4DV6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv6O00
3J81N 1HR0O 5A2QN 1XEQA 4JI5O 3J80N 5LL6Y 3O65A 3J7AU 4JI3O 4YHHO 4LF9O 4DV4O 4B3SO 4B3RO 4LFBO 2UXDO 4JI0O 3M8AA 1R1BA 4LFAO 4X64O 3JAMN 4JI6O 4OX9O 1N32O 4NXMO 2JRIA 2AGAA 5BR8O 2LW7A 4DV5O 1A32A 4AQYO 1KUQA 1HNXO 5FLXN 2N74A 5BY1A 4LFCO 4A5UB 4JV5O 4OPHA 2UUCO 3OTOO 1XNRO 4LF6O 1IBLO 2UU9O 1XMOO 2UUBO 1XMQO 4DR6O 4JI7O 5BXZA 1F7YA 4DR7O 1D2DA 1IBKO 1J5EO 4LF5O 1X59A 2DJVA 3T1HO 4B3MO 1HNWO 2VQEO 4KHPO 4LF4O 1N36O 4LF8O 4DV1O 4GKJO 2FKXA 2F4VO 5IT9N 4JI8O 2UXCO 4JI2O 4DUZO 1G1XB 4X66O 1HNZO 1I94O 2DOSA 4DUYO 1XNQO 1N34O 1AILA 2Z0AA 4DR5O 5IWAO 1FJGO 4DR2O 4DV7O 4JYAO 4B3TO 4YY3O 1AB3A 1IBMO 3T1YO 3RT3C 3R66A 2ZKOA 4DR4O 4JI1O 1YZBA 1N33O 1DK1A 1R6TA 4DR1O 4X65O 4OPAA 1NS1A 4DV2O 4LF7O 3F5TA 4GKKO 5LMNO 4K0KO 4DV6O 5LMUO 4DR3O 1FYJA 4JI4O 2UUAO 2VQFO 5H5NA 4NXNO 4DV0O 3SDLA 4X62O 4DV3O 2UXBO 2HHHO 2ZM6O 2E5LO 1FKAO
chains in the Genus database with same CATH superfamily
1SERA 4W4LA 4I55A 5JQGB 4YIPA 4RQEA 4B3SO 4LR3A 1S0VA 4JV5B 4L8JA 1VQ6V 2ZXWB 2JRIA 2GDSA 2WLJA 2LFRA 1FFXB 2W0FC 4DR6B 2YIBD 1IBKB 4JV5O 1S5LZ 2ZIMA 4B3MB 5KAIZ 1XHZA 4DO2A 4DR6O 1P49A 4QNHB 5L3DA 1IBKO 1AI6A 3BEHA 2JEXA 1Q86W 4FLVA 1YIJV 1B04A 4B3MO 1YJNV 4DUYB 2JGDA 3BY6A 2CH7A 2EULA 2JK5C 3E8FA 4DR2B 4WBNA 2VQFB 1K73W 5LP6B 4LH7A 1G1XB 2QWQB 2WA4A 4DUYO 1XILA 4G28B 2Y4TA 2BTQA 2YSUB 3IFXA 3X2QB 4X65B 4DR2O 2HKOA 3A2FA 3ZMSA 3JD1A 2IJIA 3RT3C 4WCEV 4ZHQB 2AW9A 3DXRB 2F93B 2P6JA 3W7WA 1FS0G 2D2CB 3VBBA 4X65O 4RUFA 2P7TC 3M7MX 1XNRB 2RN9A 1K5QA 4K3AA 1OV9A 4I55B 3BAAA 3OT7A 3BHPA 4WF9V 1IX9A 4B3RB 1SESA 5J2TA 4DR7B 3BVOA 2E5LO 3ASOC 3SJAC 1GO3F 1F23A 4H44B 4BR6A 3F7YC 3T2MA 4KHPB 4B3RO 3B40A 4TOIA 1O9HA 4NXMO 1S5JA 2AZ2A 3ZEDA 4O4IA 2VWKA 3K9SA 2QGNA 4FIPC 5CBFA 3WG7B 3FD9A 3AG1C 3TGUH 5JJNB 3GB7C 4NVPA 5EBLC 1R3LC 1Y4MA 2P67A 1SKVA 2ZDIA 2JGDB 2ADPA 2CH7B 1SQFA 4J42A 4WBNB 2YDEA 2IBZH 3TXSA 2FMLA 3G4SV 3AG4B 1OHHG 5C93A 1CEZA 2BTQB 3OMIB 1I0HA 4MW3A 1FJGB 4JZGA 4JYAB 3AK2A 2FKXA 2YXHA 1M57C 1IXMA 2NN4A 2JJ2G 4CH5A 3ETDA 4J11A 3K06A 5D5QA 1FJGO 3DGEA 1WA8A 3K57A 4JYAO 4ZI7A 3I55V 5LMUB 1F51A 5KUKA 3K59A 1RM1B 1ZLZA 4DR4O 4DR3B 1OCOC 4JAAA 2H8PC 2BSKA 3E8HA 4F4LA 1XUQA 3SYOA 3G6BA 2EINB 4MTFA 4NTWA 4NKGB 5J2TB 1WAZA 1DTOA 3K3WA 1BQ0A 5LMUO 3DC6A 2FL4A 1GH6A 3DSQA 1BS3A 4UCVA 1G6UA 5EYPA 4DR3O 1PM9A 2UUBB 1B6QA 3T4ZA 4ABMA 3A0HZ 1KC8W 1OCCC 2HHHO 1FXHA 3T1HB 3E35A 4O4IB 1KKDA 4LF9O 3B8NA 2CE4A 2NLJC 4JI6O 4JYCA 4PA3A 1MMMA 2FB5A 2EJ7A 2YIDA 5KA5A 4MVSA 2Q6AA 1H2KA 3K5NA 4ZKIA 4PDLA 1XOUA 4IYHA 2IJHA 3L73H 4I50B 4YJ2A 1H2LA 1N33B 1G4YB 4F6RB 3P3PA 2F4VB 1M93A 2DYSC 5KX5A 3MDSA 3SJCC 1DGSA 1RPOA 4QJFB 1XNQB 4UCTA 4Z1MG 1SS3A 4WFBV 4B7EA 1WA8B 3SYCA 4XDLA 2F4VO 1K5SA 3T1YB 2A3QA 4FLXA 3CRAA 3UT5A 4I9QA 1H8EG 2BSKB 1XNQO 5JJJB 1W0KG 3AG2C 4IYIA 4X89A 1K3EA 4MVRA 5LA6B 3T1YO 1B3QA 4IL6Z 2ATKC 1YZBA 4CC6A 4D7TA 3D36A 2XAHA 2UUAB 3SJQC 4WFHA 3ZHSA 3H1LH 2DN9A 2OCCB 2FTKA 5JVDB 3ABMB 1JOYA 1WN7A 3OTFA 2Q0AA 3A0RA 3ICXA 1FYJA 2UUAO 1Y67A 5LHGA 4R7CA 5GTIZ 2P06A 4LF5B 2DWEC 3U11A 5H2FZ 1WB7A 2BE3A 4W4KA 1SZXA 2ZR2A 3ZHVA 4BIZA 1S76D 3ZCCA 2GTSA 1VQ4V 2L35A 2UU9B 3BCCH 4UFZA 4QPKA 2LW7A 4HNAA 4YJ2B 1I94B 1Q8IA 4TV8A 1HNXO 4LFCO 4NB5A 1BQZA 1VF5B 1XHXA 2IJKA 3LSQA 2ZINA 1XL4A 5KX5B 3S3XA 4FM0A 2UU9O 4K8XA 1HNWB 3AG1B 1R3KC 1HDJA 2RCVA 2YEVB 5DEDA 2QR4A 1M90W 4TWKA 1NVPD 5GTHZ 1VQKV 1HNWO 1U97A 2KB1A 1ZTEA 5KHKA 5HFMA 1KQSU 3A8TA 4DR5B 1T5EA 4U3JA 5IT9N 3AEIA 1BGYH 1Y66A 2A06H 5LGUA 2A7WA 1F4MA 1M57B 1K4CC 4DR5O 2YI8A 1W59A 4I0XA 4U7NA 3CE2A 1XBLA 1D5AA 3ZHRA 4DV6B 4JF3A 4X20B 2WLLA 4EB6B 2PYJA 4FLZA 4EFEA 2NNUA 1VQMV 1V54C 2CTQA 2JIZG 2YIBA 4DV0B 2QKAA 2HEPA 2PTMA 4DV6O 3APQA 3SPJA 3BFRA 3SPCA 4P2ZA 1TA8A 3TETA 3E22A 1WP8A 3LSUA 5LXTA 4JI7B 4DV0O 3K04A 4PA6A 4PDMA 2UXBO 4BW5A 2ZM6O 4IIJA 2QTOA 1FXKA 4HNAB 3EFFK 4MVQA 1OCCB 1YVWA 4TV8B 1Y74A 1JJOA 3AG3C 4LFAO 5ITZA 1OCRC 2JGUA 3OR7C 2RNBA 3LNMB 2K9PA 2EIMB 3FYEB 1S72V 2GUZA 4JASA 1URFA 1PL0A 4XDJA 4HZ3A 2N05A 3CMAV 1J5EB 1KD1W 1JMKC 1ZL8A 1QHTA 2UXNA 2OWOA 2CK3G 4X1YA 1GN3A 5BZBA 1MZEA 4JI1B 2D3OW 4LF8B 3OEEG 3K9AA 1J5EO 5EK0A 4UCUA 5A9GA 2ZIOA 1HWYA 3G6EV 4J80A 2UXCB 