3X2QB

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3x2qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x2qB02
1QNIA 2QPDB 3NSYA 7PCYA 1VLXA 4A2EA 1E5ZA 4BWTA 2VM4A 3NJNA 1ASPA 1NPNA 1AZCA 1KV7A 2DY2A 2R7EB 4DP8X 4YL4A 3KW8A 4DP1X 1V10A 5B1JA 3ABKB 1J9SA 1GSKA 4YSOA 3S3BB 1OF0A 2YXVA 4WKXA 3WNIA 1MG3C 1L9RA 4N4YB 1ZIBA 2VN3A 2XXGA 3QJVB 1AG0A 1BXAA 4YSPA 2DYRB 2IDSA 4AX3A 1SJMA 3DIVA 2VM3A 2UXVA 1J9RA 3ASOB 2IH9A 1NPJA 1J5DA 1KYAA 5D4HA 2YAPA 5I5IA 2A3TA 3CDZA 2DWTA 3PAZA 1RKRA 3UACA 1QLEB 4N8UA 1A4CA 4GP5B 4E9WA 1ZPUA 1NWOA 1PZCA 3IN2A 2W8CA 1WA1X 3EF4A 4DPBX 2Q5BA 1ASOA 5AZUA 3QPKA 1FWXA 3PAUA 4NB7A 2CJ3A 4A68A 1B3IA 2OCCB 4DP7X 1UATA 3GDCA 1SFHA 4BWUA 1GY1A 2FTAA 2QT6A 4E9TA 3FYIB 3AG2B 1A8ZA 1ILUA 3PCYA 3NJIA 3FU9A 1J9QA 1X9UA 3WIAA 3ABLB 3HB3B 4KOBA 2IAAC 2TSBA 3T6ZA 3T9WA 5IY5B 1GYCA 1T5KA 4BXSV 4KO6A 4AKPA 3X2QB 1TEFA 4P5SA 1M57B 4YSCA 3OMNB 1ZDQA 2YAMA 4HALA 2XX0A 2OJ1A 4DPAX 2GIMA 3TASA 1TU2A 1AZRA 2HLEB 2BP0B 2DYSB 2GI0A 1JXGA 4YVUA 1XMEB 3U25A 1PNDA 1GS6X 3OQRA 1GW0A 1MG2C 2YXWA 3L45A 3X1NA 1A3ZA 1ADWA 5I6MA 2PLTA 2BP0A 3AG4B 4KNTA 2NRDA 1PLAA 2I7SA 3PAVA 4E9SA 1AQ8A 4FAAB 2EIKB 4JHVA 4GXFA 1WS7A 2HX8A 3TA4D 2BP8B 1J5CA 1N68A 1URIA 3QJQB 4KNUA 4G72B 2GC7C 3OM3B 1AANA 4AI7A 3IBOA 1CC3A 3CZUB 3OD3A 2GHZA 3PPSA 4Q8BA 2OV0A 2UXGA 2FWLB 1W8EA 3BQVA 1JXFA 1TEGA 2JXMA 1AZUA 1AZNA 3S3CB 2PPCA 4E9YA 1ZV2A 2VSMB 3FU7A 2FT6A 1PY0A 3AG1B 1SNRA 1ASQA 1ETJA 4G70B 2FQEA 2XV3A 3FYEB 3WKPA 1NICA 4YSAA 5LDUA 2AANA 5I5MA 2PPAA 4YSSA 2YEVB 3WNJA 1JZJA 4DP2X 4YVNA 1JXDA 3EH4B 2YQBA 2I85A 3IEAA 3DKHA 3IN0A 5I6PA 3HEIB 4E9XA 1HAUA 1OE3A 2YAEA 3QJRB 1L9QA 2YAFA 5B7EA 3WKQA 7PAZA 3UABA 2VMJA 3CVDA 4G7RB 3KW7A 1BXVA 2UX7A 2WO2B 3V9EA 2FJSA 3IE9A 5B7FA 3EH5B 3BVDB 3MBWB 2BWDA 3FSWA 3ZIYA 1V55B 2XLLA 1SDDB 2PP8A 4K9JA 5TK2A 3FU7B 1ZDSA 4PAZA 5I26A 1QHQA 3FT0A 1JERA 1SF5A 3FSAA 4FA7B 1AACA 1ID2A 1MDAA 4DP0X 3NT0A 1E67A 3FPXA 3MX0B 1KCBA 1HFUA 2CBPA 1BXUA 2FT8A 2BP8A 4GYBA 1W6LA 1PAZA 1ZIAA 2Y69B 3H4HA 4JKNA 1KBWA 1JZIA 2CAKA 5FC9A 3GYRA 3ABMB 2HZHA 4YSQA 3QJSB 2Y1AA 3NJMA 4F2EA 1RCYA 4DP9X 1IUZA 4F7KA 2XV2A 1SDDA 1KCWA 1A4BA 1PLBA 2YAHA 2JKWA 4HCGA 1GY2A 3QQXA 4L0PB 2MRYA 1SHXA 2GBAA 2X87A 2CCWA 4BXVA 2PCYA 1AR1B 2FQDA 1BQKA 3AG3B 1E5YA 3NP3A 1PLCA 5TK4A 1AOZA 2BZCA 4A2HA 1M56B 1OV8A 1CYXA 3G5WA 4W1TA 1MZZA 3NJGA 4EF3A 4G71B 3X1FA 3ZX1A 1NIEA 1FA4A 3T6WA 3JTBA 2DV6A 5F7BA 3OMAB 1BYOA 1NIFA 4BWWA 3DTUB 3S3DB 2ZXWB 4HHGA 5B1JC 4QKTA 2PP7A 4YSDA 4X4KA 5PCYA 2IH8A 3FSVA 1SHWA 2N0MA 2BW5A 1XB6A 5B3SB 3TBCA 4BK5C 4F2FA 2E86A 1NWPA 2PPFA 2RACA 2XYBA 4HIPA 4DP6X 2YARA 1JZHA 1ET8A 1HAWA 4GP8B 2XV0A 4A66A 1IBYA 3UADA 5I28A 2FT7A 2EINB 4W9ZA 4GP4B 2I7OA 2UXTA 2GC4C 3C75A 3ABGA 1L9TA 2UXFA 2EIJB 1EHKB 2XX1A 3V9CA 1MZYA 2JFCA 6PCYA 1BAWA 1NDTA 1I53A 3SQRA 1KDIA 3SBRA 1BQRA 3FQYA 4UF7C 3SBQA 5I6NA 3WG7B 1AZBA 1IBZA 1NTDA 4YSRA 3NSFA 5A7EA 4HAKA 1XB8A 1YLBB 4AKQA 5B1BB 2R7EA 2J56A 9PCYA 1NIDA 1X9RA 3QJUB 2DWSA 5I6KA 2FQFA 3CG8A 4WTQA 5I5JA 1PMYA 4HZ1A 1CYWA 4DPCX 1JZEA 3FU8A 1OE2A 6PAZA 2XWZA 4NERA 4PCYA 2XVBA 3FQ1A 2H5UA 2J55A 3AY2A 1E65A 3AW5A 1L9OA 4KO9A 5ANHA 4YSEA 2LLNA 2VSKB 2H47C 3X1GA 2XUWA 1GR7A 1A4AA 3X1EA 3NYKA 1JZGA 4YSTA 1JZFA 2BW4A 2IDUA 4GY4A 1OOWA 5EHFA 1OE1A 1N70A 1GS7A 1L9SA 1OCOB 3EH3B 3T6VA 4CSPA 3NJHA 2IWFA 1EZLA 2CALA 3TBBA 2BZ7A 2FQGA 2MTAA 1AG6A 4RH4A 2IDQA 2XU9A 2YAQA 3JT2A 2X88A 3CDZB 4BDVB 1KBVA 4QLWA 1BQ5A 1XB3A 2HXAA 2HX7A 2WO3B 2W88A 2VW6A 4NAJA 3ASNB 4A2DA 3NJLA 4E9RA 2B08A 4UANA 2J57A 1AS7A 2GSMB 3NJKA 4CSZA 1JVOA 3UGEA 3EHBB 2QDWA 1NINA 3FSZA 4KNSA 4BDVA 1TKWA 1RZPA 5I6LA 1CUOA 3QJTB 1ILSA 1ET7A 2EILB 2GB2A 1V54B 5AFAA 3FS9A 3GXUB 4KO7A 2PCFA 3NJFA 4HCFA 2VW4A 5B1KA 3NP4A 1SF3A 5F7AA 1AS8A 3FQ2A 4DP5X 1BEXA 2PP9A 2QDVA 1FFTB 1AS6A 1GS8A 3PLYA 2IWKA 4ENZA 3X1BA 2QPEB 1AIZA 1NIAA 4TXVB 2ZONA 4ZK8A 1DZ0A 3ZDWA 3FPYA 3NSDA 1IC0A 1NZRA 2IDFA 4P5RA 1W6WA 2AZAA 3UAEA 1WS8A 4G7SB 1WA0X 2P80A 4KOCA 1F56A 1IKOP 2XXFA 3NSCA 8PAZA 4A2GA 3SBPA 1PNCA 4E9VA 2P80D 4AZUA 2ZWNA 3ZBMA 1OCZB 2Q9OA 2FNWA 2VW7A 3AZUA 3T71A 3RYMA 5B1AB 2BO0A 3OMIB 2AFNA 3CVCA 2TSAA 1WAEA 2PPEA 3ERXA 3UAAA 1NIBA 4KO5A 2H3XC 2AVFA 2YAOA 2ZOOA 2HRGA 2HRHA 3WI9A 5B7MA 1ET5A 4JHUA 2AZUA 4HHWA 1JOIA 2BHFA 1OCCB 4M4RB 2PPDA 4MFHA 2WSDA 3S8GB 1PZAA 2HX9A 4A2FA 4A67A 2CUAA 1E30A 3D12B 1KDJA 2B3IA 3CVBA 2EIMB 1OCRB 5AKRA 1PF3A 1WA2X 3NJJA 1A65A 2IDTA 3H4FA 5D4IA 2UX6A 1DYZA 3TU6A 1BYPA 1J9TA 1KGYE 5I6OA 3S8FB 2IWEA 4G7QB 3H56A 5PAZA 3T6XA 1M9WA 1AAJA 4YSUA 4M3HA 4DP4X 1JVLA 1PZBA 2J5WA 4E9QA 3N55A 3PXLA 1CURA 1RZQA 4HCIA 5D4JA 2BWIA 4Q89A 5E9NA 1L9PA 1R1CA 4UAHA 1SFDA 3N2JA 4AKOA 1PCSA
chains in the Genus database with same CATH superfamily
