3X2QB

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3x2qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x2qB02
3WNIA 1WA2X 1WS8A 1A8ZA 3T6VA 1E5YA 4HHGA 5I26A 1JZEA 1ET5A 3IEAA 2DYRB 1GSKA 1NINA 1OOWA 5A7EA 1ILSA 3FPYA 3C75A 1SFDA 2IH9A 2MTAA 3KW8A 5PCYA 4DP5X 2YAMA 5I6LA 2NRDA 3HEIB 2IDUA 2J55A 4E9XA 3CDZA 1PZBA 2Y69B 1AZUA 1BQ5A 1MG2C 1PY0A 4AKOA 1R1CA 1ASPA 2I85A 3IBOA 1VLXA 3FU9A 4PAZA 3T6ZA 5TK2A 4N8UA 1IBYA 2R7EA 4HALA 2UXVA 2JXMA 3UADA 5I5JA 1QHQA 1OCOB 3AG2B 3ABMB 2X88A 4JHUA 3V9EA 4YSPA 4YSSA 4DP4X 2Q9OA 1KBVA 1WA0X 2QPEB 1ILUA 2HX7A 1OCCB 2BP8A 2FWLB 5LDUA 2FT7A 1A3ZA 2PCFA 3ERXA 3NSFA 3ASOB 3X2QB 2YXWA 5B1JA 5I28A 5AFAA 3H4FA 1E30A 1B3IA 2IDQA 5TK4A 2Q5BA 3NSCA 2IAAC 1V54B 4M4RB 5I6PA 1AANA 1W6WA 1AZNA 3UAAA 1OE1A 5I5MA 1MDAA 2YARA 2IDSA 2FTAA 1ZIAA 1SHXA 1AS7A 1J5CA 2IWEA 1EZLA 3S3CB 2EILB 3PAUA 5AKRA 4TXVB 2YAPA 3IN0A 2PLTA 3H4HA 1NIFA 1A4AA 4HCIA 2IH8A 3RYMA 5I6KA 4BDVB 5B7MA 1T5KA 5B3SB 5AZUA 1OF0A 1DZ0A 3DIVA 1FA4A 4DPCX 1XMEB 3QJQB 3ZX1A 3NJFA 4YVUA 2DWSA 2VN3A 3WKQA 2GC4C 4X4KA 4RH4A 4YSTA 4E9RA 3WG7B 2CAKA 4YSEA 4KO9A 2HRHA 3NT0A 3CZUB 1PZCA 1CYXA 1KDJA 2XVBA 4A2HA 2UXGA 1GY2A 2HZHA 1BEXA 1ZV2A 1TEGA 2CJ3A 2BP0B 1ASOA 1W8EA 3ABGA 3PPSA 4BDVA 2IDTA 2RACA 4AKQA 5F7AA 1RZQA 1OCZB 1E65A 2FQFA 3OMAB 1M9WA 1RZPA 1BQKA 2YAFA 3QJSB 4UANA 4Q89A 2BWIA 1IC0A 1L9QA 1URIA 2DY2A 4W9ZA 3PAZA 2XX0A 1J9SA 3T71A 1KV7A 3S8GB 1SDDB 3FSZA 3L45A 1UATA 2ZWNA 5D4JA 1V55B 2PPFA 1JXGA 4A66A 2QDWA 2HLEB 1E67A 5I6OA 2H47C 3FT0A 2BHFA 3NJMA 1FWXA 4A2GA 2I7OA 3IE9A 3S3DB 1ETJA 4YSDA 1GS6X 1NICA 5B1AB 4GYBA 2ZXWB 5I6NA 3QPKA 2GSMB 2UXTA 1CUOA 3ABKB 3OD3A 4JKNA 1SDDA 4MFHA 1DYZA 3EH4B 2WO2B 3NSDA 4E9SA 2XX1A 3OMIB 4EF3A 4BXVA 3PLYA 3IN2A 1NIAA 4DP6X 1BXUA 3DTUB 2EIKB 3CVDA 2TSBA 3KW7A 4F2EA 3GDCA 1IKOP 1CC3A 2GHZA 2DV6A 2AZUA 3FU7B 1V10A 3QJVB 3T6WA 2E86A 2UX6A 2TSAA 2CUAA 2XLLA 1KCWA 1GS7A 3TBBA 1KGYE 1GS8A 2QDVA 2AVFA 4BWUA 1AIZA 1ZPUA 2I7SA 1PLAA 2BW5A 2XYBA 7PAZA 2UXFA 3CVCA 1ADWA 3JTBA 1PCSA 5D4IA 3CVBA 1PLCA 4DP0X 3SQRA 2X87A 2GI0A 1AZRA 1OV8A 2FT8A 3NYKA 1QNIA 3OM3B 3WI9A 1X9RA 3PCYA 1E5ZA 1AZCA 1JZHA 3NJLA 2EIMB 1OE3A 2XXFA 3UGEA 5B1BB 3TBCA 3FSVA 2HRGA 1KBWA 3DKHA 3EF4A 3FSWA 9PCYA 4AKPA 4KNSA 1SF5A 2PPDA 4E9WA 3AG3B 4CSPA 1FFTB 5IY5B 4HIPA 3AZUA 2CBPA 4HZ1A 4KNUA 2IWFA 1PMYA 5I6MA 1SJMA 1YLBB 4UF7C 1WAEA 3X1BA 1ZDSA 2VSMB 4DPBX 4G72B 3OQRA 4GXFA 1RKRA 2HX9A 5E9NA 2BZCA 5B7EA 3S3BB 1BYOA 1TU2A 1ET7A 4BWTA 2JKWA 4GY4A 1PNDA 1M57B 2XV2A 3H56A 1HFUA 4P5SA 1MZYA 1NPJA 2PCYA 2XWZA 4HCGA 2LLNA 5D4HA 3TA4D 4E9TA 4G70B 4A2EA 3NJKA 3QJRB 4HHWA 3UABA 2DWTA 4YSQA 2QT6A 2P80A 1JZJA 4KOBA 1AAJA 4E9QA 1N68A 1IUZA 1EHKB 1JZGA 2H5UA 4KO7A 3WNJA 2B3IA 4ZK8A 3AY2A 2GB2A 3ZDWA 4YVNA 4A2DA 4A68A 5B7FA 3NJNA 1J9TA 2H3XC 4BK5C 2PP8A 3EHBB 2GC7C 1SFHA 3ASNB 2OCCB 3SBQA 3CG8A 1A65A 1NDTA 1J9RA 2YAQA 4AX3A 3QJUB 2PPCA 1AR1B 2DYSB 3T6XA 5EHFA 4YL4A 2VSKB 4BWWA 2BZ7A 4G7RB 2VMJA 4FAAB 2BP0A 2XUWA 4DP9X 5PAZA 4DP7X 3NSYA 3FQ1A 3QJTB 2IDFA 2IWKA 4HCFA 2YAHA 2YXVA 4WTQA 3V9CA 2OJ1A 1WA1X 3NP4A 2FQEA 1PF3A 1XB8A 4GP4B 1NZRA 6PCYA 1RCYA 4YSAA 3S8FB 2VW7A 2PP9A 3FYIB 2W88A 2WSDA 3NJIA 1NWPA 7PCYA 3G5WA 2WO3B 3ZBMA 2XXGA 3BVDB 1TKWA 2VW6A 2YAEA 1JXDA 1ZDQA 2J57A 5F7BA 3CDZB 1ASQA 3WIAA 1X9UA 6PAZA 1J5DA 2GIMA 5FC9A 4NAJA 2YQBA 1ZIBA 4M3HA 2CCWA 1JZIA 1BYPA 2J5WA 2GBAA 2CALA 3AG1B 4NB7A 1AOZA 1ID2A 2R7EB 1JVOA 2FQDA 2JFCA 3BQVA 1TEFA 1AZBA 1IBZA 3D12B 1NTDA 4JHVA 1JERA 4KNTA 1HAUA 1NIEA 4YSUA 2QPDB 1I53A 2UX7A 4DP1X 3FS9A 3SBRA 4GP5B 4A2FA 2BP8B 1JZFA 1CURA 3GXUB 1BAWA 4F7KA 1NIDA 3NJJA 3UAEA 3MX0B 1GW0A 4KO6A 2P80D 1JVLA 2VW4A 1PNCA 4QKTA 3FPXA 3EH5B 2FT6A 3FU7A 2VM4A 1JXFA 1AG6A 3OMNB 1N70A 5ANHA 3GYRA 4KOCA 2ZONA 2AANA 4YSCA 1A4BA 2EIJB 3X1FA 2BW4A 1PLBA 2YEVB 3FQYA 3X1EA 5B1JC 1AS6A 1L9RA 3SBPA 1L9TA 2B08A 1SF3A 4G7QB 4L0PB 4G71B 4A67A 2PP7A 3EH3B 3UACA 2BWDA 3ABLB 2XV0A 3WKPA 3ZIYA 1J9QA 4HAKA 1AG0A 3NJHA 4QLWA 4E9VA 2FNWA 3N2JA 3JT2A 3TASA 3AG4B 1XB3A 3QQXA 3FQ2A 1JOIA 1ET8A 1M56B 1W6LA 2AFNA 3T9WA 2FQGA 2HXAA 3N55A 4W1TA 4YSRA 1F56A 2YAOA 3X1GA 4DP8X 1GR7A 1MZZA 5B1KA 4UAHA 3PXLA 2A3TA 1CYWA 8PAZA 2W8CA 2VM3A 2XV3A 2AZAA 1KDIA 1SNRA 1NWOA 2XU9A 1WS7A 1GYCA 2OV0A 4NERA 1NPNA 2HX8A 4P5RA 1L9PA 1AACA 4DP2X 3PAVA 1BXVA 1BXAA 4CSZA 4KO5A 2PPAA 4DPAX 3U25A 2Y1AA 4AZUA 4FA7B 3HB3B 4Q8BA 1GY1A 1NIBA 4N4YB 3NP3A 4E9YA 2PPEA 3NJGA 4F2FA 2MRYA 1HAWA 1L9OA 4AI7A 2FJSA 1A4CA 3X1NA 1BQRA 2N0MA 3AW5A 1AQ8A 5I5IA 4PCYA 1OCRB 4G7SB 4WKXA 4GP8B 1MG3C 1OE2A 1PAZA 2BO0A 3FYEB 1KYAA 1QLEB 4BXSV 4K9JA 4YSOA 3MBWB 1L9SA 1SHWA 1PZAA 2J56A 2EINB 3TU6A 2ZOOA 3FSAA 1XB6A 3FU8A 1AS8A 1KCBA 4ENZA
chains in the Genus database with same CATH superfamily
