3X2QB

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3x2qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x2qB02
3FT0A 2XX1A 5AZUA 2CJ3A 4A67A 4BWWA 3TASA 1KDJA 3UGEA 3AW5A 3PPSA 3ABKB 1OV8A 5AFAA 4KNTA 3QJVB 3N2JA 4W9ZA 2JXMA 4GP8B 1L9TA 3ASNB 3X2QB 2VSMB 3S8GB 2X88A 1TU2A 3HEIB 3NJLA 2GC4C 1KYAA 1CYWA 3FQ2A 2FQDA 3ABLB 1DYZA 5D4JA 3UADA 5B7FA 3S8FB 1KV7A 2GBAA 3EH3B 1L9OA 8PAZA 1PAZA 4YSEA 3NT0A 3NP3A 4NERA 4DPBX 4DPCX 1AZCA 1AAJA 1RZPA 1KCBA 2HX8A 2X87A 1SF3A 5AKRA 4KNUA 4DP1X 2GB2A 1E5ZA 2H5UA 1ET7A 2GSMB 2W88A 2UXGA 3FU7B 3NJGA 1J5CA 4AKQA 3GXUB 3AG1B 1E65A 4HZ1A 3T6ZA 1ILUA 2BWDA 4WKXA 3H4FA 2GI0A 2WO2B 2IDSA 1X9UA 4P5SA 5I5IA 4BWTA 2OCCB 1AOZA 1HAWA 2YAQA 4DP4X 4AKPA 4NB7A 2BO0A 4KO9A 2XV2A 2PLTA 3S3DB 5ANHA 2ZONA 1I53A 2YXVA 3EHBB 2PPCA 4Q89A 2XLLA 1J9SA 1ILSA 2XUWA 2BP8A 2BP0B 1GSKA 1OE3A 1M57B 4G72B 2JFCA 3IBOA 1SDDA 1BQKA 2PPEA 3QPKA 5I5MA 1PLBA 4E9RA 1A4AA 2IDQA 1T5KA 2QDVA 2R7EB 3WI9A 3X1EA 3D12B 5F7AA 4HALA 4DP9X 1AG0A 2TSAA 4GP4B 4HCFA 7PAZA 1NINA 3PAZA 2HX9A 2EINB 4K9JA 4ZK8A 1JZHA 5F7BA 7PCYA 1WA2X 3T6VA 3PCYA 3U25A 4A2DA 3NJIA 2PCYA 2IAAC 2YXWA 3V9EA 2RACA 1L9SA 4L0PB 3MX0B 5B7MA 3FPYA 2YAPA 5I6PA 3OMIB 2W8CA 1J9RA 1ASOA 4QLWA 2XXGA 4N4YB 3WNJA 1WS7A 3FSVA 3TBBA 1X9RA 2FT7A 2GIMA 2BP0A 3NJJA 1NIEA 1GS8A 3FU8A 2QPDB 3SBRA 3T9WA 2PPDA 4DPAX 4YSUA 2YAOA 1FA4A 1JERA 3V9CA 2TSBA 2XX0A 2YAMA 5I6KA 1AQ8A 3WG7B 1ZIAA 4M3HA 1YLBB 3KW8A 2FNWA 1MZYA 2FWLB 1WAEA 1JXGA 1TKWA 2H3XC 5FC9A 2ZWNA 1CYXA 4FA7B 1NWOA 3X1BA 4YSSA 2VM4A 3FSAA 1F56A 1MG3C 2HRHA 1ZIBA 4KO6A 3ZBMA 4ENZA 4A68A 2UXVA 4YSRA 4GYBA 2XU9A 1J9TA 2WSDA 1JXFA 3FYIB 1DZ0A 2A3TA 2B08A 3X1NA 1NPJA 3WIAA 2Q9OA 1OCZB 1B3IA 1SFDA 2CALA 2GC7C 3NSFA 2P80D 3TU6A 1PCSA 3S3BB 3C75A 3QJQB 2FTAA 6PAZA 2GHZA 1W6LA 4DP2X 4E9QA 3H56A 4KOBA 2IWFA 2CUAA 3IN0A 3OD3A 2CAKA 4DP0X 1ET8A 3GYRA 1CC3A 1OE1A 2OV0A 1ID2A 3X1FA 3T6WA 2BWIA 3CDZB 4YSTA 4JHVA 2PCFA 2FT6A 2HXAA 4A2GA 3PLYA 4GXFA 2EIMB 2YQBA 4AKOA 1OCOB 2WO3B 2PP8A 4TXVB 1J9QA 2IDTA 2I85A 2AFNA 4E9WA 5I6LA 4JHUA 3NJHA 4GY4A 2LLNA 2XVBA 1JZIA 1BQ5A 1VLXA 5I5JA 1NIFA 3TBCA 1ET5A 2UXTA 3UAAA 2Y1AA 1MZZA 1RKRA 1ADWA 2XXFA 1NPNA 1JZJA 1PMYA 1TEFA 2I7OA 3FSZA 3FPXA 3JT2A 5TK4A 2VW6A 3DTUB 5A7EA 2BZ7A 2XV3A 4AI7A 1AANA 3FYEB 5I6MA 4PCYA 4KNSA 4BDVB 1FWXA 2B3IA 3OM3B 1JVLA 3OMNB 3NP4A 2FQEA 1EHKB 1W6WA 2YAFA 1JZFA 3ABMB 1A4BA 1V55B 1NIDA 3FU7A 4HCGA 4YSOA 3ZX1A 2QPEB 4UANA 1OOWA 4EF3A 1E5YA 3JTBA 2EIJB 1GW0A 1GR7A 1QNIA 1FFTB 2UXFA 3QQXA 1AZBA 1AZNA 4HIPA 2HZHA 2DWTA 1N68A 3KW7A 3AZUA 4KO7A 4DP7X 2FJSA 5PCYA 1PZBA 4KOCA 3NJNA 3UABA 5B1JC 2IWEA 3BQVA 3CVCA 2VM3A 3BVDB 2XYBA 2PP9A 1V10A 2BHFA 2FT8A 4F2FA 4E9XA 3CVBA 4A66A 4X4KA 3AG3B 2AZUA 3WKQA 3WNIA 2UX7A 3T71A 3EH4B 1AG6A 3S3CB 4Q8BA 3ABGA 1KBWA 2BW5A 4G71B 1NZRA 1ASQA 3DIVA 5TK2A 3L45A 4AX3A 2NRDA 5D4HA 1W8EA 1ZV2A 3CVDA 5IY5B 3AG4B 2CCWA 5I28A 4YSCA 2DWSA 1M56B 3NYKA 1OE2A 2R7EA 4HCIA 1NIBA 3FQ1A 2DYSB 1ZPUA 5PAZA 1A65A 1AS8A 2J57A 3IE9A 2XWZA 2XV0A 1PLAA 2HRGA 2IWKA 1IBYA 3N55A 1MG2C 5B1AB 1NDTA 4BK5C 1GS7A 1IBZA 1CUOA 1PZCA 1KDIA 3ASOB 1AR1B 1J5DA 2IDFA 3CG8A 1JVOA 3H4HA 4DP8X 1HAUA 2PP7A 1IKOP 1BXVA 1XMEB 1GY1A 1RZQA 3QJSB 1AZUA 3SBPA 1TEGA 2PPAA 1JZGA 2N0MA 4UF7C 3QJTB 1A8ZA 1QLEB 3GDCA 3PXLA 2IH8A 4E9SA 3AG2B 3UAEA 1XB8A 2IH9A 1GYCA 2MTAA 2QT6A 4NAJA 1BXUA 4YSPA 4HHWA 2BP8B 2I7SA 1WA0X 1PF3A 1XB3A 1HFUA 3QJRB 4W1TA 4BXSV 1OCRB 1ETJA 4DP5X 3OQRA 1BXAA 1QHQA 2JKWA 3X1GA 1JXDA 1SDDB 1M9WA 1OCCB 3PAVA 4YVNA 3NSDA 4CSPA 1BQRA 4YVUA 5EHFA 4QKTA 3AY2A 5D4IA 3ZDWA 4YSAA 4FAAB 2VW4A 2AVFA 4E9VA 2VMJA 1A3ZA 1N70A 2YAEA 5B3SB 4UAHA 9PCYA 1KCWA 1SF5A 2IDUA 1L9RA 5B7EA 1PZAA 1SJMA 2MRYA 4HAKA 5B1BB 3EH5B 1E30A 1BEXA 4M4RB 2VN3A 3CZUB 1A4CA 5I6NA 1JOIA 4MFHA 2ZXWB 2J55A 3HB3B 1PNCA 2YARA 1AS7A 3NSYA 4HHGA 2P80A 2OJ1A 3WKPA 3TA4D 1WA1X 1EZLA 1WS8A 4KO5A 3FQYA 4YL4A 3UACA 3G5WA 1URIA 1R1CA 4AZUA 4G7SB 3CDZA 1RCYA 3IN2A 2CBPA 1KBVA 1PNDA 3ZIYA 4E9YA 5B1JA 1L9QA 1ASPA 2AANA 1IUZA 1E67A 4G70B 1SFHA 4YSQA 2DY2A 4N8UA 1SHXA 2BW4A 3FU9A 1NIAA 1V54B 1SNRA 1ZDSA 4A2HA 2QDWA 1IC0A 4PAZA 1AS6A 2J5WA 1BYOA 4DP6X 2H47C 4F2EA 4F7KA 2EILB 2AZAA 2UX6A 4A2EA 5B1KA 1KGYE 2J56A 2E86A 3SQRA 1CURA 2HX7A 4WTQA 1AZRA 2HLEB 2VSKB 2Q5BA 3QJUB 4E9TA 1L9PA 2YEVB 1GS6X 1BAWA 1OF0A 3DKHA 5E9NA 1PY0A 2ZOOA 1NICA 3FSWA 3NJFA 3SBQA 2EIKB 5LDUA 4BDVA 6PCYA 4G7RB 1JZEA 5I26A 3FS9A 3MBWB 2PPFA 3NJKA 3OMAB 1NTDA 1ZDQA 2Y69B 3IEAA 3NSCA 3PAUA 3RYMA 3T6XA 4CSZA 4RH4A 2FQFA 1PLCA 1UATA 2YAHA 3NJMA 4P5RA 4BXVA 4YSDA 2DV6A 4JKNA 2DYRB 4G7QB 4A2FA 1AIZA 2BZCA 1NWPA 1GY2A 5I6OA 1XB6A 1AACA 1MDAA 1SHWA 4BWUA 2FQGA 3ERXA 3EF4A 1BYPA 2VW7A 4GP5B
chains in the Genus database with same CATH superfamily
