1N4CA 3SPGA 4LFBO 1J5EO 4U3FH 1KQSU 3EFFK 4JGSA 3F7VC 3ZN1A 3FKSG 1SESA 2QWNB 3GWKC 2EIMC 3B77A 2OCHA 2PF4E 1Q6UA 2IBZH 1RPOA 2NR5A 5JH7B 1XL6A 3FD9A 3FB7C 3LNNA 2HVJC 2CTPA 1OHHG 1FD9A 3N27A 4UCOA 2VWJA 1KBHA 3K5OA 1XMQB 2CH7A 2UXDB 1D2DA 1M57B 1N36B 5EBLC 1JQ0A 2Q8VA 2CAZC 3VQVA 4PI2A 3W7UA 3PJSK 4X9QA 2JDIG 2EULA 4K8ZA 4B3TO 4I0XA 4X65O 2KSDA 3H1HH 1N0NA 4MT8A 1L0LH 1AI4A 3OEHG 3OR6C 2QR4A 5LGUA 2DOSA 2ZR3A 4RQEA 1PNKA 5LGTA 4FLZA 5KUKA 3ZMZA 5CB4B 1BE3H 2YIDA 2E5LB 5JQGA 3W7WA 1DK1A 4IHJB 3ETDA 4U3JB 1I5YA 1S3JA 4J42A 4LFAB 3CB2A 1OCOB 3RFRA 5KMGB 3B8MA 1BHBA 3T1HO 3BCCH 2CE4A 2QA4V 5J2UB 1RSOA 1VQLV 1XMOB 1GK9A 4GX2A 3B4SA 1HNXO 1MOFA 1V9PA 4I9QA 1JR9A 4CZZA 4DR5B 4H37A 2R72A 4FM1A 1N34B 2D2CB 2LW1A 3CEIA 2CK3G 1GRJA 3QG5A 2HHHB 2UUBO 3RW0A 3VOUA 1AB3A 5EYPB 4GKKO 3ZHQA 1E1RG 1R6KA 1VMGA 4QE9A 1TUBB 3C3SA 2EIMB 4GX1A 2Y48A 1GKFA 1QNMA 4QNHB 3K9AA 2A9HA 3KCXA 4P2ZA 4GKJO 2ITCC 3CRRA 1NTMH 3TCUA 1AI7A 3WG7C 2X0LA 4B3SO 3BY6A 2IJHA 4HBNA 4PELA 4JI0B 4R6ZA 2F4VO 1CPYA 1N33B 4UVCA 1G1XB 4MTGA 5EBWC 1XBLA 5DECA 1KKDA 5GONA 2UXCB 1J95A 2BOBC 1M4UA 4Q6GA 3L73H 2Q67A 4NR1A 4OX9O 4JV5O 3IC9A 4ZOLA 3CC4V 1W2BU 4NTXA 3QF7A 2BCCH 1KU9A 2YICA 4NB5A 2Q68A 1DF5A 4I4TA 5EBMC 3K5MA 1YVWA 4O4HB 3P3PA 1JFFA 3J7AU 2Y0IA 3EVKA 1SF9A 2PUSA 2YC0A 1E1QG 3OMNB 2JJ1G 4DV7B 4WCEV 4EFBA 1JX9A 3JD2A 3FX7A 3FYIB 2ZNJA 1BQ0A 1SZXA 2QKSA 1L1FA 4EB6A 4AILC 4KUMA 5L3BA 4DR2B 2EZPA 2VWKA 3CRMA 3JARB 2Z5UA 3RVZA 1R73A 2YI8A 2ZR2A 1KP2A 4RUEA 5ITZB 1K7DA 1R3KC 3HKCA 1FJGO 1HW7A 1NZ6A 1VIBA 1GTOA 1SQBH 1Y6XA 4JI5B 4LH7A 1VQ4V 2QGNA 3K0GA 5B5EZ 2Y4TA 4UB8Z 5BZBA 1GM9A 2JJ2G 1IXMA 1IXBA 1LUVA 1IX9A 3ZCCA 2CGOA 3UO2A 4FLVA 3O65A 4X66O 1K9MW 3T4DA 5C93A 1K5QA 2WA4A 1NTZH 5LL6Y 1QHTA 4X62O 2X6CA 3CMEV 4LF5B 1Q82W 4P9PA 1NT2B 2GBOA 3ZJZA 4DK1A 3ZHVA 3BA8A 1YJ9V 1N32O 5IT9N 4TV9A 3ZRSA 4JAUA 2NNUA 4YIOA 4A5UB 1XDCA 1EM1A 1MZFA 3MAQA 3SJBC 3CC2V 3K03A 3AG7A 3K57A 4LCUC 2KQXA 2P5OA 2IJKA 3SYCA 4BAYA 3ZRVA 5L3DA 4LFBB 1J5EB 1KUQA 3H1JH 4J10A 5JVDB 5JCOC 1MSDA 1BT8A 4HNAB 4FK5C 4XDLA 4XDJA 3B8NA 5KA5A 4JTAB 2ZXWC 5CA0B 5GW7A 3A8TA 3A0RA 4CC5A 3JALA 4TV8A 2QJ1A 2Y0PA 4FLUA 3OMAB 2Q7HA 5IYZB 3RYCA 1B6QA 2Y4UA 2CH7B 3CCSV 4KP4A 3CXCU 3ZMVA 5CBHA 1R3LC 2UXDO 3UO3A 2KG7B 4Z2WA 2PYLA 3S3XA 4UUJC 2BTOA 1N36O 4BW9A 3RGBA 3AG3C 3ABLC 2DYRC 2LP7A 1AJNA 1Q90D 2GUZB 3VQYA 3CMAV 3ABKC 4DV5B 5BMVA 1ZX3A 2ZM6O 1EFRG 3JD3A 2BSKA 3K5NA 3T2MA 4X65B 1CXZB 2DE0X 3ABUA 3RYFA 1YSCA 3KKYA 3SJAC 1GO3F 4JI6B 2IW5A 3JAWB 5L3CA 5KA6A 1DLBA 3QTCA 4IYHA 4F4LA 4J11A 4DR3B 3QVNA 2Q0OC 5DN6G 1NJIW 5IYCO 1JCHA 2E74B 1XILA 4JPRA 4LFAO 1BQZA 1PL4A 1IBLB 1HDJA 2ZT9B 3MDSA 3RBZA 3U0ZA 4I50A 2UXBB 2YXHA 1XMOO 1OCCC 2NLJC 4OPAA 2FTKA 4AHCA 4DV2B 1YJNV 3CJHB 4DV1O 4O4IA 3BVOA 2BOCC 5A9GA 1HNXB 4DR5O 4CS3A 5D5PA 3BFRA 1N34O 4LF8B 1S72V 5H9CA 3K79A 4TWKA 2HHHO 4B08A 1ZWIC 1EZJA 2GSMB 2HG5C 1Q43A 4KFMA 1R3IC 1BCCH 4K0KB 1K97A 3E8HA 4CS4A 1AR1B 4DV3B 2QWQB 1URFA 2ZXWB 2QM7A 3ASOC 3W7XA 4JTCB 3UQ8A 4CH5A 3AG2C 4UCVA 4WFGA 3FB8C 4B3SB 4JI0O 1NTKH 1H2NA 2R70A 2PY5A 5LGNA 4X1KA 3G4SV 2YXLA 1N33O 1XREA 3IAYA 3ZN0A 3CWBH 4MW8A 4X89A 5F2VO 3HR0A 3AG3B 3ABLB 4O4LB 2DYRB 4BWAA 2OYQA 4EFEA 2ZD9A 3R66A 4OX9B 1N0JA 3ABKB 3SYOA 5IY5C 4I4TB 1V54C 3BRCA 4UV9A 3OM3B 4YJ3B 1YI2V 5FPRA 2JGUA 2W6JG 2QWRB 3MHHC 4FLXA 1IBKO 1NS1A 5LP6A 2E76B 3K06A 1WJZA 3LDDA 3CCRV 2VS0A 1PL0A 2JGDA 1JVMA 1AILA 3OFNG 4DV7O 4Z1VA 5EC2C 4E2LA 4MVZA 3E35A 2QDOA 5KUMA 4E4EA 3BPZA 3JCZA 4N23A 2UXNA 3H1LH 5LYJB 5KX5A 2JEUA 5DM6V 2ADQB 1Z5WA 4DR2O 1WA8A 4U7OA 4DW0A 3OW2U 2QTOA 1T5EA 4G27B 1SRYA 1X4TA 5LOVB 1FJGB 1K34A 4JYAB 4JI5O 4BIZA 4R50A 3WFVA 3ASOB 4MVQA 3AG2B 4TOIA 4TUYA 