3X2QB

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3x2qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x2qB02
1FWXA 2VM4A 3IBOA 5B7MA 4AKOA 1RZQA 2JFCA 1GY2A 1X9RA 3T6XA 1BYPA 1J9SA 2YAFA 3CVDA 3TA4D 2YQBA 3ZX1A 4NB7A 1EHKB 2Q9OA 5B7FA 3NSYA 3PAVA 2FQDA 4A66A 3FSVA 3EHBB 3TBCA 4A2GA 1DZ0A 1OF0A 2PP7A 2J55A 2CBPA 2QDWA 2N0MA 1L9OA 2X88A 4PCYA 4DP0X 1ASQA 1ILSA 1CUOA 1JZGA 3FYEB 4NAJA 1ASOA 4BK5C 1E5ZA 3NJKA 2HZHA 5B3SB 2JKWA 2XLLA 3ZIYA 1AANA 2GC4C 3BQVA 3OQRA 4E9WA 4DP8X 3NSFA 3X1BA 2HX9A 1J9QA 1L9SA 4YSAA 3DTUB 3HB3B 1WA1X 1KYAA 1ZPUA 4YSPA 3WNJA 1ILUA 1GSKA 1VLXA 1URIA 2VSMB 3NJJA 3S3CB 3IE9A 4BWTA 2IDQA 4HCFA 4Q89A 4W9ZA 2AZAA 4DPBX 4AZUA 4BDVB 4UANA 1JXFA 1A65A 1L9PA 4TXVB 1NIEA 3NP3A 1PCSA 4HIPA 3GYRA 1TKWA 2W88A 3NJNA 1J5CA 1NINA 1WS8A 2HLEB 2AANA 4KOCA 3FSWA 4Q8BA 3WKQA 4RH4A 1KBWA 3QJQB 3WKPA 1BYOA 3CG8A 2UX7A 1V10A 3PPSA 3UADA 4E9XA 1J9RA 1NIAA 3S3BB 1AOZA 5I26A 1TEFA 2GSMB 2HX7A 2EIKB 2BW4A 3AG1B 1W8EA 1GY1A 2GHZA 2DYRB 1JZIA 3PCYA 1CC3A 3ZBMA 1CYWA 4G70B 3N2JA 4M3HA 3MX0B 3NP4A 1E5YA 2BW5A 2ZOOA 4GYBA 5F7AA 2BWDA 2IWEA 4DP5X 4UAHA 2BHFA 3NYKA 4HHGA 2I7OA 4YSCA 3JT2A 1RCYA 4DPCX 2H3XC 1OE1A 3TBBA 1GW0A 1OCOB 2HXAA 4YVUA 3NJMA 1BXUA 5I6PA 3ERXA 4YSQA 3PAUA 2BZCA 1WAEA 4CSZA 2IDUA 2FT6A 2Q5BA 2FT7A 1TEGA 3CVCA 2UXVA 4BDVA 1V54B 4L0PB 4AKQA 1QLEB 1AZBA 5E9NA 3FU7A 1BQ5A 4EF3A 1PLBA 4YSDA 3WI9A 4BWWA 2AZUA 2IWKA 2VMJA 2IAAC 3NSCA 2FQGA 2VW7A 1AG0A 2PPEA 2J5WA 4HCGA 2ZWNA 2IDFA 1NIDA 1ET7A 2YXWA 3EH4B 3QJUB 3JTBA 3FS9A 2GIMA 4HCIA 4E9RA 2XXFA 2FQFA 3WG7B 2AFNA 2BP8B 3FQ2A 3QPKA 3T6VA 4E9SA 1M57B 4KNUA 4F2FA 4DP7X 4YSSA 1W6LA 1ET5A 3NJGA 3UACA 5B1AB 1ETJA 2NRDA 4HZ1A 2PPDA 3FT0A 4MFHA 2HX8A 4BWUA 3CDZB 1ZDSA 1SJMA 3SBRA 2BP0B 2FTAA 1AQ8A 5AKRA 4PAZA 1FA4A 4QKTA 5I6KA 1SFDA 2CCWA 3QJRB 1WS7A 2FT8A 3ASNB 2QT6A 1SHWA 1OCCB 1AAJA 1XB3A 4YSOA 3V9CA 3OM3B 4AKPA 1RZPA 1JERA 1A4AA 3FPXA 2YAMA 1NPNA 1J9TA 3FPYA 4FAAB 3UGEA 1KBVA 1SDDB 4YL4A 1A3ZA 1JZFA 3UAEA 3UABA 2DYSB 5I5MA 2A3TA 1AZRA 3S3DB 1M56B 1PNDA 1CURA 2GI0A 9PCYA 1PAZA 2YAOA 2ZONA 1BAWA 2YAQA 4A68A 1PZCA 2CJ3A 3X1EA 3NJLA 1MZZA 3G5WA 2H5UA 4JKNA 5D4JA 4M4RB 3CVBA 4DP2X 7PCYA 1M9WA 1ZIBA 3FQYA 4AX3A 2UX6A 1PY0A 3SQRA 1PLAA 4NERA 1WA2X 1NICA 4G7RB 3NJIA 2VM3A 4GXFA 1CYXA 2PPFA 2P80A 2TSBA 5LDUA 4ENZA 2Y69B 5I28A 1OV8A 2BP8A 4P5RA 2FQEA 3ZDWA 1E65A 1F56A 1B3IA 3QJTB 1NIFA 2EIJB 2XV2A 2GB2A 5A7EA 2EIMB 1IBYA 1N68A 3X2QB 1HAUA 3CDZA 3RYMA 1QHQA 1NIBA 3HEIB 4DP4X 5B7EA 2BP0A 1JXDA 3KW8A 1AIZA 1NZRA 2BWIA 3FQ1A 2XYBA 3IN0A 3PAZA 4G72B 1ZV2A 7PAZA 3IN2A 1KV7A 5TK4A 1A8ZA 2EILB 1N70A 1KDJA 2R7EB 2VN3A 1IKOP 5PAZA 1XMEB 4KNSA 2UXTA 3IEAA 1PNCA 5I6LA 2BO0A 3T6ZA 3V9EA 4KNTA 1EZLA 2HRGA 3FYIB 2PP9A 3OD3A 2B08A 1ZIAA 3DKHA 1OOWA 4UF7C 1IUZA 1BEXA 1IC0A 1AS7A 3UAAA 1MG2C 2RACA 1NWOA 5EHFA 5FC9A 3T6WA 1L9QA 3TASA 2LLNA 1AACA 5I6MA 1JZJA 4QLWA 2MRYA 3AG3B 3WIAA 3OMNB 1WA0X 2CUAA 1ASPA 5AFAA 2IDTA 3FSAA 3S8FB 1AZCA 2ZXWB 2FJSA 3FSZA 2OV0A 5I6OA 3U25A 2HRHA 1SHXA 2DY2A 2W8CA 2FNWA 1KCBA 2XUWA 5I5JA 1PF3A 2XV3A 1GYCA 1GR7A 5B1JC 4AI7A 1X9UA 1ET8A 3AG2B 2IWFA 1IBZA 3KW7A 1ADWA 2QPEB 4YSEA 1ZDQA 3SBQA 2DWTA 3GXUB 4FA7B 6PCYA 4KO7A 4DPAX 1XB8A 3L45A 1MDAA 4BXVA 3CZUB 3AZUA 1JOIA 4K9JA 1FFTB 3AG4B 1A4BA 1DYZA 1GS6X 2Y1AA 1SF5A 1BXVA 2VSKB 5I5IA 3MBWB 1AG6A 1JZHA 3ABGA 3T71A 1AS8A 2YAHA 4KO5A 3ABKB 1AZUA 1NPJA 2XXGA 4E9YA 2IH8A 4YSRA 3X1NA 4DP9X 1OE2A 1BQKA 2YAPA 4A2FA 2IDSA 4P5SA 3OMIB 1L9RA 2CAKA 4KO6A 1KCWA 1AR1B 1PLCA 1TU2A 5PCYA 3X1FA 1W6WA 1BXAA 3QJSB 2YARA 1AS6A 2PPCA 4BXSV 2XWZA 4G71B 5F7BA 5D4HA 2GC7C 3FU9A 3T9WA 2IH9A 2VW4A 3BVDB 3D12B 2PCFA 2XU9A 3H4FA 4F2EA 2EINB 1PMYA 2YAEA 3PXLA 3NJHA 4GP8B 3WNIA 2XVBA 4N8UA 2YEVB 1SNRA 2UXGA 4GP4B 3EF4A 1JVOA 1NTDA 5TK2A 1RKRA 4G7QB 3EH5B 2JXMA 1ID2A 2H47C 3DIVA 3TU6A 4F7KA 2WSDA 1OCZB 5B1JA 3FU7B 4DP6X 3PLYA 3QJVB 1MG3C 1KGYE 4G7SB 2OJ1A 1NWPA 2XV0A 2I85A 6PAZA 2PCYA 4A2DA 4DP1X 5B1BB 2B3IA 2VW6A 2QDVA 5IY5B 3ABMB 3NSDA 4HAKA 4A2EA 4WTQA 3X1GA 4JHVA 1SDDA 1R1CA 1OE3A 1XB6A 1BQRA 4JHUA 5D4IA 3GDCA 2WO2B 1JZEA 1SFHA 1SF3A 1T5KA 3N55A 4E9VA 1A4CA 4WKXA 1GS8A 2AVFA 1KDIA 2P80D 2XX0A 5B1KA 1YLBB 2J56A 2UXFA 4CSPA 2XX1A 4N4YB 2TSAA 1JVLA 1HAWA 1I53A 1AZNA 1E30A 2I7SA 4ZK8A 4HALA 1JXGA 3SBPA 2QPDB 5I6NA 3ABLB 2DWSA 2FWLB 8PAZA 3S8GB 3OMAB 4E9TA 4YSUA 3AY2A 2PLTA 2OCCB 1J5DA 4KOBA 2E86A 3ASOB 1OCRB 2DV6A 4X4KA 2PP8A 4A2HA 3NT0A 4HHWA 2J57A 4W1TA 2BZ7A 2GBAA 3AW5A 1E67A 2MTAA 2CALA 4YSTA 3H4HA 4E9QA 2PPAA 3C75A 3NJFA 5ANHA 1UATA 5AZUA 2YXVA 4GY4A 1NDTA 3EH3B 3QQXA 1GS7A 2X87A 1HFUA 4A67A 1QNIA 2WO3B 4KO9A 1MZYA 4GP5B 1PZBA 3FU8A 1PZAA 4YVNA 2R7EA 1L9TA 3H56A 1V55B
chains in the Genus database with same CATH superfamily
