3F7VC

Kcsa potassium channel in the open-inactivated state with 23 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
AGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment Heavy chain
publication title KcsA Potassium channel in the open-inactivated state with 23 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7vC00
2HJFC 2Q68A 3UM7A 4OXSA 2EIMC 1OCOC 2YEVA 3ZRSA 2A9HA 4R50A 3LDDA 4EKWA 4PDMA 3SYAA 5IY5C 1QLEC 4MTFA 3F7YC 4JTDB 3RW0A 1OCZC 2Y69C 3FB5C 2X6AA 3AG1C 4MSWC 2BOCC 2ZD9A 3SYQA 1J95A 2EIJC 3K04A 3T4ZA 2P7TC 3E89A 4XDJA 5E1AC 4QE9A 2QTOA 1M56C 2WLLA 3ASOC 3OR7C 4RAIA 5B1AC 4CBCA 2ITCC 5CBFA 1V55C 3K0GA 2X6CA 3FB7C 5EK0A 5CBHA 2BOBC 2AHYA 4PA6A 3LUTB 3R65A 4X88A 2WLIB 1M57C 4WFHA 4PDRA 5BZBA 2X6BA 2W0FC 4UUJC 1BL8A 3E8BA 4KFMA 3OUFA 4LP8A 2DYSC 3FB6C 3SYOA 2WLJA 5EBMC 3VOUA 2IH3C 2WLKA 4GX0A 4WFEA 4MW3A 4PA9A 3UKMA 2DWEC 5KUKA 1OCRC 2A0LA 2HVJC 2AHZA 1R3KC 4ZBMA 1S5HC 3T1CA 4BW5A 4H33A 4F4LA 4MTOA 3ASNC 2IH1C 2Q69A 3RBZA 1KKDA 4MVZA 4PA3A 3K06A 3LNMB 4RO2A 4X89A 4RUEA 4GX2A 3STZC 5J9PC 3ABKC 3SPHA 4MVOA 3IFXA 4P30A 4MVQA 5EC2C 1P7BA 3STLC 3T4DA 3WG7C 4MVRA 3E83A 3F7VC 4LCUC 3FB8C 4PA7A 4J9ZB 2H8PC 2OCCC 4X8AA 3T2MA 3LDCA 2WLLB 3SPGA 4MVUA 2HVKC 3F5WC 2WLMA 2ITDC 3AG2C 2ATKC 2HG5C 3EFFK 4PA4A 3SYCA 2QKSA 3ABMC 3TCUA 1ORQC 3JYCA 5KUMA 3E8FA 4LBEC 4QE7A 5EBLC 1XL6A 4WFFA 3E8GA 1OCCC 3BEHA 4RUFA 3SPJA 2WLNA 4DXWA 3HPLC 4MVSA 4HYOA 2EILC 2ZXWC 4P2ZA 2Q6AA 1JVMA 3AG3C 2WLHA 4MS2A 2NLJC 3E8HA 3E86A 3OR6C 2JK5C 4MTGA 5B1BC 2R9RB 4QNHB 4TWKA 4XDLA 1G4YB 4P9OA 3SPCA 5B3SC 1R3LC 1K4CC 3TETA 5EBWC 3X2QC 5EC1C 2DYRC 1XL4A 3AG4C 3PJSK 4GX1A 2DWDC 3K03A 4P9PA 4R8CA 2KB1A 4H37A 3GB7C 4XDKA 2EIKC 4PDLA 4R7CA 3IGAC 1R3JC 3K0DA 4JTCB 4MVMA 1R3IC 3OGCC 4I9WA 1LNQA 4MW8A 3RVYA 3SPIA 3SYPA 4PDVA 3OUSA 4R6ZA 4WFGA 2EINC 2WLIA 4J9YB 4JTAB 2A79B 4GX5A 1ZWIC 3ZJZA 2Q67A 1V54C 4G27B 3K08A 5CBGA 3LDEA 3RVZA 3KG2A 4G28B 3ABLC 3SJQC 1K4DC 4HZ3A 2K1EA 2HFEC
chains in the Genus database with same CATH superfamily
4I50B 3NXSA 3W7UA 1AP5A 2EIMC 5LP6C 5J2TA 4NR1A 4GCZA 4GZRB 4K3AA 2YC0A 1NT2B 4LF8B 2Y4TA 4BIOA 4TUYA 4MSWC 2BOCC 3NR7A 2YICA 3P3NA 1FAFA 4FLZA 3OMAB 1O9HA 2ZNJA 2CH7B 2ZM6O 2EIJB 2X6CA 2A7WA 3QF7A 1GMGA 2LQTA 4FK5C 4WFHA 2D2CB 1M9NA 4UUJC 4KFMA 1WN7A 4FLXA 3JAMN 2YDEA 2LW1A 4TV9B 3JALA 4IGGA 2CTQA 2H3OA 4H33A 4F4LA 2GUZB 4LFBB 3JD4A 2AXTZ 2IH1C 3RBZA 4I50A 2PF4E 2GTSA 1THZA 2BTOA 1VEWA 2VQFO 2EZPA 1GRJA 1VQOV 5EZYB 1NJIW 1SESA 1EZVH 2XAGA 4UV8A 1AI6A 4JZ2A 3JYCA 3AG2B 1IVSA 3D3IA 4DV6B 4DK0A 4YXWG 3N2GB 1XHXA 1UFIA 4JI2B 4YHHO 4FVMA 4P9OA 4NB5A 5EBWC 3P32A 2CTPA 4YJ3B 3AG4B 4UVCA 3B4SA 3CPWU 4TT3G 2EULA 5JWPA 1BSMA 4LH7A 5LMNB 5EZYA 4DV5O 4DV2O 4DV7O 3ETEA 1VARA 2UUCO 3VBBA 2CUGA 4J10A 5DECA 5B1BB 2A9HA 3LDDA 5IT9N 2DYRB 3SYAA 4JI4O 1AVMA 2Z3YA 1Z2GA 2GSMB 3K04A 2UU9O 2QTOA 3O9OA 3OR7C 4NTYA 2Z5UA 1YIJV 1YTFB 1DLBA 3MD0A 2L6LA 1NR1A 1K97A 2HLDG 4LP8A 1VQ7V 2P6JA 2WLKA 2DYSB 5DM6V 4ZBMA 1NU1H 4FM1A 4RQFA 2JS3A 2IU0A 4X89A 3OD4A 1AR5A 1RPOA 2AGAA 2RMKB 2Q73A 4X8AA 5IYBO 2AZ2A 4HNAB 1F7YA 1R1BA 2DOSA 2QM8A 3G4SV 3G67A 1Q6IA 2F66C 1XDCA 1P84F 1BS3A 4DV1O 2Q0AA 1KQSU 2HR3A 3OT7A 4LF4B 4HYOA 2XAHA 2ZXWC 3AK3A 4JAUA 4XDLA 1GN2A 3CWBH 3W7WA 4W4KA 4XDKA 3G6EV 2RCVA 5C93A 5LOVB 4FM2A 5L3BA 3TXSA 1W2BU 1TGOA 2VRZA 4L8JA 4CC5A 4LFAO 4GT1A 1QVFU 4HNAA 1BCCH 1N32B 1BT8A 3JD3A 4H13B 2ZDIA 3SJQC 3OE7G 1EBOA 2WWWA 2HJFC 1JOYA 5A9GA 4BAYA 1Y6XA 2JGDA 4O2AB 5IY5C 1WB7A 3FB5C 2L35A 1G8MA 4JASA 3CHXA 3SYQA 1W59A 3QTCA 2ILMA 2HHHO 1SQFA 2ITCC 1SZXA 1XQ8A 5KX5A 4Q20A 3H1HH 4J41A 5KHHA 3LUTB 1PV0A 2WLIB 1IBLO 4JI3B 1VQMV 3ZRWB 3J7AU 2WLJA 2ZE7A 2VS0A 4EFBA 1Z5WA 1WNSA 3JARB 2DWEC 1OCRC 3HKCB 3T1CA 1KC8W 5B5EZ 4JI5B 4XBFA 4X65B 3HKEB 4MVQA 4O2AA 3F7VC 3IAYA 2LP7A 4A5UB 1JJOA 2QKAA 1RM1C 4B3SO 2UXCO 3PN1A 1K7DA 3B8MA 3F5WC 4EB6B 3THOA 2YUAA 3ABMC 3ZRVA 4CH3A 1JX9A 1TUBB 3ZEDA 1VQLV 5EBLC 1MZEA 5IWAO 5CA0B 1WPBA 2EILC 3ZRWA 3L73H 1VMGA 4K0KO 2JK5C 2UXDB 4NYKA 3HKCA 4QNHB 4TWKA 5IYDO 1YZBA 5EC1C 3T1YO 2ETNA 2E5LO 2VQEB 1BQ0A 2YIDA 3HKEA 1GH6A 2Y4UA 4X64O 4GUNA 2PI4A 2RN9A 2MK3A 1MNGA 2C2AA 1S5JA 3OUSA 4I4TB 4J9YB 4KP4A 4JI2O 4JI1B 4G27B 1QCEA 1HNWO 4X1YB 3UM7A 1R6TA 5CA0A 4TV8B 4JPRA 2RQ6A 1XEQA 4X1IA 1CP9A 2GBOA 1MG1A 1JA8A 1M5IA 2FYUH 5KHJA 3K5OA 3GWOA 1BHAA 3SJBC 4PJ0Z 2ZM6B 3E2EA 1V55B 2EX3A 2UUBO 1Q86W 3CCVV 2W0FC 4UCVA 5LGUA 3K59A 2FKXA 4DR2B 5LGTA 4WFEA 5D5QA 1I94O 1YJWV 1SQXH 3ASNC 3JATB 2LGWA 4LWSB 5C8YA 5KA5A 4E2LA 4FLYA 1WJZA 5BR8O 4J7ZA 3ZBHA 4TV8A 3UO2A 5KMGB 2CGOA 4CH5A 2KKWA 4NKGB 2IJKA 5GONA 5KUMA 1SQPH 1IBMB 3JD1A 2FB5A 4C7UA 3OMNB 1KP3A 1N4CA 3OTFA 5B1BC 1NI8A 4KHPO 3CRAA 1K4CC 3ZN0A 2D3OW 2DYRC 1XL4A 2DWDC 3JATA 4LWSA 5B3SB 2PTMA 4YHHB 4H37A 3IGAC 3JAWB 3K0DA 4JTCB 4ICGA 5KMGA 2P4VA 1SF9A 1MA1A 3SYPA 4LF4O 2LFSA 5KLVH 1EFRG 3RWRD 3TGUH 1Y74A 4B08A 2RDCA 4UXNA 4DV5B 5CBGA 3RVZA 4FZ1A 3ML0A 3ABLC 2HEPA 4CZZA 2UUCB 1G1XB 1LUVA 1XOUA 1M1KW 5LXTB 1WA8B 2EBOA 1OCZB 2P7TC 3B8NA 2K9PA 4XDJA 4JI4B 2V4DA 1PNLA 2XHBA 1M56B 3FB7C 2EINB 2Y48A 4X9QA 3W7TA 3JAWA 3RT3C 2R9IA 5JVDB 3OUFA 1M57B 3JASA 3KZIZ 4F6RB 4OPHA 4ZOLB 1YVWA 3RYCA 3M99B 2QSAA 1RSOB 2DN9A 3P30A 4MTOA 2Q69A 1KKDA 4DV4O 1B3QA 2QWPB 3H1IH 2OYQA 3APQA 3P3PA 3T4DA 3T2MA 5LXTA 1WA8A 1N0NA 3AG7A 2OCCB 2ZR2A 1VQKV 1ORQC 1XMQO 3W7XA 3BY6A 2XOKG 4UVBA 5KAFZ 4FLVA 5FLXN 4X65O 1OCCC 1ZAUA 5JVDA 2OTLV 3RYHA 4MVSA 3D3QA 1H38A 1XNRO 4F6RA 4DV1B 4ZOLA 3FFQA 4HBNA 3L9DA 4P9PA 3ZMTA 1DF4A 4BR6A 3RYFB 4MVMA 3OGCC 2Q9LA 4FZ0A 2OT5A 1BHBA 2YXHA 2A79B 2Q7GA 5LHHA 2UXDO 4O4IB 4LFAB 4ZI7A 3ABUA 1R6NA 1ROPA 1K92A 3AG3B 2YSUB 1B04A 5LHGA 2P06A 3WB1A 1KKCA 5BMVA 2A3QA 2RNBA 2P67A 