4IYHA

The crystal structure of a secreted protein esxb (semet-labeled, c-term. his-tagged) from bacillus anthracis str. sterne
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
IKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (SeMet-labeled, C-term. His-Tagged) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 30
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4iyhA00
4J42A 3FX7A 4KXRA 4IYIA 4J41A 4J7JA 4IYHA 4J10A 4W4KA 4W4LA 4J11A 4J7KA 2G38A 2GTSA
chains in the Genus database with same CATH superfamily
2X7RB 3FKSG 3B8NA 4PA9A 4TSFG 1VIBA 2QE7G 3B40A 4JI1O 1PNMA 3N2KB 2QWRB 1K9MW 2GDSA 4UVCA 4FLXA 1GH6A 3A0HZ 4YY3B 1HNWO 3ABKB 1KD1W 1GN4A 3K9AA 2IJHA 2KQXA 4DV4B 2WLIB 4PA7A 1S3JA 1VF5B 3OTOO 5BMVA 1L1FA 1B06A 3LDEA 4QGPA 2UUAB 5L3CA 5CB4B 5LXTA 1H8EG 1V9PA 4AI8A 1R3LC 3AG4C 4NR1A 2ARHA 4YXWG 3ZMSA 2WLLB 2UXDO 4PJ0Z 4DV5B 1M9NA 2A7WA 2ITDC 3E22B 4RQFA 2RNBA 3ABMB 4G2KA 4PELA 3QO7A 2Q0AA 2XT9A 2ZE7A 2LJ2A 5LMNO 3KCXA 2IBZH 4X1YB 5IWAO 1NU1H 4X66O 4DV3B 2F4VB 1GN2A 4BAYA 2XAGA 2CK3G 2ILMA 1JX9A 2LQTA 3AG3C 1QU7A 5JCOC 4NTWA 4TUYB 3FAVA 3OM3B 2QJ1A 5IJ0A 4PA4A 2V7QG 1OCOB 2BSKB 1IX9A 4RQEA 2LP7A 4TOIA 3GB7C 1HW7A 4UCSA 1F7YA 1Z2GA 2ZD9A 5EZYA 2ZNIA 4HZ3A 4F6EA 1Z5WA 4YY3O 4N23A 5LMUB 1RP3B 1IBKO 2Y4TA 1URFA 1S76D 5H6QA 3K04A 1KQSU 2WLMA 2RQ6A 4X20A 5AG2A 1ZX3A 1EN4A 2F43G 3MAQA 4LF9B 4PDLA 2UUCB 2YC0A 5DECA 3JATA 2UUAO 3P30A 3A2FA 1YSCA 4L8JA 3Q4HA 2GUZA 2EULA 2UU9B 1H38A 1P7GA 1IZ3A 1CEZA 4J10A 1YZBA 4OGQB 5L3BA 1XHZA 1WPBA 1YHQV 3T1HO 2VRZA 2Z3YA 3CC4V 1MZFA 3AK1A 3O65A 3QVNA 3IC7A 5LXTB 4G27B 4QE7A 3CCQV 3J7AU 4HNAA 4UUJC 1VQOV 5J2UA 1E1RG 1M57B 2XAJA 2ZINA 4UVBA 4JI8B 5GONB 3MHHC 4JI3B 1H2GA 2BCCH 4NVPA 1HNXB 5C8YB 3ZRWA 4O4IB 4QNHB 2LGWA 4YIOA 2UXBB 2QWQB 5CA1A 5B5EZ 2RJZA 4XDLA 5B66Z 2HJDA 3N2GB 3K79A 1DGSA 4ZHQB 3CPWU 4H0LB 2Q0OC 3E86A 4MS2A 2W6JG 5H2FZ 5A9GA 4UB6Z 3TXQA 3AG1B 2ADPA 2ODMA 2ETNA 3K5MA 3UT5A 1XNRO 4O4LA 4MTOA 4DV7O 4LF9O 5EZYB 2UUCO 5KHKA 2FL4A 3DTUB 1M56C 3W7XA 2PI5A 5D5PA 4DR6B 3CCJV 4X1IA 2Y4UA 1WPXA 1FXKA 1I94B 4W4LA 2AGAA 4YIPA 3ETQA 3E2EA 3L74H 1MSDA 1JR9A 3SPJA 1BGYH 2DE0X 2DMXA 5KX5A 5FNVB 2OWOA 4NXNO 4YHHB 4P30A 3ZRSA 1Y66A 2GUZB 3AG7A 1YIJV 3ASOB 1NBMG 3I55V 2E5LO 5BXZA 2VQFB 2PTMA 4JZ2A 4B3MB 4B08A 3JCZA 4CS3A 4X65O 1IBMB 5IYZB 4D7SA 2YXHA 1AILA 3L71H 2FTKA 3OGCC 2UXBO 3I5DA 3CSXA 3HB3B 5LOVA 1GRJA 2UUBB 1U97A 4WBNA 2YXLA 2QTOA 4K35A 3K0GA 1Q6UA 5B1BC 5J2UB 2WLKA 4O4JA 2R70A 4AQYO 2M6YA 1R6KA 2ZR2A 2YIAA 4DUYB 3E8GA 1VMGA 1WLEA 2AZ2A 5JWPA 2OCCC 4UV8A 1JMKC 4TWKA 3FB8C 4DR5B 1KBHA 4JAVA 4JYYA 3BRCA 1FKAO 1VQ5V 4PA6A 4DR6O 2P06A 4DV1B 1QBZA 1JOYA 1FFTB 5KAFZ 2GTAA 1QLEB 2XAFA 3M99B 4OPHA 3UT5B 4MVOA 4O4LB 4I9QA 1ZAUA 2KG7B 1K34A 2EJ7A 3LNMB 3UCSC 2E76B 3TJTA 1SF9A 4DV2B 4BW9A 1E1QG 3WG7B 5LGUA 4PI0A 1TVKA 1N34B 1WNSA 3DGEA 2BE3A 2DYRC 5FPRA 4QIWF 1FXKB 4JYCA 2E74B 3RT3C 1FFXA 4I9WA 2JJ2G 4WF9V 4JYBA 2VQFO 1PM9A 2B9ZA 4B3MO 5KX5B 5B3SC 2WLJA 2UUBO 1Y67A 4PDVA 4DR2O 2ZM6B 3F5TA 2Q68A 3P3PA 4U7NA 1H2KA 1S5JA 3RYHA 4NB5A 3TK1A 5LGNA 5KHGA 2HJFC 4DUYO 2JRIA 2CDYA 5KMGA 1UPGA 1K73W 2CUGA 2PI4A 5LOVB 1PD3A 3AG2B 4DR5O 3JARA 4LFBB 4RAIA 5KAIZ 1VP7A 2Q69A 4UCOA 4JI6B 3X2QB 4X64O 3BA8A 4TV8B 1NJIW 1XBLA 4GX2A 3RVYA 4DV1O 1KYOF 1N8RW 2GSMB 5FPOA 1XQ8A 1D5AA 4DUZB 4JTCB 2EIMC 1BHBA 2Z0AA 4O2BA 1NS1A 1WN7A 2IJJA 4DV2O 5B1OA 1OHHG 1P84F 4JI5B 3ZMTA 3W7UA 3JALA 1O9GA 1NI8A 3SYQA 2ZR3A 1N4CA 2HHHB 1N34O 1BMFG 2QKSA 2QWNB 1T5EA 4B3RB 4O4HB 1VEWA 2DJVA 1VQKV 1TUBA 4PHZA 1M5IA 1O9HA 3BEHA 4PA3A 4GKKB 2E75B 2A9HA 2JS5A 1IXBA 2PUSA 3U10A 3SYOA 2WA3A 1TVKB 1W59A 4DV6O 1XMOB 2EILC 4OXSA 3P3NA 2ZM6O 2PZSA 5LYJB 4EFEA 4FFBA 4ZOLA 4HBNA 1XNQO 1I5XA 1BSMA 2V4DA 5D5QA 1R1BA 2EIJC 3ABTA 4BIOA 1DF4A 