4DV6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv6O00
4B3SO 4JI7O 4DR4O 2E5LO 1YZBA 3OTOO 4DV0O 2UUCO 4X62O 4B3RO 4JI1O 5A2QN 3RT3C 4GKJO 4DV5O 4DR3O 1D2DA 1IBMO 2LW7A 4YHHO 4LFAO 4DR5O 5IT9N 4AQYO 4YY3O 1N33O 4LF7O 5FLXN 4JI2O 1HR0O 1N34O 2UXCO 1FKAO 4OPAA 4OPHA 4X66O 1XMOO 4JI0O 1AB3A 3J80N 3SDLA 1XMQO 1HNXO 2F4VO 2Z0AA 4JI4O 4LF8O 4OX9O 2ZKOA 4JYAO 4JI6O 3M8AA 2DOSA 2DJVA 4DR7O 1F7YA 4DV7O 1N32O 5BR8O 2ZM6O 4DUYO 5BXZA 1N36O 2UU9O 3T1HO 2HHHO 1XNRO 4DR6O 4KHPO 2N74A 4LF9O 1G1XB 4DUZO 4DV1O 4X64O 4B3TO 2AGAA 3J7AU 4LF6O 2UXDO 4JI3O 3J81N 4DV3O 1R6TA 2VQFO 5LL6Y 1DK1A 1KUQA 1R1BA 3JAMN 1AILA 3R66A 4K0KO 4JI8O 4GKKO 5H5NA 4DR2O 4DV4O 2JRIA 4B3MO 4X65O 1FYJA 4LF4O 5LMNO 1NS1A 4A5UB 3F5TA 1FJGO 4LFBO 5BY1A 1J5EO 2UUAO 1IBKO 4JI5O 4NXNO 1XNQO 4DV2O 5LMUO 4LF5O 2UUBO 2FKXA 2VQEO 3T1YO 5IWAO 3O65A 1XEQA 4NXMO 4DR1O 1I94O 1HNWO 4DV6O 4LFCO 1X59A 2UXBO 1A32A 1HNZO 1IBLO 4JV5O
chains in the Genus database with same CATH superfamily
1K34A 2QWNB 4TQFA 2GUZB 2ZNIA 2EULA 1I08A 4DV0O 4I55A 4FLUA 4X62O 4WBNA 3JD3A 4ICGA 3OUSA 4IHJB 4YHHO 2GUZA 2ZINA 1K92A 1P4RA 1PM9A 4X1KA 4DR5B 3D8CA 3WB2A 3IC9A 1BHBA 2HJFC 1GN6A 4LWSA 3CE2A 1PL4A 4FLXA 3RWRD 5KA6A 5K1PA 2EIJC 2N04A 2QM4A 1SQFA 3FB7C 1UFIA 1ZL8A 3IC7A 3ZHTA 2LO1A 5FNVB 4DR6B 1TVKA 2Q8VA 1AI6A 2XNDG 3FKSG 3F7VC 4PELA 1V9PA 1YVWA 2JS5A 1JOYA 4UB8Z 1K3EA 1W0KG 3K0GA 4AILC 4LFCB 2JJ1G 4R6ZA 2XOKG 4H37A 3U11A 4K8ZA 4DV3O 1R73A 3ZN0A 4EKWA 2EX3A 5B1AC 3O9OA 4PDMA 1MZEA 1J95A 1P7GA 4EEQA 4D6TH 2HG5C 1XMQB 4O2BA 4IIJB 5DEDA 1IZ3A 2X6AA 3WU2Z 1VQOV 3K3WA 3HPLC 1ORQC 1MG1A 1Q6IA 4MT8A 3L73H 4YIPA 4IHJA 2EINB 2RCVA 1PV0A 5L3EA 1PKXA 2AHZA 4X88A 1FFTB 4GCZA 1KP3A 1S5JA 4BIZA 2DYRC 2E74B 1JPXA 1H8EG 3JALB 1R3KC 1B6QA 4FFKA 1KKDA 2AXTZ 1Q6HA 2IW5A 1VF5B 1YZBA 3EVKA 4L8JA 4UV8A 3B8NA 3TXSA 4R50A 1JR9A 3B09A 1G8MA 3ZIAG 3ZN1A 4Z1VA 2IU0A 3D3QA 2KG7A 2NNUA 1MSWD 1EFRG 2WLMA 4JI0B 2XUMA 2X7RB 5EC2C 5GONB 1WA8B 1IVSA 1FKAO 1XMOO 2M6YA 5L3BA 3OD4A 1IURA 1M57C 1JQ0A 3AK2A 2PI4A 5KX5A 4LF8O 2R9IA 4PI0A 3M8AA 3OAAG 4JTDB 3ASOB 2P67A 2CH7A 5EBMC 2ZT9B 4DV7B 2IM9A 3CJHA 2JVDA 1N4CA 2DWDC 3D3IA 3T1CA 2EBOA 3OMNB 3G71V 2F1MA 4JI1B 3K5NA 1P7BA 1K8AW 5IE9A 3ABMB 3OTOB 5CA3A 3LNMB 1EM1A 2YEVA 4UCUA 4CC5A 3CP1A 4HZ3A 2XHBA 1XL4A 4WFFA 3CCSV 3CC2V 3RFRA 5CA1A 3UT5A 3F5TA 1YIJV 2PI5A 4LF7B 1J5EO 4JI5O 4PDVA 1FXKC 4XDLA 1NH2D 1I5YA 1AJQA 1NVPB 5LHIA 4U3JA 1PNMA 4PA4A 2NN4A 4TV9B 4KFMA 4FLZA 3ABTA 4DR1O 1GM7A 2UXNA 4DR7B 4IYHA 3AEIA 5CMUA 1M56C 3LDEA 1B04A 3H1JH 1M57B 3CXCU 3ZCCA 2W0XA 4B7EA 1VMGA 3H01A 1QR9A 5IJ9A 4DV1B 5KUKA 1V55C 3FX7A 4O4IB 3OR7C 3SPCA 2QM8A 4PA6A 4CS4A 2D3OW 1TUBA 2W6JG 4MVMA 2Q0AA 4LF7O 4TUYB 1K7DA 4ZHQA 3LSUA 2XAQA 1Y6XA 3JCZA 2CGOA 2WLIB 2KG7B 1ZLZA 3VQYA 4OXSA 4OX9O 1VARA 2ZKOA 4QE9A 4ZIBA 2CTPA 2YEVB 4KUMA 4ZI7B 4B7KA 2EINC 4O4JB 3RYHB 3EHBB 2UXBB 2H8PC 3B2EE 4X64O 3OEHG 3ABUA 3THOA 3L74H 2HLDG 3K5MA 4IT5A 4WFBV 2FYUH 1VEWA 3U10A 4JI8B 2ZD9A 1SQQH 4I4TA 3SYCA 3K9SA 1Y76B 3RYHA 2WLLA 2HR3A 4B3MB 1URFA 5B66Z 3E22A 5C8YB 4TV8B 3VQXA 3SYPA 1Z5VA 3T4DA 4LFBO 2WAMA 4FLVA 1P84F 1K97A 1M56B 1RSOA 1AP5A 3E89A 1Y67A 4J11A 1XEQA 2E3CA 1GM9A 1KKCA 1Q82W 4C7UA 1AI4A 1W59A 2LP7A 4X9QA 4XBFA 1HNWO 3H1LH 1B3QA 4KL1A 4GYCB 1N0JA 3PN1A 1N36B 1GRJA 2HHHB 2P22C 3AK3A 1AR5A 4DW1A 1MA1A 1ZSPA 1WP8A 4YJ2B 1OHHG 4DR4B 3ZMSA 1JJOA 3C90A 2MK3A 3OMAB 4UXNA 2A0LA 1NTZH 1K5SA 2L35A 2Y48A 2PYLA 2WLHA 4JASA 2UUBB 4N21A 4P30A 3P32A 1BZKA 1RM1C 3TJTA 3VQWA 2EJ7A 2QSAA 2KSDA 4UCSA 1FPOA 1PL0A 4NYKA 2PGGA 1F4NA 1F7YA 3G6BA 2XAJA 4WFAV 2LFRA 3QNEA 1JJ2U 1N36O 1XNRO 1XL6A 3AG7A 2JIZG 1SQBH 1E1QG 2YIBD 1L0LH 1NR1A 2DE0X 2ZE5A 1QCEA 2IJJA 1YXBA 2JJ2G 4Q6GA 4MW8A 4RWUA 3TETA 1R3LC 5LL6Y 2XAGA 1HP8A 2GHYA 4X8AA 4O2AB 4Z2WA 4JI2B 4DV4O 2P5OA 3ETQA 4X65O 3K58A 4A5UB 1LUVA 4CH3A 5C8YA 3OMIB 1AI7A 4YJ3A 1YF2A 3T2MA 3UO3A 3ML0A 2R9AA 4RUFA 3N2KA 4YXWG 3G4SV 2ZQMA 1ZX3A 2JEUA 3H1IH 1QQCA 2IJKA 3ZMUA 2R9RB 4B3SO 3IAYA 1YTFB 2B5UA 4JYBA 1L0NH 2DWEC 4FK5C 1SZXA 5KLVH 1Y66A 4O2AA 4I5SA 2OIGA 3ABKB 3MHHC 4WFEA 1E1RG 3W7WA 3A0HZ 4P2ZA 3ZX6A 2F4VO 3K08A 1GH6A 3FYEB 4JTAB 4N23A 5C93A 3T4ZA 4FLYA 4J80A 3CPWU 2ZM6O 3ZHSA 2OCHA 3JD2A 1ZAUA 4DR1B 4LWSB 4W4LA 