5E5MA 3US1A 1RZGA 3HMWL 1TNMA 2XFGB 5L9DL 1NC4A 4ZUUB 1NBZB 2CE4A 5E8EB 5FYLL 2BVPA 1AQKH 4P4KA 5D8JH 1JX9A 2ZUSA 5KBDA 1OPGL 3JCZA 1X4XA 3LHPH 4HX1A 4YL4A 5FUZH 5CZXD 3THMH 1JZ6A 3FULA 1R5WA 3QT2A 3SY6A 2QL1A 3D4CA 4RUFA 2PXYC 4HQQH 3DOSA 1XUQA 2DW5A 5HI3C 4NKDA 4LLMA 4AE1A 3KKYA 1DQDL 4JAVA 4OD2B 1SMDA 2G38A 3OKOB 3TBYB 4IGBA 4O58L 3TBVB 5ITZA 1UM4H 3MKKA 3CDCA 1N2RB 3IXTB 4XNZC 5IMKA 5T3ZD 3KPOA 4MBOA 4YBQC 2R83A 3VI3A 2IH9A 2ZM6O 4GNKB 5FGBA 3IGUA 3QJFB 4XWOD 4OIAA 4PJEA 1MCLA 4HAFA 5EUKB 4XPGH 2ZYRA 1TYRA 3PAZA 2D7QA 2D9CA 1OCOC 1R6TA 4ZMLA 5CN1A 5JR1H 5FOBA 1NGQH 3DGGB 3QRLA 1ZE3H 4MDJB 3REVA 3B2VL 5DJZA 1KGUA 2DM2A 3OJDB 3NQIA 3HCVA 3VXMA 5EC1A 4PVLA 4AEIH 4Y4FA 3JV4A 5DD1H 1IM3D 3B2UC 1CU4H 3L75H 4JUTA 3ZKND 5HHVH 5H94B 3RA7L 4JFFE 5DTFA 4PS4L 3F2LA 3FN3A 3L5WB 4Z95L 3FU9A 3CCLV 1J9QA 5IQ7L 1DVFD 4UCFA 3CSXA 5F9JA 1XGUB 5EK0A 2J1YA 4NKGB 2EC9T 5JLZA 4NZDA 2Y2TA 4JDZA 2ETWA 4AKPA 3X2QB 1HZHH 3L5XH 4MJ2A 4PA9A 1M57B 1OGTA 1Q94A 3TXAA 4AUJA 4B50A 1XX9C 4XVJL 1J5OH 2EDMA 3MV9D 1ZLWK 3CN0A 4JTDB 3OKYA 1HR0B 5IUSA 4O4JA 3GBMH 4X8AA 3V0WH 5LHHA 3BP5B 4GQZA 5FYLD 4XMTA 4RQQB 2B1AL 4F7PA 4IKJA 2J21A 2NXYD 1IGCL 2ED7A 2F53D 3D06A 2WLLB 5IG7B 2XZQL 1YCSA 3UCQA 4AIEA 4CVUA 1S5IH 4X65O 1ZLVK 5ERWB 1BLNB 5HGDB 4A7UA 1S9XB 1IT9H 3AG4B 3QPQD 5D4QA 4Z7IA 4FFVC 3L3HA 1UB5A 4NAMA 2X1OA 4J28A 4X5WA 1JD7A 5FUOL 3FB7B 4LP8A 3OHXC 4PJEF 1P84K 2OYPA 3VM5A 1I31A 4X66O 2NTFB 1QR9A 4QIWF 3HR5A 3B2PA 3O4LD 4BSWA 3ZMNA 1O9GA 4JFEA 2XY1A 1DJHA 4DN4H 2NZIA 1XCQA 1D7DA 4UQEA 3VXSB 1AANA 3APNA 1CC3A 2YR3A 4I9WD 1JGVH 2VJXA 3OD3A 5CD3A 1U2CA 3SGEH 5IVXE 3ROLA 1DDHA 4PJ9A 5LP6A 4TQ8A 2ZCEA 4Y88A 4I9WA 1RURL 1A14L 3VFUA 1XREA 5FGSA 1ZHLB 4DKFL 4BQ8A 4PV9A 1HZKA 2Z0UA 1THCA 5CBFA 3K04A 4KJYB 4M7LT 3H0TA 1FNFA 3BVNA 4G6AC 4RMQA 4CZZA 3FW6A 1GYVA 2FT6A 1PY0A 3AG1B 3RX8A 1SNRA 1ZD6A 2QZ5A 2G4GA 2HEPA 1V7ML 3FYEB 2XV3A 2ZOKA 3DETD 4LKXB 3ROLB 2FO4B 3POCA 1IGML 1WBXA 3AACA 3JWOH 3KG5A 4K3HA 5FDWB 4F37K 1QX1A 4B3TO 1QW8A 1XEUA 1XSIA 2A9AA 2DD8H 2QKIA 5JORA 1ZT7B 3OTFA 1A7NH 3BKCL 3GD1C 1KTJA 1PIGA 3HJ0A 3IN0A 1T7XA 3MHZA 4RX4A 3CX2A 2YAFA 1KLFA 1RPOA 1ORQB 1HXMA 1RVFH 4Q52A 3TIDA 3HZKB 4X6FA 1J12A 2F54D 1M90W 5JZ7D 5LCVH 2D9QB 1YVLA 3IGFA 2C4FU 4AYSA 2HYMA 4NC0B 4RESB 4DQOL 3S3SA 2BWDA 1Y6NR 3ZIYA 3A8TA 4PSPA 5F3HA 2C9SA 2IV8A 2UUDK 4QGPA 3QDGE 2IBZX 4O4YH 4G6MH 4CKQA 2XTJE 2Z6FA 3IFNH 1DDTA 3LD8B 1FZMA 2L04A 3KH3A 3DX6A 5KJ7E 1HXYB 3FSAA 2D0HA 4QE9A 5EUOB 4Y7OC 4YHYC 4NTYA 1OAUL 1IBBA 3FPXA 1U93B 2HUEA 3Q9PA 4YWGH 4DK3A 2WN3A 3DVFA 3JVGA 1KCBA 1SOXA 3TF7C 3K2KA 1PNMA 3WDHA 1PPIA 1T5EA 3QI9B 4QHKI 1BHBA 3ETBJ 5E8PB 1LD9B 1W6LA 2BIHA 3PDOB 5A2LH 1KMGA 1BQHA 5FYLH 4L37A 4UILH 3ZDYB 2NXYC 4HIQA 1N36B 4XCFH 4Z7VB 1DCLA 3GM8A 3P4NA 4YSQA 1ZT1B 4PRPA 4DR2O 1S7TA 3V5DB 2E9BA 4CBZA 4ETQB 3BD5A 2V2WB 4IW4C 4P23A 5J3HD 4H5SA 1AP6A 2E8ZA 1D9KC 5B21A 1D7CA 2BK8A 4JY5L 4QRTB 4YHZL 2E7LC 1BA9A 1W0VB 3KLSA 5B4MD 3CSPA 5FCSH 3QXDA 5D6CB 3CZGA 4JDEA 4N86A 3DOIA 4XNBA 4JFZH 3V6FA 1U42A 3LXBA 4FCHA 1VARA 4I9QA 1SM3H 2JI2A 4J41A 4DV0O 5KBPA 4PRDA 5FR3A 4JI5B 3VO0A 4LO9A 2IV9A 4UQ2B 2NQ3A 3QQ3B 4QOKA 3LH2L 4FMKA 1TVKB 2HJDA 4APXA 4G71B 1BWWA 1MCOH 1G84A 3JTBA 1FG2B 4AG4H 2W60B 5DZAA 4L0YA 1H3PL 1R3IC 3ZMZA 1CLOL 4ZAKA 3GXDA 5DZ9A 4H8WL 5I8EB 1Q0EA 3DMMA 1BYNA 5C0RH 1HI6B 4KHPB 3NABL 3CEIA 3NG5A 1O5PA 2AQ3A 1XGTB 4GKNB 4LNRB 4KHTL 1P5UA 2Q7YB 1FH5H 4N2BA 3LKRA 1KLUA 1YUHA 3WAKA 4Q7DA 2RACA 3WO3B 3GS0A 5SWZA 2ENYA 5ISZA 3QG7L 1GGIH 4G6FB 3A5VA 1MJ8L 3HC0A 3P1VA 3VGFA 4NXMB 4TSFG 3NIGE 3VSTA 3JALB 4M8VA 5K9OB 1YDXA 1U3NA 4BR6A 3L54A 3LTVA 1IQWL 1L3WA 5IVXF 5I28A 2Y1ZA 3BMVA 1FPTH 1B0RA 5F7LB 5D9SB 3G5XB 5IMOA 3RBZA 3U4BH 1MRCL 1TF4A 1O6SB 4FEMA 3M1OA 4UBDC 1OLLA 4L8SC 4HNAB 4K5MA 3WTUA 4UUJA 2JJTA 3RFRA 1NCDL 2RH0A 4P5TC 4MDRA 2XKNB 2G4EA 3WFEH 3HG1D 3EUDA 4K8ZA 3TBTA 4PEEA 1NCNA 4UTAA 4Y5YA 1NCAH 2KB1A 5KYNA 3PWPD 4FYQA 1IL1A 3QH3B 4H8VA 4R3SB 1EEQA 4RIRB 1FL5B 3GBDA 1CLVA 3L9BA 2WAHA 3HPLA 3PNRB 4N0CC 1R17A 5A43C 3SKUD 1L7TL 1MI5A 4UV9A 4HX1B 3CSYB 2ADPA 3KBHE 4MVBC 1D6VL 4CL7A 1AHWB 1N3NB 1QSED 1TFPA 3QZWB 1KXVC 4WF9V 4NKQB 4FLUA 3TA3A 3F7QA 4B9ZA 3ZPDA 2BIPA 4YLBA 4OFYD 1I8AA 1CXKA 2HWZH 4XC1L 2COVD 4H0IA 3WIHL 1T66D 1T2JA 2R23B 3TNNB 1U8JA 1P7QB 5DUBB 1VACA 1XBDA 4M7ZB 5CN3A 4DV5O 5MEND 4PJXB 3HNSH 4GG6E 1TTFA 1UA6L 1FFNA 1N2RA 3E6FA 3QYMA 3WYRA 4LVOB 2EXWC 4A5UB 4KX7A 5ID0A 4IS6A 5C0AB 4CMMB 3EXJA 3H53A 3X1EA 1JZGA 1NFDE 3MLXL 4PRIB 5CJQL 3ULVE 4K71B 2JS3A 1JN6A 4ZJ9A 5IMMA 1IM9A 3OLIA 4CSPA 2RCSH 2VDPB 3EH3B 2FGWH 3LXUX 3K5OA 1JJUA 2JCCA 3LIZL 1TU2B 2Q5ZA 3TBBA 5HHQA 1MOFA 5GGRY 4RH4A 2VISA 4R5TA 1IIIA 4Z7OF 2L4OA 1WIUA 3D69A 4N2FA 2RMKB 1AHMA 1P6FA 1T1WA 2VR9A 3NDYE 1E6OL 4PLJD 3BZ4A 4CVWA 1MREL 4P4KB 2NX5E 1EO5A 3NACH 4QHMB 1T5WA 2WYZA 4GRLD 3ASNB 4XOBA 5LGJA 1KN4H 3QDJD 4LRNL 5GGSB 4KL1A 3O4OC 3QS3A 5AKTA 3W7UA 1AHWA 1WWBX 3A4FA 5DS1A 5IGXL 1FFOB 2P28B 4DEPB 2Z7YA 3DURB 3VFRB 3MPCA 2R9RB 1ROPA 1T1WB 4JF3A 3NA4A 1H8OA 2BNQE 1JPTL 2ALAA 1PL3A 3A6CH 3T8MA 5C0IB 5D5ME 3E0GA 1PLGH 3WLBB 5EYPB 5KSAC 2BSSB 2HFGL 3PWNB 4Z1PA 5FW6A 5EZYA 4GLRH 2MQCA 3AMLA 4RFNB 4MA1B 4IS6B 5C0AA 3QO1B 4DP5X 2QDVA 5I1EL 1T21A 4M9OA 4XZUA 3E80A 2CKNA 2O6FA 3ZGHA 4I1PA 2ZJSL 4K5PA 5IHLB 2DMGA 1IMHC 1KB9J 1AXSB 1NLDH 1BQLH 1URFA 3QJXA 4HH8A 2VQEB 3P40A 4MGXA 4RSVA 3HTLX 1RJYA 4M4RA 4TVPL 3NCWA 1CLZH 1T6VN 1QZNA 5D7IA 3LEYL 4OLXL 2Y72A 4ZMTA 3CMEV 2W0XA 2Y7LA 5TDNA 4FK5C 5B8CA 4WI0B 1KKCA 3ZQWA 2X4NB 1GCYA 4CADA 3T3PE 1S3KL 2WBJA 3DX4A 3L4VA 5CN2A 4LPCA 1EEZA 3FRUA 4PP2B 5E9DB 4NP9A 3T71A 3HKCB 1PZDA 3N6YA 2FMLA 2XA8L 1YMMA 2UYLB 1QASA 1M6OB 2WXHA 1QBMH 2F58L 5AAMC 2XQYG 5T1JA 4WFHA 1CPUA 4JFPA 3U4KA 2Q0ZX 4GKLA 4AUUA 5HYQA 3G6BA 3ZHTA 5HI4D 2MHAB 4WWKA 1YMMD 2OBGA 1DTUA 4P2QB 5FFGA 3DYMA 3A22A 2QEJA 1JJOA 1H2NA 1MREH 4K3EL 4HUWB 3ZT7A 1EIBA 4AJVA 2Z4TA 3FKUS 2P8PB 4ACTA 4UFZA 4C4BA 5GS0D 4N1CA 2DJ4A 2I5YH 2N0KA 3HBPA 5B1NA 2FBRA 3IDGA 4O51B 4K7FB 5ESQB 4QF1A 5C3TA 3DVIA 5AKRA 3KPSA 3P4MB 1O7DE 5C07D 2IDTA 4PH8A 4L1SA 4NM4H 1EZVX 3PV7A 1H2SB 5D4IA 2AKRB 2UX6A 1HQ4B 2FEEI 5L8LB 3OR6A 2EDQA 4M61A 5FYLE 5KHKA 4BRJA 1IGIH 3H9YA 2NZ1A 3RGVA 3VFMB 3K91A 1FBIH 3N2KA 4MSWA 4N1EA 3W7SA 3NZUA 5FEBA 1WTGT 3PABB 3G6JE 5GGSY 1Z1WA 1PD3A 3SGJA 2J5WA 3N42B 4AYBA 1RZQA 1EXHA 3PY9A 4LAQL 4K3EH 5D7LB 5C2BH 5EZIL 3T3PB 3CDGA 1NKRA 3LKQA 2VDLL 1ORQC 4NDMA 1V3KA 2L35A 2NY2D 1LWRA 5E8NB 5AVWB 1BFVL 1UJ3C 5I82A 3R8QA 5F7DB 3T0EE 3RKDC 4DOHE 3M7OA 1ZHNA 3F01A 3HE7C 5F0PB 4YR6A 2J12B 4WWKC 1WUNT 3RWFB 4O02H 1FZJB 3WTVA 3AQYA 5DGQA 4UQCA 2YWYA 2OAAA 5FYJH 1US6A 1U93A 2R0KH 2R7EB 1YEEL 4LHJB 1XWVA 5SWZB 3NH7L 3O65A 4ZUSA 3MTXA 4LK4A 5BNXD 1K8AW 1B4LA 3A0RA 3LHPL 1FF5A 2NY6C 4HH9B 1VRSA 4JRLA 5GGVY 1EA9C 2EH8H 3BKML 3CH1A 4MJID 3LDCA 2VMEA 2L7UA 1MG3C 5IBLC 5INDB 4KXRA 1YPZF 4MAYD 2BNRA 1EZSA 2PR9A 4J2XA 4RWYL 4JVPA 1U8HB 4LCUB 1S7TB 3V5DA 1QRKA 3ETDA 1ROCA 4FCAA 3T4ZA 3EO9H 4PLOB 4YHOH 4MMZA 3SD2A 1KPRB 2JSFA 1ZSDA 5J6SA 1ECYA 3HN3A 3DIDA 1T3FA 4KUZL 3VQVA 1J5DA 2VLKE 1KJ2H 4Y4HA 1OOAA 2ZSWA 3UTZA 1F13A 4XCEB 5LXGL 1K34A 4GP5B 4QOKD 1IGFL 2C9PA 2IBBA 4DVBB 3IN2A 4QJ5B 3V5HA 1ZJAA 2P22C 4WO4A 1J5IA 2IH3C 1D5BB 4HDIA 3EZJB 3QPKA 2YD9A 4UVCA 3DO7B 4AW4A 3MLSL 4P2OC 3FFCA 4YHHB 1L0NH 4X98B 5ALCL 1CFNB 3MBED 3ARQA 4I2XA 1UATA 1UQSB 3H0TB 5IJ9A 5I18H 1WAPA 1UM5L 2F1MA 4AENB 2C1PA 3D33A 3T04D 2ZG1A 3RA7H 4UB0L 3FF7A 5AYQA 1FHGA 1X9UA 5LP6B 4PJ8C 4X9YA 4X62B 5F89A 3MV11 1N4CA 2NSMA 2J8OA 3QDMB 3DXRA 2DOCA 2XN9D 1J0HA 4I2XE 1WWAX 2OZ4A 4GKJO 5IY5B 3L17A 1ZS8A 1RZKH 1BQ0A 2MNWA 3L3KB 1QVGU 1S7SA 3PWUA 5F71A 5JHMA 1NUNB 4TKWA 1Y74A 1IAOA 1P6AB 2UUAB 4X20A 4NQQA 5ECJE 1FRGH 1W16A 3OGCA 5KVGL 4CNIB 3D3VD 4OM1L 3ZMEA 5JORB 5EBWC 4IIQB 1C08B 4QHNB 4PGBB 3M8AA 1X5JA 3ESPA 3VXNA 4X0NA 3N9GL 2DMKA 4GRWE 1MRFL 1T22B 3X1NA 1VQNV 1H6UA 3FJTA 1P9MA 1IX2A 3M1BA 1HNXO 5T8IA 3VGEA 1Q72L 2BCMA 4XCNA 4KNTA 3TYFB 4CNIA 3WU2Z 1XGTA 2ZD0A 4G42B 1BP3B 1TZHB 1GOHA 3I02A 4ZFGL 4JB9H 4JZJC 4FAAB 5EBGA 4RDQG 3L71H 3F7VA 1WFJA 1X4YA 3GJFK 4ZUTB 3THML 2CIIA 2YPKA 1LK2A 3KLHD 2WVVA 1QP1A 2W91A 1UGNA 3BT0A 4G72B 4RSYA 4WK0B 4MRCA 4S2SA 4R4BA 5EBMB 2VUKA 2I9TB 4Q6GA 4YWGL 4AV4A 1HCZA 3CSYA 4JFEB 4K7PL 3Q3GA 2FB4H 2QJ1A 1AE6L 4N5EC 5EBLC 4GW1A 1X5GA 4UV4L 3MRHA 2A6JA 4XP4H 5FFLA 1SVCP 2CG9X 1QFWI 4TUOB 2GUOA 5DD6A 1E5AA 4QRSB 3IAPA 3QWRD 1QO3B 1XIWB 1K5NB 2VDOH 1GL4B 3FCGA 1CICC 2H41A 1W2KT 3Q1SH 4AK2A 1T83C 1WDAA 3NOIA 1K33A 3O8XB 3I9GH 4ELMA 3H55A 5EF3A 4JO8A 3BDXA 2F74A 4ELMF 3BCFA 3KYMB 1I1YA 3NCEB 3CD4A 1YZZA 3IJSA 1YDPB 1ZHKB 4N0UE 5GISH 4UUJB 3EH4B 5JIPA 2YQBA 1P1ZB 3SD5A 3BGMA 4JE4B 4E9XA 4UDTB 1NOLA 4S1DC 4P5TD 4Q9QH 1Y6MR 3LRHA 5DJ6A 1N7ML 5ID1B 1LNQA 4M7ZC 4XP1H 2Z0BA 5D6DA 2QKIB 3EJYC 4GQ9L 1RP8A 4Q0XL 1AR2A 2W81C 5F2VO 3N50A 3KYMA 1K4DA 4G8AC 3UO1H 4B0MM 4WI9A 3BVDB 2XWJB 1DEEB 1RZFH 4RISH 4Z7UF 3EYQD 4M62H 3GHPA 1V55B 3GT6A 3HIZA 3K6IA 2DTSA 3CN1A 1MVUA 2YIHA 4XH2B 5FB8B 3OXRB 1ZDSA 3W1ZA 3WIIL 5F9OH 2Q7YA 2VXUL 3C9NA 5DHYA 2IGLA 2NNAB 1EAQA 1CLOH 3AJ7A 4DO4A 4EXKA 5ISZE 4WI6A 1AXTL 43CAA 2X6AA 3SE4C 2GHYA 4B3VA 4FA7B 2G75B 2QEXV 1E28B 3B5GA 5B1OA 2R70A 2FL5A 3FTVA 5I8EA 4LPTA 3MX0B 4TVPE 2WINA 3QNZB 3I6GB 4AQAB 4ZZFA 3BWSA 4PJAA 2H26A 1AD0B 3BPOC 3VGGA 5JHDA 1TJHL 2A83B 3FH7A 3VG0H 4L1TA 4GBXB 1G6RB 2VOTA 1Q1JL 2OR9L 2EDFA 1N0XH 1S5LZ 3LRGA 5CIPA 1K8IA 2B59B 5IQ9B 1ZIAA 3DUHA 3HC3H 3F8UB 5IT2H 3O2VH 3ZJAA 5JNYA 2PR4L 2OW7A 1R0AL 3IAGC 3TTYA 1YEJH 4HKJA 1P1ZA 3L08A 4E5XA 1ZLUH 2CMRH 3VRLE 4F2EA 3AABA 1FZKB 3QDAA 3DX7B 1XF3A 3Q2CA 1T4KB 2P5WB 2QBWA 3GRWA 3R4RA 4G11A 3T8XB 4OF5A 1R3IL 5J12B 1TQCB 2V4LA 3FUNA 4KJQC 3Q6GL 4EQ3A 1NCHA 1I7TA 2F5AH 2QSQA 3NFPB 4EIZC 3SHSA 4XPTL 1JRHL 1RUAL 3MLPA 2Y0PA 4JREC 5J3HC 1SXCA 1GC1H 4RUEA 4NKIL 4XO8A 3U1PA 1JGUH 5C6TL 3UEQA 4NS0A 4LSPL 3W11D 4L2LA 1SXZA 1AILA 2ZWKA 2B5IC 2Q86A 3I6GA 4XVUD 2AGJL 2VXSH 2VZ1A 1SEQH 5GONA 1KPVA 1SXSA 3IFXA 1U0QA 3QYCA 3CP1A 1U8PB 5EB9A 2JKIS 1WAAF 2GT9A 1F1GA 3CZSA 3II3A 5C86A 4L87A 2ATKC 5C07A 2UUDH 3PDDA 4BD4A 1JS4A 4PJ9B 3ARFC 4ODXA 3UZVB 5BRZA 4NKIH 4FQHA 3QAZB 5D7JC 3AS1A 5AB1A 5DSCA 2EKJA 1TUEB 4FM0A 2QLYA 1H2MA 2Z1PA 3DJRA 5ACZA 4UV7H 4KQ3L 1E40A 2QQLH 1IGTA 4X6CA 1SEBA 2OCFD 3SGJC 2JB5H 2WXOA 1TTBA 3QUYC 3ZRFC 2VRQA 7FABL 3BP7B 1J11A 1MELA 2WWKO 4WJG3 1BZ7B 2EEXA 4H26A 