3X2QB

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3x2qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x2qB02
2TSBA 3GXUB 1NDTA 2HX8A 3NYKA 2UXTA 2XWZA 4DP4X 2J5WA 1CYWA 1AR1B 1NPJA 3QJUB 3AG4B 5I5IA 4PCYA 3X2QB 2BZ7A 3EH4B 2BP0A 2XYBA 1FWXA 4AZUA 2YARA 1AZBA 1JVLA 3UACA 1J9QA 1GS6X 3UABA 2VW6A 3NJJA 3AG3B 3SBRA 1SF3A 2WO3B 3TBBA 2UX7A 1GS8A 3X1NA 1L9SA 3OM3B 3NJLA 2H5UA 2ZWNA 2AANA 4JKNA 1A4CA 1XMEB 3N2JA 3NJMA 1SDDA 1FA4A 3AW5A 1WS8A 2XLLA 1BXVA 2QPEB 1NICA 2J56A 4X4KA 2BW5A 4M4RB 2E86A 4YSRA 5EHFA 2YQBA 2IDQA 2X88A 1ZPUA 5I6KA 1PZBA 4YSUA 2VN3A 1BQ5A 1NWPA 2XVBA 2YAPA 3WIAA 2GC4C 3S3CB 4YSAA 4YSTA 2YAQA 1BAWA 4NERA 5D4IA 1IUZA 4DP7X 2GSMB 2FQDA 4CSZA 3NJIA 3FSVA 2GI0A 2YAHA 3FSAA 3ZDWA 2VM3A 5IY5B 1CURA 4N4YB 2Y1AA 4QLWA 3ABGA 2YEVB 1M9WA 3QJSB 1M57B 4E9XA 2ZOOA 4ENZA 4YL4A 4GP8B 4JHUA 2XUWA 1TEFA 5B1KA 1RCYA 3CDZA 2VMJA 2GBAA 6PCYA 1M56B 3ABKB 1GR7A 3ERXA 4YSSA 2XXGA 3ZX1A 1E30A 4CSPA 1EZLA 1KCBA 5FC9A 3JTBA 2DWTA 6PAZA 1OOWA 5ANHA 3H56A 1SJMA 2EINB 5B1JC 2AFNA 1XB3A 2Q9OA 2VSKB 4YSQA 1XB8A 1NPNA 1HAWA 2IDUA 2PP9A 3BVDB 2PPFA 4NAJA 1PLBA 5AZUA 1TKWA 1X9UA 5I26A 2DY2A 2W8CA 2I85A 2YAFA 1MZYA 3V9EA 3PAVA 1OCOB 2BWDA 1BXUA 1L9OA 2DWSA 2HX7A 5B7MA 5PCYA 2VSMB 1WAEA 2YXVA 1F56A 1PLCA 3AG2B 2PP7A 1MG2C 3HEIB 2I7SA 5TK4A 5I6LA 1AG6A 4QKTA 3L45A 4KNTA 3FSZA 3T71A 4UF7C 1AS6A 1PF3A 4UAHA 4A2DA 1PNCA 2CJ3A 3FQ1A 3PCYA 2EIMB 1SNRA 2I7OA 4KOCA 1ET8A 3IN0A 1N68A 4KOBA 2GB2A 2B3IA 1W6WA 4A67A 3SQRA 3ZIYA 5B1JA 3FPYA 2XU9A 2XV2A 4E9RA 1GW0A 2IDTA 4FA7B 2GC7C 2BZCA 2H3XC 1HFUA 2VM4A 1GS7A 3KW7A 4A2HA 4DP9X 1AOZA 2BW4A 3OD3A 5F7AA 2HXAA 1T5KA 4DP1X 1PAZA 2VW4A 1PLAA 4E9QA 1NZRA 5TK2A 4DPAX 2J55A 2XV0A 3N55A 4HAKA 4KO7A 3WKPA 5B3SB 4HZ1A 4P5RA 3TASA 2TSAA 3WKQA 3QJQB 3UGEA 3S8GB 3FU7B 1ILSA 1AZNA 1HAUA 1NINA 4KO5A 1NIAA 1ZDQA 5B7FA 4F7KA 2EILB 7PCYA 1JZJA 3BQVA 3OQRA 2XV3A 4HCGA 5AKRA 1BYOA 4W1TA 2DYRB 1NIFA 4E9SA 3FQYA 2FQFA 2WSDA 1WA1X 2FQGA 2GHZA 4F2EA 4NB7A 3NJHA 4Q89A 4AKQA 4BWTA 4BK5C 1BQKA 2PPEA 2CALA 3RYMA 1NIDA 4DPCX 5I5JA 5I6PA 1ASPA 2BO0A 2YAOA 4GP5B 4MFHA 1ET5A 2PPCA 2N0MA 3QJVB 4JHVA 1VLXA 4BXVA 3NSFA 4YVUA 3CVDA 2B08A 3FT0A 2IWKA 1SF5A 1BEXA 7PAZA 2MTAA 4RH4A 1YLBB 4P5SA 4E9VA 3OMAB 2PLTA 4YSPA 4YSEA 4BDVA 3AZUA 3CVCA 1WA2X 2DYSB 1B3IA 2FNWA 2FT8A 1L9RA 1R1CA 1QLEB 3FS9A 3FPXA 3H4HA 4KNUA 1KBWA 1ZDSA 3T9WA 3ZBMA 2EIJB 3ABMB 1E5YA 1A65A 1JZFA 1KGYE 4K9JA 1V55B 3T6XA 4HHWA 2ZONA 2OJ1A 1A8ZA 5F7BA 1IBZA 3T6ZA 4PAZA 5B1BB 3WNJA 4DPBX 2WO2B 1PCSA 5I5MA 1SHXA 2P80A 2AZUA 3S8FB 3FU7A 1MG3C 4WKXA 1OF0A 2BP0B 4BWWA 4UANA 2IWFA 3PAUA 4G7SB 1JXFA 1TEGA 3NJKA 1L9PA 3NSYA 1NWOA 1A4AA 4G72B 1JZIA 4HCFA 1AS7A 4YSCA 3T6VA 1AANA 1L9TA 1PMYA 3X1BA 2P80D 3MBWB 3KW8A 2AZAA 3NP4A 1IKOP 3PXLA 1ASOA 1OE2A 2IAAC 3S3DB 3NJFA 1SDDB 4G71B 3OMNB 2QDWA 8PAZA 1E67A 2HZHA 5AFAA 1J5DA 3CVBA 1A3ZA 2QDVA 3NSDA 1GY2A 4L0PB 1ASQA 2HX9A 2XXFA 5D4JA 4DP6X 4A66A 4E9WA 4YSDA 4TXVB 4GP4B 1ZIAA 3X1EA 2PP8A 2YAEA 1OV8A 1URIA 2UXGA 4AKPA 3NP3A 1AZCA 3CG8A 1ILUA 4ZK8A 5LDUA 2Y69B 2PCFA 1X9RA 3EHBB 4M3HA 3C75A 1AQ8A 2J57A 1NIEA 3U25A 3UAAA 4G70B 2R7EB 1RZQA 1DYZA 1WS7A 2X87A 3ABLB 2YAMA 3DKHA 2DV6A 3T6WA 5B1AB 2IH9A 3G5WA 1FFTB 1I53A 2LLNA 3H4FA 3IE9A 2FQEA 4DP2X 3EH5B 5I6NA 2QPDB 1W6LA 1ETJA 2Q5BA 4YVNA 1NIBA 3NSCA 4A2GA 1ET7A 3FSWA 3IN2A 2HRGA 4A2EA 4A68A 1KBVA 1QHQA 1KCWA 1J9SA 1JXDA 3CDZB 1IBYA 1BXAA 1BYPA 1GSKA 2AVFA 5D4HA 3PPSA 4KO9A 3QPKA 2NRDA 1IC0A 1L9QA 2A3TA 4DP8X 3WNIA 1ZV2A 1CUOA 2HRHA 2QT6A 3FU9A 2W88A 2FT7A 5I6OA 3NJNA 4A2FA 9PCYA 1V54B 1JZHA 1KDIA 1OE3A 4AKOA 4FAAB 1PY0A 1J9RA 1RZPA 1DZ0A 2JKWA 4HCIA 3PAZA 3QQXA 1EHKB 1CC3A 4HIPA 2CAKA 2IWEA 2IH8A 2PPDA 5E9NA 1E5ZA 4HHGA 2PPAA 4F2FA 1J9TA 4GYBA 2H47C 4EF3A 3JT2A 1JZGA 2BP8B 1NTDA 3IEAA 1N70A 4E9TA 3ASOB 4DP5X 2BWIA 1JVOA 3V9CA 2RACA 3D12B 2XX1A 5A7EA 1MZZA 2FWLB 2CCWA 1V10A 3X1FA 2ZXWB 1XB6A 3TA4D 1OCRB 3UADA 1J5CA 3FU8A 3WG7B 2R7EA 3WI9A 1AZUA 5B7EA 2VW7A 3X1GA 1SFHA 3NJGA 1OCCB 2HLEB 1BQRA 3QJRB 2UXFA 2EIKB 3S3BB 1MDAA 3FYEB 4KO6A 1AIZA 2GIMA 1AAJA 1JERA 2FT6A 2IDSA 2OCCB 3AY2A 1JXGA 1ZIBA 4BXSV 4KNSA 3DTUB 4WTQA 4DP0X 2OV0A 3AG1B 3IBOA 2JFCA 3GDCA 3FQ2A 4GY4A 1PNDA 2PCYA 2XX0A 4BWUA 2YXWA 3PLYA 4GXFA 3HB3B 2JXMA 1AACA 3CZUB 1SFDA 3EH3B 2FJSA 1GY1A 3UAEA 1ID2A 1KDJA 3ASNB 5I28A 1TU2A 2FTAA 1WA0X 5I6MA 3TU6A 3SBPA 3FYIB 1AG0A 4N8UA 4Q8BA 2UXVA 3QJTB 1PZAA 4AX3A 4E9YA 3TBCA 1E65A 2CUAA 1CYXA 1JOIA 4HALA 1W8EA 1RKRA 1AZRA 2BHFA 2BP8A 3DIVA 1OE1A 1SHWA 3OMIB 1AS8A 2MRYA 1ADWA 4G7RB 1GYCA 1A4BA 3SBQA 3MX0B 5PAZA 1OCZB 3EF4A 4W9ZA 4YSOA 1KYAA 4G7QB 2CBPA 1JZEA 1PZCA 1QNIA 2IDFA 4AI7A 4BDVB 1KV7A 3GYRA 1UATA 3NT0A 2UX6A
chains in the Genus database with same CATH superfamily