1SA0B 1DLBA 4ABMA 3QTCA 1WB8A 1PPJH 2Y69B 4MVMA 4JAUA 1Q82W 3CRMA 2A79B 1PP9H 1XL4A 4GUNA 4FVMA 4GX0A 1RSOA 5F2VO 2XHBA 1J5EB 4LNUA 4TQDA 4LFBO 4JI4B 3SYPA 1N33B 3E8FA 2BOCC 5CBFA 4JI6O 4JV5O 3UO3A 3SJBC 3J80N 3SPHA 4LF6B 4J9YB 2QGNA 4LWSA 4JASA 4EB6A 2JGDB 3THOA 4B3TB 4ZIBA 3UKMA 4DUZO 2CGOA 4MW8A 3ZBHA 2DW4A 3DXRB 3CEIA 2EZOA 4KHPO 1OCRB 4QE9A 3RYCA 4R7CA 4JI5O 2WWWA 1I08A 1K33A 4FM1A 1AI4A 3K57A 1J95A 1S5HC 2V1DA 1I0HA 4MW3A 4Q6GA 2DQ3A 4LBEC 5CA0B 2PF4E 1PL4A 4IYIA 5K1PA 4O2BB 3IC9A 1YI2V 4UXNA 2Q9LA 2XOKG 3RYIA 1PNKA 3K5OA 3SPCA 3HKDA 1NTKH 4WCEV 3JALB 3BA9A 3K3WA 1Y6XA 3CJHA 5LP6B 1XMOO 1ZUQA 1B04A 2BTQA 1KECA 4JYAO 3OD4A 4X62B 1BE3H 1AP6A 1X4TA 3EXAA 1FJGB 2ZE6A 5IYCO 3UO2A 4PV1B 2YUAA 2EX3A 4FK5C 2ZQMA 1MOFA 4TV9A 1DTOA 4NTYA 2ZIOA 2ZE8A 1NT2B 2FB5A 1J5EO 5DN6G 3A0RA 4ZOLB 4GYCB 1AVMA 3K59A 2MK3A 1VQ7V 3KZIZ 3B4SA 1AR4A 3ICXA 1XI1A 5H5NA 5GW7A 4Z1VA 4B3TO 4DR3O 4NXMB 4UCVA 3H1KH 4LNUB 4E4EA 2R72A 1KMIZ 4LFCB 3CX5F 2IH1C 5E1AC 4G28B 1Y4MA 3C90A 2Q7HA 2KSDA 3F7VC 2OTJV 4EB6B 2P22C 5B1AC 3D3IA 5IDJA 2WA4A 3HKBB 1V55B 3ETDA 1B3QA 1SC5B 1ZL8A 4JAAA 2HKOA 4J7JA 1S77D 5H6RA 5EYPA 4LH7A 3TGUH 1LUWA 1V54B 3RVZA 3SYCA 3W7SA 5H9CA 3T1CA 1K7DA 3HKCA 5B1NA 1JQ0A 3WU2Z 1ORQC 1ZLZA 4B3SB 2YXYA 1Y74B 3SYAA 1ZSPA 4JPRA 4PI2A 3CJHB 1SQFA 2IW5A 5HFLA 5TISZ 1I7FA 3H01A 4UB8Z 1X59A 1XDCA 3K5NA 2CTWA 2Q7GA 1RM1B 1SQXH 1SZXA 2G38A 1WP8A 1GN3A 2JVDA 4B7EA 3LUTB 2YSUB 3FFQA 1JJOA 3RWRD 4DV4O 3P32A 4IIJA 3HKEA 1QNMA 4BIUA 3ABKC 4PDRA 5CMUA 3O9OA 5KHJA 1FPOA 1QQCA 1TGOA 3BHPA 2XNDG 1SQQH 2R9AA 4CS4A 2WLNA 5K1XA 4DR1B 1DK1A 3ABLB 1Q6HA 4DV5O 5EIBC 1VQ8V 5BMVB 3L70H 3VBBA 4R6ZA 1GO3F 4I5SA 1Q8IA 4J7ZA 5LA6A 3SDLA 1YF2A 5L3DA 3ZHQA 4CC5A 2CTRA 1SERA 1M93A 3KCYA 4B3SO 4DV3O 2F4VO 1TA8A 5JJEB 1KP2A 4B7KA 3ABMC 1HWYA 5EBWC 2QM8A 4K8ZA 5EYPB 1COWG 2CAZC 3PN1A 1QHTA 2Q6AA 2VWJA 2F66C 4WFBV 2F93B 3D36C 4U3FH 2Y0IA 3HKCB 3IAYA 4YJ3A 1PKXA 3GWOA 2L35A 1VQLV 3LDDA 3K9SA 3DSQA 3U11A 5LMUO 1EZVH 1OCOC 2CH7A 4OX9B 3JD1A 4EFBA 3JAWA 3FAVB 1UJWB 3FYEB 5IJ0B 1GAXA 3H9VA 4I0XA 2JEUA 3R66A 1WP7A 4KP4A 5J9PC 4QPKA 4MTXA 4BR6A 3F7YC 3LSUA 3ZJZA 5LHHA 2VQEB 5CBHA 1Q43A 3ASNB 3CCVV 5FL7G 2Q7EA 1GM9A 2QM4A 1QR9A 2UU9O 2HVKC 1SETA 4J80A 4X20B 4DR1O 4IIJB 3HKEB 3DC5A 1QLNA 3JATB 3CXHF 4Q20A 4JTDB 1M1KW 3Q4HB 3H1HH 1Q90D 3K58A 4GT1A 3ABLC 2YI9A 2Z5UA 1N36B 4JI8O 2EINB 4JI3O 1MSWD 4KUMA 1HNXO 1XOUA 2JEXA 3OMAB 2RCVA 1M57C 1NZ6A 4DK1A 4QPJA 1NH2D 5LA6B 2UXXA 1QVGU 1EN5A 3WB0A 4HNAB 4UCRA 4J9ZB 4IHJA 5J2TA 4FZ1A 3J81N 1NTZH 4FLYA 2K9PA 2FKXA 2JS3A 3ZRWB 5JJJB 2YS8A 1H2MA 1WJZA 2QWPB 4OX9O 3RYFA 3JCUZ 3OR7C 5CA1B 3CCUV 2ADQB 1XEQA 4HYOA 3KG2A 4X1KA 2PYJA 1DF5A 3AG1C 3T1YB 5BY1A 2W0FC 3TCUA 4H37A 4U3JA 2LW7A 3D8CA 2CTPA 1I94O 5JQGA 1YTFB 2PGGA 4J11A 4LF4B 1U96A 1OJHA 1L0LH 5JVDA 2IJIA 1MZEA 4WFHA 5IY5B 1W0KG 3RW0A 4YHHO 1OCZB 4DW1A 4W4KA 4X1IB 3L9DA 4LR3A 1YCIA 1B6QA 1K92A 1GK9A 2JJ1G 5KUMA 3ZHSA 2N74A 4IL6Z 5LL6Y 3CWBH 4I4TA 2YICA 4XDJA 1IBMO 1M90W 2P6JA 4DR7B 3DC6A 2VS0A 3ASOC 2YEVA 3K08A 1OCCB 5KLVH 4FLZA 3U0ZA 1GM7A 2R9IA 3BABA 4WFAV 4RUFA 4GZRB 3E35A 2FYUH 1VQMV 3WB2A 1JFFA 4WBNB 1AROP 4O2AA 4FM0A 4EEQA 5J2TB 1VQPV 4O4JB 1YITV 2QKCA 1YJNV 4L87A 3OTFA 3JASA 3RFRA 4JI0B 3CXCU 2QA4V 2HLDG 3IFXA 3OR6C 1SQGA 4FLVA 4JF3A 3CC2V 3H1IH 3JAKA 1G6UA 3UM7A 1YTFD 2LFRA 2Q67A 2A0LA 2ZXWB 1QLEC 3JYCA 1BQ0A 5E79Z 2XAQA 1VARA 3OFNG 5CN0A 4RO2A 1P4RA 4K8XA 1FYJA 2NNUA 4XBFA 2EIKB 3GWKC 3WG7C 3ZS8C 3BY6A 3RGBA 5JVDB 1YJWV 5IE9A 4CH6A 1K97A 5LHGA 4DR7O 1FXKC 2LGQA 4LC1A 5JCOA 4BW5A 1VF6C 4LF8B 1XL6A 1R3IC 3BPZA 4K0KB 2X6CA 2QWOB 4MVQA 1HP8A 3MHSC 1FFXB 4I7ZB 3VQXA 1F51A 2Y48A 4KL1A 4R50A 4MVZA 2RMKB 3WB1A 4MSWC 1FAFA 1SQBH 5C93A 4IGGA 3JSNA 3N2KA 2GTSA 3B09A 1EBOA 3OUFA 2YI8A 2HG5C 2EBOA 