4JFHE 5KWYC 4YBLB 2YD1A 3EGXA 4MASA 4NNXA 3SZ6A 4WJKB 3GQFA 1JPTH 3WE1A 1QRNB 3OR6C 1BPVA 4YJ3A 4Y4HB 2NN4A 1IM9A 4PGBB 3W11D 5BV7L 5C97A 2CKBL 2E46A 4PJ9B 4R3SB 5FO8B 2PTVA 3HRZB 3FU5A 3FQWA 2WNGA 2V9RA 4N2BA 3WFEH 5DZVA 4GQPH 2J1XA 3I6LD 4HJIA 4YFDB 5BZDB 5LGYA 2O61B 4LF4O 3VCLA 1EGJH 3Q6GL 5CJOH 4ZAKA 4GRWE 3IVKA 4RWHA 4WFEA 4NT6B 3P11H 2FEJA 3DX8B 4XNDA 2BS9A 5HD8C 4XBPB 3S97C 1ZAUA 1U3NA 3NIFB 5F88B 5G55A 1NC2D 3MTXA 3WSQL 2DYPD 4NI3A 2XWJA 4JQVA 4HZ1A 4OR1A 1NUGA 3QUGA 5EU5B 1TNMA 4DCQB 3GS4A 4R6ZA 1JWMA 3JARA 5EIIB 4FJ6A 3RFZA 1KLGA 1N8ZA 3EXLA 8FABA 3GJFA 4N87A 4ZMQA 5CCKL 1GYAA 3QO5A 3MXWL 3ZRWB 4R4BB 4X5XA 3IS1X 1EJOL 5DJ8A 1D6EB 2HKAA 2OCCB 4BWTA 1JGEB 32C2B 3QFDA 4GXUM 1D6VL 1AOZA 3G5ZB 3JWOC 4X80H 1UWXK 3CH1B 4JZOA 3AITA 4UUJB 5K9JL 5KVEL 4KROC 4CC1A 1AD0B 3C09B 2OSLA 4N0CD 1S72V 1BAGA 4YLQT 1N5YH 2RMKB 5FYJL 4OCYH 4XPGH 2EX3A 2WAHA 2P43B 1XOUA 3OWEA 1S8DB 4U7SA 3WEMA 3J2PA 3N1GC 3BKCH 1MHHA 4XWGL 3C5ZA 2YPLE 3GXMA 5L0QC 4JN1L 1IEBA 3MRQB 3RPBA 3V9FA 2D3OW 5IHWA 4QJFB 3CPLA 5JO5B 5I30L 5FXCH 2B16A 3LD8B 4DKAA 3L75H 2H26B 2NXZC 1AR4A 5ESQB 5F6HJ 3BE1L 3UGUA 2Q69A 1UH3A 3G04A 4DHLA 1R3LC 5C0CA 1P5UC 5L8JB 4G7VL 1OD9A 1BVKB 4CNIB 2PR4H 1PZ5A 3AXIA 3L5WA 3NEEA 5E6IC 1MCFA 1MZFA 2YJQA 2D2CC 1WBXA 2ITCA 1I5XA 4MJJA 4ALAL 5D96B 4CADB 1W0WB 4BCZA 1PAMA 5SX5H 3SGJA 2A06H 1WAAF 2QR4A 3FN3A 2OLDA 3SDXF 5CLWA 2CIKB 3TBTB 2B1AH 2Q76A 3GSWA 1FXKA 3WTYA 3ME0A 5I66A 1LGVA 2XWTA 5C07B 3QQ9C 3E35A 2ZD0A 4J27A 2YD5A 3MOBH 2QL1A 4GQ9H 1J8HE 1KKDA 1MFEL 3VX1A 3T4AC 4M6AA 2VDPL 1AFVH 3NTCH 2V2WA 3S36L 3ZYIA 2X9WA 3CMAV 1L6XA 1E8WA 3L4TA 3O0RH 2F61A 5CMAB 5I5RA 4JFHD 4MJ4A 3H1IH 4PA9A 1RU9L 3FQNA 4JBSA 3BCFA 1JOYA 2HJFC 3PQYE 4TT3G 1DJSA 1M1SA 4B6ZA 3HI6L 1WJZA 1MY5A 3II1A 4U6XA 4G8IA 1KWGA 4Y5YA 4H44B 5CD5D 1MFDH 1RUQH 3GXPA 1SLXA 2C26A 4JZNA 3SJVA 1I3GH 3RWJB 4N6RB 1K8AW 4D0BB 1ZIAA 5LB1A 3QWRD 4P4KD 1SKVA 2YEZB 2VL4A 2FNWA 1Z5WA 3F12A 5KYNA 4UT6L 1MCQA 2DWEB 4K8RH 1MFVA 2DM4A 2VOTA 2Z31B 4JDZB 5E4OA 1Q8IA 2DBLH 1F56A 4L4JA 2NY5L 4NZJA 4JI6O 2NOYA 3SOBL 4A68A 5CJ8A 3T8XB 5KHKA 3EOBB 2GFBB 3KWWA 3MA9L 5EBLA 2A3TA 3SR2C 2VT0A 2X2YA 4O58L 2DH3A 3LYRA 2ARHA 1LDPH 3LV3A 2BERA 5C2BL 2CBQA 3MKKA 5MEOB 2W07A 4ZT1A 1XNQB 3P9WB 2AK4E 5DJZB 2ITEA 4OX9B 1A4KB 1EWHA 4JO8A 4I55A 3CRAA 2GUYA 4LSUH 1QTYT 4WLCA 1IGTB 3SYQA 3TYFB 3BVXA 1A7OL 2WXOA 4GW4B 4ZTPH 1AR2A 5HHXH 4LCIL 3G71V 4X7EC 5EUOF 3PXJA 3FQRB 1THZA 4J8RA 1W0VB 4YL9A 2LGQA 2O6EA 2OMXB 3GMMA 4Q6KA 5AOJA 3ZN0A 1TZAA 3P1VA 4MRCA 2UXBO 2IQ9L 3I50H 5DEZA 1ZE3C 3I3BA 4P2QA 1P2CA 3UTQB 4CSSA 5DJAB 1CGWA 1VFOA 4WWKA 3TNMB 3EHBD 3HMXH 5FYJE 4DGIH 5C6PB 1INQB 2G4EA 4LCCA 1RXLA 2OMUA 4UBDD 5BVPH 3WB1A 1OAUL 5L4FA 3RB7A 5TISZ 2ADGA 2KPNA 4X20A 4Q2ZA 1CIDA 1URFA 5CIPA 3JT2A 4LSQL 5IQOA 3ARDB 3UEZA 4NM8H 4KK9D 1I8IA 2CE6A 3LEYH 4OZHB 2ZOLA 2AJ3A 2A1WH 1X4TA 3VD0A 3PV7A 3DX3A 3KGRA 4NLHA 5F97E 1T0NB 3QF7A 1OKEA 1R24A 3H3KA 1WO2A 3BRCA 4JUSA 4QRAA 4ORGB 4OZGA 5LGUA 2GUZA 2ZCKL 1CD8A 1I9EA 3DWTA 3EYOB 4L4TA 4MZ3A 3VYNA 2H32H 1TVHA 2IALA 1IBKO 1PW3A 1AZBA 2BY1A 2YPKB 4H13C 3Q2LA 1KCKA 2DWTA 4G8AC 4PVLA 1WZ1L 2LW1A 3CLEL 5T33H 4Z3GA 3KLLA 2FSDA 4OM0H 1WZAA 2XT1B 3B4SA 3CXDL 4Y4FC 4ZSOE 4K7FA 1J8HD 3CVCA 1AD9B 2KI6A 1C5BH 3OHMB 3ATBA 3VRIA 5IVXF 5JOPE 4OLUL 5AKVA 4LHQB 3GWOA 1JJOA 2JJSC 1F4MA 3FCSB 1R3JA 5KSBF 2JXMB 1B88A 1M7IA 2WN2A 3GXDA 3PQYD 3CHPA 4MX7B 4FERA 4LCYA 4JO2H 2X70A 4DN4H 1JXJA 1HWHB 3KPQB 1TJMA 4XOAA 4UV8A 1FORL 5JJEB 4X0KA 3P77B 5B1BC 5BRZB 1EXUA 4TNFA 1I8MA 1ETZA 5MP6H 3QG6B 1ZT7B 2VISA 3QUYD 3OKEA 3NYKA 2R7EA 4Y16A 1BFTA 5GS0H 4IYIA 1YO4A 3WE6B 4XNMB 1QBBA 2NR6D 2XKNB 5JR1L 5JQIB 4AVKA 1TIUA 2XHNA 4TLUA 3LQAC 2QGEA 3K46A 1S6NA 4G6FB 4S0HA 5AAWC 5EO1A 2OSXA 1RERA 2PCPB 3WUWA 5A2IH 5EU3A 5DI8B 4X64B 1NFIB 1K8IA 1XSKA 2AK4D 2TRYA 1U8NB 3PHQB 2IU3A 3QHZH 1KC5L 1Z1WA 2OCFD 3BPLC 1A25A 2P5EA 2R0KL 2CMRL 4JFEB 1L5GA 1IKOP 2FLBT 2EZPA 2QDOA 1FZOB 1AZUA 2F8IA 2FRGP 2PPAA 3F05A 4P2AA 3U4AA 2IH3C 2A73A 4KXZH 3E6FB 3QUZC 4JY6A 4BUGA 4EVNB 1TUPA 2A9AA 2WWMC 1MMMA 3JWOL 4FLVA 4JFYA 4R8WL 5E5MB 4KVNL 4LPXA 2E9GA 4CDGC 1KLFB 4YHYC 4ZS7L 4YBQC 3ZCCA 2KQNA 1MXGA 3TJEH 2GTZB 3U7WL 1FG2A 2R2EA 1US6A 4HHWA 2J6WA 1K7DA 2CR6A 2FL5B 3GMRB 2IGTA 2WM0A 2YLHA 3X1GA 5IW1A 5FYJD 1SDDB 4JCLA 1GTOA 1B6QA 2ICEB 4KK6C 5HXMA 4WIQA 4POUB 4GW5B 3VWJB 2CPUA 1DN2A 1GH6A 5LOVA 2ZG1A 5IM7B 3O3DB 3OR7B 4IOIB 1AYOA 5CA0A 1W2BU 2DJUA 4KK8D 1ZV5A 1N0JA 1SJEB 2DH2A 1RIUH 2V8LA 1SXNA 4AGPA 3K8KA 2NYKA 4UNIA 3U2SB 3GXTA 1HI6A 3B6SA 5C6WH 5IYZB 4UB8Z 2NCEA 1OV9A 5F2FA 3SCMA 1HH9A 4FZ0A 2FZ3B 5F93C 1HL5A 3VXNB 4Z0BL 3W9EA 1L7TL 4FXLA 4F80A 4JM2C 2R29L 4N21A 1FI8C 3TX4A 3H7BB 4Y1AE 3NFSH 5AG2A 4PJHE 4RNRB 4J4PC 5H4YA 2WBJA 4S1DC 5ESAB 3DUSB 3VUAA 5I6NA 4HWZA 1YYML 4YDMA 4NYKA 1G4YB 2EDFA 2PKDA 4P5MB 5EIBC 1IBLO 1BSMA 2J4WH 2JJVA 4QF1B 3ASNC 2PYEE 2WXNA 2R0ZH 1M3IA 4J3SA 2FBJL 1Z9SB 3VQLA 3TTYA 1BZ9B 5C0AA 5BO1L 3ESOA 1QO3A 3PGDB 4P48A 3MUJA 5ITFB 5IOPB 1HEHC 3JD3A 1HHHB 4YIPA 1FVCB 1PIFA 5EOTB 1AMXA 4AMWA 2DL2A 3BX7C 4MCYA 2C34A 2BNRB 2XZZA 2NPLX 4QJ3B 5B1JA 1SMDA 4MYPA 5DZPA 3L9RB 4UCOA 1OCRC 3BAIA 1E9PB 4G70B 4U1LA 1URZA 1JR9A 2D8KA 2HJKB 2VMCA 3GI9L 1OSEA 1A3RL 3ATFA 4OLYL 1JI2A 4MD5B 5EZPA 1PL3A 4FA6A 3PGFH 3MRBB 3RDTA 2E75C 1RSFA 4X4XA 4JJHA 2CHDA 