4X1YA 1S0VA 3AK2A 1R6TA 3ETQA 3M7MX 1OCRB 3TGUH 2FL4A 5FNVA 4X66B 1OZ0A 4DV4O 3C3TA 3EXAA 1S5LZ 4MVUA 1VF6A 1SETA 2ADPA 1NQTA 2FMLA 4X62B 2EJRA 4LF5O 5E1AC 3LUTB 5LXTA 1QU7A 3TETA 1OCOC 1P7BA 4DV6O 3CCUV 1FXHA 3CRQA 3QO7A 5IY5B 1V54B 3E8FA 4FPPA 2YEVA 3AK1A 4XDKA 5K1PA 1FXKA 2Z3YA 4UCTA 3E8BA 1LUWA 2AHZA 4ZIBA 2E3CA 2OTLV 4PDMA 2Q73A 1S76D 3OUSA 3OUFA 3ASNC 5LMNB 4FLTA 5GTHZ 1HWYA 1KP3A 3HB3B 1YCIA 2MW2B 4B3MB 1N8RW 4JI4B 2WLLA 2YDEA 3VBBA 4TT3G 1YITV 3Q4HA 2XAQA 4PD4F 4B3RB 5IJ0A 3OGCC 1JPXA 1P84F 4JYBA 1YTFB 3D3QA 2ZDIC 5LHIA 1AR4A 4DRXA 2BSKB 3SPJA 4DV5O 2QSAA 2PZSA 2QWOB 4MVOA 1XI1A 2ZM6B 4F6RA 3ZBHA 5LP6C 4JI6O 1H8HG 2ZE6A 3SGIA 4DR3O 2AW9A 2ZIMA 4NXNB 2GHYA 1YXBA 3W7SA 3OTOO 4MVMA 4PA7A 5KHKA 4DO2A 2B1IA 2BTQB 5H6RA 1IBLO 2IJIA 2A79B 3CHXA 2ILMA 2UXBO 2OIEA 2H94A 4HYOA 5B66Z 4DV2O 1HNWO 4DV1B 2OTJV 1O9GA 5L3GA 4YJ2B 5JJNB 4Z1MG 4LF8O 1M93A 3UCSC 4WFAV 1QLNA 4LNUA 4KL1A 2AHYA 4PJ0Z 2PI4A 1XOUA 1SQVH 1NU1H 2QKAA 4RAIA 5LA6B 1YF2A 3OTFA 4K0KO 2HFEC 1WN7A 3I56V 4TQDA 1LNQA 3ASNB 5LMUO 4DV3O 4ZHQA 1K92A 1M9NA 1EN4A 4PV1B 1SQXH 4X1KB 2M6YA 2DN9A 4K35A 2LJ2A 4G28B 3D36A 1UFIA 1SZTA 2IU3A 3VQXA 4LF6B 3JATA 4JAAA 3U10A 3N2GB 2Q6AA 4AI8A 1AI5A 5CA3A 3LNMB 4IGGA 3CC7V 3GWOA 2AZ2A 3L71H 5KAFZ 1M90W 3CCMV 5BR8O 5IYBO 1NKDA 3OT7A 4UCUA 2B5UA 5LP6B 1GMGA 2Q0AA 4RWUA 3F5TA 4WBNA 1DGSA 2V4DA 3E22A 2P90A 3AG4C 4YHHO 1IBKB 2EZOA 4XBFA 1GN3A 1JOYA 2EILC 1WB7A 1HNZB 1Y66A 4ZBMA 2VRZA 1BHAA 3ETGA 4FLYA 3ZX6A 2B9ZA 4JYYA 4O4JB 3W7TA 3AG1B 1SERA 3CRCA 1I7FA 2ZIOA 4R8CA 3ICXA 3BEHA 1IZ3A 3APQA 4JI3O 2GV9A 1KKCA 1YZBA 5KX5B 1BSMA 3JASB 1AP6A 5EZYA 3ABMC 1Z2GA 3HKDA 1H2LA 5C8YB 4X1IB 2UU9B 5CA1B 4LF9B 1YDXA 4W4KA 3IGAC 2GDSA 1WPBA 5KHJA 2H8PC 4I9WA 3ZHRA 1AROP 3JAKB 4G2KA 2V7QG 4ZKIA 4FZ0A 1GH6A 2EINC 3QO8A 5CBGA 4JYAO 4L8JA 5LBQA 1MZEA 3LDCA 3SPCA 3ZEDA 4P30A 3RYIA 3RYHB 5CN0A 1GM7A 4JYCA 4QE7A 3CCLV 3UM7A 4UV8A 4TUYB 4D6TH 3SDLA 4X1YB 3H01A 3HKBA 5KHGA 5FNVB 2LQTA 4LWSB 2OIGA 2XUMA 4ZI7A 4GLXA 3JSNA 2YSUB 3KZIZ 4MVRA 5LXTB 4DV4B 1M56C 2WAMA 2PTMA 1K33A 1VQPV 4JI2O 4IIJB 1FS0G 2LFSA 4X20A 3N2KA 4X88A 4DV6B 4MTOA 2YEVB 3FAVA 1PV0A 1X59A 1FXKB 2E75B 1V55C 2NN4A 2AZ0A 5HFMA 4AQYO 3UT5A 1U96A 4FIPC 3AG4B 4WF9V 1TVKA 1ZUQA 1MMMA 2EILB 1U97A 2IH1C 4LBEC 4X64B 3A0HZ 5LMNO 1S5JA 1VQMV 4YXWG 2A7WA 4DV0O 1FPOA 2WLLB 1AI6A 4DR6B 1NBMG 2ETNA 1S5HC 3G80A 4U7NA 4B3MO 4JI4O 2ITDC 4H0LB 3ABMB 2ZNIA 4TSFG 1TUEB 2QEXV 1NH2B 1KC8W 2JVDA 4BW5A 5H5NA 2LO1A 4DK0A 3X2QB 3IJ4A 4B3RO 1WNSA 4ICGA 3GVMA 1FFTB 2EINB 2DYSB 3A2FA 5FLXN 3AK3A 2LGWA 4I0XB 1PKXA 2DQ3A 5JH7A 3M8AA 4F6RB 3P32A 5FL7G 4FFBA 2WLJA 4FMTA 4BIOA 1I94O 3U11A 2CDYA 1KMIZ 5H2FZ 1JJ2U 1Q86W 3O9OA 4UXNA 1H2KA 1WAZA 3ZMSA 1K3EA 2ATKC 2WLHA 4PI0A 3ABTA 3L74H 1PP9H 1QR8A 3STZC 5JQGB 4NXNO 2WSSG 4EKWA 3E86A 3RT3C 3OTOB 1M56B 4ABMA 4K3AA 3DXRA 4CH6A 3J81N 4PA9A 4IYIA 1SQQH 1F4MA 3THOA 1JA8A 3ZHUA 1RSOB 2QKCA 2CTWA 1GN4A 1P49A 1KD1W 1V55B 3G6BA 1HNWB 4LF7B 1ZL8A 5CB4A 3F5WC 1VQKV 3K5LA 5J2TA 4IHJA 4U3JA 1G4YB 2XOKG 1NVPB 5E79Z 5LMUB 3M99B 1BZKA 4QGPA 5J2UA 3AEIA 1Q6IA 1FAFA 3FFQA 3KCYA 3BA9A 3NR7A 5KLVH 1FXVA 3VQWA 4O2AA 1OCRC 2Q7EA 1NR7A 3JATB 1WP7A 3RVYA 2W0FC 5EYPA 1VQ5V 5GONB 4LF6O 3CP1A 3S3WA 1TUBA 1YHQV 1CP9A 5HFLA 4ZOLB 3IFXA 4PA3A 2Y69C 1JMKC 1K8AW 5LHGA 4H13B 2O57A 1QCEA 5BR8B 1NR1A 3E22B 4DXWA 5B1OA 2F43G 1JFFB 4QJFB 1QVFU 1P4RA 3LDEA 2RN9A 1W0JG 2AXTZ 5IWAB 4MS2A 4YHHB 3OAAG 1HNZO 2R9IA 1QVGU 4LC1A 2HLDG 3K3WA 1ZTEA 5EK0A 1DTOA 3JD4A 1P7GA 2WA3A 3BHPA 5LHHA 5EZYB 4JI3B 4EB6B 4J9ZB 3L70H 4WFEA 4LF4B 1SKVA 4O4HA 2X7RB 2D3OW 1TA8A 1QR9A 2EIJC 2XASA 2UU9O 3TXSA 4LF9O 3WU2Z 4CS2A 5IDJA 4WFBV 3HKCB 2X6BA 3OMIB 3L9DA 5EC1C 