4DIXA 2A79B 1E2ZA 2QDOA 2EH8L 2GYSA 4KKBC 5D1QA 2YPLA 3H9HA 1G9MC 4BZYA 5ID1B 5JQIB 4NC1E 5JVDA 3A6OA 5GGRB 3QJUB 4BFIA 1WWBX 2BZ7A 1OL0A 4NZRL 4KI5E 1Z9LA 4JQVA 4LCUC 5TDPA 2ETWA 5GRZA 1BJMA 4MSWB 4W4NA 1GRWA 2Q20A 2UWEF 2LE9A 4HUCA 2OYLA 1XGZA 1JNHA 1S3KH 2YXFA 4PJ8B 3CK0H 3B34A 3OAUH 2BRRH 4LE8A 4N8CL 3L70H 2NUPB 1CT8A 3QWOB 5F70A 5GSRA 4WU7A 4PHXA 5FUZL 2ATKA 3QG7L 1HSAB 2VE6A 3NIGB 2DQTL 4PBXA 4HUVB 2HVJC 2Y2WA 4U3SA 1BECA 1A7QH 3M7MX 2AXWA 2LAAA 1SVCP 1V7MH 5B38A 1DVYA 1B4JH 2BNRE 3BVVA 5EO9B 2J56A 1ZOXA 3M46A 2B16A 4J3OH 1I7TB 1YNLL 4QTHB 4FXKB 5EHFA 4HJJL 2YXMA 1G7JB 3PU7A 4H26B 1MPAH 5KSUA 4R8CA 1PZBA 2JK5A 1SN0A 5KX5A 5BRZE 5EU5A 4JDTH 3EOTH 5F9AC 4H2CA 1NWPA 1VPOL 2R2CA 2FGZA 3ZHVA 1IM3A 4UUJB 5J6GA 2GSIB 3JWNE 1KJ2L 1AC6A 3K7UA 3FU6A 4HJGB 5GTIZ 3GRGA 5DFTA 5FYLH 1RAMA 4IL6Z 3C5JA 1RZFL 1XL4A 3SQOL 1VQOV 1HEZB 1SZTA 1WSST 1T20A 3NEXA 3OL2A 3TT1H 3FCSB 2F1BA 4N8VA 4X4ZA 3BPNC 4ODXA 2IAMA 3CS5A 2QJDA 3TT3H 5K1JA 3E83A 3MRIB 4Z0XA 1MSDA 4Y8DC 1ZSPA 2DQDH 5A7BA 5GPRA 4KAQL 4QLWA 5CMAA 5FX3A 4XN4A 2XN1A 5FYKE 4PJIF 1QFPA 4JO2H 2DMBA 3B9DA 1T1WB 1L6PA 5ID1A 3VI3B 3OKMB 3ZRVA 3BPOC 2LJ2A 5A2AA 3GHEL 4GX1A 1M7XA 4ZO9A 4JANB 5E8DH 3QQ3B 1DVZA 2OXHA 3UTSE 2CJTA 3C5SA 4MSWA 2LOEA 1OCRC 3WEBA 5ITBH 1B2WL 1I1RA 4CC6A 1CDCA 3HMWL 1X4YA 4LCWE 2IH1C 1CFMA 1HAWA 1KELH 2Y7OA 2ZUYA 2IOMA 3STLC 4O02H 4WVRA 4X99B 5CSBA 3ZRFC 3QWOA 2PWFA 3N40F 4LRIA 1S46A 5AZUA 3U4BL 1HSAA 3V4VB 2WY3B 4HUVA 2D2CB 2OYMA 3UGUA 4TQ8A 3V8CA 3HS0B 4QO1B 1QVOB 5EO9A 1NANI 3QIUA 1JMKC 4NIKB 5KANG 3VFSB 4QTHA 5ADOH 1DBBH 2ODIA 4JY4A 3VFGL 3O9WC 3L45A 4KNTA 3BO8A 3WHXB 5J13B 2XWTA 5FW7A 1T0PB 3FTZA 1OP5H 1I9IL 1R3IH 4MVMA 4O9HH 4HKBB 4UUJA 4K3GA 1IB5A 2GSIA 4HIXH 1YY9D 5EU6B 4ERSL 2UUCB 5J89A 4HJGA 4MD5B 3OAWA 2Q8BH 2EDMA 3CMEV 1IBHA 2EZPA 5MENB 3PP4L 4XPTL 3UJJL 3CSTA 1HEZA 2XU9A 3WGUB 2JJTC 2IDTA 3FCSA 3UP1A 1BG1A 1MIML 1QYGH 4KHXH 4LHUB 3GB7C 4WF9V 4J7KA 1VF5C 3MRIA 4LSSL 2XQBH 4HC1H 4WSJA 2F8VA 1VACB 5IB1B 2VDOB 4OZIB 1BIIB 1PLAA 2QELA 5DU7A 5IT2H 2P8MB 4YHOL 2E7HA 1E42A 1FJ1B 4MASA 4ZO7A 1LNUB 2ZM6O 1T1WA 1M42A 2E5EA 5FGSA 3OKMA 3OJMB 1EBOA 3T0VA 1FVDB 1H5BC 4NYLB 4JI6B 2IAND 3DX1A 4GSDL 1G4MA 3RIFK 3ZTNH 4JANA 2AAVA 3QQ3A 1F45A 2P67A 4YK4C 4F7KA 1SJHB 3HN8A 4NDMA 3ZVVA 3QZWB 7PCYA 1GKOA 2VUKA 1CFQB 2X4NA 3BKCL 4Q97A 1UC6A 3L5XH 1T7XA 2FX8H 3AXIA 1F42A 2EDWA 1M7DB 1HSBB 4X99A 1OGTB 1X5HA 2Z8VC 2DYPB 4OD1H 1A3LH 4M48L 5CNHA 5D7JB 4NQCB 4A2LA 3TZVC 2Y06H 1T2JA 3LEXB 2A9NH 1QTPA 2YZ8A 2DOSA 4QJFB 4QDGA 1OF2B 3L3HA 4QO1A 5EIBD 2Z64C 5DJ6B 2X1QA 1QVOA 3NQKA 4KDTA 4B9IA 2YI8A 2KHAA 3L9DA 4JM2F 3MJ9H 4YPGB 5TDNA 5BS0E 4IOFD 4B5ZA 2EDTA 4QXUL 1SF9A 3TBTB 3CLEL 3P73B 4PV8B 2RGSA 1NKGA 4JHAH 4L8BA 3C90A 1VLXA 2XG5A 3HLAB 4X89A 4BXVA 1JPTH 3ES6B 4YIQA 2PCFB 5GIRA 3WFHB 1IM9A 5AZ2H 2BSSB 3CVDA 4AYID 2B08A 1UZ6F 4YL9A 5EU6A 5J2UA 3LKOB 3NRQA 3RILA 3POHA 1KCSL 4MD5A 1ZAUA 3T0EC 5B3JF 4Y2DD 4CADB 5MENA 5K1NA 1QEWB 4QXGH 4BCZA 2WN3A 2R0ZL 3K2UL 1YEGH 1ZT1B 4J6RL 1EGJH 4GBXD 4ZW7A 2DJUA 1SQ2N 4LHUA 4FEIA 3S37H 2XBZA 2W81C 3NACL 3O2DH 5CBFA 1KZQA 3QCVL 5D71L 3OC8A 4JY6A 4ZMWA 3ROLB 1KGYE 1VACA 5BNXD 5IB1A 1QBBA 4OZIA 4PA3A 2CU9A 1BVLA 4OLYH 2P8MA 3KPQB 3VYNA 5F7BA 1FJ1A 1NL0H 4YE4L 3HG2A 5E94B 4QHKI 1RIUH 5I5RA 4ZMZA 2WO2B 5FV2A 2DLFH 1W15A 2WPDG 5E2VH 4LSUL 5I1JH 4MVZA 1JTTA 1FVDA 4NYLA 3E8HA 3N0AA 2IU0A 4G7VH 5EOTA 1F7YA 5G2NA 4PR5B 1M2OA 1SJHA 4P3CL 2DQ6A 5DFWH 1MFMA 3RWFA 3QZWA 2XTJD 4XNXL 2ICWA 1CFQA 1RFYA 5E8OB 4PD4J 4M29A 1UYWL 2IALB 4G72B 2QMJA 4TUUA 4HCFA 1AXSB 1AO7E 1LO0H 2AXFB 3EO9H 1M7DA 1HSBA 5HVGB 4JFED 4YSCA 5E00B 2MK3A 2DYPA 5AQ0A 4DKEL 3S9DB 5KHGA 2VDKL 2E9WA 4UV7L 5D7JA 5D96B 3VD9A 5E08H 4GG6B 1E1RG 3GRWA 1H8EG 2UYLB 3LEXA 4DR7O 1BQZA 3Q9QA 3RBSA 3OMNB 1OF2A 2HTKD 5M94B 5L3GA 3BEVA 5DJ6A 1JNJA 2B1HH 3MRRB 5KHJA 3D8CA 2DQIL 4UINL 4KJYB 4PJCF 4JRYE 2QVFB 1HXMB 1U95B 3QORC 3UEQA 5KSVB 4JW3A 4MTGA 2V9TA 3TBTA 3V7MA 2GQHA 3P73A 2UXGA 5CR1A 5E9AA 1J1PH 1OARL 1AP6A 3HLAA 5LDUA 2CE6A 1LYQA 3WFHA 1X7TA 1UD3A 1RPRA 2PCFA 3G6EV 2F53D 2VR4A 4KRPB 3FAVB 3RVVD 4H88L 1AQ8A 2C1PA 1NUDA 1EZUA 1I5XA 4CU6A 3HKCB 1O7DE 1GCFA 2JKSA 4CADA 3J2PA 5J3HD 5HHXH 5IBLC 5EIIB 3RP1A 3SGJA 4W6WB 4PDLA 1SBSH 1ZT1A 4UYQA 2V3DA 1DQQB 2FNBA 2KLTA 3B7RL 1KXQA 3QRBA 4DT2A 2ZCHL 4AQ1B 4YE0A 2VISB 3OMZA 1HKLL 1QZNA 4ZKIA 2NYYD 2YC0A 3G5WA 2BHUA 5IB3B 2Z0AA 4W9FC 4APQB 1XR9B 3INUH 3U9PL 3Q4HB 1EQWA 3AQXA 2X1PA 1SZXA 1TZ8A 3D2UB 4I7ZC 1NBMG 5E94A 1WIPA 4QY8A 3CMGA 3ULAB 2QLVB 1IC5L 3D34A 5KW9H 5CLZA 1OAUL 2GBTA 3QIBB 5DT1H 4JI8O 2AVFA 5J5EA 4BFRA 3PPSA 4Y4KB 1MW3A 2ADPA 1J18A 5F1NB 3LN5A 5DJZA 4X65B 3WNIA 5IM7B 4ZFFA 1GN4A 1VQ5V 2VQUA 5E8OA 2PXYB 2B1OA 2P1YA 4KUZH 2IALA 4LEXL 1MCRA 1RULH 4WHTA 2PTTB 4TQFA 1AXSA 1BFSA 1Z9NA 2AXFA 2DQHL 4FZ1A 3TXAA 1B0GB 4IMKA 1GGIH 1MNNA 5TFSL 5IE9A 5AVYB 4GG6A 5IW1B 4JYBA 5CCJA 2OL3L 2OCHA 2VXVL 4BK4A 3OWEA 3CC5B 1I8LA 1C5BH 2KKWA 4HIEB 3W9DA 2UY7B 4KJYA 1HJBC 1MZEA 1U95A 2LT9A 2X4QB 3IMBA 1N0LB 3VGAB 2ODMA 1MJ8H 4P30A 4H0LB 5GZOC 4DCQA 4KFMA 5BO0D 1JZ6A 3TO4D 1A4KB 3UEZA 4ZUVA 3FAVA 3OAYK 3OKNB 2VERN 1Y4MA 3MUGB 2ZXWB 1MI5E 2WBJB 1X4XA 2IPTL 3DYMA 3WY3A 4S2SB 1H2NA 5I71C 1QKZL 1BLNB 1TVBB 3Q6FB 2OI9B 1MKFA 1DQQA 2NXYB 2FSEA 3D4CA 2EDNA 3FO9B 4Z3JA 4N2MA 1K5NB 1T0NB 2VISA 3EJYD 