4P9OA 4P9ML 4YBLB 2DDQH 2XJLA 2VM4A 3UTQA 4OIFA 4DVBA 3VD9A 2C3XA 2YIDA 1XGRA 2EEBA 1QNZL 4PIRF 4Y2DB 4AG4L 4B9PA 4BFBD 1G6RH 4PJFF 3BUYA 4WI0A 4PRIB 2BIPA 2EDFA 2Q73A 2LFSA 1JDAA 3RYIA 1RK1B 3HZKB 3LS5H 1A9BB 3IXAA 2OYKA 1HCFX 5GRZA 1IJNA 3P4NB 4POYA 5LP6C 1DQJA 4XI5C 3GJFH 2EYSB 4NNPH 5DK3A 1IQWL 3QCUH 3QDJA 4HVBA 3ZE2E 4LCIL 4KGJA 1DN0B 3NA9L 4YDNA 4D0DB 1OF0A 1BZQK 5HYSG 3L9EA 3U30B 4DUXA 3K6IA 5EV7A 5IJBC 2JJSA 2AITA 4HD5A 1Q1JL 2YRBA 4NGHL 5KYWB 2G60H 2NLJC 1NBZB 4JFOB 3RP1A 5JPMB 5D7KE 1HSAB 4M7LT 1HNYA 1TJGH 4JG0L 4HPYL 1SOXA 4JDEA 2Z92B 1W72L 4LLAA 4TSCL 4ZI7B 2XQBH 4ELKB 3JWNE 3US1A 2QLYA 5KVFL 3W7XA 1PDKA 2DEWX 5DR5L 2NSQA 5GHWL 3WJMA 2QWQB 5A7BA 3ZKND 1FF5A 1QX1A 4OZFH 4C83A 5FDWA 2D7PA 3PJLA 5JYLA 4LEEA 4UCOA 3VGAC 2K70A 4LOFA 4R3SA 4FZ1A 1I1FB 1FIGL 4A7TA 3HG2A 1TQWA 2BVQA 5D1QB 3ZMTA 2B5UA 1MDTA 2Q7AA 2UUDK 1KIRA 3SDXB 2VXQL 1G6RB 2OZ4L 4M7LL 4MKTA 5CU9A 3U0PA 3TJHC 4QYAA 4CZZA 1X59A 1RZJH 3W11C 5AG2A 2AMUA 4X6BB 4FQ1H 1YEEL 3NQIA 3O45A 2UUBB 1CE6B 3OKKB 4R97C 4TXVB 3RT3C 3DO4A 5KBNC 5LYJA 3GJFB 5I19H 3MRRA 1G9MC 1E2WA 4R2GC 4NKGB 2J8UA 4OTXH 3ZMRA 4N6QA 2YPVA 4F1ZA 2JB6A 1FNLA 2XWBA 4CN1A 1A3RH 4R96B 4P05A 5GTHZ 2BSKB 2XQYG 1M05A 1GO3F 1FL6A 4JUTA 1TTFA 1WC7B 3DGGB 2D0HA 4U1HA 3QFJB 1ZT7B 1KBWA 2CGRL 1AB3A 2XVGA 5DSCB 5IYZB 2ICWJ 2K6YA 5AD0B 5INCB 3VXPB 3VGEA 4UOW1 4XO3A 2BS71 2BP5M 4E9XA 5A2IH 3QZPA 2QFRA 1R5WB 4P3WA 5AKSA 4TRPH 4G82A 1R47A 2WWNA 4IBTA 4X62B 4P48A 1Z7JA 4C7UA 1GY1A 3LPWA 3THOA 5G2NA 3QG7L 3DETD 4YDVA 1CC3A 3EUUA 3ZBMA 4OZFB 5EF0A 1QSFD 2D9CA 1E5YA 4D94A 1JVMA 5JCOA 2ZNIA 1A6UL 2ZOOA 3BAXA 4FFVD 4KU1A 4HLEA 1T0NA 4LF8B 1I1AB 5IFJA 1I31A 4LP4A 4ELMA 2BSEA 3RILA 2H6UA 4XOBA 4CMHB 3GMPB 3R8BB 3JSLA 1OE1A 1SJXA 1AE6H 3WUWG 1DQVA 1KJ2H 4XPFH 25C8L 3G5VA 3ZSSA 4UXNA 3D50A 3V5HB 3KLKA 2VDKL 2OXGB 1FFNA 3CLEH 4PBVC 5C07D 4GW1B 3M1CA 5ANMB 3QIUA 4DV6B 4KMLB 1WAEA 3D07A 3QDMB 5KX5A 3CX2A 1LEKB 4GSUA 4KK6D 5GRUL 2A6JA 4OZGA 4X80H 5KOMC 4AKQA 1AROP 5D6CB 5DRZB 3CDGA 5BPPA 4MMZB 4NAQA 1US6A 4YXKH 3FRUB 1A25A 4X6DF 3A2FA 3R19A 1A1OA 5AW6B 4OGYL 3E2HB 3RHWK 1TFHA 4DQOH 3F05A 5E8NA 2CIIA 2RB8A 4PGJA 3N44B 3LSOB 1DO5A 3FUMA 3CPUA 5I18L 1K5NB 2YXWA 4WF9V 4HCIA 3V4VL 3UBXG 1JCHA 2ZR3A 2VXSL 5EIBD 1JBJA 3FFCD 4DOHB 1J5HA 4IRJB 2LVCA 3PV7A 3AK2A 1NANH 4XBPA 1XD0A 1BAFH 3FT0A 4QKXB 1NCDH 3RU8H 5C9JA 1A7QL 4AWJC 4QRRA 4W6XB 4H8VA 1BF2A 3POCA 1M9SA 4K2UH 3B34A 1KJ2B 2H2SD 5H94B 3X12B 3WY1A 3GSNL 3RVTD 1S4IA 1TJIH 3FQNA 3D0AA 3KYAA 5F9AC 4K8RC 1R75A 3D18B 1P4LB 3WJLA 3DTXB 3NFPB 3STZB 3KPLA 1D5BB 2P49B 2F23A 4HS3B 5F93C 2WNXA 4LWSA 4AMXA 3P9MA 1QSEB 3MRCB 4L4TA 2ZG1A 2LR4A 3EGXB 2DQDL 4GAYA 2X6UA 3Q1SL 4WIQA 4D9QE 2Y07H 1PM9A 1IFGA 1XGPA 3ROOB 3TJPA 3S3DB 1ZLWK 4G6FD 1PY9A 2KERA 3QYCA 3SDCB 4EFEA 2AJYL 4CSTA 3C12A 1NFDA 1U3JA 3BD4A 3VFOB 2NTFA 4N0UA 1RPOA 4LP8A 2B9AA 5DFAA 1VGEL 5ICXA 4BUQA 2Y69C 1QZNA 4UFZA 1MJ8H 4KKCD 4AK1A 2ZIDA 2BTQB 1P1ZB 4AQ1A 3IJHA 1YECH 5DVOA 4Z1PA 3VXRB 5TF0A 2RNBA 1PY0A 3MRBA 4NCC1 4AGOA 3S5ZA 3RWDB 4EI5B 1DN2A 1TVBB 3VWKA 3V7AG 4FADA 3B2UC 4XAWH 2CBTA 3O6KL 3KL5A 1ULVA 3OZ9H 3TCLA 4N2HA 5SX5H 4BZ1H 1MHEA 4KVCH 4KTYA 3IJ7A 3HKDB 1E9OB 3L3GA 3DX0A 2Z31C 3AU1B 4JJ5B 4KXBA 3ZDZF 1QR9A 3ML8A 1N68A 1OSEA 4LIQL 1DVFD 2H45A 3O4LD 3VQVA 2XT1B 2IAMC 4I1RA 4YL9A 4XVUD 1JXDA 2L3BA 3KW8A 3S48A 4YDJB 3GDBA 3I2CH 5E4OA 1DUZA 1B6UA 5HI3D 5JLZB 3VGDA 4FFBA 1U93A 5DF0A 1Z9MA 5HFMA 1TTUA 1HSBA 2NOYA 3SPGA 3PIQB 5J56B 2YXYA 1KN4H 1T20A 3C6LA 4J1UB 4LQ1A 5GGTH 4LVEA 1DJHA 3X14A 1T1ZA 5IJCC 5LCVH 5C0GA 4QHLA 1H15B 1WT5A 2AJUH 2WA4A 2R15A 4LSPL 4X0NA 1ZVYA 3EF7A 1I7TB 3MBEB 3EJQA 4ZBMA 2VWJA 3Q8AA 4ORGA 1QO3B 4UB8Z 1M1XB 1A1NA 2XWJA 3FN0L 3ZJAA 4KNTA 3W56A 2WAHA 4F9LA 4XC3H 4YJ3B 4UNTA 3ARDC 4LNRA 4QYOB 5CGTA 3VBBA 2IJJA 1HH9B 3DKHA 4PJ6A 3BWAA 4AIEA 4AVJA 1NJIW 2HVBA 5HJDA 3FF7A 3UTSE 1P84F 2LTQB 4Y5YB 1CGSH 3Q13A 1G7MA 2B0SL 4FLRA 4NYLB 2J12B 3DURB 5JO5A 4P49A 1DBML 2LLGA 3LRMA 2IQ9L 3MKKA 1H6FA 3FQTA 1OAUH 2F9BT 3U4AA 3WEXA 5E70A 3O2VL 1TZHB 1TO5A 3N04A 4UM8B 2PW2A 4L8JA 3HRZA 4IDLA 1E4WH 2QGDA 1DVFB 2Y36H 3O4LB 4P5TD 1IC7H 4PRDA 4X42A 1PFCA 4BQBA 4ZQTA 1U33A 3GSUA 1WGVA 3VRJB 5IB2A 2FGWH 3DJZA 1I9IH 4I4TB 2FNWA 5KMGB 3N85H 1I1YB 2NYZA 3L81A 3RZCD 3EJZD 3KXFE 3E8BA 2AGJL 5F0LB 4P4RB 4B3TB 1T21B 1BD2B 1W0VB 1PG7L 3KPRE 4L4VE 3F3HA 4PJXA 3WE6B 5KS9E 4A2LA 2ADJB 2VUYA 2Q20A 4OZ4A 3C5SA 4J27A 4M48L 2OSLB 1QATA 2GQHA 5DQDL 4R0LA 4BWAA 4DPAX 5K9QG 4FM2A 1CGVA 2C9PA 2K3TA 2P48B 3CZUB 4I5BB 5F6HJ 5C09E 5GS1A 2QWPB 3E9UA 3H3PH 4YIPA 4HYTB 1EJFA 4PG9B 3K1DA 3OTTA 5E2WH 2NY0D 5CA1B 4QXUH 2GVYA 4XBEH 3QRGL 4LO9A 2NX5A 1JYNA 3EZJB 4EB6A 4RX4D 5I1AB 4U4BA 2R69A 4P5SA 2GEEA 1AMXA 1GGUA 3FC8A 1UXLA 3LDEA 1L9RA 2MHAA 2MNUA 3JQOB 4Y9FA 5J9PB 1YY8B 5C8YB 4GS7B 4AC2A 1VESA 4CNIB 3RWFB 1XGQA 4WAFA 4ATTA 4LSTH 5F2VO 1W0WA 3DUUB 5T5NF 1FL5B 3PHOA 3V5KA 3WL9A 2ICWB 2GJPA 4LRIC 4Z78A 5TQ0H 2JEXA 5I6XC 5F7BA 1CO1A 2V1DA 1GAFH 4MCYA 3JSSA 2UXCO 3RGBA 4HOWA 3J2PA 4N85A 1U3HA 4P3DA 3CCRV 4WI2A 4F7CA 4HLJA 3QZWB 3RTQC 3S3SA 1IFHH 3GMOB 4ANKA 4Z7VB 2YD8A 1CD0A 4QRSA 3MJ7B 3QO0A 4ACTA 5FS5A 2EZPA 2YEVB 1BF8A 1U9KA 1FNAA 4NCDA 1DQQB 1IXBA 5I1JL 1NTDA 1PL0A 1UFGA 4F57H 2DWEC 3VRLE 1B6QA 2H47C 5A3ID 2DW5A 3KBPA 2VKXA 4I9WE 5KVGL 1F6AA 1TENA 4Q4EA 3AC0A 4J6IA 