1FFXA 4MTXA 4I5SA 1ZSPA 4IL6Z 5KAIZ 4X8AA 5IJ9A 2GTAA 4KHPB 2LGQA 4FLWA 1H38A 5TISZ 4J9YB 4ZI7B 1XNRB 3CX5F 2XAFA 4NKGB 1R1BA 1R3JC 1K4DC 1AJQA 1Q81W 1XNQO 4EEQA 2VQFB 3JD0A 5ITZA 4UCRA 4NXMB 5K1XA 1YEWA 3J80N 1KYOF 1MG1A 1A32A 3N2KB 4TV9B 2YUAA 2K1EA 2R9AA 3CE2A 3FAVB 4JI2B 2Y69B 2ZCEA 5L3FA 2UUAO 4DR4B 2HEPA 1F7YA 1VQOV 2UUCB 3H9VA 4AQYB 4H33A 1IBMB 3JCUZ 4L87A 1XUQA 1I0HA 4Q20A 2QWPB 1VQNV 3SYPA 4PDRA 4TQFA 2A3QA 3SJCC 4X64O 1WB8A 1VQ8V 4FZ1A 2G38A 1HR0O 2LFRA 4JAVA 1F4NA 1AJPA 3JALB 2L6LA 3ETEA 4TV8B 1H2SB 4PA6A 3ML0A 4DV0B 4DR6O 4UFZA 1KECA 4B7EA 1ORQC 2WWWA 3RYCB 1SQPH 3H1KH 2WLMA 5FPOA 1NI8A 1TGOA 2EIKC 1XQ8A 1GAXA 2EIJB 4CH3A 4DR7B 1L8DA 5JVDA 5EIBC 1GM8A 4HNAA 4FM2A 4DUZO 2DW4A 2WLIA 4IT5A 3B40A 4KXRA 4JI7O 5BMVB 5CA0A 4FFBB 1K73W 2Z0AA 1LR1A 1SS3A 3RYFB 2P67A 2XNDG 4F6EA 4GCZA 5IYDO 1I94B 1Z5VA 3CYOA 2DJVA 5IYZA 2GTSA 2Q7GA 3E89A 3K9SA 4O2BA 3K0DA 4I55A 1ZAUA 1QBZA 3T1YB 2KG7A 3HPLC 3DXRB 4BR6A 4NVPA 2GUZA 1VP7A
chains in the Genus database with same CATH topology
2F4VO 3O65A 4X66O 2FKXA 1G1XB 4K0KO 2LW7A 5FLXN 4JYAO 2UUAO 5LL6Y 1AILA 5LMUO 4DV3O 1D2DA 4X62O 1F7YA 4LF4O 4DV7O 3M8AA 4LFAO 3JAMN 2JRIA 1I94O 3SDLA 4LF7O 4DR7O 4OX9O 5IT9N 1N32O 1XEQA 4JV5O 4A5UB 1XMOO 4B3TO 4OPAA 4DV1O 4NXNO 4X65O 4JI8O 1HNZO 4DR5O 3RT3C 5A2QN 2N74A 4DR2O 1N34O 4X64O 2DOSA 3J81N 2HHHO 3J7AU 1HR0O 4OPHA 1KUQA 2VQEO 4JI2O 4KHPO 4LFCO 1DK1A 4DR6O 1XMQO 4DV5O 1XNRO 1X59A 2UXCO 4JI5O 5BR8O 3T1YO 1FKAO 4AQYO 2VQFO 2UU9O 3T1HO 4NXMO 4JI6O 3F5TA 4LF9O 4YHHO 4JI0O 1R6TA 4DUZO 4DR3O 1HNXO 1N33O 3OTOO 4JI7O 4DR1O 4DV4O 4DR4O 2UXDO 5LMNO 2UUCO 4LFBO 2Z0AA 1J5EO 2UUBO 1N36O 5BXZA 4LF5O 1IBLO 2E5LO 1AB3A 4GKKO 4DV6O 1FJGO 4YY3O 4DV0O 2DJVA 1FYJA 3R66A 4JI3O 5BY1A 4DUYO 2UXBO 1YZBA 1IBMO 2ZKOA 4JI1O 4B3MO 5IWAO 4JI4O 4DV2O 1R1BA 2ZM6O 1HNWO 4GKJO 2AGAA 1XNQO 5H5NA 4LF8O 4B3RO 4LF6O 4B3SO 1IBKO 1NS1A 3J80N 1A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V O;  3O65 A;  4X66 O;  2FKX A;  1G1X B;  4K0K O;  2LW7 A;  5FLX N;  4JYA O;  2UUA O;  5LL6 Y;  1AIL A;  5LMU O;  4DV3 O;  1D2D A;  4X62 O;  1F7Y A;  4LF4 O;  4DV7 O;  3M8A A;  4LFA O;  3JAM N;  2JRI A;  1I94 O;  3SDL A;  4LF7 O;  4DR7 O;  4OX9 O;  5IT9 N;  1N32 O;  1XEQ A;  4JV5 O;  4A5U B;  1XMO O;  4B3T O;  4OPA A;  4DV1 O;  4NXN O;  4X65 O;  4JI8 O;  1HNZ O;  4DR5 O;  3RT3 C;  5A2Q N;  2N74 A;  4DR2 O;  1N34 O;  4X64 O;  2DOS A;  3J81 N;  2HHH O;  3J7A U;  1HR0 O;  4OPH A;  1KUQ A;  2VQE O;  4JI2 O;  4KHP O;  4LFC O;  1DK1 A;  4DR6 O;  1XMQ O;  4DV5 O;  1XNR O;  1X59 A;  2UXC O;  4JI5 O;  5BR8 O;  3T1Y O;  1FKA O;  4AQY O;  2VQF O;  2UU9 O;  3T1H O;  4NXM O;  4JI6 O;  3F5T A;  4LF9 O;  4YHH O;  4JI0 O;  1R6T A;  4DUZ O;  4DR3 O;  1HNX O;  1N33 O;  3OTO O;  4JI7 O;  4DR1 O;  4DV4 O;  4DR4 O;  2UXD O;  5LMN O;  2UUC O;  4LFB O;  2Z0A A;  1J5E O;  2UUB O;  1N36 O;  5BXZ A;  4LF5 O;  1IBL O;  2E5L O;  1AB3 A;  4GKK O;  4DV6 O;  1FJG O;  4YY3 O;  4DV0 O;  2DJV A;  1FYJ A;  3R66 A;  4JI3 O;  5BY1 A;  4DUY O;  2UXB O;  1YZB A;  1IBM O;  2ZKO A;  4JI1 O;  4B3M O;  5IWA O;  4JI4 O;  4DV2 O;  1R1B A;  2ZM6 O;  1HNW O;  4GKJ O;  2AGA A;  1XNQ O;  5H5N A;  4LF8 O;  4B3R O;  4LF6 O;  4B3S O;  1IBK O;  1NS1 A;  3J80 N;  1A32 A; 
#chains in the Genus database with same CATH topology