2XUMA 2WLMA 4GT1A 2BOCC 1XI1A 1MZFA 2DYSB 4LF8O 1ZAUA 4H13B 4NR1A 3S3WA 4I0XB 4DV7B 2QM8A 4B3TB 1P7GA 3H1HH 1H2SB 4YJ3B 4JI8O 3CD6V 2UXCO 3B8MA 2PI4A 3FYIB 4EKWA 2WLLB 2QDOA 1NH2B 2P90A 4GX1A 1AILA 4BIOA 5IWAO 1D5NA 4DV7O 4B3TO 4JZ2A 4J7JA 1ZWIC 3G71V 3AG2B 3OAAG 2EILC 3E22B 4Q20A 1IZ3A 3STLC 4AI8A 1UJWB 4N23A 1I5YA 4IIJB 2OT5A 2Q7GA 1FXKB 2DE0X 4GUNA 1B06A 1Y74B 3RN4A 5FL7G 3JAWB 2W0XA 2JDIG 3K03A 2HR3A 5ITZB 3CCMV 1LR1A 4FMTA 3THOA 5JH7A 3L74H 1MABG 1IXBA 2R9AA 2XAJA 4DK0A 2DMXA 1SRYA 1ZL8B 4LH6A 5B1BB 1P7BA 1SQGA 5D5PA 5L3EA 4X1YB 3CCLV 4FLUA 4UV8A 3MAQA 2N74A 5BY1A 5CN0A 3RYHA 2ITCC 1YSCA 2YXLA 4GLXA 1RSOB 2GTAA 1K97A 2OCHA 2R9IA 2HJFC 1GAXA 1H8HG 1FFTB 5LOVA 1M9NA 4O4LA 3BA9A 4G27B 4BW9A 1JX9A 4FM1A 5B1NA 1AI7A 2DW4A 5IJ9A 1VQ8V 1VQ7V 2QKSA 4DV2B 1THZA 4PA7A 3L75H 2B5UA 4GX5A 1AR1B 3IJ4A 4OPAA 1PNLA 4DV2O 1Q6IA 4X62B 1M4UA 3JCZA 1IVSA 1V9PA 3B2EE 1FPOA 1P4RA 2OTLV 4CC5A 2VQFO 2UXDB 1F4NA 2F95B 3CSXA 4CZZA 4X62O 4J10A 1QLEC 1GN4A 3J80N 1N0NA 1ZSPA 4ZOLA 4H0LB 3QNEA 1COWG 3RYHB 1N36B 3LNNA 2UXDO 4WFEA 1LUVA 5DN6G 1AJNA 3F5WC 3ZMVA 3ZN0A 2Y4UA 1NTKH 1PNMA 1NU1H 4X66B 3AG3B 4TQDA 2P4VA 1OCRB 4OPHA 1XNRO 2C2AA 4PI2A 4IT5A 4O4LB 1BCCH 3CXCU 2IJJA 5IDJA 3LDDA 2UXXA 4DR7O 1ORQC 2RQ6A 3SYAA 4NTYA 2QM7A 5LMNB 5IJ9B 1DF5A 3K5LA 4KHPO 2CTPA 1KMIZ 1QCEA 2ODMA 3U10A 1JQ0A 3SYQA 3BA8A 3LSSA 1RFYA 3ZMUA 3FB7C 3O9OA 2F23A 3OMNB 2IW5A 2ZQMA 2QJ1A 2ZE7A 2ZCEA 3IC7A 4FFKA 3NR7A 1AB3A 3HKCA 3T4DA 2XAQA 1QU7A 2Y0PA 3A0BZ 4DW0A 5J2UA 5CA0A 2XASA 5B66Z 2K1EA 5B1AC 2FYUH 1DK1A 2LP7A 5L3BA 2EILB 3GWOA 4FK5C 4DRXA 4HYOA 3WB0A 2E3CA 3E2EA 2DQ3A 4H33A 2Q0OC 1JPXA 3JARA 2WSSG 4RAIA 1FKAO 1ENVA 3ETEA 1KBHA 2Q69A 1XEQA 3E83A 4PELA 4DV5B 1U96A 3HKDA 1Q7YW 5LL6Y 3J7AU 4FZ1A 3JSNA 3QG5A 4MTOA 2X7RB 1I08A 1WB8A 3ZRWA 5DM6V 1X4TA 1PNKA 5LGTA 2JJ1G 4DV5O 3APOA 3KCYA 1NZ6A 3W7UA 1ROPA 5KHGA 2X0LA 2ZR3A 2QWNB 3EVKA 3B09A 4UVBA 4J9ZB 3RYIA 2G38A 2H94A 2Y69C 3U0ZA 4PDVA 1IBMB 5C8YA 1OJHA 2UUBO 3BPZA 4LF4B 3SYPA 4HAMA 4PD4F 1NJIW 2YIAA 1SQXH 3FAVA 3ABTA 3H9VA 3KCXA 4P9PA 4MVMA 3T1HO 2AHZA 1JVMA 3CRRA 4MTGA 4UV9A 1HNZB 3QTCA 4LF4O 4ZBMA 2P4KA 1W2BU 3JASA 1VP7A 4QGPA 3E89A 4KXRA 3HKCB 3ZS8C 2EIJC 3ZX6A 3D8CA 1YI2V 2XAFA 5CA0B 5EC2C 1L1FA 2HLDG 1HNZO 1AR5A 1HR0B 3H1IH 3BRCA 3MHSC 1PKXA 5L3CA 4YIOA 4KP4A 4RO2A 1BHBA 1Z2GA 4DRXB 4X64B 5EIBD 1BMFG 4FPPA 1QVFU 4ICGA 1N33O 1Y76A 5E1AC 3RBZA 2MW2B 4ZI7B 3JARB 2IH1C 4CS3A 1VQ9V 3W7SA 3JD3A 1ZUQA 2IU3A 1NVPB 2LO1A 4JGSA 3QO7A 3W7XA 3HKDB 3UO3A 2WLHA 1H2MA 3P3NA 2ARHA 1AJQA 1I5XA 3ZRWB 2JEUA 3K5OA 1GN2A 1GTOA 5EC1C 3IAYA 5EYPB 1QVGU 2CTRA 1SA0A 2F1MA 3RYIB 1TAEA 1QLEB 2XOKG 1SF9A 4GKJB 5C8YB 4DUZB 5JCOC 1VIBA 3CC7V 4NYKA 1KP2A 3JD4A 2Z5UA 2R72A 3TXQA 4LP8A 2EZOA 3FAVB 3ZRVA 2HFEC 2YI9A 2R70A 4PA9A 5FNVA 3B4SA 1K34A 3RVZA 2AHYA 4I5SA 3RW0A 5HFLA 3ASOB 3JASB 1XREA 1YITV 2WA3A 4LF5O 2Y48A 2AXTZ 5JWPA 4DW1A 5H6RA 2EIKC 4JTDB 3ABKC 3L70H 5CBHA 3IGAC 3RFRA 1EN4A 3EHBB 2PF4E 2V7QG 4J7ZA 1I94O 2YXYA 4G2KA 1Y76B 3VOUA 5IE9A 4WFFA 4X1KA 2Q4PA 4U3FH 4FLYA 2Z3YA 3UT5B 2JS3A 3R66A 4RQFA 4UCRA 1JJ2U 1K7DA 1KB9F 4PHZA 3CWBH 5K1XA 2VWJA 4TUYA 1OZ0A 1N4CA 1AVMA 1G8MA 3C90A 4NXNB 3H1KH 3Q4HA 5B1AB 3F7VC 5IYBO 5B3SC 2QKCA 2QWRB 5LHIA 1GM9A 1WPXA 1QNMA 4K35A 4NXNO 4TT3G 4N21A 3B77A 2GHYA 1TVKA 4OX9B 4IGGA 1FD9A 1W0JG 1VF6C 3G80A 4JAVA 1S5HC 3JCUZ 2OTJV 1XDCA 3SPHA 1YTFB 3L72H 1OCOB 2ZNIA 4UXNA 4LF6B 1SQPH 2B1IA 4OX9O 5LBQA 1IBLB 3ABLC 1YEWA 3ETGA 3HKBA 2LGQA 4JI2B 1S3JA 2LGWA 2ILMA 2PY5A 3CP1A 1AP6A 1KP3A 4LF6O 2M6YA 5KAFZ 1IBLO 3QO8A 2AZ0A 3WB1A 2BOBC 3OW2U 2Y69B 1BSMA 5TISZ 4JI7O 2Q9LA 4I4TA 4DV1B 1X59A 5JCOA 3WFVA 1NBMG 2ETNA 5L3FA 4I9WA 1AROP 2B9ZA 5IJ0A 2WAMA 1BL8A 3JATA 4X1KB 4DV1O 2EZPA 3CC2V 2A9HA 3ZIAG 4DK1A 5KHIA 4LCUC 2LQTA 1K4DC 4JI5B 5IY5C 1Y6XA 3E8BA 5F2VO 4K8ZA 4FFBA 4J9YB 4KUMA 2EIJB 3R65A 4TUYB 3UKMA 4U3JB 2ZE8A 4GZRB 5H6QA 3PN1A 3Q4HB 3CCRV 1N32B 4JI1O 5CB4A 3KG2A 3CCSV 5BMVA 4JI4B 3E86A 3CMEV 1VEWA 1NT2B 2Q7HA 1TVKB 2EX3A 5LYJA 4MT8A 4EFBA 1H2NA 1DLBA 2VRZA 5FPRA 4YHHB 4X88A 4JI4O 2XT9A 5JQGA 2ADQB 4XDKA 1YDXA 2QWPB 1QLNA 1SETA 2PUSA 3STZC 1XL6A 1EBOA 4YHHO 1SC5B 5LXTB 1EFRG 5EIBC 4PJ0Z 1K33A 4LBEC 4MVOA 2MK3A 1VQOV 2AGAA 4O2AA 5KHJA 1KUQA 