3BA8A 2WLNA 4X1IB 5IYBO 1QU7A 2RDCA 4PV1B 4O2BB 2XAHA 4QGPA 3N27A 1WPXA 5TISZ 3K57A 4J7ZA 1BGYH 5EZYB 1OCOC 1AILA 4TOIA 1Q90D 2PYJA 1SQPH 4K3AA 2EIMC 1V54B 3C3TA 2OWOA 2NR5A 5LMNO 2F4VB 2AHYA 3FD9A 4O4HA 4BIUA 5IJ0B 4JAVA 4LF4B 4BAYA 3MDSA 1FAFA 3H9VA 3ETDA 3QG5A 1N32B 1ZL8B 3RYIB 3VOUA 4DV6B 2OT5A 4PA9A 5EBLC 3KKYA 2CDYA 1Q8IA 4MVOA 3U0ZA 1M1KW 3FFQA 2UU9B 1TUEB 1IBLO 4J9ZB 3OM3B 1MZFA 5LXTA 2JK5C 2E5LO 3ZEDA 5J2UB 1SS3A 1DLBA 4YHHB 3B4SA 1YJNV 4YIOA 2A3QA 1LUWA 4LFAO 4DK1A 1FJGB 5B5EZ 2CUGA 3BFRA 5IT9N 4AI8A 2A7WA 2XT9A 2PZSA 1AR1B 3JARB 4JI0O 2FL4A 5E1AC 4JYAB 1D5AA 3ABKC 1XMOB 5DN6G 1SESA 4PDLA 1VQ5V 3W7TA 1VQ8V 1M9NA 5BR8O 1M93A 1S72V 1EZVH 3JD0A 3K06A 3FB5C 1AJNA 1FXKA 3CRAA 1K5QA 2P4KA 1KB9F 1WNSA 2JGUA 2Q6AA 3E22B 3ICXA 1F4MA 1KUQA 1Q5OA 3APOA 5JWPA 3Q4HB 1R3IC 2EIKB 3RYFA 4X62B 3QTCA 2G38A 5A9GA 1IDSA 4J7JA 3BA9A 3P3PA 4YY3B 3AG2C 2ITCC 3QVNA 2RN9A 1K73W 3A0RA 1GM8A 3OTFA 1J5EB 3E8FA 1KD1W 3CC4V 3DTUB 2LW1A 2ITDC 3DSQA 2XAFA 2ILMA 3AG1B 2RQ6A 4B3SB 4DK0A 1XNRB 1US6A 5K1XA 3UKMA 1H2GA 3X2QB 2VQFB 4B08A 4G28B 3L71H 2RJZA 1N33B 1KMIZ 1IBMO 2ADPA 3QO8A 5J2UA 2IH1C 5JJNB 3SPGA 5LYJA 4K35A 1AB3A 1XMQO 5ITZA 3KZIZ 2QWOB 5LP6A 1BHAA 2K1EA 3A2FA 1Y74B 2R70A 4P9PA 4NXMB 2CAZC 2HFEC 1XREA 4MVSA 4JV5B 2V4DA 1RPRA 1GMGA 1ZTEA 2N74A 2DQ0A 2GV9A 4B3TO 4O4HB 3AG3B 3KCXA 1WA8A 5JQGB 1SC5B 5LOVA 3LNNA 2DYSB 2F43G 2QKCA 3SYOA 2VQFO 3WG7B 2AW9A 3ZRXA 1VQMV 2DMXA 2YDEA 3CSXA 5H9CA 3WB1A 3UM7A 2OCCB 2YIBA 5LGUA 4MTOA 1YCIA 3ASNB 1NVPD 2F93B 1FYJA 1TGOA 2VS0A 4RQFA 1YJWV 3FB8C 1M4UA 2UUAB 3HR0A 1DF4A 3LSQA 2FMLA 2ZXWC 2Q67A 4NXMO 1SQXH 1GN2A 2KKWA 4JZ2A 1ENVA 3JYCA 3GB7C 5KHHA 2WLJA 5IDJA 1BE3H 1IBLB 3B77A 4JYCA 4G2KA 1WLEA 1A32A 1OZ0A 2X0LA 4DV3B 3CCMV 2Y0IA 1VQ9V 4GKJB 4GX5A 5B3SB 5L3DA 5J2TA 1SA0B 4W4KA 4E2LA 2QKAA 3A0BZ 3OGCC 2IBZH 1EN5A 2YI8A 3AG4C 1PNLA 3T1YB 4J9YB 4QJFB 5LMNB 3B8MA 1QHTA 2F95B 4JI6O 1TVKB 1PP9H 2DOSA 3JD4A 4HYOA 3HKEB 3QO5A 4I55B 3ZMZA 4DUYO 3MAQA 3LDDA 4DUZO 4MVQA 5DM6V 1VQ6V 4ZOLB 2YI9A 3ABLB 4I50A 1NBMG 3CMAV 2K9PA 4D7TA 4CH4A 4F6EA 4HNAB 4WFHA 4GZRB 3RN4A 4U7NA 1MSDA 3R65A 3E8HA 2QR4A 5LP6B 2JGDA 1R6KA 2Q7EA 3H1HH 3JSLA 1IBKB 3RYCB 3JAWB 1Q6UA 1L1FA 1OV9A 2ZIOA 3SYQA 1LR1A 2QTOA 3HKBB 3TK1A 4TWKA 3FB6C 1Q43A 5EIBC 1ROPA 5LOVB 4UFZA 4LBEC 5J2TB 3SR2C 2BTQA 2X6CA 4JTCB 3FAVB 1HDJA 2ZE6A 2PTMA 4CS3A 5KHIA 4H0LB 1ZUQA 1O9HA 1OCZC 1GN3A 3N2KB 2WLKA 4LR3A 2M7WA 4LH7A 2ZR3A 3CCUV 2B1GA 2EILC 1MOFA 3OFNG 3CCRV 2FB5A 1IX9A 3SJBC 5KHKA 2QJ1A 4UVAA 2VWJA 4PDRA 4NB5A 3HB3B 4P9OA 1HNXO 1FFXA 1H2NA 1T5EA 4TSFG 4FJCC 2XASA 1DF5A 4NXNB 2DJVA 1YJ9V 4LP8A 1VQ4V 2CE4A 4NTYA 3ZHVA 3JCUZ 2VRZA 5IY5B 2JEXA 1V55B 4JZGA 4F6RA 3JAWA 4FM1A 4LF9O 2QWQB 5KHGA 1IXMA 1VQPV 4U7OA 5JH7B 1GK9A 5EIBD 1R6TA 1BMFG 2QKSA 1R1BA 2GBOA 1Y74A 3RVZA 2WLLB 5CBFA 1EN4A 2P7TC 3I5DA 4EFBA 4X1IA 1KECA 1NS1A 5FPOA 1FXKB 1XQ8A 1S76D 1FJGO 1GKFA 2UUAO 2HKOA 1FS0G 4GX0A 2P4VA 2DN9A 2UUBO 2FKXA 1YDXA 5E79Z 1YHQV 5IWAO 2RMKB 3IFXA 2JDIG 3DC6A 1SQGA 4I50B 2H3OA 4BW9A 5IJ0A 4H13B 4DV6O 3ZRWB 3ZMTA 4Z1MG 2D2CB 1SF9A 4QPKA 4UVBA 3KCYA 3S3WA 1VQKV 3K5LA 3OE7G 4GKKB 3BABA 2Q0OC 4GKJO 1BS3A 5AG2A 2YXHA 1GAXA 4YY3O 4K0KB 2IU3A 3E2EA 2ZR2A 1H2SB 1K33A 4LFAB 3OR6C 1N34O 2UXCO 3JD1A 2ZCEA 4J10A 4OGQB 2CH7B 1XILA 3CXHF 1DGSA 4LCUC 1AP6A 3B40A 4LF8B 4QPJA 3CMEV 1JCHA 1WAZA 2L6LA 1N0NA 1SZTA 2C2AA 2HHHO 1WP7A 5L3GA 4MW3A 1R6NA 1G1XB 2UXDB 2AZ0A 2LJ2A 3AG4B 2ZDIC 4FMTA 5CA1B 5IYCO 4LF9B 5GW7A 4F6RB 1NR7A 5CA0B 2LFSA 1XUQA 5EYPB 3NR7A 2WA4A 4DR2B 3OEEG 5KHJA 4O4LA 4AQYB 4CS2A 4K0KO 1OJHA 1SQVH 3I56V 4ZI7A 1HR0B 4NTXA 3LUTB 2YICA 3JALA 5KMGA 2W6IG 2H94A 2ZNJA 3VQVA 5IYZB 2EZOA 5IY5C 3JATA 5GTHZ 4HBNA 2V1DA 4DRXA 3ZHRA 2QEXV 1TAEA 4RAIA 2ZXWB 1JMKC 3O65A 4JYYA 5IWAB 2Q69A 2YC0A 4NTWA 5B1AB 3DXRB 3M99B 2ZM6B 4IGGA 3SGIA 1X4TA 1XHZA 1EBOA 4FZ0A 2DYRB 1CP9A 2EILB 4LNUB 2ZIMA 1VP7A 4X20B 2OCCC 1PNKA 3BRCA 3SPJA 3C3SA 3W7SA 2OIEA 4WBNB 1Z5WA 2DYSC 4DV4B 1YI2V 4DV5O 4QIWF 5L3FA 2EIJB 2IH3C 3CRMA 1N33O 4L87A 3SPIA 4JI2O 1IBMB 1HR0O 5JCOC 4CH6A 1S5HC 2PF4E 5H2FZ 3RW0A 1XHXA 1WN7A 5D5PA 4OX9B 1SERA 2Z0AA 1EN6A 3IGAC 3HKCA 4UV9A 3CCVV 3D36C 5LHGA 4JYAO 4J42A 1JA8A 2HP8A 3ABMC 3CYOA 2Q7HA 5ITZB 1NTKH 