 3NXS A;  3AG1 C;  1B04 A;  4I50 B;  1G6U A;  3E8G A;  1ROP A;  3MHS C;  3CS5 A;  4O4I B;  3JYC A;  5KHH A;  1NVP D;  1B06 A;  3JAW A;  4PHZ A;  1ZL8 B;  3F7Y C;  1B3Q A;  1Y4M A;  1SQG A;  4LF7 O;  1H8E G;  4R7C A;  4YY3 B;  5J2T B;  2CTQ A;  4DUY B;  2IH3 C;  2ODM A;  5CBF A;  2XHB A;  4FJC C;  2EBO A;  3RN4 A;  2V1D A;  3OE7 G;  3PN1 A;  2PI5 A;  1CEZ A;  4J80 A;  2YIA A;  3CJH A;  2M7W A;  3T1C A;  4HAM A;  4O2A B;  2IJJ A;  1D5N A;  2Q69 A;  5B3S C;  1FKA O;  1E79 G;  4RO2 A;  2EIK B;  5JCO A;  1VF6 C;  1VF5 B;  2RCV A;  1SC5 B;  4NYK A;  2KKW A;  1O9H A;  1M5I A;  2JS3 A;  1UPG A;  4B7K A;  4JZ2 A;  2FB5 A;  3ZHT A;  1S77 D;  1BS3 A;  1FXK C;  4JAS A;  4LFC B;  1FYJ A;  3ZRW A;  1YIJ V;  2WLK A;  5BY1 A;  4JI1 O;  1Y74 A;  2DWE C;  5IWA O;  2P4V A;  3CCJ V;  3DC5 A;  3ZMT A;  3UKM A;  2P4K A;  3L72 H;  2JGD B;  4PDV A;  3OR7 C;  1PD3 A;  4O4L A;  3OGI B;  4J7J A;  2W6I G;  4MTF A;  4MVS A;  4UVB A;  3CCV V;  2FKX A;  2JIZ G;  4YJ3 A;  4DR1 B;  5J9P C;  3QO5 A;  3ZHS A;  4LF4 O;  2K9P A;  2HVK C;  1MSW D;  1WA8 B;  2HJF C;  1OCZ C;  2XAH A;  2JK5 C;  3P30 A;  1SA0 A;  3X2Q C;  3H1I H;  3E83 A;  3OD4 A;  1FFX B;  5D5Q A;  2N74 A;  2EJ7 A;  3KG2 A;  5IJ9 B;  2DYS C;  3JD1 A;  2PGG A;  4KHP O;  5LYJ A;  1W59 A;  2F93 B;  3ZS8 C;  3ZIA G;  3SR2 C;  1XNR O;  1IUR A;  2P06 A;  5B1B C;  1M1K W;  1OJH A;  1WPX A;  3CPW U;  2P7T C;  5B3S B;  3D3I A;  1Y76 A;  2DWD C;  2W0X A;  2VQF O;  1XNQ B;  4NXM O;  2ZE7 A;  1Q6H A;  3SYA A;  5LOV A;  4JI8 B;  5JJJ B;  2DMX A;  3WG7 B;  1D5A A;  2HR3 A;  1L0N H;  3BAB A;  3D8C A;  4DR4 O;  4RQF A;  2UUA B;  2UUC O;  3TK1 A;  5B1N A;  2VQE B;  2IM9 A;  1Q7Y W;  4NTY A;  2HKO A;  1IBM O;  2XAJ A;  3GB7 C;  4CC6 A;  3SJQ C;  4ASU G;  2ZE5 A;  1VAR A;  3HKE A;  5DED A;  1F51 A;  3DSQ A;  1QQC A;  2QM4 A;  1PM9 A;  3EHB B;  1GN6 A;  2YI9 A;  4PDL A;  1EZV H;  1HR0 B;  1XL4 A;  2OCC C;  1YTF D;  1VQ9 V;  2R9R B;  5KHI A;  4J41 A;  3APO A;  1AP5 A;  2B1G A;  3D36 C;  3Q4H B;  2OWO A;  2KB1 A;  1WP8 A;  2XT9 A;  3CRA A;  1OCZ B;  2ZE8 A;  5IJ0 B;  4DR7 O;  4GT1 A;  3K59 A;  2WLI B;  1VQ6 V;  3K04 A;  4MW3 A;  4DUZ B;  4DRX B;  3SPH A;  2RNB A;  5A2Q N;  1IVS A;  3WB2 A;  4JI7 B;  1QLE C;  1TAE A;  4JZG A;  2H3O A;  4O2B B;  3FB6 C;  1VEW A;  4I55 B;  3SPI A;  3E2E A;  1XMQ O;  5B1B B;  4D7T A;  4CH4 A;  3K58 A;  3T1Y O;  4W4L A;  4K8X A;  1AR5 A;  1SQF A;  1MA1 A;  1VF7 A;  5JJE B;  2UXX A;  4B3T B;  4I7Z B;  1ENV A;  2IU0 A;  3ZMU A;  3CD6 V;  2C2A A;  3MD0 A;  3SYQ A;  4JF3 A;  4DYL A;  1RFY A;  3I55 V;  2OT5 A;  3G71 V;  2E5L O;  3DGE A;  3CCQ V;  4YY3 O;  4WFF A;  4DUY O;  4LNU B;  3CXH F;  2ZKO A;  4QIW F;  2N05 A;  3LSU A;  4UB6 Z;  3RWR D;  4C7U A;  3G67 A;  2BTQ A;  5B1A C;  3B09 A;  1UJW B;  1EBO A;  2WLN A;  1WLE A;  4ZHQ B;  3T1H B;  2A0L A;  5KMG A;  4FVM A;  5L3E A;  2P22 C;  5EIB D;  2Q9L A;  2BE3 A;  2OCC B;  5GTI Z;  4OGQ B;  1BGY H;  3I5D A;  4YJ2 A;  2CGN A;  4YIP A;  1OV9 A;  2UUB B;  3JAM N;  3STL C;  3C90 A;  3BAA A;  4GKK B;  4QPJ A;  4UCS A;  2Q4P A;  4LH6 A;  1XEQ A;  2XTA A;  1PNM A;  4GZR B;  5LA6 A;  1RM1 C;  2ZIN A;  1F23 A;  3P3N A;  2EX3 A;  2Q5Z A;  3FB5 C;  3QNE A;  2YIB D;  4FM0 A;  2A06 H;  4GKJ B;  1ZLZ A;  1PNL A;  2XAG A;  4MSW C;  2HP8 A;  4DW1 A;  1QLE B;  3ZRW B;  1H2M A;  4OPH A;  2F4V B;  5JWP A;  2F95 B;  4LFC O;  4WBN B;  1Y74 B;  4LR3 A;  1G8M A;  2YS8 A;  3R65 A;  4JI1 B;  1RPR A;  2P6J A;  2UXC O;  1BMF G;  1R6N A;  4BIU A;  2L35 A;  4NTW A;  5CMU A;  3CSX A;  1HP8 A;  3OEE G;  4GYC B;  3N2G A;  4HZ3 A;  2ZDI A;  4LP8 A;  1I08 A;  1VQ7 V;  4JV5 B;  4OXS A;  1H2G A;  4JTD B;  1JJO A;  2RMK B;  1EN6 A;  4P9O A;  1Q8I A;  2YXY A;  2DQ0 A;  4QPK A;  3T4Z A;  4DR1 O;  3CCE V;  2HJD A;  3L75 H;  1THZ A;  1IDS A;  3HKD B;  2YIB A;  5BXZ A;  4UVA A;  2QE7 G;  1SA0 B;  1RP3 B;  3TJT A;  3IC7 A;  2FYU H;  2QM8 A;  3TXQ A;  2JEX A;  4O4J A;  1BL8 A;  2AGA A;  5B1A B;  1GN2 A;  1Q3E A;  2WPD G;  5AG2 A;  3RYI B;  2F23 A;  1OCC