1XMQB 2LJ2A 1JR9A 3OR6C 4CH6A 4I4TB 2XAGA 1BE3H 4A5UB 1VF6A 2IM9A 4IHJA 1WJZA 2GBOA 3UCSC 2GUZB 1GM7A 4X8AA 5IJ0B 3T1CA 1XMQO 3JATB 1Q43A 1I7FA 3N2GA 1RM1C 1YXBA 3ZJZA 1KKCA 1TUEB 4PA4A 2CTWA 4X9QA 1WPBA 4YXWG 4FFBB 1Z5WA 1PP9H 1VQNV 4Z2WA 2EIKB 3K0GA 4C7UA 4O2BA 1IDSA 1QBZA 3ABKB 5CB4B 1L8DA 4ZHQA 3SPGA 4BIUA 5BMVB 3D3QA 4DR1B 2WWWA 2PZSA 1PV0A 4B7KA 3VQVA 3ZRXA 3FB5C 4GKKB 3H01A 2IU0A 3UM7A 2ZE6A 1BHAA 5E79Z 1UFIA 2PYLA 1BZKA 3NXSA 4DR1O 2ZDIC 4R8CA 4GKKO 4DV3B 5GONA 4UB8Z 3OGCC 1NR7A 4F6EA 1NTZH 4FM2A 2RJZA 1PD3A 1Q5OA 1EN6A 1NH2D 4DV4B 3JYCA 4L87A 1M56C 5B3SB 1Q6HA 3JSLA 4DV3O 3HB3B 2DYRC 3J81N 1WLEA 3OMAB 4O2AB 3OGIB 3JD0A 1TUBA 4LNUA 3KKYA 4DV4O 5J9PC 1Q3EA 1NKDA 3SGIA 3OTOB 2CAZC 4IHJB 5JH7B 1V54B 1A32A 4MTXA 2GV9A 4AHCA 2QWOB 3K79A 3ABLB 3N2GB 1YF2A 4JYYA 4CH4A 3OTOO 2XTAA 3QF7A 4KFMA 2L6LA 3CRQA 4RWUA 2R9RB 2VQEB 3ASNC 1MG1A 1JA8A 2JVDA 4TV9A 4JAUA 4O2BB 2W6IG 5EZYA 3FFQA 4D7SA 2VQEO 4QE9A 2OCCC 1NQTA 3ABMC 1N36O 2DWDC 3FKSG 3C3TA 5LOVB 4J41A 4JYBA 3ZHUA 1MOFA 2E5LB 4X66O 1L0LH 1XQ8A 2NR5A 3CCJV 4TSFG 1L0NH 3AK1A 4UB6Z 2CUGA 4OGQB 3RGBA 5GONB 1S77D 5IY5B 3VQWA 4H37A 4NXMB 5GW7A 3RVYA 3OUFA 1NS1A 2N04A 4O4HA 5LMNO 3K08A 5FPOA 3CCEV 1K92A 2A0LA 3K0DA 1Q82W 4UCOA 1TUBB 1MSWD 4ZIBA 4JTAB 4LNUB 2ZT9B 4LFBB 4QE7A 3KZIZ 5DECA 2E74B 2ZD9A 4AQYB 1Q90D 2E76B 3OUSA 1AJPA 1WNSA 1SZTA 4BWAA 1V55C 3AG7A 4LFBO 2M7WA 2BCCH 4CBCA 3TK1A 2EJRA 1GK9A 3CS5A 1JFFA 1FAFA 1XMOB 1KU9A 4AQYO 1QQCA 1YCIA 2X6AA 4ZOLB 2IH3C 4I50A 3CEIA 4TV9B 3FB6C 4KL1A 3JD2A 4F6RA 3D36C 4WFAV 1XMOO 5EZYB 1K9MW 1Q81W 5IYDO 4DR4B 4GYCB 3CRCA 3MD0A 3N2KA 4BAYA 4DYLA 1D2DA 1KYOF 3UQ8A 3OM3B 2DJVA 3ETQA 2OIGA 1MA1A 3OD4A 4P9OA 5LHHA 1LNQA 4UVAA 1O9GA 1JCHA 4YY3B 1PL4A 3K5MA 1VQPV 5LA6A 3FB8C 4R50A 3AK3A 2HHHB 2HP8A 2XHBA 1CP9A 1EN5A 2CGOA 4FZ0A 4LF9B 4O4HB 4E4EA 2YUAA 4YY3O 2P5OA 1IBMO 4K0KB 4ASUG 1GRJA 4JI6B 1HP8A 4R6ZA 5JVDA 1MNGA 4LC1A 4MS2A 2HJDA 4OXSA 2Q67A 3ZHTA 1R6KA 5J2UB 2EIMC 4K0KO 3SJBC 4JI3B 4DXWA 5JJEB 2PGGA 2F66C 5AG2A 4UVCA 5H5NA 4HBNA 1SQVH 3SDLA 4O4JA 1JFFB 1HR0O 2VS0A 3PJSK 3CCVV 1ZX3A 3D3IA 5EBWC 1M56B 4JI3O 4JPRA 5B5EZ 2WPDG 2DYRB 2W6JG 3ABUA 1R1BA 1OCZC 5LGNA 4X64O 1NI8A 1VMGA 3FX7A 4AILC 1AI4A 3N2KB 2Y0IA 5FLXN 2OIEA 2YEVA 1US6A 2Q73A 5CBGA 3I5DA 4GX2A 1HW7A 1MSDA 2WLKA 1M5IA 2O57A 3BABA 3C3SA 4MW8A 1F7YA 1QR9A 3TJTA 5H9CA 1AI5A 2RMKB 5IYZA 3ASNB 2H3OA 3QO5A 3LDCA 4RUEA 3IC9A 2CDYA 2QSAA 4J7KA 2Q68A 1IURA 1FXKC 3GWKC 3E8GA 2A79B 4GKJO 3MHHC 2KG7A 1GN6A 4DUZO 2YICA 3VQXA 1YJ9V 3WB2A 3ML0A 2DOSA 4X20A 5L3GA 3HKEA 4EB6A 1NR1A 1R6NA 5IYCO 1AP5A 3QVNA 3M99B 2ZE5A 2ZKOA 2Q8VA 2X6BA 1H2GA 5KA6A 5CMUA 2LW1A 5B1BC 5EBMC 1HNXB 3P30A 4LFCB 4O4JB 4FVMA 4D6TH 1E1RG 2Q5ZA 2QA4V 4EEQA 3CC4V 4I7ZB 2B1GA 3LDEA 1RPRA 3ZMZA 2E75B 1Z5VA 4P30A 3OE7G 2YC0A 3OEHG 4TQFA 4CS2A 2OYQA 2DQ0A 2ZXWC 2ITDC 3CB2A 4B08A 2XNDG 3ZHQA 3RYCA 3M8AA 2UUCB 1BT8A 2RDCA 1H38A 1N8RW 2BTOA 4PV1B 3ZRSA 1V55B 3L71H 4Q6GA 1SA0B 4MVUA 1KECA 1J95A 4PI0A 1UPGA 3ZMTA 2UUCO 5B1OA 2ZNJA 5IYZB 1TGOA 3CJHA 2WLIA 2HVKC 1E1QG 5KMGA 3CRMA 5BXZA 1PPJH 3CYOA 5FNVB 3RYFA 2KG7B 2QE7G 3JALA 3L9DA 2QTSA 3JAKA 4YJ3A 3HKEB 3TCUA 1QR8A 4QPJA 5LP6C 1WP7A 1YHQV 3CCUV 4FJCC 3UO2A 4GX0A 1N0JA 1VARA 3X2QC 4LWSA 4JI2O 2UXBB 2ZM6B 4NTXA 1K8AW 3W7TA 1CPYA 1EZVH 1GMGA 1Q6UA 2Z0AA 3P32A 3CPWU 1RP3B 4LF7B 2HVJC 4LFAB 1R3IC 2HG5C 1P84F 1M1KW 3CX5F 4X1IA 4QIWF 5KUMA 2JS5A 4LF7O 3F5TA 3JAWA 3K58A 5CA3A 1LUWA 5CA1A 3CHXA 3CXHF 2PI5A 3I56V 4MVZA 1CXZB 3RYCB 4UCSA 2CGNA 4JI0B 4FLWA 3EXAA 5BR8B 5A2QN 2KSDA 4E2LA 4JI5O 3O65A 1VQ5V 2V4DA 3N27A 1YJWV 5K1PA 4JI0O 3HPLC 3HR0A 4CS4A 3JAMN 2QEXV 1N32O 3CJHB 5BR8O 4JI8B 3H1JH 2P22C 4JTCB 3SR2C 3WG7C 2GSMB 2WLIB 1SQBH 1R3JC 1RSOA 3SPIA 1OCZB 1VF7A 4Z1VA 5KMGB 2QM4A 5IWAB 3RYFB 3JALB 3HKBB 1E79G 3JAKB 4XBFA 2KKWA 1FFXA 1EZJA 3ZBHA 3AG4C 1EM1A 2WLNA 4GCZA 1YTFD 2YS8A 3ZN1A 4LWSB 2F43G 3OFNG 3RWRD 2KQXA 5KHHA 4MSWC 1N34B 3VQYA 1GM8A 3G67A 2X6CA 1AR4A 2V1DA 1N34O 4X1IB 2Q7EA 1FXVA 2LFSA 4CH3A 2EINC 5CA1B 3DC5A 1VQLV 5LP6A 3LUTB 3GVMA 2EBOA 3CCQV 1SQQH 3DTUB 1R6TA 1GKFA 3WU2Z 5KLVH 4FLTA 4WFGA 4PDRA 4UUJC 3DXRA 4U7OA 1NTMH 4B3SB 5LYJB 1R73A 1DF4A
chains in the Genus database with same CATH topology