1A64A 3CZFA 4BH7B 5T5FL 2ZM6B 1PVHA 1QLRB 4LF4O 2DKMA 2OJEB 3WNKA 2I85A 4WFFD 1QBLH 3SKOB 2O5YL 3AABA 5EC1A 2VJ0A 4DSYA 5HHXH 2HFFA 3ZHTA 1NPUA 2YHGA 4IOFC 4MNQA 3JAKB 4XZUB 5DC2A 3X1GA 1FPOA 4HBNA 5A2JH 3BVOA 5T3ZE 3THMH 4IIZA 4I0XB 4DZ8B 1BVKB 2WO2B 4JY4A 1GKFA 1JZEA 4N21A 3ZGIA 1SF3A 4PW4A 3X17A 1GS8A 1N64L 4Y4KA 1A66A 3PV6A 1L0XA 4MCMA 5B1KA 1FFQA 1U8QA 2UXFA 4OX9O 3LRGA 3OX8B 2YA2A 4XCYB 2X12A 5DS8B 1E30A 1VQ9V 5TDOA 4KDWA 1SQMA 3CRRA 4OLUL 3WAKA 1H2LA 4PTUB 4ZHQB 1QFPA 3S8GB 1CFTA 3BLPX 3TIEA 2R8SL 2NY3D 5D4QA 3BISA 1ITCA 1XTMA 2HKFH 5E8OB 4UCFA 5E2JA 2M6YA 4JHWL 2OXHA 4J2QA 3IRPX 1UACH 1EDYA 1LO5B 2A6DB 2DV6A 1OD9A 3JV4A 4LDOB 4X4KA 3LN5B 3AT0A 1ED3B 2DJSA 3GRWL 4LQFH 4WLCA 5C08B 1LE9A 2MTAA 1GZHA 2MOGA 3GMLA 3MACL 2ZOUA 5LXTB 3N2KB 2B1AL 4IK7A 4ZUVB 5KANG 4YJZL 1PG7W 4KI5D 4PJFA 3RWJA 3D85A 3F8UB 4P9PA 1MREL 4H20L 2G2RB 4KRPC 4R83A 3G6JE 2Z1KA 4M1GH 2C7FA 4OGQC 2F54B 2X87A 3M46A 2WXMA 5F1IA 2Y1YA 5I16A 1U4FA 2WO3B 5B7EA 3P0GB 3ARGC 4KUCD 5AOKA 1J8RA 5HI4D 2YA1A 1IGCL 1CFBA 5ESAA 4QTIH 4NQTA 2I9TB 2EDNA 3FT4A 4AILC 4LCUC 1K3EA 1EFQA 2YGNA 2GCYA 3AADB 1AKJA 2BDNH 1O7VA 2RMKB 1XR9A 3BH4A 3GZOA 1DVSA 1TF4A 3AQZA 1X9RA 3T6XA 2VQUA 2EADA 2QSCL 1XBRA 4TNEA 5DUBA 2KQNA 1ZLSH 2O5XL 1QUPA 3MLVH 1Q86W 5LHIA 3LD8B 4N2FA 5AB1A 3ZX1A 3T0EE 1OK0A 1YEGL 3HVDA 1YEJH 1FXHA 1FJGB 4TUUA 4OD1L 4ONFH 2PNDA 3LUTB 3BGMA 2EIZB 2I5YH 2F4VO 3QXTA 4X5QA 1QUNA 4X9YA 5DA4A 4H0LC 3HE6D 4HGWB 2C1OA 3MOBH 3P11L 3A6BL 2AEPH 3PFQA 4PB0H 1CXLA 4RISL 1BVOA 4E68A 1G7QA 5SWZD 3ZIYA 1AANA 4NQEE 2BSSA 4R7NB 4JO1H 1J9QA 4ANUA 1OLLA 3E1ZA 3VQLA 1S7XB 3VI4F 3LH8A 4GH7B 4JFDD 1KYAA 4RGNC 4FA6A 3II3A 2OTUA 1B0GB 3DUHA 3RFRA 5CINL 4UT7H 3V8OA 3ARFD 1RLWA 1MNUH 4F2ME 3EXJA 2IPUK 5FLVA 3HPLB 1IM9A 2MTPA 4U7NA 2CGYA 5DO2C 3F83A 4KH2A 5E1HB 3BHPA 1UWGL 3V0WH 4OGZA 1A4JA 3GSWA 3ZDXE 2YICA 1IFRA 1JGLL 3SY6A 4OGAD 3AEIA 2XWCA 3JARA 3MLZH 3FO2A 1NANI 2QHRL 4XRCB 1NINA 2IU0A 1VFAA 4FD0A 4EOWL 1DEEB 5DYOB 3UYRH 1WD9A 4N0RA 1JL8A 3SY0A 1AGBB 3MRJA 3N3EA 4P5KA 1C9SA 1V3MA 3QIBA 4KJQC 4KVNL 2DYRC 4MVBD 4F8PA 4IHBA 3O3BA 1Q38A 3BEHA 2GJ6B 2Z91B 2NZ9D 2RDCA 2CTQA 1N33O 3QEHA 1JFFB 2P8LB 4FJCC 3IU3A 4KKLD 1NAML 2IPKA 2QSQA 3ULSA 1KXVC 3VD5A 1WUZA 4ZYKB 4X6CF 2AK4E 2D31A 4PTTB 1QI3A 3JV6B 3MO1A 3WDHA 3EH2A 4G8GE 5I1GL 5I15L 3NTCH 1D7CA 3F84A 3PCYA 5FGBC 3W7TA 5IBUG 1PLGL 4JR9H 4M3HA 4AW7A 2BW5A 3DBSA 5EC2B 4P5MB 1EANA 2WZAA 4EZKA 4MA7L 1HEHC 5E6YA 4HQQL 2Z93A 4OFKA 3WLBB 4DVRL 5HGDA 1QWHA 3LKPA 3OL2A 3MRGA 4X6DA 4FLYA 1E27B 3U36B 3VB8A 3JT2A 4Z0BH 3ARFB 5KN5B 2B59B 3MLXH 4XN9A 5F3HB 4HKJA 2E3VA 4S1QH 1F4YH 1KGIA 4P04A 2K6WA 4I18A 2PY5A 3O11B 4RFOL 3NXSA 1OPGL 1W59A 4W9LC 3POHA 4BHUA 1XF2A 1HS6A 4HMDA 1P4RA 1DBJH 1MN4A 1TEGA 1ITBB 1X5FA 4KROC 4U1NB 4WO4C 4Z8FL 4G7YH 4L0PB 3TNNA 1XF3A 1AZBA 3GSOA 4YE4L 5HD8C 4GUOA 3T3PB 5EEZA 1FHNA 5I8CB 4DN4H 1WPCA 4LASL 2FK9A 3C60B 2WUBH 1ZUQA 3D9AL 4KAQH 2BRRH 4PCKA 2F68X 4ZQKB 2FQGA 3PP3H 1AI7A 2VW7A 1QKZL 4FQXA 4APQD 4FLWA 4YQXL 4QLRA 4ZTEA 4FFZL 4HUVB 3KGTA 1TEYA 1RIUH 2WWMC 1CIUA 4HHAB 1V7ML 1V7NL 4UQCA 2M7WA 3WELA 1IDSA 1D5MB 2OMVA 3CSBA 1QBMH 1EJ8A 3UCSC 1KXQE 3QEUB 4WJ5A 4E9SA 2VIRA 3H9SE 4M00A 1FYJA 1KXTB 3ULVD 4LKXA 5IFHL 1CF8H 4X7SH 2VQFO 4CW1A 2VLLA 2PXYA 1GK9A 1PKQA 2UY6B 3PL6B 5EU4A 2X44D 3ULVH 1A0QL 2P46B 5GZNC 3TNMA 1ZMYA 4PAZA 3WSQL 4N24A 3GS7A 1FSKB 1KPRA 3OR7C 4A55A 3F04A 3LXAA 3S3JA 3VACA 5BW7C 3GLDA 3TYFA 3NH7H 1A4AA 2ICEB 5I2IA 1KFGA 1C5BL 2HT3C 4DJMA 2J1WA 1AJ7L 1XF4A 3IETB 5DVKA 2IG2H 4NHUA 5KHJA 4NOFA 1UD4A 1BM7A 3QEQB 5CJOH 4K9EH 1PNDA 1Z32X 5JPNC 1R3KA 1Y6NR 1RZIB 2ZONA 2A4ZA 1MY5A 3U6RA 2ZCKL 4X1KB 4DF9A 3WTYA 3S5LG 2WJ5A 1PYWB 4WWPA 3JASA 3DC0A 5KYNA 4GI8A 5ABAA 4JKNA 1WP8A 4Q14A 5KVEH 4KGLA 4LSQH 3JATB 2PYEA 4WI3A 5GSRB 4XN1A 2OSYA 5CJ5A 1ZIBA 4UQ9A 1H0DB 2NY6D 5GTIZ 4AX3A 2X89A 1BECA 3SE8H 2ICWI 1O6SB 4K3DL 5ALBH 2ZD0A 1J95A 1R0AH 4NCC2 1G7JB 1EXUB 3D4CA 1CYXA 3T8XA 2NY1B 3M1OA 3SB3A 1BEYH 5HHVH 5DJ0B 3OGCB 3RBZA 2P42B 2Q67A 2VZSA 5EZJB 4AIOA 2PWHA 4NWUH 4WU7B 5B39A 5I17A 3RIFF 4RAIA 2EILC 1NCIA 4DKEL 1SVBA 4YC2C 2GJZA 3UYOD 4ZKIA 4FZ0A 3TO2A 3GSRA 1O7DE 5F7EH 3OGOE 3HRPA 1Q6IA 1QACA 3HR5A 4NRYA 4YGVA 5DD3H 4Y7MA 4YAQB 4H0HB 2X2JA 3BEWB 4LC1A 3QO5A 3D87B 4RRPG 4XB3A 1N70A 3CDFA 3QC5X 5J5EA 3K72A 3OG4B 5BXFB 3OW2U 4O2FA 4J23A 3UTQB 4JFSA 2FX7L 3LQAC 3RNKA 3EYFA 4F7PA 1TQBB 3UZEC 3IEAA 4DVBB 5D1ZA 3HE7A 1XGRB 1DVQA 5F89A 4CVUA 4KVPA 1J0JA 1KPVA 4DR6O 2QLVB 3BUYB 4PJAE 1OAJA 5IHHA 1BOGA 1VFUA 1KC5H 4MMYA 4Y16C 1A6AA 2O5ZH 3MRFA 1WZ1H 3IXAB 3UTSA 4AYFA 3IFPA 4M5YL 3UO2A 1WUNT 3NESA 4UVCA 2LOEA 1OGPA 3IFOA 3QDJB 4QHMB 1AS7A 4X9BA 2BNRA 5MEQB 4FK5C 2IIJA 2YPVH 5DZLA 5GGQL 4QOKE 4KQ3L 4ZO8A 2G0KA 3FW6A 1CXHA 3CXHF 4IHJB 4L5FL 5FC9A 2LLNA 4KKQA 3V4PL 5BUPA 1DSFH 3BJLA 3TN0C 3VFNA 2CJUL 1SUJA 1TQCB 5KUKA 4KZCA 4MB4A 4NQUA 5TFSL 2JJTA 3KHOA 3OTOB 1KXHA 3AS2A 3OMNB 2CUAA 1FFOB 4UV8A 2WZ0A 2XDHA 4GRLD 1PDKB 1J9CT 1FFXA 3WO4C 2QVFB 5T3XL 5C0RH 4O9HH 3TIDA 3WJMB 2F19H 2DY2A 1CXEA 