4JAVA 2Y69B 3M8AA 1WP8A 4JI1O 4Z1MG 2LW7A 4MTXA 1VQPV 2E3CA 3IC7A 1IBKO 1KU9A 5BY1A 4UB8Z 3ZHQA 5JQGB 4CH6A 2DJVA 4WBNB 1FD9A 5BZBA 2O57A 5LGNA 1KMIZ 1IBLB 3OMIB 3UKMA 1VQ5V 3FAVB 4O4IA 4NTWA 1QLEB 3OFNG 3RN4A 4MVZA 2IJJA 2ZT9B 4ABMA 5CN0A 3IFXA 4UCOA 3AK1A 3ZX6A 2AW9A 3K57A 2QKCA 1YSCA 4DR2O 5LBQA 4MVUA 1VIBA 2QGNA 3CC2V 1YI2V 4B3SB 1FFTB 2UXCB 4NVPA 1I5XA 1WLEA 4WFFA 3L71H 3J81N 1L1FA 4TOIA 2XAFA 5IWAB 1AI7A 4FMTA 1KD1W 2OWOA 3FAVA 1TAEA 2R9RB 5CA1B 2ZIOA 4K0KB 3BA8A 1K9MW 4Z1VA 3CYOA 3JCUZ 3VQYA 1IBMO 2ZE5A 1BQZA 3T1YB 2CH7A 1JQ0A 2E5LB 2YI8A 3K5LA 2UXBO 1LNQA 4MW8A 3SPIA 4WFGA 4X64B 5IJ0B 3D8CA 3WU2Z 1ZWIC 1P7GA 1SQQH 5EIBD 2R72A 3K08A 4LH6A 4TV9A 1K4DC 3SR2C 4EEQA 3CSXA 4EFEA 2GUZA 2H94A 1PNKA 3ZCCA 1HNWB 4GLXA 3CXCU 3B77A 4GKJO 1PNMA 1I0HA 4DRXB 1SQBH 4UV9A 2OCHA 4UCUA 1O9GA 4WFAV 3ASOB 5CBHA 1K8AW 1BE3H 4UVAA 3CCLV 2ZQMA 1J5EO 2UUBB 5IJ0A 2QWQB 3N2GA 2F95B 4PA9A 1GAXA 2AHZA 4BW5A 3HR0A 5JJNB 5L3CA 1I94B 1ZTEA 3E35A 4GKKO 4YJ3A 4DR7O 4IL6Z 2GV9A 1Y67A 5BR8B 3LDCA 2WLLB 3ZHVA 4OGQB 1Q8IA 1OJHA 1N36B 1H2SB 2P4KA 2QKSA 3JSNA 1SRYA 3E8FA 3OTOO 3A8TA 1US6A 4QGPA 1S0VA 4X20B 5LMUB 5EIBC 1ZUQA 3RFRA 3AK2A 2Q6AA 1JVMA 2YS8A 3OW2U 3EHBB 1UJWB 3B09A 1EN4A 4DR3B 2YIAA 3IJ4A 3SPCA 2IW5A 3DSQA 3CCMV 3X2QC 2GTAA 1TA8A 3UO3A 4KHPB 1FXKB 1JMKC 1MMMA 4PDLA 1R3JC 2EZOA 3OGIB 3WB0A 3C90A 2VWKA 4UFZA 5K1XA 5JJJB 2JVDA 4O4JB 4QJFB 3C3TA 2QWRB 1IZ3A 3GWKC 1AR4A 2EINC 2JJ2G 5L3FA 4X66B 5KHIA 1PL0A 1GTOA 1ZLZA 2Q7EA 2IM9A 2W6IG 3CCUV 1S5LZ 3Q4HB 1OCOC 5E79Z 1XILA 4X20A 5FPRA 4R50A 3MDSA 4N21A 1KECA 4KL1A 1NR7A 4I55B 4JYCA 1GM8A 1CEZA 1D5AA 1HW7A 2YIBA 3OM3B 2ZR3A 1FXKA 5EK0A 2BOBC 1QR8A 5JCOC 5IYCO 4JI0O 3MHSC 3CMEV 1BL8A 3ZHTA 4X62O 3CXHF 3QVNA 1GN3A 4H0LB 2JGUA 4CC6A 4RUEA 5H2FZ 3DC6A 3GVMA 3Q4HA 1COWG 4P30A 2XASA 4DV4B 3KCXA 1P7BA 3DC5A 3WG7C 3ABKB 2P22C 1PD3A 4PA7A 5B1AB 2PY5A 1IXMA 3JAKB 4I55A 5LOVA 4YY3O 3OEHG 1MZFA 3CMAV 5H6QA 2LGQA 2QWNB 3DTUB 1PP9H 2QR4A 1PPJH 1XMQB 1NTKH 1Q6UA 1E79G 3TK1A 3HPLC 3ZMVA 4D6TH 4P2ZA 4DUZB 2QM4A 3L70H 3AG3C 1M90W 2ZCEA 1XNRB 1WAZA 5CMUA 1N8RW 3CRQA 1YEWA 2ADPA 3WB2A 1NS1A 2QE7G 4JZGA 3JAKA 2WLIA 3SJAC 2QEXV 1KBHA 2QWOB 5KHGA 2JRIA 1VF6A 3JARA 1B06A 1ZSPA 2HJDA 4FLWA 5AG2A 3ETQA 2QM7A 4EKWA 5LP6B 1QLEC 3F7YC 3SJCC 4X1KB 2WPDG 2X6AA 2CGNA 5IDJA 2CTRA 2EIJC 1HNXB 1QHTA 4QE9A 2G38A 5CBFA 4LF9B 1VQ6V 4EB6A 3M7MX 1Q5OA 3BA9A 1IBKB 1TUBA 1V54B 3ZHSA 2BE3A 1YJNV 3HKDB 2XNDG 1NH2D 3ZN1A 5KUKA 4K8ZA 5FNVB 2QA4V 3S3WA 1S5HC 2ADQB 1F4MA 4LR3A 2F23A 2CK3G 1VF5B 5ITZB 1XI1A 2ZE6A 4RQEA 5GW7A 1PL4A 3AG2C 3EFFK 4I4TA 4PA4A 1AI5A 2GHYA 2DW4A 2FMLA 4AILC 5F2VO 4PV1B 1IDSA 2DQ0A 2YI9A 1Y66A 4X1YA 3E22B 3QO8A 4FM0A 1QBZA 1N33O 4UB6Z 4MS2A 2XTAA 2NLJC 3RGBA 5JH7B 1N36O 2R70A 2XT9A 1S72V 2W6JG 3AG4C 1WP7A 3A0BZ 2CE4A 1RP3B 4DW0A 1Y76B 5LMUO 4I9WA 4PDVA 4B7KA 2QDOA 3ZHUA 1Q7YW 4DR3O 2UXBB 3B40A 3ZJZA 3LDEA 1VQ9V 4HZ3A 2W0XA 2MW2B 2Q68A 4D7SA 1G6UA 1BMFG 3E22A 4JTDB 3K79A 5LHIA 4X66O 1FS0G 5JH7A 4LC1A 1LUWA 4GKJB 4CBCA 4FFKA 1E1QG 1Y76A 1BGYH 1YCIA 2DYSC 5EBMC 1MSWD 1NVPD 2ZNIA 2HVJC 1J5EB 2FTKA 1M4UA 2B1IA 2YEVB 3K5MA 4RO2A 1I5YA 3AG1B 2IJIA 5B66Z 3ZIAG 2DE0X 1K33A 4GKKB 1CXZB 1SQVH 3CC7V 3APOA 4DR7B 2CAZC 4B3MO 2ZDIC 5IE9A 1QR9A 5HFLA 3CRRA 3UT5B 2OTJV 1YDXA 4FIPC 4DV0B 2AZ0A 3B2EE 4PD4F 3ABTA 3ETGA 3OTOB 2UXXA 4RUFA 3K9SA 3H9VA 1VQ8V 3ICXA 4MTGA 2ZXWB 4B3RB 4JYBA 3K58A 4FFBB 1R3LC 1X59A 2XAJA 1N34O 1L0NH 1K3EA 2F4VO 2M6YA 4CS2A 3T1HB 4IYIA 4MT8A 3U11A 3I56V 3QO7A 1LR1A 2KQXA 4DUZO 1I08A 4DR6O 1DF5A 1A32A 3LSUA 1SETA 1YXBA 3UT5A 2V7QG 3CCJV 4LF5O 1W0JG 4U3FH 4R8CA 1WB8A 3I55V 1AILA 4OX9O 1RSOA 1TVKB 3H01A 1YHQV 1QVGU 1HR0O 5IY5B 2ODMA 2WAMA 1J95A 2JDIG 1E1RG 4FFBA 3CCEV 2E76B 1XUQA 5B1NA 4UCRA 4F6EA 5B1AC 3ZMUA 4JI8O 3BPZA 2E75B 3N2KB 5LA6B 2B5UA 2B9ZA 3E8BA 4UCTA 3TJTA 2JIZG 4JI0B 3O65A 4JF3A 4ZHQB 1EN6A 2WSSG 3L72H 1HNXO 4DR5O 4X62B 5DN6G 3K06A 3LNMB 5GTIZ 4LF9O 3STZC 3QO5A 3RYFA 2H8PC 1URFA 1B6QA 2Q5ZA 4GYCB 1RM1B 2HG5C 1NBMG 4DO2A 4ZIBA 4DV3B 2OIGA 4YY3B 4LBEC 4QE7A 2JEUA 1GM7A 3VQWA 1XL6A 3ZMSA 1XBLA 3N2KA 5J2UB 5LA6A 3BEHA 3JALB 4DW1A 2WLNA 4DXWA 1FPOA 1VQNV 2ARHA 4ZHQA 3OR6C 2EILB 1H2KA 2GDSA 1FYJA 4GX1A 4LF6O 5K1PA 5DEDA 4OPAA 4I0XB 4W4LA 3RVYA 1Q6HA 1AR1B 5JQGA 4KUMA 4WBNA 1V54C 3LSQA 4B3TB 4CS4A 2JJ1G 4YIPA 2ZIMA 4R7CA 2HFEC 4BWAA 3CEIA 5J2UA 2UXNA 1Q90D 1I7FA 4NXMO 1FJGO 1BZKA 1AJPA 1GN4A 4JGSA 2B1GA 3RW0A 3JSLA 4IIJB 2ZD9A 3S3XA 5LL6Y 5FL7G 1VF7A 1IXBA 1H2GA 4J11A 1FXVA 3AEIA 1V55C 1D5NA 4TQDA 2BTQB 3CJHB 2PZSA 4I0XA 1K5SA 2Q0OC 3SYOA 4I9QA 1HWYA 3VOUA 3ZHRA 4TQFA 2A0LA 4DR1O 1R3KC 1H2MA 1F23A 4KXRA 4PA3A 5CA1A 1QLNA 1YITV 3ASNB 1T5EA 5L3EA 3W7SA 3IC9A 1Y4MA 3L75H 4YJ2B 3ZMZA 4IIJA 1K73W 4B7EA 1H2LA 2WLMA 1U97A 3CCQV 1XHZA 3TCUA 4IHJB 2DMXA 2PYLA 1K34A 4BW9A 3OEEG 2XUMA 2BTQA 3CJHA 1DK1A 2KSDA 2Q8VA 3SPJA 1GK9A 1P4RA 2UUAO 2ZE8A 4BIZA 1CPYA 1N33B 5B3SC 1SC5B 3EXAA 1NKDA 3PJSK 1VP7A 4DV0O 2A06H 4D7TA 4DRXA 1NH2B 4J80A 4H44B 1ZX3A 5HFMA 2VWJA 4YJ2A 3ZS8C 4R6ZA 4NXNO 1NTMH 3RYIB 4B3RO 1L8DA 4IHJA 3KG2A 4CS3A 3K9AA 4JYAB 3ABLB 3T1HO 5TISZ 4LF7O 1OCZC 3AG1C 2EIKB 2JEXA 2BSKB 3CB2A 4LNUB 3DXRB 1M56C 1ENVA 2WLLA 3BFRA 5L3GA 4TSFG 1SQGA 4WCEV 1M57C 2X6BA 5D5PA 1AI4A 2X0LA 1MSDA 3RYIA 2EJ7A 2F43G 1RFYA 2HKOA 2R9AA 2ZINA 5CA3A 3WFVA 4JI6O 2JGDB 3JD2A 3D36A 5H5NA 1XMOO 4DR4B 3STLC 1FFXB 3JCZA 3LNNA 4ZKIA 4AQYB 4J7KA 3FB8C 2OCCC 1GKFA 2FL4A 2BSKA 5KX5B 5H9CA 1RPRA 4LNUA 3L74H 4O4JA 1AB3A 3DXRA 4B3MB 4O4HB 1P49A 3TXQA 2LO1A 1EZJA 3E8GA 4JV5O 4Z2WA 4IT5A 4DUYO 1OCCB 3H1KH 1ZL8B 2WLHA 1G4YB 1U96A 2DQ3A 3OAAG 3G71V 4QIWF 4DV3O 4JAAA 4FLUA 1NVPB 1N34B 2EJRA 1QU7A 4WFBV 1FFXA 1R3IC 1HNZO 1NQTA 2F4VB 2YXYA 