4IYHA

The crystal structure of a secreted protein esxb (semet-labeled, c-term. his-tagged) from bacillus anthracis str. sterne
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
IKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (SeMet-labeled, C-term. His-Tagged) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
total genus 30
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4iyhA00
4J7KA 4W4LA 4J42A 4J11A 4IYIA 2GTSA 4IYHA 4J10A 4J41A 4KXRA 2G38A 4W4KA 4J7JA 3FX7A
chains in the Genus database with same CATH superfamily
3VQVA 4U3JB 5BZBA 3P3PA 4B08A 1AB3A 1QR9A 1H8HG 1N4CA 3GB7C 2HVJC 1K7DA 3AG2B 2LO1A 2DYSC 4JASA 3N27A 4I55A 4YJ3A 1F4MA 1H2SB 2Q7GA 4MVOA 3J81N 5KMGA 2ZXWB 1O9GA 1IXBA 4R7CA 1JVMA 3Q4HB 2YEVA 2IJIA 4TSFG 3CB2A 2Q4PA 2Y48A 1H8EG 1ZL8A 1XEQA 3L72H 1CXZB 2ZKOA 1BL8A 3EXAA 4XBFA 2ZD9A 4DR1B 1M5IA 2VQFO 3DTUB 2F1MA 3BEHA 2QTSA 4MSWC 3CC2V 5LHHA 3IJ4A 4DV0B 4B7EA 5IJ9A 4I9QA 1KQSU 2YI9A 4JI0O 5B1NA 2E5LO 3AK3A 5ITZA 5IYDO 3ZHTA 5CBGA 5IJ0B 2AHYA 3ZRVA 3D36C 5EYPB 2W6JG 2FYUH 3LSUA 2XAHA 4U7OA 2Q69A 4WBNB 1RM1B 2CH7A 5IY5B 2ZR3A 2ATKC 3CSXA 1ORQC 4LFCB 3ZHSA 1F7YA 3T1YB 3OT7A 4PA7A 1XMQO 1S76D 4D6TH 2CTQA 5D5QA 3WB0A 1NZ6A 3T1HB 5JJEB 4ASUG 3ASNB 4CH6A 2GHYA 3RN4A 1YI2V 2RJZA 2ZDIC 2ZE5A 4O4HA 4DR7O 3CJHA 4NTXA 4LF6B 1PNLA 4NVPA 1GN6A 2Q7HA 3BPZA 3FB8C 2IH1C 3KZIZ 4J7KA 5JVDA 4AQYO 3BABA 4JI1B 1SF9A 4N23A 2AHZA 1PKXA 2WLNA 4HNAB 5LP6A 3ASOC 1L1FA 5D5PA 2UU9O 5L3CA 1JA8A 3CRAA 1OCZC 2ZQMA 3WU2Z 2P90A 4ZOLA 2AZ0A 4WCEV 3CCSV 2DOSA 4LF5O 1XNRO 2DYSB 1R1BA 4DYLA 2RNBA 5LXTA 2A79B 5H2FZ 2B1GA 5EZYA 3IFXA 2GSMB 1H38A 3N2KA 1HDJA 3VBBA 3SPGA 4UB8Z 4LF4O 2XAQA 5J9PC 3EHBB 3JCZA 3W7WA 1JQ0A 4TV8B 4FLYA 2EULA 1AILA 3K5OA 1H2GA 1I08A 4JYCA 3ZMTA 1AROP 4H33A 3OMAB 2X7RB 1I7FA 1VF7A 2BOCC 3HKEB 4JTCB 4K8ZA 3C90A 3H1JH 3JAKB 4JI4B 1T5EA 4YXWG 4ZIBA 3AK2A 3CXHF 3SYQA 1KP2A 4XDJA 1PNMA 1Z5VA 4CS2A 1YVWA 2YXYA 2BSKA 5GONA 2BCCH 4GUNA 1N8RW 5FPOA 3RVZA 1R6NA 2YDEA 2ZE7A 1YTFD 1W0KG 5FL7G 4X8AA 3ZJZA 1Y74A 4MVZA 4UCVA 2P5OA 3RYFA 1TAEA 1EZJA 4QGPA 1FFXA 4LFAB 3K59A 4QIWF 3O9OA 1NKDA 2XT9A 4FPPA 1WA8B 5CA0B 2ZNIA 3ASOB 4HYOA 3STZC 1EZVH 1Y76B 3K3WA 1OCZB 2Z3YA 2EINC 2NR5A 4LNUA 3SYCA 4MS2A 2DW4A 2QA4V 2BTQA 4TUYB 4FLXA 3FYEB 4F6EA 4QE9A 2NLJC 1LNQA 1JOYA 5CMUA 4MVRA 1E79G 5B1OA 3GWOA 2E74B 2EZPA 2ODMA 3K03A 1P4RA 4BR6A 4GKJO 4MVSA 1BZKA 2YIBA 1V54C 2CUGA 4EEQA 4WFAV 3SDLA 4O4IA 2HVKC 3ZCCA 2Y4UA 3PJSK 2GUZB 4NTYA 2VQFB 4DV2O 5LGNA 2PGGA 4ZI7A 2F4VO 2R9AA 3LDCA 5KLVH 5GW7A 1VP7A 2E5LB 1K9MW 4FVMA 1AVMA 2Q0OC 3BFRA 4DR5O 3UT5B 5B3SC 3OUFA 2VQEO 1SESA 3VOUA 3ZMZA 5LP6C 4D7SA 1GM7A 1Q86W 2MK3A 1L8DA 2YSUB 4GT1A 2H94A 2QM4A 4G27B 1PL0A 2P67A 3A0RA 1N32O 2EILC 5B1AC 1XMQB 1Z5WA 1MABG 1QVGU 2OIEA 3H1HH 2WLIA 2OWOA 3A2FA 2ZIOA 4YJ3B 1VQMV 1N33O 4LP8A 5KMGB 2DN9A 4MTOA 1EN6A 2EJRA 2XAGA 3U11A 4X1YA 1NT2B 2YEVB 1ZL8B 5JWPA 4UCTA 4QE7A 2QEXV 3P30A 1EBOA 4IYHA 1OCRC 3K0DA 1DF5A 3ZRXA 4DV6O 3WFVA 3A8TA 3CCEV 4LF5B 1BHAA 4JI7O 3CX5F 2WAMA 2EINB 4YY3B 3UQ8A 4FZ1A 4O4LA 2E76B 2XTAA 5ITZB 2AGAA 2ADQB 4FFBA 1OHHG 3FAVB 5A9GA 3LNMB 1G8MA 2KG7B 3FYIB 5JCOA 1R3JC 3ABMC 4LC1A 4GX2A 4JI3O 1V54B 4X1IA 2L6LA 4JV5B 1Q6IA 1AI6A 1W59A 4UVBA 1N0NA 4WFEA 2CH7B 4LR3A 3P32A 1K4CC 3ZMSA 3CPWU 2E3CA 2DWDC 1S5JA 2B5UA 3A0HZ 3PN1A 1WAZA 3JD2A 4ICGA 2OTLV 2UUAO 4B3TO 1VQPV 2A06H 5AG2A 4LF9O 2EIKC 1COWG 4X20B 1SQBH 2YXLA 1U97A 1F4NA 5L3FA 1WPBA 4E4EA 5B1BC 1NVPD 5JVDB 3ZMUA 2CAZC 2XASA 5B3SB 3B4SA 2N05A 5EBMC 1EM1A 2YI8A 1GH6A 2IU0A 3OMIB 4JYYA 5LP6B 3H9VA 4IGGA 1RPOA 2AXTZ 3ZHRA 1Y67A 5A2QN 4O2BB 5EBLC 1SQQH 2Q5ZA 3RW0A 3K5MA 2EILB 4ZOLB 5B1AB 3JALA 4J10A 5KA5A 1MMMA 1OCOC 3BCCH 2NN4A 4LF7O 3OTFA 1E1RG 3HR0A 5EZYB 4NKGB 1VF6A 3CC7V 1SQPH 3N2KB 4BWAA 1MZFA 