4IYHA

The crystal structure of a secreted protein esxb (semet-labeled, c-term. his-tagged) from bacillus anthracis str. sterne
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
IKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (SeMet-labeled, C-term. His-Tagged) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 30
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4iyhA00
4J41A 4J10A 4W4KA 4IYIA 2GTSA 4IYHA 4J42A 4J7KA 4J7JA 4KXRA 3FX7A 4W4LA 4J11A 2G38A
chains in the Genus database with same CATH superfamily
3TJTA 2VRZA 1VQKV 2F4VB 2ZNIA 4GCZA 5JJJB 2LO1A 4TT3G 5LA6A 3IC7A 1PV0A 3QO8A 1IBMO 3RBZA 3OE7G 3B09A 4D7TA 2WWWA 5CN0A 2CAZC 4GX5A 1XMOO 1R3LC 1SZTA 1T5EA 3JALA 3CCSV 2DN9A 2RJZA 1XREA 4U3JB 3OT7A 1KC8W 3KKYA 4NTWA 2ZDIC 4N23A 2FYUH 1I0HA 1JCHA 1Q6HA 4PI2A 2Y48A 5L3CA 2A0LA 4DV4O 2EJ7A 2UUCB 4ZI7A 1SQBH 1IBMB 4TUYB 1DK1A 1GN6A 3DXRA 1K73W 3CC4V 1YVWA 4IL6Z 1DLBA 2Q67A 2IU3A 1IBLO 2AHYA 3MHSC 1K4DC 3W7SA 1XUQA 3FYEB 2O57A 3CEIA 3E86A 4B3RO 4ICGA 5FL7G 2KG7B 3ZRXA 2ZR3A 2CGNA 1I94O 4FLYA 4MS2A 4DR7O 4U7OA 1NVPB 4Z1VA 3LDCA 2K1EA 2Z5UA 2YS8A 4RAIA 1J5EB 2RDCA 2Q0AA 5GTIZ 3B8MA 1FXKC 3WG7B 3IJ4A 4O4LA 3P30A 1Q3EA 4DW1A 1KQSU 1N33O 2UXCB 2GV9A 3ASOB 2ZINA 2ATKC 1SA0B 1HW7A 5KX5A 4LF9O 2ZE6A 3P3NA 4EEQA 2JS5A 4WFAV 1WA8B 3K03A 4UCSA 3HR0A 5BXZA 2BE3A 1OCZC 3VQWA 2EINB 3G6BA 3MDSA 3CSXA 4UVAA 2XAGA 4WFHA 1QNMA 4NTXA 2X7RB 4IIJA 2FTKA 2XAQA 3KCYA 3SR2C 1GM9A 1TGOA 3CD6V 2Q7HA 2DQ3A 2JGUA 5D5QA 5CA0B 1AR4A 1YDXA 3K58A 3SJQC 3FAVA 3TK1A 5IY5B 3RVZA 2HVJC 5FPOA 5K1PA 3RVYA 1DF5A 4KUMA 1MNGA 2YC0A 1WPBA 4LFCB 4UV9A 5IDJA 4I50B 3LNNA 2WLIB 1VQ9V 4ZKIA 1R1BA 5EYPA 3ABKB 4LC1A 3OGIB 2ILMA 1KP2A 4WF9V 2LFRA 3OUFA 1YSCA 2QA4V 1V55C 4O2AA 5DEDA 1ZL8B 3BHPA 4EB6B 1VF6C 4K8ZA 3HKDB 5IYBO 2IJHA 1Z5VA 4HYOA 1LNQA 2DJVA 1XDCA 3A0HZ 4DV0O 2K9PA 1VP7A 3CPWU 1WB7A 3ABMB 1XNRO 2ZCEA 1TVKA 1PL4A 2WLMA 2Y4TA 4FM0A 1GN2A 3JSLA 3RW0A 1GRJA 5GW7A 1ORQC 4UXNA 3I56V 1Y76B 2P5OA 2ADQB 3L9DA 4X1IA 3CCMV 3OMIB 1I5YA 2QTSA 4PDMA 4PA9A 5IWAB 4DV0B 2OCCB 2CTWA 4HBNA 3SYAA 1N8RW 2P67A 3ZHTA 1SQGA 5L3DA 3CCRV 4GZRB 5KHJA 1OCCB 3ABLB 3QO7A 2YDEA 1D5AA 1N36B 3ZMSA 4JI4B 1KD1W 4AQYO 1AP5A 1AJPA 1QLEB 5J2TA 1NBMG 1J95A 2ZE5A 4UB6Z 2UUAB 1XNQO 3E2EA 3JASA 4EKWA 3K9SA 1M57B 2YIBD 1IXBA 2WLLA 2VS0A 1BZKA 4ASUG 4WFFA 1Y67A 1S0VA 4X89A 3SPIA 2Y0PA 1AROP 3BVOA 1AI6A 4JAUA 3K06A 4X9QA 3W7UA 3FB6C 1FPOA 4JI0O 4GLXA 4B3TO 5EBWC 3CRCA 4X64O 3UQ8A 4QNHB 2XUMA 5KAFZ 1H2SB 4F6EA 3K5LA 3SDLA 2E76B 1B04A 2LGWA 4DR1B 1HNXO 2PYLA 2LJ2A 2MW2B 2QGNA 1Y6XA 4UCUA 1NKDA 3QG5A 5LA6B 5H2FZ 3K0DA 3CRRA 2PZSA 4DV3O 1URFA 2EIJC 5JH7A 4DO2A 1VMGA 1DGSA 4X64B 1D2DA 2LW1A 5CA3A 1IVSA 2AZ2A 4G27B 4U7NA 2PYJA 1NR7A 3ZCCA 2X6BA 3CE2A 2F1MA 3JALB 1HNXB 1NR1A 2FB5A 2KG7A 2WSSG 4QGPA 2X6CA 3WU2Z 4DV6B 2HJDA 2XNDG 1G8MA 1X59A 5KUKA 2R9RB 3DXRB 1SQVH 4LP8A 1AR1B 1K5SA 3OW2U 1IXMA 1HR0O 1SA0A 4J41A 3ETDA 3E22B 1H8EG 2OCHA 2A06H 1HNWO 2Q73A 3QTCA 4KHPO 3JCZA 4PD4F 2L35A 1Y74B 1KKCA 5K1XA 3OGCC 4DUYB 2NLJC 1ZX3A 4JYAO 4QPKA 5B1AB 2YI8A 1KYOF 3THOA 1MOFA 4DRXA 4I4TB 5JCOC 2A3QA 3L72H 4NXMB 3LSSA 1S5JA 1GN3A 1EN5A 4K0KB 3VQYA 1S5LZ 5DN6G 4MVOA 3AG3B 1KU9A 4KHPB 5IJ9A 2DYRB 1N0JA 5KX5B 3S3XA 4LF6O 1SQXH 3P3PA 3SJAC 1IURA 2OCCC 3CXHF 2AXTZ 5J2UB 1GAXA 5FPRA 2WA4A 4OXSA 5EC2C 3ZHUA 1FFXB 4R50A 3I55V 5KMGA 2YXYA 1SF9A 1OCRC 4LH6A 1KBHA 1N34B 4JGSA 4NTYA 4DV5B 4JI7B 3CMEV 2XT9A 2VWKA 1VF5B 2CE4A 4JYYA 2Q7EA 4LF7O 3I5DA 4LF6B 1HNZO 3FFQA 3B40A 3FKSG 3SGIA 1HP8A 1ZL8A 1XMQB 3FB8C 1ZAUA 1XOUA 3HKDA 4BWAA 3CX5F 4JTDB 5AG2A 2CTQA 3K5OA 3AK3A 1VQ7V 2R72A 2ZD9A 1V9PA 4HNAA 4FMTA 3OTOB 3JAKB 4PA6A 2QR4A 4TWKA 4LF7B 3NXSA 3ETQA 3CCQV 5LP6A 1HNZB 2YSUB 4BW5A 1Z5WA 3ZRVA 2XAHA 1MZEA 1Y76A 2GDSA 4E4EA 