3A0RA 2WA3A 1SS3A 1KUQA 4O2BB 3FX7A 3ETDA 1Q82W 2Q67A 4O4LB 2OIEA 3JD0A 4DR6B 3KCYA 4LFCB 4O4HA 4OXSA 4LF5B 1X4TA 2HP8A 4LF8O 3ZRSA 1D2DA 4OX9B 1ZL8A 1Q43A 2KG7B 2Y69C 2RJZA 1JFFB 3T4ZA 4AHCA 1AP6A 3E89A 5E1AC 5B1OA 1QQCA 1SKVA 1HR0B 1S76D 2PI5A 1OZ0A 4B3TO 2XAQA 4J7JA 3K0GA 1FKAO 3VQXA 1NTZH 4Q6GA 2N04A 4JI8B 5BXZA 1GO3F 2N05A 1XNQB 2IH3C 1AJNA 1UPGA 4GX0A 4O2BA 3U0ZA 4LFBO 2EIMB 4RWUA 3QG5A 4O4LA 4DR5B 5KHKA 2P5OA 1DTOA 2IJHA 4X1IB 3FD9A 4ASUG 1JCHA 2IU3A 3BABA 3J80N 2KG7A 3LSSA 1PM9A 5JJEB 3MHHC 1W0KG 1JFFA 1SA0B 2QJ1A 2ITDC 3SYCA 2NN4A 5CB4B 1IX9A 4DV6O 1YF2A 4HAMA 1F4NA 2F93B 4JI7B 3CD6V 1S3JA 3BCCH 4JYYA 5IJ9B 2F1MA 1MABG 1YTFD 1OV9A 1SERA 5C8YB 1WPXA 5LP6A 1QNMA 4X1KA 2BCCH 3VQVA 3CX5F 4N23A 2Z0AA 5LMNO 4LF6B 1KYOF 1L0LH 4J42A 5GONB 3CCRV 1SA0A 3U10A 4GX5A 2M7WA 2QTSA 3HKDA 5CB4A 4PELA 5FNVA 2K1EA 2YIBD 1M93A 4U7OA 2PGGA 3HKBB 3BAAA 5IJ9A 4NTXA 4PDMA 4MTFA 2E74B 4DK1A 5ITZA 4E4EA 4NXMB 1AJQA 1FJGB 2Y0PA 3MAQA 3ASOC 1Q3EA 3FKSG 4U7NA 2AHYA 3CE2A 3CP1A 4JYAO 1FXHA 3R65A 4X88A 1R6KA 1KP2A 2LJ2A 4PDRA 2VQFB 3C3SA 4BIUA 1Y74B 4K35A 1V9PA 4MW3A 4L87A 4UCSA 2NR5A 3HB3B 1Z5VA 4DR1B 4FLTA 4GX2A 5J9PC 1AROP 3HKBA 4MVOA 3R66A 3H1LH 3CRCA 4MVRA 3E83A 4LCUC 2IBZH 4J9ZB 3CCSV 2HVKC 3A0HZ 3QNEA 5IYZB 2ATKC 1SZTA 3I5DA 5GTHZ 1MOFA 3JASB 4DYLA 4DR4O 1Q81W 4AQYO 2YXLA 1H2NA 3RYCB 3D36C 3E8HA 5L3DA 4DV2B 3E86A 4DV7B 3G80A 4PHZA 3TETA 4PI0A 3FYEB 1FXKC 1PKXA 2UUAB 2PYJA 4YIOA 2KB1A 2Q7HA 3X2QB 2EIKC 5FPOA 1K5QA 1KB9F 4CH4A 1N32O 4FPPA 2UU9B 4JTAB 4AI8A 3SDLA 5IYZA 2Q4PA 1H8EG 5H6RA 3CS5A 4NXNB 3SGIA 4G28B 1R73A 4IYHA 4I7ZB 3RYHB 1N0JA 2N74A 2YEVA 1HP8A 2NNUA 2CDYA 1NZ6A 3CRMA 1OCOB 1JJ2U 5A2QN 1XREA 4LF7B 2JS5A 3G6BA 2P90A 4RAIA 3BVOA 4FJCC 3UCSC 4LFCO 3ZRXA 1TUEB 4PA6A 4JI3O 4PI2A 2CTWA 3BRCA 1IURA 3FB6C 4ZI7B 2ZKOA 4G2KA 1GM9A 1GN6A 4JI5O 2WA4A 3ABKC 5BMVB 1EM1A 5EYPB 3SPHA 4JI6B 1JR9A 5EC2C 5KA6A 1VQ4V 1XMOB 3WG7B 3EVKA 4U3JB 3BHPA 3DGEA 2LFRA 1XNQO 3SPGA 1VF6C 1S77D 2PUSA 5LYJB 1EN5A 3FYIB 3CC4V 4K8XA 3A2FA 1OCRB 5J2TB 1JPXA 2X7RB 5JCOA 4JV5B 1TVKA 2Y0IA 4TUYB 3UQ8A 4DUYB 4QPKA 3K3WA 2VQEO 2V1DA 3K03A 3K5NA 3GB7C 4QPJA 5EYPA 4JI7O 1DGSA 3KKYA 3N27A 4WF9V 3ABMB 3F5TA 1H8HG 1OHHG 4I5SA 5KAIZ 4U3JA 3H1JH 1HNZB 1F51A 2HHHB 1HDJA 1YJ9V 5LYJA
chains in the Genus database with same CATH topology
3K9AA 3NXSA 3W7UA 3ABLB 2EIMC 1M1KW 2QM7A 4GCZA 4EKWA 1QLEC 3F7YC 1OCZC 2WPDG 2X6AA 3AG1C 4MSWC 2BOCC 2EIKB 5IDJA 2JEXA 2EIJC 2EBOA 1OCZB 2P7TC 3B8NA 4XDJA 4QE9A 3OMAB 1M56C 1ENVA 2WLLA 2EIJB 1PNLA 5CBFA 1VQ6V 1M56B 2X6CA 3FB7C 2EINB 2Y48A 5L3GA 3W7TA 4TSFG 2R9IA 1GMGA 4WCEV 1M57C 1V54B 4FK5C 4WFHA 2X6BA 1M9NA 4UUJC 4KFMA 3OUFA 1AI4A 1M57B 1YJNV 2X0LA 2XNDG 1NH2D 3ZN1A 5KUKA 2F43G 2QA4V 2HKOA 3M99B 1S5HC 4H33A 4F4LA 5CA3A 3P30A 3JD4A 1F4MA 4MTOA 2IH1C 2Q69A 3RBZA 3WFVA 1KKDA 3JD2A 3D36A 2CK3G 1THZA 3STLC 3T4DA 3JCZA 4ZKIA 3FB8C 2EZPA 3T2MA 2OCCC 4RQEA 5GW7A 1VQOV 1GKFA 1NJIW 1SESA 2OCCB 2XAGA 2ZR2A 4UV8A 1AI6A 5H9CA 1RPRA 3AG2C 1VQKV 3EFFK 4PA4A 1AI5A 2GHYA 1ORQC 2DW4A 3JYCA 3W7XA 3AG2B 3BY6A 2XOKG 3D3IA 4UVBA 1EZJA 3E8GA 2DQ0A 1OCCC 2OTLV 4YXWG 1Y66A 3QO8A 4MVSA 1QBZA 1OCCB 1H38A 4MS2A 2WLHA 2NLJC 1G4YB 4P9OA 2DQ3A 5EBWC 1S72V 2W6JG 3AG4C 3OAAG 3P32A 3G71V 4QIWF 4P9PA 3ZMTA 1DF4A 3AG4B 1NVPB 4UVCA 4MVMA 3CPWU 4TT3G 2EJRA 4WFBV 1R3IC 1NQTA 3OGCC 4I9WA 4PDVA 2OT5A 1BHBA 3A0RA 1Q7YW 2A79B 3ETEA 3ETDA 3ZJZA 5LHHA 1Q82W 2Q67A 3LDEA 3JD0A 3VBBA 1VQ9V 3ABUA 1R6NA 1K92A 1ROPA 4HZ3A 3AG3B 2YSUB 2Q68A 5LHGA 4OXSA 5B1BB 3ZRSA 2A9HA 1BMFG 3LDDA 2DYRB 3SYAA 4JTDB 2Z3YA 2Y69C 3K79A 2GSMB 5LHIA 2P67A 4JAVA 1FS0G 3K04A 3T4ZA 2Y69B 3E89A 4LC1A 5E1AC 5B1OA 1S76D 2QTOA 2PI5A 1OZ0A 3OR7C 4Z1MG 2Z5UA 4MTXA 4CBCA 1VQPV 2XAQA 3IC7A 1YIJV 3K0GA 1DLBA 1YTFB 3MD0A 1E1QG 1NR1A 1K97A 5BZBA 2HLDG 4LP8A 5LGNA 2DYSC 1GO3F 1VQ7V 5EBMC 1MSWD 2P6JA 3OMIB 2IH3C 1AJNA 2WLKA 2DYSB 4GX0A 3UKMA 1NVPD 2EIMB 1VQ5V 5DM6V 2HVJC 4ZBMA 2FTKA 2B1IA 4RQFA 1QLEB 2YEVB 3OFNG 4MVZA 4RO2A 4X89A 2IU0A 2IJJA 1I5YA 3AG1B 2IJIA 1DTOA 2IJHA 5CN0A 3IFXA 1RPOA 3ZIAG 1K33A 4ASUG 1JCHA 2IU3A 4X8AA 3LSSA 5IYBO 3MHHC 3CC7V 1YSCA 1W0KG 5LBQA 4MVUA 2ZDIC 2ITDC 3CC2V 3SYCA 1YI2V 1QR9A 1FFTB 5HFLA 2OTJV 4FIPC 2QM8A 3G4SV 1I5XA 3ABTA 1WLEA 4HAMA 4WFFA 3ETGA 1F4NA 3CD6V 1S3JA 2UXXA 4RUFA 1KQSU 1L1FA 2HR3A 4HYOA 2XAHA 2ZXWC 1VQ8V 2XAFA 1AI7A 4FMTA 1MABG 1YTFD 4MTGA 2ZXWB 1KD1W 1SERA 4JAUA 1WPXA 2R9RB 4JYBA 4XDLA 1R3LC 2XAJA 1K9MW 3W7WA 3CYOA 4XDKA 1JQ0A 3G6EV 1K3EA 4N23A 4MT8A 5C93A 3I56V 1LNQA 3QO7A 4MW8A 3SPIA 5L3BA 1W2BU 3CCRV 4WFGA 4GT1A 1QVFU 1DF5A 4GX5A 1ZWIC 2M7WA 3JD3A 3K08A 1SETA 2V7QG 3CCJV 2ZDIA 1W0JG 3SJQC 1K4DC 4PELA 3OE7G 1EBOA 4R8CA 2WWWA 2K1EA 2HJFC 3I55V 4U7OA 1JOYA 3H01A 4BAYA 2H94A 1PNKA 3ZCCA 1YHQV 4PDMA 5IY5C 4MTFA 1QVGU 3FB5C 1G8MA 3CXCU 3B77A 4JASA 5IY5B 1AJQA 3SYQA 2WAMA 1J95A 1PNMA 2JDIG 1E1RG 3CCEV 5B1NA 3ASOC 4UV9A 5B1AC 2ITCC 4WFAV 4Q20A 3FKSG 3ZMUA 3ASOB 4U7NA 5CBHA 2AHYA 3CP1A 3LUTB 1FXHA 1K8AW 3R65A 4X88A 1R6KA 2WLIB 1KP2A 4UVAA 2B5UA 4PDRA 4BIUA 3E8BA 1VQMV 2JIZG 3ZRWB 3CCLV 2ZQMA 2WLJA 4JF3A 2WSSG 4MW3A 4PA9A 2DWEC 1OCRC 4L87A 2AHZA 3T1CA 4BW5A 1KC8W 5L3CA 3HB3B 3E35A 5DN6G 3K06A 3LNMB 4GX2A 3STZC 5J9PC 3QO5A 4XBFA 1AROP 4MVOA 4MVQA 4MVRA 3E83A 3F7VC 4LCUC 4J9ZB 2H8PC 3LDCA 2WLLB 2LP7A 1RM1C 3CCSV 1B6QA 1K7DA 2HVKC 3B8MA 3F5WC 3QNEA 1RM1B 2ATKC 2HG5C 1NBMG 2QKSA 3ABMC 3ZRVA 4DO2A 1JX9A 1SRYA 3E8FA 1SZTA 4LBEC 1VQLV 4QE7A 2JEUA 1GM7A 5EBLC 1XL6A 3ZMSA 1MOFA 1S0VA 3BEHA 1Q81W 2WLNA 4DXWA 2EILC 3ZRWA 1VQNV 2Q6AA 1JVMA 3OW2U 3EHBB 1UJWB 3E8HA 5L3DA 3E86A 3OR6C 2EILB 2JK5C 4QNHB 4TWKA 3SPCA 2IW5A 3TETA 5IYDO 3FYEB 3CCMV 1FXKC 1PKXA 3X2QC 5EC1C 4GX1A 2KB1A 1FXKB 