4JTAB 3FB5C 4CH4A 4DR3O 2JGUA 5LA6B 3H01A 1OCRB 2GTSA 1PNKA 4KUMA 2JJ1G 4MW3A 4FJCC 5IWAO 4IIJA 3HPLC 1YZBA 1VQ7V 4JI2O 3RYIB 4JYAO 4TT3G 2H8PC 2FL4A 1JJOA 5JH7B 3L73H 3UKMA 2PYLA 2JGDA 2Q0AA 1MOFA 2ZE6A 1QLNA 1IBLO 4FFKA 3ABMB 5B66Z 5CBHA 1PPJH 5DN6G 1GKFA 3OTOO 1YTFB 2OT5A 3DSQA 3WB1A 1H2NA 5KX5A 4UUJC 1F23A 3APQA 3JAWB 4LFBO 1NH2D 3CXCU 2CGOA 3QNEA 3E89A 5LOVB 4AHCA 2BSKB 1I5XA 3SJQC 5GONB 1BMFG 2Q8VA 1BSMA 3T4DA 2EIKB 1LUVA 1Y74B 4X64O 3RYFB 4DR5B 5B1BB 1FFXB 4I9WA 2W6IG 1J5EO 1U96A 4Q6GA 2YS8A 1RSOA 1JJ2U 3CMAV 2UXDB 3D3QA 2ZNJA 3SPHA 3JAMN 3E35A 1S5LZ 1CP9A 3CRMA 4LNUB 4DV4B 3K0GA 2UXCO 3AG1C 2BTQB 1N33B 4CZZA 1XL6A 3S3WA 1OCOB 4IHJB 4FLUA 1SQVH 1M4UA 3F5WC 3R65A 3CEIA 3QTCA 4O4IB 3X2QC 1XMOO 2WSSG 4Z2WA 1SS3A 4B3RB 3FFQA 4YJ2A 1XHZA 1QVFU 3BVOA 1FKAO 1O9HA 2P22C 3TK1A 1TGOA 2K1EA 2YICA 4J7JA 4JI7B 5KA6A 4ZI7B 3AG4C 4JI5O 1N0JA 3L71H 2UUBB 1HNWO 1NTKH 2GV9A 2W0FC 3HKCA 4I4TA 3CCJV 3CRRA 2P4VA 1JFFA 4I5SA 2FKXA 2VS0A 5C8YA 5IE9A 4X65B 5EK0A 2Q73A 4MTXA 1B3QA 5EC1C 5LHGA 3CCUV 4OGQB 3SJAC 3W7SA 1UFIA 5TISZ 2JK5C 4DV7O 2BE3A 1AJQA 4K0KO 4P2ZA 1WB7A 2CDYA 4X9QA 1XL4A 5L3DA 2IW5A 2R72A 4B3TB 3SJCC 3G71V 2WLIB 5BR8B 4K3AA 5KHIA 2IM9A 1SRYA 3STLC 2QWQB 4N21A 1GN4A 1VQKV 1S5HC 1L0LH 4X1YB 1VF6C 5HFMA 1GMGA 5H5NA 3G67A 4J41A 3G6EV 2ADPA 4DUYB 4PV1B 4IYIA 1TUBB 5J2TA 4TV9A 3C3TA 5LYJA 1NTMH 3L74H 1GK9A 4HAMA 2F23A 3LSSA 3AG7A 3BA9A 1FYJA 3ZEDA 2Q6AA 4CC5A 3AG1B 1KP3A 4O4LB 2N74A 4FFBB 5E1AC 2YUAA 1FS0G 3DGEA 1AI4A 4NR1A 4DV5O 1IBMB 3ABTA 5EIBD 4MVQA 4DV3O 1H2KA 4X1IB 3CCLV 3QO7A 4UVCA 3JYCA 1E1QG 3X2QB 2X6AA 2PI4A 1NVPB 1XQ8A 5IWAB 1FJGB 1P7BA 2B1IA 5FNVA 2Q9LA 1DF4A 4MTFA 4JI2B 1MG1A 3AG4B 5JQGA 2KSDA 1R73A 4L87A 1MNGA 4PA6A 1I94B 4KFMA 4PA3A 5KHGA 2V1DA 4LF8O 3SPJA 3U0ZA 4X89A 3ETEA 4RQEA 1IBLB 3OTOB 2EZOA 5HFLA 1KKDA 4O4JB 1S77D 2QM7A 4LFBB 1ZUQA 1NTZH 3QG5A 4FK5C 4Q20A 3THOA 1BGYH 1FXVA 1ZLZA 3LSQA 2UUCB 1AI7A 3KCYA 4OX9O 4X62B 1J95A 3JD3A 1BE3H 1P49A 2LGQA 4UVAA 4X64B 3CYOA 3SPCA 1V55C 2GBOA 3VQWA 4CC6A 1XNQO 1RP3B 2DWEC 2Y0PA 1B6QA 3JCUZ 4IT5A 2DE0X 2OCHA 1NJIW 1MSDA 5LMUB 4OPAA 4YHHB 1ENVA 2QKSA 5C93A 2QKCA 4NB5A 1GAXA 4U7NA 5EC2C 4WFFA 3MDSA 4PD4F 3E2EA 3E8HA 5BY1A 3R66A 1NH2B 3ABLC 3JD1A 4ZHQA 3UO3A 2QWPB 4I7ZB 3IAYA 1N34O 2LFRA 2JS5A 3K79A 1I0HA 4QNHB 2UXBO 2RCVA 5KX5B 1TVKA 1K97A 1YXBA 3ZRWB 3BRCA 3CCQV 3B8NA 1VQ4V 3JATA 2W0XA 1R3LC 1SZXA 3AK1A 1G6UA 3S3XA 5JJNB 4JAVA 3VQYA 3FKSG 2Q7EA 1NI8A 1DLBA 1K73W 4H44B 3RT3C 2CTPA 1VF5B 2YXHA 4Z1VA 2YIBD 1K5QA 1UJWB 1ZAUA 4JI0B 1VQ8V 4P9PA 4F4LA 4K8XA 4RAIA 2HHHO 3Q4HA 2QSAA 5EIBC 4JGSA 1OCCC 2FMLA 2WLKA 3GVMA 2X6BA 4B3SO 1QLEC 4GX0A 4UCRA 5IYCO 1GTOA 4GYCB 3J80N 3VQXA 1UPGA 1YF2A 4TQDA 2OCCC 4GCZA 3BA8A 2HG5C 2P6JA 3ZHQA 4GKKO 1JX9A 1VIBA 4X88A 3HKBA 1QR8A 3QO5A 1V55B 4I55B 3U10A 3N2GA 5F2VO 3DXRA 2BTOA 2QM8A 2KQXA 4DR7B 3CCRV 2B9ZA 1XI1A 2DQ0A 2VRZA 4YJ2B 4AQYB 3BY6A 4PI2A 4J7ZA 1D5NA 2Y0IA 1W2BU 4WBNA 2UU9B 5IYBO 3W7TA 2WLHA 4FIPC 4Z1MG 4W4KA 5IDJA 1R3KC 1R6KA 4E2LA 3HKCB 4I4TB 3TXSA 2UXXA 2R70A 2E75B 1JFFB 3K5LA 3ABLB 1XNRB 5IJ9B 3OR7C 1PM9A 5H6QA 1Z2GA 2RMKB 1AJPA 3L70H 2DMXA 3T1CA 3SYAA 4PJ0Z 4HNAA 4AILC 1M57B 4GLXA 4LF4B 3BHPA 2YIDA 1AJNA 4IL6Z 4OXSA 2R9IA 1BT8A 3T4ZA 2IJHA 4DV0O 2HEPA 3CS5A 3CMEV 1A32A 1Y6XA 3MHHC 3KG2A 4O4HB 3CJHB 5J2TB 3M7MX 1KKCA 4TV9B 3CE2A 3CCMV 5LYJB 1PV0A 1HNZO 1RFYA 1AP6A 5IYZA 1OCCB 1Q82W 2ZR2A 5FPRA 1IVSA 1QLEB 2ETNA 3FX7A 4B7KA 4KP4A 1KC8W 2OCCB 3D8CA 3ZMVA 1H2LA 1JPXA 2WWWA 1Q7YW 4LFCO 3B8MA 2OYQA 3K9SA 1CEZA 4MVMA 3L9DA 3ZN0A 3T1YO 4FLZA 3TCUA 1G1XB 1KB9F 1MZEA 3ZRSA 1VQNV 4JZGA 2V7QG 5LXTB 4LWSA 3ZBHA 3JASA 1G4YB 2P4KA 5CBFA 3HKEA 2L35A 2WPDG 1WJZA 1VMGA 2BOBC 4I50A 2JJ2G 3ZHVA 2HJFC 3H1LH 5FNVB 3JAKA 3RYHA 4H37A 3RGBA 1YSCA 1MSWD 2CTWA 