1K92A 2OT5A 1P4RA 1OHHG 4LF5B 4X1YB 3DC6A 3VQXA 2XTAA 4O2AB 1WPXA 4UVBA 4OPAA 4UCVA 1YIJV 4L87A 4GKKB 1P7BA 4UVCA 1MSWD 1K3EA 2N74A 1P84F 1AILA 4F6RA 2ZKOA 4X62O 1YI2V 5IT9N 4PV1B 4JI1O 2GHYA 1B06A 3BFRA 1M93A 4BR6A 1VQMV 2E5LB 4FZ1A 3T4ZA 4ZHQB 4JI5O 1PP9H 1MA1A 4LFBO 2HKOA 3T1YO 1BS3A 1U97A 2EULA 4JTCB 4X8AA 1FD9A 4DXWA 4X1IB 4IYHA 3WB1A 3ZRSA 4Q6GA 1G1XB 1VQNV 3CS5A 1OCOC 4ZBMA 3SJBC 1L0NH 1YITV 4JI1B 3ZBHA 2QWNB 5GTHZ 4DR6B 4XDJA 4FLXA 2ITDC 5CB4A 3ZMZA 1ZTEA 4YIOA 1XHXA 5LBQA 4J7ZA 3UO2A 2VQEO 1QLNA 3IAYA 2EZPA 5JVDB 2VQFO 3K3WA 4H37A 5ITZA 3C3TA 2EILC 2IM9A 1PM9A 5B3SC 1Z2GA 2BTQB 5J2TB 2QDOA 4MW8A 1M5IA 1EN6A 4X66O 4B08A 1NH2D 3EHBB 4OX9B 4DR5O 4EFBA 1B3QA 3JASB 2E3CA 2ZXWC 5EBMC 2ETNA 2DW4A 2WLLB 3ZRWB 1TUBB 4UCRA 4JYCA 5KA5A 2F93B 1IDSA 1IBKO 2RN9A 1S3JA 4DV2B 2IU0A 4EFEA 3STZC 3K5MA 3MAQA 1MMMA 2JVDA 4X88A 4LR3A 4J9YB 2AGAA 3A0RA 4QIWF 3D36C 3JD1A 2OYQA 2EJRA 3ABTA 5A9GA 2F95B 4TQDA 3BPZA 1XMOB 3RFRA 1L8DA 1SZXA 3LUTB 1SESA 4I7ZB 1S5HC 4JZ2A 3CRQA 3ZHQA 5JH7B 1Q86W 2CH7A 1YZBA 3E22A 1SQPH 1JJ2U 1FJGO 5LHHA 2EIKB 4ZOLB 1Y74A 1JX9A 1GMGA 4DV4B 3AG4C 1GN4A 3IFXA 2DYSC 4FFKA 1WP8A 4I4TA 3LSUA 1VQ6V 5L3GA 1BCCH 2HVKC 3LDDA 1IBLB 4GKJO 5BY1A 3CCUV 4LF4O 2QKSA 4MTOA 5HFMA 3BAAA 2MK3A 2RQ6A 2BCCH 4B3RB 1S77D 5EC1C 2UUBO 5TISZ 4OGQB 4K3AA 1I94B 5B1BB 1XL6A 2H8PC 5J2UA 2W0FC 2NR5A 4DR7B 2G38A 3ZJZA 2Q69A 2P4VA 3GWOA 1FFXA 3K5NA 1BSMA 3E8FA 1F4MA 3MHHC 2JGDB 4DRXB 1IX9A 1FKAO 1VQ8V 1N33B 2X6AA 3CB2A 4K8XA 2YXLA 1QR8A 4MTGA 1VQLV 4LF9B 2IH1C 1MZFA 3O65A 2PY5A 4XDLA 2ZDIA 4XDKA 1NQTA 1AP6A 5C93A 1K9MW 5IJ9B 2YUAA 3ZHVA 2JDIG 4JYBA 5BR8O 2WLJA 3ASNB 2QJ1A 3IC9A 4MW3A 3W7WA 4U3FH 5HFLA 4YXWG 1BL8A 1JPXA 5KMGB 5EIBC 3BRCA 2PI4A 4BIOA 4YY3O 2M6YA 3JAKA 3LNMB 4JASA 2A7WA 1AI5A 2E75B 1YJWV 4NXNO 3RYCA 1PKXA 3K04A 4PA4A 1AVMA 4LF8O 3G6EV 1XQ8A 2FKXA 1F23A 5BR8B 1WLEA 4GX2A 4FIPC 4X1YA 4DV1O 1JA8A 3SYOA 1JFFB 4PDVA 2JEXA 2OTJV 4PDRA 2HHHO 2QWRB 2QE7G 4I9QA 3GVMA 3QNEA 3FD9A 3K59A 2V1DA 1FAFA 4JTAB 2CK3G 2YXHA 4HNAB 1W0JG 4ZHQA 2QWPB 3AG1B 3H9VA 3J81N 4GX0A 3KZIZ 1COWG 1HWYA 5LP6B 3AK1A 4CS4A 1YTFD 1NJIW 4JAAA 2ZIOA 1Q5OA 1M90W 4DYLA 1P49A 1K33A 1Q43A 3RYIA 2HHHB 3ZHRA 1YJNV 3UM7A 2EX3A 3K0GA 5CMUA 3U10A 1YJ9V 3K79A 3A2FA 4DR4O 1IZ3A 3M7MX 1VQ4V 1XNRB 4XBFA 3OR6C 5LMUO 2IJKA 4JI3O 5LHIA 1K97A 4F6RB 3CCVV 2CDYA 4FLVA 2Y69B 3T1HO 1R3IC 3SJCC 5JVDA 4JPRA 4YHHO 2B9ZA 1KKDA 5KLVH 3H1LH 2BTQA 2P90A 3C90A 4D7SA 5IYDO 1M4UA 3BA8A 3JAMN 1N32O 1N0NA 2UXNA 5LHGA 1E1QG 1FFTB 1R6TA 3ZRWA 3WG7C 1R6NA 4O2BB 5LGUA 2PGGA 3D8CA 2DQ0A 3H1HH 5L3BA 2ZQMA 2HJFC 3T1HB 1TUBA 3ASOC 2FL4A 2OWOA 5CB4B 3RT3C 4YHHB 4CZZA 3DC5A 2ZM6O 4QE7A 4AQYB 2YIDA 5H6RA 3JD3A 4I55B 3L70H 5ITZB 1NVPD 4IGGA 1XNQB 1BGYH 2EINC 4X20B 3T4DA 1WN7A 3HKCA 4R6ZA 2V7QG 5H9CA 3CCJV 1NTMH 2Q0OC 4MVSA 1M56B 2HFEC 1GO3F 2C2AA 4DW0A 1SQFA 3BY6A 5LL6Y 5CBHA 3N2KA 4MSWC 2HP8A 4LFAO 3TXQA 3JYCA 4B3SO 4KL1A 3OEEG 3T1CA 1F4NA 4AHCA 4JI0B 1D5NA 3CJHA 4B3TB 5KHGA 3ZMVA 1JR9A 3JD0A 1AR5A 3SYPA 3N27A 3ASNC 5IY5C 1W59A 4LNUB 4P30A 4MVQA 4ZOLA 3M99B 5IYCO 2KSDA 5DM6V 2DMXA 3B2EE 2QM8A 3ZIAG 5BMVA 2YIBA 1EBOA 4C7UA 5LMNO 2QWQB 3ZN1A 1DTOA 4JI2O 2QKCA 3APOA 2GTSA 4DV3B 2QEXV 3ABKC 2PF4E 3AG2B 3X2QB 2AZ0A 1K7DA 2CH7B 5KUMA 4W4LA 3OD4A 2EIMB 4P9PA 1K8AW 2DWDC 3F7YC 4H0LB 3P32A 1Q82W 4UFZA 3ABUA 1NH2B 4UCOA 1G6UA 4X65O 1Q6UA 3L74H 2P22C 3STLC 4MVUA 1CXZB 2B1IA 2JGDA 3ABMC 1TA8A 1YEWA 2HEPA 5KHIA 2A9HA 1HR0B 3JD2A 3OFNG 5L3EA 4UV8A 3SPCA 4IYIA 2D3OW 4NB5A 2Q8VA 2F43G 4HAMA 2RNBA 4TV9B 1HNWB 4RQFA 1NTZH 5IYZA 4J7KA 3OTFA 5FNVB 4O4HB 5B66Z 4JYAB 4N21A 5JQGA 3SPHA 3CP1A 1RM1B 3UCSC 1MG1A 1NZ6A 1OCCC 3ABLC 2UU9O 2Y69C 4QJFB 2QM7A 3B4SA 3H1JH 1XI1A 4RUEA 1QLEC 1RP3B 2P7TC 2DWEC 2CTPA 4FK5C 3NR7A 1R3KC 3A8TA 5H6QA 