4JYYA 1I53A 4HEPG 1SLXA 2AEQH 2B2XH 1SRYA 2PTMA 1XTMA 5SWSA 1VF5B 3BHPA 4DUYB 1NGXA 2FECL 2WLZA 4UF7C 4LEXL 2QFPA 1K3EA 1CLCA 3QE5A 2BNUA 4LSVH 4MTOA 2IFFH 2OL3H 3BZDA 1N33B 3GDBA 3OKMB 4PP1C 5G2NA 4ZQTA 1T03L 4B7IA 5I16A 5GGTA 4L5FH 2GAZA 2HR3A 1KCVH 2XYCA 2Y5EA 3QR2A 1M1KW 4GI8A 4JI7O 1MY7A 4V2BA 1Y76B 2R7EA 2QR0A 2XETA 3P9LB 4MMXB 3A67H 4ZTOH 5CD5C 5AW8B 2FD6H 3W39A 3VH8B 3D36C 3X11B 4ZZKA 2JS5A 4P2OA 3T2OA 5B1AC 5BO1H 6CGTA 1NKOA 1QI5A 4DFIA 5E1QA 3BA8A 3I56V 4KRPB 3TV8A 3ZE1E 3UO3A 4FMVA 2WPDG 2P43B 3VRJA 5JPMA 1E65A 4AL8H 3WY4A 1AGCA 3L3HB 5E0QA 1DJXA 3EO0B 5LN4A 4YDLB 5AB0A 1QKZH 2WYHA 2YPLE 3MACH 5DD0H 1ERNA 1XEDA 1E79G 3OQ3B 3ZE2E 4BYHA 1HSAA 2V9QA 4Y4FD 2DWDA 2YD2A 4B7LA 1DSYA 1KG0A 1WO2A 4KI1A 1I9IH 2UXCB 3T4AB 5MEOA 1USZA 2EUXA 1ZMYA 2H3KA 4RFEA 4TS6A 4IBVA 4LLQB 4MCZA 2M6YA 4ODTL 1MCFA 1M53A 4JI0O 5H35B 2EULA 5IK3B 8FABA 3G80A 2LW7A 3R4DA 4WEBH 3RVWD 5CJ5A 4J23A 3UTSA 1FZJA 4AT6B 5BOJA 1S7VA 1SETA 3ARFB 2Q76B 4JI6O 3TH2T 5IFAL 3UYRL 1TSRA 4G8IA 4QR7A 4Q6IB 4DGWC 2V17H 4LCUC 2AI0H 4M6MH 4PDRA 4M5ZL 2AQRA 3ZMUA 4AYFB 2Y5QA 4K0KO 2ICEA 1R46A 4WU7B 3RJOA 3EYFB 2FECI 5IROA 4I3SL 1ET7A 1GZQA 1NDMA 5I1DA 5ALBL 3O11A 2CTWA 3ZHQA 1XGRA 2JIZG 3NTCH 3A6BL 3KH4A 2FYYB 1YVWA 1JRHH 1ZANL 2GJ6E 2WCPA 3GLAA 1QYGH 4KKCD 4S11A 2XXCB 1UJWB 1KTBA 1G7JB 3OAYK 1SF3A 1U21A 1CL7L 1KC5L 2WUBH 2UVFA 3PWLB 5D1ZI 1BEXA 4DN4L 4NOBA 2UU9O 1FFTB 1AS6A 4XC3L 2ED6A 4NQXB 1WWWX 3KPSB 3P4MA 4GAGL 2JK5A 4JPIA 4BSJA 2IWKA 2ZSWB 3JAWA 4QRBA 2AJXH 3CCUV 2X89D 3OG6B 1NIAA 1I7ZB 4PJBA 4Z8FL 4TXVB 4HIXH 3TWCL 4A1RA 1NU1H 1LLAA 1KTRL 3IGLA 4X1IA 3D4GA 3NSDA 3O2VL 4L4VA 4M6NL 1YMME 3PABA 2JB5L 4OKVA 5J6HB 4LF5B 3BAEH 1X5XA 4HVBA 5KVFL 2C3HA 4L4VD 3OKLA 3W0WE 1I5YA 5FECA 2QQLL 3BYYA 5E4IA 1DVSA 2WTRA 5CSZB 5AZEH 5CCHE 3V6BR 1U92B 1O7VA 2H94A 1QYGL 4JCMA 4NKDB 2QPSA 1JPXA 5I9QC 2VDRL 3H3KA 1IILE 1U8LA 5TFSH 2OW6A 5AAWC 4LLAA 1HZHL 5C8JB 1IFGA 1RMFH 4WU7A 5C07E 3SBWC 1NMAH 1JGDB 2DJVA 3O3EB 2AVFA 1PG7H 2WCGA 3KPQB 4YIQB 1M1XB 5AAMA 4DESA 2BHYA 3Q8EA 4PA4A 2MOQA 3CFKA 4NHUA 2GJ6B 2ZX8A 4YDVA 4R97C 2IPKB 3W7XA 4F58H 2NDFA 5KZCD 1JOIA 2PPDA 3U0WH 2LFRA 1B4JH 4LESA 3R1GL 3LS4L 3ZMSA 1NAML 2W9LA 4HIIA 4FLOA 3BHBA 4MZRA 1YJDL 1L0PA 1WBZA 1KDJA 3CVBA 4RLDA 5CEZD 1R6NA 1E2ZA 1GTFA 1BIIA 3H4FA 2R8SL 1DBBH 3T0ED 4X66B 3SIKA 3GSWB 4YDKL 1N32O 2FUQA 5I6OA 2YK1L 5DEJA 3IFPA 3STLB 3PJSK 4IEFB 4XNQB 1KLUB 3FT4B 4X6EB 3WJMA 4FXGA 1AAJA 1FFNB 1FLRL 2F9BT 1JVLA 2JELL 5EBLB 3T4DA 2W0FA 4QRRA 2QADB 3IMSA 2KZ1B 1UVQA 1ZVYA 5FFOA 2FSEB 1MWAL 4Q89A 1FNHA 4JANB 5C0GB 5I8CA 3NCMA 4MD0B 2QPDB 4O2BA 2EO1A 2YQGA 3V5KB 3SCMD 1RXLA 2W80C 2Y07H 3B9KC 5CCKH 3BZFB 3GKZA 4LCCC 5H37G 3RVVC 1JGIA 2W07B 4MTMA 3RL2A 5ISZB 1F4YL 4NN6C 1BOGA 4F9PA 1OAZH 5ANME 1VF6C 2P5EB 2VLKD 4AWJC 1WJZA 1V10A 3L4XA 3QNFA 4LKCA 4EI5A 5EOCJ 5KW9H 2YSTA 4G9FE 1FVCB 2ZNXA 5I8OL 1JR9A 2E75C 4XP5L 2LGWA 1T03H 5AAPA 3QH3A 5J11B 1QLFA 1DBJL 1HYSD 3FFQA 4M5YL 1GMEA 2V8MA 4ZAKB 3CVHL 5L2KD 3VD4A 1UXLA 4LE8A 4YZFF 4MKTA 2A4EA 4X7CC 3WFDL 2BVQB 4OY9A 4XMLH 2JKSA 4U1GC 1JTPA 2KLRA 3QEQD 2ODIA 2LU3A 3BAXA 3ES6B 2DJMA 2O26U 4OLVL 4WENB 1FBIL 5FA3A 5D1XD 5IB1B 2P45B 1RKRA 3JWOC 4JY6A 1NCJA 2QWQB 3L48A 1F4XL 1ZPUA 2F0CA 5GRJL 4KZDH 3O9WA 3JALA 2W8CA 2CXKA 1U8CB 2A6IA 2X05A 3MV7B 1OP3K 3SDDA 1R5IA 2ZKXA 3CC5B 1A7BA 2A99A 2X28A 1WC7A 1BJ1H 3WEXB 4YH6A 1D2PA 3V4VA 3HN8A 2XTAA 3V0HA 2YIBA 5C0CB 2BVUA 3D2UB 5AYTA 1M7XA 4LSDA 4RBPK 4RGMC 1HNYA 5EU4B 4KJWC 1BF5A 2NY2C 2GTAA 2HG5C 2XC8A 5TQ2L 3T6ZA 3WFHB 2HB0A 4R4ND 3JBG7 2OLDA 5D7JA 2CLRB 3ZMVA 4KO6A 3GB7A 4LBEC 2J3SA 4WJ5A 1MSWD 4HWEL 4YSCA 1KEML 2ZWZA 1JHLL 2AJSL 4FYRA 3HG1A 3RDTC 2BMKA 2E3VA 5DJYA 3FO2B 3IJSB 1CFVL 5FWQA 1Y7VA 1I7TB 2CHXA 2NSQA 4D7TA 1BX2A 1UFUA 1TVBB 3LIZA 5TH2A 3GZOA 4L0ZA 2XWBB 3O0RL 2AZ0A 2GW5A 3LN9A 3TBWB 5ANMA 4XMPH 2EIJC 3DX7A 2DE0X 5C08D 4U6YB 1K6QL 1C08A 2WNGA 5IJKA 4HZLA 1JRHI 4H0LC 4DHLA 1K72A 5B5EZ 3H3PH 2BMKB 3Q2NA 1PLAA 4YDZA 4KKNA 3R06B 1QTSA 2DWEC 4WFFE 3D0LB 3CC7V 2BRRL 3ARBC 1GXEA 3E7JA 2XRAL 4FQ1L 4NN7C 2H8PA 3VFPB 3DV4A 4RMUA 4JN2A 5JHDB 2HPTA 3MCKB 2OMZA 4P46D 4YEFA 3PJSB 4JI7B 2GHZA 2WMPA 2QR0B 2VRAA 2FL5B 2GTWB 3L4TA 4AM0Q 4ZAKC 1OZ0A 4PG2A 2XWTA 1AZUA 2JJWA 2OYQA 3G9VA 1T1XA 4ZHQB 3FFDA 5KYYB 4U1IB 3UO2A 1S7XA 2D3OW 2X1PA 2Z34A 1BM3H 1UZ8A 1F90H 2NPLX 2JB6B 3MRMA 4H4NA 4NZJA 4RMTA 5H37A 5DJ8A 4TTDD 1M3JA 2VE6B 3TN0A 4MDJA 4OF7A 5CJOL 1UHVA 3C8DA 3EH1A 3FFCE 2YEVB 3FUHA 1LO2L 1SHMA 2JTDA 2N7SA 4E5XB 4LF9B 2JF1A 4QTFA 3L3DA 3IF1A 3ZDZE 4L4TB 1FXHA 2E56A 5JQIB 4EO5A 1FV1A 3QR0A 2H0JA 1HK6A 5CR1A 3SPCA 4ZBMA 4UAOC 3MRBB 4KROB 1ZHKA 2CA4A 4WFFA 2JIXA 3Q43A 3ZL4L 3P3UA 4KKLC 1BV8A 4W68A 4XWGH 3EBIA 4DN3H 3QHZL 4R90H 4WWNA 1WP8A 2GI7A 3FUIA 3KXFB 4N5ED 4PG9B 2HTKC 4WZ9A 3GLDA 3ZE1F 3LVEA 4Y5YC 3TLRA 3WNNA 1YUHB 4EXPX 5A1AA 1MJ7L 3MR9A 5LO7A 2PW2B 4JAMA 4XP6H 4LU5L 2G9HB 3LNDA 1JI2A 1NCGA 1NBVL 3VAEA 3VXMB 4F91B 2XZCH 2PXYA 1AGEB 3NT0A 4N20A 2FCBA 1F45A 1K92A 4Q2ZB 4YHLL 4U0RC 3MBWA 2JQAA 3ULVD 4P3CL 