2H3OA 4FLTA 2FB5A 1L0NH 3A0BZ 1IXMA 4DR6O 2QR4A 4ABMA 1SERA 4JYBA 1XHXA 2ILMA 3J7AU 3ETDA 1Y4MA 5CN0A 1JMKC 1SQFA 5CB4A 3I5DA 2ZDIA 2UXBB 5H9CA 1GN2A 1KMIZ 3EVKA 3MHSC 1CPYA 4GKJB 3G80A 3ZS8C 3EFFK 4X1KA 1WA8A 2QJ1A 3HKDA 5E79Z 3RVYA 3CHXA 3OM3B 4DV2B 3KKYA 2PY5A 1BCCH 1Y76A 2WA3A 3LNNA 4JZ2A 2F4VB 1RPRA 2DYRC 1Q8IA 1SA0A 3APOA 4GZRB 2LW7A 3OW2U 4C7UA 4BAYA 1VEWA 2VWJA 2VQEB 3ETGA 4B3SB 3MD0A 1HR0O 2G38A 4JI4O 3RWRD 2EBOA 4JAUA 2QWOB 3ABKC 3OGIB 1N32B 3OR6C 4GKKB 3AEIA 3WG7C 4XDLA 4ZHQB 3RYCA 1Q6UA 1OZ0A 3K04A 1M1KW 4DK1A 1FFTB 2P06A 1HWYA 2R9RB 4B3MO 4O2AA 3FB7C 3K58A 5LGUA 1TVKB 1N36O 2LW1A 1LUWA 5JCOC 2QGNA 1WP7A 2UXNA 5KUKA 2IBZH 2O57A 2PI5A 4HBNA 4TWKA 4UV8A 1KD1W 1NU1H 3JATB 2JIZG 2OIGA 3FD9A 4R8CA 3AG3C 3E8GA 1VQOV 2EIMC 3JARA 3DC6A 4DV6B 4EKWA 1YEWA 3CRCA 4DV1O 4J80A 2X0LA 4CS4A 1US6A 4LH7A 1X4TA 1WN7A 3ZIAG 4GX1A 2Q67A 4JPRA 2JDIG 3K5NA 3C3SA 3CC4V 4AI8A 4DR4O 1EN5A 2JS3A 1JCHA 1HW7A 5DM6V 1Y66A 4JI8O 3HB3B 4JI3B 2M6YA 1AI5A 2Q68A 1BS3A 2JEUA 4DW1A 2QKAA 3HKBB 3NR7A 4J9YB 4PA9A 1YITV 3P3NA 2UUAB 1PP9H 2HR3A 4LH6A 4LF9B 5DECA 3N2GB 3OD4A 3DXRB 1GRJA 2DYRB 2Y4TA 1NR1A 2Y69C 1M9NA 4EB6A 3FAVA 1SETA 2KG7A 4FM2A 4PHZA 1HNZB 4FM1A 3K57A 1B04A 2F43G 4L8JA 1MA1A 2QE7G 5J2UA 4D7TA 2LQTA 1K33A 4X66O 2K9PA 4J42A 3TXQA 4WFBV 3ABKB 2F93B 4I0XA 3WG7B 4JTDB 3E86A 2WLLA 4G28B 1HNXO 1KBHA 1EN4A 2ITCC 1FXKA 4MW8A 4X20A 4LF7B 2JVDA 2A3QA 2IU3A 1H2MA 3CRQA 1FPOA 3M99B 3G4SV 4NXMO 4ZKIA 2A7WA 1P7GA 1K4DC 4PELA 1KYOF 2ZT9B 4A5UB 2EX3A 1WPXA 2CTRA 2D2CB 3AG3B 4DR3B 1WLEA 4DW0A 5K1PA 2EIMB 4O2BA 1JR9A 3E8BA 4DR6B 4NYKA 2V4DA 4EFBA 2WA4A 1IDSA 3K9AA 4YY3O 3SJBC 5L3BA 4JYAB 1V9PA 4MTGA 3OAAG 1I5YA 3H1IH 1IZ3A 2QDOA 2XHBA 5IYZB 5DEDA 4J9ZB 1ROPA 5LL6Y 4JV5O 1URFA 2PF4E 4F6RA 1QHTA 4MVUA 4RUFA 1S72V 1EFRG 5LA6A 5L3GA 1QBZA 1X59A 3JALB 4PDMA 3E22A 1M56C 1LR1A 4NXNO 3RYIA 4LWSB 3IGAC 2Y69B 3JASB 5JH7A 1XUQA 4I50B 1R3IC 4RO2A 4P9OA 2QTOA 5CA3A 1HR0B 4YIOA 3RYHB 5BMVA 4OPHA 1J5EB 3SYOA 3D3IA 4DRXA 5LMNO 1FXHA 3K08A 1Q43A 3JAWA 3QVNA 5LOVA 4IIJB 2M7WA 2UXCB 2XAJA 4R50A 3G6BA 4UV9A 4CBCA 3M8AA 4NTWA 3WB2A 4B3MB 1K92A 2ZM6O 5CB4B 2HJDA 2OTJV 1N36B 2IH3C 2CGNA 2JGDB 3ETQA 3CCVV 2RQ6A 2XUMA 4DUZO 3UCSC 4JI6O 1XMOB 1IBKO 1Q81W 5CA1A 4FM0A 4U3FH 4X1KB 3HKDB 3I55V 3E8FA 4CS3A 3NXSA 4K35A 4DK0A 1D5AA 3SGIA 3KCXA 4DV1B 1HP8A 2XOKG 3OEEG 1D2DA 5KUMA 1M57C 4U3JA 4JI5B 1HNWB 1SA0B 3OFNG 4IHJA 4EFEA 1VARA 2HFEC 4DR4B 3IC9A 5K1XA 3GWKC 4TOIA 1M93A 3ML0A 2JEXA 4FMTA 4BIZA 3B40A 2F95B 4DR2O 4JI8B 1WNSA 1P84F 1QU7A 4RWUA 2Z0AA 2LJ2A 1XOUA 1RSOB 4LBEC 4DV7B 1KU9A 4K0KB 4W4LA 1AP5A 2ZIMA 1ZTEA 3RYCB 2GDSA 1B06A 2ZCEA 2ITDC 1DGSA 4TQFA 1FXKC 1M56B 2PZSA 3ZHUA 4O2AB 3OE7G 4UCOA 4HZ3A 3TGUH 1VQ5V 2KB1A 1QNMA 3F5TA 4JF3A 1AR5A 2HKOA 1R6TA 4RQFA 4QPJA 4X66B 5IJ0A 1AR1B 3JARB 1K3EA 2UXDO 4BW5A 4KHPO 2VWKA 2RDCA 5EYPA 4YIPA 5FLXN 1SC5B 4JAAA 2LFSA 3OEHG 4CH3A 1GO3F 5H6RA 3T2MA 3W7UA 4DV4O 5JJJB 4RUEA 3JD4A 5GTHZ 1HNXB 4P30A 2EIJC 2FTKA 4H0LB 3ABUA 5B5EZ 4NXMB 2P7TC 4DV5B 5C8YB 2A0LA 1S0VA 2QWNB 4DV3B 1YJNV 3JD0A 2HLDG 5LGTA 1THZA 4BIOA 1K34A 1TUBA 2PTMA 3B2EE 4B3RO 4BIUA 4ZBMA 2GTAA 3BAAA 5EBWC 2DJVA 5LHIA 4QPKA 1BHBA 3CP1A 4G2KA 2NNUA 2UUBO 4DR1O 2IJJA 1M90W 1NS1A 5KAIZ 4EB6B 1KUQA 2PYJA 1TUEB 2Z5UA 1GM8A 4LF8B 1IURA 5IT9N 4PA4A 4X65O 3JSNA 2EJ7A 4UXNA 2JRIA 2LP7A 4UCUA 5J2UB 4XDKA 4PDLA 3ICXA 3W7XA 3OMNB 3ZN1A 3F7VC 1QQCA 1VQ9V 2A9HA 1ZWIC 4I0XB 3SYPA 2WLLB 4OX9B 1NBMG 5BR8O 1SQXH 1ZSPA 4NXNB 1YHQV 1YDXA 1BQ0A 1TA8A 1FXKB 3E83A 4LCUC 3O65A 3OUSA 4TV8A 2HP8A 1YJWV 1XNQB 2AZ2A 1NR7A 4J11A 3T1HO 3H1KH 5LBQA 3SR2C 1DTOA 4DUYO 4LF6O 2ZE8A 4O4JA 5LMNB 1YJ9V 4H13B 5GTIZ 3RFRA 4JI1O 1SKVA 3TETA 3D36A 4PI0A 4KL1A 2YIAA 2YC0A 3TJTA 5BXZA 5JQGB 1Q90D 1YCIA 4BW9A 2ZM6B 2EIJB 3IC7A 