B;  1Y67 A;  4N21 A;  4GX0 A;  1Q5O A;  2N04 A;  3JAS A;  3K08 A;  3HKB B;  5H6Q A;  3LSS A;  2ZQM A;  1W0K G;  3A0B Z;  5IE9 A;  1EN5 A;  2LW7 A;  3DTU B;  2MK3 A;  1Y76 B;  5C8Y A;  1YJW V;  4X1I A;  4PA4 A;  1M57 C;  5CA1 A;  3JAR A;  1K5S A;  2JRI A;  4WFH A;  4J7K A;  3DC6 A;  4GUN A;  1RM1 B;  2PYJ A;  1K4C C;  1I5X A;  3JAK A;  4D7S A;  2RDC A;  4FFK A;  3ZRX A;  4X20 B;  3WB1 A;  4H44 B;  1KB9 F;  2X6A A;  4JI8 O;  3RYH A;  1AVM A;  1MAB G;  1XHX A;  2QTS A;  1COW G;  1MNG A;  3JSL A;  2RJZ A;  1DF4 A;  2F66 C;  4GX5 A;  3UT5 B;  2VQE O;  4LWS A;  2CTR A;  4RUF A;  2F1M A;  3FYE B;  4J7Z A;  1TVK B;  3HKE B;  2CUG A;  2ARH A;  2RQ6 A;  3LSQ A;  1XHZ A;  1N32 B;  4IIJ A;  1NH2 D;  3WB0 A;  3G6E V;  1US6 A;  1PPJ H;  2JS5 A;  3B2E E;  4CBC A;  1N4C A;  3SPG A;  4LFB O;  1J5E O;  4U3F H;  1KQS U;  3EFF K;  4JGS A;  3F7V C;  3ZN1 A;  3FKS G;  1SES A;  2QWN B;  3GWK C;  2EIM C;  3B77 A;  2OCH A;  2PF4 E;  1Q6U A;  2IBZ H;  1RPO A;  2NR5 A;  5JH7 B;  1XL6 A;  3FD9 A;  3FB7 C;  3LNN A;  2HVJ C;  2CTP A;  1OHH G;  1FD9 A;  3N27 A;  4UCO A;  2VWJ A;  1KBH A;  3K5O A;  1XMQ B;  2CH7 A;  2UXD B;  1D2D A;  1M57 B;  1N36 B;  5EBL C;  1JQ0 A;  2Q8V A;  2CAZ C;  3VQV A;  4PI2 A;  3W7U A;  3PJS K;  4X9Q A;  2JDI G;  2EUL A;  4K8Z A;  4B3T O;  4I0X A;  4X65 O;  2KSD A;  3H1H H;  1N0N A;  4MT8 A;  1L0L H;  1AI4 A;  3OEH G;  3OR6 C;  2QR4 A;  5LGU A;  2DOS A;  2ZR3 A;  4RQE A;  1PNK A;  5LGT A;  4FLZ A;  5KUK A;  3ZMZ A;  5CB4 B;  1BE3 H;  2YID A;  2E5L B;  5JQG A;  3W7W A;  1DK1 A;  4IHJ B;  3ETD A;  4U3J B;  1I5Y A;  1S3J A;  4J42 A;  4LFA B;  3CB2 A;  1OCO B;  3RFR A;  5KMG B;  3B8M A;  1BHB A;  3T1H O;  3BCC H;  2CE4 A;  2QA4 V;  5J2U B;  1RSO A;  1VQL V;  1XMO B;  1GK9 A;  4GX2 A;  3B4S A;  1HNX O;  1MOF A;  1V9P A;  4I9Q A;  1JR9 A;  4CZZ A;  4DR5 B;  4H37 A;  2R72 A;  4FM1 A;  1N34 B;  2D2C B;  2LW1 A;  3CEI A;  2CK3 G;  1GRJ A;  3QG5 A;  2HHH B;  2UUB O;  3RW0 A;  3VOU A;  1AB3 A;  5EYP B;  4GKK O;  3ZHQ A;  1E1R G;  1R6K A;  1VMG A;  4QE9 A;  1TUB B;  3C3S A;  2EIM B;  4GX1 A;  2Y48 A;  1GKF A;  1QNM A;  4QNH B;  3K9A A;  2A9H A;  3KCX A;  4P2Z A;  4GKJ O;  2ITC C;  3CRR A;  1NTM H;  3TCU A;  1AI7 A;  3WG7 C;  2X0L A;  4B3S O;  3BY6 A;  2IJH A;  4HBN A;  4PEL A;  4JI0 B;  4R6Z A;  2F4V O;  1CPY A;  1N33 B;  4UVC A;  1G1X B;  4MTG A;  5EBW C;  1XBL A;  5DEC A;  1KKD A;  5GON A;  2UXC B;  1J95 A;  2BOB C;  1M4U A;  4Q6G A;  3L73 H;  2Q67 A;  4NR1 A;  4OX9 O;  4JV5 O;  3IC9 A;  4ZOL A;  3CC4 V;  1W2B U;  4NTX A;  3QF7 A;  2BCC H;  1KU9 A;  2YIC A;  4NB5 A;  2Q68 A;  1DF5 A;  4I4T A;  5EBM C;  3K5M A;  1YVW A;  4O4H B;  3P3P A;  1JFF A;  3J7A U;  2Y0I A;  3EVK A;  1SF9 A;  2PUS A;  2YC0 A;  1E1Q G;  3OMN B;  2JJ1 G;  4DV7 B;  4WCE V;  4EFB A;  1JX9 A;  3JD2 A;  3FX7 A;  3FYI B;  2ZNJ A;  1BQ0 A;  1SZX A;  2QKS A;  1L1F A;  4EB6 A;  4AIL C;  4KUM A;  5L3B A;  4DR2 B;  2EZP A;  2VWK A;  3CRM A;  3JAR B;  2Z5U A;  3RVZ A;  1R73 A;  2YI8 A;  2ZR2 A;  1KP2 A;  4RUE A;  5ITZ B;  1K7D A;  1R3K C;  3HKC A;  1FJG O;  1HW7 A;  1NZ6 A;  1VIB A;  1GTO A;  1SQB H;  1Y6X A;  4JI5 B;  4LH7 A;  1VQ4 V;  2QGN A;  3K0G A;  5B5E Z;  2Y4T A;  4UB8 Z;  5BZB A;  1GM9 A;  2JJ2 G;  1IXM A;  1IXB A;  1LUV A;  1IX9 A;  3ZCC A;  2CGO A;  3UO2 A;  4FLV A;  3O65 A;  4X66 O;  1K9M W;  3T4D A;  5C93 A;  1K5Q A;  2WA4 A;  1NTZ H;  5LL6 Y;  1QHT A;  4X62 O;  2X6C A;  3CME V;  4LF5 B;  1Q82 W;  4P9P A;  1NT2 B;  2GBO A;  3ZJZ A;  4DK1 A;  3ZHV A;  3BA8 A;  1YJ9 V;  1N32 O;  5IT9 N;  4TV9 A;  3ZRS A;  4JAU A;  2NNU A;  4YIO A;  4A5U B;  1XDC A;  1EM1 A;  1MZF A;  3MAQ A;  3SJB C;  3CC2 