3F7VC

Kcsa potassium channel in the open-inactivated state with 23 a opening at t112
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
AGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment Heavy chain
publication title KcsA Potassium channel in the open-inactivated state with 23 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3f7vC00
3OUFA 3SPGA 4MVSA 2ATKC 4KFMA 3FB6C 1QLEC 1JVMA 3RVZA 3FB7C 5IY5C 2K1EA 5KUMA 4JTAB 3K04A 4P9PA 4G27B 1M56C 3HPLC 3LDDA 3LDCA 2A9HA 4JTCB 4J9ZB 2HVKC 2Q68A 4P9OA 3F7VC 4RAIA 4RUEA 2WLKA 2P7TC 3IFXA 3EFFK 2W0FC 3OR7C 4G28B 4WFGA 3UKMA 1P7BA 1ORQC 1S5HC 2Y69C 3OR6C 4OXSA 3SPCA 3F5WC 4CBCA 4PA7A 3AG3C 1OCOC 3PJSK 3UM7A 5EC1C 3VOUA 3E83A 3SYPA 4F4LA 4PDLA 5CBHA 1G4YB 2QTOA 3FB8C 4MS2A 2QKSA 4HYOA 5EBLC 4MTOA 4QNHB 4GX5A 1OCCC 3GB7C 1R3LC 2A79B 4MVZA 2HG5C 1K4CC 2EILC 4R8CA 5J9PC 2DYSC 3ASNC 3X2QC 4HZ3A 1KKDA 2EIMC 1ZWIC 3SYCA 2BOCC 5EC2C 3RVYA 3SYAA 4GX0A 4TWKA 4R50A 4R6ZA 3T1CA 3T2MA 4XDLA 4BW5A 4WFFA 1XL6A 4MVRA 5B1AC 3BEHA 4MTFA 2X6BA 3SPHA 3ZJZA 2WLMA 4QE9A 2BOBC 2X6CA 3E89A 4X8AA 4MVQA 3K08A 4MVMA 4H33A 2WLLB 4PDMA 4MW8A 4PA3A 5BZBA 3SYOA 2HFEC 2AHZA 4X89A 4PA6A 2EIKC 3E8GA 2WLLA 4PDRA 4RO2A 3AG1C 4EKWA 2Q67A 2Q6AA 3STLC 3WG7C 3TETA 3E8FA 4GX2A 3LNMB 4LCUC 3E8HA 4MTGA 2Q69A 1V55C 4UUJC 5CBFA 2DWDC 5EK0A 3T4ZA 1BL8A 3RBZA 3STZC 2ITDC 2YEVA 3OUSA 3TCUA 2A0LA 3K0DA 1V54C 5EBMC 4QE7A 5EBWC 1K4DC 3SYQA 2EINC 1J95A 4MVUA 4XDKA 4P2ZA 3KG2A 1R3KC 2JK5C 3OGCC 3SPIA 4MW3A 2NLJC 2HVJC 3ZRSA 4R7CA 4PA9A 2DYRC 4MSWC 4WFEA 2H8PC 3AG2C 5E1AC 4P30A 5B3SC 2DWEC 3ASOC 3F7YC 3JYCA 4RUFA 4PA4A 2WLIB 1XL4A 5CBGA 2KB1A 3E86A 3LUTB 3R65A 4PDVA 1OCRC 4WFHA 2HJFC 1M57C 3ABMC 3AG4C 4XDJA 2WLJA 1R3IC 2ZXWC 2WLIA 4DXWA 2OCCC 5B1BC 2R9RB 3FB5C 4GX1A 1OCZC 2IH1C 4J9YB 3RW0A 3K06A 5KUKA 4MVOA 2X6AA 3SJQC 2ZD9A 4JTDB 3E8BA 1R3JC 1LNQA 4I9WA 2EIJC 3LDEA 3K03A 2AHYA 4ZBMA 2IH3C 2ITCC 4H37A 4X88A 3T4DA 3K0GA 4LBEC 3IGAC 2WLHA 2WLNA 3SPJA 3ABKC 4LP8A 3ABLC
chains in the Genus database with same CATH superfamily
1BZKA 3CCVV 5KUMA 1QCEA 2FYUH 2P90A 3HKEA 1JJ2U 2OWOA 4DV4O 3EXAA 2RJZA 1KD1W 3D3QA 3SPCA 3OR6C 3JSLA 1IX9A 4DV5B 2HR3A 3PJSK 2PTMA 1MNGA 2YIAA 3N27A 2HJDA 4JI6B 3BABA 4IIJB 1YF2A 4IHJB 2OYQA 3SDLA 3OGIB 1KKDA 3HKCA 1D2DA 4U3JB 5FPOA 1WB7A 1KBHA 3W7XA 3CPWU 4XDLA 3QO5A 2UXCB 4X64O 2XAGA 3ZJZA 4DR3O 4ZKIA 1G1XB 3I5DA 1VF5B 1GAXA 2X7RB 4MW8A 4AHCA 5D5PA 5ITZB 2ZNIA 1SQVH 1H2MA 4ZI7B 1F4NA 4O4HB 5LHIA 1CPYA 5IYZA 5JH7A 2ITDC 4O4LA 1DK1A 1V54C 1GMGA 4TV8A 4YIOA 5A2QN 2WPDG 4P2ZA 1QLEB 3SJAC 2NLJC 1NVPB 2NN4A 1Z5WA 4PA9A 4X65O 1YSCA 4MSWC 5LOVB 3RYFB 2CK3G 2FB5A 4DK0A 4XDJA 1X59A 1VARA 1NR7A 5JVDB 1XMOO 4CS3A 4GKKB 3CJHA 1N0NA 4PD4F 3RYHB 3CYOA 1NTKH 2XAQA 3LSSA 5KHHA 4FZ0A 3VQVA 3JD1A 1F4MA 1TUBA 2F95B 2IH3C 1SC5B 4H37A 1H8HG 3A2FA 3RVZA 1AP6A 1JVMA 4D7SA 3OW2U 1J5EB 4OX9O 1N4CA 2DQ3A 3A0BZ 1WNSA 1L0LH 3OR7C 3NR7A 1S5HC 2DMXA 2N04A 3G4SV 3ABMB 4F4LA 1VQ8V 1WB8A 1H2LA 3FB8C 1EZJA 5KHIA 4DW0A 4MVZA 4JI1B 4K0KO 4PI2A 1SZTA 2F66C 1LUWA 3KCXA 4O2AB 4LNUA 2EIJB 4UVBA 2ZE5A 5KLVH 4JI4O 2HHHB 3J80N 4QE9A 2P22C 1OCRB 1PM9A 4QPKA 1NI8A 2UUAO 5B66Z 4JI5O 3STLC 3TETA 5LGNA 4FFBB 4H44B 1VQ6V 4ZOLA 4X62O 1TUBB 3TXQA 1Q6UA 1TGOA 1YVWA 3SJCC 1ZAUA 2UU9O 3EVKA 3M7MX 5JCOC 4DR3B 4WFEA 3APQA 2ADQB 1K5QA 1YCIA 3HKBA 2RN9A 1M57C 2GDSA 5BXZA 3K9AA 5CA1B 1W59A 2R9RB 2QM8A 2WWWA 2B9ZA 2ZIMA 2JVDA 2ZT9B 3LDEA 3I55V 4K3AA 2QGNA 3T1HB 1SQGA 1S77D 2IJHA 1HR0O 3K57A 4DR1O 4X65B 3K04A 4LF8O 1FXVA 3LSQA 3K5NA 3CMEV 2YICA 1SZXA 3J7AU 4J9ZB 1BQZA 4N23A 3CCEV 1XMOB 1G8MA 1M4UA 4BWAA 4DRXA 1PNMA 2KQXA 5B1OA 4FK5C 1RSOB 4K35A 5EYPA 1N34O 2QKSA 2VQFO 2CTPA 3JD0A 4NXMB 4JAUA 4DV0B 1JX9A 1ZSPA 1XOUA 4J80A 4HBNA 5JWPA 1XILA 1IXBA 3QNEA 4R50A 4BAYA 3MD0A 1N33B 5DN6G 1MOFA 4OX9B 3WB0A 4PA3A 4B08A 3HKBB 3QO8A 5DEDA 3VQYA 1FPOA 2QE7G 1SA0A 4UCTA 2BCCH 3AEIA 1V55C 4UUJC 3H1JH 1XREA 2EBOA 1Z2GA 2A0LA 4DR2O 3H01A 3UT5B 3OMIB 2EINC 2DYSB 1BHBA 2W6JG 3APOA 1GK9A 2UUCB 3RN4A 3E86A 3R65A 4DYLA 1WP7A 1AJQA 1Y76B 2UUAB 1OCZC 1UPGA 4DRXB 4TV9A 1NTMH 5JQGA 5EYPB 4YJ2A 1QVFU 1Q82W 4X62B 4FVMA 4ZBMA 5LXTA 3JD3A 3UO2A 3HKDA 2YXHA 3ABKC 3ABLC 2UU9B 2BSKB 2E75B 1BCCH 2FKXA 1SETA 3CRQA 3ZMVA 3N2KB 1BGYH 2PGGA 3P32A 3ZHUA 4B3MB 2GTAA 1GM7A 1YZBA 1VF7A 2QR4A 3CRAA 2Q68A 4RUEA 1KUQA 5JCOA 3UKMA 4LF4B 3AG1B 2QJ1A 3E22B 4PA7A 4JV5O 1OCOC 4IGGA 2Z3YA 1XMQO 4HYOA 2DOSA 3BAAA 1Z5VA 3GWOA 4GX5A 1VQ7V 2ZQMA 1BE3H 5H2FZ 3ASNC 3CRRA 2GV9A 1EN4A 4TQDA 5EC2C 1LUVA 3RWRD 3ZRWA 1JOYA 4GX0A 4DR1B 1R6TA 4LF8B 5KMGA 5LBQA 1RP3B 2JGUA 4PV1B 4YIPA 4X8AA 2CE4A 3K08A 4H33A 4GCZA 1L0NH 2PI4A 4X89A 3WU2Z 3ETDA 1NS1A 3M99B 3P3NA 1BMFG 1IBKO 3LNNA 4O4JA 4TV9B 2Q69A 2Y69B 5CBFA 1NJIW 1OZ0A 3TCUA 1Q3EA 1HNZO 2E3CA 1GN2A 5LXTB 1WPXA 4FLTA 1XNQO 1W2BU 4LF5O 2VWJA 4DR7B 4JI7B 5KHJA 3ZMUA 3W7WA 1S5JA 2M6YA 4KXRA 3JALA 1AJNA 2F93B 3DTUB 2WLJA 2ZCEA 3ZRXA 2Y48A 3FB5C 5CB4B 2H3OA 1WA8A 4GX1A 5CN0A 4TSFG 2ZD9A 2ADPA 4X66B 4JTDB 5C8YB 1P7GA 1XQ8A 2HKOA 1L8DA 4I9WA 1B3QA 4DV6B 4DR2B 3K0GA 3IGAC 1NR1A 3W7SA 2ATKC 3M8AA 1QLEC 3N2GA 3ZRWB 1T5EA 1XHZA 1RM1B 4QJFB 2QA4V 4GT1A 2ZE7A 3EHBB 4E4EA 2HVKC 4DV5O 3U11A 3VOUA 2QKCA 1R73A 3DXRB 3K3WA 1ROPA 3B77A 3W7TA 4QNHB 1K73W 1PD3A 3ZMTA 3CCSV 1YI2V 1AI4A 1HNXB 4JI3B 1XHXA 2VS0A 3S3XA 2UXCO 4LWSA 2CUGA 4TWKA 1MZFA 4YJ3B 5F2VO 2W6IG 1MG1A 1RPRA 1LR1A 2W0XA 3ASOB 2LW7A 2JRIA 2PY5A 1DF4A 2WLLB 4EEQA 5LP6B 2JGDA 3BA9A 4LF9B 1W0JG 1GKFA 1Q8IA 3L70H 4B3TO 1F7YA 1RFYA 1WN7A 5CA3A 2YEVA 3IAYA 3K0DA 3CS5A 3BVOA 3CCUV 4D7TA 1KP3A 4UCOA 1H2NA 3N2GB 2L35A 5KX5B 2VQEB 2PYJA 1WJZA 3FYIB 1QBZA 4NKGB 5FPRA 4LF6B 3ZIAG 1OCRC 2QTSA 4GKKO 2HJFC 3JCUZ 3KZIZ 1G6UA 