2DW4A 5JQGA 1MNGA 1HW7A 4NR1A 5B1OA 1AVMA 3RBZA 4UCRA 4UCOA 1KP2A 4GUNA 3CX5F 1W0JG 4JAUA 3J7AU 2OTJV 2BOCC 2ODMA 4BIOA 1TA8A 4DO2A 4DR3B 2WA3A 1RP3B 4LF6B 2B9ZA 3ASOC 5LBQA 1KC8W 2Y0PA 4JI8O 3HKEA 4JGSA 2GSMB 4B3MO 3CCQV 1YSCA 4JPRA 1UJWB 2VQEB 3LDCA 5B1NA 1H2MA 2CK3G 5BMVA 1BQZA 4LF5O 2DQ3A 2Q7GA 3GVMA 3T1YO 5CB4A 5LMUB 5LHHA 3K59A 2ADQB 4BWAA 2ETNA 5B1BC 2WPDG 4UCVA 2BE3A 4JI6B 1QLEB 3CB2A 4GLXA 2Y69B 1NKDA 1SRYA 5H6QA 1PD3A 4H44B 2N05A 3E83A 3UO2A 1AR4A 1SETA 1NZ6A 2A79B 1AROP 4RQEA 2Y4UA 1Y76A 3OGIB 5B3SC 4DXWA 1AJPA 5A2QN 2LGWA 4PA3A 4FFBB 1OCRC 3P30A 3EXAA 4DR5O 1QR8A 1VF6A 1Z2GA 1M5IA 3SDLA 1N34B 2UXCB 4XDJA 3BHPA 2ZE7A 1L8DA 3CCEV 1N32O 1K4DC 2AZ2A 4DR6O 3TCUA 3AK1A 1EZJA 1NH2B 4KP4A 4E4EA 1KBHA 3UQ8A 4PHZA 1MABG 3WG7C 4AHCA 4JI7B 3G67A 3BEHA 4O4LB 5DECA 4EB6B 5KAFZ 2BOBC 2CTRA 3ZBHA 4DYLA 3ZHQA 2IJIA 1I5XA 1YITV 1S0VA 1HNXB 1F51A 1AI5A 3HKDA 1BSMA 1RPOA 3K9AA 4NXNO 3BCCH 2VQEO 4MS2A 2Q5ZA 4GT1A 3TGUH 2MW2B 1NJIW 1KYOF 3K04A 1YEWA 2QGNA 3ZHUA 4X64B 5BR8B 2KB1A 3IJ4A 3FYIB 4I9QA 1V54C 3WFVA 2P90A 4JI7O 3F5WC 3OTOO 3K79A 1GN4A 4GX2A 3ZJZA 2UUCO 3VBBA 2P06A 3W7UA 4PI2A 3OUFA 4LH6A 4EB6A 3SJAC 2HVJC 5H6RA 1Q7YW 2YUAA 1OCCC 4AQYO 4LFBB 4DV5B 4UVCA 3AG1C 2XTAA 3M7MX 3J80N 1LNQA 3ZRWA 5LGNA 2IJHA 2R72A 3K5OA 3JAKB 2EJRA 1Q86W 3CCJV 3K03A 5JVDA 3ZS8C 1XI1A 4WFGA 1JFFB 4O4IA 5EZYA 5KAIZ 1R3JC 4DV7O 4X20A 5KA5A 5BXZA 3L72H 1THZA 5GONA 4DV1O 1H2KA 3HKDB 3DXRA 4LF6O 5LA6A 1WB7A 4MVRA 2EIKC 3D36A 3CCLV 1IXBA 1GO3F 3JATB 1OCZB 2V7QG 1U96A 4PA7A 2GTSA 4LF4O 2ATKC 5BY1A 2QWRB 2QWPB 3BVOA 1IBKO 2BTOA 2Q9LA 2YXYA 1XNQO 5LMUO 2EZPA 3CWBH 5FNVA 3W7XA 3H1KH 4GX1A 1VF7A 4HAMA 4MTXA 3L70H 4UB6Z 3CHXA 2JS3A 5EBWC 2QDOA 2OYQA 4R8CA 1UPGA 3HKCB 4PD4F 1WPBA 1I94O 1QLNA 4B3TB 4BW5A 2GDSA 4MVZA 1X59A 1HNZO 5BMVB 5HFMA 3UCSC 2E5LB 1K4CC 3CS5A 2CTWA 3STZC 4F4LA 2ARHA 4WCEV 1H38A 1I7FA 5CN0A 5LP6C 5JVDB 3CRCA 4DR3O 4U3JB 2RNBA 3E86A 1D2DA 4MTFA 5L3CA 5KX5B 1JVMA 4TQDA 4ZBMA 1COWG 4YJ3B 4MVUA 1Q81W 5JCOA 4OPHA 4OPAA 3ABLC 5LGTA 2PUSA 2ZDIA 1QVFU 4JI4O 5KMGB 3UT5B 4QNHB 3CRRA 2YSUB 3JSNA 1SA0A 4LF5B 2JGDB 3SJQC 2P6JA 3MHSC 5EYPA 4G27B 5CA0A 3T1HO 2NLJC 4KHPO 5IYDO 3SYAA 2W0FC 4IYIA 4PJ0Z 2EIMB 5CBHA 3JASA 2UXDO 5KUMA 1KQSU 3CEIA 2CTQA 4J7KA 1GTOA 2ZE8A 4CH5A 2CGNA 5J9PC 2HEPA 5H5NA 4X1YA 4Q20A 2O57A 4RO2A 4DRXB 1I0HA 3A8TA 1NQTA 1O9GA 2PY5A 3JASB 4FZ1A 1VQNV 4FVMA 5F2VO 2QA4V 5LYJB 3WB0A 3EFFK 3G80A 4D7SA 3GWKC 4TT3G 4RUEA 2WSSG 1NI8A 4I4TB 4ASUG 2Z3YA 1CPYA 1BT8A 5JH7A 1HNWB 5BZBA 3T1HB 3JAKA 3E8GA 1VQ7V 1FXVA 3APQA 3E8BA 4NVPA 4LFCO 2Q68A 5EK0A 4TV8A 4ZHQB 2UUCB 3S3XA 1D5NA 3F7YC 3ZRSA 3BY6A 1QVGU 3ASNC 3P3NA 1E79G 4JI1O 4I7ZB 4FPPA 3RT3C 3ETGA 2A9HA 3TXQA 5LA6B 2LW7A 1DTOA 1S5LZ 5IJ9B 4B3RB 4UUJC 1BQ0A 3L75H 3CD6V 5FLXN 2FTKA 4XDKA 4LNUA 4CBCA 3AG3C 2HVKC 4KXRA 5EC1C 3STLC 1TUBB 2GTAA 4ABMA 1OCRB 4K8XA 3BPZA 3E35A 1P49A 3OT7A 4JF3A 3I55V 4NKGB 3RYFB 1MMMA 4X1YB 4DR7O 4YJ2A 1S77D 1JFFA 4KHPB 1K9MW 1NTMH 4LC1A 2WLIA 2UU9O 1M90W 2Z5UA 2E76B 1H2LA 4FIPC 5IYZA 2E75B 1FD9A 2Y69C 3MD0A 5D5QA 1VQLV 3RYIA 5B1BB 4O4JA 4FLTA 1DK1A 4I0XB 4FLWA 1S3JA 2QM7A 5CB4B 2YXLA 4GKKO 1G4YB 4DR2O 1OCOB 1H8HG 3K0DA 3NXSA 3QF7A 3CC7V 1BL8A 4ZKIA 2A06H 2QTSA 4DV2B 3X2QC 2Q73A 4FM0A 2YIAA 5JJEB 2BSKA 3SJCC 4EFEA 2VWKA 4QE7A 1VIBA 2B1IA 4J41A 3GWOA 3N2GB 2F23A 4HNAA 3BAAA 1N8RW 3RVYA 4FM2A 1YTFD 1HNZB 3DC5A 2LQTA 5FPRA 2YS8A 2UXBO 1I94B 4JI3B 3G6EV 1BCCH 1F23A 3AG2B 5FL7G 1QNMA 4DR4O 1WJZA 4I0XA 4B3RO 1XBLA 3CRQA 1CXZB 4R7CA 4BR6A 1CEZA 1KU9A 1FFXB 2X6BA 1RSOB 3JARA 4JI4B 4JAAA 1NU1H 4X66O 2BSKB 3RYCA 4H33A 4X89A 4TUYA 1Q3EA 3LSSA 1XNQB 2F66C 3SPHA 1FXHA 3QO7A 4IL6Z 4WF9V 4MSWC 1B06A 2LGQA 3ZRVA 5HFLA 1RFYA 3PJSK 2BCCH 3KG2A 5CBGA 4DUYB 3FAVA 3CJHB 1JX9A 2AGAA 2Q4PA 2BTQB 4DV0B 1Y4MA 4DUZB 3DGEA 4JI3O 3J81N 1PPJH 4TV9A 3JAMN 1QLEC 1HWYA 3Q4HA 3R66A 3RGBA 4FFBA 3N2GA 4X65B 4CZZA 4I9WA 4X66B 2JRIA 1ZWIC 2QE7G 3OW2U 4ZOLA 4JI5B 1QBZA 2HJDA 1VF6C 2WWWA 3ZMVA 4DW0A 2KQXA 4UCTA 1XOUA 5GTIZ 4DV2O 1XDCA 1G6UA 4MTGA 2OTLV 1OCCB 3L9DA 1NT2B 1W2BU 2Y4TA 1WB8A 1SKVA 5JJJB 4U3FH 3HKBA 2YIDA 2UXXA 4CC6A 3ETEA 5LXTB 4IIJA 1RM1B 1U97A 4X1KB 4JV5O
chains in the Genus database with same CATH topology