3UC0H 2VC2H 3GXMA 4C4KT 5DHMC 1K34A 1IJNA 4KPHL 2E76B 1R5WB 5IB3A 4ZBJA 1NAKH 3EHBD 2JELH 4FQJL 5FO7B 1M53A 1XR9A 3T0XA 1KCRL 4TQEH 4WI4A 3Q4HA 3UTOA 5I1GL 1BVZA 4EOWH 3UBXI 3D2UA 4Z7QF 1UWGL 3ZHLA 4JG1H 4UT9A 1MRFH 4RSVA 1KYFA 3B9KB 4TV9A 3WS3A 2ADYA 3ILPB 3QIBA 4U6HB 5LBSH 4FFBA 4PJAF 2Z8WC 1JDDA 2JFCA 2UZXB 4N2KA 4PB9H 4Y4KA 1N0XL 1B0IA 1USZA 5F1NA 2IADB 3KPRD 1BJ8A 2KPWA 2A3QA 3CIAA 3CAFA 2PXYA 5B1OA 4QHMA 2PTTA 1RSOA 2YS4A 1B0GA 2KMWA 5E8EB 1EEQA 5FO2A 4D0BB 3ZEDA 1Y76B 3BWSA 1LILA 2BVUA 2BP3A 2IBZY 2J12B 1TUEB 4Q2ZA 2IMMA 5D1QC 3S48A 3TIDB 1RZJH 4G5ZL 5ITFA 4HLZG 2ZYRA 4OW6A 1UOKA 3CC5A 3PV6B 5BVPL 2OJZL 1X7SA 4JQVC 1C8PA 3PJSA 2UXVA 5C86A 1PZAA 2UY7A 3HC2A 3B2DC 2CA4A 4YXKL 4XDKA 1MCHA 2E9IA 4IYIA 4DV3O 4XMKL 4LGSB 3GPEA 3N9GH 4L9DA 1A02N 4M5YH 1ODAA 1QP1A 4PJ7F 2LGQA 5E6ID 3C2SA 1NM4A 1YVLA 2ATKC 3O8XB 3G5XB 3OKNA 1TEYA 2BCCH 4I5SA 2XWCA 3P30L 4NPKA 3MUGA 2ZR2A 4MXVF 1ZLWH 5C7XH 3EF4A 3KVPA 4J3TA 3CD4A 4W9ZA 4WRLA 2WBJA 1VGKB 5K93A 2O30A 1ZHKB 4BFKA 1QNIA 4DR2B 1GW6A 5CLWA 2IGTA 1FORL 1BLNA 1TVBA 2R1XB 4NFBA 4NBXB 1NCUA 1L3NA 4UTAH 2TSBA 2G4GA 2H3OA 1IBLO 2OMWB 2I24N 3FO9A 9CGTA 1K5NA 2L04A 3HTLX 5DD1L 2JK5C 1FV1B 4MNQD 3EBAA 3C6LD 1AR1B 2ZWLT 4ODVH 5FO7A 3HNVL 3GSRA 1BQLL 3ILQC 4OSUL 3LXCA 3CXFA 1CL7H 3AACA 4ABWA 1HNZB 3B9KA 4KXZH 3C3TA 4U6HA 3KPSB 2YD6A 3L4TA 4NP4L 5FCSH 2OJEB 3CHOA 1RU9L 4U3FH 1F8TL 5E1IA 4CKQA 5DVOA 2IAMC 2IADA 4H8PA 4JEGB 4BZ2A 3FQNA 1YEFH 1L9NA 4O5LL 3CCVV 4NUGL 2ZG3A 2BTOA 1DL7H 3QSKB 3CWGA 4LEBA 5E8EA 2N74A 3T0DA 1YMHB 1Y76A 1VDGA 1XXFC 1EJFA 3TIDA 5ITZB 3A3YB 1HWGB 5CWSB 5HDBB 3SSGA 1KXTA 1CXZB 4P2RA 3SCMB 3X12B 2DQFB 2VN3A 2C8NA 4H8VA 3TLRA 4X5WA 4MSWC 4UU9B 2XVLA 2M7WA 1BQUA 3D0LB 2WQXA 3VD1A 1KEGH 2F5BH 4EEEA 2B4CL 2DD8L 5L2KB 4F8LA 1K33A 4JDEB 1IKNA 4I9WA 2F19H 2GEQA 4EPSA 3VQ1C 4LRIC 1ZLEA 3O8XA 4PJ5A 2H45A 1A14H 3G5XA 2XQYA 3NVQA 1SM3H 1YMMB 4BQ8A 2DMKA 2OR8A 4KKCC 1H38A 2WXLA 1VGKA 2ZOWA 1ZHKA 5C2BH 1WJ3A 2AJ3B 1X5MA 2VQ1B 1UACL 4TOYL 2BOLA 3QIUC 4G1MB 3FFQA 2R1XA 3WS6A 1JMZA 2YEVB 3LKNB 1M57B 2KLRA 2OMWA 2ZOOA 4TYUA 3WEMA 4KUCF 1J1XH 1RZIB 1FV1A 1ZVYA 1BZDA 1IFGA 3GTNA 2ZAGA 4M1CD 4M3KB 2OK0H 3ABKB 1CFBA 2FH6A 2XXGA 4M1DL 4UUJC 2Q0OC 4JI2O 3DIFB 4MQTB 1WAAE 3Q6GH 4B5EA 1CGWA 4OFDA 4I87A 4AENB 2ZPKL 3QUMH 5ANHA 3P9MB 3PUCA 3CVIH 4YQXL 4JO8A 3KPSA 4PEEA 4UT7L 3IE4A 5F21B 5BW7A 2OJEA 1EO8L 1IVSA 1I1YB 1KLGA 2AEIT 3D36A 4ZMPA 1U2YA 2H8PB 3ZE0E 1HZHL 1A6WH 1KPUB 4PJHE 2F2HA 2AK4E 1HDJA 1VQNV 1CLZH 2V7HB 2VLME 3R4RA 1TKWA 1E8XA 2F54D 4I18B 4TUKH 4XNUL 2JB5L 2FX9H 1OAYH 1V3MA 1GMGA 4GQRA 1ZLUH 2ARJQ 1QUNB 4KKAC 1L9OA 4KI5F 4GSQA 4XO9A 1YMHA 5E99L 3P0YL 4HEPG 3HW7A 1CE1L 5G5DB 3RIFF 1C08B 5CWSA 1VZIA 3DBSA 1F56A 2IBGA 4KX8A 4XN1A 4NS0A 3SR2C 2EVJA 4UF7C 5ALCH 5I1IL 4JAAA 3BP4B 2R9RB 2R59A 1CLCA 3IFNH 4UU9A 3VWKD 1GHFL 3D0LA 4IIZA 3JD0A 1NOAA 4JG5A 4C7UA 5HHMB 5IG7B 3BKYH 1SMOA 4S0TD 5HHOE 1Z9OA 3CUPA 1BGYH 1Q82W 4JO4H 1P7KB 3KYNB 5L2JB 4EI0A 4OIAA 1HNWB 5DRXB 5IHZA 3KBFA 5EEVA 4G8GD 1CIUA 2IV8A 4K3DH 1XBRA 4R7CA 2D2CC 4DP9X 2Q6AA 1WPXA 4NQEB 4YFDB 1F11B 4KZEL 3ALPA 1B4TA 4Z6AT 4FXGB 1QQDB 3TA3D 1KN4L 4KDTC 32C2B 5TF1H 2YEVA 1YEEH 3LKNA 1AJ7H 4LGRB 1NCAH 3DA0A 3VB8A 2R56H 2XFGB 1XF3A 1RZIA 4LO9A 2RN9A 3GS4A 4L8CA 1ECYA 1JGEA 2VKWA 4DHLA 1P4BH 1CE6A 3DIFA 4NFDA 5LUMA 2DQUL 1IIKA 2ZE5A 4G9FA 3S4SB 4FERA 2EX3A 4S0SD 4J3WA 5EU7E 3EYOB 1KQSU 1NIFA 1ETA1 1I1YA 2R0KL 2Y07H 1LDPL 5KYWB 5CP7A 2H8PA 1A7PL 1IC7H 1QSVA 2VZUA 4MZIA 4F2EA 1KPUA 4LNVA 4RWHA 2V7HA 1KXVA 3NJHA 3KPMB 4ODWB 3CFBA 4I18A 4LCIL 1ZWIB 1JK9A 1G84A 4N90D 1KGUA 4IKKA 1M5IA 1ZT4A 2CLVB 5EUOB 4UV4H 1QSED 3UG5A 2RTTA 1QUNA 5D72H 4LH6A 5AWNL 2AXTZ 3AREA 1NOLA 1F4YL 2LHAA 1I8MB 2H6OA 5AOLA 1YCIA 3FH7A 4FADA 4AW7A 3MV8D 2JJVA 4YHML 3E2HB 1ZE3C 3CSYB 3RPBA 3BE1L 4I1RA 5I76B 4AEIL 4ZUSA 4FLTA 3BP4A 2BVEA 4TVPH 3GSOB 3VSUA 3BAEL 2VUOA 3NSFA 4D0CA 1JV2A 1AI6A 2MTAA 5IG7A 2AQPA 3QULB 5EPMB 4HNAB 3F64A 1KEMH 1QQCA 4QD2E 4AYSA 3APQA 3VRJB 5L2JA 4FVMA 3KYNA 5FYJH 5DN6G 3ML0A 2YIHA 5D7JC 2FLRT 5DRXA 4WEMB 1L9RA 4XOAA 4OY9A 4U7KA 3UYPB 1RJZB 2NY5C 1K8IB 5IMKB 1WGVA 5D5ME 1CGSH 3T4AA 1E5YA 1F11A 1NUGA 5F7HA 6CGTA 3RYCA 4FXGA 3TBYB 1JWSA 3IRPX 1Z3GL 2ZCLL 32C2A 5ABDE 3S34H 3B9VA 1NCJA 5CINH 2E74B 5BZXA 2BIMA 3T6ZA 5B1BB 4FZ8L 4UCTA 1NFDE 1AROP 1RPKA 4QT5B 4U6XB 1Y0LB 3HAEH 2EJRA 2OW7A 3R65A 1TQVA 3NSJA 4XPHH 4PPTA 2K0RA 4FM2A 3P4MB 2V2TB 4U1MA 5DJAA 4GS7B 4IRSB 1JXFA 1G0XA 1H8SA 3EYOA 3KPPB 2WWMD 1NC4D 4RGOL 1LO4H 4PJBB 1NWOA 2H9GA 3HR6A 1T1ZB 3SGJC 1WG3A 4YXLL 4PRIA 5DD3L 2VN6A 3JASB 4GOSA 3UBFA 2WOYA 4TV3A 2A4ZA 1PMYA 3X1BA 4R26H 4WWOA 4ZODA 4MZRA 2EO9A 1Q38A 1ZWIA 4CKVX 1IKFH 2VABB 2CLVA 5EUOA 5KZCD 2O6FA 1T66D 1C1EL 1WBYB 2WYZA 4ELMB 2WTOA 4K3EH 4BINA 2VLLB 2XXFA 1I8MA 3LPOA 1YO4A 1NC2D 3RNKB 4ZAKB 3K3WA 3F5TA 3L95B 3CSYA 1MFCH 3M7OA 3RGHA 2CXKA 3EF7A 4UZGA 5FGCE 3RWRD 4XBEL 5F7EL 3VFUB 3CZEA 3QULA 5LGUA 1YTFD 3IKCB 2FGWH 4TKWA 5AKVA 3IMTA 2B9BA 2JF1A 4IMKC 3FTSA 3QNZB 1XNRB 3LZQA 5HYQB 4GXVL 3RPIB 