2WLIA 1HWYA 1IBKB 3RW0A 1M9NA 2UXDO 1HNZB 3CXHF 1XNQB 1X4TA 4LP8A 1J5EO 4LF5B 2JEXA 4FLWA 1Y67A 1D5NA 4LWSB 5IY5C 3ETEA 1I5YA 1NH2B 4J11A 4LR3A 3L73H 4GKJB 1NVPD 2A9HA 2XAFA 2D3OW 4GLXA 2UXBB 3HR0A 5JJJB 3Q4HA 4O2BA 3SYPA 1DGSA 4FM2A 3PN1A 3OEEG 1K4CC 2Z5UA 2YEVB 2EILC 4I0XA 4J7JA 4X1IB 3S3WA 2Q73A 4JYYA 2FMLA 2Q7EA 2HHHO 4DV2O 1K5SA 1FKAO 3U0ZA 4X1YA 4WFFA 1PP9H 2CH7A 2BOBC 2E76B 5H6RA 5IJ9B 4LF7B 3TJTA 2HFEC 1VF6A 5KAIZ 4I55A 2O57A 3E8GA 2Q67A 5L3FA 4UB8Z 2JIZG 4MTGA 1RPOA 1QU7A 3RYIB 4LFAB 1BT8A 1GM8A 1NTZH 1E1RG 3OEHG 3ZMZA 1J95A 4XDKA 2KG7A 3X2QB 2EIMB 4FJCC 2HVJC 3F7YC 2LO1A 5BR8O 3D36C 2JJ2G 3LUTB 3P30A 4W4LA 2IBZH 2JJ1G 2OCCC 4DR6B 1R1BA 3Q4HB 2XT9A 5KUKA 4B3TB 1Q5OA 1UJWB 3T1HO 5GTIZ 2ODMA 3WG7B 1QLNA 1OV9A 5KHGA 1K97A 4WFBV 4QGPA 2WLHA 1VQNV 1AB3A 4CH5A 2CAZC 3SPGA 5B1AB 5EIBD 4X1YB 3HKEB 4X1KA 1YDXA 2CH7B 2DYRB 2OT5A 3OD4A 4P9OA 1FS0G 4I4TA 3CC7V 2F43G 4OXSA 3TXSA 2UXDB 1HW7A 2P4VA 4NXMO 4DV0O 2B1IA 2YIBD 2EZPA 3GB7C 4FMTA 1R3LC 3HKCB 2HG5C 3FD9A 5H9CA 2JS5A 2X0LA 4Z2WA 2E5LO 4JZ2A 1FXKC 1N33O 1D5AA 4N21A 2JDIG 1H2GA 2IJKA 2YIDA 1I7FA 1KU9A 3T1CA 4JGSA 3CE2A 3AG2B 1YJWV 2A06H 4FIPC 1I94B 3A0RA 5FNVA 4MVQA 4I5SA 1Q43A 2ZDIA 1W0KG 1M56B 4PHZA 1SQBH 4PA6A 3CWBH 4EKWA 2WA4A 3AG1C 1Q6IA 5IYZB 5JH7B 3CCLV 4LCUC 4O4LB 5IYDO 1VQLV 3L74H 2DWDC 2DW4A 3AG3B 4TV8B 4DK1A 5IDJA 2XOKG 5EBWC 1PL4A 2B1GA 4DV2B 1I5XA 2UUCO 2UXNA 3CXCU 1OJHA 3U10A 2H8PC 4X9QA 3KKYA 3VQXA 3ETGA 3CJHB 1VP7A 2ZXWC 3CP1A 1NT2B 4I4TB 4J42A 1N32O 4WBNA 3TK1A 2GUZA 3G6BA 4YY3B 4LFCO 4K8ZA 3O9OA 3T1YO 1EBOA 3K03A 2YDEA 2AGAA 1GO3F 2ITCC 3JASA 1QR8A 1GTOA 2LW1A 1VIBA 1DLBA 1WPBA 1TA8A 3FB7C 2XUMA 4B3MO 4L87A 5BR8B 3H1LH 3CRMA 1JCHA 3ZEDA 4LF4O 2BTQA 1KB9F 4J10A 3R66A 3EFFK 1ORQC 4QPJA 2QWOB 3IC9A 1GM9A 1JA8A 5LA6A 5J2TA 3D36A 1K3EA 1OCCC 4TUYA 4JI2B 4IL6Z 4LNUB 4C7UA 5LHHA 4HZ3A 1Y74A 1ZL8A 3JCZA 1V9PA 1KC8W 3SPHA 5J2UA 4CC6A 2QKAA 2LQTA 3ZN1A 4ASUG 2QWPB 2Q6AA 5EZYA 4H0LB 3FX7A 4ZOLB 4WBNB 2Q0OC 3LNMB 2IW5A 1S5LZ 3RBZA 3OUSA 3K5LA 2E5LB 1NQTA 4JI0B 4LC1A 1QNMA 4DR7O 4JI7O 4MVUA 1YTFB 1R3KC 4GYCB 1S3JA 5KA6A 1GN6A 2P4KA 5E1AC 1IBLB 4B3RO 3ASOC 4I9QA 1FXKA 3JAKA 4D6TH 3FFQA 1F51A 4JPRA 1IURA 3K59A 1JFFA 1AR1B 3HB3B 4X66O 3MHHC 3J81N 3K06A 1AVMA 5LA6B 5J2TB 2X6AA 1MSDA 4DV6O 2WSSG 1SQXH 4NTYA 1YHQV 5IYBO 2F1MA 4NR1A 3SPJA 1SF9A 4JAAA 1V54B 5GTHZ 2K1EA 4JTAB 4XBFA 4OPAA 4MTXA 4G27B 3ZX6A 1BQ0A 3LDDA 3MDSA 4GUNA 1S0VA 4CH4A 4BIOA 3ZRVA 4UV9A 2Q9LA 4WFAV 2W0FC 4UCRA 1N32B 4CBCA 3CEIA 5E79Z 3OFNG 2YC0A 4LFCB 5HFMA 3T1YB 1QVGU 1XNRB 5IJ0A 1HNXO 3VBBA 4JI3O 4O4IA 1O9GA 5LGUA 2PZSA 4CH3A 4J7ZA 4PI0A 1P84F 2Q0AA 4A5UB 4DR4O 1XUQA 3K5MA 1NBMG 2FL4A 3JAWA 5LHGA 4FLXA 5D5QA 5IT9N 3RT3C 1XEQA 3SJBC 4LF9O 1SA0B 2AHZA 4NVPA 2EIKC 4CZZA 1Q90D 1P4RA 4IYIA 2HEPA 3RFRA 1WP8A 4AI8A 1BL8A 3QG5A 5TISZ 3MAQA 4F6RA 2VQEO 3BRCA 3OTOB 3OGCC 4MW3A 5GW7A 3JAMN 3C3SA 2QSAA 5CA0A 2Y0IA 3CB2A 4LF6O 4X20A 2P6JA 1H2KA 4JYCA 1DF5A 5CBGA 2ZE6A 3QTCA 2WA3A 3FAVA 4DXWA 2EJRA 1QQCA 5JQGB 2XTAA 4YJ2B 1MMMA 2ZR2A 4JASA 4DUZB 2RDCA 2YI8A 3ABUA 3HKDB 4O4IB 5LYJA 4DV7B 4MVSA 4KFMA 2GSMB 3JATA 3DC6A 4GKJO 3THOA 4B3RB 1VEWA 3OT7A 2JS3A 2UXBO 4JZGA 2BE3A 2P7TC 3WB2A 4I7ZB 4UVCA 1M57B 3UM7A 1XBLA 4UCUA 3RYCA 1VQMV 3B8MA 4MS2A 4TQFA 1HDJA 4UFZA 1O9HA 3KCYA 3L72H 3L9DA 3H9VA 3JARA 3DSQA 4WCEV 4JYAO 2BOCC 3MHSC 5KMGB 1PNKA 3CHXA 2FTKA 3CD6V 5B1AC 1N36O 2EZOA 5CA0B 1TVKA 4FLZA 4LF7O 1K34A 2X6CA 4X20B 4B3SO 1K8AW 1THZA 1NH2D 4KUMA 3NXSA 4FLVA 4ZHQA 4O4JB 2DN9A 3FYEB 1FFTB 3VQWA 1GN3A 4LFAO 3E8FA 4IT5A 3E8HA 3IC7A 1KP2A 4IYHA 1K9MW 1Q6HA 4BIZA 4QE7A 4DR4B 4DV1B 2NR5A 1NZ6A 1FFXA 2DJVA 3K5OA 4R7CA 3CCRV 3JALB 3AG2C 3E35A 2ILMA 3JYCA 2R70A 4PELA 1WA8B 3ABMC 4DR6O 4HNAA 2OTJV 5BMVA 5B5EZ 1GRJA 2EIJC 5JJEB 1V55B 2YSUB 4RQEA 2ZM6B 3CMAV 3CCQV 2EINB 4J7KA 2EJ7A 2QEXV 2WLKA 3JD4A 2V1DA 1EZVH 4ZHQB 5EC1C 2PYLA 5CBHA 4ICGA 5EIBC 4H13B 4NB5A 2KSDA 4JI8O 5J9PC 4IIJA 4CH6A 1ZWIC 1AI6A 4IHJA 1I94O 1JMKC 1FFXB 3T2MA 3BA8A 2QWRB 4U3JA 2R9IA 3BEHA 3ABLB 2AXTZ 3ZHVA 2JGDB 3AG4B 2OCHA 1F23A 5LMUB 2RMKB 5DECA 4DV3B 4BW9A 4HNAB 5ITZA 1AI5A 4CS4A 4WF9V 5BMVB 2F23A 3CC4V 1OCOB 2LP7A 1YJ9V 4O4HA 3FKSG 4AQYO 2YUAA 4JYAB 3SYQA 1COWG 4EFBA 1AILA 4YHHO 3AK2A 5H5NA 3SPIA 3ASNB 2P5OA 2HLDG 1N36B 1K92A 2HP8A 5DM6V 4B3SB 3LSUA 4PA4A 2WLIB 3C90A 4EFEA 2KB1A 2YXYA 5BY1A 3RYFA 5LOVA 4YY3O 1TAEA 1VQ9V 2RQ6A 1GH6A 1JPXA 4KHPB 5JVDA 4Z1MG 2ARHA 3RYHA 3G71V 1Q86W 2AHYA 4LBEC 3CCJV 3A8TA 1AR5A 1A32A 3B8NA 4FM0A 1H2SB 3UCSC 2Q5ZA 3LDCA 3ZHRA 2LFRA 4RAIA 4O2BB 2AZ2A 3TGUH 2N74A 1P7BA 3QO7A 1HNWO 4JI2O 1IBMB 4I0XB 2E74B 4MTOA 1TUEB 1IDSA 2D2CB 4B7KA 2DYSC 3JD2A 3SYAA 1N8RW 4O2AA 1XL6A 5FL7G 4I55B 3ZMSA 4DUYB 5IWAO 5B1BB 2CGOA 3ABTA 4PDRA 2IJIA 2CTRA 1QR9A 4L8JA 1PL0A 4JI0O 1S76D 3T4ZA 1ZX3A 4FFBA 4JI8B 2H94A 1M5IA 2KG7B 5EBMC 1PPJH 1IBLO 2K9PA 2QDOA 4OPHA 1YITV 1WAZA 3K58A 1DTOA 1US6A 1KQSU 2OIEA 1Y4MA 3B2EE 1R3IC 2RNBA 2XAHA 5LMNO 1JR9A 2LJ2A 4DO2A 5KAFZ 5CA1A 2YI9A 2Q8VA 3SJQC 2YIBA 2UUBB 4KP4A 2M7WA 4AQYB 5B1NA 4B7EA 2Y0PA 5C93A 3SYCA 1ZUQA 4YHHB 1VQOV 4X1KB 1M90W 5K1PA 1SKVA 2R72A 4FFKA 5L3DA 1YTFD 3AG7A 4BR6A 3GWKC 1SQQH 4JTCB 2ZIOA 1Y66A 3AK1A 4WFGA 3W7UA 1XI1A 1PV0A 2L6LA 2Y69C 1XNRO 4PJ0Z 4DV4B 1MA1A 3SGIA 4TOIA 3F5TA 2XAJA 3OE7G 3C3TA 1RSOA 1U96A 2IU0A 4MT8A 2CDYA 2MW2B 3DGEA 1EFRG 3BY6A 5FNVB 2ZINA 4BW5A 4FLUA 1K33A 1MZEA 4TT3G 2UXXA 2C2AA 4MTFA 4UB6Z 5B3SB 2WLMA 5IY5B 4MVMA 4X64B 1FYJA 1H8EG 4LH7A 3SYOA 1VQ4V 1HNWB 2LGWA 2ETNA 3BPZA 1H38A 1FAFA 4FZ1A 3OTOO 2AW9A 1M1KW 1BSMA 1P49A 1RM1C 1GN4A 3P3PA 3L75H 2EILB 3UT5A 2N05A 3OM3B 4DW1A 4OGQB 2JEUA 2P06A 5IE9A 3G6EV 2F4VO 4Z1VA 5IWAB 3B4SA 2GUZB 4DUZO 4DR5O 2CTQA 4U7NA 