3AM8C 4L4VA 4AENB 2BSED 4Y7OC 3UKMA 3SDDC 4G6AC 4OCRL 2ED6A 4NT6B 1YJDH 1AO7D 2BVQB 3ZL4H 5JW5A 3QWRD 4AL8L 5F7YC 35C8H 2Q87A 4U0RB 2QPEB 3W7WA 5EU3A 5DEFA 3VH8G 3U0PB 5C09A 2HFEA 2JXMB 5AW1B 2CMRH 4NKIH 4GX1A 4RUEA 3E7JA 3PPEA 1P6AB 5GISH 3U2IA 4Q4IA 1CE1H 4FM0A 5LYJB 3QORC 4JFED 4IGBC 3QUYA 2W60B 1NGPL 1A14H 1N36B 4NAMA 2JB6B 1LP9F 4UINL 4XPAL 2X4QB 5LGTA 3OB8A 2RCVA 3S3PA 1DQLH 1DQMH 5IJVA 2UUBO 4H40A 2QQQA 3Q5TA 1M05B 2AMGA 3FSOA 4U1HB 1XMQB 2V9UA 4OJFL 1TQVA 2X38A 5TE4L 5I5IA 5BQDA 1AS8A 2FEDC 2YAHA 2ZKWA 5FM5M 7TAAA 4CVZA 1EDQA 4O02L 1G84A 5JVDA 1X44A 5D6DA 3X1NA 1OE2A 5A6MA 5D71H 2AF2A 4E42B 4KMQA 4PV1C 5K9JL 1AHWA 2A2QT 1G43A 5GS0C 3ULUD 4UV7L 4LVNC 3AGVA 1MZFA 4K0KB 1HOEA 3QUHA 2Z65C 3O6FC 4XO4A 3T1YB 3U48A 1ZANL 4MVSA 4JREC 4I1NB 3TT3L 2A73A 3T4AC 3CK0H 5LVEA 1T0NB 5K5YA 4X62O 3BVDB 3VGFA 2ZOLA 1HNGA 4NBXB 5E1AA 5FKAA 4ELMB 1FE8H 1GH6A 3HS8A 2K7QA 1OTUD 3FQUB 3BVWA 3P2DA 4YXHL 2CO3A 1QLFA 3G5VB 3U9PL 5IK3A 3DOIA 4I9WA 5CLYA 2L8AA 2K8MA 4LF8O 1FFNB 2WXQA 5K93A 4DR3B 2UXGA 3QIUB 1Z1WA 4NQCD 2X0VA 4KKPA 5E08L 4RWHA 1XEUA 5HJ3B 1I82A 3MJ9L 4JO4L 1IMHC 4IGGA 4BFOA 1JWMA 1FD9A 4TPRH 5J11C 5EWIL 4U0QB 4DV6O 3O2WL 4UT6A 2P47B 2DYPA 3E2EA 1A1OB 2WYHA 1HW7A 1RHHA 5DHMC 1ZOXA 1D9KA 4HK0A 2W0XA 4XPBH 5E8NB 3ABMB 4RQEA 4EI0A 3BAYA 2CIIB 1YDXA 5I8EA 2ZT9B 3H1IH 1MPAH 2QELA 4N2NA 4JHVA 4TOYL 3TPUA 1M4UA 5KYYA 5JW4R 1KEGL 4HLZH 3GSVB 3MTXA 1D5XA 5JOPE 4YLCA 3KEHA 1IAIH 1PNKA 5J2TB 3GD1C 4QAMB 1MFMA 4HT1H 4IEFA 4MZ2A 2MW2B 1UEMA 2XX1A 3MNMA 4LNUB 2BPBA 3DSNA 3GBDA 3GMMA 2E4TA 4JI8B 4XBPB 3HNVL 4DGYL 5DFVC 1XMWA 1ZY9A 1JNNH 4QRRB 3HZMB 2CK0H 3MAQA 1WZKA 1IO4C 4DRXA 4Y5VB 3OSVA 3UMTA 4XCNB 4IS6A 3GPSA 1C5CH 3FQNB 1B2WH 3LH2H 2OCCB 3AACA 5AYUL 3KPLB 3KPQB 4JGMA 4WI7A 4C54A 3RY6A 4UCRA 3ZT7A 4B08A 4LWSB 3G6JA 1UA7A 3AITA 3P9MB 2R70A 4L4TB 2B5IC 1CD8A 2Q9LA 3QPQD 5HXMA 1BZ9A 1XGPB 4CGTA 3MUUA 4XMPH 4D7SA 2VLKB 4YBLC 4LE8A 2OW6A 3FFQA 1NFDB 1E5AA 4Y2DC 2NTFB 4N0UB 3OB0H 3T2PA 3O65A 3WFCH 5ICXB 2K0RA 1T04A 3WXVH 1CDIA 1VACA 3FU8A 5B4MC 1I9RL 4AW4A 4N3UA 1BCCH 4X9FA 3MRBB 3X3GL 1QWUA 1FWXA 1NFIA 3N1FC 3QULA 4PJHE 3RKPA 5C6TL 3MA7A 2EBOA 3VWKB 5IVOA 1N59B 3LN9A 3T0EA 4LFHD 4PGBA 1NMBH 4K7FA 5LHGA 5L8LB 4KKBC 1J9SA 1MHEB 2VT0A 2ADGA 5KAQG 1BQHB 3ARXA 3U30C 1VQLV 5FYKL 4U49A 3FBKA 2R39A 2FMLA 4JI1B 4QPEA 1UD6A 5JPMC 1X4TA 2VLME 3GSXA 4NRZA 2WVUA 2IW5A 4XAKD 1DSYA 3MYJA 1MEXL 1VF5B 1J1OH 5DHXB 1G7LA 2BNQE 4R9HA 3K5LA 3V6FA 3I6LE 2Q7YA 3FTUA 2ZE5A 4ALAL 5GGSA 2CHWA 4M7JH 5LGNA 4C4KT 4CH4A 4DW0A 3HHMA 4IU2A 4D8OA 1OZTG 4QT5A 3A24A 2QDWA 3ILQD 4FFBB 1MF2H 1MH5A 1U93B 3LKSB 1OO2A 4PCYA 4WWKB 4UQBA 4Z77A 4NQEA 1HSBB 1FFPA 3B1UA 3CB2A 2MIZA 2Y72A 3MPCA 2CGOA 4UQ2A 1T20B 3C6LB 4GKNA 2JKWA 1OD7A 5ACLA 3X14B 2OL3L 5F7FA 2HB0A 5D1QC 4QHLB 4NIKB 4JV5B 4PFEA 4F2MA 4ORGB 3VX0A 4YSAA 4BKLB 5IT2H 3GF8A 4OQTL 4ZW8A 1A1NB 2XWJB 2V6HA 1SQGA 2QADD 1CL7H 4W4OA 4I8DA 3H6AA 4LNRB 4HWEH 5IFAH 1K6QH 2M1KA 3BWAB 2R83A 4ODHL 1AVMA 3ZE0F 4K3JH 3BSHA 5TD4A 5B22A 3OWRA 4WUKH 4K8XA 3D8MA 3T2NH 4X6CA 1YJ9V 4HJTA 3H2WA 3QQ9D 3ZYOA 2WLMA 1G7MB 4Y4HA 3NIFB 3GXNA 2BY2A 3DV4A 3IDYB 5KJ7E 2Q7HA 4TS6A 1IARB 3EJCA 3QQNA 4U05A 1EN5A 3LRHA 3WEXB 5KBPA 3J7AU 1K34A 5L3CA 1J8HE 4E5XA 3DX8A 1LO2H 2R69H 5H4YA 2PW2B 1OP5K 1VKXA 3HRZB 2P06A 4WBNB 4B9IA 2WKGA 2XWEA 4N2DA 2WLZA 1YNLH 3P3RA 3FO1A 3GSUB 3QR0A 4G8GA 3F7VA 4NC1C 3V52H 5C3IA 5IB2B 5BOZG 4HPOL 1T0OA 3MODL 2J88H 5EORL 4ODTL 2X42A 3IMTA 2ZOKA 2O5NA 4KHPO 1Z9NA 1I1AC 3P77B 4H25A 3EYQC 2BW4A 5D1XE 2I26N 2DEXX 4L3CB 3D3VE 2C5DC 2AEQL 2LT9A 2ZPKL 4ZDHA 4PJXB 4CMHC 5GGRA 2X05A 1JZIA 5BV7L 3MVSA 1ROPA 1RZJC 2FO4A 2DIBA 4OZ4B 3C5SB 2XOTA 4ZPTA 2BWDA 3N41F 4B3TO 3DDGA 4U7OA 2ZWSA 2DOCA 4JY5L 1PV0A 4R0LB 3NYKA 1ZHKA 2HMID 2BXZA 4QXGL 4R4FH 5GS1B 2EE9A 1P7QD 3QXWA 4MMZC 4L1BA 3A0HZ 4MNQD 3EAKA 1UYWH 2Q7GA 3NJXA 1JHTB 3E6FA 4P2QB 2BH0A 3E2HC 4JDZA 4IBUA 2NX5B 3WDIA 1R5VA 4MJHA 4ERSH 2BJMH 4MA1B 3LNEA 2V37A 4Z7NF 2OMTA 3IFNL 1YCIA 4U1GB 4EF3A 2QTEA 5J4MA 4H13B 1E6OL 4L8BA 3X3FH 3HG3A 2HLAA 4B95C 4AT6B 1UB6A 2GIYA 3VVVA 1RXLA 4HUKB 3CWGA 4NKOB 5EOCL 1W0WB 4IRJC 1S5HA 4Z0XA 5IQ9A 3V5KB 3PHOB 4D3CH 3H9ZA 1KXQA 4OLXH 5DT1H 4PW3A 3H9SA 1P9MC 3QJUB 4ELDA 4M62L 4J3OD 3FS9A 2AABL 1GGYA 3EJPA 3ETSA 1TYEB 1U3HB 2A79B 2BCKA 2O6DA 2ZCHL 4P3DB 5BZWA 3ZE1F 2AFNA 3WB1A 3DNKA 3T6VA 2YQ3A 4NYKA 1OAKH 4YSSA 1JJ2U 1W91A 2Z1PA 3QO0B 4QRSB 5HDQH 1RUML 2W81C 5IMOA 3STZC 1NA8A 4CN4A 1FRGH 3TZVD 4MFHA 4U6VH 4Y1AB 4QF1A 4YHLL 1TCMA 4CS4A 3MX0A 5GONA 3D85D 2UZIH 2EICA 2IM9A 1F6AB 1WFTA 4Z7WE 5HHOD 1FA4A 1OSZA 3QNFA 2V7QG 1ICTA 1UD2A 2Y9RT 3CZFB 4J3BA 2QM7A 4X1IB 4KK6C 5TGBA 3S37L 3CSTA 4DR2B 3CIAA 5FB8A 5EC1B 3SDCC 4G8FA 1T0PB 1RZPA 4J4PA 4MNQB 3GWOA 3K0WA 5A2QN 4FLHA 3EJUA 4MCZA 4TWKA 2Z64C 4M7ZC 4L8SB 4GJTB 1G4MA 2ZM6O 2X53A 4JTDB 2RTTA 3KDMB 1AKJD 4UILH 4B9KC 3S97C 4DW1A 4JY4B 2MKLC 2NW3A 2DJ4A 3N1PC 2A3TA 3TV3H 4TUKH 5I0XA 2C3GA 3KLSA 4Y4KB 3PV6B 5F70A 3RVWC 2Z3YA 2I69A 3MXVL 1U8QB 4JFXA 1QHOA 3VG9B 4WO0A 4I88A 4EI5C 