2GHYA 2A3QA 5FFLA 2YGVA 2YJQA 4X4ME 4CBPA 3FU5A 3HA0A 3HC0A 5B21A 3K9SA 5FEBA 4PLJC 4EN3D 5CEYB 2H8PC 1VGEH 2UWEB 3HI5H 4MSWB 4YIQB 5E8DL 1CXKA 4ZMOA 2L35A 3H3PH 3IT8D 1C16B 5F9OH 2WW8A 2OMYA 3V5HA 5D5MA 3VQLA 1TGOA 4E9XA 4GEIA 1SUJA 2CBQA 3A21A 3V0WH 1S9YB 1S7WA 3GMRB 4R97B 3HG5A 4HJEA 4XXWA 2ZCEA 1F6LL 2UXCB 3BPOB 3D85D 3MKKA 1GIGH 2F8OA 3UADA 3KPNA 1E3FA 3DX3A 1HW7A 4ZW8A 1O6VA 4PJCF 1PFCA 3RNKA 2CUMA 2EYTA 2HJFB 1F1AA 5D1XB 3GGWA 3NACL 1XMQB 1ZVYA 3Q13A 1SC5B 5G55A 1B6QA 1KU9A 4LF7O 3VB9A 1M90W 3QUMB 1WA0X 2QPEB 4JHWL 1NT2B 4H2AA 1A21A 4GX5A 4MS8C 1UJ3B 2C9QA 1WQVT 3WEOA 3K71B 4GUOA 3BVXA 1Z5LA 1LK3L 4AEHL 3HAEB 1GHFH 3QZWG 5DJAA 2F53B 4DVRH 5HY9B 5ERWA 2UUBO 1R73A 1OWWA 4JI2B 1U8PB 3F64A 4Y9GA 1JHLH 5FHBH 3VXNB 3E8VA 4FLZA 1CDCA 2MTPA 3MXWH 3NSCA 3WFEH 4ZOBA 1V54B 1LO2H 4H8VA 4XMWA 3AACA 4G8EB 2RHEA 2VWKA 2ZPKH 4Y88A 4AIZA 1KG0A 1R0AL 1HHIA 3ILQD 5F6IC 3IFLH 3HCVB 3SDXA 2QKAA 2XN9E 1EZLA 3L3HA 2BOLA 3A6CL 1NBVL 4N6RB 3NIGB 1J05A 5CMAB 3TA3A 1I94B 4XVUD 5BUPA 1QW8A 4FE9A 4EKJA 4N2CA 1A4JA 5SWZD 1ZWIB 4ISVA 1BZ8A 5SWQB 1UD6A 1P7QA 5M94B 5C0RL 3LZFH 5C0AA 3RTQB 4F4LA 5EBLB 2IFFH 3WY4A 5B3SB 4OUOA 4TOYH 3A6OA 2Q3AA 4DV0B 2DL9A 3NCBB 1IFGA 2DWSA 2UXXA 4O02H 3DMMD 4JDZA 1ZLVK 1CXZB 4M7KH 1UFIA 3EYOA 4LIQH 4ZI8A 5I24A 5DI8B 2WWKO 2WUCH 1KGWA 1UXSA 2D0GA 3PWPA 5F8RC 1DBKH 4JFPB 1LO5A 1GK9A 4TRPH 5ALBL 3RWFB 5BUAA 3ULUD 3QTCA 3OTOB 3PL6C 1N5YL 2VAJA 1EERB 2EJ7A 2HKHH 4DV2B 1OK8A 3CSBA 4KKAD 4AV0A 3CCVV 2V5YA 2FVNA 3O9WA 3EIFA 1IAIH 2QQQA 5CBFA 1L1FA 2X4UB 3QDGE 1OV9A 1NCBL 3LVTA 5HDBE 5E08H 1QNMA 3FU3A 2OTWA 4OZGB 2Q87A 4QIWF 1BQKA 4DGUA 1MVUA 5E4OA 5SX4H 1M05A 4WV1C 2IJHA 2XBTA 5TE4L 1CGUA 1IFHH 2XHBA 4ZFGH 3SDAA 1NC2B 1KV7A 1GGTA 4G8GE 4X80L 1A7PH 3T2LA 1KCRL 1N5AA 1UATA 1X4ZA 2ZWNA 2MQGA 3KL5A 1EHLH 2JCCF 2Z8RA 3H7BB 4N0CD 5IVXF 3RA7H 3PNWB 1E4JA 3NJXA 3CRRA 2FGWL 2HLEB 2WSKA 4G7VH 3DARA 3N41B 5FV1L 3RL2B 1E4KA 1CI3M 2IXQA 4QPJA 1R3HA 2AP2A 5J0BA 1MHPH 1MREL 4U49A 3I5DA 2VLJD 3CLWA 5ICZB 2ZXWB 2F54D 5DO8A 2FIKB 3O3AA 4IOFD 1QFWH 3BC9A 5I71C 1KQSU 4I0PD 4NFCA 1GAXA 3TXAA 3VFOA 1G84A 4ZNEE 3Q05A 3WTUA 3N5AA 3SJVB 5DF0A 5JDJA 1NDGB 2D9QB 3IU3B 1JYVA 3VMPA 1ZK5A 5HYJD 1QRNE 4F8LA 5DFAA 5EO0B 4TQFA 1M2VA 2V3DA 5KVGH 2GTZB 4J6RL 3OGCC 2E3CA 4NM4H 4ZRGA 3T0EC 1CFTB 2A9NL 5IJ0A 4K8RH 3WJMA 1BM3H 4JKMA 4LLYB 5A2CA 5KYWA 5IB5A 4NQEB 2LLLA 5E5UB 1T83C 3S35X 1O6SA 2R83A 2GV9A 2Z65C 3T0WA 4UTAH 2B59B 1KGYE 3DX6B 3TBBA 5E6IB 5FW8A 4TYUA 1PKQA 5IBTH 2QDVA 3ZS8C 1I9IL 5J6GB 5EIIG 1T4KB 3GZOA 2I7SA 4M8VA 3WMSA 1ZS8A 1PZ5A 2BJML 3LSOB 4C54A 3F8UB 4GMSL 3WO4C 1GMIA 1LNUA 1IGIL 1I7TA 2EC8A 2BTQB 3FUMA 4DP0X 5GGUB 4HPOH 1MRDH 4ZPVB 2JVDA 2KUTA 3SE8H 3BAXA 5F7NC 1EDQA 1OIOA 3SGIA 2IU0A 1OGSA 2VLLA 3IPEA 4HEPG 1BVKB 3LKNB 5GGTH 5TDOB 1E3XA 5BQ7B 4AENA 4KITB 1ZGLP 4ONHA 3P02A 4D0DB 2WIIA 2DS4A 5DN6G 2IWGA 2MNUA 3UGEA 3VXMD 1CFMA 4Y4KA 3L3IB 4I9WE 5HDQL 3BUYB 4CSPA 4XVSH 1IQWH 2ZKOA 2UY6A 2P49B 2W9EH 1JZ8A 1F4YL 3B9KC 5E0FA 2C3VA 1JGUH 3X1BA 3LX9A 5E8EA 1R6TA 2O6EA 4IS6B 4L9LA 4FABL 5FB8A 4QE7A 4G6KL 3VNZA 2ZDIA 2H2SD 1N33B 3CNKA 3BPNC 2GTWB 2AABH 4KX7A 2QM8A 1BQHG 2EIMC 1KZYA 2BMKB 4H8QA 3MRMB 4LF3A 1TJGH 2X6MA 5JJEB 2G30A 3VVWA 4MDJB 4IRSC 5J06A 5D1ZA 1K34A 4K3EH 5T5FH 1AVAA 3ZE1F 4X7EC 1HQRA 5FKPA 2L7UA 1BGXH 4QRTB 3LSUA 3W9EA 1FYJA 4NLHA 3SGJC 4PJAB 3WNJA 1J18A 1U8OB 3RBGA 4ZTOL 1IFRA 2IM9A 3DXAD 1LDSA 2F58L 4Z1VA 3GO1H 3OKDB 4A7TA 1M57C 3NA4A 2R2BA 2NMSA 2ZSVA 1KJMB 2W9LA 1RZJH 4XCYB 3GMLB 4Y2OA 1J5HA 5GSVB 1J9TA 1MNUL 3QI9B 2MNWA 3D3VA 3L48A 1NTMH 5A2KH 3OFNG 4DFIA 4Q0XL 3H9VA 3SYQA 5I1EL 2V7NB 5D1QB 3LPWA 4M1CD 2B7DT 3LH9A 4PJIA 4Z7UE 3NXSA 3SBQA 3K0DA 3M17A 4NEHB 3NIFB 4PGZA 5JORA 2MOVA 1D5AA 2EE6A 4CMHB 1OP5K 3CFNA 1J8HD 2FYUH 5JJJB 2NY6C 2XJLA 4NQQA 5DEGA 1LD9A 1D2PA 1XGTA 5DLML 1NBMG 1UCBL 2C9AA 5AVRB 4ZUSA 1BYNA 2DEXX 3C3SA 1CQYA 1C7SA 3I3BA 3UQ8A 4TPRL 4D0CA 4FJZA 4X6CB 1FYHB 3UTZA 4ERSL 1AQKH 4WNSA 1MVFA 1HNWO 1YMHB 3VRJA 4IBVA 3PY9A 3BMVA 1FDLH 3VWKC 3PHQA 1BVOA 1Q0EA 4XH2A 1QWHA 4GQ9H 3ZBMA 4RMTA 4E0RB 5TD4A 2UUBB 2QZ5A 3O3BB 1T04B 3UP6A 5TISZ 2HKAA 1Q9OB 1USQA 4LK4A 4MVBD 1DBML 4DK5A 3NN8A 4OQTH 3GIZH 5I1LB 1P7KA 2GIMA 2VLRB 4YHOH 4NAJA 5D7IB 2GTAA 4MLSA 1IGML 1W72A 1FFOB 2LW1A 4KXZH 2GI7A 4NB7A 5MEOB 2R7EB 3KWTA 3MMEA 3P4LA 1CZ8L 1SYVA 3QJHA 4FXKB 2D31B 1KB9K 4KMTL 4MDIB 1QW9A 5AOLA 3ZKMC 3WTWA 4GPVA 4KNTA 1C1EL 4MAUL 4N1EA 3LPGA 4WDIB 5KYUA 3TN0A 3UAJA 2EVJA 3HNVL 4KI5F 3BKML 3R19A 2JI2A 5GS0C 4NQCA 1MEXH 1Y4MA 4GP5B 4JFEB 5FECA 4O4IA 4LVHC 4FPPA 4XNZB 2J5LB 3ZDYF 3JWNG 1ZA3A 3N44F 4ZX3A 4I7ZC 4QHLB 2OCJA 1DQLL 3GXUB 1I3RB 4KPHH 1ZTXL 2IADA 1ZVNA 4N1CA 4XXWC 4UNUA 1A7RH 5J1AA 1JPSL 3FFCB 5DTFA 1CD9B 3MGOA 4P59L 5EYPB 1CFQA 1KB5H 2W59A 4F7TB 1HWYA 3QQ9D 3WV0A 3O4LD 5BRZB 1SESA 4ZX6A 2KG7A 5IMOA 1JYWA 1AG6A 1MCJA 2Q5ZA 3T09A 3HMXA 4U7KA 4XN2A 3W82A 3QDMB 4XN1A 1NGZA 1MFAL 3FUEA 3QEUA 4Z1PA 3BKCL 4LPVA 1CTMA 2OMNA 1ZSDA 1BFOA 4FNSA 2D7OA 2WVTA 3K5MA 3FQYA 3FO9A 4IGBB 5IYBO 5DJ0A 3KEHA 5E8DH 3W2DL 3WFBH 4YMPA 4FFYH 5FW6A 1INEL 4L0PB 1Z9LA 3O4OB 3EJJX 3S96B 5KA6A 1KGIA 1DE4B 2K8QA 2QV4A 3FDWA 1H3PL 4M48L 2J1ZA 2Q20A 4GKSA 4JFSA 1BZ9B 4LEBA 3RX7A 1LP9A 4OCNC 3OEEG 3DYMA 2EIDA 3UO2A 1ZA6A 4BHUA 2QHRL 5DRNA 2GUOA 1AO7B 2VXUH 5F1KC 3ZZSA 2HMIC 3TA3C 4PRIE 