1Y76A 3E8BA 3JASB 3ZBHA 1LNQA 4DV7O 3B09A 2ZNJA 3CSXA 1R6NA 4CS2A 4LFBO 1UFIA 1HP8A 2BSKA 2BTQB 1Y6XA 5LP6C 1SQFA 1I0HA 3HPLC 3OMNB 3CX5F 3N2KA 3F7VC 3CCMV 5LMNB 4G28B 4UVAA 4AILC 2R9AA 3ICXA 5GONA 2XHBA 4TUYB 2OCCB 4FLYA 2QTOA 3E22A 5EBLC 1JQ0A 4U3FH 2Q4PA 1Y74B 1R6KA 1ZL8B 2A79B 2GBOA 2Y4UA 2LFSA 2YS8A 4K0KB 2A3QA 5J2UB 2AZ0A 3JSNA 2IJJA 5A9GA 1IZ3A 2X6BA 1L1FA 4JI4B 2NNUA 3BCCH 4LH6A 1NKDA 1ZLZA 4JF3A 5AG2A 5EZYB 4I50A 3E2EA 2V7QG 3ML0A 2DQ0A 2ZE8A 4FPPA 3ZHTA 3K9SA 4UV8A 4JI5B 1FJGO 4DV1O 4HAMA 3ETQA 1FXKB 3JAKB 4ZIBA 1YJNV 5FLXN 2WAMA 1JFFB 5HFLA 4NXNO 1SS3A 3O65A 3CC2V 1FD9A 3AG4C 1Q7YW 3G80A 4NTWA 1PKXA 2LGQA 2IH1C 2Q7GA 1N0JA 1CP9A 4MVOA 5JJNB 2MK3A 5GONB 5CB4A 1XDCA 2QWNB 1R3JC 2ZM6O 1SRYA 4FM1A 2Z0AA 3H1IH 5C8YA 3T4DA 2XNDG 3BHPA 2EX3A 2ZR3A 2P67A 1VQ5V 3D3IA 1HR0B 1FXHA 4NYKA 2F4VB 4P9PA 1PNLA 2OTLV 2IM9A 1E1QG 1AP5A 5CMUA 3IFXA 1EN5A 4Q20A 4DR5B 4E2LA 4I50B 3UQ8A 3UO3A 5IJ0B 2ZXWB 2KKWA 1G4YB 3H1KH 2G38A 2QM7A 5KA5A 4F6EA 3QVNA 3DXRA 1N34B 2VQFB 3X2QC 2VWKA 2EIMC 4UXNA 5K1XA 4LFBB 1YIJV 4ABMA 3JAWB 2Q7HA 2PUSA 1ZTEA 4YJ3A 3E89A 1CXZB 3L71H 5LMUO 4PDMA 4NTXA 1SQPH 4DV3O 1OHHG 3D8CA 2WLLA 5LP6A 3WG7C 3ZHQA 4GX2A 1KKCA 2GTSA 1BHAA 1YXBA 5EK0A 4UCSA 3STZC 1EM1A 3WB1A 4K8XA 4F6RB 2CGNA 1OCCB 1I08A 3KG2A 1MSWD 3BFRA 3ZS8C 2DYRC 3DC5A 5KHKA 4P30A 1MABG 3FAVB 4KL1A 5LGTA 2GHYA 1VF6C 3K79A 5KX5A 3ZCCA 1JJOA 3H1HH 4U7OA 4J41A 5B1BC 4KHPO 4BIUA 1KMIZ 2DE0X 4J9YB 4EB6A 1BS3A 1SESA 2YXLA 3OMAB 4JI6O 5LYJB 1VQKV 1FJGB 1AI7A 1QHTA 2PI5A 3B40A 3G67A 3JATB 3OTFA 3OUFA 3ZN0A 3FB6C 3WFVA 1B04A 2OIGA 3CRCA 2XASA 1NU1H 3RGBA 4NXNB 1M56C 4QIWF 1E79G 1M93A 1YEWA 1SERA 1EN6A 1VQPV 3RYCB 4JYBA 1IBMO 4CC5A 2Y4TA 3F5WC 3AG3C 1ENVA 1K7DA 3E83A 4PDLA 5IYCO 2B5UA 4JV5B 3OAAG 1S72V 3JARB 4R8CA 1XMQB 1KECA 3RVYA 2QM4A 1TVKB 2VRZA 4R6ZA 3ZHSA 4RQFA 1AJPA 4X1IA 1AROP 5L3CA 4UCVA 4MVRA 4DUYO 4YXWG 5BZBA 2IU3A 1OCZB 4RO2A 5IJ9A 1CEZA 5L3EA 4W4KA 1B6QA 2A7WA 4EB6B 4GZRB 4Q6GA 3QF7A 4G2KA 2BTOA 1URFA 3RYIA 3ABKB 1K4DC 3IJ4A 4RWUA 1KYOF 2V4DA 2JK5C 1VMGA 3ZRSA 5LL6Y 1WLEA 2PF4E 5B3SC 2CTWA 2DWEC 2EULA 4RUFA 1XL4A 2ZDIC 1U97A 4PDVA 4WFHA 3I56V 5L3BA 1Q81W 1B06A 4ZI7A 2UUBO 3A0HZ 1IVSA 5H6QA 2EIKB 2QWQB 3GVMA 4JAVA 3SR2C 4JI1O 3AK3A 2RCVA 4X88A 1AR4A 1IXMA 2WLNA 5L3GA 2ZKOA
chains in the Genus database with same CATH topology
2ATKC 1QLEC 1V54B 3ZRWB 3CCVV 1M90W 2K1EA 5KUMA 4JTAB 1QCEA 4XBFA 1RM1B 4QJFB 5L3DA 2QA4V 4MTXA 4G27B 4GT1A 1YTFD 2P90A 3LDDA 1JJ2U 3EHBB 1S0VA 4JTCB 2HVKC 3ZRVA 1Y66A 4UV9A 4WFGA 4WFAV 3W7UA 2W0FC 1KD1W 3SPCA 3OR6C 2Y69C 4CBCA 3OFNG 2HR3A 3PJSK 3VOUA 5HFMA 1R73A 3K3WA 2XAJA 1QVGU 1ROPA 3OE7G 3B77A 3W7TA 4QNHB 1K73W 1PD3A 3VBBA 3ZMTA 3CCSV 1YI2V 2IU0A 1AI4A 5LGUA 4MT8A 1KKDA 3DGEA 1EFRG 3BY6A 4TWKA 3W7XA 3CPWU 4XDLA 4BW5A 3QO5A 2W6IG 1K33A 4TT3G 1MG1A 1RPRA 2UXXA 2C2AA 2XAGA 1NBMG 3ASOB 4MTFA 3ZJZA 5B3SB 4ZKIA 2WLMA 1DF4A 5IY5B 5LHGA 4MVMA 2WLLB 2X7RB 4MW8A 1H8EG 3SYOA 2AHZA 1VQ4V 2EIKC 4CZZA 1W0JG 1GKFA 1P4RA 1F4NA 5LHIA 1H38A 1CPYA 5CA3A 1BL8A 2ITDC 2YEVA 3K0DA 1V54C 1GMGA 1M1KW 2WPDG 1RM1C 3CCUV 4P2ZA 2EILB 1QLEB 1KP3A 3OGCC 4MW3A 2NLJC 5GW7A 1NVPB 4PA9A 1YSCA 3OM3B 4MSWC 2JEUA 3FYIB 2P6JA 1QBZA 3G6EV 4JYCA 2CK3G 1DF5A 5CBGA 3ZIAG 1OCRC 2HJFC 4XDJA 4DXWA 2WLIA 1HWYA 2EJRA 1NR7A 3RW0A 4U7NA 1M9NA 2ZR2A 4JASA 3CYOA 2XAQA 3LSSA 3E8BA 3JD1A 1LNQA 3ABUA 1F4MA 2IH3C 4H37A 1H8HG 1R6NA 4LP8A 2JEXA 4MVSA 4KFMA 3RVZA 1JVMA 3OW2U 5IY5C 2GSMB 3ETEA 1I5YA 1NH2B 3HPLC 3OMNB 2DQ3A 1NVPD 2A9HA 2XAFA 2D3OW 3F7VC 3CCMV 2P7TC 3OR7C 4G28B 4UVAA 1S5HC 3G4SV 4UVCA 1M57B 3ABMB 4F4LA 3UM7A 1VQ8V 3SYPA 2OCCB 2QTOA 3B8MA 3FB8C 4MS2A 1EZJA 1VQMV 5EBLC 1JQ0A 1R6KA 2A79B 4MVZA 3OEEG 1K4CC 2Z5UA 2YEVB 2EILC 1SZTA 2LFSA 2EIJB 4UVBA 4WCEV 2BOCC 3MHSC 1K5SA 1PNKA 2IJJA 2FTKA 4WFFA 3CD6V 5B1AC 2EZOA 2X6BA 1L1FA 1K34A 4QE9A 2BOBC 2NNUA 2X6CA 1OCRB 1NKDA 1K8AW 1THZA 4JF3A 5H6RA 5L3GA 1NH2D 4QPKA 4KUMA 2HFEC 3NXSA 3E2EA 3E8GA 3FYEB 1FFTB 2Q67A 2V7QG 5L3FA 3STLC 3ML0A 3TETA 3E8FA 5LGNA 2JIZG 3E8HA 4MTGA 2DQ0A 4FPPA 4UV8A 3IC7A 1RPOA 1VQ6V 1KP2A 1GM8A 1E1RG 3OEHG 1K9MW 4BIZA 3ZMZA 4HAMA 4QE7A 1J95A 4XDKA 3X2QB 1FXKB 2EIMB 4FJCC 2HVJC 1YJNV 4R7CA 3CCRV 4WFEA 3AG2C 3E35A 2WAMA 3JYCA 3F7YC 1K5QA 5HFLA 4PELA 2JJ2G 3LUTB 3P30A 5C93A 3CC2V 1M57C 3ABMC 3AG4C 1Q7YW 2JJ1G 2OCCC 3K9AA 2R9RB 1PKXA 2QM8A 2IH1C 2WWWA 1CP9A 5KUKA 2OTJV 4MVOA 2MK3A 1UJWB 1R3JC 1SRYA 3WG7B 1QLNA 2EIJC 3LDEA 3I55V 1V55B 1K97A 2YSUB 3T4DA 2XNDG 4RQEA 4WFBV 2WLHA 3CMAV 1VQNV 1S77D 2ZR3A 2IJHA 3SPGA 2P67A 1VQ5V 3D3IA 5B1AB 3CCQV 2EINB 3K04A 1FXHA 1FXVA 3LSQA 4P9PA 1PNLA 2OTLV 3CMEV 1E1QG 2QEXV 2DYRB 2OT5A 4J9ZB 5CMUA 4P9OA 1FS0G 2WLKA 3IFXA 3JD4A 4N23A 4Q20A 2V1DA 3CCEV 1G8MA 4E2LA 3CC7V 2F43G 4OXSA 1PNMA 2ZXWB 5EC1C 5B1OA 4FK5C 5CBHA 1G4YB 2QKSA 2B1IA 2QM7A 5KA5A 3JD0A 2EZPA 3GB7C 4FMTA 1R3LC 4JAUA 2HG5C 5H9CA 2X0LA 5J9PC 1JX9A 3X2QC 1FXKC 2EIMC 4UXNA 4N21A 2JDIG 1ZWIC 1AI6A 1H2GA 2IJKA 3QNEA 1YIJV 4R50A 4BAYA 3T1CA 3T2MA 3MD0A 4JGSA 2R9IA 3AG2B 3BEHA 3ABLB 5DN6G 4FIPC 1YJWV 1MOFA 3A0RA 3E89A 4MVQA 4I5SA 4PDMA 3AG4B 4PA3A 3QO8A 2ZDIA 1W0KG 1OHHG 1M56B 4PA6A 1F23A 4EKWA 2WLLA 3AG1C 2QE7G 3WG7C 4GX2A 3CCLV 1AI5A 4LCUC 4WF9V 5IYDO 3AEIA 1BHAA 1V55C 4UUJC 1VQLV 2DWDC 2DW4A 5EK0A 3CC4V 3AG3B 1OCOB 2LP7A 3STZC 1YJ9V 2EBOA 3FKSG 2A0LA 5IDJA 3H01A 1OCCB 2XOKG 5EBWC 3OMIB 1COWG 2B1GA 2EINC 3SYQA 1I5XA 3KG2A 3SPIA 2DYSB 3ASNB 2UXNA 3CXCU 1MSWD 2HLDG 1BHBA 1K92A 2W6JG 2DYRC 1GK9A 2H8PC 4P30A 5DM6V 1MABG 4PA4A 2WLIB 5LGTA 2GHYA 2KB1A 3K79A 3E86A 3R65A 3ZCCA 1AJQA 3ETGA 4U7OA 2ZXWC 3CP1A 5B1BC 4BIUA 1VQ9V 1OCZC 4J9YB 3TK1A 1SESA 1JPXA 3OMAB 1QVFU 1VQKV 4Z1MG 1Q82W 1EBOA 3G71V 3K03A 1Q86W 2AHYA 