4WCEV 5DDHA 3G5ZB 4AHCA 3G5WA 4N8CL 3GGWA 4ONGH 4CS3A 4FNRA 5A16B 2W9DH 4JRLA 2CO2A 2UX6A 1CFTB 5D7KD 1J8SA 1WA2X 1BZOA 2ORBH 3TIEB 2JJ2G 1E9QB 4X4XA 5IJ9A 4ODBD 4G8IA 3L6FA 5ICYA 1N6QH 2OXHB 4W9IC 1K85A 1SBSH 2BP8A 4RDQG 3MV8A 3JV4B 1CGYA 2L7QA 4I48A 3LZRA 4NHCL 1JUFB 3MRQA 3GMLB 3BKML 3WFDH 4PJFB 3UDWA 1S5LZ 1HAUA 1EGJA 1XBLA 2EVHA 1I8LC 4H4NA 4OJYA 3E0GA 1NFAA 2EJRA 4HWBL 4I0PA 3DXAD 1NZRA 4H8UA 4KDTC 4BBWA 3MBEC 2C3HA 3DYOA 5B5EZ 1DJZA 4HGKC 3FQ1A 3SDAA 5I16B 3GBMH 3PAZA 3LVEA 2ALAA 3WNOA 1GGCH 1HCYA 2KUTA 4LEXL 3HG1E 3W3BA 1A8ZA 3NCBB 5ESAB 1IM9D 3SE3A 1A1MA 2DIAA 4PJAA 1KEML 2DQUH 4LB8A 4WJKB 1XMEB 3EFFA 1AGDA 3FCUB 3ISWA 3HA0A 2AXHA 3HMXL 5DEZA 1XR9B 3HKCA 2BCCH 2UUCB 3E8UL 3F7LA 3PJSA 4YWGL 3LN4A 2Q6WA 3NAAH 4Y5YC 3ZE2B 1A02N 1ZV5A 3FYIB 2HRGA 4O2CA 3WBDA 4QOKA 3A0OA 4HOZA 5LQBH 5FM5O 2J1YA 1ZLDA 3WTTA 3PXJA 2ZINA 2KQMA 4L1DA 4GBXA 1XOUA 3QIBD 3T0VA 2QPFA 3KGSA 3KL0A 3TWCH 2XFGB 3ZEDA 4XBFA 1MCEA 3GI9H 1WCBA 4OZFG 1DVFC 3MRMA 3BGMB 2HRLA 3L74H 1A21A 1QUNB 4XVUC 3T5WA 1SA0A 2RD0A 3RVZA 2C1OB 2PTTB 3G08B 4XXWA 1S2EA 4R8WL 4JCMA 4E0RA 4PVLA 3T8MA 5EU6B 3DO3A 1CZ8H 1G7QB 3QIWA 5GW7A 3MNWA 1IGML 4K3HA 3RGVD 3VA2C 4EKXA 1N26A 1E9PA 2GV9A 2QFPA 2BSSB 4X98A 5T1JA 2X6BA 3OPZH 1EBPA 2DQFA 4EZMA 1VRSA 1JPGA 4MTXA 3H42H 2C8NA 1WB7A 3ZZQA 2OWOA 1JD9A 2CUIA 4JI7B 2N56A 2OTUB 2XUWA 4EUPA 5GGTL 2WBKA 2X6VA 1VQPV 3DC5A 1X9UA 2JELH 3AG2B 2DJUA 2RCSH 4UQ3A 3QUMA 5KAFZ 3ZIMA 2IANE 4HAFA 4DETA 2P67A 4X88A 4LHUA 1WZMA 2WNWA 3I3BA 2Q8AL 5DK2A 3VUAA 2IGLA 3IB4A 1A4JB 1YIJV 3GSWB 1IAII 4FPPA 1AXTH 2R9AA 3ENEA 2YUWA 3TA3A 3JARB 3L45A 3SJAC 1E7UA 4TV8A 1VFAB 4IU3B 1UH3A 2WBWB 2QVMA 3JAWA 1MCHA 1JHKH 4DO5A 2X4OB 4PLJD 3RA7H 3DBXA 1CGXA 3DMMB 1SXAA 2CO7B 3D8CA 3QIBB 1GOFA 1UGNA 1E5BA 4LVOB 3UAJD 4GS7C 1IAIM 4HZAA 3ABGA 4MXVE 3WFEL 3O3BB 2EC8A 1OT2A 2DPKA 2BSCA 3QYMA 3QEHB 3SOTA 4LCWE 2IPKB 3ULSB 1THAA 2R0ZL 3MO1B 4H2AA 1MLCA 5DJXA 5GJTH 1MHPH 1F3RB 2A7WA 5PCYA 4JI2B 3ZO9A 4QNPE 2PXYD 3NACL 3OHXA 1D2PA 1T7YA 3N85L 5D93B 3HOGA 5IIEA 5M94B 4PI2A 1CN4A 4FG6D 4JPIA 2Z93B 3FJTA 3H3BC 4PGZA 5LA6A 1XQ4A 2F58H 5HGDB 4KX9A 3CPLB 4MSWA 1EHLH 3LKPB 3MRGB 4X6DB 5DMKA 3ZKMD 4A5UB 4BW5A 4LSSH 1R3IL 3EBHA 3ZRXA 5AOZA 2DRUA 1FNHA 2WWKO 4AH2B 3W39A 4HKJB 1IILE 4D9QD 4PIBA 4F7MA 4UVAA 1VQ8V 5DM6V 1ZT4B 4I18B 4B3VA 5IW6B 2QA4V 1JVOA 2F1MA 5AAPA 1ID2A 4S1RH 3K9AA 2I27N 1AI4A 4QRPE 4PB9L 4PU2A 3TNNB 5EF3A 3GSOB 1U0QA 4GCZA 4JFTA 3LHPH 4PLKC 3CQFA 1OAQL 4KQ4H 2ZR2A 2YC1A 3K03A 2OJ1A 4KZ0A 1WG3A 1KTRL 3OC8A 1IL1A 2LU7A 4WTZA 5F0JB 3RFZA 2B20A 2JNZA 3P40A 2XA8L 4FQXB 3UC2A 3F5WC 2AQ2A 2QSAA 4N87A 5J1AB 2Q5ZA 3SIKA 5FPRA 4JO5A 2X89D 2QGEA 4K0OA 1B0RA 1UWEL 2WO4A 3KYKL 3N55A 2DQEL 3QISA 5JORB 1HWHB 1JRHH 4PH8A 2AVFA 2CH7B 5AG8A 3Q8CA 1K9TA 2VIRB 4QIWF 2J4WL 3JVGC 3BP5A 4KUZH 4LKXB 4JPVL 1MWOA 4CW1B 2XAGA 4O4YH 1EEZA 1UKTA 2I7SA 2PXYB 4XOEA 5I8KH 4OI8A 1PKQB 3U6XS 1QI5A 5I6NA 4UB0L 4GO9A 3TNMB 1T4KA 2YK1L 4AQOA 3OMAB 2D3OW 4HYOA 2CKBA 3DPDA 2EKJA 4JFPA 1CL7I 1JMXA 3BUTA 4IRZL 1CK0L 3WEAA 3FCSA 4W4LA 4M8UA 3ILPA 3MHSC 1CDGA 4GXVL 4ZOLA 4IMKA 4O2EB 4URTB 1OHHG 1FIEA 2VNCA 3LKQA 4IJTA 5EO9A 3BRDA 5KG9A 4LOVA 5IQ7L 1JFQH 4BELD 4AYBA 5I2IB 3CX5J 3GHEL 2R29L 1JWUA 1G0DA 2J73A 4FZ8L 4NQDE 4W9JC 3QUZA 1XF4B 1QYGL 3ZN1A 4NHUB 4CUCA 1JPXA 3APCA 4YEFA 1DBKH 5D1ZD 3IDMB 1KC8W 2XKNA 3ESVF 4JHAH 2YSUB 3TVMB 1R3KB 1RIVH 4GRWF 4I3SL 4U1SA 4GQPH 3ZDZB 1I7ZA 3EFDL 4FM1A 1F4WL 1P5VB 2ZSVA 4MQTB 2VR7A 3UTSD 2KB1A 3DK2A 4JVUA 4PJHA 5KVGE 3HG4A 4ODSL 3NUKA 3AXHA 1EIBA 3VD2A 2PYEB 4HF5L 2R7EA 4GMTH 3H56A 3O3DA 4FQ2L 3LD8C 5KOVC 2H0PA 2H0FA 5A40E 3H7BB 4OBSA 4G9DA 4LPVA 5CUSH 2AAVA 1DGSA 2XQYK 4AKOA 4HX1B 2EEFA 3T8XB 4TVPE 3ZYJA 3SJVE 4IRSA 1MWAA 4MXQD 4NZFA 1S8DA 5I74B 1ZS8A 2QV4A 1N12A 2NUTA 4ZBJA 4NZRH 5B39B 4MYWB 5I17B 1JMKC 2G3XA 3KPOA 4V1DE 3AT8A 2YIBD 3QXAB 3KXFD 1E90A 5JIKA 3EHBB 1WIPA 3LIZA 4QHUA 5IYBO 4YBHA 3KPRD 1HKLH 3SE4C 4BQCA 1EZVH 2X88A 3WTUA 3HR5B 2HUHA 1DEDA 4NRYB 1L1FA 2DYSC 4YGVB 1KJVA 3QVAA 3N43F 4NDMA 4KKRA 1U3ZA 5HSFA 3U4BL 2WKOA 3N2GA 4HS8L 1T80A 3JD1A 4KPHH 1UUNA 3QZMA 1JDDA 2R56L 4JAMA 5TE6L 1JK9B 2GC4C 2A9ML 2ADIB 5C09D 2KKWA 3UGUA 4F7PB 3HPLC 3EYFB 3L72H 4ZD3L 4HFUH 3HE7B 5DZVA 1KTBA 5F89B 3UEZA 2CUMA 4AVHA 1EHXA 1KPVB 3PUCA 3NCWA 1WA1X 4HXAL 4Z3EA 4FFKA 1NC4B 3T0WA 1BOGB 3QUYD 4A7GA 4MMYB 1PD3A 1A6AB 1T2QL 3HC3H 3MRFB 2VERN 3T2LA 3VD4A 3MJ8A 5FYKU 2ZKOA 4OFPA 4AQYB 3IGFA 1INDH 2OIEA 2B9BA 3JAMN 4LVHB 3IFOB 2HT4D 4HJGA 1RLBA 2NY4D 2BNRB 3TJEL 1OQXA 5GS2D 1ZLZA 1UCBH 3AK3A 2P28B 4XNMA 1N18A 5E1IA 2A83B 5DEGB 3BYTA 1N9PA 4MW8A 4G6ML 4R90L 1KIQA 4FX5A 5K1XA 3N42F 3WMQA 3VFNB 3NZ8A 1T2XA 3L3OA 2Q0AA 3NBNA 5DD0H 1OM3H 4I55A 3CAFA 2FO8A 1Q9KA 1T89C 4Z7OF 4H8PA 4ZS6D 3QZWG 2VMFA 3ETDA 2I60H 5KWYC 2ITEA 1FFXB 2I9LB 1HP8A 5D1XA 4HIHA 3ME0B 3KCYA 3D3VA 5EC2C 1MNNA 5FUOL 5TJWK 4L4VB 3TH4T 1M2VA 3UC0H 1LK2A 3OTOO 4PMFA 4WUUD 1EN6A 1I3RA 1SHSA 3P54A 3QWNA 5I1CH 4LDEB 2BSRA 5JW5B 4PA4A 4I9WD 3ARFC 1NCCH 3CIQA 4B5ZA 1HILA 1JTTA 1W72A 