1MWAB 4KKCD 4N85A 5EPMA 4ATTA 1IC5H 4K07A 3KPOB 4YHNA 4AXWA 1S7VB 4JANA 4Z95H 4JHWH 4XDJA 3WIFA 4YDIL 4O2EA 4UOW0 1YHPA 4E41B 4YWGL 2YD5A 3HRZA 4U31A 1XBRA 2WLHA 4CMMA 3TETA 5CINL 1XZ0A 3QFJA 4AEHH 1J1XL 2X4OA 4OM0H 2FR4B 4L18A 3LXUX 2VN5A 2A74B 1UZ6E 3GI8L 4BD4A 4R84A 2FWUA 1J95A 3ZMUA 1VENA 2RFXB 4Y4FB 3KXFA 2OMUA 1FXKA 1QBML 2Z91A 2XTJE 1BP3B 4G8FB 1K2DB 3ELAT 4P2QE 1UM5L 1U91A 1OTSC 5E5MA 1HXKA 4GSRA 1CL7H 5IVNA 2RA1A 2XETA 1NDMA 4PJXB 1DO6A 1JDCA 3WUZA 3A6CH 4ZS6C 2QWRB 2FJSA 2MQCA 2CR6A 1H0DA 4HWBA 3X1NA 1G7HB 3MRQB 5KSAA 4LSDA 3G6BA 2RTTA 1A3RL 1D3CA 3Q4HA 1I1CA 5C0RH 3IDIA 1CGWA 1MFUA 4S2SB 2Q1EA 3S34L 2XZAL 3VW3L 3Q06A 4HT1L 5E8OA 2SODB 2Y72A 2HLFC 4P2OB 3HKZA 3P9MB 5IB4B 5CJOL 2ZUXA 3P9LB 3RL1B 1DSFL 3TYGL 3EGXB 5I0WA 2A6IA 3Q3GB 4TULL 1E4KC 4FZ8L 5ESQB 5ALBH 1SHWA 1NANH 4QRBA 2CSPA 1N5YH 2RH0A 1MLBA 3L3OB 3MFFB 1BQLH 1S7SB 4P04A 2J73A 4GUQA 4P5KA 1E5YA 4HHGA 1NCBH 4J2QA 2L04A 3B7TA 1OPOA 3VFUA 1OWRM 4DOHE 1S9XB 4WW1B 2IAMD 1DBBL 2A4ZA 1N2RA 5J2UB 4OPAA 3KLHC 3ZE2E 1R6VA 2P90A 3K4DA 5E99L 5TE4H 3VRIA 2YAMA 1JQ0A 5I6LA 1HESA 1TVKB 1K4CA 4X80H 1KCRH 2Y2WA 1BAFL 3L3KA 1N0NA 2HYMA 1H15B 4PJ8B 4NRZA 2VB5A 3RFRA 2FGWH 5BOZG 4AKOA 5KVGE 1OALA 3DOIA 3CFJA 3L7EA 3U1QA 4Q9RL 1VLXA 1SQFA 3BD4A 3F7RA 5KHHA 2CMRH 2CGOA 5ILTL 4YXLL 2IEPA 3CX5J 3T3PF 1MREH 2JXMA 1NLBL 4I18A 5AOZA 3RWCB 4NXNO 1D5XA 3WXWL 2UXNA 3O6FC 5EU6A 5T1MB 3ABMB 1OD9A 2GITB 2NXZC 3RAJL 2RR3A 1VEPA 1IVLA 3LPOA 4RRPG 5DVMA 1JF1A 4GRLD 3L4UA 4U3JA 5K1NA 3WKNA 1JFFA 1OCCB 4YBLC 2EDXA 5I1AB 4X1YB 2YPLE 3NSFA 5GSRB 3X2QB 4FZ1A 4HAMA 4UXNA 1XAKA 2AJXL 2P24A 4JRYB 4EDWL 2PO6B 3EOAA 3DX7A 4LSTL 5FO2A 1KCLA 5FGBC 3ETEA 4QRPA 4Y4KC 2CO2A 1S9VA 4GX2A 4H25A 4H44C 4J6RH 2ITDB 4JGSA 4PEEA 4AMKL 2GBOA 2Y07L 2Q7GA 4FJYA 5F2VO 1WBYA 4JN2B 4Y5YB 5F44A 43CAA 2ENPA 1HHGB 2EDTA 2ZDIC 2WXLA 1I9JL 1I9IH 3GK8L 1ZE3C 5AZ2L 3VFMA 3PRZA 3IN0A 3V0HA 2BJMH 4HCIA 1HNWB 5BW7A 4GMSH 1XBLA 4IOSA 5AW3B 3CS5A 1IGIH 4NT6B 1IM9D 1MJJA 4PWJA 3H0TA 1WE5A 4LF8O 1TCRA 4N90D 2MHAB 5ICXA 4J9YB 4O2BB 4B7IA 3KVPA 4Y8DC 5E0QA 5TF1H 2WCGA 3OPUA 3OKMA 2DWXA 5D1ZC 3APMA 3IFOB 4A6YB 4F7EB 3BQUB 3DECA 2DL2A 3IJEB 2D7MA 3LRSA 3MV9A 5HHOA 1MH5B 4HGKC 3C08L 5HDQH 4A2HA 1YPZA 1A6UL 1GY2A 1RUKL 5TDPA 5CSZA 3P3UA 1ZSHA 5TQ0L 3ZO0A 4O2AB 3ISWA 5DS8A 4YJ2A 1F4YH 3AT8A 4QOKE 1U0QA 1WIUA 4G6KH 2M26A 4MJ5A 2RACA 1K7DA 4X9QA 5TE6L 2FQFA 2HA1A 2DI7A 2H6UA 5T33L 1B6DA 2YXMA 5IMKA 3TPUB 3IETA 3SGKA 2PY5A 5TH2A 5KW9L 4APXB 4JDTL 2A9HA 5LYJB 1JD7A 1L7TL 1YMMA 5B5EZ 1X7SA 4W9KC 3CCJV 4UQ3A 2NNAA 5AW6B 3RGVD 1JPGA 5DO2C 5AAWA 2NY3B 4BFKA 2NX5E 3OJDB 5KEZA 4Z7QF 4P07A 4W6XB 3WGVB 4IMKA 5DXWA 2XQ0A 25C8L 4X9HA 1WZAA 4ZTOH 2FEJA 3IFPA 4J3XA 4MXVE 4OF8A 4B6ZA 4ZMWA 2VQEO 1XQ4A 2EDDA 2F58H 2VDRL 4WEUD 3ZUNC 2EVIA 1RUAL 5KSBF 4OFYA 2FWOA 1SXNA 3MRKB 3WXVL 4CA4A 4RSVA 2N56A 1MNUH 1EN4A 5AW7B 3S5ZA 4DCQA 3GMOB 4Q0XH 4HJGB 4OV6F 3BT2L 4DN3H 2C9SA 3OE7G 1SF9A 2VSCA 2XG4A 5IF0B 5LG1A 4AC2A 2J25A 3SDCA 4AJ0A 3L7FB 3BSGA 2Y7QA 1H3XA 3FT4A 5B4MC 2ZP0T 2LU3A 4J8RA 4CNIA 1NIAA 1K8DB 4HDIA 4X6DA 1E4XI 1NU1H 1KPRA 5D2NA 5K5YA 1YAIA 2NSXA 1BD2A 5CLXA 1D5MA 3GDCA 1R75A 5DLMH 2OT5A 1UCBH 5GONB 1SQBH 2X4PA 2A6DB 2W60A 3OKLB 4GB9A 3O45A 4N2MA 3TBWB 5JDSB 3M8OL 4QXTB 4TPRH 3UAJC 3QJVB 3TN0C 4OZIE 3IYLW 4HIXL 4ERSH 1XOUA 2AW2A 2V9UA 1BF8A 4NO0B 1UXWA 5GW7A 2AAVA 2Z31D 2ZYSA 3D39B 3HE7B 4I4WA 4KTYA 5HGHA 2I5YL 1GS8A 4ZTEA 3WSQL 5DJXA 4HC1A 2A6JB 1B2YA 1CT8B 4H13B 1AIZA 1ZPUA 3U46A 1B3JA 4ZAKB 4HWBL 1PS3A 1YUHB 2PCPA 4HFUL 3CVCA 4U05A 1PCSA 2JJTA 1MJUL 4YDJB 2K3TA 1DBMH 3V79C 3P30A 4I50A 3OKEA 3HLAB 2F1AA 4U3XA 2C1OB 3QZOA 3T8MA 1OLZA 1IGMH 5GZNC 4WFGE 2YGOA 4H5SB 1EH9A 3O3EA 3Q8FA 1NUNB 1UH4A 4QJ4B 3RPIB 2H32B 1CZ8H 2HRGA 4EO5A 9PCYA 1VADB 4D9LL 4GSUA 4AC4A 1BMWA 4MAUH 3OF6A 4JCWA 4HZ1A 4YDLB 3BKMH 5K93A 4JJHA 1CWVA 4CW1A 3EDKA 1FVCB 3VFSA 4W70A 1YNTA 5LOVB 2C8NA 4PGDA 2F7PA 3ZLQC 1DQLH 1KB9F 3EO1B 1ZTXH 3O11A 5I0YA 4FNPA 3R06B 3D0AA 4EN3A 3VG0H 1JPSH 4DGYL 3U9UB 5I16A 2ADYA 3BP4A 3L1FA 2V17L 3DOSB 5IIEB 3IF1A 1UHVA 3HLKA 4H33A 4RZCA 5DUPL 4GW5B 2R1WA 3ZT5A 4LP5A 4LVNB 1XEDA 4E9TA 3J80N 4KXZI 2D0FA 2NW2A 4GW1A 4XDKA 2IQAA 1NH2B 4I4TA 1RJLB 3KH4A 3KLDA 2AJ3B 3BKCH 1GGIL 5TDNA 1U8KA 3HRZC 3LKSB 2R29A 2G0LA 1YEEH 4HK0A 4RA0C 2CBTA 4MBRA 5K1JA 5KOMC 3CC4V 1U92B 2HFEA 3WUWB 1O5PA 1XV8A 2WBJD 1QVFU 4Y19D 3SJBC 4QNHB 4NI3A 3L3GA 1INEH 4A2DA 4BWWA 1FFQA 3SPGA 5BV7B 2HVJA 4ZMNA 4ZO6A 3F58L 2JKRM 1H3PH 4JI7B 3GB7C 4LSRL 4M48H 3TL5A 3V0AC 4JG5A 4K7FA 3QS2A 4WIQA 1P4LA 1XHXA 2HTLD 4X9BA 1QR8A 4P5MB 1L0QA 2IMMA 5E56A 4J3OF 3TBTB 1TYJA 1RJYA 5I73C 5KSAC 1E9QA 1KCSL 3WOVA 3W7TA 5HVHB 2V9RA 4LFCB 3MRBA 4JREB 4QO1B 2UWEF 2BP0A 4GRMA 4OJFL 4YDIH 1VACA 2XUWA 5EWIL 4YWGH 5MEQA 1T7ZA 5H35B 4ICGA 4UI2A 5CINH 4B9FA 3BD3A 4UM9A 1J1XH 3UTSB 3ZUCA 3DBXB 4U1NA 3V9CA 5HHVL 3HAEG 4PDRA 3T0EE 3GI8H 1N34O 1JWMB 5C0CB 1ZEAL 4HUWB 6PCYA 4K15A 2VDLL 1OP9A 1OAUL 1QBMH 4N5UA 1EVTC 4IDJH 1AI4A 4ATWA 5SWZA 3LV3B 4Y16B 4GO8A 1NM9A 1KIPA 1UM5H 