3L5WB 5D96C 5DRNB 4J2XA 5AVWB 5H9CA 2F8IA 3D4GA 4N87A 1CTNA 1NM9A 4E2LA 2XAJA 1IFHH 1RJZA 3JWOC 4YWGL 3UYPA 1K8IA 5IMKA 3IAPA 1I8LC 3MODH 3EXAA 2PR9A 3CPUA 4R2GD 1SXCA 1BJ1J 4W9EC 3QDMD 1E79G 4JI7B 1R3JB 4U1GC 3TBYA 2J1WA 4DP2X 2NPLX 4K9EC 5HI3D 4P2AA 5AKSA 3ULSB 3CC4V 4EVNB 2C3HA 4KH9A 1PG7X 3V4VH 4QT5A 2BXYA 5DVPA 4U6XA 4ZDHB 2EE9A 4RZKA 4JHWH 5DURD 5HY9B 5KVEH 3HZMB 3DVIA 2FEDC 5GRVK 1YN7B 4FP8H 1GSKA 5EN2B 1FXVA 2V2TA 3WFVA 5L4JA 2QTVA 1B3JA 1OAKL 5JA9A 4WWPA 4IRSA 4HUNB 1FH5H 3KPNB 1GM9A 2CH8A 3A0OA 4HWEL 4PJBA 4LF3B 1T1ZA 4WUUB 2BS8A 1J10A 3EO1B 5HTSA 3KWUA 3QEQE 3JASA 3MLUH 4AKOA 3NABH 1U2HA 3APDA 1HXKA 3K8KA 1CC3A 1P7GA 3BPCB 4RWYL 3KHQA 2IWEA 4ADGA 3DO7B 2AQNA 2EP6A 2VABA 1MFUA 3SGKA 3QYMA 2XNDG 4XNYH 1WBYA 3WDIA 3BGAA 3CFMA 2E7MA 4FJCC 2FRGP 2VQ4A 4PMFA 2BFVL 5IQLA 3BQUB 3RNKA 4ZAKA 3UAFA 3QIBC 5HDRA 1I3GL 4NWTH 5EU3A 1CFVH 4Y4KC 3ESVF 2VDOH 4JFHD 1VFOA 2XZAH 4CH5A 4CVZB 4Y9EA 2Q0AA 2Y72A 3FW6A 2VSCA 2PXYC 4L48A 5ANMB 3VFUA 5L8JB 4LL9A 5AG2A 1FL3B 2IJIA 2VZVA 2EYSB 2HT4D 3DPBB 3IKCA 3QS2A 4GINA 4HV8A 1NBVH 2QR0A 3UADA 2E4TA 3K8MA 3QNZA 5HYQA 5A2CA 5DD0L 3RPIA 5CJOL 1AZUA 5B66Z 3L5WA 2YUZA 4LF9O 3IJSB 5KTEH 3SODB 1YNKH 4AQZA 5KVFE 2FL4A 2BVTA 4I2XB 3TEXA 3NCWA 3OKLB 5BS0D 1R3JA 4KUMA 3PWLB 3S3BB 3AS1A 3UTQB 3NTCH 5LKNA 3IAGC 2AW2A 1SRYA 5AOJA 3OV6A 3ULSA 1OTUC 2FT6A 4EVNA 2BXZA 1T5EA 2OWOA 4YHHO 1DQMH 1NGWB 5K9QG 5KVGL 4ANXA 1AGCB 3DTUB 4OJEH 5J1AA 3SY0A 2OV0A 1N26A 2P5PA 3RZCB 4ZDHA 2P5EE 4H0LC 5TQ0L 1XR8B 2KL6A 2YUVA 3HZMA 2F66C 1E3XA 4JFQB 1AYOA 5EOQL 5JIQA 4I13B 3BAKA 1DN0A 4FFYH 4HCRH 5KSBE 1A7OL 3I6KB 2ZXWC 4Y5YB 2PI5A 4Y9CA 2WBJC 4EXPX 3KPNA 4CJ0A 2CR6A 4DK3A 5F2FA 4K8ZA 3E1F1 4UZSA 3QFJB 3QRGH 2P4VA 4RMWA 1KIQB 5IGXL 3EO1A 1YSCA 2P47B 2OI9C 3UCQA 4XXDB 2NXYC 2EZ0D 5AAMA 2XV6B 3GMMB 4PJGA 1KENH 4DRXB 4X6CA 4OKDA 2FJSA 2PKDA 4F8TA 3DSFL 4MAUH 3UAEA 4B9PA 1ID2A 2E76C 2Y5TB 3F65A 3VA6A 3BPCA 4WU5B 3VDAA 4B0MM 4NJAL 2P5WB 5I28A 2FTAA 2W65B 1BGXL 3MRDB 4R4NC 1S7UA 3S35H 3KJ6L 4JQIL 3B40A 1EAOA 5T3ZH 4AX3A 1DE4A 5KBKA 1SEQH 2MNWA 3B9KC 1JOIA 4NCDA 3BQUA 3HMXA 5D7HA 4Z3GA 4DV4B 4YLCA 2Z3FA 2PWEA 4I5BB 2G3ZA 3CZLA 4JKMA 4MBRA 4XGZB 5E1HB 3VXRE 4CVZA 1X3DA 4D7PA 3LSOB 5ANMA 3KG2A 3V0DA 4XNMB 4QJ5B 1FL3A 3L17A 4I4TB 2EYSA 2WMPB 5IEKB 1KPRB 3FU3A 2LW1A 3W11C 4CSSA 1JZEA 1E1QG 3PS6A 2OP4H 2WOBA 3QE5A 1HKFA 2QKIA 3MXWL 4DPRA 1C9SA 2OZ4H 5FGRA 4CJ1A 3DJ9A 4G6JL 3IJSA 1PNKA 3BAXA 4I2XA 1G6RA 4B3RB 4M7LL 2NNFA 3P0VL 3PWLA 4WFGD 3UTQA 3J07A 5I5IA 5LQBL 5HVFB 4OZHB 4JZJB 4XC1H 5LN8A 3TPUA 2V4DA 4ZFGH 2MCPH 3RZCA 1SHSA 1IKNC 1XR8A 3UABA 4AJWA 2VLKD 3AG3B 2O72A 3II2A 2G2RB 3JBG7 2JI3A 1O0VA 3O8XC 5DQ9B 1ZLVK 3RVTD 3S5LG 2YICA 4JI5B 5C0AE 5B3NA 4X6EB 2HPTA 1U8HA 1SYVA 4Y5YA 4CN1A 3NJLA 2UXXA 5DF0A 2H5UA 1P5UB 3NJMA 2O5XL 1KIQA 4FQ1L 4NO2B 3D0VB 3WS6C 4H7VA 4NN6B 4XXDA 3VH8A 3GMMA 2I25N 4DRXA 1CFSB 4XB7A 4FM1A 3MV11 1YF2A 1OCWH 2CWRA 2N1KA 4WU5A 4AW4A 1D2DA 4QAMB 5BZWB 2W65A 2YFNA 4IK6A 2D73A 4B9FA 2J1YA 5F96H 4R7LA 1T6VN 4YHLL 5J2TB 3P3NA 1OAXL 2CLZB 3HZYB 3OUFA 5HGBB 2JIXB 3GMLA 4O2CB 2P6JA 3MV7D 2GC4C 3HG1D 5A2JH 4TSBH 5BW7C 4G43B 5I1KH 3MRKB 3AWFA 3NQIA 3D36C 3ZSSA 1CXIA 3QHZL 1V54C 4I5BA 1SLWA 4XGZA 3GIVB 5DJ0A 5ESVB 1IC4H 2HKHL 3JD4A 1IGTB 4XT1C 4UT9H 1J5IA 1NH6A 4XNMA 3VXOA 3SGIA 1ITCA 3SYCA 4Y16D 1DK1A 2P52A 2GFBB 1IBBA 1MCWW 1KPRA 3WAKA 5IEKA 2JEXA 3FQWB 3GSUB 1XOUA 2VDNH 2LU4A 2Y1AA 4AIOA 3KYKH 4LSQL 3U36B 1M9WA 5LGTA 4I0XA 2RCSL 3CZKA 1KTLB 1JZ2A 1YDXA 2I9LB 1UT9A 1J5HA 3ASOC 2GBAA 3GHBH 3FHAA 4P4KD 3GK8L 3ZYZA 4X20B 2PY5A 4YXHH 4JZJA 4M7ZB 3ZZSA 3H9SB 1I9RL 4XPAL 4FULA 4Y2OA 5AOKA 3RRQA 2YR3A 2EINB 4XOCA 3V8OA 1XB3A 2HJKA 5GGSA 1GTFA 2K3TA 5J6HB 3ML8A 2VDPH 1FDLL 3FUMA 4KROC 4J3UA 4F7PA 1PKQB 3SE4A 4X5LA 3ZPDA 1MFDL 1P5UA 3W2DH 3QWNA 3LNFA 4Y1AD 2NW2B 1ZA3B 1N6VA 1T83A 3D0VA 1MABG 3SYOA 3LNEA 3DX9A 4H8WL 4R96B 5EO1A 2BWDA 1GXEA 1S7RA 2W9LA 1I7FA 2JKJA 1PBYA 4G82A 4PELA 3TETA 3LCYA 5JUEL 4O2BB 2W0LA 5BZWA 3AC0A 3VDCA 5D7KE 1VRSA 4TQDA 2JJ2G 1Q0XL 5D7LB 5J2TA 4RCAA 2Y25A 2CLZA 4UAHA 5C09D 3U7YL 4WWKB 1NCHA 3A24A 3BI9X 3CBJB 5I8KL 4O2CA 4HAFA 5GGUB 3VU1A 2D7NA 2CLRB 4UTBL 3RTLA 3N44F 4G43A 2YXLA 3L73H 3MRKA 1AR5A 1W59A 2AERT 4E0RA 2J72A 3TM6A 4LAQL 4UQBA 2H8PC 2ZD0A 4NVPA 3MREB 2GV9A 4XOBA 5GGSY 4ZPVB 2MPAL 2C2AA 3CRAA 4JJ5B 4L8JA 3ASNC 1KXVC 4FQ2H 4I18C 2WIIB 2FD6H 4KDWA 2GFBA 3JWDL 3EJJX 3PHAA 4P06A 3A6CH 4TTDC 3RX8A 1QFWH 2YPLE 3FQWA 3GSUA 2VR6A 3JWNG 3PV7A 2FWSA 3AREC 4XB8A 2Q3AA 3RA7H 2X10A 1O5PA 1WP6A 3VXSE 3ZTJG 2ADIB 3U36A 2L8AA 2BX5A 4FJ6A 4BZ2H 4ZX6A 4PJDB 3WCYA 2I9LA 1L9MA 1UXWA 1SBBA 4ALAH 3A4FA 3D07A 3DARA 4HZ1A 3HC3L 2RALA 3GBDA 5IEHA 3IS0X 2AEQL 1AZNA 2KZBA 2VDRL 1XCXA 3TESA 4HG4J 1YEHL 3H9SA 4XCEB 5GS0D 3QPXH 4ABUA 5D8JL 4MJ6B 2MKLC 1U8CB 2DYRB 2Q68A 5KHKA 1EJOH 5GISH 3WO3B 2A6DB 4HBCL 3STBA 5J6HA 4XNBA 3KJ4B 3O4LE 1BZ9B 3X3GL 1PKQA 1JV5B 4ZS6D 4S1DC 3T4AC 3AMKA 3ARDD 4OCYL 4MGXA 4FXGC 4NPYA 4Z7UB 2EH7L 1ZA3A 2JMRA 1HE7A 5KUMA 3CFJB 3U0WH 3RWDB 1KSRA 1UM5L 