4B3SO 4JI7O 4DR4O 2E5LO 1YZBA 3OTOO 4DV0O 2UUCO 4X62O 4B3RO 4JI1O 5A2QN 3RT3C 4GKJO 4DV5O 4DR3O 1D2DA 1IBMO 2LW7A 4YHHO 4LFAO 4DR5O 5IT9N 4AQYO 4YY3O 1N33O 4LF7O 5FLXN 4JI2O 1HR0O 1N34O 2UXCO 1FKAO 4OPAA 4OPHA 4X66O 1XMOO 4JI0O 1AB3A 3J80N 3SDLA 1XMQO 1HNXO 2F4VO 2Z0AA 4JI4O 4LF8O 4OX9O 2ZKOA 4JYAO 4JI6O 3M8AA 2DOSA 2DJVA 4DR7O 1F7YA 4DV7O 1N32O 5BR8O 2ZM6O 4DUYO 5BXZA 1N36O 2UU9O 3T1HO 2HHHO 1XNRO 4DR6O 4KHPO 2N74A 4LF9O 1G1XB 4DUZO 4DV1O 4X64O 4B3TO 2AGAA 3J7AU 4LF6O 2UXDO 4JI3O 3J81N 4DV3O 1R6TA 2VQFO 5LL6Y 1DK1A 1KUQA 1R1BA 3JAMN 1AILA 3R66A 4K0KO 4JI8O 4GKKO 5H5NA 4DR2O 4DV4O 2JRIA 4B3MO 4X65O 1FYJA 4LF4O 5LMNO 1NS1A 4A5UB 3F5TA 1FJGO 4LFBO 5BY1A 1J5EO 2UUAO 1IBKO 4JI5O 4NXNO 1XNQO 4DV2O 5LMUO 4LF5O 2UUBO 2FKXA 2VQEO 3T1YO 5IWAO 3O65A 1XEQA 4NXMO 4DR1O 1I94O 1HNWO 4DV6O 4LFCO 1X59A 2UXBO 1A32A 1HNZO 1IBLO 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S O;  4JI7 O;  4DR4 O;  2E5L O;  1YZB A;  3OTO O;  4DV0 O;  2UUC O;  4X62 O;  4B3R O;  4JI1 O;  5A2Q N;  3RT3 C;  4GKJ O;  4DV5 O;  4DR3 O;  1D2D A;  1IBM O;  2LW7 A;  4YHH O;  4LFA O;  4DR5 O;  5IT9 N;  4AQY O;  4YY3 O;  1N33 O;  4LF7 O;  5FLX N;  4JI2 O;  1HR0 O;  1N34 O;  2UXC O;  1FKA O;  4OPA A;  4OPH A;  4X66 O;  1XMO O;  4JI0 O;  1AB3 A;  3J80 N;  3SDL A;  1XMQ O;  1HNX O;  2F4V O;  2Z0A A;  4JI4 O;  4LF8 O;  4OX9 O;  2ZKO A;  4JYA O;  4JI6 O;  3M8A A;  2DOS A;  2DJV A;  4DR7 O;  1F7Y A;  4DV7 O;  1N32 O;  5BR8 O;  2ZM6 O;  4DUY O;  5BXZ A;  1N36 O;  2UU9 O;  3T1H O;  2HHH O;  1XNR O;  4DR6 O;  4KHP O;  2N74 A;  4LF9 O;  1G1X B;  4DUZ O;  4DV1 O;  4X64 O;  4B3T O;  2AGA A;  3J7A U;  4LF6 O;  2UXD O;  4JI3 O;  3J81 N;  4DV3 O;  1R6T A;  2VQF O;  5LL6 Y;  1DK1 A;  1KUQ A;  1R1B A;  3JAM N;  1AIL A;  3R66 A;  4K0K O;  4JI8 O;  4GKK O;  5H5N A;  4DR2 O;  4DV4 O;  2JRI A;  4B3M O;  4X65 O;  1FYJ A;  4LF4 O;  5LMN O;  1NS1 A;  4A5U B;  3F5T A;  1FJG O;  4LFB O;  5BY1 A;  1J5E O;  2UUA O;  1IBK O;  4JI5 O;  4NXN O;  1XNQ O;  4DV2 O;  5LMU O;  4LF5 O;  2UUB O;  2FKX A;  2VQE O;  3T1Y O;  5IWA O;  3O65 A;  1XEQ A;  4NXM O;  4DR1 O;  1I94 O;  1HNW O;  4DV6 O;  4LFC O;  1X59 A;  2UXB O;  1A32 A;  1HNZ O;  1IBL O;  4JV5 O; 
#chains in the Genus database with same CATH topology
 1K34 A;  2QWN B;  4TQF A;  2GUZ B;  2ZNI A;  2EUL A;  1I08 A;  4DV0 O;  4I55 A;  4FLU A;  4X62 O;  4WBN A;  3JD3 A;  4ICG A;  3OUS A;  4IHJ B;  4YHH O;  2GUZ A;  2ZIN A;  1K92 A;  1P4R A;  1PM9 A;  4X1K A;  4DR5 B;  3D8C A;  3WB2 A;  3IC9 A;  1BHB A;  2HJF C;  1GN6 A;  4LWS A;  3CE2 A;  1PL4 A;  4FLX A;  3RWR D;  5KA6 A;  5K1P A;  2EIJ C;  2N04 A;  2QM4 A;  1SQF A;  3FB7 C;  1UFI A;  1ZL8 A;  3IC7 A;  3ZHT A;  2LO1 A;  5FNV B;  4DR6 B;  1TVK A;  2Q8V A;  1AI6 A;  2XND G;  3FKS G;  3F7V C;  4PEL A;  1V9P A;  1YVW A;  2JS5 A;  1JOY A;  4UB8 Z;  1K3E A;  1W0K G;  3K0G A;  4AIL C;  4LFC B;  2JJ1 G;  4R6Z A;  2XOK G;  4H37 A;  3U11 A;  4K8Z A;  4DV3 O;  1R73 A;  3ZN0 A;  4EKW A;  2EX3 A;  5B1A C;  3O9O A;  4PDM A;  1MZE A;  1J95 A;  1P7G A;  4EEQ A;  4D6T H;  2HG5 C;  1XMQ B;  4O2B A;  4IIJ B;  5DED A;  1IZ3 A;  2X6A A;  3WU2 Z;  1VQO V;  3K3W A;  3HPL C;  1ORQ C;  1MG1 A;  1Q6I A;  4MT8 A;  3L73 H;  4YIP A;  4IHJ A;  2EIN B;  2RCV A;  1PV0 A;  5L3E A;  1PKX A;  2AHZ A;  4X88 A;  1FFT B;  4GCZ A;  1KP3 A;  1S5J A;  4BIZ A;  2DYR C;  2E74 B;  1JPX A;  1H8E G;  3JAL B;  1R3K C;  1B6Q A;  4FFK A;  1KKD A;  2AXT Z;  1Q6H A;  2IW5 A;  1VF5 B;  1YZB A;  3EVK A;  4L8J A;  4UV8 A;  3B8N A;  3TXS A;  4R50 A;  1JR9 A;  3B09 A;  1G8M A;  3ZIA G;  3ZN1 A;  4Z1V A;  2IU0 A;  3D3Q A;  2KG7 A;  2NNU A;  1MSW D;  1EFR G;  2WLM A;  4JI0 B;  2XUM A;  2X7R B;  5EC2 C;  5GON B;  1WA8 B;  1IVS A;  1FKA O;  1XMO O;  2M6Y A;  5L3B A;  3OD4 A;  1IUR A;  1M57 C;  1JQ0 A;  3AK2 A;  2PI4 A;  5KX5 A;  4LF8 O;  2R9I A;  4PI0 A;  3M8A A;  3OAA G;  4JTD B;  3ASO B;  2P67 A;  2CH7 A;  5EBM C;  2ZT9 B;  4DV7 B;  2IM9 A;  3CJH A;  2JVD A;  1N4C A;  2DWD C;  3D3I A;  3T1C A;  2EBO A;  3OMN B;  3G71 V;  2F1M A;  4JI1 B;  3K5N A;  1P7B A;  1K8A W;  5IE9 A;  3ABM B;  3OTO B;  5CA3 A;  3LNM B;  1EM1 A;  2YEV A;  4UCU A;  4CC5 A;  3CP1 A;  4HZ3 A;  2XHB A;  