2Y06L 4OF3A 5MERA 1H6UA 1NEZA 4OLWH 2ERJC 2AK1L 2G2PA 3NFPB 2VZVA 1CL7L 3BVOA 4OFIA 1BHGA 3L5JA 5TE4H 3SQRA 2YN5A 5LXTB 3LIZH 1JK9B 3MOQA 3VWKB 5IJ9A 4DV0O 3HN5A 3LKNB 4AIZB 1U3HB 2Q5BA 4W4NA 4A6YB 4OV5A 3DHMA 1QP1A 4FLXA 5D1ZI 1U6AL 3RVWC 2AEOA 1ONQB 2OR7A 1HZHL 3SBQA 3VFRA 4ZMTA 6PCYA 1H9VA 2Y6SC 4ZS6C 3ECBB 3TWCL 1T03H 1GTNA 5D1XD 4AQ8C 5LWYH 5T1LD 2YHGA 1KXHA 3RVXD 4BSVB 2L04A 2VIRA 1WG3A 2D4DA 1ULVA 5B4MC 3B8SA 3MJ9H 2A9BA 1ZLUK 3KKYA 4I48B 4CU8A 1VENA 4S0TD 5JOFB 4Z8FH 5KHGA 4U3JB 3KYMA 4FQHA 4O5LH 4D0CA 2ZXBA 4B53A 4R4ND 2XRAH 4UILL 4FK5C 3HE7A 5IFHH 1PZSA 4HZLB 4GKSB 5IP4A 1XB6A 2J6EL 1SHWA 3H9HB 1M57C 4NQDE 3ERXA 1W15A 2PGGA 4KV5F 4NZFA 4MJHA 3SE8H 1TJHH 2WZ6A 4BHUA 5FLVA 3LPWA 2WTOA 4PB0H 4NUMA 3U4BH 1ZSDB 1G1YA 1RJZA 4O4LA 3FN9A 3QH3B 4LF5B 3N5AA 5C70A 2R23B 3K7UA 1JMXA 3LKQA 1IXBA 5F7KC 3HS8A 3F7VB 4FM1A 2F5BH 1CFVH 1WNSA 4FQJH 1YECH 4ZUTA 1NGYA 3TA3C 1JGDA 1RK7A 5DHYB 1RPOA 2GBAA 4HXAH 3D18B 4ODTL 4WHDA 5E5UB 2VC2H 1YPZB 4HJ0D 3WUWG 1SYSA 1BLIA 2FEEL 4IBUA 5IB4A 5ITZA 3WIIL 5DK3A 4HGMA 4GRMA 4PG2A 3BH9B 3X3FH 1WN7A 2GB2A 4UV4L 4YXLH 2CNZA 3Q4HA 4JO1H 1ET7A 3BWUF 3M8OL 4PSRA 4X9BA 2VXSL 4X5PA 3WOVA 4TQDA 2HVKA 4U33A 4UCUA 1Z5LB 4MAYD 3H9YA 4Y1AD 4GX1A 2DLTA 3L7FB 3S96A 3MRRA 1OAZH 2UVFA 1ZLEA 2CA3A 3FQXB 3OKMA 1CE6B 2WWNA 1UT1A 1TSHA 4RGOH 3ZYJA 2IMMA 1FFOB 2BY2A 4P2RE 4H20H 5HVFB 2GJ6A 3SJCC 2WIMA 2PYED 2YRBA 3V0DA 2Y2TA 5DJCB 3OE7G 3L5XH 3RUGA 4KTDH 1IAKB 4LGSB 4GH7B 2BO0A 1NBVL 4JFFE 2VQ1B 4NDMB 1I85A 2Z91B 1F4XH 4P46A 1FNGA 4UTAL 5BRQA 4K0KO 3TN0A 3KXFE 2W0LA 1KB5A 4BH7B 4AEHL 4ICGA 4G6MH 3TPUB 4JZGA 2V9QA 2B20A 3K9SA 4KTEH 4L8JA 3ULAB 1T4WA 3IJSA 1N59A 1YTFD 4HAMA 5EC1A 2P8LB 4YO0A 3DARA 3HG0A 3TESA 4O4JA 1BQKA 2DD8H 1AXSB 1MCCA 1P7QA 5KYUB 3QG7H 1DQQB 3CN0A 1FZKA 1K3ZA 4WW1B 3QDHA 4OM1H 3QIWC 4HC1A 4HMDA 4X6DA 4DEUA 5FF6A 1U3JA 3APMA 5JVDA 4WI6A 1X3DA 4JZ2A 1YRKA 2Y9RT 3HZ3A 4JFDE 4PY7A 4Z77B 4QHNA 3TTSA 2V4LA 2CGZA 4OSUL 5JQGB 3EOTH 4FYSA 4CMMA 5FS5A 5IHBA 3S8WA 1PZDA 1LP9F 1T2XA 3MBEC 2A0LA 3G08B 2FAUA 4TV9B 1U96A 4HA1A 5F1IA 1MFBH 4EOWL 5LHDA 4NO2B 5E4EB 2FUTA 4OZIB 4F7TB 3VFPB 3BUYB 3CFEB 2L7QA 4G59C 4LZKA 5J2TB 4NIKB 4EN3A 1B0IA 2IWGA 2FJGA 1NBZB 1HXKA 4U0QB 2CD0A 1BIHA 2ZOKB 4K7PL 1CMOA 4NQDD 1NEZG 3G6AA 1M05A 3X12B 1KYOJ 1MAJA 1VRSA 4OFDA 2PW1B 5E6ZA 3V6OC 5I1HL 2WPDG 4DW2H 2X4PB 3NZ8A 4MMXB 3J80N 4ESKA 2XQBH 2X1PA 4LNRB 4YE0A 3VFUA 5IVNA 4EPSA 2ZPKL 5IVOA 4JMXA 4YSUA 3OGCC 1KACB 3OPUA 1WP7A 1UM6L 3CFKB 3QIUC 3JWNG 4KROD 2O6DA 4JFPA 1J5IA 3GSUB 3MNVB 5TE7L 2DEYX 4M5ZH 4ZPVA 5ITBL 4FI6A 4FQIL 4H0LB 1YEDA 2XWBA 4WWOA 4PA7A 3X13A 1E3FA 3IFPA 3MAWA 1UB5B 1AGEB 5DJ0A 5TPWL 4M62L 1CICA 2Y3AA 4DGYL 2JK5A 1HWYA 1NWOA 1MUJA 3FSAA 5F9WB 4KO6A 1Y18B 4L8CA 3CQFA 1FQ9C 1MEXH 2NXZD 4XDKA 3MCKA 1PY9A 1ZWIB 3V6FA 1W16A 1VCAA 5FLUA 4OGQC 4EI5B 3FFCD 5SWSA 3Q3GB 3TWYA 1M71A 1XL6A 4G8FB 2W9EH 4AHCA 2P80D 5E6ID 3ULUF 3VXRD 4PJIE 5BVJB 4N26A 4XNUL 1RUAL 4PGDB 4BFJA 5I23A 2I07A 4HS8H 2FX8L 2H2SC 1QHPA 1J1XL 4UV7L 3NCBB 3TBWB 4LDLB 4P2RD 4NQXB 1OE1A 3NMEA 1P5VA 1XZ0A 4CC4A 4IBVA 1D5NA 5J0BA 1JK8A 1PG7X 2VAAB 2D2OA 3LRHA 4K8XA 1OANA 3QQ9D 1BX2B 4M7ZC 4BHUI 3ORJA 3F7QA 5AENA 3VX0A 4GAGL 1YHQV 1QU7A 1BS3A 4JFFD 3CXFA 2DM3A 2V7HB 4L1TA 1VGEH 4YNYA 2PP8A 4YC2B 3L72H 2WXLA 3NIDB 2YWYA 1KCVL 4G8GA 4O4YH 2EZOA 3BKMH 3IDXL 3N0PB 3WNKA 2IAMA 3VAEA 2R83A 2O93L 3PHOB 4UQEA 4ISVA 2HKHL 1NBCA 3NAAL 4XN2A 4WDIB 5EBGA 2CHNA 2Y1AA 4P5TA 4BRVA 3V0AC 3R0NA 4WNSA 3RVVC 5IESH 2R39A 3GJFK 4WKZA 1S5JA 3U2JA 3ZHUA 3WY2A 3FHAA 5IQ7H 3DGGA 2ADPA 4FQQB 3L1OH 4I7ZB 1SBSL 1KPUA 3WD5H 5ICYB 3ZEDA 1A02N 4L87A 2P52A 4XMKH 1OAXH 3Q9PA 1BGYH 4D3CH 2B3IA 4MJ5B 2EQDA 1H0DB 4DRXA 3VFWB 4MNGE 2Q0OC 1Z9OA 2CRZA 3MJ8A 3GZPA 5CKGA 3VB8A 3B2DC 2V5YA 2EIJB 1JPFB 1UQSA 4W9CC 4UZSA 5C0RH 1Q9OA 3AJ7A 3FUIA 3HFFA 2VERN 2FCBA 1WYJA 3HLAB 2ZSWB 4OUOA 3T3ME 1P6AB 2XVKA 2WKLA 3ZDXE 4MQ7B 5FO7A 4MMZB 1LD9A 2Z7YA 1A6WL 1KCUL 3PE9A 3KH4A 3V5HA 1RPUA 3B56A 2TAAA 4IL6Z 3GMNB 4ILDA 4U7OA 4M6NH 5IWAB 4CH4A 4XXCA 5ANMB 1O9HA 2E6PA 4X1YA 4NQVA 1ACYL 4J3BA 2VQFO 1X7SA 1S0VA 1CFTA 3CIAA 2ZIMA 2AJUH 3L3DA 4Y4KB 3ARBA 2HJLB 1UGKA 2PF4E 4XAWH 3TBYA 3WENA 3O11B 1RULL 3RTLA 2OYQA 1NCJA 1DDTA 3EGDB 2ZIDA 3TO4A 1RZ7L 4JI3O 3FB5B 3NFNA 2X4SB 3CUPA 2DJVA 1G4RA 4MNQB 5E8PB 3L3IA 3TT3H 4JRYB 1NMBH 4LGPB 5FM4A 2NLJB 3L17A 3UC0L 1G9NC 1JHKL 3ZTDC 1QA9B 1E9QA 1JFFB 1V3MA 5HGDA 2EDTA 2NNAB 4FFZL 3CVDA 4UWQB 4PLOB 5DJYA 2NDGA 4WHTA 1SY6L 3QCUH 4XRCA 3VI3F 3QIBB 5D2LA 3HHRB 1LUWA 1JXKA 4OIIL 1CK0H 5DXWA 5GS1C 4RUFA 1JJUA 5D7HA 3TT1H 1RZFH 5EOCJ 1BD2A 5DTFA 1G9EA 5KANG 3ZKXC 5DECA 3H1LH 4XPFH 3H0TB 3K72A 1UWFA 3TURA 3BW9B 5CGMA 2P49B 4HIXL 1DUZB 1HDMB 2MJWA 3RZCB 2DJMA 1DGSA 3F7KA 3TH2T 3WS3A 1NDTA 2Y2YA 3SOTA 5AB1A 1GS7A 1F4WH 1QX1A 2WZPD 1QSED 1NKGA 1PLGL 4J3OG 1K2DA 3FHEA 3NGBB 4K5OA 4Q7DA 1JV5B 1KB9J 5D7IF 4WEBL 3BUPA 4MDRA 2BNQD 3H9SB 4TRPH 1EVTC 1JZGA 4ZW8A 5HYJD 5B8CB 4ZKIA 5LHHA 1FG9C 3IPEA 2UUAB 5KANI 5E2VH 3A0OA 3Q1SH 1OJHA 4Q6IA 2RTTA 4M56A 