3AG2C 1S3JA 4FLVA 4PDVA 1FAFA 1IBMO 2DQ3A 4CH5A 4DUZB 2X6CA 1Q6HA 4JI6B 4MT8A 1IBKB 1N34B 3CD6V 2ZXWC 4F6RB 1IX9A 1Q5OA 1PD3A 1SZTA 4PDRA 1GM9A 2LGWA 3F7YC 3DC5A 4UFZA 2PUSA 3LDDA 2CE4A 3QO8A 4DO2A 1K8AW 2WLMA 1FJGO 1WB8A 4UB6Z 4FLWA 4KXRA 3JSLA 5KHJA 4WFGA 2MW2B 3E22B 5CA0A 4R6ZA 2RN9A 2F66C 1VQLV 3I56V 1FD9A 1VQ6V 1PL4A 3QF7A 1I94O 3LDEA 2XAFA 4UCSA 3FB6C 2ZINA 1WP8A 2D3OW 1BQZA 3B09A 1F51A 1SQGA 4DR2B 4TUYA 5L3EA 3L75H 5BMVB 1YIJV 1GN3A 2XNDG 2HHHB 4DRXB 3LUTB 2ARHA 1AR4A 2N04A 1KECA 3ZRWA 4WF9V 1XDCA 1W0JG 1OJHA 4QJFB 2UUCO 1Q3EA 1RM1C 5IY5C 2CK3G 2C2AA 3B77A 1OV9A 1XBLA 1ZX3A 2IJKA 4X62O 2GUZA 4WFHA 4DXWA 2QWRB 5KHHA 2KKWA 5KAFZ 3ASNC 3SPIA 1XILA 3ZX6A 1NQTA 3UO2A 3UM7A 1K5SA 1XREA 4FZ0A 5CA1B 1QCEA 2WLJA 3RBZA 4GX5A 3CWBH 3OGCC 3UT5A 3MAQA 1DK1A 4KHPB 5LMUO 5KHKA 4YHHO 4LFAO 3K06A 2AW9A
chains in the Genus database with same CATH topology
4J7KA 4W4LA 4J42A 4J11A 4IYIA 2GTSA 4IYHA 4J10A 4J41A 4KXRA 2G38A 4W4KA 4J7JA 3FX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7K A;  4W4L A;  4J42 A;  4J11 A;  4IYI A;  2GTS A;  4IYH A;  4J10 A;  4J41 A;  4KXR A;  2G38 A;  4W4K A;  4J7J A;  3FX7 A; 
#chains in the Genus database with same CATH topology
 3VQV A;  4U3J B;  5BZB A;  3P3P A;  4B08 A;  1AB3 A;  1QR9 A;  1H8H G;  1N4C A;  3GB7 C;  2HVJ C;  1K7D A;  3AG2 B;  2LO1 A;  2DYS C;  4JAS A;  3N27 A;  4I55 A;  4YJ3 A;  1F4M A;  1H2S B;  2Q7G A;  4MVO A;  3J81 N;  5KMG A;  2ZXW B;  1O9G A;  1IXB A;  4R7C A;  1JVM A;  3Q4H B;  2YEV A;  2IJI A;  4TSF G;  3CB2 A;  2Q4P A;  2Y48 A;  1H8E G;  1ZL8 A;  1XEQ A;  3L72 H;  1CXZ B;  2ZKO A;  1BL8 A;  3EXA A;  4XBF A;  2ZD9 A;  4DR1 B;  1M5I A;  2VQF O;  3DTU B;  2F1M A;  3BEH A;  2QTS A;  4MSW C;  3CC2 V;  5LHH A;  3IJ4 A;  4DV0 B;  4B7E A;  5IJ9 A;  4I9Q A;  1KQS U;  2YI9 A;  4JI0 O;  5B1N A;  2E5L O;  3AK3 A;  5ITZ A;  5IYD O;  3ZHT A;  5CBG A;  5IJ0 B;  2AHY A;  3ZRV A;  3D36 C;  5EYP B;  2W6J G;  2FYU H;  3LSU A;  2XAH A;  4U7O A;  2Q69 A;  4WBN B;  1RM1 B;  2CH7 A;  5IY5 B;  2ZR3 A;  2ATK C;  3CSX A;  1ORQ C;  4LFC B;  3ZHS A;  1F7Y A;  3T1Y B;  3OT7 A;  4PA7 A;  1XMQ O;  1S76 D;  4D6T H;  2CTQ A;  5D5Q A;  3WB0 A;  1NZ6 A;  3T1H B;  5JJE B;  4ASU G;  3ASN B;  4CH6 A;  2GHY A;  3RN4 A;  1YI2 V;  2RJZ A;  2ZDI C;  2ZE5 A;  4O4H A;  4DR7 O;  3CJH A;  4NTX A;  4LF6 B;  1PNL A;  4NVP A;  1GN6 A;  2Q7H A;  3BPZ A;  3FB8 C;  2IH1 C;  3KZI Z;  4J7K A;  5JVD A;  4AQY O;  3BAB A;  4JI1 B;  1SF9 A;  4N23 A;  2AHZ A;  1PKX A;  2WLN A;  4HNA B;  5LP6 A;  3ASO C;  1L1F A;  5D5P A;  2UU9 O;  5L3C A;  1JA8 A;  3CRA A;  1OCZ C;  2ZQM A;  3WU2 Z;  2P90 A;  4ZOL A;  2AZ0 A;  4WCE V;  3CCS V;  2DOS A;  4LF5 O;  1XNR O;  2DYS B;  1R1B A;  4DYL A;  2RNB A;  5LXT A;  2A79 B;  5H2F Z;  2B1G A;  5EZY A;  3IFX A;  2GSM B;  1H38 A;  3N2K A;  1HDJ A;  3VBB A;  3SPG A;  4UB8 Z;  4LF4 O;  2XAQ A;  5J9P C;  3EHB B;  3JCZ A;  3W7W A;  1JQ0 A;  4TV8 B;  4FLY A;  2EUL A;  1AIL A;  3K5O A;  1H2G A;  1I08 A;  4JYC A;  3ZMT A;  1ARO P;  4H33 A;  3OMA B;  2X7R B;  1I7F A;  1VF7 A;  2BOC C;  3HKE B;  4JTC B;  4K8Z A;  3C90 A;  3H1J H;  3JAK B;  4JI4 B;  1T5E A;  4YXW G;  4ZIB A;  3AK2 A;  3CXH F;  3SYQ A;  1KP2 A;  4XDJ A;  1PNM A;  1Z5V A;  4CS2 A;  1YVW A;  2YXY A;  2BSK A;  5GON A;  2BCC H;  4GUN A;  1N8R W;  5FPO A;  3RVZ A;  1R6N A;  2YDE A;  2ZE7 A;  1YTF D;  1W0K G;  5FL7 G;  4X8A A;  3ZJZ A;  1Y74 A;  4MVZ A;  4UCV A;  2P5O A;  3RYF A;  1TAE A;  1EZJ A;  4QGP A;  1FFX A;  4LFA B;  3K59 A;  4QIW F;  3O9O A;  1NKD A;  2XT9 A;  4FPP A;  1WA8 B;  5CA0 B;  2ZNI A;  3ASO B;  4HYO A;  3STZ C;  1EZV H;  1Y76 B;  3K3W A;  1OCZ B;  2Z3Y A;  2EIN C;  2NR5 A;  4LNU A;  3SYC A;  4MS2 A;  2DW4 A;  2QA4 V;  2BTQ A;  4TUY B;  4FLX A;  3FYE B;  4F6E A;  4QE9 A;  2NLJ C;  1LNQ A;  1JOY A;  5CMU A;  4MVR A;  1E79 G;  5B1O A;  3GWO A;  2E74 B;  2EZP A;  2ODM A;  3K03 A;  1P4R A;  4BR6 A;  4GKJ O;  4MVS A;  1BZK A;  2YIB A;  1V54 C;  2CUG A;  4EEQ A;  4WFA V;  3SDL A;  4O4I A;  2HVK C;  3ZCC A;  2Y4U A;  3PJS K;  2GUZ B;  4NTY A;  2VQF B;  4DV2 O;  5LGN A;  2PGG A;  4ZI7 A;  2F4V O;  2R9A A;  3LDC A;  5KLV H;  5GW7 A;  1VP7 A;  2E5L B;  1K9M W;  4FVM A;  1AVM A;  2Q0O C;  3BFR A;  4DR5 O;  3UT5 B;  5B3S C;  3OUF A;  2VQE O;  1SES A;  3VOU A;  3ZMZ A;  5LP6 C;  4D7S A;  1GM7 A;  1Q86 W;  2MK3 A;  1L8D A;  2YSU B;  4GT1 A;  2H94 A;  2QM4 A;  4G27 B;  1PL0 A;  2P67 A;  3A0R A;  1N32 O;  2EIL C;  5B1A C;  1XMQ B;  1Z5W A;  1MAB G;  1QVG U;  2OIE A;  3H1H H;  2WLI A;  2OWO A;  3A2F A;  2ZIO A;  4YJ3 B;  1VQM V;  1N33 O;  4LP8 A;  5KMG B;  2DN9 A;  4MTO A;  1EN6 A;  2EJR A;  2XAG A;  3U11 A;  4X1Y A;  1NT2 B;  2YEV B;  1ZL8 B;  5JWP A;  4UCT A;  4QE7 A;  2QEX V;  3P30 A;  1EBO A;  4IYH A;  1OCR C;  3K0D A;  1DF5 A;  3ZRX A;  4DV6 O;  3WFV A;  3A8T A;  3CCE V;  4LF5 B;  1BHA A;  4JI7 O;  3CX5 F;  2WAM A;  2EIN B;  4YY3 B;  3UQ8 A;  4FZ1 A;  4O4L A;  2E76 B;  2XTA A;  5ITZ B;  2AGA A;  2ADQ B;  4FFB A;  1OHH G;  3FAV B;  5A9G A;  3LNM B;  1G8M A;  2KG7 B;  3FYI B;  5JCO A;  1R3J C;  3ABM C;  4LC1 A;  4GX2 A;  4JI3 O;  1V54 B;  4X1I A;  2L6L A;  4JV5 B;  1Q6I A;  1AI6 A;  1W59 A;  4UVB A;  1N0N A;  4WFE A;  2CH7 B;  4LR3 A;  3P32 A;  1K4C C;  3ZMS A;  3CPW U;  2E3C A;  2DWD C;  1S5J A;  2B5U A;  3A0H Z;  3PN1 A;  1WAZ A;  3JD2 A;  4ICG A;  2OTL V;  2UUA O;  4B3T O;  1VQP V;  2A06 H;  5AG2 A;  4LF9 O;  2EIK C;  1COW G;  4X20 B;  1SQB H;  2YXL A;  1U97 A;  1F4N A;  5L3F A;  1WPB A;  4E4E A;  5B1B C;  1NVP D;  5JVD B;  3ZMU A;  2CAZ C;  2XAS A;  5B3S B;  3B4S A;  2N05 A;  5EBM C;  1EM1 A;  2YI8 A;  1GH6 A;  2IU0 A;  3OMI B;  4JYY A;  5LP6 B;  3H9V A;  4IGG A;  1RPO A;  2AXT Z;  3ZHR A;  1Y67 A;  5A2Q N;  4O2B B;  5EBL C;  1SQQ H;  2Q5Z A;  3RW0 A;  3K5M A;  2EIL B;  4ZOL B;  5B1A B;  3JAL A;  4J10 A;  5KA5 A;  1MMM A;  1OCO C;  3BCC H;  2NN4 A;  4LF7 O;  3OTF A;  1E1R G;  3HR0 A;  5EZY B;  4NKG B;  1VF6 A;  3CC7 V;  1SQP H;  3N2K B;  4BWA A;  1MZF A;  4JTA B;  3FB5 C;  4CH4 A;  4DR3 O;  2JGU A;  5LA6 B;  3H01 A;  1OCR B;  2GTS A;  1PNK A;  4KUM A;  2JJ1 G;  4MW3 A;  4FJC C;  5IWA O;  4IIJ A;  3HPL C;  1YZB A;  1VQ7 V;  4JI2 O;  3RYI B;  4JYA O;  4TT3 G;  2H8P C;  2FL4 A;  1JJO A;  5JH7 B;  3L73 H;  3UKM A;  2PYL A;  2JGD A;  2Q0A A;  1MOF A;  2ZE6 A;  1QLN A;  1IBL O;  4FFK A;  3ABM B;  5B66 Z;  5CBH A;  1PPJ H;  5DN6 G;  1GKF A;  3OTO O;  1YTF B;  2OT5 A;  3DSQ A;  3WB1 A;  1H2N A;  5KX5 A;  4UUJ C;  1F23 A;  3APQ A;  3JAW B;  4LFB O;  1NH2 D;  3CXC U;  2CGO A;  3QNE A;  3E89 A;  5LOV B;  4AHC A;  2BSK B;  1I5X A;  3SJQ C;  5GON B;  1BMF G;  2Q8V A;  1BSM A;  3T4D A;  2EIK B;  1LUV A;  1Y74 B;  4X64 O;  3RYF B;  4DR5 B;  5B1B B;  1FFX B;  4I9W A;  2W6I G;  1J5E O;  1U96 A;  4Q6G A;  2YS8 A;  1RSO A;  1JJ2 U;  3CMA V;  2UXD B;  3D3Q A;  2ZNJ A;  3SPH A;  3JAM N;  3E35 A;  1S5L Z;  1CP9 A;  3CRM A;  4LNU B;  4DV4 B;  3K0G A;  2UXC O;  3AG1 C;  2BTQ B;  1N33 B;  4CZZ A;  1XL6 A;  3S3W A;  1OCO B;  4IHJ B;  4FLU A;  1SQV H;  1M4U A;  3F5W C;  3R65 A;  3CEI A;  3QTC A;  4O4I B;  3X2Q C;  1XMO O;  2WSS G;  4Z2W A;  1SS3 A;  4B3R B;  3FFQ A;  4YJ2 A;  1XHZ A;  1QVF U;  3BVO A;  1FKA O;  1O9H A;  2P22 C;  3TK1 A;  1TGO A;  2K1E A;  2YIC A;  4J7J A;  4JI7 B;  5KA6 A;  4ZI7 B;  3AG4 C;  4JI5 O;  1N0J A;  3L71 H;  2UUB B;  1HNW O;  1NTK H;  2GV9 A;  2W0F C;  3HKC A;  4I4T A;  3CCJ V;  3CRR A;  2P4V A;  1JFF A;  4I5S A;  2FKX A;  2VS0 A;  5C8Y A;  5IE9 A;  4X65 B;  5EK0 