1XL4 A;  4WFF A;  3CCS V;  3CC2 V;  3RFR A;  5CA1 A;  3UT5 A;  3F5T A;  1YIJ V;  2PI5 A;  4LF7 B;  1J5E O;  4JI5 O;  4PDV A;  1FXK C;  4XDL A;  1NH2 D;  1I5Y A;  1AJQ A;  1NVP B;  5LHI A;  4U3J A;  1PNM A;  4PA4 A;  2NN4 A;  4TV9 B;  4KFM A;  4FLZ A;  3ABT A;  4DR1 O;  1GM7 A;  2UXN A;  4DR7 B;  4IYH A;  3AEI A;  5CMU A;  1M56 C;  3LDE A;  1B04 A;  3H1J H;  1M57 B;  3CXC U;  3ZCC A;  2W0X A;  4B7E A;  1VMG A;  3H01 A;  1QR9 A;  5IJ9 A;  4DV1 B;  5KUK A;  1V55 C;  3FX7 A;  4O4I B;  3OR7 C;  3SPC A;  2QM8 A;  4PA6 A;  4CS4 A;  2D3O W;  1TUB A;  2W6J G;  4MVM A;  2Q0A A;  4LF7 O;  4TUY B;  1K7D A;  4ZHQ A;  3LSU A;  2XAQ A;  1Y6X A;  3JCZ A;  2CGO A;  2WLI B;  2KG7 B;  1ZLZ A;  3VQY A;  4OXS A;  4OX9 O;  1VAR A;  2ZKO A;  4QE9 A;  4ZIB A;  2CTP A;  2YEV B;  4KUM A;  4ZI7 B;  4B7K A;  2EIN C;  4O4J B;  3RYH B;  3EHB B;  2UXB B;  2H8P C;  3B2E E;  4X64 O;  3OEH G;  3ABU A;  3THO A;  3L74 H;  2HLD G;  3K5M A;  4IT5 A;  4WFB V;  2FYU H;  1VEW A;  3U10 A;  4JI8 B;  2ZD9 A;  1SQQ H;  4I4T A;  3SYC A;  3K9S A;  1Y76 B;  3RYH A;  2WLL A;  2HR3 A;  4B3M B;  1URF A;  5B66 Z;  3E22 A;  5C8Y B;  4TV8 B;  3VQX A;  3SYP A;  1Z5V A;  3T4D A;  4LFB O;  2WAM A;  4FLV A;  1P84 F;  1K97 A;  1M56 B;  1RSO A;  1AP5 A;  3E89 A;  1Y67 A;  4J11 A;  1XEQ A;  2E3C A;  1GM9 A;  1KKC A;  1Q82 W;  4C7U A;  1AI4 A;  1W59 A;  2LP7 A;  4X9Q A;  4XBF A;  1HNW O;  3H1L H;  1B3Q A;  4KL1 A;  4GYC B;  1N0J A;  3PN1 A;  1N36 B;  1GRJ A;  2HHH B;  2P22 C;  3AK3 A;  1AR5 A;  4DW1 A;  1MA1 A;  1ZSP A;  1WP8 A;  4YJ2 B;  1OHH G;  4DR4 B;  3ZMS A;  1JJO A;  3C90 A;  2MK3 A;  3OMA B;  4UXN A;  2A0L A;  1NTZ H;  1K5S A;  2L35 A;  2Y48 A;  2PYL A;  2WLH A;  4JAS A;  2UUB B;  4N21 A;  4P30 A;  3P32 A;  1BZK A;  1RM1 C;  3TJT A;  3VQW A;  2EJ7 A;  2QSA A;  2KSD A;  4UCS A;  1FPO A;  1PL0 A;  4NYK A;  2PGG A;  1F4N A;  1F7Y A;  3G6B A;  2XAJ A;  4WFA V;  2LFR A;  3QNE A;  1JJ2 U;  1N36 O;  1XNR O;  1XL6 A;  3AG7 A;  2JIZ G;  1SQB H;  1E1Q G;  2YIB D;  1L0L H;  1NR1 A;  2DE0 X;  2ZE5 A;  1QCE A;  2IJJ A;  1YXB A;  2JJ2 G;  4Q6G A;  4MW8 A;  4RWU A;  3TET A;  1R3L C;  5LL6 Y;  2XAG A;  1HP8 A;  2GHY A;  4X8A A;  4O2A B;  4Z2W A;  4JI2 B;  4DV4 O;  2P5O A;  3ETQ A;  4X65 O;  3K58 A;  4A5U B;  1LUV A;  4CH3 A;  5C8Y A;  3OMI B;  1AI7 A;  4YJ3 A;  1YF2 A;  3T2M A;  3UO3 A;  3ML0 A;  2R9A A;  4RUF A;  3N2K A;  4YXW G;  3G4S V;  2ZQM A;  1ZX3 A;  2JEU A;  3H1I H;  1QQC A;  2IJK A;  3ZMU A;  2R9R B;  4B3S O;  3IAY A;  1YTF B;  2B5U A;  4JYB A;  1L0N H;  2DWE C;  4FK5 C;  1SZX A;  5KLV H;  1Y66 A;  4O2A A;  4I5S A;  2OIG A;  3ABK B;  3MHH C;  4WFE A;  1E1R G;  3W7W A;  3A0H Z;  4P2Z A;  3ZX6 A;  2F4V O;  3K08 A;  1GH6 A;  3FYE B;  4JTA B;  4N23 A;  5C93 A;  3T4Z A;  4FLY A;  4J80 A;  3CPW U;  2ZM6 O;  3ZHS A;  2OCH A;  3JD2 A;  1ZAU A;  4DR1 B;  4LWS B;  4W4L A;  3BA8 A;  2WLN A;  4X1I B;  5IYB O;  1QU7 A;  2RDC A;  4PV1 B;  4O2B B;  2XAH A;  4QGP A;  3N27 A;  1WPX A;  5TIS Z;  3K57 A;  4J7Z A;  1BGY H;  5EZY B;  1OCO C;  1AIL A;  4TOI A;  1Q90 D;  2PYJ A;  1SQP H;  4K3A A;  2EIM C;  1V54 B;  3C3T A;  2OWO A;  2NR5 A;  5LMN O;  2F4V B;  2AHY A;  3FD9 A;  4O4H A;  4BIU A;  5IJ0 B;  4JAV A;  4LF4 B;  4BAY A;  3MDS A;  1FAF A;  3H9V A;  3ETD A;  3QG5 A;  1N32 B;  1ZL8 B;  3RYI B;  3VOU A;  4DV6 B;  2OT5 A;  4PA9 A;  5EBL C;  3KKY A;  2CDY A;  1Q8I A;  4MVO A;  3U0Z A;  1M1K W;  3FFQ A;  2UU9 B;  1TUE B;  1IBL O;  4J9Z B;  3OM3 B;  1MZF A;  5LXT A;  2JK5 C;  2E5L O;  3ZED A;  5J2U B;  1SS3 A;  1DLB A;  4YHH B;  3B4S A;  1YJN V;  4YIO A;  2A3Q A;  1LUW A;  4LFA O;  4DK1 A;  1FJG B;  5B5E Z;  2CUG A;  3BFR A;  5IT9 N;  4AI8 A;  2A7W A;  2XT9 A;  2PZS A;  1AR1 B;  3JAR B;  4JI0 O;  2FL4 A;  5E1A C;  4JYA B;  1D5A A;  3ABK C;  1XMO B;  5DN6 G;  1SES A;  4PDL A;  1VQ5 V;  3W7T A;  1VQ8 V;  1M9N A;  5BR8 O;  1M93 A;  1S72 V;  1EZV H;  3JD0 A;  3K06 A;  3FB5 C;  1AJN A;  1FXK A;  3CRA A;  1K5Q A;  2P4K A;  1KB9 F;  1WNS A;  2JGU A;  2Q6A A;  3E22 B;  3ICX A;  1F4M A;  1KUQ A;  1Q5O A;  3APO A;  5JWP A;  3Q4H B;  1R3I C;  2EIK B;  3RYF A;  4X62 B;  3QTC A;  2G38 A;  5A9G A;  1IDS A;  4J7J A;  3BA9 A;  3P3P