2B1GA 1MG1A 3RYHB 4JI0O 4FM2A 5GTHZ 4HAMA 1VQ6V 4LCUC 4TT3G 3AG2C 4I55A 4WFFA 5KMGB 4DK0A 4JI1B 1FXHA 2WLIA 1D2DA 3X2QC 4O2AB 3JARB 5JH7A 2OIGA 3QG5A 3I56V 5L3GA 1JA8A 3E8BA 2HHHO 1ENVA 2A3QA 3JD2A 5KHIA 4X8AA 4B3RO 4YJ2A 1HNZB 2WLLA 4IYHA 4GX1A 1Q3EA 1H8HG 1P7BA 4GKKO 3BVOA 3RBZA 4EKWA 3ZMUA 3OTOB 4TQFA 4J42A 3CCMV 3E22A 1KUQA 2QM7A 2MW2B 4K0KO 4MTGA 1IDSA 2JK5C 4NKGB 4X1YA 5BR8B 3D36A 1BCCH 1TUBB 1KU9A 2ZDIC 5GTIZ 4ASUG 3M7MX 4MVUA 3CCLV 2LO1A 4PD4F 4TUYA 2ZCEA 3SJQC 2P7TC 3FB6C 2ATKC 2X6AA 2CE4A 2BSKA 1F4MA 2Q4PA 3ZHTA 3APOA 3CS5A 5DEDA 3OEEG 4JI4O 4FFBB 1N33O 4CBCA 1RPOA 4P2ZA 3SJCC 4LF6O 4UCTA 4UCUA 2WPDG 2Y69C 1BS3A 1FD9A 3IGAC 2WLHA 3OEHG 1WB7A 1NR1A 1EM1A 2YIBA 2E3CA 2A06H 1VQNV 5JJNB 1RSOB 4A5UB 3UQ8A 3JD3A 1K4CC 1A32A 3CHXA 3SPGA 3FX7A 4J41A 4LWSB 1IXMA 2EJRA 1IBKB 1NVPD 4GCZA 2IH3C 4I55B 3NXSA 2DOSA 1OCRC 2DQ0A 1HNZO 2AHZA 3B2EE 4F4LA 1NKDA 2F95B 1W2BU 2K1EA 1AR1B 5JH7B 3RYCB 2H94A 1NTMH 2R9RB 4FIPC 3OGIB 5EC1C 4X9QA 3STZC 4RWUA 4YJ2B 5GONA 4LP8A 4X62O 2OCHA 4D7TA 5LHIA 5BR8O 2P4VA 3RYIB 1FJGO 5C8YA 3ZHRA 4O4IA 3L72H 3T1HB 3ABUA 3HKDB 1K3EA 5LP6C 5L3FA 2QTSA 3ZRXA 3L75H 3N2GA 1AR5A 5KUKA 2BTQB 4ZHQA 1AJQA 3EFFK 4JTAB 3ZX6A 3SGIA 5EC2C 4FZ0A 1SQVH 5EK0A 3G4SV 4ICGA 1N0NA 4ZBMA 1NQTA 2XUMA 2P90A 2XTAA 2QSAA 4BWAA 1PL0A 4H13B 4UVAA 4TV9B 1JPXA 3CRRA 4NXMO 5IT9N 3CRQA 2DYSB 1SKVA 3QO5A 2XAHA 3OW2U 4LFCO 4NYKA 2IM9A 4AILC 1H2LA 3CE2A 4N21A 1XREA 1M56B 4WFGA 2RDCA 2O57A 1Q6IA 3CCEV 1XNRB 2PYLA 3AK3A 1Q7YW 4K3AA 4JZGA 4DV7B 3GVMA 2OYQA 4DRXA 2OT5A 4CH3A 3CMAV 5FNVA 3JD4A 4FLTA 4NTXA 5CBGA 3VQVA 1V55C 4FLUA 5EIBD 1MMMA 1R6TA 4JI7B 1FS0G 3LNNA 1ZWIC 3EHBB 3FB7C 4MVSA 2NN4A 1SQPH 4FJCC 4X89A 3H1LH 5IYZA 1ZL8B 3BCCH 1V54C 1AI5A 3CCSV 1NH2B 1S72V 4NXNB 2AHYA 2YIDA 1ROPA 3E83A 1Y76A 2AZ0A 1KKCA 2ZT9B 2E5LB 3K06A 1S0VA 5B1BB 2RN9A 4X65B 5EBMC 5IYDO 3PJSK 3TXSA 5L3EA 2BOBC 1YXBA 2IU3A 2EZPA 3CRAA 3ZRVA 3HR0A 4CC6A 1RM1C 4XDKA 3T4DA 3NR7A 2OCCB 3S3XA 3ZMZA 1OV9A 4AQYB 4X88A 3T4ZA 5CA3A 1AB3A 3CB2A 3JSLA 2Y0PA 2DYSC 3CMEV 3WFVA 2KG7A 1F23A 3F5WC 3MDSA 4I50A 2JGUA 1QVFU 2YIBD 2FMLA 1SESA 3CD6V 1US6A 1R3KC 3K0DA 2JIZG 2CTQA 2P67A 3APQA 3T2MA 4OPAA 4CH5A 1VF6A 3JAMN 1EZJA 4JI7O 4UV9A 2DYRB 1AI7A 4MT8A 3JD0A 3ZHUA 4DRXB 2NLJC 1D5NA 1XHXA 1BQZA 1IVSA 1Q5OA 2HR3A 1LNQA 4Z2WA 4JI2B 1MA1A 2GHYA 5B3SB 1I5YA 1LUVA 3MD0A 4P9PA 4CS2A 2UXCB 5KA5A 3W7TA 4U7OA 3EVKA 3BFRA 4P9OA 3ZEDA 3A0BZ 3B8MA 3E8HA 1SZTA 4ZI7A 2P4KA 5ITZA 1KKDA 4KXRA 4DYLA 3E89A 1XMQB 2OTLV 1L8DA 1GMGA 1MNGA 2WAMA 4DR2B 2F23A 3K5LA 4RUEA 1Y76B 2QKAA 1Q86W 4LF5B 3CRCA 2ZIMA 3ZMVA 4TV8A 2VQEO 4YJ3B 3ZIAG 1VF7A 1PNLA 1R6NA 1WA8A 4Z1MG 2CH7B 3OT7A 1TUEB 3JAWB 1AJNA 1UFIA 1IBLB 1JJ2U 2C2AA 3G80A 4I0XB 3RN4A 4FPPA 4D6TH 2QEXV 1TAEA 2EIMB 4MVRA 3ASNC 4X64B 3QNEA 3OAAG 3W7WA 5FLXN 3FD9A 1EFRG 1S5LZ 1VQ9V 2D2CB 2ZNJA 2B5UA 1H2SB 1N0JA 4F6RA 4O4HA 4GX5A 5BZBA 3ZHVA 1N36O 2HFEC 4AHCA 4GKJB 3H1JH 2GV9A 4I50B 3D3QA 2M7WA 2ZDIA 1L0NH 2Q8VA 1H2NA 3FYIB 4H44B 3AK2A 4JI2O 4CZZA 3OE7G 1KB9F 1BZKA 1BT8A 5LYJA 2UXCO 3LDCA 2EINC 1E79G 2EILB 1PV0A 3G6EV 1SA0A 4DV0B 1Q81W 2XASA 5KA6A 2JDIG 5A2QN 4LH6A 1GM8A 2EIJB 2ITCC 1XMQO 4MTFA 2H8PC 4DXWA 4PDMA 3QF7A 4DV6B 2QR4A 2N05A 1WAZA 1HDJA 1CP9A 1XNQB 3B77A 4C7UA 3G71V 4LF5O 4IHJB 1R73A 1QCEA 3CYOA 2AXTZ 4ZI7B 1G4YB 3T1YO 2LFSA 5ITZB 3TETA 3OUSA 2JGDA 5HFMA 3IJ4A 1THZA 1XUQA 3RYFB 3DXRA 4H33A 2HP8A 1IBLO 1CXZB 2ZKOA 2F1MA 4LFAB 4LF4O 3ZCCA 4KFMA 3N27A 4X1KB 1K4DC 4JV5B 2B1IA 1ZTEA 1YVWA 2H3OA 1W0JG 2HEPA 5IJ9A 2W6IG 2DN9A 4U3JB 2X0LA 3G67A 1WA8B 4DR4B 3VQWA 5CA0A 2P5OA 1EN6A 2CGNA 1N32B 4KHPB 4R8CA 2N04A 2IJKA 1R3JC 4JGSA 5JQGB 4GKJO 1M4UA 2NR5A 3S3WA 1RPRA 3SJAC 5IY5C 4ZKIA 1OCZC 2YDEA 3CCRV 3SR2C 2VWKA 1MABG 1GN6A 3BAAA 2X6BA 5LP6A 2QDOA 1NR7A 2HVJC 