3X2QB 2EIKC 4PDLA 1R3JC 2EZOA 1K5QA 2PI4A 3RVYA 1AR1B 2MK3A 4QJFB 2C2AA 4KUMA 3OUSA 2EINC 2JJ2G 4J9YB 5L3FA 4FPPA 4JTAB 4KP4A 1V54C 1H8EG 4G27B 5H6RA 3LSQA 1PL0A 1GTOA 4G28B 1R73A 2JJ1G 1QCEA 4R7CA 2HFEC 2W6IG 3UM7A 3CCUV 1OCOC 2UXNA 2YEVA 2NNUA 4R50A 4JPRA 4N21A 1AJPA 4JGSA 1OCOB 2B1GA 3RW0A 1JJ2U 1CP9A 1KECA 1NR7A 4JYCA 1MG1A 2ZD9A 1GM8A 1CEZA 5FL7G 1H2GA 2P90A 1FXVA 4RAIA 3OM3B 2ZR3A 4FJCC 3AEIA 1V55C 1FXKA 3ZRXA 3GWOA 1TUEB 5EK0A 1BHAA 2BOBC 3E2EA 1QR8A 4PA6A 5IYCO 1V55B 3MHSC 1Q86W 3CCVV 2W0FC 3CMEV 1BL8A 1K5SA 5LGUA 3FB6C 3SYOA 1HWYA 5LGTA 3VOUA 4WFEA 4G2KA 2A0LA 1GM9A 1R3KC 1YJWV 3ASNC 1F23A 5KA5A 4PA3A 4E2LA 1QLNA 1YITV 4RUEA 3ASNB 3ABKC 5L3EA 3W7SA 3SPHA 1COWG 4P30A 2XASA 5EC2C 1P7BA 3WG7C 5KA6A 1Y4MA 3ABKB 1PD3A 4PA7A 5B1AB 1IXMA 1VQ4V 3ZMZA 3WG7B 3DGEA 2LFRA 2IJKA 3SPGA 1K73W 2WLMA 1S77D 3OEHG 3CCQV 3TCUA 3CMAV 5H6QA 5KUMA 3DTUB 3JD1A 3FYIB 3CC4V 1K34A 3OEEG 1OCRB 1JPXA 1E79G 2X7RB 3SPJA 3OMNB 3HPLC 3TK1A 3ZMVA 1GK9A 4P2ZA 1M90W 3AG3C 1P4RA 1KP3A 4BIZA 5B1BC 1CPYA 4QPKA 3K3WA 5B3SC 1K4CC 3ZN0A 2D3OW 1NKDA 2DYRC 1XL4A 2V1DA 3PJSK 5CMUA 2DWDC 3K03A 1N8RW 5B3SB 4H37A 3GB7C 1NH2B 4QPJA 3IGAC 4JTCB 3K0DA 5HFMA 2QE7G 4WF9V 3SYPA 3ABMB 1H8HG 1OHHG 2LFSA 4I5SA 4R6ZA 1EFRG 2WLIA 2QEXV 1F51A 4UXNA 5CBGA 3RVZA 1YJ9V 3KG2A 3ML0A 3ABLC 4CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJF C;  2Q68 A;  3UM7 A;  4OXS A;  2EIM C;  1OCO C;  2YEV A;  3ZRS A;  2A9H A;  4R50 A;  3LDD A;  4EKW A;  4PDM A;  3SYA A;  5IY5 C;  1QLE C;  4MTF A;  3F7Y C;  4JTD B;  3RW0 A;  1OCZ C;  2Y69 C;  3FB5 C;  2X6A A;  3AG1 C;  4MSW C;  2BOC C;  2ZD9 A;  3SYQ A;  1J95 A;  2EIJ C;  3K04 A;  3T4Z A;  2P7T C;  3E89 A;  4XDJ A;  5E1A C;  4QE9 A;  2QTO A;  1M56 C;  2WLL A;  3ASO C;  3OR7 C;  4RAI A;  5B1A C;  4CBC A;  2ITC C;  5CBF A;  1V55 C;  3K0G A;  2X6C A;  3FB7 C;  5EK0 A;  5CBH A;  2BOB C;  2AHY A;  4PA6 A;  3LUT B;  3R65 A;  4X88 A;  2WLI B;  1M57 C;  4WFH A;  4PDR A;  5BZB A;  2X6B A;  2W0F C;  4UUJ C;  1BL8 A;  3E8B A;  4KFM A;  3OUF A;  4LP8 A;  2DYS C;  3FB6 C;  3SYO A;  2WLJ A;  5EBM C;  3VOU A;  2IH3 C;  2WLK A;  4GX0 A;  4WFE A;  4MW3 A;  4PA9 A;  3UKM A;  2DWE C;  5KUK A;  1OCR C;  2A0L A;  2HVJ C;  2AHZ A;  1R3K C;  4ZBM A;  1S5H C;  3T1C A;  4BW5 A;  4H33 A;  4F4L A;  4MTO A;  3ASN C;  2IH1 C;  2Q69 A;  3RBZ A;  1KKD A;  4MVZ A;  4PA3 A;  3K06 A;  3LNM B;  4RO2 A;  4X89 A;  4RUE A;  4GX2 A;  3STZ C;  5J9P C;  3ABK C;  3SPH A;  4MVO A;  3IFX A;  4P30 A;  4MVQ A;  5EC2 C;  1P7B A;  3STL C;  3T4D A;  3WG7 C;  4MVR A;  3E83 A;  3F7V C;  4LCU C;  3FB8 C;  4PA7 A;  4J9Z B;  2H8P C;  2OCC C;  4X8A A;  3T2M A;  3LDC A;  2WLL B;  3SPG A;  4MVU A;  2HVK C;  3F5W C;  2WLM A;  2ITD C;  3AG2 C;  2ATK C;  2HG5 C;  3EFF K;  4PA4 A;  3SYC A;  2QKS A;  3ABM C;  3TCU A;  1ORQ C;  3JYC A;  5KUM A;  3E8F A;  4LBE C;  4QE7 A;  5EBL C;  1XL6 A;  4WFF A;  3E8G A;  1OCC C;  3BEH A;  4RUF A;  3SPJ A;  2WLN A;  4DXW A;  3HPL C;  4MVS A;  4HYO A;  2EIL C;  2ZXW C;  4P2Z A;  2Q6A A;  1JVM A;  3AG3 C;  2WLH A;  4MS2 A;  2NLJ C;  3E8H A;  3E86 A;  3OR6 C;  2JK5 C;  4MTG A;  5B1B C;  2R9R B;  4QNH B;  4TWK A;  4XDL A;  1G4Y B;  4P9O A;  3SPC A;  5B3S C;  1R3L C;  1K4C C;  3TET A;  5EBW C;  3X2Q C;  5EC1 C;  2DYR C;  1XL4 A;  3AG4 C;  3PJS K;  4GX1 A;  2DWD C;  3K03 A;  4P9P A;  4R8C A;  2KB1 A;  4H37 A;  3GB7 C;  4XDK A;  2EIK C;  4PDL A;  4R7C A;  3IGA C;  1R3J C;  3K0D A;  4JTC B;  4MVM A;  1R3I C;  3OGC C;  4I9W A;  1LNQ A;  4MW8 A;  3RVY A;  3SPI A;  3SYP A;  4PDV A;  3OUS A;  4R6Z A;  4WFG A;  2EIN C;  2WLI A;  4J9Y B;  4JTA B;  2A79 B;  4GX5 A;  1ZWI C;  3ZJZ A;  2Q67 A;  1V54 C;  4G27 B;  3K08 A;  5CBG A;  3LDE A;  3RVZ A;  3KG2 A;  4G28 B;  3ABL C;  3SJQ C;  1K4D C;  4HZ3 A;  2K1E A;  2HFE C; 
#chains in the Genus database with same CATH topology
 4I50 B;  3NXS A;  3W7U A;  1AP5 A;  2EIM C;  5LP6 C;  5J2T A;  4NR1 A;  4GCZ A;  4GZR B;  4K3A A;  2YC0 A;  1NT2 B;  4LF8 B;  2Y4T A;  4BIO A;  4TUY A;  4MSW C;  2BOC C;  3NR7 A;  2YIC A;  3P3N A;  1FAF A;  4FLZ A;  3OMA B;  1O9H A;  2ZNJ A;  2CH7 B;  2ZM6 O;  2EIJ B;  2X6C A;  2A7W A;  3QF7 A;  1GMG A;  2LQT A;  4FK5 C;  4WFH A;  2D2C B;  1M9N A;  4UUJ C;  4KFM A;  1WN7 A;  4FLX A;  3JAM N;  2YDE A;  2LW1 A;  4TV9 B;  3JAL A;  4IGG A;  2CTQ A;  2H3O A;  4H33 A;  4F4L A;  2GUZ B;  4LFB B;  3JD4 A;  2AXT Z;  2IH1 C;  3RBZ A;  4I50 A;  2PF4 E;  2GTS A;  1THZ A;  2BTO A;  1VEW A;  2VQF O;  2EZP A;  1GRJ A;  1VQO V;  5EZY B;  1NJI W;  1SES A;  1EZV H;  2XAG A;  4UV8 A;  1AI6 A;  4JZ2 A;  3JYC A;  3AG2 B;  1IVS A;  3D3I A;  4DV6 B;  4DK0 A;  4YXW G;  3N2G B;  1XHX A;  1UFI A;  4JI2 B;  4YHH O;  4FVM A;  4P9O A;  4NB5 A;  5EBW C;  3P32 A;  2CTP A;  4YJ3 B;  3AG4 B;  4UVC A;  3B4S A;  3CPW U;  4TT3 G;  2EUL A;  5JWP A;  1BSM A;  4LH7 A;  5LMN B;  5EZY A;  4DV5 O;  4DV2 O;  4DV7 O;  3ETE A;  1VAR A;  2UUC O;  3VBB A;  2CUG A;  4J10 A;  5DEC A;  5B1B B;  2A9H A;  3LDD A;  5IT9 N;  2DYR B;  3SYA A;  4JI4 O;  1AVM A;  2Z3Y A;  1Z2G A;  2GSM B;  3K04 A;  2UU9 O;  2QTO A;  3O9O A;  3OR7 C;  4NTY A;  2Z5U A;  1YIJ V;  1YTF B;  1DLB A;  3MD0 A;  2L6L A;  1NR1 A;  1K97 A;  2HLD G;  4LP8 A;  1VQ7 V;  2P6J A;  2WLK A;  2DYS B;  5DM6 V;  4ZBM A;  1NU1 H;  4FM1 A;  4RQF A;  2JS3 A;  2IU0 A;  4X89 A;  3OD4 A;  1AR5 A;  1RPO A;  2AGA A;  2RMK B;  2Q73 A;  4X8A A;  5IYB O;  2AZ2 A;  4HNA B;  1F7Y A;  1R1B A;  2DOS A;  2QM8 A;  3G4S V;  3G67 A;  1Q6I A;  2F66 C;  1XDC A;  1P84 F;  1BS3 A;  4DV1 O;  2Q0A A;  1KQS U;  2HR3 A;  3OT7 A;  4LF4 B;  4HYO A;  2XAH A;  2ZXW C;  3AK3 A;  4JAU A;  4XDL A;  1GN2 A;  