A;  4YY3 B;  3AG2 C;  2ITC C;  3QVN A;  2RN9 A;  1K73 W;  3A0R A;  1GM8 A;  3OTF A;  1J5E B;  3E8F A;  1KD1 W;  3CC4 V;  3DTU B;  2LW1 A;  2ITD C;  3DSQ A;  2XAF A;  2ILM A;  3AG1 B;  2RQ6 A;  4B3S B;  4DK0 A;  1XNR B;  1US6 A;  5K1X A;  3UKM A;  1H2G A;  3X2Q B;  2VQF B;  4B08 A;  4G28 B;  3L71 H;  2RJZ A;  1N33 B;  1KMI Z;  1IBM O;  2ADP A;  3QO8 A;  5J2U A;  2IH1 C;  5JJN B;  3SPG A;  5LYJ A;  4K35 A;  1AB3 A;  1XMQ O;  5ITZ A;  3KZI Z;  2QWO B;  5LP6 A;  1BHA A;  2K1E A;  3A2F A;  1Y74 B;  2R70 A;  4P9P A;  4NXM B;  2CAZ C;  2HFE C;  1XRE A;  4MVS A;  4JV5 B;  2V4D A;  1RPR A;  1GMG A;  1ZTE A;  2N74 A;  2DQ0 A;  2GV9 A;  4B3T O;  4O4H B;  3AG3 B;  3KCX A;  1WA8 A;  5JQG B;  1SC5 B;  5LOV A;  3LNN A;  2DYS B;  2F43 G;  2QKC A;  3SYO A;  2VQF O;  3WG7 B;  2AW9 A;  3ZRX A;  1VQM V;  2DMX A;  2YDE A;  3CSX A;  5H9C A;  3WB1 A;  3UM7 A;  2OCC B;  2YIB A;  5LGU A;  4MTO A;  1YCI A;  3ASN B;  1NVP D;  2F93 B;  1FYJ A;  1TGO A;  2VS0 A;  4RQF A;  1YJW V;  3FB8 C;  1M4U A;  2UUA B;  3HR0 A;  1DF4 A;  3LSQ A;  2FML A;  2ZXW C;  2Q67 A;  4NXM O;  1SQX H;  1GN2 A;  2KKW A;  4JZ2 A;  1ENV A;  3JYC A;  3GB7 C;  5KHH A;  2WLJ A;  5IDJ A;  1BE3 H;  1IBL B;  3B77 A;  4JYC A;  4G2K A;  1WLE A;  1A32 A;  1OZ0 A;  2X0L A;  4DV3 B;  3CCM V;  2Y0I A;  1VQ9 V;  4GKJ B;  4GX5 A;  5B3S B;  5L3D A;  5J2T A;  1SA0 B;  4W4K A;  4E2L A;  2QKA A;  3A0B Z;  3OGC C;  2IBZ H;  1EN5 A;  2YI8 A;  3AG4 C;  1PNL A;  3T1Y B;  4J9Y B;  4QJF B;  5LMN B;  3B8M A;  1QHT A;  2F95 B;  4JI6 O;  1TVK B;  1PP9 H;  2DOS A;  3JD4 A;  4HYO A;  3HKE B;  3QO5 A;  4I55 B;  3ZMZ A;  4DUY O;  3MAQ A;  3LDD A;  4DUZ O;  4MVQ A;  5DM6 V;  1VQ6 V;  4ZOL B;  2YI9 A;  3ABL B;  4I50 A;  1NBM G;  3CMA V;  2K9P A;  4D7T A;  4CH4 A;  4F6E A;  4HNA B;  4WFH A;  4GZR B;  3RN4 A;  4U7N A;  1MSD A;  3R65 A;  3E8H A;  2QR4 A;  5LP6 B;  2JGD A;  1R6K A;  2Q7E A;  3H1H H;  3JSL A;  1IBK B;  3RYC B;  3JAW B;  1Q6U A;  1L1F A;  1OV9 A;  2ZIO A;  3SYQ A;  1LR1 A;  2QTO A;  3HKB B;  3TK1 A;  4TWK A;  3FB6 C;  1Q43 A;  5EIB C;  1ROP A;  5LOV B;  4UFZ A;  4LBE C;  5J2T B;  3SR2 C;  2BTQ A;  2X6C A;  4JTC B;  3FAV B;  1HDJ A;  2ZE6 A;  2PTM A;  4CS3 A;  5KHI A;  4H0L B;  1ZUQ A;  1O9H A;  1OCZ C;  1GN3 A;  3N2K B;  2WLK A;  4LR3 A;  2M7W A;  4LH7 A;  2ZR3 A;  3CCU V;  2B1G A;  2EIL C;  1MOF A;  3OFN G;  3CCR V;  2FB5 A;  1IX9 A;  3SJB C;  5KHK A;  2QJ1 A;  4UVA A;  2VWJ A;  4PDR A;  4NB5 A;  3HB3 B;  4P9O A;  1HNX O;  1FFX A;  1H2N A;  1T5E A;  4TSF G;  4FJC C;  2XAS A;  1DF5 A;  4NXN B;  2DJV A;  1YJ9 V;  4LP8 A;  1VQ4 V;  2CE4 A;  4NTY A;  3ZHV A;  3JCU Z;  2VRZ A;  5IY5 B;  2JEX A;  1V55 B;  4JZG A;  4F6R A;  3JAW A;  4FM1 A;  4LF9 O;  2QWQ B;  5KHG A;  1IXM A;  1VQP V;  4U7O A;  5JH7 B;  1GK9 A;  5EIB D;  1R6T A;  1BMF G;  2QKS A;  1R1B A;  2GBO A;  1Y74 A;  3RVZ A;  2WLL B;  5CBF A;  1EN4 A;  2P7T C;  3I5D A;  4EFB A;  4X1I A;  1KEC A;  1NS1 A;  5FPO A;  1FXK B;  1XQ8 A;  1S76 D;  1FJG O;  1GKF A;  2UUA O;  2HKO A;  1FS0 G;  4GX0 A;  2P4V A;  2DN9 A;  2UUB O;  2FKX A;  1YDX A;  5E79 Z;  1YHQ V;  5IWA O;  2RMK B;  3IFX A;  2JDI G;  3DC6 A;  1SQG A;  4I50 B;  2H3O A;  4BW9 A;  5IJ0 A;  4H13 B;  4DV6 O;  3ZRW B;  3ZMT A;  4Z1M G;  2D2C B;  1SF9 A;  4QPK A;  4UVB A;  3KCY A;  3S3W A;  1VQK V;  3K5L A;  3OE7 G;  4GKK B;  3BAB A;  2Q0O C;  4GKJ O;  1BS3 A;  5AG2 A;  2YXH A;  1GAX A;  4YY3 O;  4K0K B;  2IU3 A;  3E2E A;  2ZR2 A;  1H2S B;  1K33 A;  4LFA B;  3OR6 C;  1N34 O;  2UXC O;  3JD1 A;  2ZCE A;  4J10 A;  4OGQ B;  2CH7 B;  1XIL A;  3CXH F;  1DGS A;  4LCU C;  1AP6 A;  3B40 A;  4LF8 B;  4QPJ A;  3CME V;  1JCH A;  1WAZ A;  2L6L A;  1N0N A;  1SZT A;  2C2A A;  2HHH O;  1WP7 A;  5L3G A;  4MW3 A;  1R6N A;  1G1X B;  2UXD B;  2AZ0 A;  2LJ2 A;  3AG4 B;  2ZDI C;  4FMT A;  5CA1 B;  5IYC O;  4LF9 B;  5GW7 A;  4F6R B;  1NR7 A;  5CA0 B;  2LFS A;  1XUQ A;  5EYP B;  3NR7 A;  2WA4 A;  4DR2 B;  3OEE G;  5KHJ A;  4O4L A;  4AQY B;  4CS2 A;  4K0K O;  1OJH A;  1SQV H;  3I56 V;  4ZI7 A;  1HR0 B;  4NTX A;  3LUT B;  2YIC A;  3JAL A;  5KMG A;  2W6I G;  2H94 A;  2ZNJ A;  3VQV A;  5IYZ B;  2EZO A;  5IY5 C;  3JAT A;  5GTH Z;  4HBN A;  