4R96A 2KT6A 4KVCL 4KHPB 1BQKA 1RJYA 5AW6B 1WAAF 1H3VA 3AAZB 1AD0B 3CFQA 3VFTB 4O2BA 1MFAH 4GMSL 1ASPA 1KY7A 4L0YA 2D7OA 2LABA 1EAPB 2FAUA 4BYHA 3MACH 2NXZB 2GBVA 1O6VA 4Q14A 1UWXH 2YRBA 1UOWA 3ZE0F 4YEFA 4PJHF 2CLRA 1JTPA 4G6MH 4A04A 4K0KO 1HC1A 1RZ8B 4ZTEA 1JZ4A 3GKWL 4WFEA 1GJWA 4U6VL 5I1AA 3IDXH 2PLTA 3MREA 4FNTA 4M7JL 4ZPVA 4Z0BH 4P07A 3TNNB 5CUSH 2Y6TE 2FNWA 4JJ5A 3Q5YA 2K1MA 1ZWIC 2WIIA 3KLHD 3C08L 5KA6A 4FA6A 1CD0A 3PFUA 4B50A 1E5CA 3DUSB 3U2JA 1JYNA 1N32O 2ADIA 2JCCA 3OJ2C 2CG9X 2HG5A 2YWZA 1Z6JT 3CNKA 3E2HC 4PJDA 4N0YL 3WNJA 3I6LE 3PDDA 2ZT9B 4YJ3A 4YDKL 1SS3A 1NS1A 3LN4A 1VEMA 3Q8BA 2CGRL 4WDIA 5C0CB 2B77A 2HLDG 4OPAA 4R4FH 5AALA 1OF0A 2BP0B 3B2UD 5CMUA 3EDKA 4QRFA 4WGVB 1N4XH 2WZPA 4CC4A 1ZS8B 4MJ6A 5AAPA 3MLPA 2J4WL 1CLYL 2EYTB 3OZ9H 2I5YH 4OCNC 3VTTA 1U8CA 2HEPA 1G9ML 2A6DA 3FAXA 1H3XA 1FGNH 3LZNA 1BZ9A 1FI8C 4P5KB 4QPKA 4FQLH 3R1GH 2QWOB 2P80D 4KK8D 4TRPL 1CL7I 1IT9H 3UCRA 4UXNA 5LN4A 4Z7UA 1J8HD 4W4LA 4KXZI 2FATH 3RWDA 5TH2B 2P43B 4IU3B 4RLDA 2E74C 1DBKH 1A1NA 1U4EA 2KH2B 5B1BC 1ASQA 4TN9A 2EE6A 4DP6X 4ZW5A 5IHWA 3AAZA 1AD0A 2V4LA 3UTTE 2WB7A 5I1EL 3OVUB 3M1CA 2R0LH 4FTDA 1ZIAA 2WLYA 2YN5A 3MV01 4TUOB 3QJFB 4QHNB 5GRUL 5FFOA 1ILUA 4EKXA 3VQYA 4JFFA 5SWSB 5T33H 1T03L 2JE8A 4GS7C 1PLGL 4IRSC 4YN3A 4LGPB 5KOMC 1I7RA 4PP2B 1TPXB 4WSGA 3UPRB 4OFVA 3MI6A 1RY7B 4ODSL 1OTSD 4EI5A 2ADGB 2WWKT 2V5RA 1H2KA 1J9CT 4ZD3H 5JO5A 5LWYL 3L2MA 1DTOA 1WS7A 4W9CC 3QR2A 3DKHA 1T1YB 1WITA 3FRPA 4H0IA 4NHUB 3SGKC 1ZHBA 3QK0A 5C0IB 3VQVA 1U42A 1MJJA 4OZGE 5D2LE 4Q9RL 3T0AA 3E6FB 1NOFA 4NN7B 4AYGA 3DUSA 4GQ9H 3VXTB 5CS7A 1Q3EA 2D03H 3MROB 2EDXA 4LLAA 4DW1A 3HNSH 3MRJB 2QBWA 4V1DE 2Q5BA 4ZAKC 4GIAA 2HKFH 2HB0A 3UM7A 3QCUH 4NBYB 4N0UB 1L6ZA 4JPVL 4Z7WB 1KCWA 3GWOA 1JWUB 1MNUL 3CDZB 2DLFL 4P5TD 3PABB 2WLJA 2WLIB 4F1ZA 3J7AU 2NY6B 1OHHG 2XETA 3AY4A 5F3BB 2NRDA 4JRLA 3QDGE 2R8SH 1ZMYA 5TTRA 1CUOA 1ZS8A 5C0FA 2GY7B 1LO3H 4MA8H 4MJIB 1SJVA 2QWPB 5D5MF 5I24A 4L1LA 2ZX5A 4MDJB 1VF7A 2ZX8A 1JZHA 4JPRA 1XCTB 4HCIA 1VZHA 1MOEA 3V4UH 2P4KA 4HUWB 4J6IA 4MCZB 4FLQA 1R3JC 1NFDF 2UZPA 2WXPA 4P9PA 4DKDC 4RFOL 5CGYC 1R3KB 1ANUA 3EDDA 2YKLL 5TH2A 1IAIH 3B6SB 2VQFB 4NKIL 2WTRB 3OHXB 4A6YB 4X7SL 1CFTA 2MPVA 2QQKH 3D85D 5C0JB 1J9TA 3V6OA 3TH2T 5F9DC 3VMNA 3US1A 2D3VA 1N70A 3DNKA 4FMTA 2F68X 4X64B 4TUOA 4UOJA 4D9RD 2AI0H 1QG3A 1Q6HA 4MKTA 3OX8B 4QHNA 1FNAA 5SWSA 2YEZB 3HLKA 4RO2A 3DTXB 1ZHNB 2IJJA 4O2EB 5KYNA 1VADB 2BOCB 4U1SB 1T0OA 3UPRA 1CDBA 1FZOA 5FHAH 5EBGA 4MAYD 2AXJA 2VN4A 2VLRE 4B60A 2A9MH 2ADGA 3HRZA 2Q7YB 1XB6A 3ZL1A 5AAMC 4FS0A 2NOYA 2VZSA 4OCXH 2EQDA 2X9YA 2GTZB 3H42L 3AQZA 2F1EA 1Q90A 2VW7A 5HHQA 4D7BA 1SERA 1T1YA 3TFKD 2R4SH 4NHUA 5JXEA 4PGCA 5C0IA 1CR9H 3FT4B 1NCDL 1NMCC 5DA4A 4N1HB 4JY5L 4Q9CA 2UXFA 3RFRA 5LAXB 4QRRA 2R51A 3VXTA 2B5UA 3RKDD 5D7SL 4X6DE 3FH5A 3MROA 3LS4L 3BEHA 2GIMA 5T3XE 2X9WA 3MRJA 1JGUH 2Y6SD 3BQUC 2QSAA 2OCCB 3NCJH 5KG9B 3ZHTA 3BFWA 4BXSV 5TE6L 3H1LH 1ADQL 1PG7L 1OP9A 3QRLA 4NFCA 3PABA 4Y9FA 3ABUA 5T1MA 3ULVH 2WLIA 4DGIH 2DQCH 3IBOA 1D5AA 3FQ2A 3TJPA 3P3PA 2VR9A 1KF9B 3SDYL 1IAMA 3RURA 4DTGL 2CMRH 3LZPA 3SYAA 4OGQB 2QKIC 4WJ5A 5J12C 4OF8A 3DXAA 4X0NA 1EHLH 4IIJB 4K23L 2V8MA 1XCTA 4O2FA 5F0LB 2Y7QB 4OKVB 5FUCE 4PTTB 4KC3B 1AKJB 1UFGA 3H3PH 1NCCL 3I6GB 4NNYA 3B2XA 1ETB1 3B6SA 3ETDA 1AG0A 1AR4A 2ZUTA 2DQMA 5GZNA 3O6FA 3TBCA 4LESA 5F2VO 3RZCC 5C0JA 1ZL8A 4QWWC 2AEPH 3FXIC 2VL4A 1ROWA 3DIVA 3C5XA 4FQPA 4WY7H 4ZOEA 4UT6A 3F3HA 5DFVD 4EIGB 3ROOB 2BNQE 3OX8A 3FO0L 3G04A 2YEZA 3SJVB 1A4BA 2GABA 5J9PB 4Y5YC 1ZHNA 4UQIM 4RFNB 1VADA 4U1SA 5C0NC 2J88H 1I8KB 1X5KA 1JGLL 2CBPA 4Y1SA 4JG0L 3MRBB 3BT0A 3LB6D 4HUUA 2GTZA 3KDPB 3TCLB 4I0KA 4LSRL 1QBLH 2PF4E 2XWZA 4HS6A 2R15A 4DP4X 2DRUA 1CYWA 5H6RA 1CU4L 4PGBB 2I60H 5LAXA 1L7IL 1ICTA 4MYPA 1MH5B 2VTFA 4D7SA 3GT6A 3EYFB 5KG9A 2WUBH 2VXQA 2XYBA 3K4AA 1WEJH 4WLCA 3JV0A 5CO1A 3BN9C 1B6QA 3UO1L 3TJTA 5JOPE 2WP3T 2F95B 4HPOH 2NYKA 5KA5A 3UQ8A 2WO3B 2X2IA 4Y88A 1Y1DA 3WY4A 5E1AA 3Q06A 1HJCA 4NPJA 3ARRA 1PX8A 3QUGA 3KAAA 4JG9A 4GLXA 1N3NB 3VDBA 4DGYH 4QCIB 4YGAB 4D8OA 1NSNL 3HE7D 3GI8H 1IBGL 1AGFA 1DQDH 3KYOB 5DC2A 1IARB 5HYEA 4V2BA 2BW5A 4OKVA 3CEIA 5KHIA 3HHMA 4IBSA 3DHPA 4PTTA 4B9GA 1UTDA 4XPBL 1T04B 2F1AA 4KJWC 3ABZA 3H2WA 4R84A 4XP1H 4JZJC 1SRDA 2H94A 1OD7A 5H2BB 1RIHH 4AUJA 5KSBF 3LZOA 1TTGA 2NN4A 2IBZX 4RMUA 3N40P 2ZKYA 2AW9A 4CA4A 3AG3C 4LVNB 4NKDA 4XR8C 1GGCH 3H53A 2ZD9A 2Z91B 3ROOA 3WLBB 1XREA 5JQGB 2H32B 4PJIB 3SE4C 5J9PA 4G42B 1DQLH 1P5UC 5E6ZA 4X9QA 3NJIA 3H1JH 1I8KA 1T83C 3R19A 2I26N 4XAWH 4XI5D 1G1XB 4UILH 5E5UB 2YC1B 5FA4B 1N5AA 1J0KA 4MDRA 3TCLA 4P23D 1QRNE 5EB9A 3FCGA 3M8OL 3B5GA 5E2TH 2JS5A 1KJ2B 5JH7B 2FEEI 5J6SA 1QACA 1GR7A 4ODVL 4PGBA 3RDTB 4YSSA 4FFVC 5IWAB 4DR3O 4GKKO 1AI5A 1X5XA 1SXBA 3EYFA 3LEVH 5FLUA 3N1FC 5E4AA 3JSLA 2DTML 4XTRD 3RBGA 2HUEA 1OOWA 2GHYA 3T0BA 3O2VH 2JGDB 3MGOB 1WB8A 1T22B 2BC4B 1TTRA 3RVUC 3CLFL 4AIXA 1RJLB 3AEIA 3KL0A 2Q10A 1FYHB 3NG5A 1LNQA 3O81A 1L3WA 1N3NA 1WUNT 4X8GA 3RQ3A 4LPVA 5C07B 5DMGC 4QCIA 2W8CA 