2C7FA 1H38A 4UVAA 1RZKC 2R56L 4F33B 3VXPB 4DUXA 3LD8B 2WWNA 1S9KC 3J7AU 4XO9A 5H2BB 2X0WA 1KIQA 1TZAA 5FC9A 3T0BA 3BP5A 4HIHB 2YQBA 4NAMA 2ID5A 3DMMA 1CLCA 3MBEB 1YA5A 5JPNA 5CIPA 2E3VA 5L3EA 3WEBA 3QXWA 1AOZA 1A3RH 1OO2A 1G9HA 1OHHG 5ICYB 1KTDA 4O4JA 1G9NL 3S34H 3K6SB 4KBPA 4ZDHA 1K4CC 3CQPA 3VW3H 4QHNA 3MHHC 2MKLC 2UX7A 3C09C 4HT1H 4WKZB 3K04A 2DWEB 3QG6B 3KCWA 5CJOH 3C60C 3M7OA 5FIEA 1DSFH 2A6KB 2FYYA 1T1YA 4IMLA 2PCFB 5DD5L 2DJVA 3PJSA 4TULH 5GHWL 3WTTA 3AVEA 3NJJA 3L9RA 4IBLT 4BKSC 3DC0A 4JB9L 4YBQC 4I18C 4X20B 5DJ6A 4IYHA 5JO5A 4O5LH 5DEDA 3IC7A 3NIGF 5IVXA 3K4AA 4J7RA 3APOA 2WHVA 3KNBB 4F7CA 3ML9A 4J4PD 2YLHA 3NZ8B 2EE0A 3P3SA 2X6CA 2KI6A 3RTQD 3FH8A 2B1GA 4NZTL 5JOFB 1ZHKA 2AJSL 2Y0PA 1OAXL 1PLBA 3QB7C 1GZHA 1PNLA 3C2AH 3EH2A 1WISA 4O9HL 2VLJA 4HJ0C 2F54A 1BAFH 2EDNA 2CHNA 2J8UA 5LA6B 4JDVB 3X14B 3LN9A 1UWGH 4LF4B 2Z3FA 5JXEA 2WQ8A 1BEYH 1QBLH 1NOAA 5J11B 5SWSD 2DD8L 3D0LA 5L3DA 1I8KA 4YXLH 4AYBA 5ILTH 1S7QA 2V2WB 1U3HB 5HYJA 3QO0A 5IV2A 4URKA 3WXWH 2BOCB 2CR0A 3L08A 3U9PL 4OZGF 3RAJH 2UXBO 2AFNA 3MJ8B 5B39B 1UPGA 3U7AA 2L6LA 4APQC 5F3BB 5BW7C 3BO8B 1WTGT 5L2JB 2XN9B 3GC3A 1AY1L 3DVGA 1Z0MA 2O5XL 2JGUA 4YZFF 3REWA 3BYTA 4JFDE 3TEWA 1LEIA 1JPEA 2L0DA 1E1QG 4EEEA 1RIUL 2G5BB 3OKOB 3PABA 2JKNA 4UIMB 2WVUA 4RFEA 2AJXH 2AZAA 5LXGH 4PI0A 1KDIA 3HS9A 4HHAB 3BUQA 4LSTH 1ANUA 5E1HB 1P6FA 4IU3A 3N41F 4L4VE 5FYLD 4HC1L 1RURL 4YGVA 4XRCA 3B37A 5I8KH 4Z3EA 3FOMB 1KYDA 5KA5A 4P23A 2XAJA 1MHHA 4YHYC 3QO1B 2A83B 5G4MA 2F23A 1UVQA 3P30L 3GK8H 5AZ2H 5KAQF 3P54A 4R26L 3QA3B 4MMYA 3RILA 1N8ZB 4IEFB 1Y76B 1W72H 4L8DA 1NKRA 5E9AA 3SGKC 1Q3EA 1DLHA 3QDGB 3U30B 5HDBB 3IJHB 3C6LB 2XVKA 2OYKA 4O2CA 3LMJL 5EIIA 2CTQA 3VGBA 4G7SB 2P5OA 2E8ZA 4XO5A 4XBFA 1HWGB 2J1WA 5AAWC 2HTKD 4P3WA 1FO0B 2OX5B 3FAWA 5IOPB 2AK4A 1V9PA 2LO1A 1WFUA 4X9YA 1MG3C 4UV4L 5D5ME 1BIIA 4DV3O 1B2WL 5G2NA 4IMKC 4G8GB 5FR3A 1LYQA 4AY0A 2ZOTA 4N2KA 3T2NL 5AALA 5ACMA 2XQYK 4D8PA 4U3HA 4YSOA 2WMPA 1A6UH 3EYUL 2P3YA 4HEPA 1RUKH 2JMRA 2VDMB 4P05A 5ALCL 1L5GB 1OB1A 1S5HB 3TU6A 1KT2A 2EAEA 3I75A 5GS3A 2H9GB 3FT1A 2HJLB 5HPOA 3MJWA 3TNMB 3CFKA 4RMRA 5LXVA 5TE6H 1WP8A 2DYRB 1ITBB 2MFNA 2YQGA 3LKRA 5FWRA 1ETB1 3SDCC 2VL5B 4PRBA 3ETBF 1Z5VA 4JDTH 1WP7A 2G2RB 4KXBA 4CDHA 1OCWH 3DXAA 5IKCB 1L7TH 4I48A 5T1DL 5T1JA 3QUGA 3Q44A 1MXDA 3DSFH 2YEZA 3COOA 4JASA 3HEIB 4PWGA 1BQHA 2ZE7A 1SVCP 1EVUA 1QRNB 2J88L 5CJ8A 25C8H 3LN5A 1KTLB 3L6FB 3QUZD 4NDMA 1O9GA 5CS7A 2HT3D 1HL4A 1VEMA 2XDHA 3AM8C 3MA9L 4UCOA 1KWGA 2CHXA 2VDRH 1T1ZA 2X53A 4LHJB 1RUAH 1ZHBB 1P4RA 3BHBB 5F7MC 3WXVH 3M7FB 4NQXA 1OCOB 2XT9A 1J8HA 5IQ7H 3BW9B 3SDXE 4IKNA 1CDYA 5I0XA 5HJ3A 5EIBC 3PGDB 3QUKB 3HC2A 3T8XA 2R69L 4ZPTB 3UPRB 1YTFD 4JFFB 1MCDA 4K94C 3ULVF 5E94B 4X89A 2AXTZ 2AV7A 4U6VL 4N2BA 3W7XA 5C0AE 2FDBP 4XCCL 1IURA 5EA0L 1Y6MR 3FTXA 4UILL 3JSSA 5CB4B 4J9ZB 5HGBA 3W38A 1NEPA 2ZUQC 1BZDA 2YUAA 1N18A 1WFNA 4XMUA 3ARBB 2OTJV 1G7JA 1NBQA 2B14A 2WQVA 2ZT9C 4PJAF 3M8OH 4WVRA 1KULA 1W6WA 1SXCA 1DVQA 3UAAA 1QHTA 3BPCA 3PWPE 1W0KG 4HIXH 2NSMA 1ZIAA 4LE8A 5DSCA 5EC2A 2HRPH 3QI9D 3EKCA 4NHUA 2FL4A 3HE6B 1TLMA 2I5YH 4G7YL 4HWBH 4HFUH 4W9LC 2GSIB 4W9DC 1KZQA 5DS2A 4YS4A 1N34B 2ZKXA 5FFGA 5C6PB 5KBMA 3NIFF 1M1XA 3Q8EA 3SGEI 1M1KW 4DV7O 3KG5A 1UA6L 4MMXA 5T8IA 4FQIL 3S36X 3QYMA 3GBLA 3QJZA 4AIEA 4WGKA 5E2WL 4JZJA 3ARQA 4LESA 3GBNL 2VN3A 2ATKA 3GUTA 3SJQC 5E6UB 1EFXD 1FLTX 3K4ZA 4HPYL 4YSEA 5GRUL 2EILC 2JLLA 5CCGE 2XWXA 1VQ8V 2FJHB 3NT0A 5KS9A 1PZCA 3BPLB 4F8NA 1JZ2A 4X6CF 3BVUA 4L1BA 4D9LH 2WAMA 3G08A 2UXGA 4K3GA 4NXSA 4HMDA 1R34A 1U97A 2QKIB 3O4LA 3BAEL 2HVJC 3IJ9A 4PWFA 1FNEA 1PG7L 4FJ6A 1OY3B 2P4VA 1MY5A 2GW5A 4XHJC 4AKQA 3NCYP 2BS8A 1U58A 3OMAB 2HH0H 4R0LA 1SY6A 5T1MA 1G7QA 4FN0A 4DGYH 2V17H 3G5VB 2DIEA 4JI1O 4FQQA 3EBHA 5DUPH 4OZFG 5D7IF 2XX0A 2BY0A 3DV4A 2K70A 4MJIE 3SDDA 3MI6A 2LAGB 2X3BA 3L45A 3R0NA 4G6AD 5FDWB 5ITBL 1I8MA 3E8FA 1LTXA 1KN2L 1NEZG 4EI5C 4ZQTA 2Y0IA 1B0RB 3MJ9A 4QWWD 4W9GC 3GF8A 3VXTB 2VLKB 1P1VA 3LTVA 1NC4D 3TFKC 2OMXA 3ILQC 5IJ9B 1R5WA 1YY9D 2WTRB 1A7QL 4M6ML 2UZIH 5CEXB 3IE9A 2OIGA 3QSKB 2A0LD 4HU8A 2AERT 5F3FA 4GYBA 2ORBL 3MGAA 1MCKA 5CJBA 2J44A 4LSRH 2FUQA 3UEQA 1PKQE 1SDDA 1J7VR 3VFPB 4U7MA 3WY2A 3TCLB 5CD3B 4CBZA 4BQ8A 4NLAA 1KC5L 5AYUH 1RIVL 3HKCB 4R7VA 3IN2A 2WXPA 3A4AA 3DMMC 2CLZB 3WNOA 1BBJB 2CK0L 2AXFB 1ROPA 5BO1L 1KCSH 2OYPA 5JPNC 3GRWL 4HIIA 1E7VA 3MJ7A 2ODIA 4YHHB 2DE0X 3A22A 3KPLB 4LCCA 5EWIH 1Z9PA 4E42A 3V0DA 3ULUC 4LMQE 3ISYA 4NRXB 3IWVA 5AVYB 3PQYD 3LHAA 4NQDB 2RBLA 5HHVH 3NPSB 3L75H 2OJZL 2UX6A 4KJWD 4M3JA 5D6CB 5LN8A 1ZEAH 1HDMA 2VDLH 1JTTA 1KOAA 5EFIA 2WLNA 1HI6A 5C09B 2VAAA 1WC7B 3DXRB 1YO4A 1YJ9V 1FBIH 3ARGD 3OL2A 2JRIA 3NCYS 2GJ6A 2PYLA 2VDNL 1I75A 1HJBC 1PLCA 3MRHB 5F7FA 1A6TB 3SQRA 1SQQH 2PW1B 4JPVL 1PZUB 1A6AB 4ZMQA 4KXDA 4RWYL 2AI0L 5F7HA 1Q90A 2IAND 3LCYA 1NM4A 4N5ED 4J7ZA 5GGSY 4JPRA 3TV3L 5HSFA 3OUFA 2X7LB 4GS7C 1S5LZ 1OP3K 4E41D 3NJLA 3O2DL 5DQ9A 3MC0A 3EF4A 1OKEA 1GZHC 1FD9A 1IBMO 1G9NH 3B7SA 4XX1G 4Y4FD 2LV4A 1D9KC 1E8WA 1SYSB 5JPMA 