4LF7B 4F6RB 4GLXA 4DO2A 3OMIB 5LBQA 1JVMA 4WFEA 4DV0O 1RFYA 3AEIA 4BIZA 1HR0B 1XILA 2W0XA 4I4TB 2AW9A 1OCCC 1Z5VA 4IT5A 1AI6A 3ETEA 3OMNB 1F4NA 2YEVB 4JYAB 4DW0A 3HPLC 1YDXA 3STLC 3VOUA 2D3OW 2IU0A 1YEWA 1JFFB 1G8MA 4LFAO 3G6BA 5EBLC 1K8AW 1GKFA 1LR1A 2Q5ZA 1AP5A 3SPIA 1IURA 1NVPB 5CB4A 2L6LA 3JASB 3CC7V 1VQ4V 4FFKA 1HNWB 3M8AA 4FMTA 1OZ0A 5DM6V 4DR4O 3HKBA 1N32O 4DR3B 5B1AB 1G1XB 2ZE5A 1P49A 3AG4B 3C3SA 1BL8A 1K5SA 3JAKB 1KC8W 2DWDC 2ZXWC 1AJPA 1CPYA 5LGTA 2LW1A 2KKWA 5KHHA 4QJFB 1SS3A 5IJ9B 2KB1A 5IYBO 2PY5A 1FXVA 4LF7O 4LF8O 3VQYA 3ZN1A 1YJ9V 4J7KA 3CP1A 2EIKC 2OIEA 3R65A 2GBOA 3A8TA 3K03A 2UXDB 1K5QA 3LSQA 1Y74A 3L73H 1HR0O 3ML0A 3QO8A 1BHAA 4UFZA 3C3TA 4E2LA 2BTOA 2Q73A 2UXNA 3AG3B 2DWEC 4FLWA 1QR8A 3ETGA 5LMNB 3FB5C 2WSSG 3LSSA 1SRYA 1JCHA 5IWAB 1KP3A 1GTOA 4X66B 3ZN0A 4CH4A 3KKYA
chains in the Genus database with same CATH topology
4J42A 3FX7A 4KXRA 4IYIA 4J41A 4J7JA 4IYHA 4J10A 4W4KA 4W4LA 4J11A 4J7KA 2G38A 2GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J42 A;  3FX7 A;  4KXR A;  4IYI A;  4J41 A;  4J7J A;  4IYH A;  4J10 A;  4W4K A;  4W4L A;  4J11 A;  4J7K A;  2G38 A;  2GTS A; 
#chains in the Genus database with same CATH topology
 2X7R B;  3FKS G;  3B8N A;  4PA9 A;  4TSF G;  1VIB A;  2QE7 G;  3B40 A;  4JI1 O;  1PNM A;  3N2K B;  2QWR B;  1K9M W;  2GDS A;  4UVC A;  4FLX A;  1GH6 A;  3A0H Z;  4YY3 B;  1HNW O;  3ABK B;  1KD1 W;  1GN4 A;  3K9A A;  2IJH A;  2KQX A;  4DV4 B;  2WLI B;  4PA7 A;  1S3J A;  1VF5 B;  3OTO O;  5BMV A;  1L1F A;  1B06 A;  3LDE A;  4QGP A;  2UUA B;  5L3C A;  5CB4 B;  5LXT A;  1H8E G;  1V9P A;  4AI8 A;  1R3L C;  3AG4 C;  4NR1 A;  2ARH A;  4YXW G;  3ZMS A;  2WLL B;  2UXD O;  4PJ0 Z;  4DV5 B;  1M9N A;  2A7W A;  2ITD C;  3E22 B;  4RQF A;  2RNB A;  3ABM B;  4G2K A;  4PEL A;  3QO7 A;  2Q0A A;  2XT9 A;  2ZE7 A;  2LJ2 A;  5LMN O;  3KCX A;  2IBZ H;  4X1Y B;  5IWA O;  1NU1 H;  4X66 O;  4DV3 B;  2F4V B;  1GN2 A;  4BAY A;  2XAG A;  2CK3 G;  2ILM A;  1JX9 A;  2LQT A;  3AG3 C;  1QU7 A;  5JCO C;  4NTW A;  4TUY B;  3FAV A;  3OM3 B;  2QJ1 A;  5IJ0 A;  4PA4 A;  2V7Q G;  1OCO B;  2BSK B;  1IX9 A;  4RQE A;  2LP7 A;  4TOI A;  3GB7 C;  1HW7 A;  4UCS A;  1F7Y A;  1Z2G A;  2ZD9 A;  5EZY A;  2ZNI A;  4HZ3 A;  4F6E A;  1Z5W A;  4YY3 O;  4N23 A;  5LMU B;  1RP3 B;  1IBK O;  2Y4T A;  1URF A;  1S76 D;  5H6Q A;  3K04 A;  1KQS U;  2WLM A;  2RQ6 A;  4X20 A;  5AG2 A;  1ZX3 A;  1EN4 A;  2F43 G;  3MAQ A;  4LF9 B;  4PDL A;  2UUC B;  2YC0 A;  5DEC A;  3JAT A;  2UUA O;  3P30 A;  3A2F A;  1YSC A;  4L8J A;  3Q4H A;  2GUZ A;  2EUL A;  2UU9 B;  1H38 A;  1P7G A;  1IZ3 A;  1CEZ A;  4J10 A;  1YZB A;  4OGQ B;  5L3B A;  1XHZ A;  1WPB A;  1YHQ V;  3T1H O;  2VRZ A;  2Z3Y A;  3CC4 V;  1MZF A;  3AK1 A;  3O65 A;  3QVN A;  3IC7 A;  5LXT B;  4G27 B;  4QE7 A;  3CCQ V;  3J7A U;  4HNA A;  4UUJ C;  1VQO V;  5J2U A;  1E1R G;  1M57 B;  2XAJ A;  2ZIN A;  4UVB A;  4JI8 B;  5GON B;  3MHH C;  4JI3 B;  1H2G A;  2BCC H;  4NVP A;  1HNX B;  5C8Y B;  3ZRW A;  4O4I B;  4QNH B;  2LGW A;  4YIO A;  2UXB B;  2QWQ B;  5CA1 A;  5B5E Z;  2RJZ A;  4XDL A;  5B66 Z;  2HJD A;  3N2G B;  3K79 A;  1DGS A;  4ZHQ B;  3CPW U;  4H0L B;  2Q0O C;  3E86 A;  4MS2 A;  2W6J G;  5H2F Z;  5A9G A;  4UB6 Z;  3TXQ A;  3AG1 B;  2ADP A;  2ODM A;  2ETN A;  3K5M A;  3UT5 A;  1XNR O;  4O4L A;  4MTO A;  4DV7 O;  4LF9 O;  5EZY B;  2UUC O;  5KHK A;  2FL4 A;  3DTU B;  1M56 C;  3W7X A;  2PI5 A;  5D5P A;  4DR6 B;  3CCJ V;  4X1I A;  2Y4U A;  1WPX A;  1FXK A;  1I94 B;  4W4L A;  2AGA A;  4YIP A;  3ETQ A;  3E2E A;  3L74 H;  1MSD A;  1JR9 A;  3SPJ A;  1BGY H;  2DE0 X;  2DMX A;  5KX5 A;  5FNV B;  2OWO A;  4NXN O;  4YHH B;  4P30 A;  3ZRS A;  1Y66 A;  2GUZ B;  3AG7 A;  1YIJ V;  3ASO B;  1NBM G;  3I55 V;  2E5L