3J81N 1HR0O 5A2QN 1XEQA 4JI5O 3J80N 5LL6Y 3O65A 3J7AU 4JI3O 4YHHO 4LF9O 4DV4O 4B3SO 4B3RO 4LFBO 2UXDO 4JI0O 3M8AA 1R1BA 4LFAO 4X64O 3JAMN 4JI6O 4OX9O 1N32O 4NXMO 2JRIA 2AGAA 5BR8O 2LW7A 4DV5O 1A32A 4AQYO 1KUQA 1HNXO 5FLXN 2N74A 5BY1A 4LFCO 4A5UB 4JV5O 4OPHA 2UUCO 3OTOO 1XNRO 4LF6O 1IBLO 2UU9O 1XMOO 2UUBO 1XMQO 4DR6O 4JI7O 5BXZA 1F7YA 4DR7O 1D2DA 1IBKO 1J5EO 4LF5O 1X59A 2DJVA 3T1HO 4B3MO 1HNWO 2VQEO 4KHPO 4LF4O 1N36O 4LF8O 4DV1O 4GKJO 2FKXA 2F4VO 5IT9N 4JI8O 2UXCO 4JI2O 4DUZO 1G1XB 4X66O 1HNZO 1I94O 2DOSA 4DUYO 1XNQO 1N34O 1AILA 2Z0AA 4DR5O 5IWAO 1FJGO 4DR2O 4DV7O 4JYAO 4B3TO 4YY3O 1AB3A 1IBMO 3T1YO 3RT3C 3R66A 2ZKOA 4DR4O 4JI1O 1YZBA 1N33O 1DK1A 1R6TA 4DR1O 4X65O 4OPAA 1NS1A 4DV2O 4LF7O 3F5TA 4GKKO 5LMNO 4K0KO 4DV6O 5LMUO 4DR3O 1FYJA 4JI4O 2UUAO 2VQFO 5H5NA 4NXNO 4DV0O 3SDLA 4X62O 4DV3O 2UXBO 2HHHO 2ZM6O 2E5LO 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 N;  1HR0 O;  5A2Q N;  1XEQ A;  4JI5 O;  3J80 N;  5LL6 Y;  3O65 A;  3J7A U;  4JI3 O;  4YHH O;  4LF9 O;  4DV4 O;  4B3S O;  4B3R O;  4LFB O;  2UXD O;  4JI0 O;  3M8A A;  1R1B A;  4LFA O;  4X64 O;  3JAM N;  4JI6 O;  4OX9 O;  1N32 O;  4NXM O;  2JRI A;  2AGA A;  5BR8 O;  2LW7 A;  4DV5 O;  1A32 A;  4AQY O;  1KUQ A;  1HNX O;  5FLX N;  2N74 A;  5BY1 A;  4LFC O;  4A5U B;  4JV5 O;  4OPH A;  2UUC O;  3OTO O;  1XNR O;  4LF6 O;  1IBL O;  2UU9 O;  1XMO O;  2UUB O;  1XMQ O;  4DR6 O;  4JI7 O;  5BXZ A;  1F7Y A;  4DR7 O;  1D2D A;  1IBK O;  1J5E O;  4LF5 O;  1X59 A;  2DJV A;  3T1H O;  4B3M O;  1HNW O;  2VQE O;  4KHP O;  4LF4 O;  1N36 O;  4LF8 O;  4DV1 O;  4GKJ O;  2FKX A;  2F4V O;  5IT9 N;  4JI8 O;  2UXC O;  4JI2 O;  4DUZ O;  1G1X B;  4X66 O;  1HNZ O;  1I94 O;  2DOS A;  4DUY O;  1XNQ O;  1N34 O;  1AIL A;  2Z0A A;  4DR5 O;  5IWA O;  1FJG O;  4DR2 O;  4DV7 O;  4JYA O;  4B3T O;  4YY3 O;  1AB3 A;  1IBM O;  3T1Y O;  3RT3 C;  3R66 A;  2ZKO A;  4DR4 O;  4JI1 O;  1YZB A;  1N33 O;  1DK1 A;  1R6T A;  4DR1 O;  4X65 O;  4OPA A;  1NS1 A;  4DV2 O;  4LF7 O;  3F5T A;  4GKK O;  5LMN O;  4K0K O;  4DV6 O;  5LMU O;  4DR3 O;  1FYJ A;  4JI4 O;  2UUA O;  2VQF O;  5H5N A;  4NXN O;  4DV0 O;  3SDL A;  4X62 O;  4DV3 O;  2UXB O;  2HHH O;  2ZM6 O;  2E5L O;  1FKA O; 
#chains in the Genus database with same CATH topology
 1SER A;  4W4L A;  4I55 A;  5JQG B;  4YIP A;  4RQE A;  4B3S O;  4LR3 A;  1S0V A;  4JV5 B;  4L8J A;  1VQ6 V;  2ZXW B;  2JRI A;  2GDS A;  2WLJ A;  2LFR A;  1FFX B;  2W0F C;  4DR6 B;  2YIB D;  1IBK B;  4JV5 O;  1S5L Z;  2ZIM A;  4B3M B;  5KAI Z;  1XHZ A;  4DO2 A;  4DR6 O;  1P49 A;  4QNH B;  5L3D A;  1IBK O;  1AI6 A;  3BEH A;  2JEX A;  1Q86 W;  4FLV A;  1YIJ V;  1B04 A;  4B3M O;  1YJN V;  4DUY B;  2JGD A;  3BY6 A;  2CH7 A;  2EUL A;  2JK5 C;  3E8F A;  4DR2 B;  4WBN A;  2VQF B;  1K73 W;  5LP6 B;  4LH7 A;  1G1X B;  2QWQ B;  2WA4 A;  4DUY O;  1XIL A;  4G28 B;  2Y4T A;  2BTQ A;  2YSU B;  3IFX A;  3X2Q B;  4X65 B;  4DR2 O;  2HKO A;  3A2F A;  3ZMS A;  3JD1 A;  2IJI A;  3RT3 C;  4WCE V;  4ZHQ B;  2AW9 A;  3DXR B;  2F93 B;  2P6J A;  3W7W A;  1FS0 G;  2D2C B;  3VBB A;  4X65 O;  4RUF A;  2P7T C;  3M7M X;  1XNR B;  2RN9 A;  1K5Q A;  4K3A A;  1OV9 A;  4I55 B;  3BAA A;  3OT7 A;  3BHP A;  4WF9 V;  1IX9 A;  4B3R B;  1SES A;  5J2T A;  4DR7 B;  3BVO A;  2E5L O;  3ASO C;  3SJA C;  1GO3 F;  1F23 A;  4H44 B;  4BR6 A;  3F7Y C;  3T2M A;  4KHP B;  4B3R O;  3B40 A;  4TOI A;  1O9H A;  4NXM O;  1S5J A;  2AZ2 A;  3ZED A;  4O4I A;  2VWK A;  3K9S A;  2QGN A;  4FIP C;  5CBF A;  3WG7 B;  3FD9 A;  3AG1 C;  3TGU H;  5JJN B;  3GB7 C;  4NVP A;  5EBL C;  1R3L C;  1Y4M A;  2P67 A;  1SKV A;  2ZDI A;  2JGD B;  2ADP A;  2CH7 B;  1SQF A;  4J42 A;  4WBN B;  2YDE A;  2IBZ H;  3TXS A;  2FML A;  3G4S V;  3AG4 B;  1OHH G;  5C93 A;  1CEZ A;  2BTQ B;  3OMI B;  1I0H A;  4MW3 A;  1FJG B;  4JZG A;  4JYA B;  3AK2 A;  2FKX A;  2YXH A;  1M57 C;  1IXM A;  2NN4 A;  2JJ2 G;  4CH5 A;  3ETD A;  4J11 A;  3K06 A;  5D5Q A;  1FJG O;  3DGE A;  1WA8 A;  3K57 A;  4JYA O;  4ZI7 A;  3I55 V;  5LMU B;  1F51 A;  5KUK A;  3K59 A;  1RM1 B;  1ZLZ A;  4DR4 O;  4DR3 B;  1OCO C;  4JAA A;  2H8P C;  2BSK A;  3E8H A;  4F4L A;  1XUQ A;  3SYO A;  3G6B A;  2EIN B;  4MTF A;  4NTW A;  4NKG B;  5J2T B;  