1AI7A 4ZBMA 2PI5A 1GO3F 2ITCC 1QR8A 4LBEC 3JD3A 3CCJV 1GTOA 3ABKC 3ABLC 3OUFA 1DLBA 3B8NA 3ZN0A 3FB6C 3FB7C 3WFVA 1SETA 4L87A 3ZMVA 2XASA 3P32A 1M56C 4QIWF 1E79G 1GM7A 1JCHA 3LDCA 2LFRA 2Q68A 1VQPV 1SERA 4RAIA 4RUEA 3EFFK 4JYBA 3UKMA 1P7BA 1ORQC 3AG1B 4QPJA 3F5WC 3QO7A 1GM9A 4PA7A 3AG3C 1OCOC 1ENVA 1K7DA 3E83A 3D36A 2Z3YA 4PDLA 5IYCO 2B5UA 4HYOA 1K3EA 4MTOA 4GX5A 3GWOA 1OCCC 1TUEB 3OAAG 1VQ7V 1S72V 2ZQMA 4R8CA 1KECA 2DYSC 3ASNC 5LHHA 4HZ3A 3JD2A 5EC2C 3RVYA 3ZRWA 3SYAA 3JCZA 4GX0A 1JOYA 4R6ZA 4RQFA 1AJPA 1AROP 5L3CA 1N8RW 1XL6A 4MVRA 1KC8W 5LBQA 3SPHA 5FL7G 4X8AA 4YXWG 3ZMSA 3K08A 4H33A 4GCZA 5BZBA 5B1BB 2PI4A 4X89A 3ETDA 3ABTA 3ZN1A 2IU3A 3M99B 1OCZB 4ASUG 1BMFG 4PDRA 4RO2A 1CEZA 5L3EA 1B6QA 2IJIA 2Q6AA 1QR9A 3LNMB 2IW5A 2Q69A 1PL0A 2Y69B 5CBFA 1S76D 3T4ZA 4G2KA 3RBZA 1NJIW 3OUSA 2H94A 1OZ0A 3TCUA 1NQTA 5EBMC 1WPXA 4LC1A 3ABKB 1K4DC 4MVUA 1W2BU 1YTFB 1R3KC 2JK5C 1S3JA 1YITV 3ZRSA 5KA6A 1WLEA 5E1AC 5B3SC 3ASOC 1DTOA 1FXKA 2DWEC 4RUFA 3ZMUA 3W7WA 1XL4A 2ZDIC 1KQSU 1AJNA 1F51A 4PDVA 4WFHA 3I56V 4JPRA 1Y4MA 3DTUB 2WLJA 1R3IC 3ZRXA 3HB3B 5L3BA 1AR1B 1Q81W 2Y48A 3FB5C 2XAHA 4GX1A 4DO2A 3MHHC 5CN0A 3K06A 2X6AA 4TSFG 5H6QA 3SJQC 2EIKB 2ZD9A 4JTDB 4JAVA 4KP4A 2M7WA 2WSSG 2HKOA 4I9WA 5B1NA 1YHQV 5IYBO 4X88A 3K0GA 3IGAC 1IXMA 2WLNA 3SPJA 3SYCA 1NR1A 1VQOV 3W7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUF A;  3SPG A;  4MVS A;  2ATK C;  4KFM A;  3FB6 C;  1QLE C;  1JVM A;  3RVZ A;  3FB7 C;  5IY5 C;  2K1E A;  5KUM A;  4JTA B;  3K04 A;  4P9P A;  4G27 B;  1M56 C;  3HPL C;  3LDD A;  3LDC A;  2A9H A;  4JTC B;  4J9Z B;  2HVK C;  2Q68 A;  4P9O A;  3F7V C;  4RAI A;  4RUE A;  2WLK A;  2P7T C;  3IFX A;  3EFF K;  2W0F C;  3OR7 C;  4G28 B;  4WFG A;  3UKM A;  1P7B A;  1ORQ C;  1S5H C;  2Y69 C;  3OR6 C;  4OXS A;  3SPC A;  3F5W C;  4CBC A;  4PA7 A;  3AG3 C;  1OCO C;  3PJS K;  3UM7 A;  5EC1 C;  3VOU A;  3E83 A;  3SYP A;  4F4L A;  4PDL A;  5CBH A;  1G4Y B;  2QTO A;  3FB8 C;  4MS2 A;  2QKS A;  4HYO A;  5EBL C;  4MTO A;  4QNH B;  4GX5 A;  1OCC C;  3GB7 C;  1R3L C;  2A79 B;  4MVZ A;  2HG5 C;  1K4C C;  2EIL C;  4R8C A;  5J9P C;  2DYS C;  3ASN C;  3X2Q C;  4HZ3 A;  1KKD A;  2EIM C;  1ZWI C;  3SYC A;  2BOC C;  5EC2 C;  3RVY A;  3SYA A;  4GX0 A;  4TWK A;  4R50 A;  4R6Z A;  3T1C A;  3T2M A;  4XDL A;  4BW5 A;  4WFF A;  1XL6 A;  4MVR A;  5B1A C;  3BEH A;  4MTF A;  2X6B A;  3SPH A;  3ZJZ A;  2WLM A;  4QE9 A;  2BOB C;  2X6C A;  3E89 A;  4X8A A;  4MVQ A;  3K08 A;  4MVM A;  4H33 A;  2WLL B;  4PDM A;  4MW8 A;  4PA3 A;  5BZB A;  3SYO A;  2HFE C;  2AHZ A;  4X89 A;  4PA6 A;  2EIK C;  3E8G A;  2WLL A;  4PDR A;  4RO2 A;  3AG1 C;  4EKW A;  2Q67 A;  2Q6A A;  3STL C;  3WG7 C;  3TET A;  3E8F A;  4GX2 A;  3LNM B;  4LCU C;  3E8H A;  4MTG A;  2Q69 A;  1V55 C;  4UUJ C;  5CBF A;  2DWD C;  5EK0 A;  3T4Z A;  1BL8 A;  3RBZ A;  3STZ C;  2ITD C;  2YEV A;  3OUS A;  3TCU A;  2A0L A;  3K0D A;  1V54 C;  5EBM C;  4QE7 A;  5EBW C;  1K4D C;  3SYQ A;  2EIN C;  1J95 A;  4MVU A;  4XDK A;  4P2Z A;  3KG2 A;  1R3K C;  2JK5 C;  3OGC C;  3SPI A;  4MW3 A;  2NLJ C;  2HVJ C;  3ZRS A;  4R7C A;  4PA9 A;  2DYR C;  4MSW C;  4WFE A;  2H8P C;  3AG2 C;  5E1A C;  4P30 A;  5B3S C;  2DWE C;  3ASO C;  3F7Y C;  3JYC A;  4RUF A;  4PA4 A;  2WLI B;  1XL4 A;  5CBG A;  2KB1 A;  3E86 A;  3LUT B;  3R65 A;  4PDV A;  1OCR C;  4WFH A;  2HJF C;  1M57 C;  3ABM C;  3AG4 C;  4XDJ A;  2WLJ A;  1R3I C;  2ZXW C;  2WLI A;  4DXW A;  2OCC C;  5B1B C;  2R9R B;  3FB5 C;  4GX1 A;  1OCZ C;  2IH1 C;  4J9Y B;  3RW0 A;  3K06 A;  5KUK A;  4MVO A;  2X6A A;  3SJQ C;  2ZD9 A;  4JTD B;  3E8B A;  1R3J C;  1LNQ A;  4I9W A;  2EIJ C;  3LDE A;  3K03 A;  2AHY A;  4ZBM A;  2IH3 C;  2ITC C;  4H37 A;  4X88 A;  3T4D A;  3K0G A;  4LBE C;  3IGA C;  2WLH A;  2WLN A;  3SPJ A;  3ABK C;  4LP8 A;  3ABL C; 
#chains in the Genus database with same CATH topology
 1BZK A;  3CCV V;  5KUM A;  1QCE A;  2FYU H;  2P90 A;  3HKE A;  1JJ2 U;  2OWO A;  4DV4 O;  3EXA A;  2RJZ A;  1KD1 W;  3D3Q A;  3SPC A;  3OR6 C;  3JSL A;  1IX9 A;  4DV5 B;  2HR3 A;  3PJS K;  2PTM A;  1MNG A;  2YIA A;  3N27 A;  2HJD A;  4JI6 B;  3BAB A;  4IIJ B;  1YF2 A;  4IHJ B;  2OYQ A;  3SDL A;  3OGI B;  1KKD A;  3HKC A;  1D2D A;  4U3J B;  5FPO A;  1WB7 A;  1KBH A;  3W7X A;  3CPW U;  4XDL A;  3QO5 A;  2UXC B;  4X64 O;  2XAG A;  3ZJZ A;  4DR3 O;  4ZKI A;  1G1X B;  3I5D A;  1VF5 B;  1GAX A;  2X7R B;  4MW8 A;  4AHC A;  5D5P A;  5ITZ B;  2ZNI A;  1SQV H;  1H2M A;  4ZI7 B;  1F4N A;  4O4H B;  5LHI A;  1CPY A;  5IYZ A;  5JH7 A;  2ITD C;  4O4L A;  1DK1 A;  1V54 C;  1GMG A;  4TV8 A;  4YIO A;  5A2Q N;  2WPD G;  4P2Z A;  1QLE B;  3SJA C;  2NLJ C;  1NVP B;  2NN4 A;  1Z5W A;  4PA9 A;  4X65 O;  1YSC A;  4MSW C;  5LOV B;  3RYF B;  2CK3 G;  2FB5 A;  4DK0 A;  4XDJ A;  1X59 A;  1VAR A;  1NR7 A;  5JVD B;  1XMO O;  4CS3 A;  4GKK B;  3CJH A;  1N0N A;  4PD4 F;  3RYH B;  3CYO A;  1NTK H;  2XAQ A;  3LSS A;  5KHH A;  4FZ0 A;  3VQV A;  3JD1 A;  1F4M A;  1TUB A;  2F95 B;  2IH3 C;  1SC5 B;  4H37 A;  1H8H G;  3A2F A;  3RVZ A;  1AP6 A;  1JVM A;  4D7S A;  3OW2 U;  1J5E B;  4OX9 O;  1N4C A;  2DQ3 A;  3A0B Z;  1WNS A;  1L0L H;  3OR7 C;  3NR7 A;  1S5H C;  2DMX A;  2N04 A;  3G4S V;  3ABM B;  4F4L A;  1VQ8 V;  1WB8 A;  1H2L A;  3FB8 C;  1EZJ A;  5KHI A;  4DW0 A;  4MVZ A;  4JI1 B;  4K0K O;  4PI2 A;  1SZT A;  2F66 C;  1LUW A;  3KCX A;  4O2A B;  4LNU A;  2EIJ B;  4UVB A;  2ZE5 A;  5KLV H;  4JI4 O;  2HHH B;  3J80 N;  4QE9 A;  2P22 C;  1OCR B;  1PM9 A;  4QPK A;  1NI8 A;  2UUA O;  5B66 Z;  4JI5 O;  3STL C;  3TET A;  5LGN A;  4FFB B;  4H44 B;  1VQ6 V;  4ZOL A;  4X62 O;  1TUB B;  3TXQ A;  1Q6U A;  1TGO A;  1YVW A;  