3AK2A 1JFFA 1SETA 2H94A 3J7AU 1UJWB 3RYFA 2B1GA 1FS0G 1M57C 2ITCC 4DV7O 5J9PC 3N2GA 4BW9A 1BHBA 3OMAB 2OIEA 1PNKA 4J42A 5KA6A 3J80N 2R9AA 1RSOB 3B77A 2BOBC 3RYCB 2BSKA 2W0XA 2JIZG 2UXXA 4MVRA 3CXCU 3ETGA 4LWSB 1L0LH 5JCOA 2R70A 4DR2O 1FXKB 1K5QA 4GYCB 3OAAG 4P2ZA 1XILA 4TOIA 2UXDO 2B5UA 1VQ5V 4DR3O 4I9WA 4ZIBA 3WB2A 5C8YA 1H2GA 3TCUA 4B3MO 2BTOA 4FLTA 5GONA 2Q7GA 1O9HA 3TGUH 1GK9A 1F51A 1OCZB 3CC7V 3HKEB 2JRIA 4Z1MG 1K34A 2W6IG 3JCUZ 4PA3A 1EM1A 3MD0A 3G80A 3RYIB 1NU1H 3FB7C 1H2KA 3EFFK 1SQQH 1UFIA 4X62B 4O2BA 2WLHA 4DUZO 3FX7A 2IH3C 4JI5B 1CEZA 4H44B 4LFBB 3T1YB 1I5XA 5CA1B 2QM4A 1Y66A 1FYJA 5JWPA 4I55A 3T2MA 4X20A 3ZS8C 3PJSK 2PTMA 1I7FA 1Q6IA 2N05A 2W6JG 1Q90D 5B1AC 3DGEA 1AJNA 4KP4A 1BQ0A 1V54B 3E89A 2XOKG 3DTUB 3L75H 4MTXA 2PI5A 5FLXN 2LGQA 4IHJA 2VQEB 4CH6A 1AB3A 1DF4A 3AG3C 4NVPA 4MVMA 1VQPV 2VQFB 1TAEA 1SERA 1YHQV 4FVMA 1SS3A 2DYRC 1O9GA 1YTFB 3CRMA 3JATA 1V55B 3QVNA 1G4YB 3ZEDA 4CC5A 4H13B 1JOYA 4LNUA 3K57A 4E2LA 4X66B 1B6QA 1U96A 4DR5B 3HKCB 4RWUA 1RM1C 4R8CA 2UUCO 5IJ0A 1ENVA 4L8JA 1EZJA 3S3WA 3E8GA 5B5EZ 1F7YA 1UPGA 2WPDG 3SYCA 3N2KB 2JEUA 1IBKB 5E1AC 2D2CB 2OIGA 4J9ZB 4RQEA 2DOSA 3CJHB 4O4IA 3F5TA 2KB1A 4J7JA 3BABA 3IGAC 1H38A 3BCCH 4LH7A 2X0LA 1J5EO 3JSNA 1RPRA 5BMVB 2ZIMA 4A5UB 2PUSA 1SC5B 3BEHA 4JF3A 1R6KA 2UXCO 1E79G 3RWRD 1MABG 3L71H 3KG2A 1BE3H 4YJ3B 4PI0A 4TV9A 1FJGB 4CH3A 1CP9A 2IBZH 2RMKB 5FNVA 4O4HA 1ZUQA 1GKFA 1QR9A 5IE9A 3OR7C 3E8BA 2JK5C 2Z0AA 4UB8Z 1S72V 2QSAA 4G28B 2RCVA 2Q9LA 1VARA 3U11A 4Q20A 4GKJB 1H2LA 4LF4B 1Q81W 2Q4PA 2ZT9B 1PNLA 3Q4HA 4FM1A 1PL0A 1NS1A 2UUBB 1AI4A 4WBNB 4UCTA 3JAWA 1NI8A 3JARB 5IYZB 1FXVA 3APQA 3JD4A 1LUWA 3D36A 1WB8A 1KECA 3H1KH 1R73A 1RFYA 2EZOA 4NR1A 5JQGB 4LFCO 1JMKC 2AW9A 3HKBA 5LOVB 5DECA 2ODMA 2EIJB 1VF7A 3BA9A 1QBZA 1MSDA 1JQ0A 4TSFG 4AILC 2ZE7A 1RSOA 1THZA 2XAFA 2IJJA 1GTOA 4Z2WA 3ZMTA 2EBOA 4D6TH 2FMLA 1GH6A 3KCXA 4LWSA 3LDEA 3SPGA 1BT8A 2E74B 3VQVA 3SYQA 1V54C 1WP7A 4CH4A 1VEWA 3RYFB 1SKVA 4WFGA 5EIBD 3N2GB 1FXKA 3QF7A 4YY3B 3AEIA 4NXNB 1YXBA 1KUQA 2XASA 4X1KB 5KHKA 4LF8B 1E1RG 5A2QN 1JJOA 4K35A 2HLDG 3A0BZ 2LQTA 2OTLV 4WFBV 2LFSA 4TV8B 2UXBO 4DV1B 3UO3A 4JZGA 3HKEA 2BSKB 5LXTB 5IWAO 2ARHA 3OUSA 2F23A 3H1IH 5KHHA 1BMFG 3O9OA 1R3JC 5EZYA 1QU7A 1H2MA 1ZLZA 2YICA 2NNUA 3G67A 5LYJA 1N36O 3WFVA 1NT2B 1OV9A 4JI4O 4P9OA 2NN4A 2UXBB 4CBCA 5CA1A 5C8YB 3ZHSA 2Y0IA 2LW7A 2JS3A 3PN1A 4HZ3A 5GONB 2UUAO 2EIKC 4BIZA 2H3OA 3LSQA 4JI8O 3F7VC 3RYHB 4FM2A 4DR4B 1OCRB 1LUVA 5LMUB 5JJNB 4JI3B 1OZ0A 2GUZA 4I0XB 1OJHA 4W4KA 4YJ2B 4H33A 4ABMA 4MT8A 3M8AA 1QCEA 1PPJH 3CCLV 3WB0A 3GB7C 5B1BC 3OM3B 4JI8B 4FLZA 5E79Z 3E8HA 1VF6A 4DR1O 3RGBA 3SPJA 1EFRG 1N32B 5B1OA 4O4JB 1WJZA 4JI6O 4NKGB 4FFBB 1L1FA 4YIPA 3UT5B 1CPYA 2QTOA 3F5WC 4J11A 3H01A 1US6A 2YEVB 4DK0A 1M9NA 4U3JA 2ZM6B 4IHJB 4BAYA 3CYOA 4PHZA 1KP3A 3C3SA 1AJQA 2KQXA 1NTKH 1HDJA 1AI7A 3JATB 2YIAA 4JAVA 4TUYA 4DV6O 4JI6B 3W7XA 2DE0X 1YCIA 1QHTA 5IJ0B 3ML0A 1W2BU 1Y4MA 4G2KA 3L73H 2N04A 3OMNB 3TXSA 3U0ZA 4LFAB 4CH5A 4B3SB 5H5NA 3DSQA 2VWJA 4GX1A 4YJ3A 4DK1A 2P4KA 3EXAA 3ICXA 4O4IB 3ETEA 3FYIB 4DUYO 2R9IA 4J80A 3CWBH 3RN4A 4ZI7B 1OCOB 1KB9F 2Q5ZA 2P6JA 5LMNB 4NXMO 4JI2B 1P7GA 1GM8A 3G71V 4KXRA 3ZX6A 1VIBA 2XHBA 4K0KO 4CS2A 2IJIA 3K9AA 3AG1C 5LP6C 1VQOV 1WA8A 2EILB 4UUJC 3ZMUA 3VBBA 3AG7A 5B3SB 4WBNA 4B7KA 2JJ1G 1EN4A 2CGOA 1PNMA 5B1NA 3JARA 4NYKA 3E83A 4KFMA 2M7WA 3G4SV 1W0KG 4X65B 1S76D 4RO2A 4MVZA 3W7TA 1LR1A 1KMIZ 2Q6AA 2ZXWB 5LOVA 1QVGU 4O4LB 1N34O 4DV5O 4JI7O 5CA0A 3R66A 4CC6A 3TETA 2CUGA 2WLNA 3OEHG 3Q4HB 5BZBA 4JV5O 2BOCC 2QWOB 1XMQO 2WAMA 3JAWB 1BQZA 1N4CA 1XL4A 4GUNA 4I50A 1X4TA 2HG5C 2WLIA 4FLUA 4IIJB 4MTFA 2UU9B 4AI8A 1WNSA 3HKBB 1XBLA 4CS3A 3OTOO 3CRAA 2Y4UA 4IT5A 5L3FA 1Q7YW 1TUEB 1YF2A 4X1KA 1H8HG 3HB3B 2ZE8A 2ZNJA 4JV5B 