3ARDB 4ZJ9A 5DVLA 4JFYB 5JHDB 2EDFA 5BUGA 3P3RA 3TO4B 3WNPA 3S4SG 3X13A 4MWFA 3U36A 5BZDA 3DV6B 1N3NA 5A2JH 2OMZB 1U8JA 4G1MB 5DD5H 5GHWH 3PWUA 3BWZA 5JXEC 3CCLV 2IAMA 4CC5A 1U95A 3FQNA 2BRRL 3DGEA 1NUDA 3D3VE 4R7LA 3A5VA 2AV1A 4Z8FL 1K8IA 2Y5TA 4N6QA 4PJXF 4DV3B 4PDVA 1B6UA 3OJ2C 4PJIE 5DZOA 5DEJA 1MZYA 3CZKA 4XPHL 3KWVA 5IYDO 3VXRD 1UASA 3DJRA 1ZV9A 3IDNA 4XXCA 5IB1A 1R3KC 5IMLB 1HINL 2DWTA 4NZTH 3PP3H 2AJSH 3QQDA 1OAXH 2H26B 2P4KA 1N7ML 2C3GA 1AYOA 1JHKL 1O0VA 3HJ0A 3NZUA 3UBXG 5I76B 4C4BA 4CH3A 4P2OD 3TWCL 2EKSA 3K2KA 3V7AE 3WL9A 4O9HH 1LE9A 1ETZB 4WK0B 3SPVA 1F1GA 2HN7A 1Y18B 4L1TA 5C1MB 4IRJB 2UZYA 5CGTA 5KBDA 3KYMB 2Z4TA 3DPBA 2K9UA 1AMYA 4YXWG 2WP3O 3D30A 4GRLA 1KJ2L 4MQSB 3KR3H 3P4NA 3V6ZB 3H9HA 3FUFA 4P23C 4NJ9L 1AZZC 2XWTA 1IARB 2DD8H 4I9QA 2NY4B 5C0IB 3P3NA 1A65A 2YPVA 3WTYA 4P2QB 2FBRA 3ZMZA 1YRKA 1HCVA 2NY0C 2WZPD 1AD0A 3SN6N 3T2PA 4DT2A 2DYSB 1S2EA 4BA0A 4CVWA 2Y2YA 4QDGA 4D3CL 1TOXA 1AY1H 3FCSB 1L0YA 1PKOA 5FYKD 3BEHA 4FULA 4NOFA 5H94B 4DP9X 4W4OA 5DJYB 1RIUH 2K9PA 1NFAA 4IGGA 2BY3A 2OCCC 4IHJA 4RRPA 4X98B 1RCYA 4PRHD 1DJWA 4JM2B 3VG9C 4HC1H 1RURH 4UM8B 4EPSA 1MAMH 4HGWB 4FQJL 1IM9A 2LE9A 4DUYO 2WJ5A 4UTCA 3WJLC 3RYIA 1KKCA 2BTOA 2EIZA 5AOMA 3MVSA 2Q9LA 3LYRA 2C34A 3BAJA 4K94H 4OBRA 3LNNA 4JAVA 1J5DA 3P30H 3OVUB 4FEMA 3UIYA 4R26H 3NFNA 1R5IA 4M3HA 1UGNA 4PJFE 1WITA 1D5IL 5IEKA 4PB9H 1FV1B 3MRIB 4MB1A 1DFBL 1ECYA 3FQRB 4R7CA 1ID2A 1JVOA 2QV2A 2FUTA 2D2CB 1BHAA 1QFWM 2XQYG 2H6OA 1TAEA 3ABKC 3H6JA 3UZVA 4RESB 4JQVA 4JRYD 5EZLB 3V4UL 2PO6D 4DOHB 3RX8A 1A32A 3LAFA 4PRDB 1CLVA 4HOMA 1WD9A 4U1HA 3RW0A 5DHXB 3BUBA 3T4ZA 4DV7B 3N43F 4UV4H 3L2LA 4WJ5A 5LCVA 3VE0B 3ZKSD 1IIKA 3EDEA 1CURA 4DKEL 1YDXA 4F7KA 3KWWB 1R3JB 2HJDA 3EYUH 3AC0A 5GJSL 1SY6L 1ZL8B 1KCUL 5ALCH 5AUMA 3BUPA 4LKXB 5IVOA 3VRLF 3LIUA 4B9CA 3H8NA 1EEUA 1LP9E 1KACB 3N1PC 4FG6C 5HYSB 2HJKB 4TTDD 2WPGA 4ASUG 1P4UA 2YUZA 4ZUUB 1RVFL 4P5TD 5KYYA 2VUOA 5L3GA 3ESMA 3MJ9L 2Q73A 3KMDA 1RZ7L 1QLFA 4ODBD 2Y7MA 4NPYA 3H1ZA 5T1DH 3RWHB 3TJHC 2W91A 5MERA 1L9TA 4X8GA 3DRTB 1HHHB 1H2GA 1NMCC 2YPLB 3K91A 4HW6A 4JI1B 2X4SB 3QFJE 1OAZL 2ZOUA 4HAFA 4BFGA 4MZ2A 1ZVHA 3I9GL 3KXFE 4I87A 5DK0B 3IJ8A 1J9QA 3LNDA 1E7UA 2VQFO 3ZHLA 2JKLA 3GSWB 5EC2C 2APVA 2EIJC 2BXZA 5CFHA 3AG4B 4AGPA 4NTXA 4BSVB 2AK1L 1OAKL 2XPYA 2E6PA 3QJFB 2Z7UA 3HPJA 4U1MA 3T1CA 4FMVA 2BNQB 4PJHE 5C8JA 3TC9A 4HV8A 1ZHNA 1JYNA 2R69H 1CGXA 4X7FC 2ED6A 3RWDB 1A7BA 1ACYL 1NGYB 4DK6A 1T5WB 2IC2A 3IPBA 3CCMV 2Z1KA 1UD3A 2D9CA 4U6VH 5HHQB 2DQIL 5DRZA 5DJDA 5DWUH 2ICWJ 4XCCH 5EA0H 4CUCA 4JZJC 5C0FB 1NAMA 4R83A 2Q6AA 3VQYA 2V3EA 4N3TA 3B2VL 1CU4L 4NERA 1A47A 4WFED 3OR7A 2Q69A 1EEZA 4RETB 4IHOB 2J4WL 4LQ1A 2YS8A 1GJUA 5IYZB 3FZUD 3IVKA 4XP4L 3N1FC 5J2TB 4TS6A 1AC0A 4DR2O 3NJGA 4MBOA 1GAFH 3BXNB 1IV8A 2FHBA 1S7RA 4Y9FA 5ITZA 4KJYB 3BOVA 3MRRA 5EC1C 5T5NG 2DQ6A 4G7YH 1F11A 4XMTA 2HFFB 4R0LC 1KGCE 4HOZA 1JV2B 1ORQA 2BY1A 1WFMA 5CIPH 4NS0A 2QLYA 1HZHL 4B0MM 2YXHA 3KLKA 3JWNC 5CN2A 3SDDC 3ULUH 1SOSA 3BUTA 4KJQD 5FO9B 5SX5H 2ZAIA 3GBNH 3K57A 1SJEB 1S8DA 4HPYH 3C9NB 5CBAA 3GRGA 2H8PB 4BQBA 5IFHL 3C90A 1LR1A 3WFHB 3KGTA 4NO0D 3KBEA 3D39D 3OEHG 1MDTA 4KKCC 2WA3A 3BAEH 4HH8A 2MJWA 4FMTA 1OT1A 3VVVA 4ZYKA 2P8PB 1IBMB 1PTZA 4I8DA 4DNLA 5I66A 4RAVB 3DSQA 1MY7A 1XAUA 3MTXA 3L95B 2QQLL 3Q6FA 4Y0GA 5A6IA 1ET5A 4M7ZC 1OXYA 5EU6E 3EADA 3OSKA 1QSED 1VGKA 2VXVL 2XTLA 1XMOB 1NUFA 3V4VA 3OXRB 3FPYA 3LY6A 4WO4B 2NDGA 5IQOA 1MHCB 1NFIB 1IILE 2BSRA 4L8BB 4WI7A 4CC1A 3S88L 1EBPA 2WBJA 4Y19A 3K58A 4N24A 4OUUB 5ES4B 2ZKHL 1P5VA 5LBQA 4HA1A 5IEHA 1LMKA 3TBVB 1XR8B 5FA4B 1JGEA 3LQZA 3P2BA 4KKQA 1FL5B 5ITBH 2RGSA 4LCCC 5JNYA 4ABVA 1WFOA 2Z7ZA 4NN5C 3TF4A 4QRPE 4JAMB 4UINL 2CIKA 2QVKA 4PJDE 2I60L 5FK9A 5TK2A 2EULA 1A7QH 2YGNA 4HNAB 4FLXA 4HUXA 4M6MH 4XPBL 5IQLA 3SOBH 3ZDXE 1I8AA 4AM0A 1UUNA 2YPVL 1J5EO 4FP8L 3SJCC 5I1DB 3ARED 2BSED 4OZIB 1YVWA 3IXAA 3GT6A 4F15C 4F91B 2WYZA 1UKTA 1GOFA 3IK2A 4AM0Q 1UG9A 4EUPB 4X7SH 4UCUA 2MIZA 1C16A 4PA4A 4PGCA 4WY7L 4EKWA 3VQWA 4AYFA 4YSSA 1CICB 3CN1A 1NBZB 2BP8A 3GJFH 5CSGA 4OVVA 1TT6A 5F6IB 2YFNA 2YUVA 1GRJA 1RIVH 1TETL 1NH2D 1S9YA 5EDXA 3DO7B 5E2JA 5BO1H 5AFAA 4RGNC 1HL9A 2G38A 3QULB 1MPAL 2MOGA 2BVQA 1HEZB 3CXHK 3TCTA 4FHJA 1WA8B 4LR3A 4DKFH 3MV9E 5JPMC 2P7TB 5I5MA 4MXWL 3BE1H 4NX0A 5HHOE 1K85A 1V3JA 4FEIA 4UNTA 1YPZE 2HPOA 1NFDB 4YO0A 4GXUM 1MCIA 2CKBA 4F7PA 3ZXAC 4KZCA 5F0JB 3E9UA 3PE9A 1KD1W 2JSFA 4IOIA 2IPKB 1THZA 5DRWB 2PYEA 3BEWB 3PL6B 3AK1A 2VDKB 5B7MA 2Y25A 4H2CA 3E89A 3CIAA 5ITFB 1IGJA 3H2QA 1OGTB 4X8CA 4RWYH 2AI0H 4XXCC 2QWNB 3NJFA 3EDDA 2DLTA 1YMME 3I55V 1WDAA 2MPAL 3UYRL 4DRXA 4TLKA 1J0KA 1I8LA 2N04A 1T21A 4RH4A 2CAKA 3ZZLA 5IB3A 5D55A 4ILDA 4WHTB 4WV1B 4X5LA 1GCYA 3J81N 5CWSB 4F8TA 2VE6A 2HZHA 4JY6B 1VCBC 3R1GH 4CKVX 3ENEA 4FI7A 5C70A 3QQ4A 5IM7B 3FFDA 4J4PA 5C2BL 1YJDC 4OIBA 3LZQA 1JPFA 3DHUA 4GRLC 4AGQA 4HLEA 1U8NB 3DRQB 2QTEA 4Z1MG 2JIXB 2MCPL 1AHKA 1BF2A 3T3MB 5ABDE 2BRRH 1AQDA 4UANA 3LN4B 2LFEA 4FTVD 4Z8FH 5H6RA 3WG7C 1QFHA 1XR9A 4Q6KA 1RZIA 1W2BU 