3E2EA 4DTGL 1ZLSL 5L0QB 4UV8A 1OTUD 4KMTH 4FQ1H 1WLEA 1RZGB 3G5ZA 3VGHA 3LEYH 3QTCA 1KENL 1YEHL 5JQGA 1Q38A 5F2FA 3T2LA 1EJFA 1KBWA 3C6EA 3MJ8A 4F1SA 5FC9A 4GUQA 1JBJA 2HMIC 4EE2A 2PTUA 1CFSB 3BPNC 1VQMV 3EHBD 1BFOA 3ZT5A 2WIIA 1MFAL 4LF4B 2AZ2A 2NMSA 5B22A 2OCCC 3REVB 2FHCA 2FLMA 3F5WC 1SHXA 2VQ1A 1YAIA 4NQSB 4XNMB 5F0JB 3U0PB 3QUYB 1E90A 1QUNA 5F72S 5DVNA 2DH2A 4A2HA 3D18B 3KJ6H 1NBYA 4NT6B 3ZE2F 1CGUA 2DQCL 4B9KC 1ACCA 4P2QE 4EDXB 3FOLB 2XBZA 5DD3L 4OGXL 1QEXA 4RO2A 1MZZA 1JPTH 3VI3B 3JD0A 4KQ4L 4MA1C 5DGRA 3MRKA 4HUMB 3RWGB 3S5LB 4ODHH 5AOZA 3WOVA 1KLGA 1IBMO 1HL8A 3MBEC 4L23A 4DZBA 5E79Z 5H2BA 2FRGP 4WWKB 1CZ8H 1I3GH 2CM6A 5D7SH 2ZXWB 3O3EA 3DRQB 5JA8B 3AVEA 3BO8A 3O81A 3RZCD 1N0LA 3DXAB 1WP6A 4FFTA 4J1UA 1E4XI 1AO7D 5EU7E 3RL1B 3C87A 1NGYB 1MH5A 1VIWA 4JI0B 1W8OA 2AHZA 4IHJB 1NWPA 4YPGA 2BC4A 3IRZA 1XSKA 5AVSB 3FFCB 1B0GA 3RB5A 2AXFB 1CBVL 5KVEE 3PP3K 3MLSH 4PJFB 3MD0A 4YDIL 5HJDA 12E8H 4BFRA 5E1HB 1IBYA 3UADA 4D9RE 3BI9X 2UZIH 1G87A 1IJ9A 1AKJB 2SEBB 4NZUH 4W9GC 3FN9A 1V05A 4H44B 4JLRA 4QPEA 4NBXB 4ERSL 1LGVA 2HTKD 3GSVA 3IMVA 2ESVD 4PD4K 1EHKB 2X9YA 2CH8A 1H9VA 4B3EA 3QO5A 2H2SC 2W0PA 4P49A 5C7ZA 3IGAB 1U8IA 6PCYA 4LSRL 3UBXG 3WY2A 4PDLA 4WCYL 2A74A 4DWHA 3SQRA 4WFGE 3T1YB 1DF4A 3NN8A 4OF0A 3LZNA 4FI6A 4LPVA 1J1OL 4QHKJ 4OZIB 4CU7A 1HIMH 3D2UA 3F7YB 1HE8A 2AQNA 3SBQA 2VDML 1IEHA 3DX9B 1TEYA 1XQ4A 1AHKA 4QHNA 3T1CA 3UL4A 4KJYA 3DOHA 1RHHA 1N12A 1G4MA 2XVGA 3IJ8A 3NSFA 1H3TA 1QHPA 5J9PB 4J3OF 1E43A 1Y74B 1IAOB 1R47A 2V9UA 3NR7A 1Q9LB 3ZK0A 2G5UA 3RTQA 2QSAA 2VZTA 4UT6L 4E41E 5I6KA 4Z3FA 2BRRH 4YHKH 5I1CH 1WAAE 4QNPE 3V2AR 1NBQA 4PJFF 4OFDA 3CSTA 4XP6L 1I1AC 2DYPD 1UUSA 2MNJB 2PW1B 4Y4FC 5FIEA 1PS3A 3N04A 3T2NL 3CDGB 4X4ME 3MXVL 1UVQB 4V11A 4PW9A 2FSEA 3V0GA 3SO3C 1SA0A 3WD5L 3V79C 3GWOA 4C56E 4KO9A 3TYFA 4R0LC 3FCSA 1XF4B 3T3MB 3Q01A 4IEFA 4XNQA 4KUMA 1COBA 4QHLB 1AP2A 2FBOJ 2WTRB 3ARYA 4R7XA 1XBLA 1IBKO 3FB5A 3ZSTA 1N70A 4TT3G 3MMEA 4N5UA 1A1OA 1CVSC 2BSED 3GSNH 4QRUB 1AG6A 3MLXH 4ZNCD 1W9XA 2RFXB 2X4UB 4NKOB 3L95B 4LCYA 4EAEA 3ALXA 4YBHA 1B06A 4KZEL 1KTDB 3BIKB 4NNPH 1XB3A 4P2RB 1GN4A 5KANI 1V3JA 3UDWC 4KH9A 3LEXB 4UM9D 1VCBC 3WE6B 5DJCA 2IPKA 5GZOA 1KIPB 3FTSA 2AMUA 3IC7A 3P02A 4MD0A 4I18A 2CO2A 4NZ8A 1JGDA 1RK1A 4HBCL 4H25B 3HKDB 3OGCC 4ZFOL 2EVHA 3U7YH 1MCJA 4H2AA 3K79A 2A73B 2NT1A 2B0SH 1P4UA 5D71H 4BUQA 1A22B 5BMVA 2P42B 3H6AA 4FQXA 2XN0A 1DO6A 2Q9LA 3D3IA 4I8DA 1QSEE 1G7QB 4H88H 1BDYA 3HZVB 4I18B 2MH4A 4O5LH 1KZQA 1NGZB 5FO2A 3FQ2A 4MCNA 4NRZB 5LXTA 3JCUZ 3JWDL 1CXEA 3JD4A 4J10A 5EEWA 3QC5X 1DBML 1KXQE 3B5HA 5DEGA 3D1MC 2Q8BH 5IB3A 3D4YA 1EO7A 2BSRB 1V3MA 4FFKA 3E1ZA 2XZQH 3ARBB 3RZWA 2X4UA 1WHOA 4NKOA 4X4XA 1IC0A 1MFEL 1J0YA 1D5IH 1OALA 1W6WA 5ITZB 4F7TA 4X6EA 1NCWL 3WJMB 3V7AE 7TAAA 5LXTB 1NZ6A 2H8PC 1MRCH 1TVHA 5I1EH 2Z1KA 3RBGA 4HIJB 5JIKA 4WO4C 4HS6B 4X42A 2VNCA 4ZX5A 5ALBH 3CH1B 1CDCA 5DURB 4A2GA 4NQUA 4TQEH 4PJXA 2OMBA 1OT1A 1R5WB 2LU4A 3VFOB 1I1AB 4WTZA 3IFNL 4HU8A 3ERXA 4NXSA 2CK2A 4TTGA 2OTUA 2Z4QA 4LLDB 1HT6A 3SDCB 2HRHA 3C6SA 4FKKA 4J80A 4NFCA 2OTJV 4ZMAT 3OFNG 4CC4A 3QZLA 4I4WB 4X99A 1A4KA 1G1XB 2WSKA 1Y76A 1OTTC 1OZUA 2WUCL 2WWKT 4DYLA 1DLHA 1A6TA 2NW3B 2WGXA 3GMOA 4FXKB 5DEGB 2YK1H 4ANVA 5IB3B 4WU5A 2R1WA 1HYRC 3OC5A 43C9A 2RQ6A 4YGVA 4R7DB 3UG5A 1HDMA 1MCQA 1RM1B 3MRCB 3CZJA 4LP4A 4WO0A 4CGUB 4YDJA 4E5XG 3IDYB 2EIZA 1HR0O 3S2AA 3SYAA 2RQ8A 1F86A 1P84F 5CINL 3RI5F 4RRPA 4PRHB 1GAFL 4E9QA 4WUUB 4DJMA 1KBGH 4W9KC 2IWGA 4B41A 3HE7B 3FSOA 1NCCH 3G5XA 4D9LL 5BXFA 3RVUC 4EZLA 4GMTH 1HS6A 3I2CL 2DQIH 2H6OA 3J7HA 1AGBB 4JI1B 3J07A 4I77H 4PP1D 4W70A 4A2EA 2QM8A 4RAVB 3TCTA 1ZSHA 2DL2A 2DN7A 3EJRA 3IU4L 4HA1A 5GS2H 2OTUB 1NPNA 2XQBH 3PIQA 4J3OG 4A55A 4TLTA 3NXSA 4YX2H 4PVBA 3CFCL 4RVBA 2NY6B 2QJDA 3CRCA 1FJGB 3S4SB 4DGYL 3NEXA 1JFFB 3FDWA 2NY5C 5C93A 3KW8A 4G3YH 4U1LA 5HJ3A 3SGIA 4URTB 3MYJA 1FGVL 1CVRA 4OZIF 5EU6D 2J88L 1JNHA 3B7RL 2ITDC 1KCLA 3VXOB 4PB9H 4IBTA 3QZBA 2C3XA 1ZS2A 2D3NA 3HI1B 2AEQL 4G7VH 5G4MA 2Q3ZA 1MFUA 2IU3A 3HAEG 2DQTL 4I55A 4PJGF 2G5BA 5GS1B 3CQPA 3EOTH 1SJMA 3Q8CA 3VQYA 1U58B 1KXVA 2AEOA 2MQ0A 2HG5A 1SZNA 1J9RA 2OTWA 3DJ9A 4GSXA 3L74H 4FJ6A 1XGQB 5D72L 1X9LA 4J3WA 3AG4C 4L1BA 3N27A 4PM1A 3L3DB 4PJBF 3G6AA 3HZYB 4H0GA 4X5XB 2A83A 4ZODA 9CGTA 3VACA 3KYKL 2Q5BA 2BOLA 4A7GA 4Z77B 4NM4L 3P9LA 2YC1B 4MMXA 1UD8A 2GJRA 4I3SH 5E2UL 3ZVVA 2EDWA 3WSQL 1PNLA 1J10A 4DP7X 4AQYO 2ENSA 3GDCA 4J3OH 1G7PA 5H37H 3LV3B 4IQHA 4F58L 4A04A 3IKCA 4KXDA 5GZND 1KU9A 1KJ2A 4DV3B 2VXTH 1H8SA 5LNEA 3NABH 2H32B 5KSBA 2QHRH 3K3WA 2X4QA 3HB3B 1Z5LA 2MCPH 5IWAB 5C0ND 3WDJA 4KITB 2QA4V 3K7UA 3FTYA 4I0PB 5MEPB 1T5WB 2P3YA 4YXLH 4TV8B 1P49A 1MCOL 1OGAA 1RZ7H 2R39A 5ID1A 1XHHA 4OCRL 2QQNL 5F9DC 2OMXA 2BSDA 3GXTA 1HNWB 4XNZB 5E2JA 4HUNB 5GRJH 3HBGA 1NUGA 5AUMA 1T80A 3GQFA 1OSZB 5ACZB 5JOFA 4YVUA 4OLVH 2K1EA 1BG1A 1QOKA 4K8RH 1MABG 1O7SA 4NP4H 4XVOA 4UAOB 3FCBA 3PJNA 1JA8A 1BQLL 4Y89A 3O0RH 2DQMA 3P3PA 1AGCB 4GO9A 1LP9A 3GMLB 2ZE5A 3LZRA 4DF9A 1YHPA 5DJDB 3UJJH 4BFIB 1GGUA 