1WAZ A;  1DTO A;  3K3W A;  1BQ0 A;  5LMU O;  3DC6 A;  2FL4 A;  1GH6 A;  3DSQ A;  1BS3 A;  4UCV A;  1G6U A;  5EYP A;  4DR3 O;  1PM9 A;  2UUB B;  1B6Q A;  3T4Z A;  4ABM A;  3A0H Z;  1KC8 W;  1OCC C;  2HHH O;  1FXH A;  3T1H B;  3E35 A;  4O4I B;  1KKD A;  4LF9 O;  3B8N A;  2CE4 A;  2NLJ C;  4JI6 O;  4JYC A;  4PA3 A;  1MMM A;  2FB5 A;  2EJ7 A;  2YID A;  5KA5 A;  4MVS A;  2Q6A A;  1H2K A;  3K5N A;  4ZKI A;  4PDL A;  1XOU A;  4IYH A;  2IJH A;  3L73 H;  4I50 B;  4YJ2 A;  1H2L A;  1N33 B;  1G4Y B;  4F6R B;  3P3P A;  2F4V B;  1M93 A;  2DYS C;  5KX5 A;  3MDS A;  3SJC C;  1DGS A;  1RPO A;  4QJF B;  1XNQ B;  4UCT A;  4Z1M G;  1SS3 A;  4WFB V;  4B7E A;  1WA8 B;  3SYC A;  4XDL A;  2F4V O;  1K5S A;  3T1Y B;  2A3Q A;  4FLX A;  3CRA A;  3UT5 A;  4I9Q A;  1H8E G;  2BSK B;  1XNQ O;  5JJJ B;  1W0K G;  3AG2 C;  4IYI A;  4X89 A;  1K3E A;  4MVR A;  5LA6 B;  3T1Y O;  1B3Q A;  4IL6 Z;  2ATK C;  1YZB A;  4CC6 A;  4D7T A;  3D36 A;  2XAH A;  2UUA B;  3SJQ C;  4WFH A;  3ZHS A;  3H1L H;  2DN9 A;  2OCC B;  2FTK A;  5JVD B;  3ABM B;  1JOY A;  1WN7 A;  3OTF A;  2Q0A A;  3A0R A;  3ICX A;  1FYJ A;  2UUA O;  1Y67 A;  5LHG A;  4R7C A;  5GTI Z;  2P06 A;  4LF5 B;  2DWE C;  3U11 A;  5H2F Z;  1WB7 A;  2BE3 A;  4W4K A;  1SZX A;  2ZR2 A;  3ZHV A;  4BIZ A;  1S76 D;  3ZCC A;  2GTS A;  1VQ4 V;  2L35 A;  2UU9 B;  3BCC H;  4UFZ A;  4QPK A;  2LW7 A;  4HNA A;  4YJ2 B;  1I94 B;  1Q8I A;  4TV8 A;  1HNX O;  4LFC O;  4NB5 A;  1BQZ A;  1VF5 B;  1XHX A;  2IJK A;  3LSQ A;  2ZIN A;  1XL4 A;  5KX5 B;  3S3X A;  4FM0 A;  2UU9 O;  4K8X A;  1HNW B;  3AG1 B;  1R3K C;  1HDJ A;  2RCV A;  2YEV B;  5DED A;  2QR4 A;  1M90 W;  4TWK A;  1NVP D;  5GTH Z;  1VQK V;  1HNW O;  1U97 A;  2KB1 A;  1ZTE A;  5KHK A;  5HFM A;  1KQS U;  3A8T A;  4DR5 B;  1T5E A;  4U3J A;  5IT9 N;  3AEI A;  1BGY H;  1Y66 A;  2A06 H;  5LGU A;  2A7W A;  1F4M A;  1M57 B;  1K4C C;  4DR5 O;  2YI8 A;  1W59 A;  4I0X A;  4U7N A;  3CE2 A;  1XBL A;  1D5A A;  3ZHR A;  4DV6 B;  4JF3 A;  4X20 B;  2WLL A;  4EB6 B;  2PYJ A;  4FLZ A;  4EFE A;  2NNU A;  1VQM V;  1V54 C;  2CTQ A;  2JIZ G;  2YIB A;  4DV0 B;  2QKA A;  2HEP A;  2PTM A;  4DV6 O;  3APQ A;  3SPJ A;  3BFR A;  3SPC A;  4P2Z A;  1TA8 A;  3TET A;  3E22 A;  1WP8 A;  3LSU A;  5LXT A;  4JI7 B;  4DV0 O;  3K04 A;  4PA6 A;  4PDM A;  2UXB O;  4BW5 A;  2ZM6 O;  4IIJ A;  2QTO A;  1FXK A;  4HNA B;  3EFF K;  4MVQ A;  1OCC B;  1YVW A;  4TV8 B;  1Y74 A;  1JJO A;  3AG3 C;  4LFA O;  5ITZ A;  1OCR C;  2JGU A;  3OR7 C;  2RNB A;  3LNM B;  2K9P A;  2EIM B;  3FYE B;  1S72 V;  2GUZ A;  4JAS A;  1URF A;  1PL0 A;  4XDJ A;  4HZ3 A;  2N05 A;  3CMA V;  1J5E B;  1KD1 W;  1JMK C;  1ZL8 A;  1QHT A;  2UXN A;  2OWO A;  2CK3 G;  4X1Y A;  1GN3 A;  5BZB A;  1MZE A;  4JI1 B;  2D3O W;  4LF8 B;  3OEE G;  3K9A A;  1J5E O;  5EK0 A;  4UCU A;  5A9G A;  2ZIO A;  1HWY A;  3G6E V;  4J80 A;  2UXC B;  2XUM A;  2WLM A;  4GT1 A;  2BOC C;  1XI1 A;  1MZF A;  2DYS B;  4LF8 O;  1ZAU A;  4H13 B;  4NR1 A;  3S3W A;  4I0X B;  4DV7 B;  2QM8 A;  4B3T B;  1P7G A;  3H1H H;  1H2S B;  4YJ3 B;  4JI8 O;  3CD6 V;  2UXC O;  3B8M A;  2PI4 A;  3FYI B;  4EKW A;  2WLL B;  2QDO A;  1NH2 B;  2P90 A;  4GX1 A;  1AIL A;  4BIO A;  5IWA O;  1D5N A;  4DV7 O;  4B3T O;  4JZ2 A;  4J7J A;  1ZWI C;  3G71 V;  3AG2 B;  3OAA G;  2EIL C;  3E22 B;  4Q20 A;  1IZ3 A;  3STL C;  4AI8 A;  1UJW B;  4N23 A;  1I5Y A;  4IIJ B;  2OT5 A;  2Q7G A;  1FXK B;  2DE0 X;  4GUN A;  1B06 A;  1Y74 B;  3RN4 A;  5FL7 G;  3JAW B;  2W0X A;  2JDI G;  3K03 A;  2HR3 A;  5ITZ B;  3CCM V;  1LR1 A;  4FMT A;  3THO A;  5JH7 A;  3L74 H;  1MAB G;  1IXB A;  2R9A A;  2XAJ A;  4DK0 A;  2DMX A;  1SRY A;  1ZL8 B;  4LH6 A;  5B1B B;  1P7B A;  1SQG A;  5D5P A;  5L3E A;  4X1Y B;  3CCL V;  4FLU A;  4UV8 A;  3MAQ A;  2N74 A;  5BY1 A;  5CN0 A;  3RYH A;  2ITC C;  1YSC A;  2YXL A;  4GLX A;  1RSO B;  2GTA A;  1K97 A;  2OCH A;  2R9I A;  2HJF C;  1GAX A;  1H8H G;  1FFT B;  5LOV A;  1M9N A;  4O4L A;  3BA9 A;  4G27 B;  4BW9 A;  1JX9 A;  4FM1 A;  5B1N A;  1AI7 A;  2DW4 A;  5IJ9 A;  1VQ8 V;  1VQ7 V;  2QKS A;  4DV2 B;  1THZ A;  4PA7 A;  3L75 H;  2B5U A;  4GX5 A;  1AR1 B;  3IJ4 A;  4OPA A;  1PNL A;  4DV2 O;  1Q6I A;  4X62 B;  1M4U A;  3JCZ A;  1IVS A;  1V9P A;  3B2E E;  1FPO A;  1P4R A;  2OTL V;  4CC5 A;  2VQF O;  2UXD B;  1F4N A;  2F95 B;  3CSX A;  4CZZ A;  4X62 O;  4J10 A;  1QLE C;  1GN4 A;  3J80 N;  1N0N A;  1ZSP A;  4ZOL A;  4H0L B;  3QNE A;  1COW G;  3RYH B;  1N36 B;  3LNN A;  2UXD O;  4WFE A;  1LUV A;  5DN6 G;  1AJN A;  3F5W C;  3ZMV A;  3ZN0 A;  2Y4U A;  1NTK H;  1PNM A;  1NU1 H;  4X66 B;  3AG3 B;  4TQD A;  2P4V A;  1OCR B;  4OPH A;  1XNR O;  2C2A A;  4PI2 A;  4IT5 A;  4O4L B;  1BCC H;  3CXC U;  2IJJ A;  5IDJ A;  3LDD A;  2UXX A;  4DR7 O;  1ORQ C;  2RQ6 A;  3SYA A;  4NTY A;  2QM7 A;  5LMN B;  5IJ9 B;  1DF5 A;  3K5L A;  4KHP O;  2CTP A;  1KMI Z;  1QCE A;  2ODM A;  3U10 A;  1JQ0 A;  3SYQ A;  3BA8 A;  3LSS A;  1RFY A;  3ZMU A;  3FB7 C;  3O9O A;  2F23 A;  3OMN B;  2IW5 A;  2ZQM A;  2QJ1 A;  2ZE7 A;  2ZCE A;  3IC7 A;  4FFK A;  3NR7 A;  1AB3 A;  3HKC A;  3T4D A;  2XAQ A;  1QU7 A;  2Y0P A;  3A0B Z;  4DW0 A;  5J2U A;  5CA0 A;  2XAS A;  5B66 Z;  2K1E A;  5B1A C;  2FYU H;  1DK1 A;  2LP7 A;  5L3B A;  2EIL B;  3GWO A;  4FK5 C;  4DRX A;  4HYO A;  3WB0 A;  2E3C A;  3E2E A;  2DQ3 A;  4H33 A;  2Q0O C;  1JPX A;  3JAR A;  2WSS G;  4RAI A;  1FKA O;  1ENV A;  3ETE A;  1KBH A;  2Q69 A;  1XEQ A;  3E83 A;  4PEL A;  4DV5 B;  1U96 A;  3HKD A;  1Q7Y W;  5LL6 Y;  3J7A U;  4FZ1 A;  3JSN A;  3QG5 A;  4MTO A;  2X7R B;  1I08 A;  1WB8 A;  3ZRW A;  5DM6 V;  1X4T A;  1PNK A;  5LGT A;  2JJ1 G;  4DV5 O;  3APO A;  3KCY A;  1NZ6 A;  3W7U A;  1ROP A;  5KHG A;  2X0L A;  2ZR3 A;  2QWN B;  3EVK A;  3B09 A;  4UVB A;  4J9Z B;  3RYI A;  2G38 A;  2H94 A;  2Y69 C;  3U0Z A;  4PDV A;  1IBM B;  5C8Y A;  1OJH A;  2UUB O;  3BPZ A;  4LF4 B;  3SYP A;  4HAM A;  4PD4 F;  1NJI W;  2YIA A;  1SQX H;  3FAV A;  3ABT A;  3H9V A;  3KCX A;  4P9P A;  4MVM A;  3T1H O;  2AHZ A;  1JVM A;  3CRR A;  4MTG A;  4UV9 A;  1HNZ B;  3QTC A;  4LF4 O;  4ZBM A;  2P4K A;  1W2B U;  3JAS A;  1VP7 A;  4QGP A;  3E89 A;  4KXR A;  3HKC B;  3ZS8 C;  2EIJ C;  3ZX6 A;  3D8C A;  1YI2 V;  2XAF A;  5CA0 B;  5EC2 C;  1L1F A;  2HLD G;  1HNZ O;  1AR5 A;  1HR0 B;  3H1I H;  3BRC A;  3MHS C;  1PKX A;  5L3C A;  4YIO A;  4KP4 A;  4RO2 A;  1BHB A;  1Z2G A;  4DRX B;  4X64 B;  5EIB D;  1BMF G;  4FPP A;  1QVF U;  4ICG A;  1N33 O;  1Y76 A;  5E1A C;  3RBZ A;  2MW2 B;  4ZI7 B;  3JAR B;  2IH1 C;  4CS3 A;  1VQ9 V;  3W7S A;  3JD3 A;  1ZUQ A;  2IU3 A;  1NVP B;  2LO1 A;  4JGS A;  3QO7 A;  3W7X A;  3HKD B;  3UO3 A;  2WLH A;  1H2M A;  3P3N A;  2ARH A;  1AJQ A;  1I5X A;  3ZRW B;  2JEU A;  3K5O A;  1GN2 A;  1GTO A;  5EC1 C;  3IAY A;  5EYP B;  1QVG U;  2CTR A;  1SA0 A;  2F1M A;  3RYI B;  1TAE A;  1QLE B;  2XOK G;  1SF9 A;  4GKJ B;  5C8Y B;  4DUZ B;  5JCO C;  1VIB A;  3CC7 V;  4NYK A;  1KP2 A;  3JD4 A;  2Z5U A;  2R72 A;  3TXQ A;  4LP8 A;  2EZO A;  3FAV B;  3ZRV A;  2HFE C;  2YI9 A;  2R70 A;  4PA9 A;  5FNV A;  3B4S A;  1K34 A;  3RVZ A;  2AHY A;  4I5S A;  3RW0 A;  5HFL A;  3ASO B;  3JAS B;  1XRE A;  1YIT V;  2WA3 A;  4LF5 O;  2Y48 A;  2AXT Z;  5JWP A;  4DW1 A;  5H6R A;  2EIK C;  4JTD B;  3ABK C;  3L70 H;  5CBH A;  3IGA C;  3RFR A;  1EN4 A;  3EHB B;  2PF4 E;  2V7Q G;  4J7Z A;  1I94 O;  2YXY A;  4G2K A;  1Y76 B;  3VOU A;  5IE9 A;  4WFF A;  4X1K A;  2Q4P A;  4U3F H;  4FLY A;  2Z3Y A;  3UT5 B;  2JS3 A;  3R66 A;  4RQF A;  4UCR A;  1JJ2 U;  1K7D A;  1KB9 F;  4PHZ A;  3CWB H;  5K1X A;  2VWJ A;  4TUY A;  1OZ0 A;  1N4C A;  1AVM A;  1G8M A;  3C90 A;  4NXN B;  3H1K H;  3Q4H A;  5B1A B;  3F7V C;  5IYB O;  5B3S C;  2QKC A;  2QWR B;  5LHI A;  1GM9 A;  1WPX A;  1QNM A;  4K35 A;  4NXN O;  4TT3 G;  4N21 A;  3B77 A;  2GHY A;  1TVK A;  4OX9 B;  4IGG A;  1FD9 A;  1W0J G;  1VF6 C;  3G80 A;  4JAV A;  1S5H C;  3JCU Z;  2OTJ V;  1XDC A;  3SPH A;  1YTF B;  3L72 H;  1OCO B;  2ZNI A;  4UXN A;  4LF6 B;  1SQP H;  2B1I A;  4OX9 O;  5LBQ A;  1IBL B;  3ABL C;  1YEW A;  3ETG A;  3HKB A;  2LGQ A;  4JI2 B;  1S3J A;  2LGW A;  2ILM A;  2PY5 A;  3CP1 A;  1AP6 A;  1KP3 A;  4LF6 O;  2M6Y A;  5KAF Z;  1IBL O;  3QO8 A;  2AZ0 A;  3WB1 A;  2BOB C;  3OW2 U;  2Y69 B;  1BSM A;  5TIS Z;  4JI7 O;  2Q9L A;  4I4T A;  4DV1 B;  1X59 A;  5JCO A;  3WFV A;  1NBM G;  2ETN A;  5L3F A;  4I9W A;  1ARO P;  2B9Z A;  5IJ0 A;  2WAM A;  1BL8 A;  