O;  5BXZ A;  2VQF B;  2PTM A;  4JZ2 A;  4B3M B;  4B08 A;  3JCZ A;  4CS3 A;  4X65 O;  1IBM B;  5IYZ B;  4D7S A;  2YXH A;  1AIL A;  3L71 H;  2FTK A;  3OGC C;  2UXB O;  3I5D A;  3CSX A;  3HB3 B;  5LOV A;  1GRJ A;  2UUB B;  1U97 A;  4WBN A;  2YXL A;  2QTO A;  4K35 A;  3K0G A;  1Q6U A;  5B1B C;  5J2U B;  2WLK A;  4O4J A;  2R70 A;  4AQY O;  2M6Y A;  1R6K A;  2ZR2 A;  2YIA A;  4DUY B;  3E8G A;  1VMG A;  1WLE A;  2AZ2 A;  5JWP A;  2OCC C;  4UV8 A;  1JMK C;  4TWK A;  3FB8 C;  4DR5 B;  1KBH A;  4JAV A;  4JYY A;  3BRC A;  1FKA O;  1VQ5 V;  4PA6 A;  4DR6 O;  2P06 A;  4DV1 B;  1QBZ A;  1JOY A;  1FFT B;  5KAF Z;  2GTA A;  1QLE B;  2XAF A;  3M99 B;  4OPH A;  3UT5 B;  4MVO A;  4O4L B;  4I9Q A;  1ZAU A;  2KG7 B;  1K34 A;  2EJ7 A;  3LNM B;  3UCS C;  2E76 B;  3TJT A;  1SF9 A;  4DV2 B;  4BW9 A;  1E1Q G;  3WG7 B;  5LGU A;  4PI0 A;  1TVK A;  1N34 B;  1WNS A;  3DGE A;  2BE3 A;  2DYR C;  5FPR A;  4QIW F;  1FXK B;  4JYC A;  2E74 B;  3RT3 C;  1FFX A;  4I9W A;  2JJ2 G;  4WF9 V;  4JYB A;  2VQF O;  1PM9 A;  2B9Z A;  4B3M O;  5KX5 B;  5B3S C;  2WLJ A;  2UUB O;  1Y67 A;  4PDV A;  4DR2 O;  2ZM6 B;  3F5T A;  2Q68 A;  3P3P A;  4U7N A;  1H2K A;  1S5J A;  3RYH A;  4NB5 A;  3TK1 A;  5LGN A;  5KHG A;  2HJF C;  4DUY O;  2JRI A;  2CDY A;  5KMG A;  1UPG A;  1K73 W;  2CUG A;  2PI4 A;  5LOV B;  1PD3 A;  3AG2 B;  4DR5 O;  3JAR A;  4LFB B;  4RAI A;  5KAI Z;  1VP7 A;  2Q69 A;  4UCO A;  4JI6 B;  3X2Q B;  4X64 O;  3BA8 A;  4TV8 B;  1NJI W;  1XBL A;  4GX2 A;  3RVY A;  4DV1 O;  1KYO F;  1N8R W;  2GSM B;  5FPO A;  1XQ8 A;  1D5A A;  4DUZ B;  4JTC B;  2EIM C;  1BHB A;  2Z0A A;  4O2B A;  1NS1 A;  1WN7 A;  2IJJ A;  4DV2 O;  5B1O A;  1OHH G;  1P84 F;  4JI5 B;  3ZMT A;  3W7U A;  3JAL A;  1O9G A;  1NI8 A;  3SYQ A;  2ZR3 A;  1N4C A;  2HHH B;  1N34 O;  1BMF G;  2QKS A;  2QWN B;  1T5E A;  4B3R B;  4O4H B;  1VEW A;  2DJV A;  1VQK V;  1TUB A;  4PHZ A;  1M5I A;  1O9H A;  3BEH A;  4PA3 A;  4GKK B;  2E75 B;  2A9H A;  2JS5 A;  1IXB A;  2PUS A;  3U10 A;  3SYO A;  2WA3 A;  1TVK B;  1W59 A;  4DV6 O;  1XMO B;  2EIL C;  4OXS A;  3P3N A;  2ZM6 O;  2PZS A;  5LYJ B;  4EFE A;  4FFB A;  4ZOL A;  4HBN A;  1XNQ O;  1I5X A;  1BSM A;  2V4D A;  5D5Q A;  1R1B A;  2EIJ C;  3ABT A;  4BIO A;  1DF4 A;  1SA0 B;  1DLB A;  4ABM A;  3QTC A;  1WB8 A;  1PPJ H;  2Y69 B;  4MVM A;  4JAU A;  1Q82 W;  3CRM A;  2A79 B;  1PP9 H;  1XL4 A;  4GUN A;  4FVM A;  4GX0 A;  1RSO A;  5F2V O;  2XHB A;  1J5E B;  4LNU A;  4TQD A;  4LFB O;  4JI4 B;  3SYP A;  1N33 B;  3E8F A;  2BOC C;  5CBF A;  4JI6 O;  4JV5 O;  3UO3 A;  3SJB C;  3J80 N;  3SPH A;  4LF6 B;  4J9Y B;  2QGN A;  4LWS A;  4JAS A;  4EB6 A;  2JGD B;  3THO A;  4B3T B;  4ZIB A;  3UKM A;  4DUZ O;  2CGO A;  4MW8 A;  3ZBH A;  2DW4 A;  3DXR B;  3CEI A;  2EZO A;  4KHP O;  1OCR B;  4QE9 A;  3RYC A;  4R7C A;  4JI5 O;  2WWW A;  1I08 A;  1K33 A;  4FM1 A;  1AI4 A;  3K57 A;  1J95 A;  1S5H C;  2V1D A;  1I0H A;  4MW3 A;  4Q6G A;  2DQ3 A;  4LBE C;  5CA0 B;  2PF4 E;  1PL4 A;  4IYI A;  5K1P A;  4O2B B;  3IC9 A;  1YI2 V;  4UXN A;  2Q9L A;  2XOK G;  3RYI A;  1PNK A;  3K5O A;  3SPC A;  3HKD A;  1NTK H;  4WCE V;  3JAL B;  3BA9 A;  3K3W A;  1Y6X A;  3CJH A;  5LP6 B;  1XMO O;  1ZUQ A;  1B04 A;  2BTQ A;  1KEC A;  4JYA O;  3OD4 A;  4X62 B;  1BE3 H;  1AP6 A;  1X4T A;  3EXA A;  1FJG B;  2ZE6 A;  5IYC O;  3UO2 A;  4PV1 B;  2YUA A;  2EX3 A;  4FK5 C;  2ZQM A;  1MOF A;  4TV9 A;  1DTO A;  4NTY A;  2ZIO A;  2ZE8 A;  1NT2 B;  2FB5 A;  1J5E O;  5DN6 G;  3A0R A;  4ZOL B;  4GYC B;  1AVM A;  3K59 A;  2MK3 A;  1VQ7 V;  3KZI Z;  3B4S A;  1AR4 A;  3ICX A;  1XI1 A;  5H5N A;  5GW7 A;  4Z1V A;  4B3T O;  4DR3 O;  4NXM B;  4UCV A;  3H1K H;  4LNU B;  4E4E A;  2R72 A;  1KMI Z;  4LFC B;  3CX5 F;  2IH1 C;  5E1A C;  4G28 B;  