3FAWA 3GVMA 3MV8A 4G3YL 1RK0B 2GIXA 2XAQA 4GBXA 5DQDL 1VFMA 1ZT7A 4IDJL 3OF6D 4DEWA 4EUPA 3UMNA 1UTDA 2NLJC 4OCWH 4R2GD 4Q4IA 1QRND 2H2PC 1VEWA 2E6PA 2DYPA 4GAAA 1CGXA 2FWLB 2PXYB 3CC2V 1BFVH 3HKFA 1BG9A 5BZXA 3TN0D 1QSFA 3NFSH 4Y16A 5DWUH 5HPMA 2PPCA 4AQEB 3AM8C 1ZV2A 1KIQA 2JNZA 1TQCC 1H9DA 3BUYA 2A9DA 1LUWA 2VN5A 2YMOA 4GH7B 1DK1A 5F96H 1PD0A 1JP5A 5DJZB 1E27A 3L4ZA 3CUPA 3CFUA 3VJ6B 2AANA 3HBQA 4QTIL 2UUBB 3LN4A 2PPAA 3WNJA 4AMWA 1JPSH 3DUUA 3TT1H 3ZL4H 2Y6SC 2X4OA 4FULA 2GTSA 5CA0B 1P4BL 2WJ7A 1A4JB 3DUSA 3HEIB 3JZ7A 2CWRA 3PWVB 4LF6B 3UAJC 4MCMA 1SZXA 3WKQA 4PRDB 4QE7A 2FGWL 2VMJA 1AB3A 4MMZB 3E2HB 2MQGA 1MHPH 2BVQA 3T0WA 3ARUA 3NRFA 3VI3E 1UACL 4UOQA 3GIVB 3FSWA 2XLLA 3JD1A 2X6VA 4TUJA 2C9RA 2NR6A 1FNSL 3CAFA 3B6SA 3CCHA 3LS5L 2CTRA 4UM8A 5CGBA 5EG6C 3ZSSA 3CRQA 3AB0B 4G9DA 1G0DA 1P9MC 3NEOA 4C57C 1KTLB 1WVZA 2R1YA 4PJCA 4DW2L 4M93B 1J87A 1CP9A 4Y19D 3BRGC 2AABL 1TZGL 4OZGB 4X89A 2KZKA 5HY9A 2QKIC 5KMGB 4NM8L 4E41D 3JV6B 4I4TA 2JI3A 3L3JA 4AV0A 4Q2ZA 4UTBA 3HR5B 2Z8RA 2X4OB 1FVEB 3QNYB 3VXPA 5I71C 5KYXB 5EBLA 1MG1A 4TLSA 5DLMH 1CDBA 5F9AC 3HCVB 1K6QH 3U9PL 3RWHB 3U1QA 2AK4D 5FW7A 3ZY7A 3DO7A 4L0PB 4GIPD 5KUMA 3GGWA 2P4VA 2GBAA 3GI9L 4ANUA 5HYJA 2BJMH 4BXVA 1CR9H 2PR4H 4PMFA 4X9QA 3BVNB 4NWUH 5T5FL 1CFVH 2AP2A 2BZCA 1MQKL 3OAUL 2K0RA 1BVKB 2GJJA 1EFXB 2W0LA 3DSNB 4QO1B 4CVZB 5KS9E 3BAJA 1NC2D 5DJ0A 4MXWL 4PGEA 2ENJA 2VDQL 1DZBA 1GO3F 4IHBA 1JFQL 4UINH 2PUSA 2N1KA 3G04A 1AXTH 4AYID 4BH7A 3F7VB 4ZUTA 4GT1A 3KL5A 4LGPB 4UQ3A 3D0VB 5DRWB 5SX5H 4JI3B 3FO1A 4YL9A 3NACL 4WSJA 4EI6A 4OW6A 4PA7A 2PTTA 4L8BA 2KBGA 2LABA 3T1HB 2AGJH 2Z31A 1S6NA 2PYEB 2YMXH 4ZFZA 2ZE7A 1FP5A 4PJDB 5SV4A 3MRFA 4LVNC 3QDME 3QCUL 4I2XB 2C5DC 3FMGL 1FDLL 4GB9A 2Y6TE 4XWOC 2PO6D 4U4IA 5AWNH 4AEIL 2BLFA 4TUKL 1CIUA 4ZSOE 1SXNA 2F1BA 4UB8Z 3O9WB 1G7IB 1Y67A 1NFIA 4MDIB 2A6DB 2FT7A 4MJ5B 3TZVA 4X5XA 4GP4B 2AQTA 5I73C 2E7HA 3GI8L 5IBLD 2XG4A 1XCWA 3UP6A 5E99L 5ICUA 5I76A 1SQXH 4HXBL 5IVXB 4J3OD 1EGJA 2VZUA 2LGQA 4J42A 4JFTA 3GO1L 4KDTA 4MD5B 3C6SB 3HZ3A 3E86A 3CFBB 5AG8A 1NAMB 2F23A 1I8IA 1KDIA 1HKFA 1P2CB 3BXNA 3D25B 1KELH 1FIGH 1MJUL 3BSZA 1DBJH 4UB6Z 1I1AA 4LF8O 3DYPA 1DUZB 4LXFA 2Z35B 3DOSB 3BW9B 2O5ZH 2EE6A 4ISVB 3P9MA 4WF7A 3HNVH 2IJKA 2VO8A 2QPFA 4TRPH 3TPUA 4KTGA 4JJOA 4U3FH 3S4SA 1HEJC 1YNLL 2AJYL 4MVUA 5CAYB 1OPGH 5FUZL 4KPHH 4CA4A 4ODUB 2CO6A 1PMYA 5A2IH 3KNBB 5ESAB 2CIIB 2WY3B 2YPKB 1Z2GA 2VLJA 3RYCA 3BZ4B 4NERA 4JR9H 1QQDB 5GSRA 3FQ1A 5EF2A 3NA9L 1FCGA 4G6JH 2UZXA 5EO9B 1U58A 3HKEA 1FL6B 1MHEA 2RAMA 1CDHA 3DO4A 4YHML 3ET9F 3V6OC 1GR7A 1KB5B 2UZIL 4ORGB 1MUJB 5JOEA 1YEGH 3OKEA 4GY4A 5FKAB 4ZTPH 5FPIA 4OIBA 2EACA 4WUKH 1DVYA 4P07A 1JNLH 2FATL 2RALA 2K70A 1X6NA 2BZ7A 5IBUB 5HVHB 5HJ3B 1FHNA 4G9FD 2YSUB 3EDFA 2EICA 3CDZB 4U1SA 5J06A 1B6QA 3OR7C 3NEEA 1BZDA 3OPZH 4UDUB 4JFSA 4DERA 1QI3A 2KDYA 4G5AA 4ONFL 1A6ZB 1OSEA 2HXAA 4GMSH 2HCZX 5GGQH 3CFQA 5D6DC 4F8NA 1AS7A 3TGUH 2C1OB 3QIBA 4ODUA 4HG4J 5KBNC 2DYRC 4CSZA 5KVDE 1YTFD 4KI5F 5LMUB 1A0QH 4CMHC 3VXOA 3AXIA 4LLMB 3ABUA 1EAOA 4PY7B 4AGLA 1NPUA 3AQXA 2EILB 1XF2A 4QRPD 1UCBL 3PGDA 5D7HA 2B16A 3K9SA 2W9EL 3Q5YA 1RK1B 4DR4O 3SDDB 3NJFA 3K46A 1IARB 3OR6B 1Y07A 4JN1L 2NUPB 2R2HB 2Q7HA 4JASA 5F1IB 3UAJA 4D7SA 4GX2A 1X5YA 1TUBA 2JKTM 3GMRA 4OV5B 3BKJH 3ZHUA 1N33O 1R3IH 4WEMB 3X1BA 4WCYH 1P1VA 3W7TA 1J8RA 1OWWA 1I9EA 2CHNA 5ITFA 4P2OD 1DBMH 3LN5B 3IK2A 5C09B 2OYLA 2YKLL 1YO4A 2A9MH 1S5IL 4HUWA 1ZAUA 1UGKA 2AJXL 3TVMD 3O9OA 2EE3A 1IJNA 1H15B 5IOKA 4HJGA 5JTWA 1F6AA 5FPRA 4HV8A 4JTAB 1QNMA 1UB6A 3CRRA 1PKOA 4TNVK 4Z7UB 3L5IA 2MFNA 3D39B 4M3JA 3FCTB 5CGTA 4ALAH 8PAZA 4Z3EA 2ZICA 4K07A 3E6FB 5D71L 5CKAA 5JYLA 5L6YL 2HLAA 3GS4A 2X0LA 4QT5A 3S5YA 1CICD 1FO0B 1RUQH 2DQGH 2XTJD 3BE1H 1E3FA 5IEHA 4LOUC 3CVCA 2TSAA 4F24A 4G6ML 4L4VE 5L0QC 2Y4UA 4Z7UA 2VDNB 3WTSA 4G8GD 4IRJD 1XMOO 5GGTL 1RV6X 5GGSA 4MNGA 3RNQA 1X5MA 5E5MB 3KS0J 5D1ZB 4XWGL 3LKQB 1S9VB 4PS4H 2BSKB 2O5YH 1SZTA 1M6OA 2OR8A 4HG4K 1PX4A 3SY0A 2LGNA 3GSNL 1XHXA 5D1QA 2DQJL 4M00A 4G8EA 2HT3C 1D6EB 1PY9A 1A65A 2DKUA 5DJAA 5TE7H 5A7BA 3QEHA 1CTOA 4O4LB 1WP7A 3E3QC 5DUMH 1P5VB 3HPLC 3TU6A 3OG4B 4JQVC 1URZA 1T1ZA 1QPPA 3S8FB 4G8FA 4JY4B 3EO0A 3PV6B 3S35H 3S98A 2LR4A 4Z7WA 4MVMA 4G6JL 4LT7A 3SKOB 3Q7JA 2HVJB 4X6BA 4DEPC 2OTLV 3KPRB 4HISA 3F7VC 1N0LB 2ESVE 3C6LC 4BFJA 1L9PA 5LBQA 4LBEA 5CU5A 4IJ3B 3IVKA 3BABA 2A0LC 2V33A 3CYOA 2VL4A 3NSYA 1I3UA 3WXVL 5KTEH 5LQBH 5KVMC 5GGRA 1DUYB 3PWLA 1XT5A 1BAFL 3BAWA 1SJHA 5DO8A 3L9DA 5KYWA 4AXWB 1HNFA 1G0YR 5CS7A 2FD6L 4NHCH 5K9KA 4Z78A 3NJXA 5DK2B 5FYKD 3KPTA 1SYVA 4GAFB 3OWRA 2BH0A 4U7OA 4XVSH 2D4FA 3L5JA 4F5CA 4ZMPA 5JUEL 4CJ1A 4X8CA 2BNUB 2J1ZA 3MROA 1IM9B 2A77L 5FUOH 3F7YA 3OZ9H 3G5VB 4WK4B 5IYZB 1X5IA 2YS8A 1L1FA 2PYFB 4FNSA 3E83A 4DO6A 1BGXH 2QWPB 1U8IB 1T6WA 2KC0A 1EUUA 1YNTB 5KA5A 1JF5A 4YFLI 5DFTA 2CO3A 3PHQB 3VWKC 2EVGA 3TIDB 3QWQB 1I8KA 3ZN6A 1NPJA 4JFHD 1BVLA 2UY7B 1FE8H 2WGNB 3FONB 4FZEL 3QFDB 1T04B 3U30C 4HPOL 1OAJA 4ZS6D 4PJ5D 3WKML 1Q6IA 1UKSA 4EIGB 4FTVD 