2V1D A;  4DRX A;  3ZHR A;  2QEX V;  1TAE A;  4RAI A;  2ZXW B;  1JMK C;  3O65 A;  4JYY A;  5IWA B;  2Q69 A;  2YC0 A;  4NTW A;  5B1A B;  3DXR B;  3M99 B;  2ZM6 B;  4IGG A;  3SGI A;  1X4T A;  1XHZ A;  1EBO A;  4FZ0 A;  2DYR B;  1CP9 A;  2EIL B;  4LNU B;  2ZIM A;  1VP7 A;  4X20 B;  2OCC C;  1PNK A;  3BRC A;  3SPJ A;  3C3S A;  3W7S A;  2OIE A;  4WBN B;  1Z5W A;  2DYS C;  4DV4 B;  1YI2 V;  4DV5 O;  4QIW F;  5L3F A;  2EIJ B;  2IH3 C;  3CRM A;  1N33 O;  4L87 A;  3SPI A;  4JI2 O;  1IBM B;  1HR0 O;  5JCO C;  4CH6 A;  1S5H C;  2PF4 E;  5H2F Z;  3RW0 A;  1XHX A;  1WN7 A;  5D5P A;  4OX9 B;  1SER A;  2Z0A A;  1EN6 A;  3IGA C;  3HKC A;  4UV9 A;  3CCV V;  3D36 C;  5LHG A;  4JYA O;  4J42 A;  1JA8 A;  2HP8 A;  3ABM C;  3CYO A;  2Q7H A;  5ITZ B;  1NTK H;  2DW4 A;  5JQG A;  1MNG A;  1HW7 A;  4NR1 A;  5B1O A;  1AVM A;  3RBZ A;  4UCR A;  4UCO A;  1KP2 A;  4GUN A;  3CX5 F;  1W0J G;  4JAU A;  3J7A U;  2OTJ V;  2BOC C;  2ODM A;  4BIO A;  1TA8 A;  4DO2 A;  4DR3 B;  2WA3 A;  1RP3 B;  4LF6 B;  2B9Z A;  3ASO C;  5LBQ A;  1KC8 W;  2Y0P A;  4JI8 O;  3HKE A;  4JGS A;  2GSM B;  4B3M O;  3CCQ V;  1YSC A;  4JPR A;  1UJW B;  2VQE B;  3LDC A;  5B1N A;  1H2M A;  2CK3 G;  5BMV A;  1BQZ A;  4LF5 O;  2DQ3 A;  2Q7G A;  3GVM A;  3T1Y O;  5CB4 A;  5LMU B;  5LHH A;  3K59 A;  2ADQ B;  4BWA A;  2ETN A;  5B1B C;  2WPD G;  4UCV A;  2BE3 A;  4JI6 B;  1QLE B;  3CB2 A;  4GLX A;  2Y69 B;  1NKD A;  1SRY A;  5H6Q A;  1PD3 A;  4H44 B;  2N05 A;  3E83 A;  3UO2 A;  1AR4 A;  1SET A;  1NZ6 A;  2A79 B;  1ARO P;  4RQE A;  2Y4U A;  1Y76 A;  3OGI B;  5B3S C;  4DXW A;  1AJP A;  5A2Q N;  2LGW A;  4PA3 A;  4FFB B;  1OCR C;  3P30 A;  3EXA A;  4DR5 O;  1QR8 A;  1VF6 A;  1Z2G A;  1M5I A;  3SDL A;  1N34 B;  2UXC B;  4XDJ A;  3BHP A;  2ZE7 A;  1L8D A;  3CCE V;  1N32 O;  1K4D C;  2AZ2 A;  4DR6 O;  3TCU A;  3AK1 A;  1EZJ A;  1NH2 B;  4KP4 A;  4E4E A;  1KBH A;  3UQ8 A;  4PHZ A;  1MAB G;  3WG7 C;  4AHC A;  4JI7 B;  3G67 A;  3BEH A;  4O4L B;  5DEC A;  4EB6 B;  5KAF Z;  2BOB C;  2CTR A;  3ZBH A;  4DYL A;  3ZHQ A;  2IJI A;  1I5X A;  1YIT V;  1S0V A;  1HNX B;  1F51 A;  1AI5 A;  3HKD A;  1BSM A;  1RPO A;  3K9A A;  4NXN O;  3BCC H;  2VQE O;  4MS2 A;  2Q5Z A;  4GT1 A;  3TGU H;  2MW2 B;  1NJI W;  1KYO F;  3K04 A;  1YEW A;  2QGN A;  3ZHU A;  4X64 B;  5BR8 B;  2KB1 A;  3IJ4 A;  3FYI B;  4I9Q A;  1V54 C;  3WFV A;  2P90 A;  4JI7 O;  3F5W C;  3OTO O;  3K79 A;  1GN4 A;  4GX2 A;  3ZJZ A;  2UUC O;  3VBB A;  2P06 A;  3W7U A;  4PI2 A;  3OUF A;  4LH6 A;  4EB6 A;  3SJA C;  2HVJ C;  5H6R A;  1Q7Y W;  2YUA A;  1OCC C;  4AQY O;  4LFB B;  4DV5 B;  4UVC A;  3AG1 C;  2XTA A;  3M7M X;  3J80 N;  1LNQ A;  3ZRW A;  5LGN A;  2IJH A;  2R72 A;  3K5O A;  3JAK B;  2EJR A;  1Q86 W;  3CCJ V;  3K03 A;  5JVD A;  3ZS8 C;  1XI1 A;  4WFG A;  1JFF B;  4O4I A;  5EZY A;  5KAI Z;  1R3J C;  4DV7 O;  4X20 A;  5KA5 A;  5BXZ A;  3L72 H;  1THZ A;  5GON A;  4DV1 O;  1H2K A;  3HKD B;  3DXR A;  4LF6 O;  5LA6 A;  1WB7 A;  4MVR A;  2EIK C;  3D36 A;  3CCL V;  1IXB A;  1GO3 F;  3JAT B;  1OCZ B;  2V7Q G;  1U96 A;  4PA7 A;  2GTS A;  4LF4 O;  2ATK C;  5BY1 A;  2QWR B;  2QWP B;  3BVO A;  1IBK O;  2BTO A;  2Q9L A;  2YXY A;  1XNQ O;  5LMU O;  2EZP A;  3CWB H;  5FNV A;  3W7X A;  3H1K H;  4GX1 A;  1VF7 A;  4HAM A;  4MTX A;  3L70 H;  4UB6 Z;  3CHX A;  2JS3 A;  5EBW C;  2QDO A;  2OYQ A;  4R8C A;  1UPG A;  3HKC B;  4PD4 F;  1WPB A;  1I94 O;  1QLN A;  4B3T B;  4BW5 A;  2GDS A;  4MVZ A;  1X59 A;  1HNZ O;  5BMV B;  5HFM A;  3UCS C;  2E5L B;  1K4C C;  3CS5 A;  2CTW A;  3STZ C;  4F4L A;  2ARH A;  4WCE V;  1H38 A;  1I7F A;  5CN0 A;  5LP6 C;  5JVD B;  3CRC A;  4DR3 O;  4U3J B;  2RNB A;  3E86 A;  1D2D A;  4MTF A;  5L3C A;  5KX5 B;  1JVM A;  4TQD A;  4ZBM A;  1COW G;  4YJ3 B;  4MVU A;  1Q81 W;  5JCO A;  4OPH A;  4OPA A;  3ABL C;  5LGT A;  2PUS A;  2ZDI A;  1QVF U;  4JI4 O;  5KMG B;  3UT5 B;  4QNH B;  3CRR A;  2YSU B;  3JSN A;  1SA0 A;  4LF5 B;  2JGD B;  3SJQ C;  2P6J A;  3MHS C;  5EYP A;  4G27 B;  5CA0 A;  3T1H O;  2NLJ C;  4KHP O;  5IYD O;  3SYA A;  2W0F C;  4IYI A;  4PJ0 Z;  2EIM B;  5CBH A;  3JAS A;  2UXD O;  5KUM A;  1KQS U;  3CEI A;  2CTQ A;  4J7K A;  1GTO A;  2ZE8 A;  4CH5 A;  2CGN