4QPJA 5CBGA 3D3QA 4BIUA 4EB6A 3CC2V 3FAVB 4TV8A 4LF5O 2GBOA 5EBLC 5D5PA 4FJCC 5LXTA 4DV7B 2IW5A 4GKKO 4TQFA 1ZSPA 3AG4B 5F2VO 4LCUC 2JJ2G 2DYSB 2A79B 1M56C 4WCEV 1Q8IA 5EYPB 3ZN0A 3K08A 2E5LO 4J10A 3EVKA 2LP7A 2L6LA 1GM7A 1XEQA 3B8NA 4WFEA 4RUFA 3CHXA 2KKWA 1EZVH 3D3IA 5JJEB 1BHAA 5LGNA 2XAJA 3FB5C 1QQCA 3RYHA 4B7EA 3CMAV 4DR2B 3R65A 1QVFU 2Q68A 3E35A 1K4CC 1H2NA 4DR6O 2V4DA 1TVKB 2Z3YA 5EZYB 2F66C 1XHZA 4I0XA 3CCEV 2UXDB 4YJ2A 4DR3B 1WAZA 1RPOA 2YI9A 2WLKA 3AG2C 2AHZA 1I08A 5LYJB 3X2QC 2ZR2A 5CBFA 4PJ0Z 4B3MB 1ROPA 1PD3A 3VOUA 2QKAA 2EIMC 3HPLC 4LBEC 1A32A 2WA3A 5EK0A 1JVMA 4OX9O 4F4LA 4QE9A 3UKMA 3GWKC 5LGTA 4FLWA 4O4JA 2F4VO 5KAIZ 4OPHA 4FFBA 4FPPA 1SRYA 4DUZB 2CTRA 1FXHA 3UT5A 4PELA 4FZ0A 2ADPA 2GSMB 2GUZB 2YEVA 4R7CA 4I5SA 4DV2O 2GTAA 1M1KW 4GT1A 4PA7A 2HR3A 1ZWIC 2P06A 4PDLA 3QO5A
chains in the Genus database with same CATH topology
4J41A 4J10A 4W4KA 4IYIA 2GTSA 4IYHA 4J42A 4J7KA 4J7JA 4KXRA 3FX7A 4W4LA 4J11A 2G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J41 A;  4J10 A;  4W4K A;  4IYI A;  2GTS A;  4IYH A;  4J42 A;  4J7K A;  4J7J A;  4KXR A;  3FX7 A;  4W4L A;  4J11 A;  2G38 A; 
#chains in the Genus database with same CATH topology
 3TJT A;  2VRZ A;  1VQK V;  2F4V B;  2ZNI A;  4GCZ A;  5JJJ B;  2LO1 A;  4TT3 G;  5LA6 A;  3IC7 A;  1PV0 A;  3QO8 A;  1IBM O;  3RBZ A;  3OE7 G;  3B09 A;  4D7T A;  2WWW A;  5CN0 A;  2CAZ C;  4GX5 A;  1XMO O;  1R3L C;  1SZT A;  1T5E A;  3JAL A;  3CCS V;  2DN9 A;  2RJZ A;  1XRE A;  4U3J B;  3OT7 A;  1KC8 W;  3KKY A;  4NTW A;  2ZDI C;  4N23 A;  2FYU H;  1I0H A;  1JCH A;  1Q6H A;  4PI2 A;  2Y48 A;  5L3C A;  2A0L A;  4DV4 O;  2EJ7 A;  2UUC B;  4ZI7 A;  1SQB H;  1IBM B;  4TUY B;  1DK1 A;  1GN6 A;  3DXR A;  1K73 W;  3CC4 V;  1YVW A;  4IL6 Z;  1DLB A;  2Q67 A;  2IU3 A;  1IBL O;  2AHY A;  3MHS C;  1K4D C;  3W7S A;  1XUQ A;  3FYE B;  2O57 A;  3CEI A;  3E86 A;  4B3R O;  4ICG A;  5FL7 G;  2KG7 B;  3ZRX A;  2ZR3 A;  2CGN A;  1I94 O;  4FLY A;  4MS2 A;  4DR7 O;  4U7O A;  1NVP B;  4Z1V A;  3LDC A;  2K1E A;  2Z5U A;  2YS8 A;  4RAI A;  1J5E B;  2RDC A;  2Q0A A;  5GTI Z;  3B8M A;  1FXK C;  3WG7 B;  3IJ4 A;  4O4L A;  3P30 A;  1Q3E A;  4DW1 A;  1KQS U;  1N33 O;  2UXC B;  2GV9 A;  3ASO B;  2ZIN A;  2ATK C;  1SA0 B;  1HW7 A;  5KX5 A;  4LF9 O;  2ZE6 A;  3P3N A;  4EEQ A;  2JS5 A;  4WFA V;  1WA8 B;  3K03 A;  4UCS A;  3HR0 A;  5BXZ A;  2BE3 A;  1OCZ C;  3VQW A;  2EIN B;  3G6B A;  3MDS A;  3CSX A;  4UVA A;  2XAG A;  4WFH A;  1QNM A;  4NTX A;  2X7R B;  4IIJ A;  2FTK A;  2XAQ A;  3KCY A;  3SR2 C;  1GM9 A;  1TGO A;  3CD6 V;  2Q7H A;  2DQ3 A;  2JGU A;  5D5Q A;  5CA0 B;  1AR4 A;  1YDX A;  3K58 A;  3SJQ C;  3FAV A;  3TK1 A;  5IY5 B;  3RVZ A;  2HVJ C;  5FPO A;  5K1P A;  3RVY A;  1DF5 A;  4KUM A;  1MNG A;  2YC0 A;  1WPB A;  4LFC B;  4UV9 A;  5IDJ A;  4I50 B;  3LNN A;  2WLI B;  1VQ9 V;  4ZKI A;  1R1B A;  5EYP A;  3ABK B;  4LC1 A;  3OGI B;  2ILM A;  1KP2 A;  4WF9 V;  2LFR A;  3OUF A;  1YSC A;  2QA4 V;  1V55 C;  4O2A A;  5DED A;  1ZL8 B;  3BHP A;  4EB6 B;  1VF6 C;  4K8Z A;  3HKD B;  5IYB O;  2IJH A;  1Z5V A;  4HYO A;  1LNQ A;  2DJV A;  1XDC A;  3A0H Z;  4DV0 O;  2K9P A;  1VP7 A;  3CPW U;  1WB7 A;  3ABM B;  1XNR O;  2ZCE A;  1TVK A;  1PL4 A;  2WLM A;  2Y4T A;  4FM0 A;  1GN2 A;  3JSL A;  3RW0 A;  1GRJ A;  5GW7 A;  1ORQ C;  4UXN A;  3I56 V;  1Y76 B;  2P5O A;  2ADQ B;  3L9D A;  4X1I A;  3CCM V;  3OMI B;  1I5Y A;  2QTS A;  4PDM A;  4PA9 A;  5IWA B;  4DV0 B;  2OCC B;  2CTW A;  4HBN A;  3SYA A;  1N8R W;  2P67 A;  3ZHT A;  1SQG A;  5L3D A;  3CCR V;  4GZR B;  5KHJ A;  1OCC B;  3ABL B;  3QO7 A;  2YDE A;  1D5A A;  1N36 B;  3ZMS A;  4JI4 B;  1KD1 W;  4AQY O;  1AP5 A;  1AJP A;  1QLE B;  5J2T A;  1NBM G;  1J95 A;  2ZE5 A;  4UB6 Z;  2UUA