3CWB H;  3W7W A;  4W4K A;  4XDK A;  3G6E V;  2RCV A;  5C93 A;  5LOV B;  4FM2 A;  5L3B A;  3TXS A;  1W2B U;  1TGO A;  2VRZ A;  4L8J A;  4CC5 A;  4LFA O;  4GT1 A;  1QVF U;  4HNA A;  1BCC H;  1N32 B;  1BT8 A;  3JD3 A;  4H13 B;  2ZDI A;  3SJQ C;  3OE7 G;  1EBO A;  2WWW A;  2HJF C;  1JOY A;  5A9G A;  4BAY A;  1Y6X A;  2JGD A;  4O2A B;  5IY5 C;  1WB7 A;  3FB5 C;  2L35 A;  1G8M A;  4JAS A;  3CHX A;  3SYQ A;  1W59 A;  3QTC A;  2ILM A;  2HHH O;  1SQF A;  2ITC C;  1SZX A;  1XQ8 A;  5KX5 A;  4Q20 A;  3H1H H;  4J41 A;  5KHH A;  3LUT B;  1PV0 A;  2WLI B;  1IBL O;  4JI3 B;  1VQM V;  3ZRW B;  3J7A U;  2WLJ A;  2ZE7 A;  2VS0 A;  4EFB A;  1Z5W A;  1WNS A;  3JAR B;  2DWE C;  1OCR C;  3HKC B;  3T1C A;  1KC8 W;  5B5E Z;  4JI5 B;  4XBF A;  4X65 B;  3HKE B;  4MVQ A;  4O2A A;  3F7V C;  3IAY A;  2LP7 A;  4A5U B;  1JJO A;  2QKA A;  1RM1 C;  4B3S O;  2UXC O;  3PN1 A;  1K7D A;  3B8M A;  3F5W C;  4EB6 B;  3THO A;  2YUA A;  3ABM C;  3ZRV A;  4CH3 A;  1JX9 A;  1TUB B;  3ZED A;  1VQL V;  5EBL C;  1MZE A;  5IWA O;  5CA0 B;  1WPB A;  2EIL C;  3ZRW A;  3L73 H;  1VMG A;  4K0K O;  2JK5 C;  2UXD B;  4NYK A;  3HKC A;  4QNH B;  4TWK A;  5IYD O;  1YZB A;  5EC1 C;  3T1Y O;  2ETN A;  2E5L O;  2VQE B;  1BQ0 A;  2YID A;  3HKE A;  1GH6 A;  2Y4U A;  4X64 O;  4GUN A;  2PI4 A;  2RN9 A;  2MK3 A;  1MNG A;  2C2A A;  1S5J A;  3OUS A;  4I4T B;  4J9Y B;  4KP4 A;  4JI2 O;  4JI1 B;  4G27 B;  1QCE A;  1HNW O;  4X1Y B;  3UM7 A;  1R6T A;  5CA0 A;  4TV8 B;  4JPR A;  2RQ6 A;  1XEQ A;  4X1I A;  1CP9 A;  2GBO A;  1MG1 A;  1JA8 A;  1M5I A;  2FYU H;  5KHJ A;  3K5O A;  3GWO A;  1BHA A;  3SJB C;  4PJ0 Z;  2ZM6 B;  3E2E A;  1V55 B;  2EX3 A;  2UUB O;  1Q86 W;  3CCV V;  2W0F C;  4UCV A;  5LGU A;  3K59 A;  2FKX A;  4DR2 B;  5LGT A;  4WFE A;  5D5Q A;  1I94 O;  1YJW V;  1SQX H;  3ASN C;  3JAT B;  2LGW A;  4LWS B;  5C8Y A;  5KA5 A;  4E2L A;  4FLY A;  1WJZ A;  5BR8 O;  4J7Z A;  3ZBH A;  4TV8 A;  3UO2 A;  5KMG B;  2CGO A;  4CH5 A;  2KKW A;  4NKG B;  2IJK A;  5GON A;  5KUM A;  1SQP H;  1IBM B;  3JD1 A;  2FB5 A;  4C7U A;  3OMN B;  1KP3 A;  1N4C A;  3OTF A;  5B1B C;  1NI8 A;  4KHP O;  3CRA A;  1K4C C;  3ZN0 A;  2D3O W;  2DYR C;  1XL4 A;  2DWD C;  3JAT A;  4LWS A;  5B3S B;  2PTM A;  4YHH B;  4H37 A;  3IGA C;  3JAW B;  3K0D A;  4JTC B;  4ICG A;  5KMG A;  2P4V A;  1SF9 A;  1MA1 A;  3SYP A;  4LF4 O;  2LFS A;  5KLV H;  1EFR G;  3RWR D;  3TGU H;  1Y74 A;  4B08 A;  2RDC A;  4UXN A;  4DV5 B;  5CBG A;  3RVZ A;  4FZ1 A;  3ML0 A;  3ABL C;  2HEP A;  4CZZ A;  2UUC B;  1G1X B;  1LUV A;  1XOU A;  1M1K W;  5LXT B;  1WA8 B;  2EBO A;  1OCZ B;  2P7T C;  3B8N A;  2K9P A;  4XDJ A;  4JI4 B;  2V4D A;  1PNL A;  2XHB A;  1M56 B;  3FB7 C;  2EIN B;  2Y48 A;  4X9Q A;  3W7T A;  3JAW A;  3RT3 C;  2R9I A;  5JVD B;  3OUF A;  1M57 B;  3JAS A;  3KZI Z;  4F6R B;  4OPH A;  4ZOL B;  1YVW A;  3RYC A;  3M99 B;  2QSA A;  1RSO B;  2DN9 A;  3P30 A;  4MTO A;  2Q69 A;  1KKD A;  4DV4 O;  1B3Q A;  2QWP B;  3H1I H;  2OYQ A;  3APQ A;  3P3P A;  3T4D A;  3T2M A;  5LXT A;  1WA8 A;  1N0N A;  3AG7 A;  2OCC B;  2ZR2 A;  1VQK V;  1ORQ C;  1XMQ O;  3W7X A;  3BY6 A;  2XOK G;  4UVB A;  5KAF Z;  4FLV A;  5FLX N;  4X65 O;  1OCC C;  1ZAU A;  5JVD A;  2OTL V;  3RYH A;  4MVS A;  3D3Q A;  1H38 A;  1XNR O;  4F6R A;  4DV1 B;  4ZOL A;  3FFQ A;  4HBN A;  3L9D A;  4P9P A;  3ZMT A;  1DF4 A;  4BR6 A;  3RYF B;  4MVM A;  3OGC C;  2Q9L A;  4FZ0 A;  2OT5 A;  1BHB A;  2YXH A;  2A79 B;  2Q7G A;  5LHH A;  2UXD O;  4O4I B;  4LFA B;  4ZI7 A;  3ABU A;  1R6N A;  1ROP A;  1K92 A;  3AG3 B;  2YSU B;  1B04 A;  5LHG A;  2P06 A;  3WB1 A;  1KKC A;  5BMV A;  2A3Q A;  2RNB A;  2P67 A;  4JAV A;  2Y69 B;  3M8A A;  1WP8 A;  4JI1 O;  4Z1M G;  2LW7 A;  4MTX A;  1VQP V;  2E3C A;  3IC7 A;  1IBK O;  1KU9 A;  5BY1 A;  4UB8 Z;  3ZHQ A;  5JQG B;  4CH6 A;  2DJV A;  4WBN B;  1FD9 A;  5BZB A;  2O57 A;  5LGN A;  1KMI Z;  1IBL B;  3OMI B;  3UKM A;  1VQ5 V;  3FAV B;  4O4I A;  4NTW A;  1QLE B;  3OFN G;  3RN4 A;  4MVZ A;  2IJJ A;  2ZT9 B;  4ABM A;  5CN0 A;  3IFX A;  4UCO A;  3AK1 A;  3ZX6 A;  2AW9 A;  3K57 A;  2QKC A;  1YSC A;  4DR2 O;  5LBQ A;  4MVU A;  1VIB A;  2QGN A;  3CC2 V;  1YI2 V;  4B3S B;  1FFT B;  2UXC B;  4NVP A;  1I5X A;  1WLE A;  4WFF A;  3L71 H;  3J81 N;  1L1F A;  4TOI A;  2XAF A;  5IWA B;  1AI7 A;  4FMT A;  1KD1 W;  2OWO A;  3FAV A;  1TAE A;  2R9R B;  5CA1 B;  2ZIO A;  4K0K B;  3BA8 A;  1K9M W;  4Z1V A;  3CYO A;  3JCU Z;  3VQY A;  1IBM O;  2ZE5 A;  1BQZ A;  3T1Y B;  2CH7 A;  1JQ0 A;  2E5L B;  2YI8 A;  3K5L A;  2UXB O;  1LNQ A;  4MW8 A;  3SPI A;  4WFG A;  4X64 B;  5IJ0 B;  3D8C A;  3WU2 Z;  1ZWI C;  1P7G A;  1SQQ H;  5EIB D;  2R72 A;  3K08 A;  4LH6 A;  4TV9 A;  1K4D C;  3SR2 C;  4EEQ A;  3CSX A;  4EFE A;  2GUZ A;  2H94 A;  1PNK A;  3ZCC A;  1HNW B;  4GLX A;  3CXC U;  3B77 A;  4GKJ O;  1PNM A;  1I0H A;  4DRX B;  1SQB H;  4UV9 A;  2OCH A;  4UCU A;  1O9G A;  4WFA V;  3ASO B;  5CBH A;  1K8A W;  1BE3 H;  4UVA A;  3CCL V;  2ZQM A;  1J5E O;  2UUB B;  5IJ0 A;  2QWQ B;  3N2G A;  2F95 B;  4PA9 A;  1GAX A;  2AHZ A;  4BW5 A;  3HR0 A;  5JJN B;  5L3C A;  1I94 B;  1ZTE A;  3E35 A;  4GKK O;  4YJ3 A;  4DR7 O;  4IL6 Z;  2GV9 A;  1Y67 A;  5BR8 B;  3LDC A;  2WLL B;  3ZHV A;  4OGQ B;  1Q8I A;  1OJH A;  1N36 B;  1H2S B;  2P4K A;  2QKS A;  3JSN A;  1SRY A;  3E8F A;  3OTO O;  3A8T A;  1US6 A;  4QGP A;  1S0V A;  4X20 B;  5LMU B;  5EIB C;  1ZUQ A;  3RFR A;  3AK2 A;  2Q6A A;  1JVM A;  2YS8 A;  3OW2 U;  3EHB B;  1UJW B;  3B09 A;  1EN4 A;  4DR3 B;  2YIA A;  3IJ4 A;  3SPC A;  2IW5 A;  3DSQ A;  3CCM V;  3X2Q C;  2GTA A;  1TA8 A;  3UO3 A;  4KHP B;  1FXK B;  1JMK C;  1MMM A;  4PDL A;  1R3J C;  2EZO A;  