3JAT A;  4X1K B;  4DV1 O;  2EZP A;  3CC2 V;  2A9H A;  3ZIA G;  4DK1 A;  5KHI A;  4LCU C;  2LQT A;  1K4D C;  4JI5 B;  5IY5 C;  1Y6X A;  3E8B A;  5F2V O;  4K8Z A;  4FFB A;  4J9Y B;  4KUM A;  2EIJ B;  3R65 A;  4TUY B;  3UKM A;  4U3J B;  2ZE8 A;  4GZR B;  5H6Q A;  3PN1 A;  3Q4H B;  3CCR V;  1N32 B;  4JI1 O;  5CB4 A;  3KG2 A;  3CCS V;  5BMV A;  4JI4 B;  3E86 A;  3CME V;  1VEW A;  1NT2 B;  2Q7H A;  1TVK B;  2EX3 A;  5LYJ A;  4MT8 A;  4EFB A;  1H2N A;  1DLB A;  2VRZ A;  5FPR A;  4YHH B;  4X88 A;  4JI4 O;  2XT9 A;  5JQG A;  2ADQ B;  4XDK A;  1YDX A;  2QWP B;  1QLN A;  1SET A;  2PUS A;  3STZ C;  1XL6 A;  1EBO A;  4YHH O;  1SC5 B;  5LXT B;  1EFR G;  5EIB C;  4PJ0 Z;  1K33 A;  4LBE C;  4MVO A;  2MK3 A;  1VQO V;  2AGA A;  4O2A A;  5KHJ A;  1KUQ A;  1XMQ B;  2LJ2 A;  1JR9 A;  3OR6 C;  4CH6 A;  4I4T B;  2XAG A;  1BE3 H;  4A5U B;  1VF6 A;  2IM9 A;  4IHJ A;  1WJZ A;  2GBO A;  3UCS C;  2GUZ B;  1GM7 A;  4X8A A;  5IJ0 B;  3T1C A;  1XMQ O;  3JAT B;  1Q43 A;  1I7F A;  3N2G A;  1RM1 C;  1YXB A;  3ZJZ A;  1KKC A;  1TUE B;  4PA4 A;  2CTW A;  4X9Q A;  1WPB A;  4YXW G;  4FFB B;  1Z5W A;  1PP9 H;  1VQN V;  4Z2W A;  2EIK B;  3K0G A;  4C7U A;  4O2B A;  1IDS A;  1QBZ A;  3ABK B;  5CB4 B;  1L8D A;  4ZHQ A;  3SPG A;  4BIU A;  5BMV B;  3D3Q A;  4DR1 B;  2WWW A;  2PZS A;  1PV0 A;  4B7K A;  3VQV A;  3ZRX A;  3FB5 C;  4GKK B;  3H01 A;  2IU0 A;  3UM7 A;  2ZE6 A;  1BHA A;  5E79 Z;  1UFI A;  2PYL A;  1BZK A;  3NXS A;  4DR1 O;  2ZDI C;  4R8C A;  4GKK O;  4DV3 B;  5GON A;  4UB8 Z;  3OGC C;  1NR7 A;  4F6E A;  1NTZ H;  4FM2 A;  2RJZ A;  1PD3 A;  1Q5O A;  1EN6 A;  1NH2 D;  4DV4 B;  3JYC A;  4L87 A;  1M56 C;  5B3S B;  1Q6H A;  3JSL A;  4DV3 O;  3HB3 B;  2DYR C;  3J81 N;  1WLE A;  3OMA B;  4O2A B;  3OGI B;  3JD0 A;  1TUB A;  4LNU A;  3KKY A;  4DV4 O;  5J9P C;  1Q3E A;  1NKD A;  3SGI A;  3OTO B;  2CAZ C;  4IHJ B;  5JH7 B;  1V54 B;  1A32 A;  4MTX A;  2GV9 A;  4AHC A;  2QWO B;  3K79 A;  3ABL B;  3N2G B;  1YF2 A;  4JYY A;  4CH4 A;  3OTO O;  2XTA A;  3QF7 A;  4KFM A;  2L6L A;  3CRQ A;  4RWU A;  2R9R B;  2VQE B;  3ASN C;  1MG1 A;  1JA8 A;  2JVD A;  4TV9 A;  4JAU A;  4O2B B;  2W6I G;  5EZY A;  3FFQ A;  4D7S A;  2VQE O;  4QE9 A;  2OCC C;  1NQT A;  3ABM C;  1N36 O;  2DWD C;  3FKS G;  3C3T A;  5LOV B;  4J41 A;  4JYB A;  3ZHU A;  1MOF A;  2E5L B;  4X66 O;  1L0L H;  1XQ8 A;  2NR5 A;  3CCJ V;  4TSF G;  1L0N H;  3AK1 A;  4UB6 Z;  2CUG A;  4OGQ B;  3RGB A;  5GON B;  1S77 D;  5IY5 B;  3VQW A;  4H37 A;  4NXM B;  5GW7 A;  3RVY A;  3OUF A;  1NS1 A;  2N04 A;  4O4H A;  5LMN O;  3K08 A;  5FPO A;  3CCE V;  1K92 A;  2A0L A;  3K0D A;  1Q82 W;  4UCO A;  1TUB B;  1MSW D;  4ZIB A;  4JTA B;  4LNU B;  2ZT9 B;  4LFB B;  4QE7 A;  3KZI Z;  5DEC A;  2E74 B;  2ZD9 A;  4AQY B;  1Q90 D;  2E76 B;  3OUS A;  1AJP A;  1WNS A;  1SZT A;  4BWA A;  1V55 C;  3AG7 A;  4LFB O;  2M7W A;  2BCC H;  4CBC A;  3TK1 A;  2EJR A;  1GK9 A;  3CS5 A;  1JFF A;  1FAF A;  1XMO B;  1KU9 A;  4AQY O;  1QQC A;  1YCI A;  2X6A A;  4ZOL B;  2IH3 C;  4I50 A;  3CEI A;  4TV9 B;  3FB6 C;  4KL1 A;  3JD2 A;  4F6R A;  3D36 C;  4WFA V;  1XMO O;  5EZY B;  1K9M W;  1Q81 W;  5IYD O;  4DR4 B;  4GYC B;  3CRC A;  3MD0 A;  3N2K A;  4BAY A;  4DYL A;  1D2D A;  1KYO F;  3UQ8 A;  3OM3 B;  2DJV A;  3ETQ A;  2OIG A;  1MA1 A;  3OD4 A;  4P9O A;  5LHH A;  1LNQ A;  4UVA A;  1O9G A;  1JCH A;  4YY3 B;  1PL4 A;  3K5M A;  1VQP V;  5LA6 A;  3FB8 C;  4R50 A;  3AK3 A;  2HHH B;  2HP8 A;  2XHB A;  1CP9 A;  1EN5 A;  2CGO A;  4FZ0 A;  4LF9 B;  4O4H B;  4E4E A;  2YUA A;  4YY3 O;  2P5O A;  1IBM O;  4K0K B;  4ASU G;  1GRJ A;  4JI6 B;  1HP8 A;  4R6Z A;  5JVD A;  1MNG A;  4LC1 A;  4MS2 A;  2HJD A;  4OXS A;  2Q67 A;  3ZHT A;  1R6K A;  5J2U B;  2EIM C;  4K0K O;  3SJB C;  4JI3 B;  4DXW A;  5JJE B;  2PGG A;  2F66 C;  5AG2 A;  4UVC A;  5H5N A;  4HBN A;  1SQV H;  3SDL A;  4O4J A;  1JFF B;  1HR0 O;  2VS0 A;  3PJS K;  3CCV V;  1ZX3 A;  3D3I A;  5EBW C;  1M56 B;  4JI3 O;  4JPR A;  5B5E Z;  2WPD G;  2DYR B;  2W6J G;  3ABU A;  1R1B A;  1OCZ C;  5LGN A;  4X64 O;  1NI8 A;  1VMG A;  3FX7 A;  4AIL C;  1AI4 A;  3N2K B;  2Y0I A;  5FLX N;  2OIE A;  2YEV A;  1US6 A;  2Q73 A;  5CBG A;  3I5D A;  4GX2 A;  1HW7 