3SJC C;  1ZAU A;  2UU9 O;  3EVK A;  3M7M X;  5JCO C;  4DR3 B;  4WFE A;  3APQ A;  2ADQ B;  1K5Q A;  1YCI A;  3HKB A;  2RN9 A;  1M57 C;  2GDS A;  5BXZ A;  3K9A A;  5CA1 B;  1W59 A;  2R9R B;  2QM8 A;  2WWW A;  2B9Z A;  2ZIM A;  2JVD A;  2ZT9 B;  3LDE A;  3I55 V;  4K3A A;  2QGN A;  3T1H B;  1SQG A;  1S77 D;  2IJH A;  1HR0 O;  3K57 A;  4DR1 O;  4X65 B;  3K04 A;  4LF8 O;  1FXV A;  3LSQ A;  3K5N A;  3CME V;  2YIC A;  1SZX A;  3J7A U;  4J9Z B;  1BQZ A;  4N23 A;  3CCE V;  1XMO B;  1G8M A;  1M4U A;  4BWA A;  4DRX A;  1PNM A;  2KQX A;  5B1O A;  4FK5 C;  1RSO B;  4K35 A;  5EYP A;  1N34 O;  2QKS A;  2VQF O;  2CTP A;  3JD0 A;  4NXM B;  4JAU A;  4DV0 B;  1JX9 A;  1ZSP A;  1XOU A;  4J80 A;  4HBN A;  5JWP A;  1XIL A;  1IXB A;  3QNE A;  4R50 A;  4BAY A;  3MD0 A;  1N33 B;  5DN6 G;  1MOF A;  4OX9 B;  3WB0 A;  4PA3 A;  4B08 A;  3HKB B;  3QO8 A;  5DED A;  3VQY A;  1FPO A;  2QE7 G;  1SA0 A;  4UCT A;  2BCC H;  3AEI A;  1V55 C;  4UUJ C;  3H1J H;  1XRE A;  2EBO A;  1Z2G A;  2A0L A;  4DR2 O;  3H01 A;  3UT5 B;  3OMI B;  2EIN C;  2DYS B;  1BHB A;  2W6J G;  3APO A;  1GK9 A;  2UUC B;  3RN4 A;  3E86 A;  3R65 A;  4DYL A;  1WP7 A;  1AJQ A;  1Y76 B;  2UUA B;  1OCZ C;  1UPG A;  4DRX B;  4TV9 A;  1NTM H;  5JQG A;  5EYP B;  4YJ2 A;  1QVF U;  1Q82 W;  4X62 B;  4FVM A;  4ZBM A;  5LXT A;  3JD3 A;  3UO2 A;  3HKD A;  2YXH A;  3ABK C;  3ABL C;  2UU9 B;  2BSK B;  2E75 B;  1BCC H;  2FKX A;  1SET A;  3CRQ A;  3ZMV A;  3N2K B;  1BGY H;  2PGG A;  3P32 A;  3ZHU A;  4B3M B;  2GTA A;  1GM7 A;  1YZB A;  1VF7 A;  2QR4 A;  3CRA A;  2Q68 A;  4RUE A;  1KUQ A;  5JCO A;  3UKM A;  4LF4 B;  3AG1 B;  2QJ1 A;  3E22 B;  4PA7 A;  4JV5 O;  1OCO C;  4IGG A;  2Z3Y A;  1XMQ O;  4HYO A;  2DOS A;  3BAA A;  1Z5V A;  3GWO A;  4GX5 A;  1VQ7 V;  2ZQM A;  1BE3 H;  5H2F Z;  3ASN C;  3CRR A;  2GV9 A;  1EN4 A;  4TQD A;  5EC2 C;  1LUV A;  3RWR D;  3ZRW A;  1JOY A;  4GX0 A;  4DR1 B;  1R6T A;  4LF8 B;  5KMG A;  5LBQ A;  1RP3 B;  2JGU A;  4PV1 B;  4YIP A;  4X8A A;  2CE4 A;  3K08 A;  4H33 A;  4GCZ A;  1L0N H;  2PI4 A;  4X89 A;  3WU2 Z;  3ETD A;  1NS1 A;  3M99 B;  3P3N A;  1BMF G;  1IBK O;  3LNN A;  4O4J A;  4TV9 B;  2Q69 A;  2Y69 B;  5CBF A;  1NJI W;  1OZ0 A;  3TCU A;  1Q3E A;  1HNZ O;  2E3C A;  1GN2 A;  5LXT B;  1WPX A;  4FLT A;  1XNQ O;  1W2B U;  4LF5 O;  2VWJ A;  4DR7 B;  4JI7 B;  5KHJ A;  3ZMU A;  3W7W A;  1S5J A;  2M6Y A;  4KXR A;  3JAL A;  1AJN A;  2F93 B;  3DTU B;  2WLJ A;  2ZCE A;  3ZRX A;  2Y48 A;  3FB5 C;  5CB4 B;  2H3O A;  1WA8 A;  4GX1 A;  5CN0 A;  4TSF G;  2ZD9 A;  2ADP A;  4X66 B;  4JTD B;  5C8Y B;  1P7G A;  1XQ8 A;  2HKO A;  1L8D A;  4I9W A;  1B3Q A;  4DV6 B;  4DR2 B;  3K0G A;  3IGA C;  1NR1 A;  3W7S A;  2ATK C;  3M8A A;  1QLE C;  3N2G A;  3ZRW B;  1T5E A;  1XHZ A;  1RM1 B;  4QJF B;  2QA4 V;  4GT1 A;  2ZE7 A;  3EHB B;  4E4E A;  2HVK C;  4DV5 O;  3U11 A;  3VOU A;  2QKC A;  1R73 A;  3DXR B;  3K3W A;  1ROP A;  3B77 A;  3W7T A;  4QNH B;  1K73 W;  1PD3 A;  3ZMT A;  3CCS V;  1YI2 V;  1AI4 A;  1HNX B;  4JI3 B;  1XHX A;  2VS0 A;  3S3X A;  2UXC O;  4LWS A;  2CUG A;  4TWK A;  1MZF A;  4YJ3 B;  5F2V O;  2W6I G;  1MG1 A;  1RPR A;  1LR1 A;  2W0X A;  3ASO B;  2LW7 A;  2JRI A;  2PY5 A;  1DF4 A;  2WLL B;  4EEQ A;  5LP6 B;  2JGD A;  3BA9 A;  4LF9 B;  1W0J G;  1GKF A;  1Q8I A;  3L70 H;  4B3T O;  1F7Y A;  1RFY A;  1WN7 A;  5CA3 A;  2YEV A;  3IAY A;  3K0D A;  3CS5 A;  3BVO A;  3CCU V;  4D7T A;  1KP3 A;  4UCO A;  1H2N A;  3N2G B;  2L35 A;  5KX5 B;  2VQE B;  2PYJ A;  1WJZ A;  3FYI B;  1QBZ A;  4NKG B;  5FPR A;  4LF6 B;  3ZIA G;  1OCR C;  2QTS A;  4GKK O;  2HJF C;  3JCU Z;  3KZI Z;  1G6U A;  2WLI A;  1HWY A;  1IBK B;  3RW0 A;  1M9N A;  2UXD O;  1HNZ B;  3CXH F;  1XNQ B;  1X4T A;  4LP8 A;  1J5E O;  4LF5 B;  2JEX A;  4FLW A;  1Y67 A;  1D5N A;  4LWS B;  5IY5 C;  3ETE A;  1I5Y A;  1NH2 B;  4J11 A;  4LR3 A;  3L73 H;  4GKJ B;  1NVP D;  2A9H A;  2XAF A;  2D3O W;  4GLX A;  2UXB B;  3HR0 A;  5JJJ B;  3Q4H A;  4O2B A;  3SYP A;  1DGS A;  4FM2 A;  3PN1 A;  3OEE G;  1K4C C;  2Z5U A;  2YEV B;  2EIL C;  4I0X A;  4J7J A;  4X1I B;  3S3W A;  2Q73 A;  4JYY A;  2FML A;  2Q7E A;  2HHH O;  4DV2 O;  1K5S A;  1FKA O;  3U0Z A;  4X1Y A;  4WFF A;  1PP9 H;  2CH7 A;  2BOB C;  2E76 B;  5H6R A;  5IJ9 B;  4LF7 B;  3TJT A;  2HFE C;  1VF6 A;  5KAI Z;  4I55 A;  2O57 A;  3E8G A;  2Q67 A;  5L3F A;  4UB8 Z;  2JIZ G;  4MTG A;  1RPO A;  1QU7 A;  3RYI B;  4LFA B;  1BT8 A;  1GM8 A;  1NTZ H;  1E1R G;  3OEH G;  3ZMZ A;  1J95 A;  4XDK A;  2KG7 A;  3X2Q B;  2EIM B;  4FJC C;  2HVJ C;  3F7Y C;  2LO1 A;  5BR8 O;  3D36 C;  2JJ2 G;  3LUT B;  3P30 A;  4W4L A;  2IBZ H;  2JJ1 G;  2OCC C;  4DR6 B;  1R1B A;  3Q4H B;  2XT9 A;  5KUK A;  4B3T B;  1Q5O A;  1UJW B;  3T1H O;  5GTI Z;  2ODM A;  3WG7 B;  1QLN A;  1OV9 A;  5KHG A;  1K97 A;  4WFB V;  4QGP A;  2WLH A;  1VQN V;  1AB3 A;  4CH5 A;  2CAZ C;  3SPG A;  5B1A B;  5EIB D;  4X1Y B;  3HKE B;  4X1K A;  1YDX A;  2CH7 B;  2DYR B;  2OT5 A;  3OD4 A;  4P9O A;  1FS0 G;  4I4T A;  3CC7 V;  2F43 G;  4OXS A;  3TXS A;  2UXD B;  1HW7 A;  2P4V A;  4NXM O;  4DV0 O;  2B1I A;  2YIB D;  2EZP A;  3GB7 C;  4FMT A;  1R3L C;  3HKC B;  2HG5 C;  3FD9 A;  5H9C A;  2JS5 A;  2X0L A;  4Z2W A;  2E5L O;  4JZ2 A;  1FXK C;  1N33 O;  1D5A A;  4N21 A;  2JDI G;  1H2G A;  2IJK A;  2YID A;  1I7F A;  1KU9 A;  3T1C A;  4JGS A;  3CE2 A;  3AG2 B;  1YJW V;  2A06 H;  4FIP C;  1I94 B;  3A0R A;  5FNV A;  4MVQ A;  4I5S A;  1Q43 A;  2ZDI A;  1W0K G;  1M56 B;  4PHZ A;  1SQB H;  4PA6 A;  3CWB H;  4EKW A;  2WA4 A;  3AG1 C;  1Q6I A;  5IYZ B;  5JH7 B;  3CCL V;  4LCU C;  4O4L B;  5IYD O;  1VQL V;  3L74 H;  2DWD C;  2DW4 A;  3AG3 B;  4TV8 B;  4DK1 A;  5IDJ A;  2XOK G;  5EBW C;  1PL4 A;  2B1G A;  4DV2 B;  1I5X A;  2UUC O;  2UXN A;  3CXC U;  1OJH A;  3U10 A;  2H8P C;  4X9Q A;  3KKY A;  3VQX A;  3ETG A;  3CJH B;  1VP7 A;  2ZXW C;  3CP1 A;  1NT2 B;  4I4T B;  4J42 A;  1N32 O;  4WBN A;  3TK1 A;  2GUZ A;  3G6B A;  4YY3 B;  4LFC O;  4K8Z A;  3O9O A;  3T1Y O;  1EBO A;  3K03 A;  2YDE A;  2AGA A;  1GO3 F;  2ITC C;  3JAS A;  1QR8 A;  1GTO A;  2LW1 A;  1VIB A;  1DLB A;  1WPB A;  1TA8 A;  3FB7 C;  2XUM A;  4B3M O;  4L87 A;  5BR8 B;  3H1L H;  3CRM A;  1JCH A;  3ZED A;  4LF4 O;  2BTQ A;  1KB9 F;  4J10 A;  3R66 A;  3EFF K;  1ORQ C;  4QPJ A;  2QWO B;  3IC9 A;  1GM9 A;  1JA8 A;  5LA6 A;  5J2T A;  3D36 A;  1K3E A;  1OCC C;  4TUY A;  4JI2 B;  4IL6 Z;  4LNU B;  4C7U A;  5LHH A;  4HZ3 A;  1Y74 A;  1ZL8 A;  3JCZ A;  1V9P A;  1KC8 W;  3SPH A;  5J2U A;  4CC6 A;  2QKA A;  2LQT A;  3ZN1 A;  4ASU G;  2QWP B;  2Q6A A;  5EZY A;  4H0L B;  3FX7 A;  4ZOL B;  4WBN B;  2Q0O C;  3LNM B;  2IW5 A;  1S5L Z;  3RBZ A;  3OUS A;  3K5L A;  2E5L B;  1NQT A;  4JI0 B;  4LC1 A;  1QNM A;  4DR7 O;  4JI7 O;  4MVU A;  1YTF B;  1R3K C;  4GYC B;  1S3J A;  5KA6 A;  1GN6 A;  2P4K A;  5E1A C;  1IBL B;  4B3R O;  3ASO C;  4I9Q A;  1FXK A;  3JAK A;  4D6T H;  3FFQ A;  1F51 A;  4JPR A;  1IUR A;  3K59 A;  1JFF A;  1AR1 B;  3HB3 B;  4X66 O;  3MHH C;  3J81 N;  3K06 A;  1AVM A;  5LA6 B;  5J2T B;  2X6A A;  1MSD A;  4DV6 O;  2WSS G;  1SQX H;  4NTY A;  1YHQ V;  5IYB O;  2F1M A;  4NR1 A;  3SPJ A;  1SF9 A;  4JAA A;  1V54 B;  5GTH Z;  2K1E A;  4JTA B;  4XBF A;  4OPA A;  4MTX A;  4G27 B;  3ZX6 A;  1BQ0 A;  3LDD A;  3MDS A;  4GUN A;  1S0V A;  4CH4 A;  4BIO A;  3ZRV A;  4UV9 A;  2Q9L A;  4WFA V;  2W0F C;  4UCR A;  1N32 B;  4CBC A;  3CEI A;  5E79 Z;  3OFN G;  2YC0 A;  4LFC B;  5HFM A;  3T1Y B;  1QVG U;  1XNR B;  5IJ0 A;  1HNX O;  3VBB A;  4JI3 O;  4O4I A;  1O9G A;  5LGU A;  2PZS A;  4CH3 A;  4J7Z A;  4PI0 A;  1P84 F;  2Q0A A;  4A5U B;  4DR4 O;  1XUQ A;  3K5M A;  1NBM G;  2FL4 A;  3JAW A;  5LHG A;  4FLX A;  5D5Q A;  5IT9 N;  3RT3 C;  1XEQ A;  3SJB C;  4LF9 O;  1SA0 B;  2AHZ A;  4NVP A;  2EIK C;  4CZZ A;  1Q90 D;  1P4R A;  4IYI A;  2HEP A;  3RFR A;  1WP8 A;  4AI8 A;  1BL8 A;  3QG5 A;  5TIS Z;  3MAQ A;  4F6R A;  2VQE O;  3BRC A;  3OTO B;  3OGC C;  4MW3 A;  5GW7 A;  3JAM N;  3C3S A;  2QSA A;  5CA0 A;  2Y0I A;  3CB2 A;  4LF6 O;  4X20 A;  2P6J A;  1H2K A;  4JYC A;  1DF5 A;  5CBG A;  2ZE6 A;  3QTC A;  2WA3 A;  3FAV A;  4DXW A;  2EJR A;  1QQC A;  5JQG B;  2XTA A;  4YJ2 B;  1MMM A;  2ZR2 A;  4JAS A;  4DUZ B;  2RDC A;  2YI8 A;  3ABU A;  3HKD B;  4O4I B;  5LYJ A;  4DV7 B;  4MVS A;  4KFM A;  2GSM B;  3JAT A;  3DC6 A;  4GKJ O;  3THO A;  4B3R B;  1VEW A;  3OT7 A;  2JS3 A;  2UXB O;  4JZG A;  2BE3 A;  2P7T C;  3WB2 A;  4I7Z B;  4UVC A;  1M57 B;  3UM7 A;  1XBL A;  4UCU A;  3RYC A;  1VQM V;  3B8M A;  4MS2 A;  4TQF A;  1HDJ A;  4UFZ A;  1O9H A;  3KCY A;  3L72 H;  3L9D A;  3H9V A;  3JAR A;  3DSQ A;  4WCE V;  4JYA O;  2BOC C;  3MHS C;  5KMG B;  1PNK A;  3CHX A;  2FTK A;  3CD6 V;  5B1A C;  1N36 O;  2EZO A;  5CA0 B;  1TVK A;  4FLZ A;  4LF7 O;  1K34 A;  2X6C A;  4X20 B;  4B3S O;  1K8A W;  1THZ A;  1NH2 D;  4KUM A;  3NXS A;  4FLV A;  4ZHQ A;  4O4J B;  2DN9 A;  3FYE B;  1FFT B;  3VQW A;  1GN3 A;  4LFA O;  3E8F A;  4IT5 A;  3E8H A;  3IC7 A;  1KP2 A;  4IYH A;  1K9M W;  1Q6H A;  4BIZ A;  4QE7 A;  4DR4 B;  4DV1 B;  2NR5 A;  1NZ6 A;  1FFX A;  2DJV A;  3K5O A;  4R7C A;  3CCR V;  3JAL B;  3AG2 C;  3E35 A;  2ILM A;  3JYC A;  2R70 A;  4PEL A;  1WA8 B;  3ABM C;  4DR6 O;  4HNA A;  2OTJ V;  5BMV A;  5B5E Z;  1GRJ A;  2EIJ C;  5JJE B;  1V55 B;  2YSU B;  4RQE A;  2ZM6 B;  3CMA V;  3CCQ V;  2EIN B;  4J7K A;  2EJ7 A;  2QEX V;  2WLK A;  3JD4 A;  2V1D A;  1EZV H;  4ZHQ B;  5EC1 C;  2PYL A;  5CBH A;  4ICG A;  5EIB C;  4H13 B;  4NB5 A;  2KSD A;  4JI8 O;  5J9P C;  4IIJ A;  4CH6 A;  1ZWI C;  1AI6 A;  4IHJ A;  1I94 O;  1JMK C;  1FFX B;  3T2M A;  3BA8 A;  2QWR B;  4U3J A;  2R9I A;  3BEH A;  3ABL B;  2AXT Z;  3ZHV A;  2JGD B;  3AG4 B;  2OCH A;  1F23 A;  5LMU B;  2RMK B;  5DEC A;  4DV3 B;  4BW9 A;  4HNA B;  5ITZ A;  1AI5 A;  4CS4 A;  4WF9 V;  5BMV B;  2F23 A;  3CC4 V;  1OCO B;  2LP7 A;  1YJ9 V;  4O4H A;  3FKS G;  4AQY O;  2YUA A;  4JYA B;  3SYQ A;  1COW G;  4EFB A;  1AIL A;  4YHH O;  3AK2 A;  5H5N A;  3SPI A;  3ASN B;  2P5O A;  2HLD G;  1N36 B;  1K92 A;  2HP8 A;  5DM6 V;  4B3S B;  3LSU A;  4PA4 A;  2WLI B;  3C90 A;  4EFE A;  2KB1 A;  2YXY A;  5BY1 A;  3RYF A;  5LOV A;  4YY3 O;  1TAE A;  1VQ9 V;  2RQ6 A;  1GH6 A;  1JPX A;  4KHP B;  5JVD A;  4Z1M G;  2ARH A;  3RYH A;  3G71 V;  1Q86 W;  2AHY A;  4LBE C;  3CCJ V;  3A8T A;  1AR5 A;  1A32 A;  3B8N A;  4FM0 A;  1H2S B;  3UCS C;  2Q5Z A;  3LDC A;  3ZHR A;  2LFR A;  4RAI A;  4O2B B;  2AZ2 A;  3TGU H;  2N74 A;  1P7B A;  3QO7 A;  1HNW O;  4JI2 O;  1IBM B;  4I0X B;  2E74 B;  4MTO A;  1TUE B;  1IDS A;  2D2C B;  4B7K A;  2DYS C;  3JD2 A;  3SYA A;  1N8R W;  4O2A A;  1XL6 A;  5FL7 G;  4I55 B;  3ZMS A;  4DUY B;  5IWA O;  5B1B B;  2CGO A;  3ABT A;  4PDR A;  2IJI A;  2CTR A;  1QR9 A;  4L8J A;  1PL0 A;  4JI0 O;  1S76 D;  3T4Z A;  1ZX3 A;  4FFB A;  4JI8 B;  2H94 A;  1M5I A;  2KG7 B;  5EBM C;  1PPJ H;  1IBL O;  2K9P A;  2QDO A;  4OPH A;  1YIT V;  1WAZ A;  3K58 A;  1DTO A;  1US6 A;  1KQS U;  2OIE A;  1Y4M A;  3B2E E;  1R3I C;  2RNB A;  2XAH A;  5LMN O;  1JR9 A;  2LJ2 A;  4DO2 A;  5KAF Z;  5CA1 A;  2YI9 A;  2Q8V A;  3SJQ C;  2YIB A;  2UUB B;  4KP4 A;  2M7W A;  4AQY B;  5B1N A;  4B7E A;  2Y0P A;  5C93 A;  3SYC A;  1ZUQ A;  4YHH B;  1VQO V;  4X1K B;  1M90 W;  5K1P A;  1SKV A;  2R72 A;  4FFK A;  5L3D A;  1YTF D;  3AG7 A;  4BR6 A;  3GWK C;  1SQQ H;  4JTC