5DQ9A 5LAXA 4BAYA 1P6FA 2J8UF 4Y4FD 4B9ZA 2F9BT 2HG5C 1ITCA 1QVOB 1KC8W 1VQKV 3BH8A 4UIKL 5GGVL 3LSOB 4WY7H 5LXGL 1FIGL 2NNRA 3SDXB 4QNPE 4JJ5B 1G1KA 4X8JB 1VQ6V 1AGCB 1QHQA 3MFFB 3ETBF 2ZUQC 4FZ8H 5FFGA 5AB0A 4K71B 3AGWA 4AQAB 5KAIZ 2LTQB 5ICXB 4B9JA 1MJJB 2NT1A 4RISL 2Y69C 1C08A 2I32A 3CE2A 1MOEA 1LQSR 3RTQA 3KL3A 3T0BA 4GUQA 1EANA 2Y7QA 1ZLVH 3EJQA 3K71A 4FG0A 2YAEA 3FTUA 5CSZB 4UDTA 1H8EG 5F9AC 1AJNA 5ID1B 3U9PL 1XNRO 4TLSA 3W9DA 3QRGL 3AU1A 4BEIA 1WFNA 1NCAH 2EYRA 3ULVC 2VB5A 1HR0O 1OCWL 3EH5B 3HFMH 1H5BC 4YBLC 2VR8A 4QRQB 3D52A 1PU0A 5IJ0A 2YI9A 1WBZA 2VYRE 4MCNA 4MFHA 4Y4HC 4PJ9C 4FFYH 2YARA 1VF5B 2OJ1A 1WA1X 3HRZC 1EZLA 3VFNB 3AT9A 3EFDL 3QFJE 4PJGA 3KE0A 2R59A 1HHKA 1JCKA 3L3GA 1GAXA 3M07A 3QUMB 2B59A 3DA0A 4KRLB 4YWGH 3FTWA 4NWTL 4BZYA 3AROA 1GW6A 1R9FA 4F92B 5JZ7C 1JNNH 2MSPA 3GHBL 4XOCA 5DT1L 1EXGA 2CA4A 4ELKA 4MD0B 2IG2H 1U58A 3QUZD 4AQZA 2JKSA 2WWMD 2YA0A 4YHPB 1U8PB 4M7LT 2QJDA 1XMWA 3HC4H 4KKNA 2LGNA 4XCNB 4XVJL 4OFYD 5CUSH 2ZJSL 4UMSA 1CLZH 4O00A 5TFSH 4YBQD 1YEKH 2BX5A 1AS6A 3H85A 5GXBB 1SBBA 4DQAA 4QGYA 1EDQA 3WGVB 4F2EA 4IQHA 4QHLA 5DFTA 4UFZA 3ET9F 3MV8E 1TKWB 4OZGF 4A2EA 4KFMA 1SOKA 2Y1YA 5EUOB 5DZ9A 2EDEA 4DEPC 4I89A 4E9TA 4KK6D 3FCTB 4XVSL 3FB7C 4UQ2A 2F4VO 2JTDA 3THML 1NCNA 2ENSA 4L8SC 2W9DL 4BK4A 3D9AH 3RX8A 3PHAA 2XKUA 3DKHA 4BZ2H 5HPMA 5BMFL 1PY0A 4NQSB 1F90H 5IJKA 5DURD 4DF9A 4LF4B 2QR0B 5AUMA 5LQBL 2OCCC 4LMQI 4N20A 4AMKH 1OK0A 4B97A 4MSWA 5I18L 3T6XA 3QJFA 4UUJC 3NSCA 4HIHB 1E4XL 4MMYA 4P2OD 1OWWA 3OFNG 2W0KA 3C09C 3O2VH 1NGXA 1UATA 1J86A 2AGJH 5FKPB 5GGQL 1LEKA 2WUBL 2JCCF 1SZNA 3WNPA 1CGSL 3BIKA 3RX9A 1ERNA 1MH5A 4M7LL 3PREA 3G6EV 5I0XA 1CFBA 2VXVH 2ZF8A 4WEMB 2DMGA 3CMGA 4V33A 2WXFA 5EO9A 5K1NA 4X9IA 2DWDC 4J4PD 4S1DD 4KBPA 4UTBH 3T2NL 3W37A 3KYKH 3QS2A 2QVMA 2VW7A 1IGJA 3QQ4A 1L0LH 5BXZA 3FT0A 2KB1A 5EIBD 1VAHA 5BR8B 1X4ZA 2DW5A 2VGLM 5H6QA 1F4YH 1W2KT 1UH2A 3WN5C 1R33A 3K3WA 5IFJA 3ABKB 1RZGB 4JKWA 5J6GB 2DE0X 4CS3A 4HFWB 2NY3C 1AIFB 5CCJA 3N2JA 3ZRCC 4P5KB 4GP8B 3CFMA 4R7DA 3MRHA 3MQIA 4ABWA 3HEIB 4N2OA 3MO1A 3L4CA 4C54A 4EIGB 1W0JG 5F96L 1JGIA 2G2RB 4PJ8D 5D96C 4Z7NE 3EYSL 4FFKA 4L2LA 1R3HA 2ATPA 5K1PA 4J9YB 1BV8A 1YEJH 2MCPH 2R69A 3EH3B 1PEWA 3UTPE 1Z3GH 2EE6A 3C8HA 1GTFA 3I2CH 3JAWB 3O3EB 5DA4A 3HHSB 5LMNO 3CD6V 2D0FA 3EH1A 3WHE0 5IVXB 2RJZA 2OI9B 3MODH 4R84A 3OJDA 3PWVA 3JD2A 3PNWA 2GBOA 5KSBB 5I1CH 2MPAH 4L29B 5AW9B 5ID0B 3UTTA 1KTJA 3VFMB 2BP3A 2LFSA 3DO7B 5I1IL 3FAWA 4NB5A 3RGVC 4D9LH 5C86A 4IU2B 3SKUD 4PRHA 4RESB 5GS2H 5B3JF 4I50B 4Y5XA 4UM8B 4F58L 1M2VB 5K1VA 1YEGL 3FAXA 4I77L 1IQWH 2Y6SD 4ZS6D 4ZMVA 3HMWL 2IDSA 4W9IC 4ANUA 4X88A 3V4VB 4H44C 1G9MH 4QPJA 4AC4A 5ICUA 1DVSA 4OF8A 5B4MD 5E2UH 3UYPB 1VPOH 2CJSA 1DN0B 2QHLA 5JQHC 3QFJD 2VN4A 4WFHE 5DUBA 1B06A 1HOCA 5CFHA 1K3EA 3RYFB 3SPGA 3CZEA 4EDXB 3GHEH 3LEVH 2DWEC 3SYPA 4HH8A 1U9KA 2OL3H 4LAQL 4N2MA 1TTGA 2Z93B 5CEZL 5A3ID 3W5NA 3TO2A 4NKGB 5L2KB 3V6OE 5HGHA 4IBWA 4PRNB 4QPKA 2Z6FA 4LLWA 1RJLB 4JM0A 3STLA 3FNKA 4XB7A 4PBVC 1O0VA 3N85H 1OB0A 2R1WA 3PS6A 1YCSA 1MCWW 2UY6B 4K07A 5JIHA 3KLHC 1W8OA 1G9NL 4QXUL 3MV8D 3P0VH 3QYNA 2P90A 4X50A 4LASL 4F2MA 4WI8A 2AV7A 5B22A 4RA3A 5T5FL 3RILA 3TA3D 5K9QI 1Y1UA 4QRRB 4DR6O 4CC0A 4DQOH 3P3NA 1KBHA 1MKFA 2VDLL 2X0VA 4IRJD 2CJUL 2Q9LA 1ORQB 3D69B 5DJDA 5IHUL 1PP9H 3QDGE 1V8HA 5JW3H 2IPTH 3N91A 1HC1A 4DV4O 3GKZA 3W7XA 1NGWB 3EJZC 2V4DA 4YGVA 4X8GA 2CRIA 1HEJC 2GTSA 3GS0A 4PTUB 4XNQB 3IDYB 5CNHA 3BPNB 3PP3K 1GIGL 3UTZA 3AREA 5TF1L 3OKLB 4LVNB 1J9RA 2I27N 4LVOB 3TS8A 4R9HA 5DHMC 4PJBE 4X1KA 1IJNA 1E6OL 2PTTB 3FZUC 4JPVL 4B9GA 4CVXB 2Y36L 3V6ZB 4X5WA 1V3KA 4DV5O 4CVWA 4NP9A 4LEEA 4RBPH 4OBSA 5HHMB 5BUPA 1GKFA 4FMTA 4LQFL 2ADFL 2BP0A 2VLJB 2ZUSA 2OMYB 2ZOWA 5KA6A 4QHMB 1R4XA 2R51A 3G5YA 4P2YA 1L7IL 4TTDC 3T9WA 1IARB 1I1AA 5DK2A 4FHJA 1KIRA 2WP3T 2Y3NA 1JF5A 5LMUO 4WU5B 2AMUA 3VU1A 1KJMA 1YEIH 3T1YB 3LNDA 3V9CA 4ATTA 5C3LD 2Y07L 3IDJB 4X6BA 3KPMA 1NLBL 3FN0L 1KD1W 43C9A 4UYPA 5GZNC 5F3BA 1IBFA 3UPRB 2YPVH 1GZPB 5DJ2B 3L16A 1MIML 3SIKA 1FNSL 4JI7O 1HXYA 1ZGLM 3MR9B 3UTPD 1JXGA 1TMQA 4JDTL 4QRPA 4KZ0A 3VE0B 2AXGB 5IF0A 5HSFA 5KVDH 4F37K 2A77L 2J88H 4D7SA 2OCHA 4B3SB 4DV7O 1A7QH 2P5WA 4HEPA 5D4QA 1L3WA 3FYIB 1IQDB 4P30A 4R90L 2XQYK 4F37F 3QIWD 2YUZA 4AQ1A 2WVUA 3N04A 1CD9B 4FXGA 4I3RL 1CD0A 5BXFA 1QBZA 3H1ZA 4U31A 3ULVL 3F5WC 2BVPA 1EPFA 1JPSH 3C8DA 4XN5A 5ALCH 1A47A 1FZMB 3TBSB 4XDLA 3JZ7A 4QIRA 4TMPA 3P4NA 3RNKB 5L7XH 2CHWA 2E5LO 3ESNA 3GYRA 4RMQA 2KQXA 1FYTB 2CWRA 3JASA 5C0EB 2HT4C 5IMOB 1T2JA 3QQNA 3IDMA 1JHTA 2QSCH 5E94A 1U2HA 3P9LA 4JVPA 2BMKB 1KXTA 4U1KA 3ARSA 1H8NA 2IV8A 3O4LD 3BFQG 4J7KA 5SWZD 3KYNA 2ZR2A 2EDJA 4YHNB 3BAWA 1A1OA 3UTSE 4N0YL 1ED3A 4C4KO 2F0CA 3HBZA 3SJQC 1FVEB 3WXVL 5HHOD 1ZA3A 3VI4F 2Q2EB 3CFDA 1EFXD 3ZTJH 3PAYA 1S9VA 4HWBL 4OJDH 1UXSA 4A63A 1VLXA 1WFMA 2BVOB 1E8XA 2BIHA 1I8AA 4OAWB 2YOCA 4ORZC 4APQA 1WBYA 3MXVL 3P4MB 1DVYA 2JLLA 3QIUD 2Q86B 3BJLA 1Q6UA 2R9RB 3L3JA 2I7OA 5IG7B 1K4DA 3G5XB 3D4YA 3UQ8A 1I7RB 1WIOA 4LL1A 1J7VR 5DCCA 