1Y4M A;  3C90 A;  2Q7H A;  2KSD A;  3F7V C;  2OTJ V;  4EB6 B;  2P22 C;  5B1A C;  3D3I A;  5IDJ A;  2WA4 A;  3HKB B;  1V55 B;  3ETD A;  1B3Q A;  1SC5 B;  1ZL8 A;  4JAA A;  2HKO A;  4J7J A;  1S77 D;  5H6R A;  5EYP A;  4LH7 A;  3TGU H;  1LUW A;  1V54 B;  3RVZ A;  3SYC A;  3W7S A;  5H9C A;  3T1C A;  1K7D A;  3HKC A;  5B1N A;  1JQ0 A;  3WU2 Z;  1ORQ C;  1ZLZ A;  4B3S B;  2YXY A;  1Y74 B;  3SYA A;  1ZSP A;  4JPR A;  4PI2 A;  3CJH B;  1SQF A;  2IW5 A;  5HFL A;  5TIS Z;  1I7F A;  3H01 A;  4UB8 Z;  1X59 A;  1XDC A;  3K5N A;  2CTW A;  2Q7G A;  1RM1 B;  1SQX H;  1SZX A;  2G38 A;  1WP8 A;  1GN3 A;  2JVD A;  4B7E A;  3LUT B;  2YSU B;  3FFQ A;  1JJO A;  3RWR D;  4DV4 O;  3P32 A;  4IIJ A;  3HKE A;  1QNM A;  4BIU A;  3ABK C;  4PDR A;  5CMU A;  3O9O A;  5KHJ A;  1FPO A;  1QQC A;  1TGO A;  3BHP A;  2XND G;  1SQQ H;  2R9A A;  4CS4 A;  2WLN A;  5K1X A;  4DR1 B;  1DK1 A;  3ABL B;  1Q6H A;  4DV5 O;  5EIB C;  1VQ8 V;  5BMV B;  3L70 H;  3VBB A;  4R6Z A;  1GO3 F;  4I5S A;  1Q8I A;  4J7Z A;  5LA6 A;  3SDL A;  1YF2 A;  5L3D A;  3ZHQ A;  4CC5 A;  2CTR A;  1SER A;  1M93 A;  3KCY A;  4B3S O;  4DV3 O;  2F4V O;  1TA8 A;  5JJE B;  1KP2 A;  4B7K A;  3ABM C;  1HWY A;  5EBW C;  2QM8 A;  4K8Z A;  5EYP B;  1COW G;  2CAZ C;  3PN1 A;  1QHT A;  2Q6A A;  2VWJ A;  2F66 C;  4WFB V;  2F93 B;  3D36 C;  4U3F H;  2Y0I A;  3HKC B;  3IAY A;  4YJ3 A;  1PKX A;  3GWO A;  2L35 A;  1VQL V;  3LDD A;  3K9S A;  3DSQ A;  3U11 A;  5LMU O;  1EZV H;  1OCO C;  2CH7 A;  4OX9 B;  3JD1 A;  4EFB A;  3JAW A;  3FAV B;  1UJW B;  3FYE B;  5IJ0 B;  1GAX A;  3H9V A;  4I0X A;  2JEU A;  3R66 A;  1WP7 A;  4KP4 A;  5J9P C;  4QPK A;  4MTX A;  4BR6 A;  3F7Y C;  3LSU A;  3ZJZ A;  5LHH A;  2VQE B;  5CBH A;  1Q43 A;  3ASN B;  3CCV V;  5FL7 G;  2Q7E A;  1GM9 A;  2QM4 A;  1QR9 A;  2UU9 O;  2HVK C;  1SET A;  4J80 A;  4X20 B;  4DR1 O;  4IIJ B;  3HKE B;  3DC5 A;  1QLN A;  3JAT B;  3CXH F;  4Q20 A;  4JTD B;  1M1K W;  3Q4H B;  3H1H H;  1Q90 D;  3K58 A;  4GT1 A;  3ABL C;  2YI9 A;  2Z5U A;  1N36 B;  4JI8 O;  2EIN B;  4JI3 O;  1MSW D;  4KUM A;  1HNX O;  1XOU A;  2JEX A;  3OMA B;  2RCV A;  1M57 C;  1NZ6 A;  4DK1 A;  4QPJ A;  1NH2 D;  5LA6 B;  2UXX A;  1QVG U;  1EN5 A;  3WB0 A;  4HNA B;  4UCR A;  4J9Z B;  4IHJ A;  5J2T A;  4FZ1 A;  3J81 N;  1NTZ H;  4FLY A;  2K9P A;  2FKX A;  2JS3 A;  3ZRW B;  5JJJ B;  2YS8 A;  1H2M A;  1WJZ A;  2QWP B;  4OX9 O;  3RYF A;  3JCU Z;  3OR7 C;  5CA1 B;  3CCU V;  2ADQ B;  1XEQ A;  4HYO A;  3KG2 A;  4X1K A;  2PYJ A;  1DF5 A;  3AG1 C;  3T1Y B;  5BY1 A;  2W0F C;  3TCU A;  4H37 A;  4U3J A;  2LW7 A;  3D8C A;  2CTP A;  1I94 O;  5JQG A;  1YTF B;  2PGG A;  4J11 A;  4LF4 B;  1U96 A;  1OJH A;  1L0L H;  5JVD A;  2IJI A;  1MZE A;  4WFH A;  5IY5 B;  1W0K G;  3RW0 A;  4YHH O;  1OCZ B;  4DW1 A;  4W4K A;  4X1I B;  3L9D A;  4LR3 A;  1YCI A;  1B6Q A;  1K92 A;  1GK9 A;  2JJ1 G;  5KUM A;  3ZHS A;  2N74 A;  4IL6 Z;  5LL6 Y;  3CWB H;  4I4T A;  2YIC A;  4XDJ A;  1IBM O;  1M90 W;  2P6J A;  4DR7 B;  3DC6 A;  2VS0 A;  3ASO C;  2YEV A;  3K08 A;  1OCC B;  5KLV H;  4FLZ A;  3U0Z A;  1GM7 A;  2R9I A;  3BAB A;  4WFA V;  4RUF A;  4GZR B;  3E35 A;  2FYU H;  1VQM V;  3WB2 A;  1JFF A;  4WBN B;  1ARO P;  4O2A A;  4FM0 A;  4EEQ A;  5J2T B;  1VQP V;  4O4J B;  1YIT V;  2QKC A;  1YJN V;  4L87 A;  3OTF A;  3JAS A;  3RFR A;  4JI0 B;  3CXC U;  2QA4 V;  2HLD G;  3IFX A;  3OR6 C;  1SQG A;  4FLV A;  4JF3 A;  3CC2 V;  3H1I H;  3JAK A;  1G6U A;  3UM7 A;  1YTF D;  2LFR A;  2Q67 A;  2A0L A;  2ZXW B;  1QLE C;  3JYC A;  1BQ0 A;  5E79 Z;  2XAQ A;  1VAR A;  3OFN G;  5CN0 A;  4RO2 A;  1P4R A;  4K8X A;  1FYJ A;  2NNU A;  4XBF A;  2EIK B;  3GWK C;  3WG7 C;  3ZS8 C;  3BY6 A;  3RGB A;  5JVD B;  1YJW V;  5IE9 A;  4CH6 A;  1K97 A;  5LHG A;  4DR7 