B;  2ZIO A;  1Y66 A;  3AK1 A;  4WFG A;  3W7U A;  1XI1 A;  1PV0 A;  2L6L A;  2Y69 C;  1XNR O;  4PJ0 Z;  4DV4 B;  1MA1 A;  3SGI A;  4TOI A;  3F5T A;  2XAJ A;  3OE7 G;  3C3T A;  1RSO A;  1U96 A;  2IU0 A;  4MT8 A;  2CDY A;  2MW2 B;  3DGE A;  1EFR G;  3BY6 A;  5FNV B;  2ZIN A;  4BW5 A;  4FLU A;  1K33 A;  1MZE A;  4TT3 G;  2UXX A;  2C2A A;  4MTF A;  4UB6 Z;  5B3S B;  2WLM A;  5IY5 B;  4MVM A;  4X64 B;  1FYJ A;  1H8E G;  4LH7 A;  3SYO A;  1VQ4 V;  1HNW B;  2LGW A;  2ETN A;  3BPZ A;  1H38 A;  1FAF A;  4FZ1 A;  3OTO O;  2AW9 A;  1M1K W;  1BSM A;  1P49 A;  1RM1 C;  1GN4 A;  3P3P A;  3L75 H;  2EIL B;  3UT5 A;  2N05 A;  3OM3 B;  4DW1 A;  4OGQ B;  2JEU A;  2P06 A;  5IE9 A;  3G6E V;  2F4V O;  4Z1V A;  5IWA B;  3B4S A;  2GUZ B;  4DUZ O;  4DR5 O;  2CTQ A;  4U7N A;  1Y76 A;  3E8B A;  3JAS B;  3ZBH A;  1LNQ A;  4DV7 O;  3B09 A;  2ZNJ A;  3CSX A;  1R6N A;  4CS2 A;  4LFB O;  1UFI A;  1HP8 A;  2BSK A;  2BTQ B;  1Y6X A;  5LP6 C;  1SQF A;  1I0H A;  3HPL C;  3OMN B;  3CX5 F;  3N2K A;  3F7V C;  3CCM V;  5LMN B;  4G28 B;  4UVA A;  4AIL C;  2R9A A;  3ICX A;  5GON A;  2XHB A;  4TUY B;  2OCC B;  4FLY A;  2QTO A;  3E22 A;  5EBL C;  1JQ0 A;  4U3F H;  2Q4P A;  1Y74 B;  1R6K A;  1ZL8 B;  2A79 B;  2GBO A;  2Y4U A;  2LFS A;  2YS8 A;  4K0K B;  2A3Q A;  5J2U B;  2AZ0 A;  3JSN A;  2IJJ A;  5A9G A;  1IZ3 A;  2X6B A;  1L1F A;  4JI4 B;  2NNU A;  3BCC H;  4LH6 A;  1NKD A;  1ZLZ A;  4JF3 A;  5AG2 A;  5EZY B;  4I50 A;  3E2E A;  2V7Q G;  3ML0 A;  2DQ0 A;  2ZE8 A;  4FPP A;  3ZHT A;  3K9S A;  4UV8 A;  4JI5 B;  1FJG O;  4DV1 O;  4HAM A;  3ETQ A;  1FXK B;  3JAK B;  4ZIB A;  1YJN V;  5FLX N;  2WAM A;  1JFF B;  5HFL A;  4NXN O;  1SS3 A;  3O65 A;  3CC2 V;  1FD9 A;  3AG4 C;  1Q7Y W;  3G80 A;  4NTW A;  1PKX A;  2LGQ A;  2IH1 C;  2Q7G A;  1N0J A;  1CP9 A;  4MVO A;  5JJN B;  2MK3 A;  5GON B;  5CB4 A;  1XDC A;  2QWN B;  1R3J C;  2ZM6 O;  1SRY A;  4FM1 A;  2Z0A A;  3H1I H;  5C8Y A;  3T4D A;  2XND G;  3BHP A;  2EX3 A;  2ZR3 A;  2P67 A;  1VQ5 V;  3D3I A;  1HR0 B;  1FXH A;  4NYK A;  2F4V B;  4P9P A;  1PNL A;  2OTL V;  2IM9 A;  1E1Q G;  1AP5 A;  5CMU A;  3IFX A;  1EN5 A;  4Q20 A;  4DR5 B;  4E2L A;  4I50 B;  3UQ8 A;  3UO3 A;  5IJ0 B;  2ZXW B;  2KKW A;  1G4Y B;  3H1K H;  2G38 A;  2QM7 A;  5KA5 A;  4F6E A;  3QVN A;  3DXR A;  1N34 B;  2VQF B;  3X2Q C;  2VWK A;  2EIM C;  4UXN A;  5K1X A;  4LFB B;  1YIJ V;  4ABM A;  3JAW B;  2Q7H A;  2PUS A;  1ZTE A;  4YJ3 A;  3E89 A;  1CXZ B;  3L71 H;  5LMU O;  4PDM A;  4NTX A;  1SQP H;  4DV3 O;  1OHH G;  3D8C A;  2WLL A;  5LP6 A;  3WG7 C;  3ZHQ A;  4GX2 A;  1KKC A;  2GTS A;  1BHA A;  1YXB A;  5EK0 A;  4UCS A;  3STZ C;  1EM1 A;  3WB1 A;  4K8X A;  4F6R B;  2CGN A;  1OCC B;  1I08 A;  3KG2 A;  1MSW D;  3BFR A;  3ZS8 C;  2DYR C;  3DC5 A;  5KHK A;  4P30 A;  1MAB G;  3FAV B;  4KL1 A;  5LGT A;  2GHY A;  1VF6 C;  3K79 A;  5KX5 A;  3ZCC A;  1JJO A;  3H1H H;  4U7O A;  4J41 A;  5B1B C;  4KHP O;  4BIU A;  1KMI Z;  2DE0 X;  4J9Y B;  4EB6 A;  1BS3 A;  1SES A;  2YXL A;  3OMA B;  4JI6 O;  5LYJ B;  1VQK V;  1FJG B;  1AI7 A;  1QHT A;  2PI5 A;  3B40 A;  3G67 A;  3JAT B;  3OTF A;  3OUF A;  3ZN0 A;  3FB6 C;  3WFV A;  1B04 A;  2OIG A;  3CRC A;  2XAS A;  1NU1 H;  3RGB A;  4NXN B;  1M56 C;  4QIW F;  1E79 G;  1M93 A;  1YEW A;  1SER A;  1EN6 A;  1VQP V;  3RYC B;  4JYB A;  1IBM O;  4CC5 A;  2Y4T A;  3F5W C;  3AG3 C;  1ENV A;  1K7D A;  3E83 A;  4PDL A;  5IYC O;  2B5U A;  4JV5 B;  3OAA G;  1S72 V;  3JAR B;  4R8C A;  1XMQ B;  1KEC A;  3RVY A;  2QM4 A;  1TVK B;  2VRZ A;  4R6Z A;  3ZHS A;  4RQF A;  1AJP A;  4X1I A;  1ARO P;  5L3C A;  4UCV A;  4MVR A;  4DUY O;  4YXW G;  5BZB A;  2IU3 A;  1OCZ B;  4RO2 A;  5IJ9 A;  1CEZ A;  5L3E A;  4W4K A;  1B6Q A;  2A7W A;  4EB6 B;  4GZR B;  4Q6G A;  3QF7 A;  4G2K A;  2BTO A;  1URF A;  3RYI A;  3ABK B;  1K4D C;  3IJ4 A;  4RWU A;  1KYO F;  2V4D A;  2JK5 C;  1VMG A;  3ZRS A;  5LL6 Y;  1WLE A;  2PF4 E;  5B3S C;  2CTW A;  2DWE C;  2EUL A;  4RUF A;  1XL4 A;  2ZDI C;  1U97 A;  4PDV A;  4WFH A;  3I56 V;  5L3B A;  1Q81 W;  1B06 A;  4ZI7 A;  2UUB O;  3A0H Z;  1IVS A;  5H6Q A;  2EIK B;  2QWQ B;  3GVM A;  4JAV A;  3SR2 C;  4JI1 O;  3AK3 A;  2RCV A;  4X88 A;  1AR4 A;  1IXM A;  2WLN A;  5L3G A;  2ZKO A; 
#chains in the Genus database with same CATH homology
 2ATK C;  1QLE C;  1V54 B;  3ZRW B;  3CCV V;  1M90 W;  2K1E A;  5KUM A;  4JTA B;  1QCE A;  4XBF A;  1RM1 B;  4QJF B;  5L3D A;  2QA4 V;  4MTX A;  4G27 B;  4GT1 A;  1YTF D;  2P90 A;  3LDD A;  1JJ2 U;  3EHB B;  1S0V A;  4JTC B;  2HVK C;  3ZRV A;  1Y66 A;  4UV9 A;  4WFG A;  4WFA V;  3W7U A;  2W0F C;  1KD1 W;  3SPC A;  3OR6 C;  2Y69 C;  4CBC A;  3OFN G;  2HR3 A;  3PJS K;  3VOU A;  5HFM A;  1R73 A;  3K3W A;  2XAJ A;  1QVG U;  1ROP A;  3OE7 G;  3B77 A;  3W7T A;  4QNH B;  1K73 W;  1PD3 A;  3VBB A;  3ZMT A;  3CCS V;  1YI2 V;  2IU0 A;  1AI4 A;  5LGU A;  4MT8 A;  1KKD A;  3DGE A;  1EFR G;  3BY6 A;  4TWK A;  3W7X A;  3CPW U;  4XDL A;  4BW5 A;  3QO5 A;  2W6I G;  1K33 A;  4TT3 G;  1MG1 A;  1RPR A;  2UXX A;  2C2A A;  2XAG A;  1NBM G;  3ASO B;  4MTF A;  3ZJZ A;  5B3S B;  4ZKI A;  2WLM A;  1DF4 A;  5IY5 B;  5LHG A;  4MVM A;  2WLL B;  2X7R B;  4MW8 A;  1H8E G;  3SYO A;  2AHZ A;  1VQ4 V;  2EIK C;  4CZZ A;  1W0J G;  1GKF A;  1P4R A;  1F4N A;  5LHI A;  1H38 A;  1CPY A;  5CA3 A;  1BL8 A;  2ITD C;  2YEV A;  3K0D A;  1V54 C;  1GMG A;  1M1K W;  2WPD G;  1RM1 C;  3CCU V;  4P2Z A;  2EIL B;  1QLE B;  1KP3 A;  3OGC C;  4MW3 A;  2NLJ C;  5GW7 A;  1NVP B;  4PA9 A;  1YSC A;  3OM3 B;  4MSW C;  2JEU A;  3FYI B;  2P6J A;  1QBZ A;  3G6E V;  4JYC A;  2CK3 G;  1DF5 A;  5CBG A;  3ZIA G;  1OCR C;  2HJF C;  4XDJ A;  4DXW A;  2WLI