B;  1XNQ O;  3E2E A;  3JAS A;  4EKW A;  3K9S A;  1M57 B;  2YIB D;  1IXB A;  2WLL A;  2VS0 A;  1BZK A;  4ASU G;  4WFF A;  1Y67 A;  1S0V A;  4X89 A;  3SPI A;  2Y0P A;  1ARO P;  3BVO A;  1AI6 A;  4JAU A;  3K06 A;  4X9Q A;  3W7U A;  3FB6 C;  1FPO A;  4JI0 O;  4GLX A;  4B3T O;  5EBW C;  3CRC A;  4X64 O;  3UQ8 A;  4QNH B;  2XUM A;  5KAF Z;  1H2S B;  4F6E A;  3K5L A;  3SDL A;  2E76 B;  1B04 A;  2LGW A;  4DR1 B;  1HNX O;  2PYL A;  2LJ2 A;  2MW2 B;  2QGN A;  1Y6X A;  4UCU A;  1NKD A;  3QG5 A;  5LA6 B;  5H2F Z;  3K0D A;  3CRR A;  2PZS A;  4DV3 O;  1URF A;  2EIJ C;  5JH7 A;  4DO2 A;  1VMG A;  1DGS A;  4X64 B;  1D2D A;  2LW1 A;  5CA3 A;  1IVS A;  2AZ2 A;  4G27 B;  4U7N A;  2PYJ A;  1NR7 A;  3ZCC A;  2X6B A;  3CE2 A;  2F1M A;  3JAL B;  1HNX B;  1NR1 A;  2FB5 A;  2KG7 A;  2WSS G;  4QGP A;  2X6C A;  3WU2 Z;  4DV6 B;  2HJD A;  2XND G;  1G8M A;  1X59 A;  5KUK A;  2R9R B;  3DXR B;  1SQV H;  4LP8 A;  1AR1 B;  1K5S A;  3OW2 U;  1IXM A;  1HR0 O;  1SA0 A;  4J41 A;  3ETD A;  3E22 B;  1H8E G;  2OCH A;  2A06 H;  1HNW O;  2Q73 A;  3QTC A;  4KHP O;  3JCZ A;  4PD4 F;  2L35 A;  1Y74 B;  1KKC A;  5K1X A;  3OGC C;  4DUY B;  2NLJ C;  1ZX3 A;  4JYA O;  4QPK A;  5B1A B;  2YI8 A;  1KYO F;  3THO A;  1MOF A;  4DRX A;  4I4T B;  5JCO C;  2A3Q A;  3L72 H;  4NXM B;  3LSS A;  1S5J A;  1GN3 A;  1EN5 A;  4K0K B;  3VQY A;  1S5L Z;  5DN6 G;  4MVO A;  3AG3 B;  1KU9 A;  4KHP B;  5IJ9 A;  2DYR B;  1N0J A;  5KX5 B;  3S3X A;  4LF6 O;  1SQX H;  3P3P A;  3SJA C;  1IUR A;  2OCC C;  3CXH F;  2AXT Z;  5J2U B;  1GAX A;  5FPR A;  2WA4 A;  4OXS A;  5EC2 C;  3ZHU A;  1FFX B;  4R50 A;  3I55 V;  5KMG A;  2YXY A;  1SF9 A;  1OCR C;  4LH6 A;  1KBH A;  1N34 B;  4JGS A;  4NTY A;  4DV5 B;  4JI7 B;  3CME V;  2XT9 A;  2VWK A;  1VF5 B;  2CE4 A;  4JYY A;  2Q7E A;  4LF7 O;  3I5D A;  4LF6 B;  1HNZ O;  3FFQ A;  3B40 A;  3FKS G;  3SGI A;  1HP8 A;  1ZL8 A;  1XMQ B;  3FB8 C;  1ZAU A;  1XOU A;  3HKD A;  4BWA A;  3CX5 F;  4JTD B;  5AG2 A;  2CTQ A;  3K5O A;  3AK3 A;  1VQ7 V;  2R72 A;  2ZD9 A;  1V9P A;  4HNA A;  4FMT A;  3OTO B;  3JAK B;  4PA6 A;  2QR4 A;  4TWK A;  4LF7 B;  3NXS A;  3ETQ A;  3CCQ V;  5LP6 A;  1HNZ B;  2YSU B;  4BW5 A;  1Z5W A;  3ZRV A;  2XAH A;  1MZE A;  1Y76 A;  2GDS A;  4E4E A;  1K92 A;  2OT5 A;  1P4R A;  1OHH G;  4LF5 B;  4X1Y B;  3DC6 A;  3VQX A;  2XTA A;  4O2A B;  1WPX A;  4UVB A;  4OPA A;  4UCV A;  1YIJ V;  4L87 A;  4GKK B;  1P7B A;  4UVC A;  1MSW D;  1K3E A;  2N74 A;  1P84 F;  1AIL A;  4F6R A;  2ZKO A;  4X62 O;  1YI2 V;  5IT9 N;  4PV1 B;  4JI1 O;  2GHY A;  1B06 A;  3BFR A;  1M93 A;  4BR6 A;  1VQM V;  2E5L B;  4FZ1 A;  3T4Z A;  4ZHQ B;  4JI5 O;  1PP9 H;  1MA1 A;  4LFB O;  2HKO A;  3T1Y O;  1BS3 A;  1U97 A;  2EUL A;  4JTC B;  4X8A A;  1FD9 A;  4DXW A;  4X1I B;  4IYH A;  3WB1 A;  3ZRS A;  4Q6G A;  1G1X B;  1VQN V;  3CS5 A;  1OCO C;  4ZBM A;  3SJB C;  1L0N H;  1YIT V;  4JI1 B;  3ZBH A;  2QWN B;  5GTH Z;  4DR6 B;  4XDJ A;  4FLX A;  2ITD C;  5CB4 A;  3ZMZ A;  1ZTE A;  4YIO A;  1XHX A;  5LBQ A;  4J7Z A;  3UO2 A;  2VQE O;  1QLN A;  3IAY A;  2EZP A;  5JVD B;  2VQF O;  3K3W A;  4H37 A;  5ITZ A;  3C3T A;  2EIL C;  2IM9 A;  1PM9 A;  5B3S C;  1Z2G A;  2BTQ B;  5J2T B;  2QDO A;  4MW8 A;  1M5I A;  1EN6 A;  4X66 O;  4B08 A;  1NH2 D;  3EHB B;  4OX9 B;  4DR5 O;  4EFB A;  1B3Q A;  3JAS B;  2E3C A;  2ZXW C;  5EBM C;  2ETN A;  2DW4 A;  2WLL B;  3ZRW B;  1TUB B;  4UCR A;  4JYC A;  5KA5 A;  2F93 B;  1IDS A;  1IBK O;  2RN9 A;  1S3J A;  4DV2 B;  2IU0 A;  4EFE A;  3STZ C;  3K5M A;  3MAQ A;  1MMM A;  2JVD A;  4X88 A;  4LR3 A;  4J9Y B;  2AGA A;  3A0R A;  4QIW F;  3D36 C;  3JD1 A;  2OYQ A;  2EJR A;  3ABT A;  5A9G A;  2F95 B;  4TQD A;  3BPZ A;  1XMO B;  3RFR A;  1L8D A;  1SZX A;  3LUT B;  1SES A;  4I7Z B;  