4ONOA 3RA7H 4AWJC 1U8CA 2FWOB 4PCYA 1GK9A 2M26A 4HOZA 1DF5A 1RZ8B 3OM3B 2NNCA 3T3PE 2J21A 1J5HA 3LMJL 5MEPB 4JZJA 1EHKB 3QDGD 3T0EE 1U92B 4M5YH 1INEL 2YC0A 2FJHB 2QPEB 5CU9A 1EGJL 1E5YA 4QIWF 4NKQB 4M8QB 4X7SL 1HSBA 2ADJA 2HFEA 3WL9A 1TVBA 4XZ4A 3BRGC 3POCA 2FJSA 1KQSU 4HUXB 4J28A 5CR8A 1ECYA 3T1FB 2V6HA 3O81A 3UG3A 5KVFH 1KYUA 5FO9A 5IEHB 5JCOA 3H42H 4I0KA 3PHSA 3ARPA 1S7TB 4NLAA 3V8CA 2CO3A 3IU4H 4DZBB 1H6TA 2H2SD 2FUQA 3CSTA 3QEGH 4WTXA 3T77B 2PWEA 3OR7C 5H94A 4PW4A 5DRXA 3CVBA 2E27L 3L74H 1DF4A 3WKQA 3MHSC 1XF2B 4JY5L 3S5LA 1OVZA 3OKOB 3AABA 4M5SA 2NTFB 1PJ9A 3QHFL 4FNQA 2EVGA 1N5AB 1N64L 4IJ3C 3KDMA 4U4IA 2H8PA 5LBSH 3UZQB 4OKVB 1IT9H 1HHIB 4LCWA 3ZJZA 5FUZH 3MRIB 3UZVA 3GSNL 5IQMA 4WTWA 5T1KA 1UT9A 3L45A 3E6HB 4XNZB 1T83A 4G8EA 3ISWA 2ISDA 5DMYA 1D2OA 2APBA 4OCYL 4LSVH 3RWEA 4YSCA 4FJCC 3BKCL 4PWKA 2CO6B 5F9JB 4G6KH 3D2UB 3FQ1A 4YR6A 2ZD9A 2Z5UA 2E7DA 3OXRA 1UUSA 4KTGA 5EZYB 4Z95L 5CGBA 5DEGA 4I2XA 1JRHI 3RVVD 3ZMEA 1QW9A 5HJGA 1ZVNA 3LKSA 1Z32X 4WUUA 5FM8A 2G30A 1GN4A 2EDWA 4ZOLB 3BZFA 4Z7UA 2WD0A 3INUH 2EEBA 2PR4L 3TPKA 4DUWA 1AILA 2CIIB 4GBXC 5IYCO 2WMPA 5FEBA 1G0YR 3ULVE 2XG4B 3Q8FA 1T89C 4PDRA 1EBPA 2YD7A 3CCJV 2XTSA 3LHAA 2CU9A 4DP8X 2EABA 2RB8A 1XI1A 3SBPA 1QRNE 5IMLB 2P45B 3OLDA 3QA3A 2DJ4A 5IVZB 4ZFZB 4P4RB 3REVA 3WHE1 4RDQF 3K59A 2YRLA 1LP9B 5HY9B 1IZJA 3FTGA 3SDAD 4Z7WA 4AYDC 2CGRH 3TVMA 4HP5A 1U3HC 4MQXD 4HKJA 3MV7B 4FD0A 4HEPG 3UTSD 2VLLA 5F7NC 5D1QD 5KMGA 4FN0A 4ZUWA 4P9MH 4PVNA 1JXDA 1AFVL 2Z8SA 3SB3A 4KXAA 1OCCB 4JFQA 4DGVH 5CEZD 2XAHA 1CFSA 4L1HA 2VL5B 1FDLL 4KVCL 3UG4A 5GZOC 1GYWA 2WNXA 4DFIA 1Q3EA 3ESUF 3U9UB 4Z7AA 1CFMA 5D4IA 3NIFE 3UJJH 4WWID 4H1LB 1B0GB 1YY8A 2ZQMA 1IL1A 2AVFA 2IW5A 2WNWA 5B3SB 4AYEC 1I3GL 3BN9C 2G9HA 5TGBB 3O6KH 1U8HB 1QWNA 4YDNA 2C1OB 2KT6A 4QO1A 1MW2A 1N4CA 1UTDA 4B3MO 3RYIB 2QQLH 1BZ7A 1MRFH 1PZAA 1S7SA 1R3KC 3MACL 3KNBB 4CVZA 1SJVA 1C16A 1AGBB 4OGYL 1FCGA 4ZX3A 3QDJA 4XNYH 1RIHH 1MJ7L 3SGEH 5CCHE 1ZX3A 1XGRB 4OI9A 3MLXH 4HT1L 4JPWL 3TA4D 1KSRA 1Q0YL 3RYCB 2OXHA 3NACH 1F13A 5I1LA 1KJ3L 3W7SA 2GBUA 2WC7A 3J8F7 3LIUA 3QBTB 5KTEL 5FPOA 1OW0A 5B39B 4BIOA 4L5FH 4PB9L 4KZDH 1BCCH 3DRTA 3ZOAA 5ILTL 5C0BD 2AS5M 4GX5A 1J1OL 3LXCA 2Q7NA 5E5LA 1CQYA 1MWAL 4G7YH 1DDHB 1MREH 4TNVK 3ZIYA 5TD4A 5M95B 2DQDH 3JAKA 2I5YL 5C9JA 1KULA 2AANA 2WCPA 2L4OA 2E3CA 3U0TA 1XF3A 1AHMA 4GEIA 4PSPA 3LNHA 2KQMA 3DC6A 5HHXL 5JIMA 3UAJA 2BIOA 3EGXB 3FU9A 1WUNT 1MHPH 3FUDA 1HEZA 3RN4A 5D7JA 2YUXA 1CFQA 4N22A 5D1XB 1QLNA 2GHWB 1G0XA 4Z0XA 4JO3H 2NSXA 1KEML 1F5WA 5A7BA 1A9BA 3OV6A 1FBIL 2EO7A 1KGYE 3PGCA 4A7GA 3JCZA 4MLSA 1S9XB 1V7MH 4A2MA 4Y5VC 1IAOB 3C3TA 3QZPA 3T0DA 1GS6X 1N6VA 2F5AL 4AZ8A 2HHHB 2O5ZL 3C6LB 4TUYB 2UUCO 5E9DB 4S1QL 4LWSA 2JEUA 4I4WB 2B14A 3MI6A 2XIBA 4NQEB 1D5IL 5C07E 2R2BB 3L4VA 1ZHKA 3B9KB 3RYMA 3MKGA 1GMIA 5DRZB 3OEEG 4PMEA 2E6JA 1MRCL 3S5LG 5FV1L 1LO4H 4G7QB 3OAYH 3ULVD 1FFPA 2BZCA 3HZMB 1UD5A 4ONGL 1MVUA 1RPKA 5AAPA 2I25N 3K58A 2WKOA 5FW7A 5HJBA 1EIBA 3JARB 1R5IB 1MABG 1TZHB 3OVUB 4HIIB 4L5FE 4JVUA 2XZQH 1KLGB 1QRND 3QCTH 3S34L 1IB5A 3EDKA 2AXHA 4NKDB 3GJFB 3N1QC 1DVFB 1N2RB 3IMSA 4NCC1 1MHCB 2IANA 2ZX5A 2FX7L 1ZGLA 1MVFA 1HILA 3QO1A 2ARWA 2VXUL 2JH2A 3KLAB 3PN1A 3KMDA 4XCYA 1FPTL 2WTRA 1NANH 2QQKL 2R4RH 2VMFA 4JCMA 3VXMB 1B3JA 5D2LF 4H8WL 5C09E 3M17A 1KCSL 1GM7A 5FK9A 1NM4A 1H3UA 2YQ2A 4IHOB 5I1AA 2ARJQ 1IE5A 3DBXA 3FMGH 3D06A 4K0KB 5JZ7D 4KPHL 4JAMB 5F7WC 5GJSL 5E4EC 2JB5L 2DQMA 3MRFB 4B5EA 4GG6A 3NP3A 2GK0A 4BFEA 2SODB 3OAWA 4DPBX 1N0XL 1Q4NX 4QRTA 1HYSD 2Z8VC 5F3FA 1AZCA 5HDQL 4F20A 1MCBA 5ENWA 4JO2L 3VTTA 4DN4L 2PN5A 3BKJL 4V1DB 1GOHA 5IW6B 2Q20A 5CP7B 2DMCA 5MEQB 4WV1C 3D3VA 1WPBA 4NXMB 1SN5A 2EDNA 4JHAL 5DK0B 5D72L 3R8QA 4O02L 4QRSB 4Z3TA 3VMNA 3G4SV 5DZLA 1W72B 5A1AA 1EO5A 1NM9A 5CHNA 5CEYA 4MMXC 1TR7A 4QY8B 1WBXB 4JFUA 1A6AB 4WKXA 4DTGH 1J12A 2BM3A 1A0QH 3TJHD 3HKCB 3CVIH 5IR1A 3LZLA 3GMLB 3TH4T 1BZEA 5JUEH 5L6YL 4RAVA 1KTCA 2K9UA 1NC4B 3PF2A 2ZDIC 4TYUA 1I9RH 4YY3O 3FT3B 3TZVD 1OB1B 3KVDD 5I66B 3BSHA 2G38A 3LOWA 3VI3B 2YIAA 1DUYB 2RD0A 1EEYA 2RALA 4H0LC 4NZRL 4IRSA 2CHZA 2XA8L 3ZMVA 3CX2A 5DWUL 1CDCA 3ROOA 2MQ3A 3GSQB 3IETB 5ANHA 5HVGB 1E9OA 5ACZA 3RBZA 2G60L 3IFOA 4Q89A 4OB5H 2XQ0A 5F9WC 5DLMH 3U4EA 2O72A 5LP6B 2XUWA 3JUYA 3WJJC 1XCTA 3SE9H 1G7IA 4IMLA 1ZWIC 5HHNB 3B2VH 1I8LC 3PL6B 2Y2WA 4Z76B 3DUUB 2OYMA 2D3LA 4NENA 5FNVB 2NY3D 5D7IB 1CDGA 5F7LB 3SGDH 1E90A 1XQ4A 4OZHE 4NEHB 4JZNB 3B77A 5KHJA 1W91A 5HI5C 1QPKA 1K5WA 2CBOA 1NCIA 2LVEA 1O7VA 2NZ9C 1JAEA 3C9NA 3D12B 3GZQA 5KSAC 4J3UA 3ZMTA 2J7LA 2O5YL 5ADPL 3JTTB 4HCRH 1D9KA 2J8UB 4PJGF 3BPOB 5KJ4A 3KPNA 5IWLC 2KZWA 5AEAA 5I0VA 4HS6A 1DQJB 2QVTA 5C07D 2RDCA 1CCZA 3GLZA 4A2DA 2H0FA 3I6KB 3W1ZA 2XI9A 3BEWB 5B38B 5C3IA 2MK3A 4YC2C 1WA8B 3F6IA 5ELIA 1HS6A 4LEOB 2ICWA 2V1DA 3BP7A 4EI6A 4Z1PA 3HR6A 1G6RL 5C6TH 1OPOA 3WFZA 4KKZA 5TDPB 1T6WA 3NFSL 4ODHH 5JHMA 4UM9D 5ABAA 2FT7A 3MGTA 1NAMA 4R26L 1X5IA 1MPAL 5IV2A 1FIEA 4HFUH 1EEZB 2HKFH 1XHZA 3BXNB 2YDEA 2J4WL 1GJIA 1JPGA 2XFXA 1EH9A 2W91A 