3N2JA 1E4JA 2HH0L 4YEEA 5DEFB 1TFPA 5EU3B 4DTGH 2JLLA 2ED7A 4GYBA 4AQAB 4EXKA 1YCSA 2JGDA 3IGAB 5IVXF 3I6KB 1XT5A 1H2KA 4K71B 4PS8A 3MA9L 1AOHA 4EZJA 4TSBL 5CGBA 4DN3H 3GIZL 4PY8J 4TSFG 2NLJA 1N8ZB 4YSCA 4BCYA 3PGDA 4MVOA 3AJ7A 1H3PL 2B8OT 4D0CA 2ZDIA 1OGAE 2CJTA 2J25A 2ZJSL 4UIMA 1TR7A 3UJJL 2W9EL 1KN2L 1BXUA 3IDUA 3L4UA 5I71B 4WCYL 4CH5A 1NCBL 4WEBH 3C60C 4UT6H 2OZ4A 2ZOTA 5E5LA 5T3ZH 1DQKA 4Q9RL 1FPTH 4CVZB 4MVRA 2FT7A 1N36O 1DZBA 1CI5A 1HNWB 3LRSA 4LU5L 1MQKL 2NZ9C 3S2CA 4PLOB 3LEYL 5CCKH 5IR1A 4TSAH 4XMUA 5DVMA 1FZKB 4KKLC 4PWKA 1HNZB 4RQQA 1T7WA 1CDCA 3NGBB 2A73B 1AG0A 5ITBH 1GRWA 4MS6A 3R8QA 3VXOB 2IOIA 4KZDH 4K0KO 1GOHA 2ZOLB 4JRYE 2FECL 4XP9L 2Q86A 3T1YO 2GIMA 4FQIL 5FHAL 43C9A 3CFEA 4U3JA 5LXGH 1CFMA 1I0HA 1FSKC 4KC3B 5IK3B 5MEOB 4F24A 2A99A 1ZSDA 3H9VA 1HQ4B 4KHTL 5C71A 1X5AA 2YD9A 3A5VA 3I50H 4JPQA 4M56A 2ICEC 3C5ZD 4X4ME 2ZUQB 3BRGC 1B04A 3SGIA 1YJWV 1GPOL 3EIFA 2QV2A 4OLVH 5B38B 3SE9H 3EO1A 3UJIH 5I6KA 3HKBA 3FK3A 4ODXB 3KYOA 5E9DE 1MCPL 3ASNB 1ZAUA 1FO0L 3SCMA 4JDVA 3OHMB 2DYPB 3D25A 4CL7A 4MAUH 1RHHB 4XXCC 4HG4J 3EYUH 1D9KB 3CXDL 1LWJA 1TGOA 4HK0B 5H8DA 1HX0A 5MI0B 4FQPA 2JI3A 3TPUB 5KYYB 1NBVL 1HHKA 1R4XA 1YEIL 1YMME 5F7UA 3CCQV 3L95A 3MLSL 2W0FC 5CJXC 3UABA 4DN4L 1A7NL 5I73B 2ALWA 1P7GA 3NABH 3QZOA 4MZIA 1QRNB 2AJ3B 3T0ED 1KCVL 1P4IL 2WXGA 1Q3EA 4IEFB 1ZPLA 4FS0A 1OCWL 2YAQA 3KHQA 1NEZG 3L2LA 4X65B 5CBEA 3TP4A 1WB8A 3GMMB 4AJYV 2NY1C 5I1KH 3KWWB 4ZUUA 5GGVH 3ULVC 3RYFA 4FLZA 2X0LA 3OGCC 3VXUB 3L7EA 1JGVL 4YLBA 4IS6B 3UTTE 3V4VA 4KJWC 4G7RB 5E1GA 1CFQA 4S0TD 3UAFA 4JI8O 3WNPA 3OKMB 4GXFA 1RVFH 1R3JB 1FAIH 2IQAA 3UPRA 5ILTH 1DVTA 1OTTC 3DK0A 4NQED 3OAZK 4O51A 1GOGA 4XWGL 4WKZA 1K8DA 5C7ZA 3AFLA 2GB2A 3VXSD 2BOCC 2EIMB 3FB8A 1BZ9B 5CN2A 1IM3B 3CDCA 5E2TH 3RYMA 1J1XL 4K9EC 1QHQA 1K7DA 1ZE3H 2MQ0A 3J8F7 4UZGA 4L3FA 4BHUI 1YYLL 2P5EE 3B7TA 3GSNA 3HG1A 2WIMA 1XIWA 1LO3L 2HVJA 2WZPD 1TQBC 3DSFH 4B7LA 5GRVK 3L08A 3VG0L 1T04B 4PRHE 2BXYA 3OKNA 1KV7A 2WXOA 2KMWA 3C5JA 4KV5F 4UYQA 3OUSA 2WBXA 4PM1A 1R3LB 3DVGA 3LZFH 5PAZA 3VFUB 1NFIB 3WTSA 1OAYH 3HIZA 1I8MA 2NY6C 4FNTA 4PGBB 2EXWD 4K7FB 2W0KA 1NCOA 3R0MA 1Q7YW 2XN0A 5EO0B 4DGIL 2ADGB 8CGTA 1WYJA 4P23A 1G6UA 5DD1L 3UTZA 4A1RA 2AV7A 4G80A 3UG4A 2ZUUA 5MP6L 3VI4B 2MCAA 4NRZB 3H1LH 1DDHA 3MYJB 5EA0L 4JNXA 1G7LB 1MAJA 2X70A 1OW0A 4UDTA 2AK4D 5CF3A 2VXVH 5JXAH 1NWOA 5GGSB 5LN4A 1KLUB 1YMHA 4NTWA 1RV6X 4IU2B 3DHJA 4TQPA 5IMKB 4XWOC 4QT5B 4BIKA 3US9A 3GKWL 1MH5B 3F62A 3D30A 4J8RB 2GY5A 3T6QC 5KYXB 4OI9A 3ESMA 4D7BA 5JNYA 3NRQA 5SWQA 4UQ2B 3TH3T 4DO6A 2JB5L 4PJDF 3O6LH 1NVPD 1YUHA 2KBGA 2VDQL 2A77L 3E83A 5ITZA 2Y4SA 1GIGH 2FJSA 1XH1A 4F2MB 3FSZA 3FCBA 3Q4HA 3V0AC 5FK9A 2L4OA 2WQVA 4HUCA 5EPMB 5CILL 4ABVA 2XV6B 4JV5O 1J0KA 2VO5A 3M17A 4K94L 2ZX6A 4TF4A 1FDLL 5AOIA 1CJYA 1D6VH 1VZGA 2XJKA 4UV4L 3CJHB 4YSEA 1S3KL 4PGDB 4X6CB 4DQAA 1JRHI 2J7LA 4M43H 4Y4HB 4WEMB 3CFCL 3DV4B 1LXMA 5JIPA 3GFUA 3FTYA 4CDGC 5JTWA 1J05A 3TXQA 1GS6X 4E5XB 1JS4A 1TNNA 2BC4B 4WSKA 5CP7A 4LCWA 2O6CA 3D51A 4QWWD 1OARL 3TL5A 1FZOB 3FO1B 4G8GB 5KSBE 3F7VB 5K59E 5JCOC 1PIFA 3WFHA 1WFNA 1JZ8A 3HKEA 4M7KL 2QEXV 3TPKA 4PRPB 2YPLE 1F1AA 5LNDA 4KZEH 4H25B 1YJDC 5C1MB 3IJYB 4LPUA 3VFRA 1G7HA 5L0QB 1S7QA 4MA8H 3H01A 4O2AA 1TU2A 4L5FE 5GGRB 3X1FA 3G6AA 1JG9A 4TQDA 4HKBA 3GTVA 2FO4B 5LG6A 4LL9A 4MLSA 1BBDH 4ZPTB 2W92A 3T3MF 3QIUC 3FT9A 3FU9A 1JXJA 5BRZB 2NCEA 4DR7B 4GMSH 2Q0OC 5EZIH 1ZHKB 5JUEL 4ABWA 4F2EA 3E35A 3APNA 1YXBA 5AB0A 3HCVA 3QDGE 4MHHI 1PMYA 2Y22A 1N67A 4LK4A 5T3XE 3HNSL 1BMFG 3O9WA 1IGIH 1AI1H 1BQLH 4W9CC 3S88H 4QRPA 2WQWA 4J4PD 3L5WA 5LBSL 2CTRA 3LSSA 1MCCA 2UYLB 4U3CA 3E6FB 4Z76B 4JDZB 4OUUB 5FA4B 3ABMC 1GXEA 2WSDA 2ZT9C 3HVNA 1NGXA 5E0QA 2J3SA 1IVLA 1I8KB 1M7IA 1YRKA 2J2ZA 5HDBE 2H6PA 1E4KA 2HLAB 4LLMA 1UB6B 1XNRB 1WAPA 2VW6A 4BZ2H 5T1DL 4DKFH 1S5HB 5IQ9B 4YBQC 3DOSB 3K5SA 1ADQL 4WTQA 5FO2A 2HTLC 3H9SB 3SOBL 3K58A 1R1CA 4UU9A 4LCYB 4G3YH 3CS5A 2A74B 1RMFL 1WQVT 5BZWB 2UY7A 3W2DH 4MVZA 1CDUA 3P0VH 3SQOH 1MCOH 1MCBA 3OAYH 1K8IB 4AMWA 4N2CA 3ZHVA 5IB3A 5IMOB 3TLRA 3WJLC 2OCCC 4PDLA 2BOBB 4JRWA 1E3FA 5K9KA 4QF1B 2QZQA 3DX6A 1L7IH 4X50A 5DLML 1RUPH 2CBOA 2AQQA 1ZTXH 2C9AA 2YIHA 1OSZB 1MI5E 1IVSA 3AMKA 3UO3A 5TGBB 4NQDA 4XPTL 1CWVA 4N1HB 4Z9KB 2E5LB 5GRYA 1EGJH 1EEYB 1KPUB 1Y1UA 1YN7A 1RHFA 2ROYA 1S9YB 2OBGA 3FNKA 4TV3A 5GSVA 1ZV9A 4G8FB 1JD7A 4UBDC 2Z0AA 4XPGL 3L4ZA 3KZ8A 3KWUA 3IDJA 2NT1A 4MCZB 4D7TA 4PD4F 1UM6L 3WN5A 4DR2O 1GHFL 2Y7QA 3J07A 4RDBA 4G8EB 1MFDH 3SO3B 2PYLA 2XN9B 4AQ1C 2NW3B 3KVPA 4E41D 2ADQB 5T5FA 4IIJB 3VWKC 3CSYA 3D34A 4M8QB 3F12A 2K8QA 4QXVA 4GBXD 1YYCA 3P73A 3TBTB 4LFAB 4IOIA 5H35A 6FABH 1DJIA 5IYCO 3D6GA 1KMIZ 3ZKSD 4UV9A 5E0FA 1F2QA 5IJ9B 1VF5C 4X4XB 4G8IB 2JVUA 2Q8BH 8FABB 4HXBL 3G67A 4MTFA 4V1DA 4DZBA 3VFMA 1SXZA 1DBBL 1GY2A 2F93B 4GPVA 4K15A 3PWJB 3MV8B 2AGAA 4YJ2A 2YAFA 3QPXL 1XILA 3U10A 2P26A 5E9AA 5JW3H 1G7IA 4WWKC 1RSYA 4NB7A 5DYFA 1EHKB 3QIWD 4TV9B 5DMIH 5JIQA 5L6YH 3PAVA 3C6LC 4KK5D 4KTDH 2HTKC 4UIKH 2K9UA 4S2SA 1UGKA 2P24A 