2HFFA 5L9DL 3F6LA 3KYOA 3MLSH 4ZSOE 2F1MA 2BERA 5CHNB 4HFWB 2EIEA 5KVDE 3BKML 4PY7A 1LMKA 5GGVY 1FFXA 1BQHA 1URZA 5ALBL 1T04A 5M95B 5TK4A 3RTQB 3BHPA 3ZE2E 3MGTA 3BABA 5H2BA 4BFFA 4FNLL 3T1HO 4OCSL 3WEAA 3WN5B 2EIMB 2QA4V 1NEZA 1HHKB 3IDYB 2JKIS 2YRPA 5HVHC 1U8MB 4XOEA 5FKAB 4DV7O 3GXIA 4PW9A 3ZMZA 2Z91A 5F8RC 1BW8A 2FYYB 3WLBA 4PJIA 1XGQB 3ZHUA 4G42A 1I1AD 1VFAB 4E41D 1CICB 1E9PB 3VW3L 1AOZA 2YXHA 1MREL 2ZJSH 5AD0B 3I75B 1NQBA 3QXAB 4EE2A 2FJGB 3R7RA 2YC1A 3KCYA 2K7QA 1F23A 2KKQA 2COVD 4TULL 2HT3C 1OGAB 1P6AB 2BSTB 2ZM6B 4ANWA 1MSPA 2PO6D 4IYKA 1HDMB 4FG4A 2HA1A 4NXNO 2F7RA 3QJQB 4OUUB 5D5PA 1ILSA 4IHJA 4B96A 1IGIH 3J8F7 4N20A 4X4ME 1FNSH 3JAKB 1ROCA 2DWEB 4G8AC 1S9WA 4DQOL 2X4PB 3MGOA 4UQ3B 2BC4A 2CIIA 4F15B 1BFVH 2FQFA 4JM2B 5CCKH 1RJLA 5DS2A 1CXLA 1Q72H 1K6QL 4JFDB 1RSYA 2GHZA 1QWHA 2NX5E 4HX1A 5GJSH 15C8L 3VFWB 3CDCA 2Z5UA 1N64H 2JJSA 4OPHA 4MDIB 3GSNL 3BFOA 3IAYA 2CDFB 3EBGA 3GLAA 4NHCH 1IILE 1KU9A 1JSYA 4P2RE 2HG5C 4FNPA 4Y2DA 1YI2V 1MRDH 2A83B 5CHNA 4ONFH 3FCTA 4PMEA 4GBXA 2BO0A 5LCVL 5E7FA 4AXWA 1A7BA 1CPUA 4I0PB 1PPIA 5DD5H 4EDXB 1KCUH 4M00A 5HP5A 3HZKB 1MCWM 4OCWL 4CC4C 4I9WE 3E80A 3Q01A 2WBXA 3DJRA 4NLHA 1HHKA 3EBIA 1S5HA 2DYRC 4PJ5E 3FTYA 1MZFA 1U8MA 3K0WA 4KJPD 5FKAA 4BH7B 1JUFB 3S3JA 4POZC 1UXMA 1XFPA 1XGQA 2AP2A 1JXKA 3ARSA 4IBQA 4LLYA 4W70A 3MV9D 5DJ8B 4PG9B 4F27A 1NLBH 5EYPB 1CICA 4BFEA 2BSKB 1SHMA 2K6ZA 3FUNA 5AD0A 3ZBMA 3ZRWB 2EIJB 3I75A 3QXAA 5EEZA 3RAJH 3NGBB 2Q87A 1FFRA 1FNEA 1Y6KR 5HPMB 1WH0A 5TQ2L 4KQ3L 1OGAA 3ZDZE 2BSTA 2CGZA 2A99A 1A8ZA 2ZP0T 1MQ8A 4PAZA 3U1SL 3DHUA 4M43H 1SHXA 2NXZC 3AM8A 5J0BA 4KGJA 1P4BL 4OUUA 2ZINA 4KXCA 4JZNB 4CW1B 4JTDB 4F6RB 4EI5C 3HA0A 3TJHD 3JAKA 2ZWSA 5HSFA 2EVIA 1L9PA 3BVOA 2K6YA 4LARL 4L4TB 1SQPH 1IBFA 2WWOA 3KWXA 3IMSA 3PWUB 1PJ9A 4QGYA 5DXWA 4G3YH 4Y2NA 3SKOB 5A6MA 4FLWA 2F5AL 5ID0B 4JM2A 4PJCB 3T6VA 5AKTA 4OBRA 3KE0A 3KVQA 2AZAA 3PXLA 3TN0D 3ULUE 3RIAK 4MDIA 4QHUB 2P46B 1SDDB 3N42F 1XT5A 4MS8C 2CDFA 4FFZA 2AZ2A 4W9HC 1QA9B 4XMPH 2ADFL 3KLDA 3CVBA 1A3ZA 2A83A 5HI4D 1GY2A 3W5NA 4YSDA 2Q5ZA 2X4UB 1H3PL 4WV1A 2QZQA 1DSFL 1BZ8A 1W91A 3AY4C 4JN1H 4I0PA 3NP3A 4IU2B 1TJGH 1G0YR 4R0LA 3HZKA 3ZE1E 1R9FA 2Y69B 3EHBB 4Z7IA 2XWJB 2P90A 3NXSA 2VDKB 5CU9A 2BVPB 2IOOA 2K9FB 1RD6A 4MCMA 4LIQH 4OI7A 1K72A 2EDYA 2EXSA 4BH7A 2VIRA 2QGDA 1NIEA 1JUFA 1QAWA 1OCOC 2NSMA 3ATBA 2BK8A 5GS3A 3S96B 2L7QA 1LO2L 2ZUUA 3VXMD 1RZQA 4NTYA 2AQ1A 5DJ8A 1XSJA 4PG9A 4GKOA 1QUPA 1DFXA 1QFOA 1YJDH 3AG2C 2C9XA 2X87A 2XIDA 2YAMA 2ZWZA 3NN8B 3ZRWA 3LH9A 5B1AB 5C6TH 2X4TB 3KPRB 2GJRA 3VGBA 3H4FA 3OBAA 4O4IB 3DDFA 4CMMA 1E6JH 2CUIA 4M8RA 3IDJA 4JLRB 3V6OC 2F4VO 3CJHB 1QPKA 4HU8A 2Y7SA 1VEOA 1EZSA 5LMNO 4P2QD 3QUYD 4G9FE 3WUZA 2DBLH 4N2LA 4XVTL 4FYSA 4JI8B 3MRNB 5IUSA 2NY4D 2J7LA 4CW1A 1TPXC 4UNVA 1WA8A 4F6RA 3BEWB 4P59H 2AJVH 3HRZC 4ONHA 1RZGB 3NJVA 4ORGB 1SUHA 2UUAO 3ETSA 2CUMA 3PWUA 3QQNA 3T77A 2Q7NA 2J20A 1QNZH 3KH4A 5ID0A 1MCPH 2BM3A 4PJCA 5HGDA 4D2NA 1OE3A 1N6QL 4M6OL 4WI7A 5JXEC 2EACA 1OLZA 1N59B 3LIZH 4S1QH 1DZ0A 2R1YB 4YZFE 3VXSD 4NN7C 1EXHA 3DI2B 2IH8A 1HVXA 4DV1O 4BSVB 2BY0A 2XG4B 1MLCB 1NDGA 1DBAL 4LWSB 1BZOA 1H6TA 2IFFL 1ZTMA 3DSNB 2LTQB 2X4UA 1M2VB 1WLEA 2F6AA 2A06H 2BP8B 1BHGA 2NY6C 3SPJA 2QVTA 4JRXE 4K8RD 5CEZL 3G6BA 3NCEB 3V9CA 4DKTA 4OLZL 5FYLE 5A7EA 3BWUF 3I3BA 1ZGLP 3TCUA 2XWJA 4QPJA 3V4PB 4DUZO 2BVPA 2VLJB 3SBWA 4HBNA 1E3FA 3U48A 3KHOA 1D6EB 1CXFA 4BUHA 1G7LA 2TAAA 1J11A 3S96A 4Z7QB 4B95C 2F58H 4JJHA 1HS6A 4RISH 1H2LA 5GRYA 1R6NA 3NN8A 4HXBH 2KB1A 2D4DA 2MWCA 2XY1A 4PJAB 4L4VB 3B37A 2X4TA 3KPRA 4P5MB 4K3JH 5A43C 4DN3L 4O4LB 3GLZA 4LFAO 2DN9A 4EDWL 1UUNA 3O6FC 5GZNC 4O4IA 4XCFL 5IVZB 5JHDB 2VH5L 4JLRA 1BD2B 3EJZC 1IGCH 4RGMC 1ZIBA 3K1KC 1FRGH 2PYEE 3LV3B 1SY6A 1XHZA 3QCTL 4I3RL 1E8ZA 4GKLA 2XA8L 3MRNA 1A4JB 3MLZH 1G7HA 1QFWI 5JW4M 3UH8A 3CFCL 4EO5A 1ORQB 4XE5B 4PRIE 3BEWA 5KS9E 5HYJD 3ARGD 1RZGA 4ORGA 2Y1VA 3G5ZB 4PTUB 2G5BA 4KV5E 1EA9C 2JKLA 1UCBL 3VE0B 4OZGF 5D2LF 4X6BA 1ZLSL 3F00A 3L08A 3HI5L 3OE7G 5FPIA 1ZVHA 2OXGB 1LDSA 4X5XB 3FHEA 1FE8L 5LP6A 1N59A 3CCHB 3DMMD 3HG0A 4QXTB 5FIEA 4E2OA 5E6IA 1KDJA 1VENA 3GMQB 5AVXB 4ZTPH 3C5ZB 4PJ7B 1V7NL 1OSPL 2AV1B 4BSVA 1TJIL 3ET9F 2BJML 3I6LD 4LWSA 5GS2D 2OCCC 1FG2B 1ZXKA 3H6AA 2ALWA 3LPGA 5CB4B 3DSNA 3ZYJA 3RJDA 3EYUL 5CBGA 2BP8A 3LZRA 3B8SA 3RPKA 2AAAA 1UUSA 4UAOB 5H4ZA 2B9AA 5E1AC 2V2XB 1FNLA 3CC1A 3VX1A 3LRGA 4CN6A 2UXCO 3V4PA 3DPDA 4WFBV 2VLJA 3QEHB 1ED3A 4WNJA 1KBKA 1QFUH 1PZCA 1S5IL 5JIMA 4PRDA 1UD4A 5KBMA 3IDIB 4JCLA 3VRLE 1YEDB 1FNGA 3NT0A 1EUUA 2V5TA 2WZ0A 4L3ED 3CFKA 5GGTH 4AQYO 3ZLQC 5BO1H 3NYKA 5I15L 3PL6B 5DQJA 1UCTA 4FQIL 4L4VA 2FHCA 2MOGA 4PJAA 5F72S 4P5MA 3UTTD 3QJHB 4O4LA 2J1KA 3LQZA 2DMXA 1OSZB 2DICA 2PYFB 2A9CA 2E7BA 3BZFB 3EH4B 4G7YL 2NLJA 1NCBL 1P49A 4LRNH 1XQ4A 4N0FB 4NM8H 5AVTB 1P4IH 1X5IA 3CZSA 1JVMA 4QF1B 3GRWL 2AEOA 3S5LB 4LQ1A 4AGMA 1BM3L 3WNNA 2FUQA 2Z31D 2NY5L 2P7TB 3K6NA 5EZLB 3RUGA 4XVOA 4BKTC 3RL1B 1C16B 1MCLA 5J9PC 4RFNC 3WFBL 4Z5RB 4NZTL 1FXHA 3SE8H 3V6ZB 1ORQA 