A;  2Q73 A;  4MTX A;  1B3Q A;  5EC1 C;  5LHG A;  3CCU V;  4OGQ B;  3SJA C;  3W7S A;  1UFI A;  5TIS Z;  2JK5 C;  4DV7 O;  2BE3 A;  1AJQ A;  4K0K O;  4P2Z A;  1WB7 A;  2CDY A;  4X9Q A;  1XL4 A;  5L3D A;  2IW5 A;  2R72 A;  4B3T B;  3SJC C;  3G71 V;  2WLI B;  5BR8 B;  4K3A A;  5KHI A;  2IM9 A;  1SRY A;  3STL C;  2QWQ B;  4N21 A;  1GN4 A;  1VQK V;  1S5H C;  1L0L H;  4X1Y B;  1VF6 C;  5HFM A;  1GMG A;  5H5N A;  3G67 A;  4J41 A;  3G6E V;  2ADP A;  4DUY B;  4PV1 B;  4IYI A;  1TUB B;  5J2T A;  4TV9 A;  3C3T A;  5LYJ A;  1NTM H;  3L74 H;  1GK9 A;  4HAM A;  2F23 A;  3LSS A;  3AG7 A;  3BA9 A;  1FYJ A;  3ZED A;  2Q6A A;  4CC5 A;  3AG1 B;  1KP3 A;  4O4L B;  2N74 A;  4FFB B;  5E1A C;  2YUA A;  1FS0 G;  3DGE A;  1AI4 A;  4NR1 A;  4DV5 O;  1IBM B;  3ABT A;  5EIB D;  4MVQ A;  4DV3 O;  1H2K A;  4X1I B;  3CCL V;  3QO7 A;  4UVC A;  3JYC A;  1E1Q G;  3X2Q B;  2X6A A;  2PI4 A;  1NVP B;  1XQ8 A;  5IWA B;  1FJG B;  1P7B A;  2B1I A;  5FNV A;  2Q9L A;  1DF4 A;  4MTF A;  4JI2 B;  1MG1 A;  3AG4 B;  5JQG A;  2KSD A;  1R73 A;  4L87 A;  1MNG A;  4PA6 A;  1I94 B;  4KFM A;  4PA3 A;  5KHG A;  2V1D A;  4LF8 O;  3SPJ A;  3U0Z A;  4X89 A;  3ETE A;  4RQE A;  1IBL B;  3OTO B;  2EZO A;  5HFL A;  1KKD A;  4O4J B;  1S77 D;  2QM7 A;  4LFB B;  1ZUQ A;  1NTZ H;  3QG5 A;  4FK5 C;  4Q20 A;  3THO A;  1BGY H;  1FXV A;  1ZLZ A;  3LSQ A;  2UUC B;  1AI7 A;  3KCY A;  4OX9 O;  4X62 B;  1J95 A;  3JD3 A;  1BE3 H;  1P49 A;  2LGQ A;  4UVA A;  4X64 B;  3CYO A;  3SPC A;  1V55 C;  2GBO A;  3VQW A;  4CC6 A;  1XNQ O;  1RP3 B;  2DWE C;  2Y0P A;  1B6Q A;  3JCU Z;  4IT5 A;  2DE0 X;  2OCH A;  1NJI W;  1MSD A;  5LMU B;  4OPA A;  4YHH B;  1ENV A;  2QKS A;  5C93 A;  2QKC A;  4NB5 A;  1GAX A;  4U7N A;  5EC2 C;  4WFF A;  3MDS A;  4PD4 F;  3E2E A;  3E8H A;  5BY1 A;  3R66 A;  1NH2 B;  3ABL C;  3JD1 A;  4ZHQ A;  3UO3 A;  2QWP B;  4I7Z B;  3IAY A;  1N34 O;  2LFR A;  2JS5 A;  3K79 A;  1I0H A;  4QNH B;  2UXB O;  2RCV A;  5KX5 B;  1TVK A;  1K97 A;  1YXB A;  3ZRW B;  3BRC A;  3CCQ V;  3B8N A;  1VQ4 V;  3JAT A;  2W0X A;  1R3L C;  1SZX A;  3AK1 A;  1G6U A;  3S3X A;  5JJN B;  4JAV A;  3VQY A;  3FKS G;  2Q7E A;  1NI8 A;  1DLB A;  1K73 W;  4H44 B;  3RT3 C;  2CTP A;  1VF5 B;  2YXH A;  4Z1V A;  2YIB D;  1K5Q A;  1UJW B;  1ZAU A;  4JI0 B;  1VQ8 V;  4P9P A;  4F4L A;  4K8X A;  4RAI A;  2HHH O;  3Q4H A;  2QSA A;  5EIB C;  4JGS A;  1OCC C;  2FML A;  2WLK A;  3GVM A;  2X6B A;  4B3S O;  1QLE C;  4GX0 A;  4UCR A;  5IYC O;  1GTO A;  4GYC B;  3J80 N;  3VQX A;  1UPG A;  1YF2 A;  4TQD A;  2OCC C;  4GCZ A;  3BA8 A;  2HG5 C;  2P6J A;  3ZHQ A;  4GKK O;  1JX9 A;  1VIB A;  4X88 A;  3HKB A;  1QR8 A;  3QO5 A;  1V55 B;  4I55 B;  3U10 A;  3N2G A;  5F2V O;  3DXR A;  2BTO A;  2QM8 A;  2KQX A;  4DR7 B;  3CCR V;  2B9Z A;  1XI1 A;  2DQ0 A;  2VRZ A;  4YJ2 B;  4AQY B;  3BY6 A;  4PI2 A;  4J7Z A;  1D5N A;  2Y0I A;  1W2B U;  4WBN A;  2UU9 B;  5IYB O;  3W7T A;  2WLH A;  4FIP C;  4Z1M G;  4W4K A;  5IDJ A;  1R3K C;  1R6K A;  4E2L A;  3HKC B;  4I4T B;  3TXS A;  2UXX A;  2R70 A;  2E75 B;  1JFF B;  3K5L A;  3ABL B;  1XNR B;  5IJ9 B;  3OR7 C;  1PM9 A;  5H6Q A;  1Z2G A;  2RMK B;  1AJP A;  3L70 H;  2DMX A;  3T1C A;  3SYA A;  4PJ0 Z;  4HNA A;  4AIL C;  1M57 B;  4GLX A;  4LF4 B;  3BHP A;  2YID A;  1AJN A;  4IL6 Z;  4OXS A;  2R9I A;  1BT8 A;  3T4Z A;  2IJH A;  4DV0 O;  2HEP A;  3CS5 A;  3CME V;  1A32 A;  1Y6X A;  3MHH C;  3KG2 A;  4O4H B;  3CJH B;  5J2T B;  3M7M X;  1KKC A;  4TV9 B;  3CE2 A;  3CCM V;  5LYJ B;  1PV0 A;  1HNZ O;  1RFY A;  1AP6 A;  5IYZ A;  1OCC B;  1Q82 W;  2ZR2 A;  5FPR A;  1IVS A;  1QLE B;  2ETN A;  3FX7 A;  4B7K A;  4KP4 A;  1KC8 W;  2OCC B;  3D8C A;  3ZMV A;  1H2L A;  1JPX A;  2WWW A;  1Q7Y W;  4LFC O;  3B8M A;  2OYQ A;  3K9S A;  