4I7ZC 3WDIA 3NCFB 5I8EB 1N4XH 3AY4C 3WFBH 2UXDO 5BRZE 4S1SH 3B9VA 4L9DA 3OPZH 5C09D 3VG9B 4RWYL 2Z4QA 4J1UA 3W5MA 4S0SD 2IQAA 3V0VA 4U3SA 5C0GA 1D5AA 4JFTA 4XX1G 5EULV 4F1SA 2AAVA 2LFGA 5AOMA 5IK3B 2DL9A 2OULB 3D0LA 4C56A 2EIJC 1CR9H 3WFCH 2BRRH 1N67A 1RK0A 5A6LA 2Q68A 1U8OB 4PJ5A 1KU9A 5D6CB 5GJTH 1QSFA 6FABL 2TRHA 2NX5B 4KHXL 1TJGH 2XBDA 1IC1A 4G2KA 4X20B 3KLHD 4YDKL 1DZ0A 2A5UA 2F74B 4Q4EA 4MMZC 3RDJA 4Z7VA 3AG7A 1LEIB 3L3HA 4D8OA 5D7EA 4YDZA 2ZNWA 1CTNA 3DXAA 1SETA 4K94H 4YDIH 5D1ZB 4XB8A 3JSLA 3MBWA 3QW9A 4EI0A 3LIZL 3HVNA 4JFEE 3L70H 1FO0A 5J9PB 1FGVL 4JTAB 3PIQA 1FNAA 2X2HA 3QHTC 5D7SL 1E28B 5F1KC 5GHWH 3WDJA 5JIPA 4M6OL 2BNUB 1CT8B 4U7NA 1YN6A 4EO5A 3S37L 3LRMA 5D2NB 4L1LA 4YAQA 1UEYA 4TOYH 3Q6FB 4L3EA 4OZGB 4PJ7A 1BIIA 4HU2A 4QXTB 3EJZD 3CQPA 4BZ1A 2Y25A 1OEZW 2W6IG 1SUHA 5KW9L 1B3QA 4NOBA 2HXAA 4PREA 1OP5K 1G7LB 4LU5H 1XGQB 4PJXF 5BS0B 1TVKA 1BW8A 1LK3L 3C87A 4OJAA 4ZMXA 1G8MA 4P23D 4YUEL 3FZUD 2AVGA 5C0JA 5HFLA 2AFNA 2I85A 2ATKA 3D0VA 4AY0A 3OMZA 1MCIA 4A7SA 2JCCB 3K5MA 2OMWB 3CMOH 4UQIM 2OR8A 3HAEH 1WFOA 4TTDD 1M7IB 1R6TA 1J8KA 3GTNA 3QB7C 3K4ZA 4GFXA 2UZIH 1RP3B 3HZKA 1J0IA 3H01A 2ZKXA 3P30L 3RHWK 4XC3H 4LCYB 4O4HA 2XOKG 4JI3B 4D6TH 3BN3B 3HNVL 4K3DH 5LGJA 3FSZA 1TQTA 2W92A 1JIBA 4TOIA 2WOYA 1VF7A 3RHWF 2OFQA 3N44F 4PV9A 3LHPL 4ELMA 2F5BL 5I6MA 3NGBC 5KHHA 4DERA 4FA8A 1U21A 2CK0L 3OKDB 4ZO6A 3GINA 1YECL 1S7XB 3FT4A 1CLVA 4PJFA 2FB4L 3DMMA 3FX7A 1JZDC 5EPMB 4MXWL 1XIWB 3BZ4B 3N1PC 1D7BA 3PWPD 5JHAA 4NQCB 4O2CA 2UXFA 2VJXA 1T1ZA 2CM6A 2NYZA 3HS0A 4S1RH 1R1BA 3B2UD 2WANA 1E8ZA 1MI5E 4DP7X 3FTXA 3U0PB 5GONB 4X5LA 2JSFA 1YC8A 1IAIL 4EN2A 3WUWB 2XAQA 1GCYA 2YQ3A 2OMTB 1RLBA 4TSBL 5KYYA 2J8HA 2ESVD 4B9CA 2LTQC 2FT8A 3R66A 1FRGH 1OAZL 4ZI8A 1TETL 5FPIA 3O45B 2EXYD 3WNIA 4RGOL 5E70A 4CN4A 4H20L 2J20A 1BE3H 1X4YA 3U0WH 3FONB 2OP4L 1Q1JH 2ORBH 4TV8A 2XNDG 1HHJA 3VG0H 3MBXL 2YGVA 1ASQA 4FQ1L 1FG2B 2DQEL 4J7ZA 4MJID 4PRIB 2BXYA 3SQOH 4LBEA 3ZL4L 3E1ZA 2NRDA 4HWEH 3UAFA 2V7QG 4CS4A 1QFPA 1W8EA 3LNGA 4NUJA 4M8UA 5IW1B 5FDWA 5GGTH 3VQVA 3AS3A 2P7TB 4XPTH 5L9DH 1IC7L 4TUOA 2CM5A 1HIML 2OZ4H 4G6ML 1E5UI 2E7MA 4NZTH 4RMSA 2C9SA 2F1BA 2NZIA 1VF5C 2BSSA 2VQ4A 5CA0B 2WIIA 4F8PA 1BLNB 4GYCB 1LO0H 2J73A 1T3FA 3ARGB 3W82A 1MHEA 5B1CA 4JGUA 1UCTA 2G2NA 4IGBB 3BP4B 5DHVB 3A4FA 1HI6B 2APXA 2XV0A 4JR9L 2GPZA 3SCMB 1AO7D 1RZJH 2ZAHA 5E2TL 2VJ8A 4PJEE 1XSIA 4H25A 4WHYH 4C55A 3P2DA 3C60D 3EOTL 3S3WA 2VDKL 3U6RB 5T8IA 5K59E 1P4IH 1G6VK 1Q9KA 1Y76A 2EDBA 1MFBL 3VJ6A 3CFBA 2XV6B 1JWUA 2OTUA 3JALB 4OJFH 2R1YB 3MUHL 1K33A 1HXMA 1WD8A 2RBLA 2V37A 4FYRA 2ZQKA 4P3CH 4U1IB 4DK0A 2WA3A 3AADB 4JMNA 1AYRA 4KJPC 4NO0A 1DR9A 1MA1A 4LF9B 3AG2B 1T20A 4UDUA 3D34A 2A6KB 1BXUA 4PRPB 1HJBC 2BP8B 3JBG7 3V4PA 1FNFA 4N8PA 1NMAL 3P3TA 3MLTA 5GPRA 3ZGHA 3QJZA 4BGLA 4DK5A 4L18A 1WFJA 5EBWC 3Q8BA 1YPZE 4L3AA 4BCYA 2F7QA 4OUUB 1HOEA 4J23A 3CSBA 1KBPA 5E95B 3P3YA 4K9EC 1YC7A 2X7LB 2R0LL 1O5PA 5E5RB 4DW2L 3G9VA 2OSWA 3JYCA 1GMEA 2XQBL 5EHFA 1XR8A 1XX9C 3P3SA 2A74A 2RCSL 3QWRA 4CKVX 3TXSA 1KLUB 1NMCC 2YUVA 4W9DC 2PR9A 2I9TB 5EORL 2NQDA 3GRGA 1NC2B 3O41A 3Q43A 4FS0A 4MJ6A 1JNLH 1ZLSL 2DYPB 3WAJA 4AEEA 5DSCB 3DI2B 3IU3B 1OOAA 3TFBA 1CZ8L 2F4VB 3LQMA 2ED9A 4UQ3B 3UZEA 1A3LH 4XVTL 1J18A 4ECNA 5D71H 3ABKC 1VERA 4LEXH 4J6RL 12E8L 1BJ1H 5EUKA 1MJ8H 4HHGA 5ICZB 2Z34A 2ZR3A 5D5MF 1MI5D 2P9RA 5ADOH 1L3NA 4O9HL 5K9KB 5GSVB 4P57A 3LKOB 1ADQH 1NGQH 1XR9A 1MQKH 4D0CB 5EEZA 5DMIL 1JVMA 2J1WA 4GBXD 3VNYA 4X9FA 2R9HD 3AQYA 4N86A 4MVOA 3MROA 4ANWA 1RCYA 1KBVA 4W6XB 5AG9A 1ZK5A 5D6DA 2QWOB 4J41A 4HS8L 1DTOA 1RZKH 1E67A 3HG4A 1A6UH 5TDOA 3HUJA 3RZWA 4PJIF 2OI9C 1EO8H 4M1DH 1QFUH 4OCXH 4A2LA 1JTTA 2CG9X 1WB7A 2AXJA 1BYOA 3LKQB 3QNXB 43CAA 1U3HD 4AXWB 1SXCA 1NS1A 5CZVH 3RVTC 3OW2U 2YPLA 1TLKA 3O9WD 4O2EB 5CLTA 2E47A 1I7ZA 1FP5A 3MLSL 3UBFA 5K9OB 1IKNC 1QACA 3EW3B 3RL2B 5FHAH 4X6EB 3J7AU 8CGTA 1SLUA 4G11A 3BAEL 3LS4H 1P84J 5GZOD 1P4LA 4OZIE 1MFAL 3HZYA 1SYSB 1I7UB 1BXXA 2BVQA 4BW5A 3K5LA 1U0QA 1Y07A 2LE9A 2YSSB 3UYRL 2X7RB 1ETB1 1LDSA 1NFDF 2HH0L 3ZKMC 1F11B 2NY7L 1SEBA 3VI4B 4XHQA 1H3XA 1D5ZA 1E0OB 2N7SA 1AGFB 1N7ML 5DN6G 2C9PA 3BN9D 3C5XA 4FM0A 1B4JL 1YYLH 2OCJA 2XTLA 1EJ8A 2GITB 3UP1A 3V10A 4C8XA 4XMKL 3ZHLA 5DD6A 2ETNA 2MH4A 2OBGA 3KGUA 4LPCA 1U8KB 4ICWA 3GC3A 5LYJA 1AJ7L 1D5BB 3OX8B 2VDQL 3BP5A 4I4TA 3GIVB 1L8DA 4LVHB 1I4FB 2GJ6B 5C0RL 3D0AA 5L2JB 3EO0A 1E42A 5C0DA 1HKLH 4IEFB 3RQ3A 5AFAA 5JW5B 4ZXBB 5I71C 2EDLA 1K6QH 2R1XB 1UJTA 3LDCA 4LKCA 1BYNA 3LSQA 2DQCL 2LV4A 3D25B 4P4KB 3W39A 3V0FA 3EO9H 1NR1A 2NUTB 3F84A 1ORQC 3PDDA 2EC8A 4OVUA 3N3EA 5F3HA 2HLAB 3MJ7B 2ZZUT 2YEVA 5C0IA 4FF9A 2KG7B 2NXYB 4XCCH 1K8DA 4F7PA 1N0NA 4LCUA 4LRIA 2MEJB 3QFGA 4YSEA 4XAWL 2UXNA 2XN1A 1KBGL 5LBQA 3GBMH 3DJSA 3IDYC 3BPNC 4F9PA 4LLUA 1KCRH 4GLXA 3HLKA 4XN7A 3Q2WA 1BG9A 4LVOC 2X87A 3FO9A 3A4EA 1LILA 3FB6B 4MA1C 35C8H 3L2LA 1NDMB 1SDAB 1ES0B 1F6AB 3UJIL 1GZHA 1XV8A 3EFOB 3RT3C 4G3YL 2B15A 4LIQH 1U8MB 3SBWA 4AKQA 1JMZA 5IQNA 3QXDA 4NWUH 1DQLH 4IS6A 1FV1A 4DEWA 