3I55V 4FCHA 3NZHL 3OB0H 4GEJA 4LPUA 3CMAV 2FJHB 4NQUA 4AYEC 1NCWH 5F6IB 3BSZH 3G5ZA 4MQ7B 4PTUA 5C9JA 5TF0A 1A4CA 3H7LA 3VE0A 2JJUA 2ZXQA 4H5SA 5K69A 2RJZA 4OLXH 4X6DF 3KXFB 2FO4B 4UOW1 4X5XA 4EZJA 3E8UL 2QSCH 4JB9L 3CCHA 2XRAL 3WV0A 2XN9D 2WCPA 2C3WA 3GMQA 3OHMB 3VTMA 4E42B 4PJ7A 5KYUB 2W59A 3P4OB 4UBDD 4XN2A 4FMFA 1VQ7V 1FSKB 2NNUA 3NJXA 1FG2A 4YLBA 2ROYA 5CZXC 1EZVY 4HDIA 1M9NA 1EEUA 2YAPA 2CO2A 2O57A 5EIQA 2DMGA 3D06A 4B3SO 2ZF8A 4HWUA 4MVUA 4MHHI 4DW0A 1QVGU 4DGUA 2YAQA 2BDNH 4KKNA 1KB5A 2VITA 4UTCA 4KZDL 3TNMB 2V2XA 1MMMA 1E50A 2ITCA 2ADJB 5KJRL 1U3ZA 1YIJV 4MTXA 1O9ZA 2CO3A 2IXQA 3QEHA 4OTXL 2DOCA 4A55A 4IS6B 4NUPA 4MVRA 1YCSA 1J0ZA 4L18A 4H13B 5IW6B 2VM3A 1MAKA 1QZ1A 4YDVB 1K7DA 1SLUA 1GZQB 2FB4L 2HT2D 2Z9TA 3IDIA 1N34B 2YBGA 1YEDA 1CQKA 4AV0A 4EN2A 3K72B 4H25B 4NGHL 4JDVA 3PL6A 5EZIH 1CLOL 4FLUA 3ERXA 5IHHA 1OAZL 1CXHA 3QJHA 5IJVB 3P3UA 1MFBL 1CDIA 2F54A 4GKJB 2PYFA 4ENED 4N8PA 2WD0A 1TQWA 3T5WA 4N0FA 2RMKB 4ZS7L 1JVKA 1TENA 2XNAB 4LVNC 1C5CL 4Z76B 4RMTA 1JYXA 3S5LA 3JUYA 3U10A 3CZNA 4RGND 3JWOL 3V79C 2F74B 3GD1C 3RL1A 5EZYA 1C16A 2AFNA 3WG7C 2V33A 4A6YH 5EOCJ 2VLRD 3PHQB 1HNYA 2QQLH 1RZKH 1U36A 3SDCD 2NNAB 2KDGA 4K9EL 3ARBD 2FJHA 4PJGE 3GMOB 3L7EA 3BVDB 4Y9BA 4L8SA 4X6CE 1RVFL 4MQ7A 4NAJA 3UKMA 4EZKA 4R97B 2H1PL 2I85A 4WCEV 1F2XK 5AYUH 2AGAA 1SLVA 2D3JA 1QPPA 3KXFA 3G80A 1T5XA 3BCCH 2FO4A 3E86A 1VGEH 2G9KA 3NZUA 2ZE7A 4Y1TA 2ZWKA 3QZLA 5T3XD 3KGRA 1CF8L 5KYUA 1PLCA 5DZJA 3QH3B 1QR1B 1P84J 1RPQA 4LLMB 4NC2B 3UZQA 1UM4L 5K9JH 2BNRB 1BBDH 3FUHA 3IFLL 2E3VA 1OP5K 2RFXA 3TA3A 3FQ1A 3KPTA 2VN5A 2OIEA 2GB2A 1I3UA 3B7TA 4TQPA 5FFGA 5BRZB 4NXMB 3RWHB 3BAAA 3TNMA 1HCYA 1HESA 1IAII 1WLHA 4FQXD 5E5RB 3WXWH 1KTDA 3FPYA 3SGDH 4OZ4B 3W7SA 2WWWA 4HFUL 2JJSC 2VDLB 4UT9L 2H2SD 2PYLA 4RMBA 4IS6A 3BUQA 4NQTA 4TLUA 2ZNXA 5IW6A 4Y2DC 3HNTL 3FL7A 4JMNA 1GZQA 3Q8CA 4JPSA 3ZXAC 3TYGH 3DGGB 3MA9H 1KY6A 3K72A 4GBXC 4QIWF 4H25A 3OAZH 3KYAA 3UL4A 3WJJA 1TZAA 2GAZA 4FFTA 5I73B 3S5YA 2Z7WA 1RUQL 2TSAA 1DBJL 1P5VB 2FECI 5IJVA 3EKCA 4XC3H 4HLZH 4FG0A 2WKLA 1NINA 3IDYC 4JFYB 4YC2B 1S5HC 2ATPB 4P46B 4BFGA 1UZ8A 2WQVA 5F7DB 1IAKB 1U21A 3TBVA 4ANUA 4BA8A 2BVQB 1OALA 5CM1A 4DV6O 2F74A 2WLHA 5ETUB 1NC2B 2OKMA 4J9ZB 2D9CA 4DR5B 1RPUA 3FT9A 1CICC 1FHNA 4AL8C 2NNAA 5I66B 5E2WH 2G38A 3KBHE 3UTSB 3BAWA 4XWGL 3GMOA 1HILB 3Q1SL 2IV9A 3P4LA 1G9NC 3KPOB 4LCWB 4AKQA 3MRQB 5DS1A 5ESQA 5I1CL 5EORH 3W38A 2J73A 2AK1H 1EO7A 3MXVL 1GPOL 4ZZFA 4OUOA 3RX7A 1EHNA 3RLSA 5MEPA 1DF4A 1A9EB 1NBZA 4JFOA 1INDL 5IQ7L 4RA3A 2YGQA 1H8LA 4K94C 5GJTH 3AM8C 3QH3A 1QR1A 1FS0G 3C2AH 2EUXA 5E9DD 4MFHA 2CIKB 2BNRA 4NJ9H 2HTKC 4ZPTB 2WXGA 1HYSD 4WI2A 1NFAA 3A47A 5D1ZD 1KGIA 3T3PE 1S2EA 1T7WA 4OJCA 3B7UX 5GSVB 3FT0A 4DEWA 3VI4E 1NGZB 5EBLB 3MVSA 5BRZA 3IBEA 4BWAA 4KXBA 3RWHA 3K5RA 4F15C 4JM2C 1QHPA 1BVNT 5IROD 4LP5A 2KC0A 3VXUD 4Z1PA 4WIQA 4OZ4A 3OW2U 2BZDA 3DV4A 4FZEH 2GK0A 2UXBO 3FPXA 1ZDSA 3RVVC 5IZ7A 2VR3A 1QCEA 2ALAA 4FJZA 5CJQH 5CIPB 3MLRH 1JK8B 1XH0A 3ZE2F 4LXFA 3I50H 2JDIG 1ORSB 4GT1A 4HHWA 1A47A 4DZBA 4WV1C 2EH8H 2BSEA 4XRCB 3NZ8B 4JPIA 4I0PC 4BIKA 1PU0A 3BPLB 3KCXA 4R0LC 5CSGA 4DAGL 3MBED 2EKSB 4NZRH 2NY1D 4JFYA 4KBPA 4P46A 4PIRF 2ZOUA 1IAKA 1L0QA 4PA6A 2BVQA 1IC1A 1KFGA 4ZNEE 5L0QB 1N5YL 3GZQA 5ETUA 3M45A 3T08A 1NC2A 1ND0B 5GISL 2G75B 4WFFD 2JKNA 2AXHA 1Q9KB 4N8CH 4R6UA 1XEUA 1MRCL 1WP8A 3UTSA 3OXRB 3VFMB 3MBWB 1HILA 2EIJC 4K71C 5J7CC 5FUZH 3JAMN 1BMFG 1TFPA 1TQSA 3QG7H 1B0WA 3NGBC 3GBML 4RX4D 5F7WC 3RFZB 2DQTH 2KDYA 1P0SE 2WXMA 3HPLA 2HFTA 4LCWA 2QDWA 3MRQA 2H32H 3ZYIA 1E67A 3FN9A 5JMOC 1G6VK 3FCUB 1QSFE 3BFQG 1A9EA 5CZKA 1YNLH 3H0TB 2NR6D 4HJJH 1GK9A 4FQHB 3WNMA 1Y6NR 4O2AA 4DUYO 5B38G 3MCYA 2YAEA 1Q9OB 1U6AL 4OAWA 5DEFA 2CIKA 5AOIA 2JH2A 4ZPTA 1BREA 1VPOH 3D3VE 5BS0B 3VD0A 1KIPB 1LP9E 2EAEA 1JWMB 3QBTB 1NGZA 1KJ2H 2XC8A 3BHBA 4F5CA 3EADA 3EVKA 1RZFH 3OFNG 1GGUA 4MNGE 3SQOH 1M4KA 4EAEA 4F33B 4HBQA 5JHLL 3P3TA 4GX5A 4ZQKA 2XWBB 1R24B 3QPQC 1PVHA 3LSQA 1SJEB 2CSPA 4WEBL 4JE4B 3QUZB 1I53A 4BJLA 4KAQH 3R0MA 4UVAA 1OY3B 3F8UB 4I1PA 1W6LA 5D6CA 3U1QA 1U91B 4A68A 4CVUA 1DVFD 1BX2B 2YOCA 3ZTDC 3ZDXE 1ONQA 3NZ8A 3EJYC 4WW1B 4KTGA 3AXLB 3GHEH 4OB5L 2Y69C 4S10A 1E8WA 1BXAA 4MZ2A 3EHBC 3SBWC 1NGXB 4QRTB 3DROB 4JYAB 4HD9A 2VDML 1MHPL 1KGCD 1BZQK 1LJMA 3PJNA 1WZMA 1B2WH 1HHJB 3HMWH 1RMFL 1BEYL 4K7FB 4Z7AA 1KTBA 1KYOJ 1Q9KA 5I30L 1YY8A 3VFMA 2FL5B 3ZDZF 2TRYA 1J9RA 2P22C 5B1AC 2E8ZA 3QQXA 3U4BH 3RFZA 2BS71 2SODB 4G80B 4MCNA 1ESOA 1AO7B 1G7MB 1LHZA 5LGNA 2OTUB 1DJWA 4PRPE 2O5ZL 4EQ2A 5JWPA 4GW1A 2JQZA 2ZUWA 2CO7A 3BVWA 3RB7A 5IOKA 2GJ6D 1Z9PA 2VOTA 4J28A 4YHNB 4DV0B 3X11B 3VFGH 3EOAB 2QGBA 1Q9OA 2Z92A 3QDJD 4PJ6A 4UWQB 2BWIA 5CA0B 4M5SA 4WFEE 3P3SA 5K9OB 1I9IH 2EIZB 3L3IB 4JRYB 4GUNA 5BS0A 2FTKA 4DW2L 1T2QL 3CN2A 1P4RA 4ERSH 3ULUF 4UQEA 1GRJA 1TITA 2K3HA 1MQKL 2X7LA 3G5VB 3BRFA 5F8QC 3OKOA 3PP4H 4XPTH 3TURA 1K4DA 5LP6C 4FTVD 1GYVA 4AI8A 2MCMA 5E6IC 4UNUA 5EU4A 5B7EA 1MIMH 1KXHA 1PNLA 2WLZA 3NJGA 2JCCE 2AQ3A 2XWBA 1R24A 3QZNA 4P8QA 1OEZW 4LSSH 