1PZCA 1XMQO 3L5XL 5KMGA 3V4PA 4Z7OE 4WW1B 1ASOA 1YUKB 1FIEA 2YGNA 3FZUC 1HNZB 5FGCB 3MAQA 3SJBC 4PRNA 4J27A 5KVDH 3CWBH 3UQ8A 2YUWA 5E8DL 1B3IA 5SWSE 5AD0B 5EIBC 3EJPA 1WZ1L 1MCEA 2NY0D 1CFSA 2OYMA 5BVJB 5CBEA 2DMBA 4XGZA 4QHUA 3VXPB 3HAEH 3MRPB 1N5YL 4GKSA 3M46A 3WIFA 3WMQA 1CE1H 2HRLA 4MTGA 2P24A 3CCJV 4R8WL 4FG2A 4WV1A 3QRGL 3QDJE 3RVUD 1JHKL 4EFEA 4AQ1B 5A3IC 2FIKB 1J8HE 3D85D 3QO0B 4AT6A 2HLFD 1KXTB 3FXIC 4L3CA 3LH9A 3WDIA 2C9UA 3K5SA 4EDXA 3CFJA 3MQIA 4P57A 4EZMA 2RCSL 2VH5L 2XX0A 2P1YA 4JFZL 4MJ5A 2OJZL 2HLEB 1Z9NA 1RUAH 2A6KB 3RIAF 3ZR6A 1JV2B 1YY8A 2ZR3A 3QXDB 4OLUL 1JXGA 4B95C 4G8GE 3ZGIA 1NEUA 4AGOA 1UA6H 1UZ6E 1ZVNA 3WB0A 1MFEH 1MG2C 3UP1A 2M83A 4P23B 4Y5VC 2OA9A 1DQDH 2ZE8A 4N3TA 3GBLA 4QD2E 4MQTB 3RP1A 1I3VA 1AJPA 4MVSA 4O2AA 3NAAH 1QW9A 3E35A 2A0LA 4JO1H 4E9SA 1AQ8A 5BW7A 2P8LA 3FO0L 2F53E 1VEPA 5I23A 2MWCA 3D30A 3C5ZB 3G5ZB 4JPKL 1M7IA 2ZUUA 3FAVA 1CLYL 1JHTB 3O8XC 3VCLB 3IBOA 2I60H 3B8MA 3A2FA 3ML9A 4MA8H 4PJAB 4YUEL 5AZ2L 3RTQB 4DW2H 1ZT4A 5HYSA 2YA2A 3QQ3A 3MV8B 5I15L 2OV0A 1T4WA 1DE4B 1LWHA 2VQFO 2Q3XA 3HOGA 1TEGA 3TFBA 2FSDA 1S77D 4HFWB 3U36A 1PP9H 3EUUA 3U2JA 2G30A 1K73W 4TUOA 4E36A 5KEZA 2YEZA 1RIVL 1ZLEA 2EDYA 3B3IA 2EYRB 4JZNB 4OLZH 3D05A 2ZX7A 4FS0A 1GOFA 4N23A 3MV7A 4JHBA 1BT8A 1H8HG 3LXAA 1DL7L 2CU9A 2R4RH 1VCAA 2R0LL 2ZCHL 3P30L 2QPUA 3LZOA 1AZZC 3II1A 2HRPL 4NC1E 4ONGL 1INDL 4HNAA 4PVNA 3UJTL 1J18A 2Q67A 4HEMA 4X20B 1HAUA 3MRJB 4K7PY 1F4XH 5DZVA 3M8OH 4UM9A 3LMJL 1AI7A 3DUUB 1ZS8B 5CJOH 2F74B 4WFBV 1X3DA 3ZMTA 4YBLB 4XHQA 4LFAO 4HWUA 3ATAA 3IFLL 4V1DD 4NXNB 3BRCA 4HPYH 2MCG1 2Q69A 1I9JH 1IKFH 1PVHA 3QUHA 1FYHB 3BX7C 3ML0A 3TEYA 2PYEA 5I26A 1P5UB 2P52A 5BOZG 5J1SC 4GIOA 3GSOB 4X64O 5IHHA 5KSVB 3E6HA 4OJYA 1A3RH 2ERJB 4Z2WA 4OCNC 5GZOC 1G9NC 4LF9O 3QI9A 1HFUA 1OAZL 4JFOA 3K59A 3GF8A 5DDHB 4BE6A 1AD0A 3B77A 4GS7C 4FQIL 3QUML 4Z9KB 2IQ9H 5D93C 2WZPA 4HS3A 1GRJA 4BW5A 1OQOA 2Q20A 5FA3B 5L88L 2G2NA 4U0QB 2XA3A 3GYRA 4W6XB 5FO7B 2OSLA 1S5HB 2NZ9D 4PRHA 1JPST 1RCYA 2P5EE 4BUGA 5IOPA 2HTLC 4GG6F 4QMEA 2DWDC 4FEIA 4PRPD 5JCOC 3NZ8A 3PL6A 4JFFA 4HXBH 4MNQA 1N67A 1W15A 4WNQA 2XPYA 3ARXA 4XE0A 2X70B 2OQJA 3VXME 3L3GB 1DQVA 1MCBA 2YD5A 3VDCA 1DHKA 5ILTH 1EZVH 5AUMB 3B8NA 5A6MA 5EEZA 1J05B 1NGWB 4WU5B 4DKAA 2A7BA 2XWCA 1TG8A 1IC5H 3VYNA 5E8OA 3ETQA 2OSYA 4S1QH 1MJ8H 5DN6G 1RZ7L 3ORJA 1J8KA 2HG0A 4FI8A 4XO3A 4PELA 1T66C 3WJLC 5AW5B 1XEQA 2FK9A 4X5QA 3UJIH 1NC4B 4ZO7A 1LO4H 3SDLA 1BBJA 2P7TB 4BWWA 3AG1C 3BPZA 3WFCL 2C9VA 3EXAA 4F6RB 3K2MC 4NTXA 3NVQA 3II2A 4BZ1A 3EDEA 4ZUVA 3RIKA 1SJEB 2N0MA 2VR6A 5FM8A 4F2FA 5MENE 4ZXBD 2E86A 2KZBA 4OSUH 3LPWA 2C2AA 3IE4A 2ZOWA 4N9GA 1ES0B 3DBXA 2BSBA 3VTMA 1FC1A 4PG9A 1UB6B 3DBSA 4ABWA 4FFYL 2BFVL 4N28A 3MCLL 4POUB 5BZWA 1OP3H 4ESKA 1IX9A 1AO7E 4IRSB 2UXTA 3MUHL 1YEGL 5KVFH 1JWSB 4U1MA 1SYSA 4I5SA 2ITCB 3N1FC 2Y0IA 3ABGA 2VSCA 3CHOA 5J0BA 4WJ5B 1OCWH 4XMLL 2UWEF 1O9VA 5IQLA 4X5LA 3UZQA 1TCRB 5GS1A 1N0JA 3CJHA 2ZJSH 2BTQB 4PJHE 5E08H 3DSQA 4PB9L 5B38A 1NT2B 2F93B 1HDJA 1F02I 2X4SA 1UYWH 3IJYB 1OSPH 4TF4A 5DVOA 2O93L 5ENWA 1XF2B 4JJHA 1S3JA 5D1QB 2HUHA 2QMKA 4PG2C 5T1DL 2R2CA 1SVZA 3CPUA 4KVNL 3DVGB 2CR0A 1FJ1A 1X6LA 1NKGA 4XBGB 4O02A 3CLFH 3FT2B 1MI5D 4KJPD 3IJ7A 5E8EA 2QTEA 4HGWB 4HZ1A 4L3EB 4JI8B 3V7AG 4LEOB 2BS8A 1RZ8A 3DV4B 4XDKA 2JJ1G 2MPVA 2HHHO 4P5MA 4PWJA 2L7EA 2XWZA 2Y7NA 35C8H 4Y4HB 4NZRH 3TEXA 3SQBB 3U46A 2J55A 3CDYA 3H9SE 1EAPA 2EH7H 4LPWA 2D3JA 4YS4A 3H9HB 2OTWB 4K8RL 2ZX9A 1UACH 4Y2DD 1FNEB 5BUGA 4PRBB 4FQCH 4NRYA 5I66A 1RFDH 2R2HA 6FABL 2DTMH 3Q8AA 3PV6A 4MSWB 5C0BD 1F51A 3MUZ1 2MK3A 4Y2DA 2JEXA 1JN6B 4RFOH 1XF1A 3LPFA 1C7TA 3ZHKA 3QAZC 1OCOB 1KCSL 3ILQD 4CAGA 2IWFA 4NUJA 4JGSA 5FHBH 4O4HB 1OHZA 2IDQA 4TNVF 2ZNJA 2CJUH 3X12A 4FXLA 5IMLB 1YNKH 2E9WA 4K7PX 1JYNA 5SWQA 3VRIB 1UM6L 4P59H 1JF6A 1DQLH 2CQVA 2R51A 3BN9D 4AXWA 1MW0A 2YMXL 4TSAH 2JK5B 4U6VH 3EYSL 3OJMB 1QVFU 1NMCB 4PJ7A 1ETB1 2VLRB 4J3BA 2YLHA 5KA6A 3GRWL 3GXMA 3QUZC 2Y2YA 3B1UA 5GGTH 2X7RB 1MRDH 1NINA 3OGIB 1OF2B 1MFDL 3VRIA 2FX8L 4AGQA 1TQSA 3MROB 1MFNA 4NQEE 3MV9E 2YJQA 4OBSA 4XB8A 1C9SA 4Z7VF 3MXWH 3L6FB 4CADB 1A6WH 3H9SB 1U92A 4JFUA 1T1ZB 4HCFA 2ARWA 5EEVA 4L1DA 1CDJA 4LEXH 4LZKA 4WLCA 2IALA 1WFNA 2DB8A 4OH2A 1EAJA 3G5YB 4YHPA 3RGVC 5BXFB 2AV1B 3DVNA 3B4SA 1FQ9C 4PV1B 3FHAA 4NQCE 1QMUA 1PDKA 2I25N 4OLEA 1CGSH 2BINA 4U1NA 2ISDA 4AGMA 4XHJD 5DD5H 5F7HA 1KY7A 4FP8L 2XHNA 1V8HA 3W2DL 2N59A 1HSAB 3E1F1 1AFVL 4IHOA 3GMNA 2FZ3A 2LQTA 1F56A 5C8YB 2WLIB 2ARJA 4TM9A 1WGVA 3BN3B 4GSUA 4NC1C 4NUQA 3ABMC 2DPKA 1PKQB 2YPVH 3AWGA 3EGXB 4MAYC 5ICZA 1TTCA 3FB5C 1E4XH 1TZGH 3QQ9D 1HHGA 1BQSA 4FJZA 4J8QA 1FAIL 1X5AA 1LO3L 3CFMA 3I3EA 5CBGA 1P5UC 2ZSVA 4OIIL 1A0QL 4LSSL 2CKBH 3BJ91 4IHOB 1MPAL 2ORBH 2ZOOA 3FB6C 1ZXKA 5DA0B 1J95A 4MMZC 1ZLDA 1ET5A 4OI7A 2BHFA 5I1HL 1CXFA 2XTLA 2BTOA 1M42A 3NCFB 3VNZA 2CDYA 2WXLA 1ZX3A 1Z66A 2LHAA 2AQ1A 4N0FA 1FZOA 1CDIA 2VDQH 4P2YA 4PN6A 5BZBA 5JO5B 2GSGB 4MBRA 4NCDA 1HE7A 3VFTA 2XWXA 3GSRA 3UYPB 1JNLL 2FATH 1MCNA 2WVTA 3VXQA 1UT9A 1XGYH 