3B5TA 4F7MB 4QHPA 1FFXA 4GKKB 1J9SA 1JFHA 1KLGB 4K9EL 5I71B 2F0CA 5D4JA 2HCZX 1DDHA 2GHWB 2VZTA 4X6DE 5HHME 5LN4A 5D2NE 4J10A 1IT9L 1BD2E 4W4OC 2YIDA 1T0OA 1JHKH 1TZIA 3CC5B 3PWJA 2P5ED 5SWSA 4Y5XB 1YECH 3TWCH 4B53A 1XF5A 3S35L 4JO4L 1JD9A 1BX2B 1XIWD 2I7OA 4G6JL 2UUDH 4JGNA 5EUOF 1ETJA 2ZP8A 3QRGL 3K79A 1NICA 1NJ9B 4LCVA 4WCYL 2ZCHL 3QG7L 4WWKD 3OGCB 3SKMB 3T0EB 1KJ2H 4O2FA 2IH3A 1R4XA 1NCTA 3H1KH 1DYZA 5F1NB 2EIEA 2QJ1A 4POZC 4AQEA 5LBGA 4JO3L 1WB8A 3CFBB 3PNWA 2AEQL 2IALA 3WEXA 3NUKA 1T6VN 3NH7L 1I0HA 3IDMA 3NRFA 4D9QE 1XTLA 1GZPB 4CVXA 4RIRB 5DD1L 1OAQH 4DR3B 4D3CH 3QEQD 2P1YA 2VMDA 2NNXA 4XN4A 4KXCA 4YEEA 4IL6Z 3U0ZA 4GKZB 1V10A 3WDHA 4M29A 1U2HA 5E5LA 5F7KC 4GG6A 1UADC 5EULV 2ZE5A 3CIQA 2Y24A 5F96L 2FBJL 5IB2A 4AWJC 4HIQA 1IL1A 1IZJA 4WUUB 2AEPL 3ZYJA 4FQJH 4HOXA 1PNMA 1U3HD 1LDPH 2IMNA 3WYRA 1AJPA 5IWLC 1AP5A 2MCMA 1F41A 3B9KB 1SETA 3JWOL 2CNZA 2AGJL 4N2LA 3SEPA 2DKUA 1PX3A 2R27A 4YIPA 4FIPC 4FMFA 1S0VA 4HLZH 2ROXA 2O6CA 1D5IH 2FNBA 4DR2B 1IVSA 1DFBH 2GAZA 4FM0A 3P3PA 1E50A 2EIMB 2ZXAA 3G6AA 5LQBL 2JNZA 4GKNA 4NQSA 3TBCA 1RZ8B 4D0BB 1ZGLA 4HUVB 3WS6A 4AKPA 3V4UH 5IT2L 4I9XA 1JN6B 3REVB 3VFVA 2RNBA 1A3LL 5J6GA 2BNUB 3GIVB 4IRSB 4PS7A 5BZBA 4PJEB 4JRXD 4ANWA 4ZFZA 3TJTA 4PJCE 2W0KA 3B3IB 2KDYA 1P84K 1HYSC 1Q1JL 3PYCA 4MZRA 4KGJA 1M93A 3K03A 1RKRA 4N9GB 1MFDL 4DKEH 1X5LA 2BZCA 1EXGA 4IW4C 3H53A 4ZOCA 1SXZA 4X6FA 1WYJA 2ZKMX 1KENL 5GJSH 1SY6H 1KCUH 3V4VL 4DGVL 1RU9L 3HG0A 1CQKA 1M57B 5F7DA 1SDYA 5EG6C 1HFUA 4D0DA 1S78C 2HVKA 2NY5C 3JWNH 5AVXB 3L3IA 4A2EA 4L5FE 1RVFH 4LASL 5JW5B 4RMUA 2J12B 1X5ZA 3UABA 4GAYB 5HDBF 4XXDB 3QUZA 3MJ9H 4KVCL 43C9B 3JASB 2LU7A 4PMEA 3FO1A 2F1MA 1AAJA 4PWKA 1RZ7H 4U6HB 5ELIA 4WU5A 4TMPA 1TFHA 2B3IA 3CUPA 5LGJB 4AUUA 2VRZA 5DM6V 1GMGA 1IAKA 2DYPB 3ULAB 4QCIA 4JFDB 1KJ3H 2NY6B 2RB8A 2XRAL 5EEYA 2OMTB 5IK3B 3W39B 3OR7C 4ELKA 5DQDL 3I9GH 1R9FA 1CFVH 3GLDA 2DKMA 2WVSA 4Z7VA 2NW3A 2YGPA 4J1UB 1JXJA 4UDUA 3JATA 2HG0A 3ECUA 5SWZE 2DBLL 1VFAA 5SV3A 1UCTA 1AI6A 2AK1H 4X7TA 1JK9B 2C1PA 3ZGHA 2MKWA 4YL4A 1ORQC 3FAVB 1JFQL 3KDPB 4MVQA 2H6PB 4JGUA 2MW2B 1CGSH 1DL7H 4C57C 1J5EB 5HJDA 1ACYH 3JAMN 2GK0A 2OBGA 3BP7A 4GO6B 3T2QA 5HP5A 4G6FB 3GWOA 2VN4A 4DP7X 4DEPB 1KJMA 2DQIH 3NSYA 5HI3D 3GMLA 3RJOA 4W9HC 4BJLA 1Q6IA 3ULUE 5F97E 2IIJA 3HC0B 1C8QA 4GP4B 5JZ7C 3FONA 2VYRE 4YSAA 4CC4C 1IB5A 3OC5A 1DLFH 3QUML 4JG9A 1CU4H 2BSKA 3T2MA 2DTSA 2HFTA 2AXGA 3DHPA 1XBDA 4G1EA 2WXOA 3I6GA 2OMYB 2D03H 3EXAA 3V5HB 5D5MB 2VW6A 4XP4H 3L13A 1ZDQA 1NEUA 1J0HA 3D4YA 4AYID 4LVHB 4OD3L 1FL6A 5H37G 5A2QN 4JCLA 6PAZA 1S7WB 2ZX6A 2H0JA 4I7ZB 2CPUA 2LOEA 3IFNL 4JFFD 1EFXA 4ZMZA 2KLSA 2JCCE 5IVXE 1UD4A 2XA3A 2A73B 1R33A 1XF3A 4MNHA 1HZHH 2WBJC 1LEGA 1SGKA 5HVWA 3FUDA 3RNKB 1BMFG 1NFKA 4DUZO 2EYTB 3GGWB 2QEXV 4KK9D 1IGFL 1JIBA 3ARBD 4GUPA 1ZLVH 5EO1A 4BFFA 2BCMA 3MDSA 3UZQA 2VLJE 1JZDC 1OF2A 4V11A 2F54E 4BFEA 2VR3A 2CCVA 1Q9WA 1MW2A 2W0PA 4FNUA 2J8UE 4XMPH 2YLKA 1Z5LB 5IFHH 3BN3B 3GKWH 3K0YA 1SQXH 5DJAB 4KO6A 3HE6D 1GZQA 1VDGA 1GSMA 5ERWB 2J7LA 1JVLA 1LUWA 4EIUA 3I02B 2NY7L 1PX8A 3VUAA 3H6AA 3QPXH 4FXKA 4YC2C 3WN5A 3RGBA 5HYJE 1JXFA 1YCSA 2EP6A 2QQLH 4DR6O 4QYAA 4AHCA 3BI9X 4AIZB 1CDJA 1KG0B 3ZHVA 2VXVH 4UDTA 2KLTA 3EJQA 1NC4A 1K97A 1HHIB 2UVEA 2ZONA 3MSPA 3SDXB 3S88H 3FB6A 5JHLA 1Q38A 3KLAA 3L3HB 2Y5QA 3MLVL 3CB2A 4NFDA 5DD0L 1J05B 4BIZA 3DNKA 1FZJA 3TA3B 3MLSL 4OKDA 2ICES 5JJNB 4LHQB 3U4BL 1CDUA 3K3WA 1N64H 4XC1L 2MMXA 1A4JB 2CKNA 5IJVA 1P7QB 1NCHA 5C0AB 4U6YA 5IG7A 3BWAB 4XVJL 1U8HB 3T04D 3D9AH 5LMNO 4NRYA 4OZFA 4UINH 3EUUA 1H8LA 4YFDB 2XAQA 2I60H 3CK0L 3PAYA 3AAZA 1WZKA 2B16A 1AG0A 2DQHL 1T66D 4LLWA 4PLOB 4XPBH 1XGRA 1NCOA 1NEZA 1TJHH 2RQEA 4JDZB 2YPVH 1TJIL 3EYOB 3EJSA 5CGYD 3MPCA 1YEDA 1UXSB 4FC3E 3PWPB 5F2FA 4AVJA 2PF6A 1OSZA 1LO5B 4LHUG 2A9AA 3MRLA 4OSUL 4WY7H 4F1ZA 3SO3B 2YD9A 4YSRA 4ABQA 3PWNA 2R4RL 4KHPO 3ABLC 3O9WB 3PQYA 4UTBA 3BN9C 3ESPA 5DYFA 3CLEL 2OTWB 1MVUB 3BGFB 1MPAH 1XF2A 2VLKD 4GUNA 1M05B 3ARGA 3AB0C 1EGJA 4ORZC 4YDNA 3ETBJ 4XB7A 1NMBL 4PGBA 2PXYA 1BXVA 1GYWA 2ZUUA 1QSFB 5LBSL 4HK3J 3SDAB 3DURA 4ZX5A 1N5AB 4AZUA 1W9XA 3WB2A 1R17A 1NKGA 3B3BA 4KRMB 4AVHA 3NP3A 2MRYA 4PR5A 2IANA 4LHUD 2VN7A 2AJZA 2MQ0A 5C9KA 1GYUA 3CXHF 5I1HL 3F7VA 2K7QA 4E41A 2ZIDA 1U42A 2IXQB 5E2TH 2ZIOA 4XP9L 3F12A 3ZE1E 3MOBL 5DEFA 4N0UA 5CLWA 1YC7A 1UD2A 1K6QL 1VZGA 2PETA 1BECA 3O3AB 1AYRA 2FO1A 2E76B 2BHUA 5EZIL 1CJYA 3AEIA 2F7OA 3RUGA 5KMGA 3DXAE 1XMWA 2D3JA 2WB1A 3UYRH 2MPAH 3VFOB 1BDYA 3RVTD 4NNYA 1D6VL 1MFEH 1SDAB 3QDJA 3KPPA 5F1IA 3WIIL 3GXPA 1PAZA 4F8PA 1I7FA 3FUKA 3MV01 4NQDD 4UVCA 4R5VA 2WTOA 3L9BA 3ZHUA 5IBLD 3JWDL 2B1AH 1LVEA 1M2VB 4FKHA 5E8NA 3M99B 3NRPA 5C09D 5HI4D 3VXRA 4EBQL 4JQXA 4DR5O 1AS8A 6FABH 3WNIA 4B9KC 5IJ0B 2J71A 4TQHA 3WJMB 3WLWD 2MCPH 5KYWB 2IH3C 1J8HE 5F0LB 2YIBA 3MRPA 5IB5B 2NT1A 2UU9O 4KRPB 1R5VA 1FXVA 4JFXA 4B50A 1U33A 1O6SB 3ZQWA 5C0BA 3TURA 3S4SA 1PKQB 3CZEA 1HS6A 3P9LA 1SXBA 4K9EH 5E79Z 1HN1A 2F4VO 1G7MA 1PZ5B 1ZS8B 2NXZB 4JO8A 4C8XA 2LU4A 2YOCA 5CF3A 2D7NA 1ZAUA 