A;  1MSD A;  2WLK A;  1M5I A;  2O57 A;  3BAB A;  3C3S A;  4MW8 A;  1F7Y A;  1QR9 A;  3TJT A;  5H9C A;  1AI5 A;  2RMK B;  5IYZ A;  3ASN B;  2H3O A;  3QO5 A;  3LDC A;  4RUE A;  3IC9 A;  2CDY A;  2QSA A;  4J7K A;  2Q68 A;  1IUR A;  1FXK C;  3GWK C;  3E8G A;  2A79 B;  4GKJ O;  3MHH C;  2KG7 A;  1GN6 A;  4DUZ O;  2YIC A;  3VQX A;  1YJ9 V;  3WB2 A;  3ML0 A;  2DOS A;  4X20 A;  5L3G A;  3HKE A;  4EB6 A;  1NR1 A;  1R6N A;  5IYC O;  1AP5 A;  3QVN A;  3M99 B;  2ZE5 A;  2ZKO A;  2Q8V A;  2X6B A;  1H2G A;  5KA6 A;  5CMU A;  2LW1 A;  5B1B C;  5EBM C;  1HNX B;  3P30 A;  4LFC B;  4O4J B;  4FVM A;  4D6T H;  1E1R G;  2Q5Z A;  2QA4 V;  4EEQ A;  3CC4 V;  4I7Z B;  2B1G A;  3LDE A;  1RPR A;  3ZMZ A;  2E75 B;  1Z5V A;  4P30 A;  3OE7 G;  2YC0 A;  3OEH G;  4TQF A;  4CS2 A;  2OYQ A;  2DQ0 A;  2ZXW C;  2ITD C;  3CB2 A;  4B08 A;  2XND G;  3ZHQ A;  3RYC A;  3M8A A;  2UUC B;  1BT8 A;  2RDC A;  1H38 A;  1N8R W;  2BTO A;  4PV1 B;  3ZRS A;  1V55 B;  3L71 H;  4Q6G A;  1SA0 B;  4MVU A;  1KEC A;  1J95 A;  4PI0 A;  1UPG A;  3ZMT A;  2UUC O;  5B1O A;  2ZNJ A;  5IYZ B;  1TGO A;  3CJH A;  2WLI A;  2HVK C;  1E1Q G;  5KMG A;  3CRM A;  5BXZ A;  1PPJ H;  3CYO A;  5FNV B;  3RYF A;  2KG7 B;  2QE7 G;  3JAL A;  3L9D A;  2QTS A;  3JAK A;  4YJ3 A;  3HKE B;  3TCU A;  1QR8 A;  4QPJ A;  5LP6 C;  1WP7 A;  1YHQ V;  3CCU V;  4FJC C;  3UO2 A;  4GX0 A;  1N0J A;  1VAR A;  3X2Q C;  4LWS A;  4JI2 O;  2UXB B;  2ZM6 B;  4NTX A;  1K8A W;  3W7T A;  1CPY A;  1EZV H;  1GMG A;  1Q6U A;  2Z0A A;  3P32 A;  3CPW U;  1RP3 B;  4LF7 B;  2HVJ C;  4LFA B;  1R3I C;  2HG5 C;  1P84 F;  1M1K W;  3CX5 F;  4X1I A;  4QIW F;  5KUM A;  2JS5 A;  4LF7 O;  3F5T A;  3JAW A;  3K58 A;  5CA3 A;  1LUW A;  5CA1 A;  3CHX A;  3CXH F;  2PI5 A;  3I56 V;  4MVZ A;  1CXZ B;  3RYC B;  4UCS A;  2CGN A;  4JI0 B;  4FLW A;  3EXA A;  5BR8 B;  5A2Q N;  2KSD A;  4E2L A;  4JI5 O;  3O65 A;  1VQ5 V;  2V4D A;  3N27 A;  1YJW V;  5K1P A;  4JI0 O;  3HPL C;  3HR0 A;  4CS4 A;  3JAM N;  2QEX V;  1N32 O;  3CJH B;  5BR8 O;  4JI8 B;  3H1J H;  2P22 C;  4JTC B;  3SR2 C;  3WG7 C;  2GSM B;  2WLI B;  1SQB H;  1R3J C;  1RSO A;  3SPI A;  1OCZ B;  1VF7 A;  4Z1V A;  5KMG B;  2QM4 A;  5IWA B;  3RYF B;  3JAL B;  3HKB B;  1E79 G;  3JAK B;  4XBF A;  2KKW A;  1FFX A;  1EZJ A;  3ZBH A;  3AG4 C;  1EM1 A;  2WLN A;  4GCZ A;  1YTF D;  2YS8 A;  3ZN1 A;  4LWS B;  2F43 G;  3OFN G;  3RWR D;  2KQX A;  5KHH A;  4MSW C;  1N34 B;  3VQY A;  1GM8 A;  3G67 A;  2X6C A;  1AR4 A;  2V1D A;  1N34 O;  4X1I B;  2Q7E A;  1FXV A;  2LFS A;  4CH3 A;  2EIN C;  5CA1 B;  3DC5 A;  1VQL V;  5LP6 A;  3LUT B;  3GVM A;  2EBO A;  3CCQ V;  1SQQ H;  3DTU B;  1R6T A;  1GKF A;  3WU2 Z;  5KLV H;  4FLT A;  4WFG A;  4PDR A;  4UUJ C;  3DXR A;  4U7O A;  1NTM H;  4B3S B;  5LYJ B;  1R73 A;  1DF4 A; 
#chains in the Genus database with same CATH homology
 3J81 N;  1HR0 O;  5A2Q N;  1XEQ A;  4JI5 O;  3J80 N;  5LL6 Y;  3O65 A;  3J7A U;  4JI3 O;  4YHH O;  4LF9 O;  4DV4 O;  4B3S O;  4B3R O;  4LFB O;  2UXD O;  4JI0 O;  3M8A A;  1R1B A;  4LFA O;  4X64 O;  3JAM N;  4JI6 O;  4OX9 O;  1N32 O;  4NXM O;  2JRI A;  2AGA A;  5BR8 O;  2LW7 A;  4DV5 O;  1A32 A;  4AQY O;  1KUQ A;  1HNX O;  5FLX N;  2N74 A;  5BY1 A;  4LFC O;  4A5U B;  4JV5 O;  4OPH A;  2UUC O;  3OTO O;  1XNR O;  4LF6 O;  1IBL O;  2UU9 O;  1XMO O;  2UUB O;  1XMQ O;  4DR6 O;  4JI7 O;  5BXZ A;  1F7Y A;  4DR7 O;  1D2D A;  1IBK O;  1J5E O;  4LF5 O;  1X59 A;  2DJV A;  3T1H O;  4B3M O;  1HNW O;  2VQE O;  4KHP O;  4LF4 O;  1N36 O;  4LF8 O;  4DV1 O;  4GKJ O;  2FKX A;  2F4V O;  5IT9 N;  4JI8 O;  2UXC O;  4JI2 O;  4DUZ O;  1G1X B;  4X66 O;  1HNZ O;  1I94 O;  2DOS A;  4DUY O;  1XNQ O;  1N34 O;  1AIL A;  2Z0A A;  4DR5 O;  5IWA O;  1FJG O;  4DR2 O;  4DV7 O;  4JYA O;  4B3T O;  4YY3 O;  1AB3 A;  1IBM O;  3T1Y O;  3RT3 C;  3R66 A;  2ZKO A;  4DR4 O;  4JI1 O;  1YZB A;  1N33 O;  1DK1 A;  1R6T A;  4DR1 O;  4X65 O;  4OPA A;  1NS1 A;  4DV2 O;  4LF7 O;  3F5T A;  4GKK O;  5LMN O;  4K0K O;  4DV6 O;  5LMU O;  4DR3 O;  1FYJ A;  4JI4 O;  2UUA O;  2VQF O;  5H5N A;  4NXN O;  4DV0 O;  3SDL A;  4X62 O;  4DV3 O;  2UXB O;  2HHH O;  2ZM6 O;  2E5L O;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...