4NRXB 1UWGH 4ZFOB 1G7PA 3H3PH 5CBEA 3JT0A 2WHVA 2WO2B 3GB7B 1VFMA 3IXAA 3TJPA 2FK9A 2EE9A 3TT1L 1S5IH 3VFVB 3HB3D 3NRQA 3SEPA 2VMEA 2AK4A 2IH1A 3A6OA 5JORA 2B4CC 2OYKA 5DQDL 3SKOA 1AGDA 3WTWA 4FKKA 4ZI7A 4NHCH 5EO0B 4OTXH 5E8NB 2HFTA 4BFOA 4NCDA 3MUUA 3SGKA 4DV5B 3EHBB 4ZD3L 5FGCB 1ILSA 3DSNB 1L0QA 3V95A 1IZKA 3CWGA 3FH5A 4HK0A 3OT7A 3RX5A 3DGEA 3VFGL 2EUWA 1PEZA 5E2VL 2PPEA 4HUVA 5I5MA 4P9OA 2QEXV 3JD4A 2ZCHH 2Q5ZA 5E2WH 3CZGA 3K6NA 5T1DL 5LMUB 1JN6B 5SV3A 1Q90D 1UWXH 4YN3A 3MD0A 3M1BB 1CP9A 1FNHA 1KUQA 1T2QL 1ZHBA 4NM4L 1FH5L 4NBYB 3WI9A 2X05A 2VSDA 3KD4A 1YNLL 1FKAO 3LRSA 3AGVA 1U95B 2XWBB 4DR5O 5AVYB 1IO4C 3AAZB 3HBPA 2QPSA 4AYGA 4BFRA 5IB5A 1GL4B 3WY1A 1O9ZA 3ELAT 2DQ6A 1IC4L 5AVRB 4AEIH 4BYHA 1WEJL 1VF6A 3ARFC 4ASUG 2PWDA 3HE6C 1KN4H 1LWRA 3NJIA 4U1JA 4MS2A 2H1PH 3HPJB 5I8CA 3EIFA 3JSNA 4H0IA 3W57A 1EM1A 2YAPA 4M5TA 1FXVA 2W8CA 4Q14A 4A7TA 1AY1L 3WTVA 2JRIA 2UY7A 5AWNL 4E41A 3FUEA 4L0YA 4UVAA 4DV6B 3KS0H 3AWEA 2Q3XA 4JHWL 2KLSA 4XO3A 5KAFZ 3LAFA 2JIZG 3HFML 4Y9CA 3DX6A 2LP7A 3ZRFC 1AVMA 5A43C 3CP1A 1T1WA 3A6CH 3QORA 4LPVA 4Y2OA 4F6RB 4MNQE 5L88L 2XPZA 4KMTH 4ZSOA 2VE6B 1B6DA 4KZEH 4IDJH 3FFDB 4BK5A 3HKDB 2WLYA 3F8UB 5E1GA 5BV7B 2PWHA 5ALBL 2LLLA 4I18A 4NUGL 2CKBB 3M7FB 2QQNH 4UVCA 2ROYA 2HA1A 3MRGA 3WLWC 3ZS8C 5EU4B 2WYZA 1VGKB 1YLBB 4AQYB 1T22A 1LO2L 2I24N 2VKWA 4ZHQA 3X14A 3ZDYF 1MCJA 4XE0A 2DIBA 3QUYB 5DRNB 3RWHB 4AE1A 1WAEA 3HMXA 1JNNL 4GI8A 4XZUA 1NUDA 1IKFH 4E2OA 4IOFC 4OCSL 5IQ9B 1UD3A 5DD5L 3CCLV 1UVQB 4ENZA 3HC4L 2UXVA 2QSVA 5CUSL 1BZKA 1G6UA 5AYUH 5C7XL 1CLZL 1PG7H 1AI7A 3O4OB 5HYSB 4N5UA 5FA3B 3X1NA 1NPJA 2JGUA 5HI5D 3ZE1F 1SJHA 3B09A 1SFDA 1WFTA 1W0KG 2CRYA 5FYKH 1VZHA 4Q74A 3ULSA 1DJHA 1PCSA 5KSAD 3SKNB 2C7UB 4Y2LA 2R2HA 2BSKB 3H9SE 1PDKA 1KTDA 2W95A 5T1LA 2CUAA 5C8JA 1I08A 3GKWH 4NFDA 2FGWL 2BK8A 1EX0A 4UB0L 1UQSB 3I85A 3GBNH 3T6WA 1RURL 1DBAH 1DQKA 2H0PA 1N36B 1OLLA 1ZA6A 4K3HA 2ALWA 3FAVB 2ITDC 1YN7A 2NT0A 3P2BA 3Q8CA 4XNZC 3QS3A 1WAAE 4KRPD 3SDXE 1IXMA 2X4UA 3KPSD 4GRLA 4QDGA 3KCXA 1LD9B 1PJWA 3R06A 3K4AA 3TGUH 3G5VB 3INOA 3AB0B 5I19L 1UPGA 2BOBC 4OPHA 1UWEL 3HBGA 1XVSA 3NJHA 4O2AA 3TBVA 1UD8A 4I3SH 1NJ9A 3WJMB 3S48A 4N0UE 2IOIA 2Z7WA 3RG1C 4IRZL 1E27B 1BAFH 5CXPA 3STZA 2YXYA 1U8LB 4CW1A 1XF5A 4HJJL 4JPKH 3FUKA 1ADWA 2H9GA 4OCRH 5CR1A 3J07A 5EZJB 4MGXA 1TEFA 5A7EA 1NEPA 1CDBA 3BSZL 2DI9A 2L7UA 4LL9A 2X4RB 5E56A 3C6SA 4WO4C 3K0DA 4NHUA 4F9LC 3DX7B 3TIEB 3B7YA 3VXTA 4BDVB 3V4VL 2YZ1A 5BCAA 1KYOF 3C5JA 1QFWL 4Q52A 2CO1A 2X4TA 4LLMA 5FYKE 1S5HA 1SXSA 5K39B 4XRCB 3I6GB 5I0ZA 1JZFA 5D2LB 4JHBA 4KHPB 3V5DB 3UIZA 3JTSA 1VIWA 3QZWA 3P3UA 4H40A 3RWDA 4Z7NF 2NSQA 4GXVL 1OSZA 2QKIB 3TP4A 4MAYA 4ZUSA 5A2JH 1T21B 3NJNA 2AKRA 5F72S 4NSKA 4PJHA 3WS3B 3EDEA 3RP1A 1OCCC 2XICA 5C0NC 1BZDA 4IK6A 3KHOA 2VDPB 4E9XA 5BMVA 2B0SH 2CDGB 2EZ0C 2PYEA 2AZUA 4GKZB 4HIJB 1MOFA 1ZLDA 3LDBB 5FA4A 5JNYA 3WJLC 2APTA 1YJNV 2IGFL 2F53A 3MNWA 5JHLL 3DOIA 5EA0H 1QI4A 2BOCB 3KDPB 1S7WA 4GEJA 3S88L 4G71B 4JKPL 4R97B 4WI2A 1LO5A 3P73A 2BSCA 4WU7B 5EUOE 2D7TH 2X5PA 3CH8A 3ZE2F 1NCBH 4KAQH 3DIVA 3MJGX 5AAMC 2PXYA 4LE8A 2PW2A 1KIQB 4PVBA 2YMTA 3AG4B 5E1AB 1PZUB 4OVVA 4G82A 1S7VB 8PAZA 1Y74B 3OR6A 1UURA 2XN9B 3DOSA 5I74C 1B2WL 4C7UA 4QJ4B 2DYSB 1KGJA 5ESVA 2Q87A 2ITFA 2VABA 1BL8A 1AROP 3ABMC 2IBGA 3CEIA 3RVYA 3KPPB 3QUHA 3RZCD 5IBUG 3KBEA 3LNMB 5CZRA 4FP8H 4MDIB 3K81A 3KZIZ 1BOYA 2XN2A 4MVBC 2WAMA 1DVTA 4DUXA 1SXBA 3QNFA 5I1JH 2P24B 4LSRH 1U8JB 4OLZL 3H9SD 5JPNC 3DTXA 3GRWL 1JJ2U 1L0PA 3WIFB 4DQOL 3PWJA 2DQJL 2OXGA 3ULUC 3GMOB 1D5MA 2QTEA 2C3WA 3BZ5A 3H7LA 3QEUA 3UO2A 4IKLA 1DEEA 3GI8L 2NW2A 2B4CL 1ZS2A 2EH8L 1QNMA 5GGRY 4YDJB 4PDVA 2QTOA 3DSFL 4JFOB 4DUZB 4AJWA 4PJGB 4TLKA 2YBRB 4NQDA 5JOEA 1HX0A 2IH9A 3LN5B 4YSPA 1IBMO 2YMOA 4XNBA 2C1PB 2PTMA 2R2CA 4KUCF 4E5XB 1FL6A 5FB8A 4PG9B 3JV4A 1FVDB 4HKBA 1SS3A 1U97A 2Z7UA 2DQFB 4DKEL 1GYUA 4ZAKC 1H2MA 5IY5C 4N0FB 5E4IA 1OWRM 4NO5A 3VD4A 5A2QN 1M56C 3FQTB 4HXBL 5IVXE 4L9LB 1G5AA 3NXSA 1JPST 4RFNB 4LLVB 2A6JA 4F57L 4LF3B 4GSQA 1SZTA 4YHKH 2YK1H 9PCYA 1Z5HA 3MOAH 1KJVB 1SMAA 5CGTA 4JQVC 5I75B 4TVPH 1L9RA 3PJSA 4FQ2L 3L3KA 1DFBL 3GSVA 3IDGA 4Y1AB 4E68A 5CWSB 1NCWL 5B1AC 3RYHA 3E8UH 5AD0B 1GC1H 3D30A 5GSRA 3HI1B 5G4OA 1OPGL 2UUCB 4PJDA 3MV9A 4PWHA 1U8IB 4CU7A 1K4CB 2B2XH 2YRPA 1JOIA 5IUSA 5GGRA 2WWWA 1AS7A 3IDIA 2P80A 4HX1A 3AXHA 4GSDH 4MA3A 3UBXI 4LLQB 4ACTA 1BQLH 1W0YT 2GUOA 3MJ9A 1ZTXH 4Y19E 4B9KC 1Q72H 1BPLB 1THCA 2R69H 1PNMA 5IMKA 1B0RA 1FJ1B 1ZVSB 4KGJA 3ZSSA 5DUMH 1WC7B 3VGAC 5L2KE 1YSOA 4JKKA 4UAOB 4UTCA 4APXB 4K3JL 1L9QA 4R96A 4Y7OC 5AZEL 3FL7A 4GUCA 4IIJB 3D3QA 1YTFB 4L1SA 3EYVB 5LVEA 1T1YA 4JFFA 4GXUN 4W81A 4KJPD 2WWKO 2EUVA 4PJFF 5I6XB 1HE8A 4PAZA 1U91B 4DP6X 2L35A 2R4SL 3HKEB 3KXFA 5BZZA 3BMVA 3I9GL 3QZWG 1I94B 3NCMA 3T8VA 3X11A 4N2NA 2D73A 3KPLB 3MO1B 3ILPA 1B4LA 3ZMRA 1RY7B 4OXSA 2VSKB 2CDEB 1KB9F 2HJFA 3W0WE 4MB1A 2KL6A 1DEDA 3DJTA 4PJXB 4PDMA 3SGJC 5E9NA 3O3UN 3FSWA 3F58H 3KJ6L 2VZSA 4HJGB 4NVPA 4RX4D 1NCCH 1KFAH 1U3ZA 4JFDA 1H8LA 4BH8A 3PAUA 