1SJEA 3MAQA 3QUZA 3B3BA 3B2VL 1UA7A 1HL5A 1BF5A 3ZE1F 4YHHB 2XKUA 1U91A 2NY3B 4FXTA 5IJKA 4YHOH 4QTIL 1BX2A 2WZ5A 1W0VB 1XGPB 2XICA 4BQ9A 3B83A 1E5AA 5C8YB 5EC1B 1A8JH 1TTBA 3IJYA 4F2ME 4EIBA 3AXLA 2F15A 4GSDH 1ULVA 2DS4A 4LF5B 5DZLA 4QRTA 1N12A 4ZJ9A 4TMPA 3O6LL 2YLHA 2XX0A 1AHMA 4ZMQA 4FX5A 3NAAL 3BKCH 4R7VA 4TSAL 1HHJA 2O93L 3IGKA 4LVOC 1UWEL 1BVKA 1WD8A 3LNGA 2DWDB 3ELQA 2DAVA 1R47A 3REVB 4M48H 3H1ZA 4CH6A 3KCWA 4PJEA 4ECNA 2EJ7A 3I02B 3O2WL 5E23A 1AO7A 2VXSL 2WW8A 1G7MA 3TU6A 2OTUA 1CFNB 3LQAC 3QXDA 1BVNP 2NLJC 2QPSA 4PHZA 3TO2B 2ZYHA 4MXWL 3MCKB 4JFFE 4UCFA 3S3XA 5T8IA 3C60B 2XUMA 3MMEB 2CKBA 1LE5B 2WYHA 1M90W 4I3GA 4NRXB 4HJ1A 4XXCA 4YHNA 5JIKA 3VWJA 3X11A 4QXUH 4DVBB 2NQ3A 3CLEH 3OMIB 1Q0YL 3CHSA 4JGUA 1ORQC 5CA0A 3CC7V 3L3IA 4JRYA 1WFNA 1II4E 5C08D 4YZFF 1WNSA 2PI4A 5DJ2B 1KCSH 1NVPB 1JHLL 2A9ML 3IKKA 4FF9A 1ZLWK 1JF1B 3Q2LA 3MLWL 4J3OF 4W9IC 4AI7A 3T2LA 4NKOA 2R0ZH 2XWEA 3ZZQA 1EEYB 1SOKA 3ESMA 2HH0L 3K2UH 4J6RH 3D87B 4F57L 3DYOA 3MRHB 1MI5B 3ZN0A 4X66O 2BOBB 3D9AL 3NACH 3QCVH 3HC0A 4OD3L 1T1XA 2ICEA 2ZXAA 5D71H 5IB2B 4P49A 1A6VL 3QEGL 4LCYA 3DC5A 3TV3L 3WKML 4DR6B 5KLVH 2I9TA 1LGVA 1W0VA 1XGPA 4YE4H 2AHIA 5C8YA 1PAMA 3X14B 4PM1A 4N86A 1AZBA 4LSUH 4PP1D 4M1CC 2ITCC 4ICXA 1N9PA 2W9EL 1SF3A 1AKPA 5H37H 3U0TA 4YJ2A 1I5YA 1XHXA 1L9SA 2G5UA 3FO1A 3BISA 4P3CH 3MAWA 3Q1EA 4M7KL 3KEHA 3GZPA 5DRWA 1ZLDA 2D0FA 4XNXH 5CSZB 1UYWH 4XCCL 3Q9PA 4PV9B 3K08A 3A67L 4ZG1A 2DWDA 3QZWG 5C1MB 2QPEB 4H8QA 3E8FA 4DKEH 2VDKH 3PL6C 2OMYB 1G43A 4UV7H 5DUJA 4TPRL 4BAYA 1H3GA 3N6YA 4B53A 4IM8A 4N6RB 4GIPD 5D4QA 3V6OE 5I6KA 2BHZA 1CFNA 1BL8A 3TO2A 1LR1A 4CSTA 2DQIH 3CVHB 4UINH 4FD0A 3MCKA 3C60A 3C6SB 3MMEA 4XVUD 1FZKB 4TSCL 1N0NA 4AVKA 5KS9F 3VYPA 4NO3A 4NRXA 4TVPE 5MERB 3VD4A 4JUSA 1NZ6A 4KV5F 3F5WB 4GAGL 1RUML 1NTMH 1JHTB 1BE3H 3PP3H 4FYQA 4K3HA 1OARH 3U4EB 4QHLA 1Z66A 4HYOA 3NCFB 2OMVB 4L8SC 5F6IC 4ZUTA 1HL4A 4C56E 4DVRL 4H88H 4PREB 2QTOA 3O3EA 5DJ2A 1FHGA 5FYJE 3VM7A 4PBWD 1UT1A 1Z0MA 5FS5A 4FMVA 3K6SB 2CAZC 4DO4A 1TTAA 3I9PA 4GW4B 3ABGA 4QRRE 3VGEA 1JCHA 4J3OD 1SQXH 5B1NA 1PCXA 3ECVA 2ZCHH 1MI5A 3MRHA 4YL4A 4JHUA 4JFZL 2JCWA 1HKLH 3LKQB 2BOBA 4MD4B 3IFPA 3H1IH 2IFGA 2R69A 2HWZL 2YD5A 5CR8A 3H9YA 5IB2A 2NDGA 4M93B 3UBXG 3U9PH 3TA3C 1JXJA 2PW2B 4FOMA 2V8LA 1RXLA 2LU3A 4I85A 3RVXC 2GHWB 5CAYB 4ETQA 4FLRA 3X14A 3KM1A 2OAAA 4PVBA 2ZX6A 1IC5H 4R8WL 4ZTOL 1SJMA 1G1OA 4JPKL 1OAUH 4M61B 1DTUA 4LPXA 1FXKB 2APBA 4AHCA 4PRHE 3BP6A 1XB8A 4J39A 4MA3A 1HEHC 3IDGA 3VRLF 3DXAE 5SX4H 7CGTA 3TV8A 1J87A 3E2EA 3KM2A 1FIGL 4AC2A 1KYDA 5I16A 3QG5A 4H13C 3MRGB 4LEXH 2CK2A 4IJTA 4KRMB 1HT6A 4Y7OC 5KANI 1THZA 3EOYG 2JJ1G 4JJOA 1MZYA 1RP3B 2DQHH 2F8OA 3ZHQA 3IVKA 2CE4A 4AYFB 5CEYB 4JZOB 5TFSH 1G7IB 3N44B 1ZLUK 2OMYA 3TL5A 3WJJC 1UEMA 1W9XA 4TQIA 4E36A 2WXOA 3UJTL 5JW4N 1XZWA 1E8YA 1TJHL 2VXVH 4G9DB 4L1BA 2YBRB 2LP7A 1EXUA 4JO3L 4PJBF 1NGPL 1GOFA 1NAMB 4I55B 3CVHA 3OF6D 5AW0B 3QP3A 3B43A 5FOBA 2HVKA 1FL5B 3C6SA 3FCBA 3MUHL 4NC1C 1FZKA 4S1SL 3UT5A 3DVGB 3MLVL 3UG3A 2VR8A 5MERA 1ET8A 3MRPB 3VXPB 1N68A 1LO5A 3CXDL 3TVMD 2XT9A 3F5WA 3JV5A 4JZ2A 3WFZA 5F0MB 1JHTA 1W6WA 2EEBA 1F4AA 3CQPA 3L3JA 1UVQB 4RSYA 3JTSB 2OMVA 4GT7A 4MA1C 4FA7B 4R97C 4PREA 3O3AB 3HVNA 3II3A 2PYJA 2IPTH 1QX1A 4XP5L 3HHSB 4BHUI 1MVYA 3QO5A 1QKZH 4FG6D 3NMEA 3WELA 4X7TA 5F88B 3K9SA 3LKQA 4MD4A 2DQEL 5F0JB 4KPHH 43C9B 1XCQA 2RBLA 4DFIA 1BPLB 4FQJH 3ARDA 1MCIA 3X13B 1KCRH 1YAZA 1DJYA 5I1GH 3U4AA 2PW2A 3LKPA 3HN5A 1UWGH 3U0PA 3BH8B 4HCGA 4BELD 2CTWA 4M61A 1U92B 2WXQA 3JWNC 3JSNA 4TNEA 1N0XH 1TETL 2E46A 2NMSA 5IB5B 2A6IB 3BP7B 3V0EA 3HMXL 3X3FL 1LEIB 4MB3A 3MJ6A 3MRGA 3CGTA 2WWMC 2ESVE 3ZE0B 4AITA 1D5IL 2ZX9A 4PJHB 2AK4B 4AYFA 3Q43A 1FL6A 2QHLA 1G7IA 4JZOA 5CEYA 2HYMA 3TOPA 5I73C 1K5QA 5KSAB 3LRSB 4G9DA 4G5ZH 4LLQB 3RGVD 1I4FB 4Q20A 2YBRA 2VXTL 3IDMB 4GP5B 5BVPH 2OJZH 3HG4A 3L3KB 2JKRM 4YC2C 1FFNB 4P46C 1R34A 2N0MA 2ZE0A 1NAMA 3ZO9A 1PKXA 4I55A 1T66C 3VD7A 4YXKH 1UH2A 1FL5A 2DQJL 2EICA 4PIBA 3U6XS 2K9PA 3MLYL 3V0AC 3DVGA 3MX0A 4K0KB 4PJGF 4U6TA 5BVJA 4FN0A 4KKBD 4X6CF 5FLVA 1BEXA 7PAZA 4HK0B 1G6RL 3QUXB 4O58L 4XMKH 3UX9B 3FSOA 4W81A 4P5SA 3NZSA 1B9KA 1IEBB 2XJKA 4YSPA 1UVQA 2G3NA 3JTSA 4M9PA 1QWNA 5L3FA 1A6UL 1QLEB 1SGKA 3P30H 5HHOB 4D8PB 3HPLC 3GBNL 3O3AA 4UM9D 4EN3B 2XAGA 4AIEA 4PYHA 2FO8A 2NR5A 4XB3A 4K7PX 4AILC 1XH3B 4K9JA 1N32B 5I1LB 3OJVC 1FORH 3CC2V 2R29A 1JNLL 2XQ0A 3IU3B 2WUCL 1D6VL 3O6KL 4HJTA 5TGBB 1R75A 1UKSA 2C5DC 5F88A 4OJDH 4LLDA 5DD1H 4UQ2B 3FQXB 1SYSB 2P80A 3KD4A 4R2GC 3HNVH 3X13A 3FB6B 3CX5K 1WE5A 3UTPD 4PGJA 1BQLH 5GS2H 4OSUH 5HI3C 4PS4L 4OV5A 2G5RA 1OM3L 2OMTB 1TEGA 4D0DB 4J12A 5TPWL 1YZZA 4NP4H 1U92A 2ZG1A 2FYVA 3AU0A 5F7MC 2VYRE 3CCRV 1RU9H 4MVBC 1F8TH 3D39E 4XODA 4HOWA 4LLUA 2DKUA 5T5NF 4JREB 4O4HA 4Y5XA 2A6IA 3RN4A 2IAAC 4O5LH 4NUGH 2R23B 1OGSA 2NTFB 4KK6C 4U05A 1AXIB 4PJXE 3JTTB 3QFDB 2AK4A 5KN5A 4F92B 5DM6V 1BS3A 2RQ6A 1KKDA 3VQLA 5BXFB 5IB4A 1PEWA 4J1UB 4AE0A 3LRSA 3VX0A 4WO0A 4HJSA 4OM1L 4R90L 3L3KA 4HWBA 1QO3A 3MJGX 4HT1L 2BSDA