3QHFH 2GHWB 3Q43A 4I0PB 1IT9H 4L3EE 2WUCL 3BMVA 1EXGA 1RK7A 3K0GA 1WT5C 2HG5A 3IDNA 2DQ6A 2JVDA 3SDAB 5IOKA 3QUXB 1FYTE 2C4FU 1ASQA 1ILSA 1CUOA 2B2XL 4R4ND 1F41A 3GRWA 4WFBV 1Q0YL 1KENL 4EUPH 3CE1A 1TVHA 2HZHA 3K0YA 4YFDB 3BQUD 4PJAB 4ZSOB 2YPKA 3QUMH 4JVWA 3DUSA 1AGDB 2ILLA 3X1BA 4OCWL 3CMEV 4WDIA 5AZEH 1I3VA 3PJSB 3LN4B 5DHVA 5FM4A 2Q6WB 1GSKA 1Q9WA 2Z7UA 2Q1EA 2FBJL 3S3CB 4QOKB 1HEJC 2I25N 3SKJL 5L3GA 3IDGA 3K80A 4ODVL 3B9KA 3IDYC 2ZXCA 1N0LA 1YNKL 3FUFA 4MCNA 5GJSH 4FP8H 4CADB 2UUCO 4MS8D 4PV8A 1FH5L 4MDJB 2VXUH 3VQXA 3CHXA 5BRQA 1WCBB 3HMWH 1A65A 2KPWA 3HRZC 4DO2A 5HI5C 3MRMB 2EVGA 3NIDF 5MEPA 4U1LA 3QEGH 1SA0B 2W88A 1UQSA 5T33H 2DQCH 5CZVL 4XP6L 2P8MA 3ILQC 5IVXA 4LESA 5IESL 3PHSA 3NFSH 4Q8BA 1JDCA 3MNWB 3QK0A 2GTWA 2AC0A 1E9PB 3MBWA 4RH4A 2IXQB 2DQFB 1BT8A 3FTXA 5EUOF 5AW4B 5FYKE 3V2AR 2EAEA 1LP9B 1DANT 1JPGB 3R06A 1BGXH 2CO6B 3UADA 2EH8L 2ZG3A 1FCCA 1HYSC 4F8QA 4Y1SA 3HR0A 2Y7SA 1MJJB 3F7KA 1MCLA 5E4IA 1KFAH 3MFFB 4R0LC 2HX7A 4CBPA 4UQ3B 3QUMB 2UXBB 3LPGA 2A9NL 3RBSA 1Q9LA 1BM3L 5GS1C 1U3NA 2CNYA 1W0KG 5DXWA 4LHUB 1RZGA 1PZ5A 1LVEA 3RWEA 3KLQA 4JI7O 1UD5A 5DK2B 2ZWZA 1OGAA 3ZK0A 3O2DL 2RN9A 3K59A 4L87A 3G5YA 3GHBH 1CXZB 1M7DA 1XSIA 2ZUTA 1FBIH 4OJAA 3TA3B 3MLYH 2I7OA 2IFFH 1RCYA 3BKYL 4IDJH 3LZPA 3JAWB 4FLTA 4MA1C 2HXAA 2V7NB 4U1GC 3MV7A 3DBXB 4H13C 1R9FA 5JOPD 2D8KA 3LYRA 4LLVB 2XACC 3KZIZ 2A38A 4NUQA 2N0KA 4GLXA 2NYYD 1CXFA 1NLDH 2QR0A 4NQSA 5D1QE 3MBXL 2XZQH 1W0JG 1DCEA 2EXYD 2KYIA 4YHOL 2JRIA 1VPOH 4RRPA 2R0LL 3P9WB 1U3HC 5IB5A 4AUJA 5DJXB 1F11A 4FYSA 2AZUA 4JRYA 5C0ND 3IWVA 4XNBA 1F8TL 3K5MA 5JIMA 2IWKA 2EE2A 1HXYA 3QG6A 5HHNA 3CLWA 3OHXB 5IIEB 1R24A 4JPIB 2J5WA 1QFWL 4YHHB 4MSWB 4YUEL 1U2HA 3QHZH 1MRFL 5L3DA 3E38A 4YNYB 1NL0L 1NAMA 3QPKA 3FQ2A 1AGCA 4GOSA 5D2LE 4X4MA 2RQ8A 4MBRA 2CKBH 3IC9A 2RR3A 3K3QA 3QFJE 1A3LH 4F7MB 5I1IL 5LDSA 1K2DA 3HNTH 1DK1A 3JWDH 1CLVA 1U8IA 4NO0D 5BR8B 4KY2A 5EC1C 1ZDSA 4LSUH 4E2OA 5E9DA 1YPZF 1WWCA 3QUZD 4PRBB 1RUKH 4G6KL 4HLZG 1ZGLA 2FTAA 1MQ8A 1MSDA 4IKLA 4GUQA 3SGEH 1KXVA 1WTLA 3AWEA 2VH5H 4Z7UF 3RWRD 1COBA 3BYYA 3PHQA 2YC1B 1CD9B 4NC1E 3TESA 5FAAA 3OG6B 1YMMA 1IL1B 2LGNA 3CSPA 4Y4KC 2L7JA 2LW3A 5I0YA 3OM3B 4DH2A 4WGVB 3VG9C 4FQJL 1MHCA 1S0VA 3WD5L 1MXGA 3FPYA 4RZCB 1C12B 3BE1L 3C5XA 4P2OA 2ZYHA 4IJ3B 3EOAA 1JZFA 4HWUA 5F88A 1H6EA 4FFYL 3UAEA 1B0RB 2P3YA 4HC1L 2EYRB 1RULH 3RVVC 1XXDC 5TQ2H 1KT2A 4AOFA 3T4DA 1U8MB 4LSRL 5TE7L 5ANME 5DWUL 4OD3H 1XD1A 1F97A 1B2YA 1MFAL 2BNQD 4IRSD 3L73H 3BJ91 3I6LD 4KXZH 5FFOA 2IH3B 3UTTA 4J41A 4GKKB 2B4CL 2IVFC 1CU4H 4XVTL 5F7WC 1M7XA 1EZJA 1E4XH 4MDIB 3CDYA 3MJWA 4L29A 1M3IA 1LDSA 1MWAH 2ZAGA 1TZIA 1UD8A 1GZHC 4FFZA 3FQYA 5CXPA 1YUKB 4ORZC 1V27A 1T4KB 2DIEA 2ZNJA 1WPXA 1V3LA 4UCUA 2CKBB 4XR8C 3FCSB 1KU9A 4HUWA 4ZOLB 1DLFL 2P80A 3L5XL 3GC3A 3KYNB 3VWJA 4AYSA 2R9IA 1OV8A 5EO9B 2FQEA 3LIZH 1JJOA 4O4JA 4U1MA 5KG9B 2G3MA 3NCCB 2QEJA 2P5EA 3B2DC 3CPWU 5KYUA 3ZSTA 1JWUB 1MW3A 2FBOJ 1G1OA 2XV2A 3K5OA 5E56A 3MLUL 4L9LA 3GM0A 3UYPB 2WAQA 4ODWA 5CB4A 4L37A 4WTWA 2H32A 4PRHA 4DOHE 3VU1A 4NC0B 1F90L 5AZ2H 4XT1C 4U1SB 3BP4A 1CPUA 2KZWA 4O58L 4LRNL 3TO4B 2ZSVB 1E42A 2XYBA 3S4SB 1MJUL 3AS3A 4LFHG 1S7TA 4PJHB 2CDGA 3SBWA 2X4PA 3IFLL 4J7JA 3QQ4B 4PHZA 2R7EB 4UOJA 1H8LA 4X7EC 3O3DB 4XTRD 3N1MC 2W38A 4KNSA 3B7RL 1ACXA 2AQRA 5ENWA 2A0LA 2HVKA 4G9DB 3OR7A 5ABZA 1J8HD 3BZFA 3T6ZA 4FABH 2O61A 4WV1A 3FOLA 3ES6B 2VC2L 3MKGA 4GKZA 1D7BA 4KK9D 4P9MH 5IW1B 3QZBA 1MWAB 2PP9A 1S8DB 4N5UA 1ZS8B 1XGZA 1QOKA 4AG4H 1QNZH 3W0WD 3BA9A 3KPOB 1L9NA 5L4FA 5DFTA 4BQ6A 5CBGA 1CVRA 5LG1A 4GT1A 1XZWA 4K5NA 4XN7A 3SKNA 5GGRY 4F15B 4PRAA 3ZZ1A 2F5BL 4QHUB 4B0MB 3D3VD 2O72A 1IQWH 1HOCB 2OSWA 4LCIH 4JQIL 3SJQC 3ZE0B 1KJVB 3NA9H 4NDMB 2ZD9A 1J86A 3WFDL 3N2GB 3DGEA 3VXRE 4S1DC 3CD6V 4XI5D 1NU1H 2CTPA 4XMZA 4LBEB 3AG2C 3VXMD 1Q1JH 1QLNA 1JQ0A 1R5IB 3JV5A 4JAMB 4IBQA 2IDTA 3FSAA 4NGHH 4Z23A 2ZXWB 1IGYA 1G7PA 2Q68A 1P0SE 4H5SB 1BJ1J 5CM1A 4JG0H 4HPYH 1Q43A 1M4KA 1GKOA 1JWSB 1KYDA 1W72H 4NFCA 4TSCH 5D72L 4ZAKA 5LB1A 4CS2A 1GGCL 5KVFH 2P5OA 1YEWA 1XTLA 5DR5H 1HH6A 1GR7A 2BNUA 3AQXA 5IG7B 3QYNA 1GC1L 1QBBA 5GHWH 4JCWA 5DJ6A 3MJ8B 4YFEA 3VMPA 4KBPA 1UEYA 1JPTL 3QUKA 5EBLA 4H7VA 3TCXA 4Q6IB 1FNEA 5C0BE 1VB9A 1ADWA 4IMLA 4Z3FA 4ZOAA 1DE4A 3ARPA 1WD8A 3K74B 1QPPA 4XNMB 4MLIA 1FIGH 4PJBF 3QCVL 1BW8A 4JTCB 3HBZA 4LVOC 1ACCA 2CK2A 3QIBC 4WY7L 1KIQB 5F7NC 2DW4A 5HDOA 2VXQH 4AQYO 2OZ4H 1UA3A 2EEXA 1OB1A 3B6SA 4LCCA 4M7LH 4XDJA 1N6UA 3L3OB 1KB5L 3FRPA 4BFFA 2P90A 1YEEH 3V95A 2FJUB 4JY6A 3M45A 4I55B 4ZNCD 2Y1AA 3N41B 4I77L 5DU7A 3FHAA 4OF0A 2V7HA 4LXFA 4ZX5A 2YPLA 3TJHD 4J42A 1R17A 1O9GA 3DVIA 3W11D 4KKAC 4LLDA 2HJFA 3K08A 4LDCA 4HIHB 5D1XB 4CC1A 2WHVA 4FHJA 3O41A 1XCTA 5D93C 4DP9X 4LLWB 3L3IA 2XA3A 5CCGE 1IBKB 3V4PA 5AW0B 1OGTA 1AP5A 2YAPA 4R2GD 2CGRH 4PCSA 1I3RB 3BGFB 3TH2T 2AP2A 2FL5B 2CLRB 3OLIA 4FI6A 1XX9C 2BSRB 5I24A 1FG2A 3UCQA 2AKRA 1HILB 3LEVL 1W72B 5JHBA 3QDGA 4Z7NB 3D3IA 3GZKA 4I18C 4AGQA 2AS5M 2JGDB 3RUGF 4PBDA 3RX7A 1YNTA 2GC7C 3QG7H 2IH9A 4BK8A 5HHPA 