V;  3K03 A;  3AG7 A;  3K57 A;  4LCU C;  2KQX A;  2P5O A;  2IJK A;  3SYC A;  4BAY A;  3ZRV A;  5L3D A;  4LFB B;  1J5E B;  1KUQ A;  3H1J H;  4J10 A;  5JVD B;  5JCO C;  1MSD A;  1BT8 A;  4HNA B;  4FK5 C;  4XDL A;  4XDJ A;  3B8N A;  5KA5 A;  4JTA B;  2ZXW C;  5CA0 B;  5GW7 A;  3A8T A;  3A0R A;  4CC5 A;  3JAL A;  4TV8 A;  2QJ1 A;  2Y0P A;  4FLU A;  3OMA B;  2Q7H A;  5IYZ B;  3RYC A;  1B6Q A;  2Y4U A;  2CH7 B;  3CCS V;  4KP4 A;  3CXC U;  3ZMV A;  5CBH A;  1R3L C;  2UXD O;  3UO3 A;  2KG7 B;  4Z2W A;  2PYL A;  3S3X A;  4UUJ C;  2BTO A;  1N36 O;  4BW9 A;  3RGB A;  3AG3 C;  3ABL C;  2DYR C;  2LP7 A;  1AJN A;  1Q90 D;  2GUZ B;  3VQY A;  3CMA V;  3ABK C;  4DV5 B;  5BMV A;  1ZX3 A;  2ZM6 O;  1EFR G;  3JD3 A;  2BSK A;  3K5N A;  3T2M A;  4X65 B;  1CXZ B;  2DE0 X;  3ABU A;  3RYF A;  1YSC A;  3KKY A;  3SJA C;  1GO3 F;  4JI6 B;  2IW5 A;  3JAW B;  5L3C A;  5KA6 A;  1DLB A;  3QTC A;  4IYH A;  4F4L A;  4J11 A;  4DR3 B;  3QVN A;  2Q0O C;  5DN6 G;  1NJI W;  5IYC O;  1JCH A;  2E74 B;  1XIL A;  4JPR A;  4LFA O;  1BQZ A;  1PL4 A;  1IBL B;  1HDJ A;  2ZT9 B;  3MDS A;  3RBZ A;  3U0Z A;  4I50 A;  2UXB B;  2YXH A;  1XMO O;  1OCC C;  2NLJ C;  4OPA A;  2FTK A;  4AHC A;  4DV2 B;  1YJN V;  3CJH B;  4DV1 O;  4O4I A;  3BVO A;  2BOC C;  5A9G A;  1HNX B;  4DR5 O;  4CS3 A;  5D5P A;  3BFR A;  1N34 O;  4LF8 B;  1S72 V;  5H9C A;  3K79 A;  4TWK A;  2HHH O;  4B08 A;  1ZWI C;  1EZJ A;  2GSM B;  2HG5 C;  1Q43 A;  4KFM A;  1R3I C;  1BCC H;  4K0K B;  1K97 A;  3E8H A;  4CS4 A;  1AR1 B;  4DV3 B;  2QWQ B;  1URF A;  2ZXW B;  2QM7 A;  3ASO C;  3W7X A;  4JTC B;  3UQ8 A;  4CH5 A;  3AG2 C;  4UCV A;  4WFG A;  3FB8 C;  4B3S B;  4JI0 O;  1NTK H;  1H2N A;  2R70 A;  2PY5 A;  5LGN A;  4X1K A;  3G4S V;  2YXL A;  1N33 O;  1XRE A;  3IAY A;  3ZN0 A;  3CWB H;  4MW8 A;  4X89 A;  5F2V O;  3HR0 A;  3AG3 B;  3ABL B;  4O4L B;  2DYR B;  4BWA A;  2OYQ A;  4EFE A;  2ZD9 A;  3R66 A;  4OX9 B;  1N0J A;  3ABK B;  3SYO A;  5IY5 C;  4I4T B;  1V54 C;  3BRC A;  4UV9 A;  3OM3 B;  4YJ3 B;  1YI2 V;  5FPR A;  2JGU A;  2W6J G;  2QWR B;  3MHH C;  4FLX A;  1IBK O;  1NS1 A;  5LP6 A;  2E76 B;  3K06 A;  1WJZ A;  3LDD A;  3CCR V;  2VS0 A;  1PL0 A;  2JGD A;  1JVM A;  1AIL A;  3OFN G;  4DV7 O;  4Z1V A;  5EC2 C;  4E2L A;  4MVZ A;  3E35 A;  2QDO A;  5KUM A;  4E4E A;  3BPZ A;  3JCZ A;  4N23 A;  2UXN A;  3H1L H;  5LYJ B;  5KX5 A;  2JEU A;  5DM6 V;  2ADQ B;  1Z5W A;  4DR2 O;  1WA8 A;  4U7O A;  4DW0 A;  3OW2 U;  2QTO A;  1T5E A;  4G27 B;  1SRY A;  1X4T A;  5LOV B;  1FJG B;  1K34 A;  4JYA B;  4JI5 O;  4BIZ A;  4R50 A;  3WFV A;  3ASO B;  4MVQ A;  3AG2 B;  4TOI A;  4TUY A;  4X1Y A;  1S0V A;  3AK2 A;  1R6T A;  3ETQ A;  3M7M X;  1OCR B;  3TGU H;  2FL4 A;  5FNV A;  4X66 B;  1OZ0 A;  4DV4 O;  3C3T A;  3EXA A;  1S5L Z;  4MVU A;  1VF6 A;  1SET A;  2ADP A;  1NQT A;  2FML A;  4X62 B;  2EJR A;  4LF5 O;  5E1A C;  3LUT B;  5LXT A;  1QU7 A;  3TET A;  1OCO C;  1P7B A;  4DV6 O;  3CCU V;  1FXH A;  3CRQ A;  3QO7 A;  5IY5 B;  1V54 B;  3E8F A;  4FPP A;  2YEV A;  3AK1 A;  4XDK A;  5K1P A;  1FXK A;  2Z3Y A;  4UCT A;  3E8B A;  1LUW A;  2AHZ A;  4ZIB A;  2E3C A;  2OTL V;  4PDM A;  2Q73 A;  1S76 D;  3OUS A;  3OUF A;  3ASN C;  5LMN B;  4FLT A;  5GTH Z;  1HWY A;  1KP3 A;  3HB3 B;  1YCI A;  2MW2 B;  4B3M B;  1N8R W;  4JI4 B;  2WLL A;  2YDE A;  3VBB A;  4TT3 G;  1YIT V;  3Q4H A;  2XAQ A;  4PD4 F;  4B3R B;  5IJ0 A;  3OGC C;  1JPX A;  1P84 F;  4JYB A;  1YTF B;  3D3Q A;  2ZDI C;  5LHI A;  1AR4 A;  4DRX A;  2BSK B;  3SPJ A;  4DV5 O;  2QSA A;  2PZS A;  2QWO B;  4MVO A;  1XI1 A;  2ZM6 B;  4F6R A;  3ZBH A;  5LP6 C;  4JI6 O;  1H8H G;  2ZE6 A;  3SGI A;  4DR3 O;  2AW9 A;  2ZIM A;  