1LNUB 1I7TB 1B04A 4FYSA 3N9GH 4YBLB 3T1YO 1MG2C 1QCEA 5KAIZ 1HXYA 3PGFL 2Q3XA 1OLLA 2R2HA 1M1SA 2VLLB 2VJ8A 3ULVL 3S35H 1A4KA 4JO4H 4BM7A 4BV1A 5JHDD 2TRYA 4N8UA 1HR0O 4L3CA 4G6JH 4ONHB 12E8L 1MCLA 3BZEA 1NR1A 2V5TA 4LO9A 4Y4KB 1KY6A 3QG7H 4H44B 4R7NA 2VR8A 3MKGA 3UBXA 2NY5H 3QO7A 2VWEC 1F90H 2YIHA 5GZOD 3OHXA 2UY6B 5IQ9A 3VQ1C 2NY2D 1RPOA 3E1ZA 4PD4K 5E8EB 4L9LB 4ESKA 5FB8B 2H0FA 4JO3H 1JXKA 2AEQH 2AQSA 1CG9A 2XT1B 2BVPA 4DV5O 3NH7H 1OP5H 1OOAA 3QWNA 5HGDA 5I28A 3CZFA 5DJZA 5A9GA 3B5GA 4PRHA 1NAMH 3KL0A 3E3QC 2E7CA 3FKUS 2IDQA 4TT3G 3L4YA 3HG4A 3WS6C 2BSCA 1K3EA 2KZBA 4UV7L 2EXSA 2FX7L 3MYJA 5KS9E 2R8SH 4LF5O 1FVDA 2Y4TA 3L8QA 5D1ZB 3ZDZE 5C97A 2F1BA 5I1GL 1HQRB 4YPGA 4D7TA 3L4CA 3O4LE 5F96H 2FBJH 5DUBA 2BHZA 3W9EB 3ZYOA 2AEPH 2NY4D 2VQ4A 1XCTA 4MYPA 2IH8A 1Q94A 1L6PA 5B8CA 4NB5A 2R2BB 5DMIL 2CUHA 3A0BZ 1UA3A 1I3GL 2ZSVB 2HVKC 3F83A 3JWOH 2XIDA 4Y2OB 1SJHA 1OF0A 2AGJH 2WCSA 3UTTD 5CCKL 4DPCX 3T8VA 2B3RA 3JWNE 4BE6A 4PJIB 1SERA 3VM7A 2V6HA 2EDQA 2DM4A 5LQBH 5JYMA 1P1ZA 2HT3C 2ZICA 3M17B 4PGEA 2QZQA 3CZUB 3V8CA 1JOYA 4H26A 1SRDA 1A3LH 1X5XA 1DN2A 3ZRXA 3GWJA 4OZHA 3Q2WA 1XGUA 2V33A 4O00A 5DEGB 1LD9B 3MREA 1XGTB 4JM2D 4O58L 2CJ3A 3WJJA 4ZUSB 4BELD 1MFCL 4JM2F 3RDJA 5DFTA 2JB6A 2XQYA 4KKLD 2APSA 3PHAA 4P5TA 5C0EA 4D0CB 1AGEA 5EEWA 3UTZB 5JHBA 1TVDA 2BVOA 1KENH 4E4EA 4FFVD 1KBBA 2BWIA 1RU9H 3V4VH 4DGVH 2X0VA 2R0WL 2WAQA 3IFOA 3IJSA 3LDBC 3VRJB 4A6YA 4NZUL 1WLEA 5AOKA 3T71A 4IYIA 1P84F 3KBHE 2YC0A 2NNFA 3PHQB 4L29A 3TZVD 4XH2B 1C5CL 1TTUA 2WZ6A 2R0ZL 3ZMEA 3CXDL 4LASH 3SDLA 3CVHA 4Z5RA 2AQ2A 1FPOA 5DZPA 4KVCH 4O2AA 4B60A 4PHZA 1P7KB 1RPQA 1FNFA 1W72B 3WE6A 3VAEA 4RNRB 5BR8O 1P5UA 2CO7A 1SYVB 3QJHB 4AL8L 3MN8A 1SQMA 3IU4L 3MCKA 2XZCL 3WY1A 3CN4A 3NESA 5FCSH 5DQDH 4WI6A 5FLVA 3LNHA 5KYUB 1TMQA 3TN0B 2WCPA 1SVZA 3MRCA 4NQCB 3LQMA 2DBLH 5FECB 4O4IB 1UH3A 2GJ6E 5KG9A 3ZKND 2PUSA 4CH4A 1P69B 1ZA3B 4P4RB 4MD4A 4UTBL 3AK3A 5J1AB 3JV0A 2IADB 3TJEL 3TH3T 3RVXD 5DTFB 3DWTA 1UZ8A 3MGOB 1JFQH 1CFQB 4PB0H 1OTTD 1XGQB 1QWNA 2FL5A 1VESA 1EGJL 3M86A 3E2HC 2KG7B 5IMOB 5IBUB 1XHZA 3QORD 5E6RB 1NGZB 3ZJZA 3K5LA 3QEUB 4DQOL 1JZ6A 3QR2A 4KHPB 1GS7A 2B1IA 1ZSDB 3LXBA 1BFOB 5IF0A 2R9HC 2Y7OA 3MXVL 4MRBA 4NJAH 5DJ0B 5CCHE 4HS3A 3F5WA 5F9JA 4CGUB 4HU2A 3FF7A 1KKDA 1J12A 4AYGA 1AGCA 4DVBA 3HAEH 1EN5A 1MCEA 1ZXKA 5L4MA 4OD3H 2BNQD 3UOAB 3CCEV 5EK0A 2XWBA 2Z8WC 3K0WA 4GKSB 4PJ6A 1EO8H 3IFNH 1A1MA 4AYDC 5GGVL 3VX0A 1LP9B 2VDRB 3C5ZD 4OF5A 3JVFC 2DAVA 1ZA6B 3LIZA 1JSYA 5DQJA 5DRNB 2GUOB 3GTVA 5KX5A 3D39A 5LMUO 5BJTA 5EPMB 4N2NA 1IGCH 5DU7A 3ZRFC 4M62L 2QM7A 1IGFH 2W81C 4YHNB 2ALAA 3C8HA 1HE8A 4JANB 5ECGA 2E7HA 3WIFB 32C2A 1GC1C 3B4NA 4O2EB 3QNFA 4DPBX 3L4ZA 1F3DJ 4G72B 3HRZB 2E7BA 1QSEA 4S10A 4CMMB 2EUWA 1XCQA 3UCSC 1XZ0B 4BK8A 3QFJB 1NOLA 2X4OB 3WNKA 1I7UA 4Z7WA 3MJ6A 4F6EA 2RALA 3KXFB 4LSSL 2OMUB 1FXKB 2XWZA 4OXSA 4HCGA 5I6XC 1TTRA 4DV4O 1U91B 2F6AA 2NYYC 5E5MB 3MNZA 2E9IA 2H3KA 4U0RB 1YEGL 3ARYA 1ADQA 2QT6A 1HYRC 4DR5B 4K55A 1NDMB 1KMGA 4YFLF 4ZFFB 1FVCA 3MLVH 3TVMD 5CBHA 2F7RA 4HBCL 5DD0H 1H0DB 3MLSH 3DO3A 3OC8A 1PL0A 2BC4A 5DK2B 3ET9F 3AREA 2UU9B 2BSEA 1ONQA 4G11A 4R7XA 3TXQA 4XC1H 4AITA 5KSAB 2ZWKA 1CF1A 2NSQA 1G6RA 4YVNA 5CBEB 3Q4HB 1RMFH 3ARPA 3IDIB 4QRFA 5IIEA 4YX2L 2PXYC 4Z7IA 4G8IA 2OQJA 2F4VB 3SKJL 5E8OB 4LL9A 5FYKL 2DQHH 3CMAV 4KTGA 3HTLX 4ZZKA 1FZMA 1GW6A 3FC8A 1RJLA 3IDUA 5GGRY 3B4SA 4WCEV 1TJIH 4N90E 4MXVF 2ZNJA 4LOEA 3V5KA 4TUYA 2A6IB 3CZSA 4WK2B 2N0KA 2FE0A 2VR7A 2EUXA 2RDCA 4MNGE 1AR1B 1Q81W 1HR0B 1QBZA 4QLRA 4OSUH 3W0WB 3ABZA 4EFEA 1KEML 2E9GA 5FYLH 1MLBB 2QWQB 3D33A 2R4RH 3B34A 3ZYIA 1NPUA 1Q72H 3EDJA 1LE5A 3NDYE 4P5KB 4MD5A 1HH6A 3AXHA 3DVIA 3VFUB 3Q8AA 3CLEH 4MS8D 1OZ0A 4M6NL 4MMZA 4PRAA 1N2RB 5DEZA 1N32O 1AZVA 1OM3L 3VRIB 4DV5B 3NJIA 1N9PA 1NMBH 3BAIA 4TSCL 3QZNA 4IU2A 2VM9A 4WSKA 1K4CB 2XBDA 3L3KB 3C09B 3E8GA 4JFOA 2IG2L 4RMWA 4NRZB 3WIAA 4JQXC 4PY7A 4XBMA 2H7WA 3CDGA 3L7EB 3CFJB 5I1HH 1JZ5A 2COVD 4L0ZA 3ETTA 5B1AC 4LF5B 1V5JA 4HWEL 4TSBL 4U6XA 3UCQA 4CADA 4XP9H 4Z7QE 3MOBH 3BH4A 5IHLB 2JXMB 4I18B 2OFQA 5GJTL 1K6QH 1WN7A 1N8OE 1D5XB 3BGMA 4HYTB 4OCSL 1NJIW 5EU6B 3WELA 3U7YL 4P4KC 2W95A 4TQPA 4XP1L 1NIEA 5EZIH 4FQ2L 1C9SA 2IH1A 2HKFL 4C4KO 3H2WA 4YSUA 1GJIA 1BOGA 4LSVL 1JF1B 4U3JB 3ZL2A 2FECL 1JFFB 4JM0A 1D6VH 4YHLL 1OAJA 3WIIH 5EEVA 2LABA 1UACL 3L9DA 4FTVA 4MNQD 1T3FA 2P24B 2C9VA 5A2BA 3JWDH 1I1AA 3LJ3A 3EOAB 3DX7B 1L9NA 1NFDF 3HMWH 3I6KA 4BK4A 4QRPB 4QKTA 3RIAK 1S9VB 4A6YL 4EBQH 4H25B 3OTFA 2Q7HA 3ZDXB 1FSKB 2X09A 5AW9B 3OHXC 3PL6D 4TL5A 3S7GA 2EXWC 1WBYB 2P5EA 5K33A 1A4BA 43CAB 4LNRA 1XIWA 5EUOA 3VFMB 4NWUL 2GJRA 4HJUA 3NABL 4EXPX 3I2CL 2J1XA 4PJ9D 1SF3A 5HYQA 4WWKA 1NCNA 2O6FA 5DRXA 1N0LA 2F08A 3UBHA 1MJJB 4CILA 3H0TB 1TCRB 3PGFH 5ICXB 1LXMA 2OSWA 5EU5A 2CDEA 3PXHA 4UNIA 2VZUA 3G6EV 4FA8A 3I56V 3OKMB 3UJTL 1Q0XH 1QYGL 4K73A 12E8H 4FNTA 4IJ3C 3TASA 2JK5A 1XB3A 3H1JH 1L6XA 5IROD 4KZDL 2A9BA 3LRSB 3HVDA 1JOIA 1OZTG 3T3MF 4BFRA 2CGNA 3BIKA 5HHOB 3QEQA 2XI9A 4TUUA 1CXLA 3V4LA 1YPZB 1ZLEA 