3OGI B;  3WB0 A;  3C90 A;  2VWK A;  4UFZ A;  5K1X A;  5JJJ B;  2JVD A;  4O4J B;  4QJF B;  3C3T A;  2QWR B;  1IZ3 A;  3GWK C;  1AR4 A;  2EIN C;  2JJ2 G;  5L3F A;  4X66 B;  5KHI A;  1PL0 A;  1GTO A;  1ZLZ A;  2Q7E A;  2IM9 A;  2W6I G;  3CCU V;  1S5L Z;  3Q4H B;  1OCO C;  5E79 Z;  1XIL A;  4X20 A;  5FPR A;  4R50 A;  3MDS A;  4N21 A;  1KEC A;  4KL1 A;  1NR7 A;  4I55 B;  4JYC A;  1GM8 A;  1CEZ A;  1D5A A;  1HW7 A;  2YIB A;  3OM3 B;  2ZR3 A;  1FXK A;  5EK0 A;  2BOB C;  1QR8 A;  5JCO C;  5IYC O;  4JI0 O;  3MHS C;  3CME V;  1BL8 A;  3ZHT A;  4X62 O;  3CXH F;  3QVN A;  1GN3 A;  4H0L B;  2JGU A;  4CC6 A;  4RUE A;  5H2F Z;  3DC6 A;  3GVM A;  3Q4H A;  1COW G;  4P30 A;  2XAS A;  4DV4 B;  3KCX A;  1P7B A;  3DC5 A;  3WG7 C;  3ABK B;  2P22 C;  1PD3 A;  4PA7 A;  5B1A B;  2PY5 A;  1IXM A;  3JAK B;  4I55 A;  5LOV A;  4YY3 O;  3OEH G;  1MZF A;  3CMA V;  5H6Q A;  2LGQ A;  2QWN B;  3DTU B;  1PP9 H;  2QR4 A;  1PPJ H;  1XMQ B;  1NTK H;  1Q6U A;  1E79 G;  3TK1 A;  3HPL C;  3ZMV A;  4D6T H;  4P2Z A;  4DUZ B;  2QM4 A;  3L70 H;  3AG3 C;  1M90 W;  2ZCE A;  1XNR B;  1WAZ A;  5CMU A;  1N8R W;  3CRQ A;  1YEW A;  2ADP A;  3WB2 A;  1NS1 A;  2QE7 G;  4JZG A;  3JAK A;  2WLI A;  3SJA C;  2QEX V;  1KBH A;  2QWO B;  5KHG A;  2JRI A;  1VF6 A;  3JAR A;  1B06 A;  1ZSP A;  2HJD A;  4FLW A;  5AG2 A;  3ETQ A;  2QM7 A;  4EKW A;  5LP6 B;  1QLE C;  3F7Y C;  3SJC C;  4X1K B;  2WPD G;  2X6A A;  2CGN A;  5IDJ A;  2CTR A;  2EIJ C;  1HNX B;  1QHT A;  4QE9 A;  2G38 A;  5CBF A;  4LF9 B;  1VQ6 V;  4EB6 A;  3M7M X;  1Q5O A;  3BA9 A;  1IBK B;  1TUB A;  1V54 B;  3ZHS A;  2BE3 A;  1YJN V;  3HKD B;  2XND G;  1NH2 D;  3ZN1 A;  5KUK A;  4K8Z A;  5FNV B;  2QA4 V;  3S3W A;  1S5H C;  2ADQ B;  1F4M A;  4LR3 A;  2F23 A;  2CK3 G;  1VF5 B;  5ITZ B;  1XI1 A;  2ZE6 A;  4RQE A;  5GW7 A;  1PL4 A;  3AG2 C;  3EFF K;  4I4T A;  4PA4 A;  1AI5 A;  2GHY A;  2DW4 A;  2FML A;  4AIL C;  5F2V O;  4PV1 B;  1IDS A;  2DQ0 A;  2YI9 A;  1Y66 A;  4X1Y A;  3E22 B;  3QO8 A;  4FM0 A;  1QBZ A;  1N33 O;  4UB6 Z;  4MS2 A;  2XTA A;  2NLJ C;  3RGB A;  5JH7 B;  1N36 O;  2R70 A;  2XT9 A;  1S72 V;  2W6J G;  3AG4 C;  1WP7 A;  3A0B Z;  2CE4 A;  1RP3 B;  4DW0 A;  1Y76 B;  5LMU O;  4I9W A;  4PDV A;  4B7K A;  2QDO A;  3ZHU A;  1Q7Y W;  4DR3 O;  2UXB B;  3B40 A;  3ZJZ A;  3LDE A;  1VQ9 V;  4HZ3 A;  2W0X A;  2MW2 B;  2Q68 A;  4D7S A;  1G6U A;  1BMF G;  3E22 A;  4JTD B;  3K79 A;  5LHI A;  4X66 O;  1FS0 G;  5JH7 A;  4LC1 A;  1LUW A;  4GKJ B;  4CBC A;  4FFK A;  1E1Q G;  1Y76 A;  1BGY H;  1YCI A;  2DYS C;  5EBM C;  1MSW D;  1NVP D;  2ZNI A;  2HVJ C;  1J5E B;  2FTK A;  1M4U A;  2B1I A;  2YEV B;  3K5M A;  4RO2 A;  1I5Y A;  3AG1 B;  2IJI A;  5B66 Z;  3ZIA G;  2DE0 X;  1K33 A;  4GKK B;  1CXZ B;  1SQV H;  3CC7 V;  3APO A;  4DR7 B;  2CAZ C;  4B3M O;  2ZDI C;  5IE9 A;  1QR9 A;  5HFL A;  3CRR A;  3UT5 B;  2OTJ V;  1YDX A;  4FIP C;  4DV0 B;  2AZ0 A;  3B2E E;  4PD4 F;  3ABT A;  3ETG A;  3OTO B;  2UXX A;  4RUF A;  3K9S A;  3H9V A;  1VQ8 V;  3ICX A;  4MTG A;  2ZXW B;  4B3R B;  4JYB A;  3K58 A;  4FFB B;  1R3L C;  1X59 A;  2XAJ A;  1N34 O;  1L0N H;  1K3E A;  2F4V O;  2M6Y A;  4CS2 A;  3T1H B;  4IYI A;  4MT8 A;  3U11 A;  3I56 V;  3QO7 A;  1LR1 A;  2KQX A;  4DUZ O;  1I08 A;  4DR6 O;  1DF5 A;  1A32 A;  3LSU A;  1SET A;  1YXB A;  3UT5 A;  2V7Q G;  3CCJ V;  4LF5 O;  1W0J G;  4U3F H;  4R8C A;  1WB8 A;  3I55 V;  1AIL A;  4OX9 O;  1RSO A;  1TVK B;  3H01 A;  1YHQ V;  1QVG U;  1HR0 O;  5IY5 B;  2ODM A;  2WAM A;  1J95 A;  2JDI G;  1E1R G;  4FFB A;  3CCE V;  2E76 B;  1XUQ A;  5B1N A;  4UCR A;  4F6E A;  5B1A C;  3ZMU A;  4JI8 O;  3BPZ A;  2E75 B;  3N2K B;  5LA6 B;  2B5U A;  2B9Z A;  3E8B A;  4UCT A;  3TJT A;  2JIZ G;  4JI0 B;  3O65 A;  4JF3 A;  4ZHQ B;  1EN6 A;  2WSS G;  3L72 H;  1HNX O;  4DR5 O;  4X62 B;  5DN6 G;  3K06 A;  3LNM B;  5GTI Z;  4LF9 O;  3STZ C;  3QO5 A;  3RYF A;  2H8P C;  1URF A;  1B6Q A;  2Q5Z A;  4GYC B;  1RM1 B;  2HG5 C;  1NBM G;  4DO2 A;  4ZIB A;  4DV3 B;  2OIG A;  4YY3 B;  4LBE C;  4QE7 A;  2JEU A;  1GM7 A;  3VQW A;  1XL6 A;  3ZMS A;  1XBL A;  3N2K A;  5J2U B;  5LA6 A;  3BEH A;  3JAL B;  4DW1 A;  2WLN A;  4DXW A;  1FPO A;  1VQN V;  2ARH A;  4ZHQ A;  3OR6 C;  2EIL B;  1H2K A;  2GDS A;  1FYJ A;  4GX1 A;  4LF6 O;  5K1P A;  5DED A;  4OPA A;  4I0X B;  4W4L A;  3RVY A;  1Q6H A;  1AR1 B;  5JQG A;  4KUM A;  4WBN A;  1V54 C;  3LSQ A;  4B3T B;  4CS4 A;  2JJ1 G;  4YIP A;  2ZIM A;  4R7C A;  2HFE C;  4BWA A;  3CEI A;  5J2U A;  2UXN A;  1Q90 D;  1I7F A;  4NXM O;  1FJG O;  1BZK A;  1AJP A;  1GN4 A;  4JGS A;  2B1G A;  3RW0 A;  3JSL A;  4IIJ B;  2ZD9 A;  3S3X A;  5LL6 Y;  5FL7 G;  1VF7 A;  1IXB A;  1H2G A;  4J11 A;  1FXV A;  3AEI A;  1V55 C;  1D5N A;  4TQD A;  2BTQ B;  3CJH B;  2PZS A;  4I0X A;  1K5S A;  2Q0O C;  3SYO A;  4I9Q A;  1HWY A;  3VOU A;  3ZHR A;  4TQF A;  2A0L A;  4DR1 O;  1R3K C;  1H2M A;  1F23 A;  4KXR A;  4PA3 A;  5CA1 A;  1QLN A;  1YIT V;  3ASN B;  1T5E A;  5L3E A;  3W7S A;  3IC9 A;  1Y4M A;  3L75 H;  4YJ2 B;  3ZMZ A;  4IIJ A;  1K73 W;  4B7E A;  1H2L A;  2WLM A;  1U97 A;  3CCQ V;  1XHZ A;  3TCU A;  4IHJ B;  2DMX A;  2PYL A;  1K34 A;  4BW9 A;  3OEE G;  2XUM A;  2BTQ A;  3CJH A;  1DK1 A;  2KSD A;  2Q8V A;  3SPJ A;  1GK9 A;  1P4R A;  2UUA O;  2ZE8 A;  4BIZ A;  1CPY A;  1N33 B;  5B3S C;  1SC5 B;  3EXA A;  1NKD A;  3PJS K;  1VP7 A;  4DV0 O;  2A06 H;  4D7T A;  4DRX A;  1NH2 B;  4J80 A;  4H44 B;  1ZX3 A;  5HFM A;  2VWJ A;  4YJ2 A;  3ZS8 C;  4R6Z A;  4NXN O;  1NTM H;  3RYI B;  4B3R O;  1L8D A;  4IHJ A;  3KG2 A;  4CS3 A;  3K9A A;  4JYA B;  3ABL B;  3T1H O;  5TIS Z;  4LF7 O;  1OCZ C;  3AG1 C;  2EIK B;  2JEX A;  2BSK B;  3CB2 A;  