4NXN B;  2GHY A;  1YXB A;  3W7S A;  3OTO O;  4MVM A;  4PA7 A;  5KHK A;  4DO2 A;  2B1I A;  2BTQ B;  5H6R A;  1IBL O;  2IJI A;  2A79 B;  3CHX A;  2ILM A;  2UXB O;  2OIE A;  2H94 A;  4HYO A;  5B66 Z;  4DV2 O;  1HNW O;  4DV1 B;  2OTJ V;  1O9G A;  5L3G A;  4YJ2 B;  5JJN B;  4Z1M G;  4LF8 O;  1M93 A;  3UCS C;  4WFA V;  1QLN A;  4LNU A;  4KL1 A;  2AHY A;  4PJ0 Z;  2PI4 A;  1XOU A;  1SQV H;  1NU1 H;  2QKA A;  4RAI A;  5LA6 B;  1YF2 A;  3OTF A;  4K0K O;  2HFE C;  1WN7 A;  3I56 V;  4TQD A;  1LNQ A;  3ASN B;  5LMU O;  4DV3 O;  4ZHQ A;  1K92 A;  1M9N A;  1EN4 A;  4PV1 B;  1SQX H;  4X1K B;  2M6Y A;  2DN9 A;  4K35 A;  2LJ2 A;  4G28 B;  3D36 A;  1UFI A;  1SZT A;  2IU3 A;  3VQX A;  4LF6 B;  3JAT A;  4JAA A;  3U10 A;  3N2G B;  2Q6A A;  4AI8 A;  1AI5 A;  5CA3 A;  3LNM B;  4IGG A;  3CC7 V;  3GWO A;  2AZ2 A;  3L71 H;  5KAF Z;  1M90 W;  3CCM V;  5BR8 O;  5IYB O;  1NKD A;  3OT7 A;  4UCU A;  2B5U A;  5LP6 B;  1GMG A;  2Q0A A;  4RWU A;  3F5T A;  4WBN A;  1DGS A;  2V4D A;  3E22 A;  2P90 A;  3AG4 C;  4YHH O;  1IBK B;  2EZO A;  4XBF A;  1GN3 A;  1JOY A;  2EIL C;  1WB7 A;  1HNZ B;  1Y66 A;  4ZBM A;  2VRZ A;  1BHA A;  3ETG A;  4FLY A;  3ZX6 A;  2B9Z A;  4JYY A;  4O4J B;  3W7T A;  3AG1 B;  1SER A;  3CRC A;  1I7F A;  2ZIO A;  4R8C A;  3ICX A;  3BEH A;  1IZ3 A;  3APQ A;  4JI3 O;  2GV9 A;  1KKC A;  1YZB A;  5KX5 B;  1BSM A;  3JAS B;  1AP6 A;  5EZY A;  3ABM C;  1Z2G A;  3HKD A;  1H2L A;  5C8Y B;  4X1I B;  2UU9 B;  5CA1 B;  4LF9 B;  1YDX A;  4W4K A;  3IGA C;  2GDS A;  1WPB A;  5KHJ A;  2H8P C;  4I9W A;  3ZHR A;  1ARO P;  3JAK B;  4G2K A;  2V7Q G;  4ZKI A;  4FZ0 A;  1GH6 A;  2EIN C;  3QO8 A;  5CBG A;  4JYA O;  4L8J A;  5LBQ A;  1MZE A;  3LDC A;  3SPC A;  3ZED A;  4P30 A;  3RYI A;  3RYH B;  5CN0 A;  1GM7 A;  4JYC A;  4QE7 A;  3CCL V;  3UM7 A;  4UV8 A;  4TUY B;  4D6T H;  3SDL A;  4X1Y B;  3H01 A;  3HKB A;  5KHG A;  5FNV B;  2LQT A;  4LWS B;  2OIG A;  2XUM A;  4ZI7 A;  4GLX A;  3JSN A;  2YSU B;  3KZI Z;  4MVR A;  5LXT B;  4DV4 B;  1M56 C;  2WAM A;  2PTM A;  1K33 A;  1VQP V;  4JI2 O;  4IIJ B;  1FS0 G;  2LFS A;  4X20 A;  3N2K A;  4X88 A;  4DV6 B;  4MTO A;  2YEV B;  3FAV A;  1PV0 A;  1X59 A;  1FXK B;  2E75 B;  1V55 C;  2NN4 A;  2AZ0 A;  5HFM A;  4AQY O;  3UT5 A;  1U96 A;  4FIP C;  3AG4 B;  4WF9 V;  1TVK A;  1ZUQ A;  1MMM A;  2EIL B;  1U97 A;  2IH1 C;  4LBE C;  4X64 B;  3A0H Z;  5LMN O;  1S5J A;  1VQM V;  4YXW G;  2A7W A;  4DV0 O;  1FPO A;  2WLL B;  1AI6 A;  4DR6 B;  1NBM G;  2ETN A;  1S5H C;  3G80 A;  4U7N A;  4B3M O;  4JI4 O;  2ITD C;  4H0L B;  3ABM B;  2ZNI A;  4TSF G;  1TUE B;  2QEX V;  1NH2 B;  1KC8 W;  2JVD A;  4BW5 A;  5H5N A;  2LO1 A;  4DK0 A;  3X2Q B;  3IJ4 A;  4B3R O;  1WNS A;  4ICG A;  3GVM A;  1FFT B;  2EIN B;  2DYS B;  3A2F A;  5FLX N;  3AK3 A;  2LGW A;  4I0X B;  1PKX A;  2DQ3 A;  5JH7 A;  3M8A A;  4F6R B;  3P32 A;  5FL7 G;  4FFB A;  2WLJ A;  4FMT A;  4BIO A;  1I94 O;  3U11 A;  2CDY A;  1KMI Z;  5H2F Z;  1JJ2 U;  1Q86 W;  3O9O A;  4UXN A;  1H2K A;  1WAZ A;  3ZMS A;  1K3E A;  2ATK C;  2WLH A;  4PI0 A;  3ABT A;  3L74 H;  1PP9 H;  1QR8 A;  3STZ C;  5JQG B;  4NXN O;  2WSS G;  4EKW A;  3E86 A;  3RT3 C;  3OTO B;  1M56 B;  4ABM A;  4K3A A;  3DXR A;  4CH6 A;  3J81 N;  4PA9 A;  4IYI A;  1SQQ H;  1F4M A;  3THO A;  1JA8 A;  3ZHU A;  1RSO B;  2QKC A;  2CTW A;  1GN4 A;  1P49 A;  1KD1 W;  1V55 B;  3G6B A;  1HNW B;  4LF7 B;  1ZL8 A;  5CB4 A;  3F5W C;  1VQK V;  3K5L A;  5J2T A;  4IHJ A;  4U3J A;  1G4Y B;  2XOK G;  1NVP B;  5E79 Z;  5LMU B;  3M99 B;  1BZK A;  4QGP A;  5J2U A;  3AEI A;  1Q6I A;  1FAF A;  3FFQ A;  3KCY A;  3BA9 A;  3NR7 A;  5KLV H;  1FXV A;  3VQW A;  4O2A A;  1OCR C;  2Q7E A;  