O;  1FXK C;  2LGQ A;  4LC1 A;  5JCO A;  4BW5 A;  1VF6 C;  4LF8 B;  1XL6 A;  1R3I C;  3BPZ A;  4K0K B;  2X6C A;  2QWO B;  4MVQ A;  1HP8 A;  3MHS C;  1FFX B;  4I7Z B;  3VQX A;  1F51 A;  2Y48 A;  4KL1 A;  4R50 A;  4MVZ A;  2RMK B;  3WB1 A;  4MSW C;  1FAF A;  1SQB H;  5C93 A;  4IGG A;  3JSN A;  3N2K A;  2GTS A;  3B09 A;  1EBO A;  3OUF A;  2YI8 A;  2HG5 C;  2EBO A;  2B1G A;  1MG1 A;  3RYH B;  4JI0 O;  4FM2 A;  5GTH Z;  4HAM A;  1VQ6 V;  4LCU C;  4TT3 G;  3AG2 C;  4I55 A;  4WFF A;  5KMG B;  4DK0 A;  4JI1 B;  1FXH A;  2WLI A;  1D2D A;  3X2Q C;  4O2A B;  3JAR B;  5JH7 A;  2OIG A;  3QG5 A;  3I56 V;  5L3G A;  1JA8 A;  3E8B A;  2HHH O;  1ENV A;  2A3Q A;  3JD2 A;  5KHI A;  4X8A A;  4B3R O;  4YJ2 A;  1HNZ B;  2WLL A;  4IYH A;  4GX1 A;  1Q3E A;  1H8H G;  1P7B A;  4GKK O;  3BVO A;  3RBZ A;  4EKW A;  3ZMU A;  3OTO B;  4TQF A;  4J42 A;  3CCM V;  3E22 A;  1KUQ A;  2QM7 A;  2MW2 B;  4K0K O;  4MTG A;  1IDS A;  2JK5 C;  4NKG B;  4X1Y A;  5BR8 B;  3D36 A;  1BCC H;  1TUB B;  1KU9 A;  2ZDI C;  5GTI Z;  4ASU G;  3M7M X;  4MVU A;  3CCL V;  2LO1 A;  4PD4 F;  4TUY A;  2ZCE A;  3SJQ C;  2P7T C;  3FB6 C;  2ATK C;  2X6A A;  2CE4 A;  2BSK A;  1F4M A;  2Q4P A;  3ZHT A;  3APO A;  3CS5 A;  5DED A;  3OEE G;  4JI4 O;  4FFB B;  1N33 O;  4CBC A;  1RPO A;  4P2Z A;  3SJC C;  4LF6 O;  4UCT A;  4UCU A;  2WPD G;  2Y69 C;  1BS3 A;  1FD9 A;  3IGA C;  2WLH A;  3OEH G;  1WB7 A;  1NR1 A;  1EM1 A;  2YIB A;  2E3C A;  2A06 H;  1VQN V;  5JJN B;  1RSO B;  4A5U B;  3UQ8 A;  3JD3 A;  1K4C C;  1A32 A;  3CHX A;  3SPG A;  3FX7 A;  4J41 A;  4LWS B;  1IXM A;  2EJR A;  1IBK B;  1NVP D;  4GCZ A;  2IH3 C;  4I55 B;  3NXS A;  2DOS A;  1OCR C;  2DQ0 A;  1HNZ O;  2AHZ A;  3B2E E;  4F4L A;  1NKD A;  2F95 B;  1W2B U;  2K1E A;  1AR1 B;  5JH7 B;  3RYC B;  2H94 A;  1NTM H;  2R9R B;  4FIP C;  3OGI B;  5EC1 C;  4X9Q A;  3STZ C;  4RWU A;  4YJ2 B;  5GON A;  4LP8 A;  4X62 O;  2OCH A;  4D7T A;  5LHI A;  5BR8 O;  2P4V A;  3RYI B;  1FJG O;  5C8Y A;  3ZHR A;  4O4I A;  3L72 H;  3T1H B;  3ABU A;  3HKD B;  1K3E A;  5LP6 C;  5L3F A;  2QTS A;  3ZRX A;  3L75 H;  3N2G A;  1AR5 A;  5KUK A;  2BTQ B;  4ZHQ A;  1AJQ A;  3EFF K;  4JTA B;  3ZX6 A;  3SGI A;  5EC2 C;  4FZ0 A;  1SQV H;  5EK0 A;  3G4S V;  4ICG A;  1N0N A;  4ZBM A;  1NQT A;  2XUM A;  2P90 A;  2XTA A;  2QSA A;  4BWA A;  1PL0 A;  4H13 B;  4UVA A;  4TV9 B;  1JPX A;  3CRR A;  4NXM O;  5IT9 N;  3CRQ A;  2DYS B;  1SKV A;  3QO5 A;  2XAH A;  3OW2 U;  4LFC O;  4NYK A;  2IM9 A;  4AIL C;  1H2L A;  3CE2 A;  4N21 A;  1XRE A;  1M56 B;  4WFG A;  2RDC A;  2O57 A;  1Q6I A;  3CCE V;  1XNR B;  2PYL A;  3AK3 A;  1Q7Y W;  4K3A A;  4JZG A;  4DV7 B;  3GVM A;  2OYQ A;  4DRX A;  2OT5 A;  4CH3 A;  3CMA V;  5FNV A;  3JD4 A;  4FLT A;  4NTX A;  5CBG A;  3VQV A;  1V55 C;  4FLU A;  5EIB D;  1MMM A;  1R6T A;  4JI7 B;  1FS0 G;  3LNN A;  1ZWI C;  3EHB B;  3FB7 C;  4MVS A;  2NN4 A;  1SQP H;  4FJC C;  4X89 A;  3H1L H;  5IYZ A;  1ZL8 B;  3BCC H;  1V54 C;  1AI5 A;  3CCS V;  1NH2 B;  1S72 V;  4NXN B;  2AHY A;  2YID A;  1ROP A;  3E83 A;  1Y76 A;  2AZ0 A;  1KKC A;  2ZT9 B;  2E5L B;  3K06 A;  1S0V A;  5B1B B;  2RN9 A;  4X65 B;  5EBM C;  5IYD O;  3PJS K;  3TXS A;  5L3E A;  2BOB C;  1YXB A;  2IU3 A;  2EZP A;  3CRA A;  3ZRV A;  3HR0 A;  4CC6 A;  1RM1 C;  4XDK A;  3T4D A;  3NR7 A;  2OCC B;  3S3X A;  3ZMZ A;  1OV9 A;  4AQY B;  4X88 A;  3T4Z A;  5CA3 A;  1AB3 A;  3CB2 A;  3JSL A;  2Y0P A;  2DYS C;  3CME V;  3WFV A;  2KG7 A;  1F23 A;  3F5W C;  3MDS A;  4I50 A;  2JGU A;  1QVF U;  2YIB D;  2FML A;  1SES A;  3CD6 V;  1US6 A;  1R3K C;  3K0D A;  2JIZ G;  2CTQ A;  2P67 A;  3APQ A;  3T2M A;  4OPA A;  4CH5 A;  1VF6 A;  3JAM N;  1EZJ A;  4JI7 O;  4UV9 A;  2DYR B;  1AI7 A;  4MT8 A;  3JD0 A;  3ZHU A;  4DRX B;  