4LNU B;  3DXR B;  1M56 C;  1ENV A;  2WLL A;  3BFR A;  5L3G A;  4TSF G;  1SQG A;  4WCE V;  1M57 C;  2X6B A;  5D5P A;  1AI4 A;  2X0L A;  1MSD A;  3RYI A;  2EJ7 A;  2F43 G;  1RFY A;  2HKO A;  2R9A A;  2ZIN A;  5CA3 A;  3WFV A;  4JI6 O;  2JGD B;  3JD2 A;  3D36 A;  5H5N A;  1XMO O;  4DR4 B;  3STL C;  1FFX B;  3JCZ A;  3LNN A;  4ZKI A;  4AQY B;  4J7K A;  3FB8 C;  2OCC C;  1GKF A;  2FL4 A;  2BSK A;  5KX5 B;  5H9C A;  1RPR A;  4LNU A;  3L74 H;  4O4J A;  1AB3 A;  3DXR A;  4B3M B;  4O4H B;  1P49 A;  3TXQ A;  2LO1 A;  1EZJ A;  3E8G A;  4JV5 O;  4Z2W A;  4IT5 A;  4DUY O;  1OCC B;  3H1K H;  1ZL8 B;  2WLH A;  1G4Y B;  1U96 A;  2DQ3 A;  3OAA G;  3G71 V;  4QIW F;  4DV3 O;  4JAA A;  4FLU A;  1NVP B;  1N34 B;  2EJR A;  1QU7 A;  4WFB V;  1FFX A;  1R3I C;  1HNZ O;  1NQT A;  2F4V B;  2YXY A;  3A0R A;  2WA3 A;  1SS3 A;  1KUQ A;  4O2B B;  3FX7 A;  3ETD A;  1Q82 W;  2Q67 A;  4O4L B;  2OIE A;  3JD0 A;  4DR6 B;  3KCY A;  4LFC B;  4O4H A;  4OXS A;  4LF5 B;  1X4T A;  2HP8 A;  4LF8 O;  3ZRS A;  1D2D A;  4OX9 B;  1ZL8 A;  1Q43 A;  2KG7 B;  2Y69 C;  2RJZ A;  1JFF B;  3T4Z A;  4AHC A;  1AP6 A;  3E89 A;  5E1A C;  5B1O A;  1QQC A;  1SKV A;  1HR0 B;  1S76 D;  2PI5 A;  1OZ0 A;  4B3T O;  2XAQ A;  4J7J A;  3K0G A;  1FKA O;  3VQX A;  1NTZ H;  4Q6G A;  2N04 A;  4JI8 B;  5BXZ A;  1GO3 F;  2N05 A;  1XNQ B;  2IH3 C;  1AJN A;  1UPG A;  4GX0 A;  4O2B A;  3U0Z A;  4LFB O;  2EIM B;  4RWU A;  3QG5 A;  4O4L A;  4DR5 B;  5KHK A;  2P5O A;  1DTO A;  2IJH A;  4X1I B;  3FD9 A;  4ASU G;  1JCH A;  2IU3 A;  3BAB A;  3J80 N;  2KG7 A;  3LSS A;  1PM9 A;  5JJE B;  3MHH C;  1W0K G;  1JFF A;  1SA0 B;  2QJ1 A;  2ITD C;  3SYC A;  2NN4 A;  5CB4 B;  1IX9 A;  4DV6 O;  1YF2 A;  4HAM A;  1F4N A;  2F93 B;  4JI7 B;  3CD6 V;  1S3J A;  3BCC H;  4JYY A;  5IJ9 B;  2F1M A;  1MAB G;  1YTF D;  1OV9 A;  1SER A;  5C8Y B;  1WPX A;  5LP6 A;  1QNM A;  4X1K A;  2BCC H;  3VQV A;  3CX5 F;  4N23 A;  2Z0A A;  5LMN O;  4LF6 B;  1KYO F;  1L0L H;  4J42 A;  5GON B;  3CCR V;  1SA0 A;  3U10 A;  4GX5 A;  2M7W A;  2QTS A;  3HKD A;  5CB4 A;  4PEL A;  5FNV A;  2K1E A;  2YIB D;  1M93 A;  4U7O A;  2PGG A;  3HKB B;  3BAA A;  5IJ9 A;  4NTX A;  4PDM A;  4MTF A;  2E74 B;  4DK1 A;  5ITZ A;  4E4E A;  4NXM B;  1AJQ A;  1FJG B;  2Y0P A;  3MAQ A;  3ASO C;  1Q3E A;  3FKS G;  4U7N A;  2AHY A;  3CE2 A;  3CP1 A;  4JYA O;  1FXH A;  3R65 A;  4X88 A;  1R6K A;  1KP2 A;  2LJ2 A;  4PDR A;  2VQF B;  3C3S A;  4BIU A;  1Y74 B;  4K35 A;  1V9P A;  4MW3 A;  4L87 A;  4UCS A;  2NR5 A;  3HB3 B;  1Z5V A;  4DR1 B;  4FLT A;  4GX2 A;  5J9P C;  1ARO P;  3HKB A;  4MVO A;  3R66 A;  3H1L H;  3CRC A;  4MVR A;  3E83 A;  4LCU C;  2IBZ H;  4J9Z B;  3CCS V;  2HVK C;  3A0H Z;  3QNE A;  5IYZ B;  2ATK C;  1SZT A;  3I5D A;  5GTH Z;  1MOF A;  3JAS B;  4DYL A;  4DR4 O;  1Q81 W;  4AQY O;  2YXL A;  1H2N A;  3RYC B;  3D36 C;  3E8H A;  5L3D A;  4DV2 B;  3E86 A;  4DV7 B;  3G80 A;  4PHZ A;  3TET A;  4PI0 A;  3FYE B;  1FXK C;  1PKX A;  2UUA B;  2PYJ A;  4YIO A;  2KB1 A;  2Q7H A;  3X2Q B;  2EIK C;  5FPO A;  1K5Q A;  1KB9 F;  4CH4 A;  1N32 O;  4FPP A;  2UU9 B;  4JTA B;  4AI8 A;  3SDL A;  5IYZ A;  2Q4P A;  1H8E G;  5H6R A;  3CS5 A;  4NXN B;  3SGI A;  4G28 B;  1R73 A;  4IYH A;  4I7Z B;  3RYH B;  1N0J A;  2N74 A;  2YEV A;  1HP8 A;  2NNU A;  2CDY A;  1NZ6 A;  3CRM A;  1OCO B;  1JJ2 U;  5A2Q N;  1XRE A;  4LF7 B;  2JS5 A;  3G6B A;  2P90 A;  4RAI A;  3BVO A;  4FJC C;  3UCS C;  4LFC O;  3ZRX A;  1TUE B;  4PA6 A;  4JI3 O;  4PI2 A;  2CTW A;  3BRC A;  1IUR A;  3FB6 C;  4ZI7 B;  2ZKO A;  4G2K A;  1GM9 A;  1GN6 A;  4JI5 O;  2WA4 A;  3ABK C;  5BMV B;  1EM1 A;  5EYP B;  3SPH A;  4JI6 B;  1JR9 A;  5EC2 C;  5KA6 A;  1VQ4 V;  1XMO B;  3WG7 B;  3EVK A;  4U3J B;  3BHP A;  3DGE A;  2LFR A;  1XNQ O;  3SPG A;  1VF6 C;  1S77 D;  2PUS A;  5LYJ B;  1EN5 A;  3FYI B;  3CC4 V;  4K8X A;  3A2F A;  1OCR B;  5J2T B;  1JPX A;  2X7R B;  5JCO A;  4JV5 B;  1TVK A;  2Y0I A;  4TUY B;  3UQ8 A;  4DUY B;  4QPK A;  3K3W A;  2VQE O;  2V1D A;  3K03 A;  3K5N A;  3GB7 C;  4QPJ A;  5EYP A;  4JI7 O;  1DGS A;  3KKY A;  3N27 A;  4WF9 V;  3ABM B;  3F5T A;  1H8H G;  1OHH G;  4I5S A;  5KAI Z;  4U3J A;  3H1J H;  1HNZ B;  1F51 A;  2HHH B;  1HDJ A;  1YJ9 V;  5LYJ A; 
#chains in the Genus database with same CATH homology
 3K9A A;  3NXS A;  3W7U A;  3ABL B;  2EIM C;  1M1K W;  2QM7 A;  4GCZ A;  4EKW A;  1QLE C;  3F7Y C;  1OCZ C;  2WPD G;  2X6A A;  3AG1 C;  4MSW C;  2BOC C;  2EIK B;  5IDJ A;  2JEX A;  2EIJ C;  2EBO A;  1OCZ B;  2P7T C;  3B8N A;  4XDJ A;  4QE9 A;  3OMA B;  1M56 C;  1ENV A;  2WLL A;  2EIJ B;  1PNL A;  5CBF A;  1VQ6 V;  1M56 B;  2X6C A;  3FB7 C;  2EIN B;  2Y48 A;  5L3G A;  3W7T A;  4TSF G;  2R9I A;  1GMG A;  4WCE V;  1M57 C;  1V54 B;  4FK5 C;  4WFH A;  2X6B A;  1M9N A;  4UUJ C;  4KFM A;  3OUF A;  1AI4 A;  1M57 B;  1YJN V;  2X0L A;  2XND G;  1NH2 D;  3ZN1 A;  5KUK A;  2F43 G;  2QA4 V;  2HKO A;  3M99 B;  1S5H C;  4H33 A;  4F4L A;  5CA3 A;  3P30 A;  3JD4 A;  1F4M A;  4MTO A;  2IH1 C;  2Q69 A;  3RBZ A;  3WFV A;  1KKD A;  3JD2 A;  3D36 A;  2CK3 G;  1THZ A;  3STL C;  3T4D A;  3JCZ A;  4ZKI A;  3FB8 C;  2EZP A;  3T2M A;  2OCC C;  4RQE A;  5GW7 A;  1VQO V;  1GKF A;  1NJI W;  1SES A;  2OCC B;  2XAG A;  2ZR2 A;  4UV8 A;  1AI6 A;  5H9C A;  1RPR A;  3AG2 C;  1VQK V;  3EFF K;  4PA4 A;  1AI5 A;  2GHY A;  1ORQ C;  2DW4 A;  3JYC A;  3W7X A;  3AG2 B;  3BY6 A;  2XOK G;  3D3I A;  4UVB A;  1EZJ A;  3E8G A;  2DQ0 A;  1OCC C;  2OTL V;  4YXW G;  1Y66 A;  3QO8 A;  4MVS A;  1QBZ A;  1OCC B;  1H38 A;  4MS2 A;  2WLH A;  2NLJ C;  1G4Y B;  4P9O A;  2DQ3 A;  5EBW C;  1S72 V;  2W6J G;  3AG4 C;  3OAA G;  3P32 A;  3G71 V;  4QIW