1NR7 A;  3JAT B;  1WP7 A;  3RVY A;  2W0F C;  5EYP A;  1VQ5 V;  5GON B;  4LF6 O;  3CP1 A;  3S3W A;  1TUB A;  1YHQ V;  1CP9 A;  5HFL A;  4ZOL B;  3IFX A;  4PA3 A;  2Y69 C;  1JMK C;  1K8A W;  5LHG A;  4H13 B;  2O57 A;  1QCE A;  5BR8 B;  1NR1 A;  3E22 B;  4DXW A;  5B1O A;  2F43 G;  1JFF B;  4QJF B;  1QVF U;  1P4R A;  3LDE A;  2RN9 A;  1W0J G;  2AXT Z;  5IWA B;  4MS2 A;  4YHH B;  3OAA G;  1HNZ O;  2R9I A;  1QVG U;  4LC1 A;  2HLD G;  3K3W A;  1ZTE A;  5EK0 A;  1DTO A;  3JD4 A;  1P7G A;  2WA3 A;  3BHP A;  5LHH A;  5EZY B;  4JI3 B;  4EB6 B;  4J9Z B;  3L70 H;  4WFE A;  4LF4 B;  1SKV A;  4O4H A;  2X7R B;  2D3O W;  1TA8 A;  1QR9 A;  2EIJ C;  2XAS A;  2UU9 O;  3TXS A;  4LF9 O;  3WU2 Z;  4CS2 A;  5IDJ A;  4WFB V;  3HKC B;  2X6B A;  3OMI B;  3L9D A;  5EC1 C;  1FFX A;  4MTX A;  4I5S A;  1ZSP A;  4IL6 Z;  5KAI Z;  4X8A A;  5IJ9 A;  2GTA A;  4KHP B;  2LGQ A;  4FLW A;  1H38 A;  5TIS Z;  4J9Y B;  4ZI7 B;  1XNR B;  3CX5 F;  2XAF A;  4NKG B;  1R1B A;  1R3J C;  1K4D C;  1AJQ A;  1Q81 W;  1XNQ O;  4EEQ A;  2VQF B;  3JD0 A;  5ITZ A;  4UCR A;  4NXM B;  5K1X A;  1YEW A;  3J80 N;  1KYO F;  1MG1 A;  1A32 A;  3N2K B;  4TV9 B;  2YUA A;  2K1E A;  2R9A A;  3CE2 A;  3FAV B;  4JI2 B;  2Y69 B;  2ZCE A;  5L3F A;  2UUA O;  4DR4 B;  2HEP A;  1F7Y A;  1VQO V;  2UUC B;  3H9V A;  4AQY B;  4H33 A;  1IBM B;  3JCU Z;  4L87 A;  1XUQ A;  1I0H A;  4Q20 A;  2QWP B;  1VQN V;  3SYP A;  4PDR A;  4TQF A;  2A3Q A;  3SJC C;  4X64 O;  1WB8 A;  1VQ8 V;  4FZ1 A;  2G38 A;  1HR0 O;  2LFR A;  4JAV A;  1F4N A;  1AJP A;  3JAL B;  2L6L A;  3ETE A;  4TV8 B;  1H2S B;  4PA6 A;  3ML0 A;  4DV0 B;  4DR6 O;  4UFZ A;  1KEC A;  4B7E A;  1ORQ C;  2WWW A;  3RYC B;  1SQP H;  3H1K H;  2WLM A;  5FPO A;  1NI8 A;  1TGO A;  2EIK C;  1XQ8 A;  1GAX A;  2EIJ B;  4CH3 A;  4DR7 B;  1L8D A;  5JVD A;  5EIB C;  1GM8 A;  4HNA A;  4FM2 A;  4DUZ O;  2DW4 A;  2WLI A;  4IT5 A;  3B40 A;  4KXR A;  4JI7 O;  5BMV B;  5CA0 A;  4FFB B;  1K73 W;  2Z0A A;  1LR1 A;  1SS3 A;  3RYF B;  2P67 A;  2XND G;  4F6E A;  4GCZ A;  5IYD O;  1I94 B;  1Z5V A;  3CYO A;  2DJV A;  5IYZ A;  2GTS A;  2Q7G A;  3E89 A;  3K9S A;  4O2B A;  3K0D A;  4I55 A;  1ZAU A;  1QBZ A;  3T1Y B;  2KG7 A;  3HPL C;  3DXR B;  4BR6 A;  4NVP A;  2GUZ A;  1VP7 A; 
#chains in the Genus database with same CATH homology
 2F4V O;  3O65 A;  4X66 O;  2FKX A;  1G1X B;  4K0K O;  2LW7 A;  5FLX N;  4JYA O;  2UUA O;  5LL6 Y;  1AIL A;  5LMU O;  4DV3 O;  1D2D A;  4X62 O;  1F7Y A;  4LF4 O;  4DV7 O;  3M8A A;  4LFA O;  3JAM N;  2JRI A;  1I94 O;  3SDL A;  4LF7 O;  4DR7 O;  4OX9 O;  5IT9 N;  1N32 O;  1XEQ A;  4JV5 O;  4A5U B;  1XMO O;  4B3T O;  4OPA A;  4DV1 O;  4NXN O;  4X65 O;  4JI8 O;  1HNZ O;  4DR5 O;  3RT3 C;  5A2Q N;  2N74 A;  4DR2 O;  1N34 O;  4X64 O;  2DOS A;  3J81 N;  2HHH O;  3J7A U;  1HR0 O;  4OPH A;  1KUQ A;  2VQE O;  4JI2 O;  4KHP O;  4LFC O;  1DK1 A;  4DR6 O;  1XMQ O;  4DV5 O;  1XNR O;  1X59 A;  2UXC O;  4JI5 O;  5BR8 O;  3T1Y O;  1FKA O;  4AQY O;  2VQF O;  2UU9 O;  3T1H O;  4NXM O;  4JI6 O;  3F5T A;  4LF9 O;  4YHH O;  4JI0 O;  1R6T A;  4DUZ O;  4DR3 O;  1HNX O;  1N33 O;  3OTO O;  4JI7 O;  4DR1 O;  4DV4 O;  4DR4 O;  2UXD O;  5LMN O;  2UUC O;  4LFB O;  2Z0A A;  1J5E O;  2UUB O;  1N36 O;  5BXZ A;  4LF5 O;  1IBL O;  2E5L O;  1AB3 A;  4GKK O;  4DV6 O;  1FJG O;  4YY3 O;  4DV0 O;  2DJV A;  1FYJ A;  3R66 A;  4JI3 O;  5BY1 A;  4DUY O;  2UXB O;  1YZB A;  1IBM O;  2ZKO A;  4JI1 O;  4B3M O;  5IWA O;  4JI4 O;  4DV2 O;  1R1B A;  2ZM6 O;  1HNW O;  4GKJ O;  2AGA A;  1XNQ O;  5H5N A;  4LF8 O;  4B3R O;  4LF6 O;  4B3S O;  1IBK O;  1NS1 A;  3J80 N;  1A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...