3K2IA 5F6IB 4D0DA 2EP6A 4BA0A 3OBAA 1PLCA 1BZOA 4AK2A 5LLIC 3CVHL 3RA7L 3IFXA 5F7DA 2BHYA 4JO4H 2E9IA 5D55A 4G42A 2VLJE 5FW6A 3ZO0A 2JB6A 4XXWA 3G6BA 1RUML 1HNXO 4PRHB 5DYOA 1ZT1A 2P28B 2X89D 1UZ8A 2HJDA 3PL6C 1WUZA 3N44B 3FBKA 5ACMA 2ZYHA 2CJ3A 4NIYE 2CTRA 2J8OA 1DHKA 4WCYH 2ZTBA 1IBBA 4YHIB 4W68A 1R5VB 1TZGH 4KROB 3DJZA 2FSEB 4KXZI 4BUHA 3IMRA 3H42L 4ANXA 4AIOA 5IBLC 3A67H 1KJ2A 3QR1A 3NABH 1FFXA 2V5TA 5H4ZA 3BPOC 3GBEA 2GV9A 3B2EE 2ROXA 3Q2CA 3CZFA 1SF9A 1QEWB 4R0LB 1TZIA 5L0QB 3W7TA 3NT0A 5JDSB 1KEGH 4X1IA 3MHHC 1G5GA 4OFKA 5EBLC 1JTPA 3EJCA 1JDAA 1L4IA 3D85D 3BWZA 4GPVA 5LBSL 4N2IA 1SF3A 5AYQA 1IT9L 4AYSA 3MA7A 1P5UB 3FFCB 3O8XA 2Q73A 2PETA 1XMOO 2GJRA 1VKXA 4YHLL 1HN1A 1Q9LB 5E6IB 5CEXB 3VXRB 2D2CB 3OAUH 4G9FA 1N8OE 2L3BA 4OLEA 3GXUB 4TSFG 4AUUA 1ILUA 1ODAA 4X89A 1QUNB 2GEEA 4EKJA 4K3EH 2VQEO 1AKJD 1FYTE 4MS6A 2G3MA 3S35L 1P1ZB 2QVFB 3ETEA 5FOBA 2CLRB 2CO7B 1VACA 3BVTA 1SM3H 2EKSA 3FFQA 4QHKI 2F68X 3BDXA 5JIDA 3UYOD 2EEAA 3VG9C 1FPOA 3MCLH 4IBQA 2YAQA 3VA2C 1MNGA 4Y19D 1QWHA 4DP4X 2HMIC 3CDGB 3AREB 4MXVE 3LDDA 4NJ9L 5FV2A 5A16B 3T4AB 2ZXEB 2PLTA 4WWKC 5L2KD 3DRQA 1TT6A 4JY4A 3S3DB 5IJVB 4FQXA 4J39A 5E00B 4N25A 1IU1A 1AE6H 2VDOH 3LZQA 2RIKA 4PH8A 4XPBH 5FIEA 3RWIB 5KSVA 2BP0B 4S10A 1NCOA 1NUNB 1QNZH 4PJCE 4Y4FA 3QPXH 2E76B 4KV5E 3BYYA 4CN1A 4DIXA 3BEVA 1TF4A 1XNQO 1KIRB 2DLGA 5D1ZC 4OX9O 5CA1B 4JE4B 1QSVA 5JHDD 1IGFH 3PDOA 1UFIA 4TQPA 2IDQA 2YFOA 3ETBJ 3KWTA 5J9PC 2EDKA 2F19L 4R7NB 2JJSA 5LGKA 3WHXB 4P59L 4M1GH 3HKBA 5T3XL 3BI9X 4RMVA 4H8PA 5F3BB 4OT1H 3W0WD 1BVZA 5GRJH 4IK7A 2V2TB 7PAZA 1NINA 4M00A 5IYDO 5KX5A 1CD1B 1A4JA 1I9IL 1OGAA 4JS7A 3H1KH 4XC1L 3RL1A 1JZHA 3T4ZA 3VXOB 1KG0A 4LPUA 3PWLA 3SPJA 3MLZH 2MHAA 2DIJA 2V2XA 3BC9A 2KLTA 1WWBX 1QZNA 4HUWA 1EZVH 2DI8A 3UJJL 1UA7A 3EF7A 4PI0A 1FN4A 2YIBA 3ZY7A 4D9QE 2X4OA 4CMHB 3GMPA 4P99A 3HJ0A 4YE4H 2W65B 3QULA 3K03A 3HUJF 4X65B 4MNGA 3CFQA 2RAMA 3WNJA 2BSED 4NPYA 3SHSA 2VLJD 4UT7H 4DKDC 2BSBA 1XSOA 3NJVA 1MRFL 3ULUL 1TUBB 3IJHB 1LE5A 4OD3L 4RZCA 4WI5A 5E8OB 4I0XA 3FO1A 3GZKA 3R1GL 4PRAB 4RETB 5E8EB 1GGCL 3U10A 1NIEA 3ZT6A 4XNYL 5TQ2L 2EADA 4N1HB 3TEXA 2JKNA 4POYA 5B1OA 2PTUA 1U2CA 1ZS8B 4ODUA 2I69A 1JWSB 3CN3A 3QDME 1YMHB 3NPSC 4U1KB 5FWRA 4P49A 5D7KE 1BQSA 4O2FB 4YXKH 3Q1EA 4H1LH 2GIXA 2Y0IA 1FL3A 4YHZL 2GAZA 3QUZA 5D5MB 2Z3YA 1EV2E 4Y16C 2AP2A 3IWUA 2AJVH 5FCUL 4L8BB 4Y7MA 1S9WB 4QCIB 3EOAA 1B04A 3P4OA 5GGUA 3ZSTA 2ZG3A 1FLTX 3TIDA 3KPRD 4MWFA 3GSXB 1H2LA 1J9TA 1I3UA 2YWZA 1YZBA 1S7UB 3G6JE 3FOLA 3VXUB 4H5SA 4MBOA 2B08A 5BOJA 5J1AB 3GLDA 1BBJA 3WKYA 1M4UA 1OCZB 3U36A 1PSKH 3WYRA 2O30A 4PJIB 2QLVB 3NSFA 3VB9A 3A2FA 3B8NA 4AVJA 3SPVA 2UXCO 5BRPA 1V7ML 3C75A 1QSEB 1TUEB 1F51A 3RLSA 4CH5A 6PAZA 1T5XB 1UOWA 2HVBA 2FO4A 1FYTD 1KXVC 5JJJB 2BNQB 3QCVH 5HHQB 3WXWL 3AEIA 3JV5A 3NQIA 3O3AA 5HYJB 4DO6A 3LNEA 3ARFD 4X83A 3SDLA 2BP5M 4H13B 1FYJA 1A1NB 1KIPA 1LP9E 3AACA 3HE6D 3PRZA 4N2EA 2D03L 2HFEB 3WL9B 2XETA 4MNHB 4Y8DC 1D5XA 2PCFA 4JM2A 5EF3A 3RURA 3L4YA 3VQMA 3MV7E 3CC4V 2GT9B 2IPKB 4KQ4H 3E22B 4EMZA 1LO4L 4TUKH 2P7TC 1NFDB 1YNTF 1IM3D 3BO8B 3CFJB 3N9GH 4H7VA 1YDXA 4FTVA 4UINH 1LO3H 4OBRA 1YQVL 5CINH 3SKMB 3B7SA 1A8JH 4AL8C 5CCGE 3WIHH 2H3KA 4IGBC 1E4WL 1CO1A 2IOOA 3N0AA 1UOVA 2ZINA 4RIRA 3IK2A 3SCMC 4RQQA 4X64O 2XC8A 3CBRA 4CBCA 2XXFA 4B7IA 4QYAA 2P4VA 1ZL8A 4GUPB 3C5SB 3G3LA 4M9OA 4ADGA 1VADB 1XCWA 2FECI 3K2UL 3KLSA 5DS8A 3CCHA 3MNZA 1U4EA 4XPHH 1FWXA 2BIPA 3FKUS 5T3XE 2K70A 2EEFA 3LCYA 2VH5L 3ALXA 3DX0A 3BLBA 4IOFD 1WH0A 3VA6A 4YSOA 1MCPH 3VXQA 1HHGA 3K8LA 2WLIA 1K9MW 1XMQO 1IFHH 3AG2C 3RGVD 3T2QA 4JJOA 5GRZA 4D9QD 5IHZA 1KPVA 2HZHA 2NMSA 1J87A 1V7NH 4JASA 1KGCE 1PZBA 2OS7A 5B1JC 2CH7A 4XO9A 5JQ6L 3QNZA 4ZZKA 4J10A 2ZSVB 2NNUA 2N05A 4KKCC 4Y0GA 4LFCB 1OCOC 2BHFA 1INDH 1VQLV 2X3BA 1T7WA 4HJ1A 3ULUE 2IH3B 3H2WA 1LNUA 3QFJA 4PS8A 1GKEA 4JAUA 1OZTG 3MLVH 4RMRA 4HMEA 5JUEL 3ZN6A 4M8VA 3U79A 4YHYB 1Q0XH 3QDMD 5DVOA 2A79B 5EIVA 5D7KD 1S78C 5D5PA 1M6OA 1YXBA 4FLUA 1JZ6A 2UZXB 2IM9A 5JMRA 4OQTH 5CBAA 4JM4H 5E9DE 3D2UD 3NSXA 3JWNC 4PLJC 3SE3A 2XXMB 4K23L 2DWSA 2QMKA 3KM2A 1CFSB 1PYWA 3ABZA 5DURB 4FXKA 1EAPB 4M02A 4NQEE 3SE9L 5JA8B 1KN2L 3MZTA 1WFIA 1SQXH 5ERWA 3WEOA 1W72H 1FC1A 4KX9A 3VW3L 3FRPB 4HIEA 1FFRA 3BD5A 5DJ6B 3SDCB 1KWKA 2NSMA 4H26B 3PWUB 1UKSA 2VSCA 4P2OB 2ZOTA 3ZR6A 3TA3A 4CJ0A 3CCEV 4J6IA 4D7BA 1NSNH 3RPIA 4WO4D 4ODVH 1S7RA 4DW0A 4L2YA 2IPUG 3FUNA 4BR6A 4JRXA 2BCKA 2FIKA 1XF4B 1CUOA 3B3IA 4BQ9A 4KUZL 3JVGC 4G9DA 5C0FA 2ETWA 2BVTA 2PF6A 3UKMA 1K97A 1YF2A 3UO1H 4MAUH 2PYJA 4GQZA 1TEGA 4XP4H 2OTLV 5LCVH 4M29A 2AEQH 3RU8L 3EADA 4PV8A 4FFYA 3RNQB 1UM5L 3HG3A 1EBOA 3VXME 4Z78B 5E8DL 2DOCA 4IU3B 3A0BZ 4BIZA 2AI0L 2AJYH 4KTYA 4MKMA 4NXKA 3IDUA 5DHEA 3P0YL 3DRTB 4GAJH 1AQMA 3PV6B 4XPAH 1PY4A 4ZJ9A 3ZUCA 3GJEA 5C0ND 1Z2KA 1OCRB 1G7QB 4PJ8B 2C7FA 4X7DC 4LSTL 1J0YA 1EFQA 4F33A 2EZ0D 1GOFA 3GFUA 3IDNB 4PRDA 2VUKA 4Y9FA 3U0TB 4DZ8B 3OGIB 4QTHA 5KAQG 2AJZB 2MOVA 1CPUA 4HUUA 2VITB 4UIMB 4PG2C 4HFUL 5JIIA 3QUKA 1I9JH 4V1DE 3LKRB 4W93A 2AW2A