F;  4P9P A;  3ZMT A;  1DF4 A;  3AG4 B;  1NVP B;  4UVC A;  4MVM A;  3CPW U;  4TT3 G;  2EJR A;  4WFB V;  1R3I C;  1NQT A;  3OGC C;  4I9W A;  4PDV A;  2OT5 A;  1BHB A;  3A0R A;  1Q7Y W;  2A79 B;  3ETE A;  3ETD A;  3ZJZ A;  5LHH A;  1Q82 W;  2Q67 A;  3LDE A;  3JD0 A;  3VBB A;  1VQ9 V;  3ABU A;  1R6N A;  1K92 A;  1ROP A;  4HZ3 A;  3AG3 B;  2YSU B;  2Q68 A;  5LHG A;  4OXS A;  5B1B B;  3ZRS A;  2A9H A;  1BMF G;  3LDD A;  2DYR B;  3SYA A;  4JTD B;  2Z3Y A;  2Y69 C;  3K79 A;  2GSM B;  5LHI A;  2P67 A;  4JAV A;  1FS0 G;  3K04 A;  3T4Z A;  2Y69 B;  3E89 A;  4LC1 A;  5E1A C;  5B1O A;  1S76 D;  2QTO A;  2PI5 A;  1OZ0 A;  3OR7 C;  4Z1M G;  2Z5U A;  4MTX A;  4CBC A;  1VQP V;  2XAQ A;  3IC7 A;  1YIJ V;  3K0G A;  1DLB A;  1YTF B;  3MD0 A;  1E1Q G;  1NR1 A;  1K97 A;  5BZB A;  2HLD G;  4LP8 A;  5LGN A;  2DYS C;  1GO3 F;  1VQ7 V;  5EBM C;  1MSW D;  2P6J A;  3OMI B;  2IH3 C;  1AJN A;  2WLK A;  2DYS B;  4GX0 A;  3UKM A;  1NVP D;  2EIM B;  1VQ5 V;  5DM6 V;  2HVJ C;  4ZBM A;  2FTK A;  2B1I A;  4RQF A;  1QLE B;  2YEV B;  3OFN G;  4MVZ A;  4RO2 A;  4X89 A;  2IU0 A;  2IJJ A;  1I5Y A;  3AG1 B;  2IJI A;  1DTO A;  2IJH A;  5CN0 A;  3IFX A;  1RPO A;  3ZIA G;  1K33 A;  4ASU G;  1JCH A;  2IU3 A;  4X8A A;  3LSS A;  5IYB O;  3MHH C;  3CC7 V;  1YSC A;  1W0K G;  5LBQ A;  4MVU A;  2ZDI C;  2ITD C;  3CC2 V;  3SYC A;  1YI2 V;  1QR9 A;  1FFT B;  5HFL A;  2OTJ V;  4FIP C;  2QM8 A;  3G4S V;  1I5X A;  3ABT A;  1WLE A;  4HAM A;  4WFF A;  3ETG A;  1F4N A;  3CD6 V;  1S3J A;  2UXX A;  4RUF A;  1KQS U;  1L1F A;  2HR3 A;  4HYO A;  2XAH A;  2ZXW C;  1VQ8 V;  2XAF A;  1AI7 A;  4FMT A;  1MAB G;  1YTF D;  4MTG A;  2ZXW B;  1KD1 W;  1SER A;  4JAU A;  1WPX A;  2R9R B;  4JYB A;  4XDL A;  1R3L C;  2XAJ A;  1K9M W;  3W7W A;  3CYO A;  4XDK A;  1JQ0 A;  3G6E V;  1K3E A;  4N23 A;  4MT8 A;  5C93 A;  3I56 V;  1LNQ A;  3QO7 A;  4MW8 A;  3SPI A;  5L3B A;  1W2B U;  3CCR V;  4WFG A;  4GT1 A;  1QVF U;  1DF5 A;  4GX5 A;  1ZWI C;  2M7W A;  3JD3 A;  3K08 A;  1SET A;  2V7Q G;  3CCJ V;  2ZDI A;  1W0J G;  3SJQ C;  1K4D C;  4PEL A;  3OE7 G;  1EBO A;  4R8C A;  2WWW A;  2K1E A;  2HJF C;  3I55 V;  4U7O A;  1JOY A;  3H01 A;  4BAY A;  2H94 A;  1PNK A;  3ZCC A;  1YHQ V;  4PDM A;  5IY5 C;  4MTF A;  1QVG U;  3FB5 C;  1G8M A;  3CXC U;  3B77 A;  4JAS A;  5IY5 B;  1AJQ A;  3SYQ A;  2WAM A;  1J95 A;  1PNM A;  2JDI G;  1E1R G;  3CCE V;  5B1N A;  3ASO C;  4UV9 A;  5B1A C;  2ITC C;  4WFA V;  4Q20 A;  3FKS G;  3ZMU A;  3ASO B;  4U7N A;  5CBH A;  2AHY A;  3CP1 A;  3LUT B;  1FXH A;  1K8A W;  3R65 A;  4X88 A;  1R6K A;  2WLI B;  1KP2 A;  4UVA A;  2B5U A;  4PDR A;  4BIU A;  3E8B A;  1VQM V;  2JIZ G;  3ZRW B;  3CCL V;  2ZQM A;  2WLJ A;  4JF3 A;  2WSS G;  4MW3 A;  4PA9 A;  2DWE C;  1OCR C;  4L87 A;  2AHZ A;  3T1C A;  4BW5 A;  1KC8 W;  5L3C A;  3HB3 B;  3E35 A;  5DN6 G;  3K06 A;  3LNM B;  4GX2 A;  3STZ C;  5J9P C;  3QO5 A;  4XBF A;  1ARO P;  4MVO A;  4MVQ A;  4MVR A;  3E83 A;  3F7V C;  4LCU C;  4J9Z B;  2H8P C;  3LDC A;  2WLL B;  2LP7 A;  1RM1 C;  3CCS V;  1B6Q A;  1K7D A;  2HVK C;  3B8M A;  3F5W C;  3QNE A;  1RM1 B;  2ATK C;  2HG5 C;  1NBM G;  2QKS A;  3ABM C;  3ZRV A;  4DO2 A;  1JX9 A;  1SRY A;  3E8F A;  1SZT A;  4LBE C;  1VQL V;  4QE7 A;  2JEU A;  1GM7 A;  5EBL C;  1XL6 A;  3ZMS A;  1MOF A;  1S0V A;  3BEH A;  1Q81 W;  2WLN A;  4DXW A;  2EIL C;  3ZRW A;  1VQN V;  2Q6A A;  1JVM A;  3OW2 U;  3EHB B;  1UJW B;  3E8H A;  5L3D A;  3E86 A;  3OR6 C;  2EIL B;  2JK5 C;  4QNH B;  4TWK A;  3SPC A;  2IW5 A;  3TET A;  5IYD O;  3FYE B;  3CCM V;  1FXK C;  1PKX A;  3X2Q C;  5EC1 C;  4GX1 A;  2KB1 A;  1FXK B;  3X2Q B;  2EIK C;  4PDL A;  1R3J C;  2EZO A;  1K5Q A;  2PI4 A;  3RVY A;  1AR1 B;  2MK3 A;  4QJF B;  2C2A A;  4KUM A;  3OUS A;  2EIN C;  2JJ2 G;  4J9Y B;  5L3F A;  4FPP A;  4JTA B;  4KP4 A;  1V54 C;  1H8E G;  4G27 B;  5H6R A;  3LSQ A;  1PL0 A;  1GTO A;  4G28 B;  1R73 A;  2JJ1 G;  1QCE A;  4R7C A;  2HFE C;  2W6I G;  3UM7 A;  3CCU V;  1OCO C;  2UXN A;  2YEV A;  2NNU A;  4R50 A;  4JPR A;  4N21 A;  1AJP A;  4JGS A;  1OCO B;  2B1G A;  3RW0 A;  1JJ2 U;  1CP9 A;  1KEC A;  1NR7 A;  4JYC A;  1MG1 A;  2ZD9 A;  1GM8 A;  1CEZ A;  5FL7 G;  1H2G A;  2P90 A;  1FXV A;  4RAI A;  3OM3 B;  2ZR3 A;  4FJC C;  3AEI A;  1V55 C;  1FXK A;  3ZRX A;  3GWO A;  1TUE B;  5EK0 A;  1BHA A;  2BOB C;  3E2E A;  1QR8 A;  4PA6 A;  5IYC O;  1V55 B;  3MHS C;  1Q86 W;  3CCV V;  2W0F C;  3CME V;  1BL8 A;  1K5S A;  5LGU A;  3FB6 C;  3SYO A;  1HWY A;  5LGT A;  3VOU A;  4WFE A;  4G2K A;  2A0L A;  1GM9 A;  1R3K C;  1YJW V;  3ASN C;  1F23 A;  5KA5 A;  4PA3 A;  4E2L A;  1QLN A;  1YIT V;  4RUE A;  3ASN B;  3ABK C;  5L3E A;  3W7S A;  3SPH A;  1COW G;  4P30 A;  2XAS A;  5EC2 C;  1P7B A;  3WG7 C;  5KA6 A;  1Y4M A;  3ABK B;  1PD3 A;  4PA7 A;  5B1A B;  1IXM A;  1VQ4 V;  3ZMZ A;  3WG7 B;  3DGE A;  2LFR A;  2IJK A;  3SPG A;  1K73 W;  2WLM A;  1S77 D;  3OEH G;  3CCQ V;  3TCU A;  3CMA V;  5H6Q A;  5KUM A;  3DTU B;  3JD1 A;  3FYI B;  3CC4 V;  1K34 A;  3OEE G;  1OCR B;  1JPX A;  1E79 G;  2X7R B;  3SPJ A;  3OMN B;  3HPL C;  3TK1 A;  3ZMV A;  1GK9 A;  4P2Z A;  1M90 W;  3AG3 C;  1P4R A;  1KP3 A;  4BIZ A;  5B1B C;  1CPY A;  4QPK A;  3K3W A;  5B3S C;  1K4C C;  3ZN0 A;  2D3O W;  1NKD A;  2DYR C;  1XL4 A;  2V1D A;  3PJS K;  5CMU A;  2DWD C;  3K03 A;  1N8R W;  5B3S B;  4H37 A;  3GB7 C;  1NH2 B;  4QPJ A;  3IGA C;  4JTC B;  3K0D A;  5HFM A;  2QE7 G;  4WF9 V;  3SYP A;  3ABM B;  1H8H G;  1OHH G;  2LFS A;  4I5S A;  4R6Z A;  1EFR G;  2WLI A;  2QEX V;  1F51 A;  4UXN A;  5CBG A;  3RVZ A;  1YJ9 V;  3KG2 A;  3ML0 A;  3ABL C;  4CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...