1CEZ A;  4MVM A;  3L9D A;  3ZN0 A;  3T1Y O;  4FLZ A;  3TCU A;  1G1X B;  1KB9 F;  1MZE A;  3ZRS A;  1VQN V;  4JZG A;  2V7Q G;  5LXT B;  4LWS A;  3ZBH A;  3JAS A;  1G4Y B;  2P4K A;  5CBF A;  3HKE A;  2L35 A;  2WPD G;  1WJZ A;  1VMG A;  2BOB C;  4I50 A;  2JJ2 G;  3ZHV A;  2HJF C;  3H1L H;  5FNV B;  3JAK A;  3RYH A;  4H37 A;  3RGB A;  1YSC A;  1MSW D;  2CTW A;  2H3O A;  4FLT A;  2FB5 A;  1L0N H;  3A0B Z;  1IXM A;  4DR6 O;  2QR4 A;  4ABM A;  1SER A;  4JYB A;  1XHX A;  2ILM A;  3J7A U;  3ETD A;  1Y4M A;  5CN0 A;  1JMK C;  1SQF A;  5CB4 A;  3I5D A;  2ZDI A;  2UXB B;  5H9C A;  1GN2 A;  1KMI Z;  3EVK A;  3MHS C;  1CPY A;  4GKJ B;  3G80 A;  3ZS8 C;  3EFF K;  4X1K A;  1WA8 A;  2QJ1 A;  3HKD A;  5E79 Z;  3RVY A;  3CHX A;  3OM3 B;  4DV2 B;  3KKY A;  2PY5 A;  1BCC H;  1Y76 A;  2WA3 A;  3LNN A;  4JZ2 A;  2F4V B;  1RPR A;  2DYR C;  1Q8I A;  1SA0 A;  3APO A;  4GZR B;  2LW7 A;  3OW2 U;  4C7U A;  4BAY A;  1VEW A;  2VWJ A;  2VQE B;  3ETG A;  4B3S B;  3MD0 A;  1HR0 O;  2G38 A;  4JI4 O;  3RWR D;  2EBO A;  4JAU A;  2QWO B;  3ABK C;  3OGI B;  1N32 B;  3OR6 C;  4GKK B;  3AEI A;  3WG7 C;  4XDL A;  4ZHQ B;  3RYC A;  1Q6U A;  1OZ0 A;  3K04 A;  1M1K W;  4DK1 A;  1FFT B;  2P06 A;  1HWY A;  2R9R B;  4B3M O;  4O2A A;  3FB7 C;  3K58 A;  5LGU A;  1TVK B;  1N36 O;  2LW1 A;  1LUW A;  5JCO C;  2QGN A;  1WP7 A;  2UXN A;  5KUK A;  2IBZ H;  2O57 A;  2PI5 A;  4HBN A;  4TWK A;  4UV8 A;  1KD1 W;  1NU1 H;  3JAT B;  2JIZ G;  2OIG A;  3FD9 A;  4R8C A;  3AG3 C;  3E8G A;  1VQO V;  2EIM C;  3JAR A;  3DC6 A;  4DV6 B;  4EKW A;  1YEW A;  3CRC A;  4DV1 O;  4J80 A;  2X0L A;  4CS4 A;  1US6 A;  4LH7 A;  1X4T A;  1WN7 A;  3ZIA G;  4GX1 A;  2Q67 A;  4JPR A;  2JDI G;  3K5N A;  3C3S A;  3CC4 V;  4AI8 A;  4DR4 O;  1EN5 A;  2JS3 A;  1JCH A;  1HW7 A;  5DM6 V;  1Y66 A;  4JI8 O;  3HB3 B;  4JI3 B;  2M6Y A;  1AI5 A;  2Q68 A;  1BS3 A;  2JEU A;  4DW1 A;  2QKA A;  3HKB B;  3NR7 A;  4J9Y B;  4PA9 A;  1YIT V;  3P3N A;  2UUA B;  1PP9 H;  2HR3 A;  4LH6 A;  4LF9 B;  5DEC A;  3N2G B;  3OD4 A;  3DXR B;  1GRJ A;  2DYR B;  2Y4T A;  1NR1 A;  2Y69 C;  1M9N A;  4EB6 A;  3FAV A;  1SET A;  2KG7 A;  4FM2 A;  4PHZ A;  1HNZ B;  4FM1 A;  3K57 A;  1B04 A;  2F43 G;  4L8J A;  1MA1 A;  2QE7 G;  5J2U A;  4D7T A;  2LQT A;  1K33 A;  4X66 O;  2K9P A;  4J42 A;  3TXQ A;  4WFB V;  3ABK B;  2F93 B;  4I0X A;  3WG7 B;  4JTD B;  3E86 A;  2WLL A;  4G28 B;  1HNX O;  1KBH A;  1EN4 A;  2ITC C;  1FXK A;  4MW8 A;  4X20 A;  4LF7 B;  2JVD A;  2A3Q A;  2IU3 A;  1H2M A;  3CRQ A;  1FPO A;  3M99 B;  3G4S V;  4NXM O;  4ZKI A;  2A7W A;  1P7G A;  1K4D C;  4PEL A;  1KYO F;  2ZT9 B;  4A5U B;  2EX3 A;  1WPX A;  2CTR A;  2D2C B;  3AG3 B;  4DR3 B;  1WLE A;  4DW0 A;  5K1P A;  2EIM B;  4O2B A;  1JR9 A;  3E8B A;  4DR6 B;  4NYK A;  2V4D A;  4EFB A;  2WA4 A;  1IDS A;  3K9A A;  4YY3 O;  3SJB C;  5L3B A;  4JYA B;  1V9P A;  4MTG A;  3OAA G;  1I5Y A;  3H1I H;  1IZ3 A;  2QDO A;  2XHB A;  5IYZ B;  5DED A;  4J9Z B;  1ROP A;  5LL6 Y;  4JV5 O;  1URF A;  2PF4 E;  4F6R A;  1QHT A;  4MVU A;  4RUF A;  1S72 V;  1EFR G;  5LA6 A;  5L3G A;  1QBZ A;  1X59 A;  3JAL B;  4PDM A;  3E22 A;  1M56 C;  1LR1 A;  4NXN O;  3RYI A;  4LWS B;  3IGA C;  2Y69 B;  3JAS B;  5JH7 A;  1XUQ A;  4I50 B;  1R3I C;  4RO2 A;  4P9O A;  2QTO A;  5CA3 A;  1HR0 B;  4YIO A;  3RYH B;  5BMV A;  4OPH A;  1J5E B;  3SYO A;  3D3I A;  4DRX A;  5LMN O;  1FXH A;  3K08 A;  1Q43 A;  3JAW A;  3QVN A;  5LOV A;  4IIJ B;  2M7W A;  2UXC B;  2XAJ A;  4R50 A;  3G6B A;  4UV9 A;  4CBC A;  3M8A A;  4NTW A;  3WB2 A;  4B3M B;  1K92 A;  2ZM6 O;  5CB4 B;  2HJD A;  2OTJ V;  1N36 B;  2IH3 C;  2CGN A;  2JGD B;  3ETQ A;  3CCV V;  2RQ6 A;  2XUM A;  4DUZ O;  3UCS C;  4JI6 O;  1XMO B;  1IBK O;  1Q81 W;  5CA1 A;  4FM0 A;  4U3F H;  