1X5JA 5TDPB 5BR8B 4W1TA 5CSZB 4YHYB 2FX8H 4NTYA 5B8CC 3FNKA 4YJ2B 5DS8B 4NUGL 5C6WH 3ZRWA 1ECZA 2X2YA 3S37H 2GCYA 8PAZA 5LA6A 2VM3A 4MJ5B 5AG2A 3RZCD 4AJVA 4NENA 4OV5A 2UZPA 2XU9A 5IMKB 4KQ3L 3IETB 5I82A 5TH2B 4AT6A 1SMOA 4UQ2A 4P5RA 3ZTJH 4PD4F 1QNZL 1YMMB 3UZEA 1L3WA 4UQ3B 2NNAB 2HP8A 3FB8C 1JPGB 3GSOA 3HC4L 4TTDC 4I88A 3Q7JA 3UAFA 4TVPL 3WJJC 1GY1A 2Y7LA 3L16A 4DFHA 2PPEA 1UEMA 1WH0A 5FO7A 2MCG1 1JGVL 4ZXBA 3MRNB 3SB3A 4YXKL 1S77D 1A4CA 5AYTA 3HKDA 2DPKA 3IFPB 1W8OA 5E1GA 2VZ1A 1A6WL 1JNNL 5IUCA 3D36A 2HLAA 1A8JH 3HHSA 5DMIH 1QPKA 1M42A 2FWOB 3BPZA 1I3GH 1I9EA 5DZLA 1AQ8A 5F21B 3KZ8A 5KVFE 5CCKH 2K7PA 4JRXA 4S1SL 2DI8A 3HR6A 4DCQB 3SJAC 4Y19E 1VQOV 1OK0A 4M1DL 4UMGA 3FOMA 2XG4B 4E68A 4NCC1 3SDCB 2ZNIA 1F2QA 2Y7QB 3FT4B 1FNHA 4ZI7A 1FI8C 2HG5C 1U2CA 4CNIB 1BZOA 2OCFD 4JPWH 2DQ3A 1ZTMA 3MLWL 3CJHA 4HDIB 4X6DB 1KPRB 1E2WA 1L9SA 1ZLDA 2OMBA 4JFQA 5F88A 5T3ZL 1BD2B 1P5UC 1D5MB 2VTFA 2OK0L 4O58H 1MFCH 2X4PB 4WUUD 4WEBH 4LOFA 3O45B 4MD0A 2F93B 4DERA 4KKBC 4ETYA 2UWEE 3AY4C 3APQA 3RKDC 4FADA 4XAWL 1IX9A 4I4WB 5CJ5A 2R0WH 5HGHB 5JHLH 4NZUH 1NCGA 4UOQA 5DJXB 4ZW5A 3U46B 3LZNA 2IPTL 2PCPB 5FGCB 1C5CH 2R0ZH 3CXDH 1JMZA 4XWOC 1MABG 1S5HA 1CLYL 1GC1H 4I50B 1UD8A 3OKEB 4IRSD 4DV4B 3UGXA 4ORGA 2XN0A 2C9UA 1A2YA 3QXAA 4OZFH 4DKTA 5FF6A 2Y23A 4PJEF 2AQQA 4OCMC 1U3YA 3ECBA 2WXRA 3ZZ1A 3O3EB 3GSRB 2ZUQB 5JIQA 3GDBA 4FQPA 2X10A 1E6OL 3EGDA 2XZCH 3Q5YA 3K6IA 2ZT9B 3AU1B 3F5WC 3MRDA 2YQ3A 3CX5K 3U4KA 1N6QL 4JHUA 4OBSA 1KBVA 2FSEA 4CW1B 3VFSB 3GFUA 2KH2B 5JCOC 4Q58C 4FM2A 4KJQC 1YNTB 3IXTA 5BV7L 3ERXA 4PGDB 2GQHA 4UTBH 3O11B 1BOYA 2OZ4A 3TJEH 2IBZH 4BA8A 4GINA 1JJ2U 4PRPA 3V0IA 4EN3B 5I16B 4PG2C 3U2SA 1E30A 4I5SA 1TVHA 2F5AL 3IF1B 4LNVA 3QK0A 3MFGB 4RZCB 1EGJH 2R1WB 5LXTA 4XC3L 4GAFB 4GW1B 2NW2B 5KJRL 1OM9A 1EMTL 1WFTA 2YARA 2IDSA 2IQAB 4I4TB 1AILA 1AP2B 4WTWA 4HWZA 4LDLB 1WGOA 2BFVL 5TDNB 1U8KB 1MSPA 3MXVH 2EILB 4UOJA 3ZQXA 3C5XA 4HK0B 3P40A 4PV1C 4TXVB 3NQIA 1LUVA 2HFEB 4N87A 1DP0A 3RYMA 1A4AA 4LQFL 4AE1A 3L3GB 2QR0A 3NGBC 1ZUQA 3ETDA 1P7GA 1FFRA 2HVJB 1N32B 2BIHA 4S1DC 4XB8A 4WW2A 3VWKD 2UUAO 4DZ8A 1DZ0A 3ARBA 4GX1A 1PBYA 3DTXA 4K7FB 4NZRL 4PS8A 1P4LB 5GGVH 4G6FD 1BLNA 4PP2A 3FUNA 1T0NA 2DWYA 3ZHTA 4I77L 4W9JC 5EIVA 1TEYA 1JCHA 3P1VA 4M93C 4HS8L 5H37A 5I75C 5CSBA 1X6LA 4HUMB 1RJYB 1E9QB 5SWSE 3ILPA 3LNFA 4M62H 3IDGA 5AW2B 1DFXA 3POHA 4R5TA 4EI5B 1WCBA 2BP0B 4GRMB 5AL8A 1VACB 2VIRA 5MEQB 4MTXA 4OZGE 5F0MB 4AVKA 3Q9PA 5F7AA 5D5MF 1QHPA 5D5PA 1PLGH 4OFIA 4PIBA 4UM9B 5GS0D 2APBA 3FH7A 4U1NB 4X50A 4YZFE 4F27A 2DH3A 2ISDA 4ABWA 1DF5A 2JKXA 4LSSH 3LEVH 3HB3C 3QIWC 1I1FA 5HFLA 5SWZB 3U4AA 1KIPB 1HHJA 3SGDH 2NQDA 3QDHA 1J9CT 2Z9TA 4Z18A 4UCRA 4KAQH 4XPGL 4MVOA 1DUZA 2CDGA 1K4DC 4P57A 1DUYA 5FYLE 3IKCB 5K39A 4GEJA 3O9OA 1KIQB 4HCRL 4HBCH 4DEUA 3BP5B 4YFEA 5L88L 3NJMA 1CD8A 3DMMB 2P45B 5C0NC 5JPNB 3KAAA 1ACZA 4MMZC 1KIRA 4YSDA 5JIMA 1Y0LA 4HGMA 1BZQK 1KTDB 3VSUA 4GG6E 4YX2H 4YAQA 1Z2KA 2DB8A 2J6EA 1ETA1 1F3DH 4ZDHB 4PVBA 3SKJH 4WI9A 4QHNB 5IZ7A 1V55C 3GI9L 5FYJD 4X0KA 4X66O 5FYKH 2G75A 4GX0A 2VWEE 4BUHA 4DJMA 2FYYB 1T1YB 1TZHA 4IMLB 4HVBA 3PLYA 3I9PA 3PJSB 1T7XA 2Z92A 2EYSA 3L9RB 2VDPB 3DTUB 2Y1YA 2Y6TE 4FQCL 3HPLA 4JQIL 1KEMH 3SDXF 2Q86A 4FF9A 1JS4A 5DJ6B 5JO5B 3CHRA 3TA3D 1Q8MA 2F68X 2O1AA 4JO1H 4QAMB 4JNXA 1ENVA 5IVXB 3FULA 2IH1C 4F7CB 4PMFA 4K5NA 4HWNA 1B0GA 4LHUA 1BE3H 3T6WA 3NZHL 1VF6A 4GS7B 4BWAA 3NBNA 1ZHKB 5C71A 1YUKB 2E6QA 5FM8A 1PV0A 1SM3L 4PM1A 4JG1H 5JIHA 3QZPA 3SD5A 4TSCH 1H3TA 3ILEA 4FD0A 1CPUA 1I1AC 2F54B 2NYZA 3LZOA 3A3YB 3AXLB 2J8UB 2IG2H 5J9PA 4Q6YA 4XN9A 4EB6A 1VQ7V 1BJ8A 2YR3A 1RI8A 2R39A 3CV5A 4ALAL 3LNIA 3OWRA 4A5UB 4WF9V 1Z9SB 5BY1A 3PCYA 3WI9A 4HWEH 3D0LB 1G7LA 1G5AA 1XGZA 3LRLA 1S7QB 4NQDA 5GJTH 1BWWA 3QC5X 4J7JA 3QO0B 1SOQA 5IV2B 5KVFH 1XIWC 3FSWA 2OTUB 4OCSH 4CC0A 1NCDH 4OFKA 4FQ2H 4BEIA 2HKFH 4GT1A 3GMQA 4WWKC 3IAQA 3BA8A 1R3KB 3MQIA 2KBGA 3DVGB 1CK0H 2C7UA 2VSMB 4YHLH 1LEIB 1QSFD 5BZZA 2WQAA 3VWJC 3ASWA 4U3SA 4KI5C 1UACH 3PABB 2G2PA 4I0CC 5C07D 4GSDH 4RFEB 3CP1A 2I9LA 5L8JB 4JKWA 3K9AA 5MHSD 4KUZH 4Z7VE 4GI6A 2JK5C 3N6YA 1X5AA 1FO0L 4AE0A 1KECA 3P11L 2GG1A 4A6YH 4JI5O 1HVXA 4YGVB 3E6FA 1P9MA 3EOYG 1INQA 4XRCB 1QAWA 1E42A 3T4AA 1VKXA 5IJBC 4P23B 4JF3A 1MHHB 4XVOA 3HBPA 1MCHA 3CVHH 4FQXC 1QR9A 4OF6A 2VDML 1CXEA 3MOQA 1NGXA 1UVQB 2EIBA 4Y9CA 1PQZA 4TQIA 3RIAF 1EHKB 4NWUH 1IZ3A 3NSXA 2NY0B 4MMYB 1W0YT 1EAQA 3DV6A 4YHML 3I2CH 1G9MC 5AENA 4L8DB 2YN3A 4HUKB 4L1DA 1TG8A 1DLHB 2CA4A 3EG9A 5J5EA 5EZPA 2DLHA 2BWQA 5GZOA 1SZTA 3RX9A 2GFBB 1Q1PA 2PP8A 3ZGIA 5EIIB 3WLBA 1IBGL 2J43A 3T1FA 2OCCB 3UC0H 3UJTH 1BAGA 2AK4B 4RDQG 2VGLM 2C2AA 1BIIB 3NCFB 4ZXBC 2XNAA 4CC6A 5CEZD 3QNEA 4KZDH 3RIKA 2H26A 2BIIA 4FLQA 3VG9B 3UXFA 2WMPB 2CRZA 3D36C 1O75A 1OB1B 4UAOC 1OCZC 1KT2B 3O6FD 4NUGH 1Y66A 2QFPA 1EANA 2VXQA 2VMFA 3I75B 3CDCA 4X6CE 2NXZD 4NZFA 4ZKIA 2PTVA 2PWHA 4A55A 3CFKB 4YXHH 4DF9A 5K9OA 2ARJB 2VC2B 4OF7A 3LKRB 1PF3A 4L1LA 3ZTDC 4KQ3H 4PRBB 3HZMA 3QQ3A 2PP9A 1E3ZA 3OLGA 1MRCL 1KEGL 4BW9A 3FYIB