1S5H C;  4JZ2 A;  3CRQ A;  3ZHQ A;  5JH7 B;  1Q86 W;  2CH7 A;  1YZB A;  3E22 A;  1SQP H;  1JJ2 U;  1FJG O;  5LHH A;  2EIK B;  4ZOL B;  1Y74 A;  1JX9 A;  1GMG A;  4DV4 B;  3AG4 C;  1GN4 A;  3IFX A;  2DYS C;  4FFK A;  1WP8 A;  4I4T A;  3LSU A;  1VQ6 V;  5L3G A;  1BCC H;  2HVK C;  3LDD A;  1IBL B;  4GKJ O;  5BY1 A;  3CCU V;  4LF4 O;  2QKS A;  4MTO A;  5HFM A;  3BAA A;  2MK3 A;  2RQ6 A;  2BCC H;  4B3R B;  1S77 D;  5EC1 C;  2UUB O;  5TIS Z;  4OGQ B;  4K3A A;  1I94 B;  5B1B B;  1XL6 A;  2H8P C;  5J2U A;  2W0F C;  2NR5 A;  4DR7 B;  2G38 A;  3ZJZ A;  2Q69 A;  2P4V A;  3GWO A;  1FFX A;  3K5N A;  1BSM A;  3E8F A;  1F4M A;  3MHH C;  2JGD B;  4DRX B;  1IX9 A;  1FKA O;  1VQ8 V;  1N33 B;  2X6A A;  3CB2 A;  4K8X A;  2YXL A;  1QR8 A;  4MTG A;  1VQL V;  4LF9 B;  2IH1 C;  1MZF A;  3O65 A;  2PY5 A;  4XDL A;  2ZDI A;  4XDK A;  1NQT A;  1AP6 A;  5C93 A;  1K9M W;  5IJ9 B;  2YUA A;  3ZHV A;  2JDI G;  4JYB A;  5BR8 O;  2WLJ A;  3ASN B;  2QJ1 A;  3IC9 A;  4MW3 A;  3W7W A;  4U3F H;  5HFL A;  4YXW G;  1BL8 A;  1JPX A;  5KMG B;  5EIB C;  3BRC A;  2PI4 A;  4BIO A;  4YY3 O;  2M6Y A;  3JAK A;  3LNM B;  4JAS A;  2A7W A;  1AI5 A;  2E75 B;  1YJW V;  4NXN O;  3RYC A;  1PKX A;  3K04 A;  4PA4 A;  1AVM A;  4LF8 O;  3G6E V;  1XQ8 A;  2FKX A;  1F23 A;  5BR8 B;  1WLE A;  4GX2 A;  4FIP C;  4X1Y A;  4DV1 O;  1JA8 A;  3SYO A;  1JFF B;  4PDV A;  2JEX A;  2OTJ V;  4PDR A;  2HHH O;  2QWR B;  2QE7 G;  4I9Q A;  3GVM A;  3QNE A;  3FD9 A;  3K59 A;  2V1D A;  1FAF A;  4JTA B;  2CK3 G;  2YXH A;  4HNA B;  1W0J G;  4ZHQ A;  2QWP B;  3AG1 B;  3H9V A;  3J81 N;  4GX0 A;  3KZI Z;  1COW G;  1HWY A;  5LP6 B;  3AK1 A;  4CS4 A;  1YTF D;  1NJI W;  4JAA A;  2ZIO A;  1Q5O A;  1M90 W;  4DYL A;  1P49 A;  1K33 A;  1Q43 A;  3RYI A;  2HHH B;  3ZHR A;  1YJN V;  3UM7 A;  2EX3 A;  3K0G A;  5CMU A;  3U10 A;  1YJ9 V;  3K79 A;  3A2F A;  4DR4 O;  1IZ3 A;  3M7M X;  1VQ4 V;  1XNR B;  4XBF A;  3OR6 C;  5LMU O;  2IJK A;  4JI3 O;  5LHI A;  1K97 A;  4F6R B;  3CCV V;  2CDY A;  4FLV A;  2Y69 B;  3T1H O;  1R3I C;  3SJC C;  5JVD A;  4JPR A;  4YHH O;  2B9Z A;  1KKD A;  5KLV H;  3H1L H;  2BTQ A;  2P90 A;  3C90 A;  4D7S A;  5IYD O;  1M4U A;  3BA8 A;  3JAM N;  1N32 O;  1N0N A;  2UXN A;  5LHG A;  1E1Q G;  1FFT B;  1R6T A;  3ZRW A;  3WG7 C;  1R6N A;  4O2B B;  5LGU A;  2PGG A;  3D8C A;  2DQ0 A;  3H1H H;  5L3B A;  2ZQM A;  2HJF C;  3T1H B;  1TUB A;  3ASO C;  2FL4 A;  2OWO A;  5CB4 B;  3RT3 C;  4YHH B;  4CZZ A;  3DC5 A;  2ZM6 O;  4QE7 A;  4AQY B;  2YID A;  5H6R A;  3JD3 A;  4I55 B;  3L70 H;  5ITZ B;  1NVP D;  4IGG A;  1XNQ B;  1BGY H;  2EIN C;  4X20 B;  3T4D A;  1WN7 A;  3HKC A;  4R6Z A;  2V7Q G;  5H9C A;  3CCJ V;  1NTM H;  2Q0O C;  4MVS A;  1M56 B;  2HFE C;  1GO3 F;  2C2A A;  4DW0 A;  1SQF A;  3BY6 A;  5LL6 Y;  5CBH A;  3N2K A;  4MSW C;  2HP8 A;  4LFA O;  3TXQ A;  3JYC A;  4B3S O;  4KL1 A;  3OEE G;  3T1C A;  1F4N A;  4AHC A;  4JI0 B;  1D5N A;  3CJH A;  4B3T B;  5KHG A;  3ZMV A;  1JR9 A;  3JD0 A;  1AR5 A;  3SYP A;  3N27 A;  3ASN C;  5IY5 C;  1W59 A;  4LNU B;  4P30 A;  4MVQ A;  4ZOL A;  3M99 B;  5IYC O;  2KSD A;  5DM6 V;  2DMX A;  3B2E E;  2QM8 A;  3ZIA G;  5BMV A;  2YIB A;  1EBO A;  4C7U A;  5LMN O;  2QWQ B;  3ZN1 A;  1DTO A;  4JI2 O;  2QKC A;  3APO A;  2GTS A;  4DV3 B;  2QEX V;  3ABK C;  2PF4 E;  3AG2 B;  3X2Q B;  2AZ0 A;  1K7D A;  2CH7 B;  5KUM A;  4W4L A;  3OD4 A;  2EIM B;  4P9P A;  1K8A W;  2DWD C;  3F7Y C;  4H0L B;  3P32 A;  1Q82 W;  4UFZ A;  3ABU A;  1NH2 B;  4UCO A;  1G6U A;  4X65 O;  1Q6U A;  3L74 H;  2P22 C;  3STL C;  4MVU A;  1CXZ B;  2B1I A;  2JGD A;  3ABM C;  1TA8 A;  1YEW A;  2HEP A;  5KHI A;  2A9H A;  1HR0 B;  3JD2 A;  3OFN G;  5L3E A;  4UV8 A;  3SPC A;  4IYI A;  2D3O W;  4NB5 A;  2Q8V A;  2F43 G;  4HAM