2R69A 5TJWK 1KTKE 1QRNE 4QRTA 4YE4L 4H8HA 5T1MB 6FABH 4WHTA 1PZ5B 4PGCA 4FZEH 3IDXL 4C7UA 2P06A 5HBBA 5KYXA 1A1NB 3SQOL 4EQ2A 2BVEA 2ZD9A 4NNXA 4XMKH 4KXZI 4TV9B 3P0YH 3FO1B 4M02A 1T7WA 1MFMA 4CU6A 1P84J 4JR9L 1EN6A 1LD9A 1N6VA 1QNIA 4M6AA 3CFEA 5L7XL 4OZHA 2FB4L 1NCBH 4NQXA 1ZGLA 5I15H 4NRZA 1SLWA 4Z7QE 4JFYB 3ECVA 4NCC2 1LO5A 1UOLA 4V33A 4R26L 3GTVA 1X5HA 3LPOA 1IBKB 1W0JG 3ARZA 2CDEB 3ISWA 4GW5B 3IETA 3SCMA 5KSAB 2YFOA 2QZQA 2EKSA 3DX6B 4LCWB 1MLBB 1YJNV 4NN5C 2AC0A 4KH2A 3K5NA 1BD2B 3BAEL 3HKDA 1E8ZA 2JCWA 3PQYA 3WAJA 5CSZA 5DO2D 3HS9A 1TSHA 5LBSL 1MCHA 4LF4O 4HIJA 1FIGL 5DD5L 1JQ0A 4EI5D 1Q9KA 2K4WA 5D5MB 1BXAA 1QZ1A 4ZX6A 4YJ3B 4KK5C 4XRCB 3AQZA 3S48A 5GS0H 1UD2A 3DTXB 2H1LM 4OF3A 3VWJD 2B1AH 1O6SA 5F7MC 5LCVL 1RIUH 4CH3A 5C08B 3UPAA 3STLC 1JZ2A 4EN3D 2FAUA 3I5DA 2IAND 5K69A 2C26A 4R0LA 4BA0A 2CLVB 3FQXA 3WJLA 1CBVH 2JKJA 4AQ1C 1LMKA 3X13A 5JW4M 2O4EA 5TE7L 1C8QA 2XIIA 3Q2VA 4A68A 4A2LA 3DMMD 1D5RA 2CGRH 2DQ3A 4EI5C 1RPKA 3K08A 1SDAB 3W3BA 1IE4A 2L3BA 4LHUD 3I9GL 1OEZW 5DD6B 1MFBH 3K3QA 5FO7A 5GW7A 1AJQA 4DUWA 3RURA 3GJEA 3PHOB 3ZO9A 1YEKH 1WYJA 4WKZA 2PABA 2VXSL 1J8HB 3RHWK 4P5MB 4AVHA 4KOBA 4G83A 1FYTD 1MFBL 4UOJA 3RY4A 2YIBD 4V2CB 5AVRB 3ULUD 2FTKA 4YHNB 3DPBB 4D94A 4KQ4H 2J20A 1OCCC 3MDJA 1IKNA 3TGXA 2UUAO 4KVCH 1TEFA 1A6ZA 1KB5H 4LQFH 3OAAG 3DDFA 5CZVH 5LNGA 3OMNB 1UJ3A 4OJDH 2PF6A 3ILPA 5AOIA 4M7LL 4L4TA 3U6XA 5CB4A 2Y23A 5EZJA 4KRLB 2GIMA 1EDHA 3ZHVA 4JX0A 4JDEB 5I74B 2Y3NA 3Q6GH 4L4TD 2GI0A 2APSA 3ELQA 1RIHH 5GQBA 3I9IA 4XPBL 4X1KB 1HWWA 3T1WA 1IC4H 5HHXL 4YK4C 4G5ZL 2Q0OC 4DV7O 3CBRA 1FZKA 3QWOB 3UZQB 1TXKA 1NR1A 5EO9A 1TVDA 1FPOA 2P6JA 3ZDYF 2AHYA 3F7LA 1IEBA 2XQ0A 5BPPA 1P69B 3N0PB 1Q1JH 4DT2A 1N26A 4JHVA 2AF2A 2EZ0D 1TIUA 4DUVA 1WS7A 4WRLA 1N0NA 4I4TB 3BUDA 3L3JB 3QJQB 1FAFA 4GW4B 3PP3H 2GC7C 3OM3B 5F9WB 1NH2B 5BZWB 4HKXA 3AS3A 4JM2F 3S36H 4Z7NE 5J5EA 1HOEA 4X9GA 3MLVH 3FO9B 5JJEB 3RWJB 2ZNIA 3R06A 3FQWA 4N9GB 5BZDA 2R2EA 3T1FB 4MJ6A 5I0XA 1T1XB 2GFBB 4M5ZH 4P30A 2HH0L 3HLKA 5IB4A 5J13B 5HYJB 3CC5A 4M1CC 4YSAA 1U3HB 2WMPB 3VI4B 4QYOB 4GI9A 5AOKA 4LOFA 2VO5A 2WANA 4IOIB 4U31A 2EX3A 1A6AB 5DZLA 3RUGF 4BCYA 5CEXA 1AJNA 1W0KG 4MSWC 2YXMA 2C9AA 1SN2A 2IQAB 4M7KH 5DMIL 1OE3A 2YAEA 4BSWB 2BOBB 2WN2A 1AI1H 1FV1B 1INDH 2EIDA 1OGTB 3L9RB 3MSPA 2P4KA 5CIPB 5L3EA 2W9DH 5B7EA 3V4UH 4AK1A 3GMPB 4B9CA 2VMCA 3QUYD 1P4BH 2UX7A 4WEBL 5F70A 3QFJA 2EDDA 2E9JA 4P05A 3RT3C 5BS0A 2XWBA 4TVPD 2D0FA 3M45A 2BDNL 1I4FA 4KDTC 1MOEA 4R8CA 2DMXA 4D0BA 5LA6A 5IG7A 1NLBH 4AZ8B 5KJRL 1QLRA 3MLRH 4IMKC 1FYJA 3FU7B 4UOW0 2F1AA 43CAB 2Q73A 1QHQA 2F53B 2CBTA 1AR4A 1D2OA 3GXIA 4JAMB 3WFCH 1DF5A 2ADJB 3JXAA 5IVZA 4KTEL 3W9EA 4ZUWA 2J8UF 2EDOA 5ADPH 2C8NA 4OGZA 4U05A 2J72A 3S37L 2ZE0A 4C55A 1A14H 1LILA 3QEUB 5BQ7A 4LPUA 2OMZB 3T0VA 4OLWL 1NVPB 1Y1UA 1X5LA 3BDBA 3ROOB 2DLEA 5ICYB 1FL3B 1Z9LA 3QXUA 3D0LA 3UTTA 1PG7X 2P24B 2VYRE 3HG3A 4PJEB 4KTYA 4QWWC 5DMGD 3I2CH 1HHJA 1ZSDB 3A24A 2YD1A 4F7MA 2HVJA 5AALA 4U4BA 5JPNB 1UD4A 5LB1A 1C5CL 5JXAH 1INQA 2WNXA 4MYPA 4P5KB 1OCWL 2BWQA 1F1DA 2JKWA 2PWGA 2QSVA 3AREB 1CFBA 2MRYA 3MRIA 4U6TA 3H1JH 4GKKO 1EWHA 1WRFA 3V4PH 3JAKA 3S3XA 3X14A 4TQHA 1XQ8A 1OSZA 5JOFB 5JOPD 3N2GA 2DLHA 5C0NC 5KYUB 2YN3A 4NUPA 2OR9H 1CXLA 3H7BA 4RMWA 5FUCE 3HE6B 1RPRA 1YEDA 3D51A 3N0AA 1DJGA 1XGPA 1OAYH 3RWDB 3VYOA 2CBOA 3D36A 1O9WA 4WFHD 5HGBB 1V27A 2EDNA 4QWWD 5D7JB 5EOCH 2BVPB 3U7YL 1HNXB 1HHHA 3JZYA 2HT2D 4JDZB 5JLZB 4B3SO 1C12A 1MFDH 3DXRB 3GEFA 5HD8D 1CBJA 2DM7A 3GLEA 4KI5E 2WXNA 5F3BB 4XN2A 1MWOA 3PQYB 2XN9B 2GY5A 4X4KA 1H2LA 1VDGA 2K8MA 3EFOA 2XHBA 3QIUB 4PI0A 2QVIA 3TEUA 1UB5B 4F9PC 3B34A 4MXVF 4BK5C 2X4RB 2JXMB 5IM7B 4HIPA 3VW3L 4MTXA 4TQEL 3WSQH 4IBSA 3WUWB 5JA9A 3SR2C 3RPIA 3STBA 1YPZB 4O4LA 4HC1L 3DGGA 4N2KA 5HHPB 4GP8B 4JO4H 3ZKXC 2GVYA 4HPOH 5J1AB 2RA1A 1RZJH 4BJLA 5FB8A 4L8SA 1QSZA 5BV7C 1HYSC 4YN3A 2PMZA 4OLXH 2AXJA 1T3FB 1JK9A 4BSVB 1CLZL 4XVTH 1ZK5A 3HMXH 1E7UA 2B1OA 4MASA 4L8DB 4LSQL 4P48A 3VQLA 2EXTA 2IJJA 3V0IA 1UURA 4HWBL 2OJEB 5KSBE 4GSDL 4DR1O 1BAWA 1NDTA 1OKEA 3HI5H 3W9DB 1KZYA 1IBLB 5EBWA 1TETH 4AH2A 5AL0A 3BSZL 3FQRB 3CBJB 3VXSE 2DLFH 1G7MB 3C2SA 3T3PF 4ETYA 1QPKA 5HYJE 1D6EA 1GH7A 5HPOA 3LKNB 5SWSD 3HHSA 3IMBA 4CC6A 4OM0L 4OGAD 5GTHZ 2E6QA 2YRPA 3MRHB 1W72H 3IWUA 2Y5TB 3GNMH 1XB8A 4OF6A 4ZX3A 1CXZB 1CTNA 1C1EH 3A6CL 4EIBA 3TPKA 4XXDA 2W65A 3MKGA 5JW3H 4DKTA 3KVDD 5IW3A 5IFJA 3EFDL 2XBTA 4KV5F 5F7YC 4LLYB 3VFVB 4PDMA 4YJ2B 2DQIL 4GSDH 3BSZH 4P2RA 3RFZB 6PAZA 2F8OA 5IB5A 5IFHH 4F4LA 4ZKIA 1PDKB 1KJ3L 2H5UA 4N2GA 3VUAA 4I0XA 4TV9A 2DEYX 4GKKB 2H0EA 1YSOA 2HP4A 3FB7A 5ANHA 1FLRH 3KYOB 3FNKA 4R2GC 3IFLH 2H47C 4WI4A 4OI9A 2IMNA 3Q0HA 4X98A 4WHTB 3STLA 1KECA 3FCTA 2Q7GA 1BQZA 1R5IB 2BNRB 1JZFA 3B7TA 4HJTA 4JFWA 3M8OL 2C4XA 3ARBD 5GGUA 1J48A 4KK9C 5KBMA 3WBDA 3FQTB 4WW1A 4WCEV 4JL2A 3EH2A 1KEMH 3LIUA 4RGNB 4JM2D 1XZWA 3UIZA 2M8XA 2CSPA 2R1WB 4P2RE 3CSFA 3KMDA 2NX5B 2XU9A 2IFGA 2ZOTA 2X3CA 1R33A 3L4UA 4S1RH 5DWPA 2WSSG 1U96A 4OCSH 3IJHA 3R1GH 4PA3A 3PHSA 4PJIB 1BQ5A