2NLJ C;  1D5N A;  1XHX A;  1BQZ A;  1IVS A;  1Q5O A;  2HR3 A;  1LNQ A;  4Z2W A;  4JI2 B;  1MA1 A;  2GHY A;  5B3S B;  1I5Y A;  1LUV A;  3MD0 A;  4P9P A;  4CS2 A;  2UXC B;  5KA5 A;  3W7T A;  4U7O A;  3EVK A;  3BFR A;  4P9O A;  3ZED A;  3A0B Z;  3B8M A;  3E8H A;  1SZT A;  4ZI7 A;  2P4K A;  5ITZ A;  1KKD A;  4KXR A;  4DYL A;  3E89 A;  1XMQ B;  2OTL V;  1L8D A;  1GMG A;  1MNG A;  2WAM A;  4DR2 B;  2F23 A;  3K5L A;  4RUE A;  1Y76 B;  2QKA A;  1Q86 W;  4LF5 B;  3CRC A;  2ZIM A;  3ZMV A;  4TV8 A;  2VQE O;  4YJ3 B;  3ZIA G;  1VF7 A;  1PNL A;  1R6N A;  1WA8 A;  4Z1M G;  2CH7 B;  3OT7 A;  1TUE B;  3JAW B;  1AJN A;  1UFI A;  1IBL B;  1JJ2 U;  2C2A A;  3G80 A;  4I0X B;  3RN4 A;  4FPP A;  4D6T H;  2QEX V;  1TAE A;  2EIM B;  4MVR A;  3ASN C;  4X64 B;  3QNE A;  3OAA G;  3W7W A;  5FLX N;  3FD9 A;  1EFR G;  1S5L Z;  1VQ9 V;  2D2C B;  2ZNJ A;  2B5U A;  1H2S B;  1N0J A;  4F6R A;  4O4H A;  4GX5 A;  5BZB A;  3ZHV A;  1N36 O;  2HFE C;  4AHC A;  4GKJ B;  3H1J H;  2GV9 A;  4I50 B;  3D3Q A;  2M7W A;  2ZDI A;  1L0N H;  2Q8V A;  1H2N A;  3FYI B;  4H44 B;  3AK2 A;  4JI2 O;  4CZZ A;  3OE7 G;  1KB9 F;  1BZK A;  1BT8 A;  5LYJ A;  2UXC O;  3LDC A;  2EIN C;  1E79 G;  2EIL B;  1PV0 A;  3G6E V;  1SA0 A;  4DV0 B;  1Q81 W;  2XAS A;  5KA6 A;  2JDI G;  5A2Q N;  4LH6 A;  1GM8 A;  2EIJ B;  2ITC C;  1XMQ O;  4MTF A;  2H8P C;  4DXW A;  4PDM A;  3QF7 A;  4DV6 B;  2QR4 A;  2N05 A;  1WAZ A;  1HDJ A;  1CP9 A;  1XNQ B;  3B77 A;  4C7U A;  3G71 V;  4LF5 O;  4IHJ B;  1R73 A;  1QCE A;  3CYO A;  2AXT Z;  4ZI7 B;  1G4Y B;  3T1Y O;  2LFS A;  5ITZ B;  3TET A;  3OUS A;  2JGD A;  5HFM A;  3IJ4 A;  1THZ A;  1XUQ A;  3RYF B;  3DXR A;  4H33 A;  2HP8 A;  1IBL O;  1CXZ B;  2ZKO A;  2F1M A;  4LFA B;  4LF4 O;  3ZCC A;  4KFM A;  3N27 A;  4X1K B;  1K4D C;  4JV5 B;  2B1I A;  1ZTE A;  1YVW A;  2H3O A;  1W0J G;  2HEP A;  5IJ9 A;  2W6I G;  2DN9 A;  4U3J B;  2X0L A;  3G67 A;  1WA8 B;  4DR4 B;  3VQW A;  5CA0 A;  2P5O A;  1EN6 A;  2CGN A;  1N32 B;  4KHP B;  4R8C A;  2N04 A;  2IJK A;  1R3J C;  4JGS A;  5JQG B;  4GKJ O;  1M4U A;  2NR5 A;  3S3W A;  1RPR A;  3SJA C;  5IY5 C;  4ZKI A;  1OCZ C;  2YDE A;  3CCR V;  3SR2 C;  2VWK A;  1MAB G;  1GN6 A;  3BAA A;  2X6B A;  5LP6 A;  2QDO A;  1NR7 A;  2HVJ C;  4LF7 B;  4F6R B;  4GLX A;  4DO2 A;  3OMI B;  5LBQ A;  1JVM A;  4WFE A;  4DV0 O;  1RFY A;  3AEI A;  4BIZ A;  1HR0 B;  1XIL A;  2W0X A;  4I4T B;  2AW9 A;  1OCC C;  1Z5V A;  4IT5 A;  1AI6 A;  3ETE A;  3OMN B;  1F4N A;  2YEV B;  4JYA B;  4DW0 A;  3HPL C;  1YDX A;  3STL C;  3VOU A;  2D3O W;  2IU0 A;  1YEW A;  1JFF B;  1G8M A;  4LFA O;  3G6B A;  5EBL C;  1K8A W;  1GKF A;  1LR1 A;  2Q5Z A;  1AP5 A;  3SPI A;  1IUR A;  1NVP B;  5CB4 A;  2L6L A;  3JAS B;  3CC7 V;  1VQ4 V;  4FFK A;  1HNW B;  3M8A A;  4FMT A;  1OZ0 A;  5DM6 V;  4DR4 O;  3HKB A;  1N32 O;  4DR3 B;  5B1A B;  1G1X B;  2ZE5 A;  1P49 A;  3AG4 B;  3C3S A;  1BL8 A;  1K5S A;  3JAK B;  1KC8 W;  2DWD C;  2ZXW C;  1AJP A;  1CPY A;  5LGT A;  2LW1 A;  2KKW A;  5KHH A;  4QJF B;  1SS3 A;  5IJ9 B;  2KB1 A;  5IYB O;  2PY5 A;  1FXV A;  4LF7 O;  4LF8 O;  3VQY A;  3ZN1 A;  1YJ9 V;  4J7K A;  3CP1 A;  2EIK C;  2OIE A;  3R65 A;  2GBO A;  3A8T A;  3K03 A;  2UXD B;  1K5Q A;  3LSQ A;  1Y74 A;  3L73 H;  1HR0 O;  3ML0 A;  3QO8 A;  1BHA A;  4UFZ A;  3C3T A;  4E2L A;  2BTO A;  2Q73 A;  2UXN A;  3AG3 B;  2DWE C;  4FLW A;  1QR8 A;  3ETG A;  5LMN B;  3FB5 C;  2WSS G;  3LSS A;  1SRY A;  1JCH A;  5IWA B;  1KP3 A;  1GTO A;  4X66 B;  3ZN0 A;  4CH4 A;  3KKY A; 
#chains in the Genus database with same CATH homology
 4J42 A;  3FX7 A;  4KXR A;  4IYI A;  4J41 A;  4J7J A;  4IYH A;  4J10 A;  4W4K A;  4W4L A;  4J11 A;  4J7K A;  2G38 A;  2GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...