A;  2RNB A;  4TV9 B;  1HNW B;  4RQF A;  1NTZ H;  5IYZ A;  4J7K A;  3OTF A;  5FNV B;  4O4H B;  5B66 Z;  4JYA B;  4N21 A;  5JQG A;  3SPH A;  3CP1 A;  1RM1 B;  3UCS C;  1MG1 A;  1NZ6 A;  1OCC C;  3ABL C;  2UU9 O;  2Y69 C;  4QJF B;  2QM7 A;  3B4S A;  3H1J H;  1XI1 A;  4RUE A;  1QLE C;  1RP3 B;  2P7T C;  2DWE C;  2CTP A;  4FK5 C;  3NR7 A;  1R3K C;  3A8T A;  5H6Q A;  3AK2 A;  1JFF A;  1SET A;  2H94 A;  3J7A U;  1UJW B;  3RYF A;  2B1G A;  1FS0 G;  1M57 C;  2ITC C;  4DV7 O;  5J9P C;  3N2G A;  4BW9 A;  1BHB A;  3OMA B;  2OIE A;  1PNK A;  4J42 A;  5KA6 A;  3J80 N;  2R9A A;  1RSO B;  3B77 A;  2BOB C;  3RYC B;  2BSK A;  2W0X A;  2JIZ G;  2UXX A;  4MVR A;  3CXC U;  3ETG A;  4LWS B;  1L0L H;  5JCO A;  2R70 A;  4DR2 O;  1FXK B;  1K5Q A;  4GYC B;  3OAA G;  4P2Z A;  1XIL A;  4TOI A;  2UXD O;  2B5U A;  1VQ5 V;  4DR3 O;  4I9W A;  4ZIB A;  3WB2 A;  5C8Y A;  1H2G A;  3TCU A;  4B3M O;  2BTO A;  4FLT A;  5GON A;  2Q7G A;  1O9H A;  3TGU H;  1GK9 A;  1F51 A;  1OCZ B;  3CC7 V;  3HKE B;  2JRI A;  4Z1M G;  1K34 A;  2W6I G;  3JCU Z;  4PA3 A;  1EM1 A;  3MD0 A;  3G80 A;  3RYI B;  1NU1 H;  3FB7 C;  1H2K A;  3EFF K;  1SQQ H;  1UFI A;  4X62 B;  4O2B A;  2WLH A;  4DUZ O;  3FX7 A;  2IH3 C;  4JI5 B;  1CEZ A;  4H44 B;  4LFB B;  3T1Y B;  1I5X A;  5CA1 B;  2QM4 A;  1Y66 A;  1FYJ A;  5JWP A;  4I55 A;  3T2M A;  4X20 A;  3ZS8 C;  3PJS K;  2PTM A;  1I7F A;  1Q6I A;  2N05 A;  2W6J G;  1Q90 D;  5B1A C;  3DGE A;  1AJN A;  4KP4 A;  1BQ0 A;  1V54 B;  3E89 A;  2XOK G;  3DTU B;  3L75 H;  4MTX A;  2PI5 A;  5FLX N;  2LGQ A;  4IHJ A;  2VQE B;  4CH6 A;  1AB3 A;  1DF4 A;  3AG3 C;  4NVP A;  4MVM A;  1VQP V;  2VQF B;  1TAE A;  1SER A;  1YHQ V;  4FVM A;  1SS3 A;  2DYR C;  1O9G A;  1YTF B;  3CRM A;  3JAT A;  1V55 B;  3QVN A;  1G4Y B;  3ZED A;  4CC5 A;  4H13 B;  1JOY A;  4LNU A;  3K57 A;  4E2L A;  4X66 B;  1B6Q A;  1U96 A;  4DR5 B;  3HKC B;  4RWU A;  1RM1 C;  4R8C A;  2UUC O;  5IJ0 A;  1ENV A;  4L8J A;  1EZJ A;  3S3W A;  3E8G A;  5B5E Z;  1F7Y A;  1UPG A;  2WPD G;  3SYC A;  3N2K B;  2JEU A;  1IBK B;  5E1A C;  2D2C B;  2OIG A;  4J9Z B;  4RQE A;  2DOS A;  3CJH B;  4O4I A;  3F5T A;  2KB1 A;  4J7J A;  3BAB A;  3IGA C;  1H38 A;  3BCC H;  4LH7 A;  2X0L A;  1J5E O;  3JSN A;  1RPR A;  5BMV B;  2ZIM A;  4A5U B;  2PUS A;  1SC5 B;  3BEH A;  4JF3 A;  1R6K A;  2UXC O;  1E79 G;  3RWR D;  1MAB G;  3L71 H;  3KG2 A;  1BE3 H;  4YJ3 B;  4PI0 A;  4TV9 A;  1FJG B;  4CH3 A;  1CP9 A;  2IBZ H;  2RMK B;  5FNV A;  4O4H A;  1ZUQ A;  1GKF A;  1QR9 A;  5IE9 A;  3OR7 C;  3E8B A;  2JK5 C;  2Z0A A;  4UB8 Z;  1S72 V;  2QSA A;  4G28 B;  2RCV A;  2Q9L A;  1VAR A;  3U11 A;  4Q20 A;  4GKJ B;  1H2L A;  4LF4 B;  1Q81 W;  2Q4P A;  2ZT9 B;  1PNL A;  3Q4H A;  4FM1 A;  1PL0 A;  1NS1 A;  2UUB B;  1AI4 A;  4WBN B;  4UCT A;  3JAW A;  1NI8 A;  3JAR B;  5IYZ B;  1FXV A;  3APQ A;  3JD4 A;  1LUW A;  3D36 A;  1WB8 A;  1KEC A;  3H1K H;  1R73 A;  1RFY A;  2EZO A;  4NR1 A;  5JQG B;  4LFC O;  1JMK C;  2AW9 A;  3HKB A;  5LOV B;  5DEC A;  2ODM A;  2EIJ B;  1VF7 A;  3BA9 A;  1QBZ A;  1MSD A;  1JQ0 A;  4TSF G;  4AIL C;  2ZE7 A;  1RSO A;  1THZ A;  2XAF A;  2IJJ A;  1GTO A;  4Z2W A;  3ZMT A;  2EBO A;  4D6T H;  2FML A;  1GH6 A;  3KCX A;  4LWS A;  3LDE A;  3SPG A;  1BT8 A;  2E74 B;  3VQV A;  3SYQ A;  1V54 C;  1WP7 A;  4CH4 A;  1VEW A;  3RYF B;  1SKV A;  4WFG A;  5EIB D;  3N2G B;  1FXK A;  3QF7 A;  4YY3 B;  3AEI A;  4NXN B;  1YXB A;  1KUQ A;  2XAS A;  4X1K B;  5KHK A;  4LF8 B;  1E1R G;  5A2Q N;  1JJO A;  4K35 A;  2HLD G;  3A0B Z;  2LQT A;  2OTL V;  4WFB V;  2LFS A;  4TV8 B;  2UXB O;  4DV1 B;  3UO3 A;  4JZG A;  3HKE A;  2BSK B;  5LXT B;  5IWA O;  2ARH A;  3OUS A;  2F23 A;  3H1I H;  5KHH A;  1BMF G;  3O9O A;  1R3J C;  5EZY A;  1QU7 A;  1H2M A;  