4X1K B;  3HKD B;  3I55 V;  3E8F A;  4CS3 A;  3NXS A;  4K35 A;  4DK0 A;  1D5A A;  3SGI A;  3KCX A;  4DV1 B;  1HP8 A;  2XOK G;  3OEE G;  1D2D A;  5KUM A;  1M57 C;  4U3J A;  4JI5 B;  1HNW B;  1SA0 B;  3OFN G;  4IHJ A;  4EFE A;  1VAR A;  2HFE C;  4DR4 B;  3IC9 A;  5K1X A;  3GWK C;  4TOI A;  1M93 A;  3ML0 A;  2JEX A;  4FMT A;  4BIZ A;  3B40 A;  2F95 B;  4DR2 O;  4JI8 B;  1WNS A;  1P84 F;  1QU7 A;  4RWU A;  2Z0A A;  2LJ2 A;  1XOU A;  1RSO B;  4LBE C;  4DV7 B;  1KU9 A;  4K0K B;  4W4L A;  1AP5 A;  2ZIM A;  1ZTE A;  3RYC B;  2GDS A;  1B06 A;  2ZCE A;  2ITD C;  1DGS A;  4TQF A;  1FXK C;  1M56 B;  2PZS A;  3ZHU A;  4O2A B;  3OE7 G;  4UCO A;  4HZ3 A;  3TGU H;  1VQ5 V;  2KB1 A;  1QNM A;  3F5T A;  4JF3 A;  1AR5 A;  2HKO A;  1R6T A;  4RQF A;  4QPJ A;  4X66 B;  5IJ0 A;  1AR1 B;  3JAR B;  1K3E A;  2UXD O;  4BW5 A;  4KHP O;  2VWK A;  2RDC A;  5EYP A;  4YIP A;  5FLX N;  1SC5 B;  4JAA A;  2LFS A;  3OEH G;  4CH3 A;  1GO3 F;  5H6R A;  3T2M A;  3W7U A;  4DV4 O;  5JJJ B;  4RUE A;  3JD4 A;  5GTH Z;  1HNX B;  4P30 A;  2EIJ C;  2FTK A;  4H0L B;  3ABU A;  5B5E Z;  4NXM B;  2P7T C;  4DV5 B;  5C8Y B;  2A0L A;  1S0V A;  2QWN B;  4DV3 B;  1YJN V;  3JD0 A;  2HLD G;  5LGT A;  1THZ A;  4BIO A;  1K34 A;  1TUB A;  2PTM A;  3B2E E;  4B3R O;  4BIU A;  4ZBM A;  2GTA A;  3BAA A;  5EBW C;  2DJV A;  5LHI A;  4QPK A;  1BHB A;  3CP1 A;  4G2K A;  2NNU A;  2UUB O;  4DR1 O;  2IJJ A;  1M90 W;  1NS1 A;  5KAI Z;  4EB6 B;  1KUQ A;  2PYJ A;  1TUE B;  2Z5U A;  1GM8 A;  4LF8 B;  1IUR A;  5IT9 N;  4PA4 A;  4X65 O;  3JSN A;  2EJ7 A;  4UXN A;  2JRI A;  2LP7 A;  4UCU A;  5J2U B;  4XDK A;  4PDL A;  3ICX A;  3W7X A;  3OMN B;  3ZN1 A;  3F7V C;  1QQC A;  1VQ9 V;  2A9H A;  1ZWI C;  4I0X B;  3SYP A;  2WLL B;  4OX9 B;  1NBM G;  5BR8 O;  1SQX H;  1ZSP A;  4NXN B;  1YHQ V;  1YDX A;  1BQ0 A;  1TA8 A;  1FXK B;  3E83 A;  4LCU C;  3O65 A;  3OUS A;  4TV8 A;  2HP8 A;  1YJW V;  1XNQ B;  2AZ2 A;  1NR7 A;  4J11 A;  3T1H O;  3H1K H;  5LBQ A;  3SR2 C;  1DTO A;  4DUY O;  4LF6 O;  2ZE8 A;  4O4J A;  5LMN B;  1YJ9 V;  4H13 B;  5GTI Z;  3RFR A;  4JI1 O;  1SKV A;  3TET A;  3D36 A;  4PI0 A;  4KL1 A;  2YIA A;  2YC0 A;  3TJT A;  5BXZ A;  5JQG B;  1Q90 D;  1YCI A;  4BW9 A;  2ZM6 B;  2EIJ B;  3IC7 A;  3AG2 C;  1S3J A;  4FLV A;  4PDV A;  1FAF A;  1IBM O;  2DQ3 A;  4CH5 A;  4DUZ B;  2X6C A;  1Q6H A;  4JI6 B;  4MT8 A;  1IBK B;  1N34 B;  3CD6 V;  2ZXW C;  4F6R B;  1IX9 A;  1Q5O A;  1PD3 A;  1SZT A;  4PDR A;  1GM9 A;  2LGW A;  3F7Y C;  3DC5 A;  4UFZ A;  2PUS A;  3LDD A;  2CE4 A;  3QO8 A;  4DO2 A;  1K8A W;  2WLM A;  1FJG O;  1WB8 A;  4UB6 Z;  4FLW A;  4KXR A;  3JSL A;  5KHJ A;  4WFG A;  2MW2 B;  3E22 B;  5CA0 A;  4R6Z A;  2RN9 A;  2F66 C;  1VQL V;  3I56 V;  1FD9 A;  1VQ6 V;  1PL4 A;  3QF7 A;  1I94 O;  3LDE A;  2XAF A;  4UCS A;  3FB6 C;  2ZIN A;  1WP8 A;  2D3O W;  1BQZ A;  3B09 A;  1F51 A;  1SQG A;  4DR2 B;  4TUY A;  5L3E A;  3L75 H;  5BMV B;  1YIJ V;  1GN3 A;  2XND G;  2HHH B;  4DRX B;  3LUT B;  2ARH A;  1AR4 A;  2N04 A;  1KEC A;  3ZRW A;  4WF9 V;  1XDC A;  1W0J G;  1OJH A;  4QJF B;  2UUC O;  1Q3E A;  1RM1 C;  5IY5 C;  2CK3 G;  2C2A A;  3B77 A;  1OV9 A;  1XBL A;  1ZX3 A;  2IJK A;  4X62 O;  2GUZ A;  4WFH A;  4DXW A;  2QWR B;  5KHH A;  2KKW A;  5KAF Z;  3ASN C;  3SPI A;  1XIL A;  3ZX6 A;  1NQT A;  3UO2 A;  3UM7 A;  1K5S A;  1XRE A;  4FZ0 A;  5CA1 B;  1QCE A;  2WLJ A;  3RBZ A;  4GX5 A;  3CWB H;  3OGC C;  3UT5 A;  3MAQ A;  1DK1 A;  4KHP B;  5LMU O;  5KHK A;  4YHH O;  4LFA O;  3K06 A;  2AW9 A; 
#chains in the Genus database with same CATH homology
 4J7K A;  4W4L A;  4J42 A;  4J11 A;  4IYI A;  2GTS A;  4IYH A;  4J10 A;  4J41 A;  4KXR A;  2G38 A;  4W4K A;  4J7J A;  3FX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...