A;  5J9P C;  2HEP A;  5H5N A;  4X1Y A;  4Q20 A;  2O57 A;  4RO2 A;  4DRX B;  1I0H A;  3A8T A;  1NQT A;  1O9G A;  2PY5 A;  3JAS B;  4FZ1 A;  1VQN V;  4FVM A;  5F2V O;  2QA4 V;  5LYJ B;  3WB0 A;  3EFF K;  3G80 A;  4D7S A;  3GWK C;  4TT3 G;  4RUE A;  2WSS G;  1NI8 A;  4I4T B;  4ASU G;  2Z3Y A;  1CPY A;  1BT8 A;  5JH7 A;  1HNW B;  5BZB A;  3T1H B;  3JAK A;  3E8G A;  1VQ7 V;  1FXV A;  3APQ A;  3E8B A;  4NVP A;  4LFC O;  2Q68 A;  5EK0 A;  4TV8 A;  4ZHQ B;  2UUC B;  3S3X A;  1D5N A;  3F7Y C;  3ZRS A;  3BY6 A;  1QVG U;  3ASN C;  3P3N A;  1E79 G;  4JI1 O;  4I7Z B;  4FPP A;  3RT3 C;  3ETG A;  2A9H A;  3TXQ A;  5LA6 B;  2LW7 A;  1DTO A;  1S5L Z;  5IJ9 B;  4B3R B;  4UUJ C;  1BQ0 A;  3L75 H;  3CD6 V;  5FLX N;  2FTK A;  4XDK A;  4LNU A;  4CBC A;  3AG3 C;  2HVK C;  4KXR A;  5EC1 C;  3STL C;  1TUB B;  2GTA A;  4ABM A;  1OCR B;  4K8X A;  3BPZ A;  3E35 A;  1P49 A;  3OT7 A;  4JF3 A;  3I55 V;  4NKG B;  3RYF B;  1MMM A;  4X1Y B;  4DR7 O;  4YJ2 A;  1S77 D;  1JFF A;  4KHP B;  1K9M W;  1NTM H;  4LC1 A;  2WLI A;  2UU9 O;  1M90 W;  2Z5U A;  2E76 B;  1H2L A;  4FIP C;  5IYZ A;  2E75 B;  1FD9 A;  2Y69 C;  3MD0 A;  5D5Q A;  1VQL V;  3RYI A;  5B1B B;  4O4J A;  4FLT A;  1DK1 A;  4I0X B;  4FLW A;  1S3J A;  2QM7 A;  5CB4 B;  2YXL A;  4GKK O;  1G4Y B;  4DR2 O;  1OCO B;  1H8H G;  3K0D A;  3NXS A;  3QF7 A;  3CC7 V;  1BL8 A;  4ZKI A;  2A06 H;  2QTS A;  4DV2 B;  3X2Q C;  2Q73 A;  4FM0 A;  2YIA A;  5JJE B;  2BSK A;  3SJC C;  4EFE A;  2VWK A;  4QE7 A;  1VIB A;  2B1I A;  4J41 A;  3GWO A;  3N2G B;  2F23 A;  4HNA A;  3BAA A;  1N8R W;  3RVY A;  4FM2 A;  1YTF D;  1HNZ B;  3DC5 A;  2LQT A;  5FPR A;  2YS8 A;  2UXB O;  1I94 B;  4JI3 B;  3G6E V;  1BCC H;  1F23 A;  3AG2 B;  5FL7 G;  1QNM A;  4DR4 O;  1WJZ A;  4I0X A;  4B3R O;  1XBL A;  3CRQ A;  1CXZ B;  4R7C A;  4BR6 A;  1CEZ A;  1KU9 A;  1FFX B;  2X6B A;  1RSO B;  3JAR A;  4JI4 B;  4JAA A;  1NU1 H;  4X66 O;  2BSK B;  3RYC A;  4H33 A;  4X89 A;  4TUY A;  1Q3E A;  3LSS A;  1XNQ B;  2F66 C;  3SPH A;  1FXH A;  3QO7 A;  4IL6 Z;  4WF9 V;  4MSW C;  1B06 A;  2LGQ A;  3ZRV A;  5HFL A;  1RFY A;  3PJS K;  2BCC H;  3KG2 A;  5CBG A;  4DUY B;  3FAV A;  3CJH B;  1JX9 A;  2AGA A;  2Q4P A;  2BTQ B;  4DV0 B;  1Y4M A;  4DUZ B;  3DGE A;  4JI3 O;  3J81 N;  1PPJ H;  4TV9 A;  3JAM N;  1QLE C;  1HWY A;  3Q4H A;  3R66 A;  3RGB A;  4FFB A;  3N2G A;  4X65 B;  4CZZ A;  4I9W A;  4X66 B;  2JRI A;  1ZWI C;  2QE7 G;  3OW2 U;  4ZOL A;  4JI5 B;  1QBZ A;  2HJD A;  1VF6 C;  2WWW A;  3ZMV A;  4DW0 A;  2KQX A;  4UCT A;  1XOU A;  5GTI Z;  4DV2 O;  1XDC A;  1G6U A;  4MTG A;  2OTL V;  1OCC B;  3L9D A;  1NT2 B;  1W2B U;  2Y4T A;  1WB8 A;  1SKV A;  5JJJ B;  4U3F H;  3HKB A;  2YID A;  2UXX A;  4CC6 A;  3ETE A;  5LXT B;  4IIJ A;  1RM1 B;  1U97 A;  4X1K B;  4JV5 O; 
#chains in the Genus database with same CATH homology
 4B3S O;  4JI7 O;  4DR4 O;  2E5L O;  1YZB A;  3OTO O;  4DV0 O;  2UUC O;  4X62 O;  4B3R O;  4JI1 O;  5A2Q N;  3RT3 C;  4GKJ O;  4DV5 O;  4DR3 O;  1D2D A;  1IBM O;  2LW7 A;  4YHH O;  4LFA O;  4DR5 O;  5IT9 N;  4AQY O;  4YY3 O;  1N33 O;  4LF7 O;  5FLX N;  4JI2 O;  1HR0 O;  1N34 O;  2UXC O;  1FKA O;  4OPA A;  4OPH A;  4X66 O;  1XMO O;  4JI0 O;  1AB3 A;  3J80 N;  3SDL A;  1XMQ O;  1HNX O;  2F4V O;  2Z0A A;  4JI4 O;  4LF8 O;  4OX9 O;  2ZKO A;  4JYA O;  4JI6 O;  3M8A A;  2DOS A;  2DJV A;  4DR7 O;  1F7Y A;  4DV7 O;  1N32 O;  5BR8 O;  2ZM6 O;  4DUY O;  5BXZ A;  1N36 O;  2UU9 O;  3T1H O;  2HHH O;  1XNR O;  4DR6 O;  4KHP O;  2N74 A;  4LF9 O;  1G1X B;  4DUZ O;  4DV1 O;  4X64 O;  4B3T O;  2AGA A;  3J7A U;  4LF6 O;  2UXD O;  4JI3 O;  3J81 N;  4DV3 O;  1R6T A;  2VQF O;  5LL6 Y;  1DK1 A;  1KUQ A;  1R1B A;  3JAM N;  1AIL A;  3R66 A;  4K0K O;  4JI8 O;  4GKK O;  5H5N A;  4DR2 O;  4DV4 O;  2JRI A;  4B3M O;  4X65 O;  1FYJ A;  4LF4 O;  5LMN O;  1NS1 A;  4A5U B;  3F5T A;  1FJG O;  4LFB O;  5BY1 A;  1J5E O;  2UUA O;  1IBK O;  4JI5 O;  4NXN O;  1XNQ O;  4DV2 O;  5LMU O;  4LF5 O;  2UUB O;  2FKX A;  2VQE O;  3T1Y O;  5IWA O;  3O65 A;  1XEQ A;  4NXM O;  4DR1 O;  1I94 O;  1HNW O;  4DV6 O;  4LFC O;  1X59 A;  2UXB O;  1A32 A;  1HNZ O;  1IBL O;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...