1ZLZ A;  2YIC A;  2NNU A;  3G67 A;  5LYJ A;  1N36 O;  3WFV A;  1NT2 B;  1OV9 A;  4JI4 O;  4P9O A;  2NN4 A;  2UXB B;  4CBC A;  5CA1 A;  5C8Y B;  3ZHS A;  2Y0I A;  2LW7 A;  2JS3 A;  3PN1 A;  4HZ3 A;  5GON B;  2UUA O;  2EIK C;  4BIZ A;  2H3O A;  3LSQ A;  4JI8 O;  3F7V C;  3RYH B;  4FM2 A;  4DR4 B;  1OCR B;  1LUV A;  5LMU B;  5JJN B;  4JI3 B;  1OZ0 A;  2GUZ A;  4I0X B;  1OJH A;  4W4K A;  4YJ2 B;  4H33 A;  4ABM A;  4MT8 A;  3M8A A;  1QCE A;  1PPJ H;  3CCL V;  3WB0 A;  3GB7 C;  5B1B C;  3OM3 B;  4JI8 B;  4FLZ A;  5E79 Z;  3E8H A;  1VF6 A;  4DR1 O;  3RGB A;  3SPJ A;  1EFR G;  1N32 B;  5B1O A;  4O4J B;  1WJZ A;  4JI6 O;  4NKG B;  4FFB B;  1L1F A;  4YIP A;  3UT5 B;  1CPY A;  2QTO A;  3F5W C;  4J11 A;  3H01 A;  1US6 A;  2YEV B;  4DK0 A;  1M9N A;  4U3J A;  2ZM6 B;  4IHJ B;  4BAY A;  3CYO A;  4PHZ A;  1KP3 A;  3C3S A;  1AJQ A;  2KQX A;  1NTK H;  1HDJ A;  1AI7 A;  3JAT B;  2YIA A;  4JAV A;  4TUY A;  4DV6 O;  4JI6 B;  3W7X A;  2DE0 X;  1YCI A;  1QHT A;  5IJ0 B;  3ML0 A;  1W2B U;  1Y4M A;  4G2K A;  3L73 H;  2N04 A;  3OMN B;  3TXS A;  3U0Z A;  4LFA B;  4CH5 A;  4B3S B;  5H5N A;  3DSQ A;  2VWJ A;  4GX1 A;  4YJ3 A;  4DK1 A;  2P4K A;  3EXA A;  3ICX A;  4O4I B;  3ETE A;  3FYI B;  4DUY O;  2R9I A;  4J80 A;  3CWB H;  3RN4 A;  4ZI7 B;  1OCO B;  1KB9 F;  2Q5Z A;  2P6J A;  5LMN B;  4NXM O;  4JI2 B;  1P7G A;  1GM8 A;  3G71 V;  4KXR A;  3ZX6 A;  1VIB A;  2XHB A;  4K0K O;  4CS2 A;  2IJI A;  3K9A A;  3AG1 C;  5LP6 C;  1VQO V;  1WA8 A;  2EIL B;  4UUJ C;  3ZMU A;  3VBB A;  3AG7 A;  5B3S B;  4WBN A;  4B7K A;  2JJ1 G;  1EN4 A;  2CGO A;  1PNM A;  5B1N A;  3JAR A;  4NYK A;  3E83 A;  4KFM A;  2M7W A;  3G4S V;  1W0K G;  4X65 B;  1S76 D;  4RO2 A;  4MVZ A;  3W7T A;  1LR1 A;  1KMI Z;  2Q6A A;  2ZXW B;  5LOV A;  1QVG U;  4O4L B;  1N34 O;  4DV5 O;  4JI7 O;  5CA0 A;  3R66 A;  4CC6 A;  3TET A;  2CUG A;  2WLN A;  3OEH G;  3Q4H B;  5BZB A;  4JV5 O;  2BOC C;  2QWO B;  1XMQ O;  2WAM A;  3JAW B;  1BQZ A;  1N4C A;  1XL4 A;  4GUN A;  4I50 A;  1X4T A;  2HG5 C;  2WLI A;  4FLU A;  4IIJ B;  4MTF A;  2UU9 B;  4AI8 A;  1WNS A;  3HKB B;  1XBL A;  4CS3 A;  3OTO O;  3CRA A;  2Y4U A;  4IT5 A;  5L3F A;  1Q7Y W;  1TUE B;  1YF2 A;  4X1K A;  1H8H G;  3HB3 B;  2ZE8 A;  2ZNJ A;  4JV5 B;  4QPJ A;  5CBG A;  3D3Q A;  4BIU A;  4EB6 A;  3CC2 V;  3FAV B;  4TV8 A;  4LF5 O;  2GBO A;  5EBL C;  5D5P A;  4FJC C;  5LXT A;  4DV7 B;  2IW5 A;  4GKK O;  4TQF A;  1ZSP A;  3AG4 B;  5F2V O;  4LCU C;  2JJ2 G;  2DYS B;  2A79 B;  1M56 C;  4WCE V;  1Q8I A;  5EYP B;  3ZN0 A;  3K08 A;  2E5L O;  4J10 A;  3EVK A;  2LP7 A;  2L6L A;  1GM7 A;  1XEQ A;  3B8N A;  4WFE A;  4RUF A;  3CHX A;  2KKW A;  1EZV H;  3D3I A;  5JJE B;  1BHA A;  5LGN A;  2XAJ A;  3FB5 C;  1QQC A;  3RYH A;  4B7E A;  3CMA V;  4DR2 B;  3R65 A;  1QVF U;  2Q68 A;  3E35 A;  1K4C C;  1H2N A;  4DR6 O;  2V4D A;  1TVK B;  2Z3Y A;  5EZY B;  2F66 C;  1XHZ A;  4I0X A;  3CCE V;  2UXD B;  4YJ2 A;  4DR3 B;  1WAZ A;  1RPO A;  2YI9 A;  2WLK A;  3AG2 C;  2AHZ A;  1I08 A;  5LYJ B;  3X2Q C;  2ZR2 A;  5CBF A;  4PJ0 Z;  4B3M B;  1ROP A;  1PD3 A;  3VOU A;  2QKA A;  2EIM C;  3HPL C;  4LBE C;  1A32 A;  2WA3 A;  5EK0 A;  1JVM A;  4OX9 O;  4F4L A;  4QE9 A;  3UKM A;  3GWK C;  5LGT A;  4FLW A;  4O4J A;  2F4V O;  5KAI Z;  4OPH A;  4FFB A;  4FPP A;  1SRY A;  4DUZ B;  2CTR A;  1FXH A;  3UT5 A;  4PEL A;  4FZ0 A;  2ADP A;  2GSM B;  2GUZ B;  2YEV A;  4R7C A;  4I5S A;  4DV2 O;  2GTA A;  1M1K W;  4GT1 A;  4PA7 A;  2HR3 A;  1ZWI C;  2P06 A;  4PDL A;  3QO5 A; 
#chains in the Genus database with same CATH homology
 4J41 A;  4J10 A;  4W4K A;  4IYI A;  2GTS A;  4IYH A;  4J42 A;  4J7K A;  4J7J A;  4KXR A;  3FX7 A;  4W4L A;  4J11 A;  2G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...