3ZRVA 3H0TA 5DRNA 4OF5A 5ELIA 1KG0B 1VQOV 1L9MA 3BMWA 4JL2A 1A6UH 2TRYA 3PGDB 4IBZA 4D0CB 3T1CA 3WNIA 4UIMB 4IK6A 4ZO9A 3RWGA 2XVBA 3OT7A 4ZUWA 1PX3A 4I50A 4PJ5A 1CBJA 2FYUH 4GYCB 4ZO7A 5DZPA 3ZE1B 2FD6L 1ONQA 25C8H 3C8DA 5IF0B 4Y19A 5TK2A 4PRNB 4WNJA 1OT4A 2FLBT 4FQXC 3AM8A 2VDKH 3SZ6A 3BW9A 3WMSA 4TNVK 1SZXA 4ZO6A 1BD2E 1SLVA 1ROCA 3BPCB 1A6ZA 1CP9A 5A6IA 5GRUH 3BIBX 3FB6A 1CICB 4RQQB 1UWFA 2BY1A 4U3SA 1BV8A 1HKFA 3NSDA 1HNWO 2Q0ZX 4A2EA 2XUMA 4D6TH 3QAZC 4PJ0Z 1TZGL 2PXYC 2VWEC 3BIAX 4HIXL 4JHUA 4O02A 1JK8A 3HUJE 4OGYH 2Q86B 43C9B 4BCZA 4M6NL 4C56B 4OH2A 3CFEB 4U3JB 1HNZO 4LF3B 5AW5B 2ZQMA 5FWQA 4UNIA 5I18H 1TA8A 2QBWA 4N4YB 3V4VH 2H41A 1ZSDB 1MI5A 2VXSH 2F58L 3LCYA 3US0A 4AV5A 3MI6A 1KUMA 2WQAA 4ZMXA 3NK3A 4ABMA 3SJCC 1TZOA 1Y0LB 4Z7QF 2DTML 5SV3A 3S98A 3BCFA 2XXCB 2YR3A 4BZYA 3A22A 3EO1B 3CMGA 3H6JA 1H38A 1A7QH 3HKBB 3ATAA 3HG1D 2F7RA 3KYOB 5AB9A 3QNYA 1X7QA 3ECBB 5C7XH 3NPSB 1V54C 3SCMB 4ZMTA 4JDVB 3D25B 2ATPA 4ZS7L 4D2NA 3TVMC 1R3KC 3GSNH 4XNUL 2H3OA 4AGMA 2VDKB 2GBAA 1ZHBA 3Q5YA 1ESOA 2XAJA 4OW6A 4E9QA 2WLYA 1QASA 1F6FB 3MJ9A 1HHKB 2V5YA 1Y76A 1OAZL 3L95B 3U7WL 1EA9C 4JGNA 4NB5A 1SXCA 4GW5A 4K8RD 2X1OA 3EH3B 3MRKB 1H19A 2DQDH 3U83A 4Y89A 1U8HA 1Z3GL 3Q1SH 3A4EA 2OTWB 4DCQA 1ECYA 2E56A 3NZSA 2H4EA 5CBEB 3GUFA 4XDLA 1IAOA 4ZUUB 3DWTA 4K5OA 1ZLVK 5BZDA 2AJYH 5I66B 5I74C 2QQKL 2PCPA 1BBJB 3L7EB 4I9XA 2OV0A 4H0GA 5HGAA 1VGEH 5C0JA 3HLAA 4TT3G 3V4VB 4GX2A 4X65O 1CFQB 2L6LA 4PUBL 4X7DC 3EHBC 2WLNA 2FX9L 2W0LA 1BYPA 2WP3O 5KZCB 3QARA 4LH7A 1M6OB 1YEHL 5EDSA 4L3EA 1NGQL 5FYJL 4J5VA 3O6KH 4ZX4A 2Q9OA 4P57B 1NS1A 1FGVL 4PJ8A 1AXSA 2XVLA 4LPXA 4JZGA 3SR2C 3QC6X 4RBPK 4DV5O 3CTTA 3IKKA 2PP7A 1XIWB 2HVJB 2IAND 3B2UD 4FFTA 1FJ1B 2QSVA 3IAGC 1RZKL 3HE7C 4LIQH 1L9OA 1HESA 1KYFA 4P46A 4U3FH 4KP4A 4Z18A 2QWNB 2Z31D 5F3FA 3OKNB 2LLLA 3C5JB 1E5ZA 1K73W 2YRZA 3DRQA 3NJKA 5B3SB 4QHKJ 5ID1B 1Z9LA 2IAMD 1G8MA 1AYRA 3HBPA 4LVHC 1N32O 3LDBB 1UG9A 3KH3A 3IAYA 3ZTDC 5C08E 4I2XA 2J5LB 1BJ1H 4B53A 5D7EA 1NMAL 4NENB 4XDKA 3DOHA 1QFOA 4LSPH 1AXIB 4OY9A 4P23B 2H1PL 4IW4C 3UTZB 4NLAA 1IB5A 2AJZA 2AV7B 2HJLB 4G80B 4TQHA 2V8MA 5AVYB 4N9OB 3FN0H 5C0AB 3LB6C 3KLAA 2JJTC 1DDHB 1IBGL 1TIUA 3NCEB 4LCWD 2V2TA 4UDTB 3DX4A 1JTOA 1NBYB 2X4RA 5FW7A 5JDJA 1TCRA 4RVBA 1YMHB 2BMKA 2KKQA 3K6DA 3NP3A 4MGXA 2CIKA 3JUZA 5C0CB 4TYUA 5ECGA 3ARDD 5JNYB 3MUJA 3LQZA 1NC2A 2B0SH 3HZKA 5LGJA 5SWQB 1XV8A 5JXEC 2X6AA 3DVNB 5E8PA 1DBMH 4G2AA 2ED8A 1YUHB 2IQ9H 3RWCB 5LL6Y 2EYSA 1MELA 2EJ7A 3QQDA 5E7BA 3CNKA 3MR9B 3SGEI 2ZX9A 3RIKA 4ZMPA 1HZLA 3Q4HB 1A7PL 1CLZL 2WVVB 4BIOA 3O2VH 3UG3A 5FK9B 3DV6A 3ZHLA 3IGAC 1OP3K 2OTPA 1WWBX 4K71C 2HLFC 3P2BA 1TZAA 5KYWA 3GXFA 2X2IA 3T4ZA 3CC2V 2FHFA 1NBZA 2IBBA 2ZTBA 3P3YA 3QUYC 4JFOA 2Y7MA 3L4YA 3OXSB 1CYWA 4G70B 2AGJH 4MJID 5F8RC 5B21A 4I3RL 2OL3A 2Z92A 4JTAB 2FHCA 3FUDA 1KMGA 2HT4C 3CFDA 4W70A 5KBDA 2Y7LA 1PG7H 4RO2A 2NY2B 1M42A 4HHGA 4KXZI 4MX7B 3VXQA 5D6DC 1UXMA 3APOA 1H8NA 2YD3A 1E4XI 3EDKA 3TBBA 2DLFL 1AHWC 4M48H 4DPCX 1OCOB 1J05B 1X4ZA 2Y5TB 5DQDH 2HKAA 3QWOB 4L0ZA 1E40A 3Q2CA 3ERXA 4H0IA 1ZLVH 5D1QA 4EXPX 4R7XA 2XG5A 2PTVA 1P5UA 2HYMA 5DWPA 3FKSG 1ND0A 3IMWA 3NGBC 4DXWA 4TQEL 4E2LA 4NUMA 3WFHB 3HKEB 3ATFA 4GUCA 5E9NA 4M02A 5E1AC 4QRQB 4PS3A 2YJLA 3Q5OA 3QRGH 2MSPA 3CVIL 3VFRB 1VSCA 4O2AB 5I75C 4NVPA 4PPTA 3X13A 5F96L 4HKBB 1JV5A 4EJ1C 3VMNA 5INDA 2IJIA 4DW2L 5D2LA 4F80A 4YFLF 4FMKA 2AV1A 4B0MM 4G6JL 4EBQL 5C8JA 2R1YA 1GJWA 5G4NA 5AD0A 3HCVB 5INCA 4NQDD 2X4TB 5L2KD 1GMIA 1R5WA 2N59A 2H94A 1DANU 3O9WB 4F2FA 3T2OA 2Z7ZA 4QRPB 2FRGP 5IQMA 3ASNC 2GJ6E 4DR7O 4J8QA 3L5WB 1S9KC 2EDKA 2NRDA 4HZ1A 5JW4M 3Q3GA 2ZXDA 1X7SA 4MZ3A 5DC9B 5CKGA 1D9KC 3IYLW 2ITCB 1MFVA 5MI0C 2Q4PA 3E80A 1MSWD 2XZAL 2GTSA 4FLUA 3GJFK 1S78D 5DMGC 1U96A 1I1AA 1NBMG 1SFDA 2J2ZB 5I1JH 4PVBA 5IHBA 1KULA 3R7QA 2Z7YA 1HJBC 2VAAA 5KVGH 2QT6A 5EF2A 1SHWA 4W9DC 1MAML 3GINA 3V9CA 2AEIT 2YGOA 4W6YB 3V5HA 3ZS8C 2CM5A 4PWHA 5T5FH 5ANMA 5B66Z 4YL4A 4TVPD 3RYCA 3SJVD 2O5YH 4UU9B 5CGMA 5B39G 4JRXB 1AZRA 2UY7B 5D6CA 1Q8IA 4JFUA 3DIFB 4M5ZL 5HYJA 5IB3B 4LPYA 4BSWA 2LGQA 2HHHB 1OHQA 2R2HB 1R3JC 1H3VA 1VZIA 2QHLA 1RFDL 5F1SA 2OMXA 1N64H 3RY6C 3BVXA 3DX6B 5K9KB 1H3GA 4QRTB 3T3PE 5CD3A 3PG2A 4M3KB 2G5BA 5DURD 2EIMC 2JKJA 1BQUA 1NICA 4P8QA 2QJ1A 5LBVA 4OLUH 2GT9A 5MENE 1YN7B 4U31A 4I7ZB 2IH1A 1UUSA 5GSVB 3K6SB 1U42A 3TEXA 4MHHG 1OALA 5JJEB 2ZUYA 1TVKA 3VXNA 1K72A 4IRJA 4KITB 1F13A 3P3PA 4JHWH 3IDJB 2EULA 5A7EA 4JYAB 5L7XL 5AW8B 2VABB 3BFRA 4UZUA 2E5LO 1P9MA 5LAPA 2V9QA 3GRWH 4TLUA 5DUML 3MACH 4JM2F 1T3FB 1RK0A 1P7BA 1R3LC 4OSUL 4EFBA 3B5HA 2B1AH 1NGWB 2AQTA 2FYYA 4JG1L 4YO0B 4ZIBA 1MREH 1M6UA 4NBZB 1P4LA 4G72B 4H20H 4HSCX 1HXMB 1CGUA 3CU7A 5DHVH 1EBOA 5AL8A 4HS3A 3F12B 3OLDA 4KMTL 5D5MF 1SJVA 3GKZA 4OKDA 1KTKE 3MRCA 4IOIB 4QR7A 3EGXA 3RGHA 4RUFA 4OV6F 3N43B 4KRPD 1NCWL 4BA0A 4ZTOL 1MFBL 1IGCH 3I56V 2FB4L 3GM8A 1K4CB 4DZBB 3HG5A 3NR7A 4V1DB 1GCYA 3VFMB 5BVPL 4QPJA 1EZLA 3SDCA 2DMXA 4LFAO 3EADA 3ARGD 5F9OL 2UUAB 3HJ0A 1GM7A 4ZUSB 1HK6A 4KKNA 2XQ0A