A;  1HWY A;  2EJR A;  1NR7 A;  3RW0 A;  4U7N A;  1M9N A;  2ZR2 A;  4JAS A;  3CYO A;  2XAQ A;  3LSS A;  3E8B A;  3JD1 A;  1LNQ A;  3ABU A;  1F4M A;  2IH3 C;  4H37 A;  1H8H G;  1R6N A;  4LP8 A;  2JEX A;  4MVS A;  4KFM A;  3RVZ A;  1JVM A;  3OW2 U;  5IY5 C;  2GSM B;  3ETE A;  1I5Y A;  1NH2 B;  3HPL C;  3OMN B;  2DQ3 A;  1NVP D;  2A9H A;  2XAF A;  2D3O W;  3F7V C;  3CCM V;  2P7T C;  3OR7 C;  4G28 B;  4UVA A;  1S5H C;  3G4S V;  4UVC A;  1M57 B;  3ABM B;  4F4L A;  3UM7 A;  1VQ8 V;  3SYP A;  2OCC B;  2QTO A;  3B8M A;  3FB8 C;  4MS2 A;  1EZJ A;  1VQM V;  5EBL C;  1JQ0 A;  1R6K A;  2A79 B;  4MVZ A;  3OEE G;  1K4C C;  2Z5U A;  2YEV B;  2EIL C;  1SZT A;  2LFS A;  2EIJ B;  4UVB A;  4WCE V;  2BOC C;  3MHS C;  1K5S A;  1PNK A;  2IJJ A;  2FTK A;  4WFF A;  3CD6 V;  5B1A C;  2EZO A;  2X6B A;  1L1F A;  1K34 A;  4QE9 A;  2BOB C;  2NNU A;  2X6C A;  1OCR B;  1NKD A;  1K8A W;  1THZ A;  4JF3 A;  5H6R A;  5L3G A;  1NH2 D;  4QPK A;  4KUM A;  2HFE C;  3NXS A;  3E2E A;  3E8G A;  3FYE B;  1FFT B;  2Q67 A;  2V7Q G;  5L3F A;  3STL C;  3ML0 A;  3TET A;  3E8F A;  5LGN A;  2JIZ G;  3E8H A;  4MTG A;  2DQ0 A;  4FPP A;  4UV8 A;  3IC7 A;  1RPO A;  1VQ6 V;  1KP2 A;  1GM8 A;  1E1R G;  3OEH G;  1K9M W;  4BIZ A;  3ZMZ A;  4HAM A;  4QE7 A;  1J95 A;  4XDK A;  3X2Q B;  1FXK B;  2EIM B;  4FJC C;  2HVJ C;  1YJN V;  4R7C A;  3CCR V;  4WFE A;  3AG2 C;  3E35 A;  2WAM A;  3JYC A;  3F7Y C;  1K5Q A;  5HFL A;  4PEL A;  2JJ2 G;  3LUT B;  3P30 A;  5C93 A;  3CC2 V;  1M57 C;  3ABM C;  3AG4 C;  1Q7Y W;  2JJ1 G;  2OCC C;  3K9A A;  2R9R B;  1PKX A;  2QM8 A;  2IH1 C;  2WWW A;  1CP9 A;  5KUK A;  2OTJ V;  4MVO A;  2MK3 A;  1UJW B;  1R3J C;  1SRY A;  3WG7 B;  1QLN A;  2EIJ C;  3LDE A;  3I55 V;  1V55 B;  1K97 A;  2YSU B;  3T4D A;  2XND G;  4RQE A;  4WFB V;  2WLH A;  3CMA V;  1VQN V;  1S77 D;  2ZR3 A;  2IJH A;  3SPG A;  2P67 A;  1VQ5 V;  3D3I A;  5B1A B;  3CCQ V;  2EIN B;  3K04 A;  1FXH A;  1FXV A;  3LSQ A;  4P9P A;  1PNL A;  2OTL V;  3CME V;  1E1Q G;  2QEX V;  2DYR B;  2OT5 A;  4J9Z B;  5CMU A;  4P9O A;  1FS0 G;  2WLK A;  3IFX A;  3JD4 A;  4N23 A;  4Q20 A;  2V1D A;  3CCE V;  1G8M A;  4E2L A;  3CC7 V;  2F43 G;  4OXS A;  1PNM A;  2ZXW B;  5EC1 C;  5B1O A;  4FK5 C;  5CBH A;  1G4Y B;  2QKS A;  2B1I A;  2QM7 A;  5KA5 A;  3JD0 A;  2EZP A;  3GB7 C;  4FMT A;  1R3L C;  4JAU A;  2HG5 C;  5H9C A;  2X0L A;  5J9P C;  1JX9 A;  3X2Q C;  1FXK C;  2EIM C;  4UXN A;  4N21 A;  2JDI G;  1ZWI C;  1AI6 A;  1H2G A;  2IJK A;  3QNE A;  1YIJ V;  4R50 A;  4BAY A;  3T1C A;  3T2M A;  3MD0 A;  4JGS A;  2R9I A;  3AG2 B;  3BEH A;  3ABL B;  5DN6 G;  4FIP C;  1YJW V;  1MOF A;  3A0R A;  3E89 A;  4MVQ A;  4I5S A;  4PDM A;  3AG4 B;  4PA3 A;  3QO8 A;  2ZDI A;  1W0K G;  1OHH G;  1M56 B;  4PA6 A;  1F23 A;  4EKW A;  2WLL A;  3AG1 C;  2QE7 G;  3WG7 C;  4GX2 A;  3CCL V;  1AI5 A;  4LCU C;  4WF9 V;  5IYD O;  3AEI A;  1BHA A;  1V55 C;  4UUJ C;  1VQL V;  2DWD C;  2DW4 A;  5EK0 A;  3CC4 V;  3AG3 B;  1OCO B;  2LP7 A;  3STZ C;  1YJ9 V;  2EBO A;  3FKS G;  2A0L A;  5IDJ A;  3H01 A;  1OCC B;  2XOK G;  5EBW C;  3OMI B;  1COW G;  2B1G A;  2EIN C;  3SYQ A;  1I5X A;  3KG2 A;  3SPI A;  2DYS B;  3ASN B;  2UXN A;  3CXC U;  1MSW D;  2HLD G;  1BHB A;  1K92 A;  2W6J G;  2DYR C;  1GK9 A;  2H8P C;  4P30 A;  5DM6 V;  1MAB G;  4PA4 A;  2WLI B;  5LGT A;  2GHY A;  2KB1 A;  3K79 A;  3E86 A;  3R65 A;  3ZCC A;  1AJQ A;  3ETG A;  4U7O A;  2ZXW C;  3CP1 A;  5B1B C;  4BIU A;  1VQ9 V;  1OCZ C;  4J9Y B;  3TK1 A;  1SES A;  1JPX A;  3OMA B;  1QVF U;  1VQK V;  4Z1M G;  1Q82 W;  1EBO A;  3G71 V;  3K03 A;  1Q86 W;  2AHY A;  1AI7 A;  4ZBM A;  2PI5 A;  1GO3 F;  2ITC C;  1QR8 A;  4LBE C;  3JD3 A;  3CCJ V;  1GTO A;  3ABK C;  3ABL C;  3OUF A;  1DLB A;  3B8N A;  3ZN0 A;  3FB6 C;  3FB7 C;  3WFV A;  1SET A;  4L87 A;  3ZMV A;  2XAS A;  3P32 A;  1M56 C;  4QIW F;  1E79 G;  1GM7 A;  1JCH A;  3LDC A;  2LFR A;  2Q68 A;  1VQP V;  1SER A;  4RAI A;  4RUE A;  3EFF K;  4JYB A;  3UKM A;  1P7B A;  1ORQ C;  3AG1 B;  4QPJ A;  3F5W C;  3QO7 A;  1GM9 A;  4PA7 A;  3AG3 C;  1OCO C;  1ENV A;  1K7D A;  3E83 A;  3D36 A;  2Z3Y A;  4PDL A;  5IYC O;  2B5U A;  4HYO A;  1K3E A;  4MTO A;  4GX5 A;  3GWO A;  1OCC C;  1TUE B;  3OAA G;  1VQ7 V;  1S72 V;  2ZQM A;  4R8C A;  1KEC A;  2DYS C;  3ASN C;  5LHH A;  4HZ3 A;  3JD2 A;  5EC2 C;  3RVY A;  3ZRW A;  3SYA A;  3JCZ A;  4GX0 A;  1JOY A;  4R6Z A;  4RQF A;  1AJP A;  1ARO P;  5L3C A;  1N8R W;  1XL6 A;  4MVR A;  1KC8 W;  5LBQ A;  3SPH A;  5FL7 G;  4X8A A;  4YXW G;  3ZMS A;  3K08 A;  4H33 A;  4GCZ A;  5BZB A;  5B1B B;  2PI4 A;  4X89 A;  3ETD A;  3ABT A;  3ZN1 A;  2IU3 A;  3M99 B;  1OCZ B;  4ASU G;  1BMF G;  4PDR A;  4RO2 A;  1CEZ A;  5L3E A;  1B6Q A;  2IJI A;  2Q6A A;  1QR9 A;  3LNM B;  2IW5 A;  2Q69 A;  1PL0 A;  2Y69 B;  5CBF A;  1S76 D;  3T4Z A;  4G2K A;  3RBZ A;  1NJI W;  3OUS A;  2H94 A;  1OZ0 A;  3TCU A;  1NQT A;  5EBM C;  1WPX A;  4LC1 A;  3ABK B;  1K4D C;  4MVU A;  1W2B U;  1YTF B;  1R3K C;  2JK5 C;  1S3J A;  1YIT V;  3ZRS A;  5KA6 A;  1WLE A;  5E1A C;  5B3S C;  3ASO C;  1DTO A;  1FXK A;  2DWE C;  4RUF A;  3ZMU A;  3W7W A;  1XL4 A;  2ZDI C;  1KQS U;  1AJN A;  1F51 A;  4PDV A;  4WFH A;  3I56 V;  4JPR A;  1Y4M A;  3DTU B;  2WLJ A;  1R3I C;  3ZRX A;  3HB3 B;  5L3B A;  1AR1 B;  1Q81 W;  2Y48 A;  3FB5 C;  2XAH A;  4GX1 A;  4DO2 A;  3MHH C;  5CN0 A;  3K06 A;  2X6A A;  4TSF G;  5H6Q A;  3SJQ C;  2EIK B;  2ZD9 A;  4JTD B;  4JAV A;  4KP4 A;  2M7W A;  2WSS G;  2HKO A;  4I9W A;  5B1N A;  1YHQ V;  5IYB O;  4X88 A;  3K0G A;  3IGA C;  1IXM A;  2WLN A;  3SPJ A;  3SYC A;  1NR1 A;  1VQO V;  3W7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...