2GHYA

Novel crystal form of the cole1 rom protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
57
structure length
57
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title Novel crystal form of the ColE1 Rom protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 24
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ghyA00
2IJHA 2IJKA 1GMGA 2IJJA 1RPRA 1PD3A 2GHYA 1F4MA 2IJIA 1F4NA 1B6QA 1NKDA 1ROPA 4DO2A 3K79A 1RPOA 1GTOA
chains in the Genus database with same CATH superfamily
1CEZA 4EFEA 1LR1A 3LDDA 2XT9A 1IURA 4AQYB 3K9SA 5KAIZ 3IGAC 3AK1A 2P6JA 4N23A 2QKCA 1OCRB 4QIWF 3ZMVA 4L8JA 5IJ9A 3E86A 1K7DA 1YIJV 1SQGA 4K0KB 1EBOA 1WB8A 4ICGA 1ZLZA 2ZD9A 1JFFA 2A3QA 1QCEA 1F51A 2XAHA 3F7VC 4XDLA 1OCCB 3ZRWB 1JPXA 1VQ9V 1KUQA 3GWOA 3BCCH 1GM9A 4GT1A 2W6JG 2PI4A 3G4SV 4MT8A 4X20A 2Q7HA 1FYJA 3G67A 4EEQA 3EXAA 2XAJA 1VQ4V 5JJNB 2ZCEA 2P7TC 4U7NA 5EZYA 4B08A 3K5MA 4NTXA 4JI8B 1M9NA 3B40A 3SPIA 2HHHB 3JARB 2MK3A 2BCCH 1R3LC 3F7YC 3K08A 1Y74B 3OMNB 3ZMTA 4JYBA 1Q6IA 4K35A 2F1MA 4PDRA 2ZQMA 3A0HZ 1M57B 1NZ6A 5DM6V 2FKXA 2QR4A 4JTAB 1VQNV 2Q0AA 3ZBHA 2OTJV 2QWQB 1YSCA 3ZX6A 3CC7V 2YC0A 2DMXA 3MHHC 2WLLA 3Q4HA 4DV1B 1Q86W 1R6NA 1K3EA 2QWPB 1XILA 3CX5F 3L9DA 5JCOA 3K5LA 3K5OA 3JASB 3EFFK 3APOA 4MTOA 4ZI7B 2Y0IA 3RYCA 3RGBA 1YTFB 2BSKA 1QLNA 1PNLA 3KCYA 4RAIA 5GTHZ 4BIOA 5CA0A 1FXVA 4I9QA 2MW2B 5BR8O 5LYJB 1L1FA 3ZEDA 2ZE8A 2FYUH 1MZFA 5CBHA 2VQEB 4FLXA 2ZIMA 4DR3B 4JI4O 2RJZA 2V1DA 4B7EA 3K9AA 4UUJC 3C3SA 5IYZA 1NBMG 4IYIA 1KBHA 1S72V 2QJ1A 3JATA 2X6AA 4LR3A 4D6TH 1VMGA 1P7BA 2YICA 4PI2A 3L75H 3U11A 4FM2A 2R70A 1M56C 3OMAB 1DF5A 2PI5A 2F66C 3VBBA 2JGDB 4KFMA 4O2BA 1Q3EA 5B1AC 2AXTZ 2D2CB 1DLBA 4UFZA 1Z2GA 4FVMA 3WB2A 1FJGO 1KECA 4ABMA 5J2TB 1N33B 4DV3O 3E22A 4O4LB 4TV9A 1ZSPA 5JVDA 1PKXA 1P7GA 3ML0A 1BQ0A 4ZBMA 1K33A 2ZXWB 2UU9O 4NTWA 1EN6A 3HKCA 1OCRC 3CWBH 3SPGA 1TVKB 5EYPB 1QVGU 3JD0A 4YY3B 4O4HA 4JI1O 1S5HC 3KG2A 4JPRA 1KU9A 5FPOA 4DV4B 1FXKB 1EN4A 1HP8A 2JEXA 2RDCA 4NB5A 4B3SO 4JASA 4TOIA 4I9WA 1OCCC 5JJEB 4DR2B 3SDLA 1IX9A 4IIJA 4WCEV 2XAQA 2OTLV 3UCSC 2ILMA 4FLYA 4O2AB 4HNAB 2YDEA 5LGTA 2CK3G 5IJ0B 5JQGA 4FMTA 2Y0PA 1AR5A 5L3FA 1XNQB 2OIGA 4MTXA 3DXRB 2QEXV 2Y4UA 3E89A 2YSUB 2ZM6B 4JTDB 1Q6UA 3ASOB 2Z3YA 4DV3B 1H2LA 1M57C 2PTMA 5L3BA 1YHQV 3OTOB 3SYPA 2M7WA 3HKDA 1O9GA 4I50A 2Z5UA 2ZDIC 5KMGB 4I5SA 4DR6O 3CC4V 4RO2A 4MVSA 2B1IA 4ZHQA 1DK1A 5EK0A 2A79B 4P9OA 2RMKB 1XL4A 1ZWIC 4CH5A 3CEIA 1LUWA 1WP7A 3HR0A 1J5EB 4LFAO 4JI1B 1F23A 2JS5A 1UJWB 1ZL8A 2HVJC 5FNVA 4NTYA 1S5JA 1R6KA 3A0RA 1Q7YW 3QTCA 5E79Z 4LF5O 1K8AW 2HVKC 3ZRXA 3ZHUA 5LA6A 5H5NA 1XREA 3P32A 3E2EA 3STZC 4TQFA 5C8YB 1FFXA 3ETDA 1XMOB 2WSSG 5B3SB 4MVQA 3A0BZ 4X66O 1K97A 1NTKH 3N2GA 2Q7EA 5C93A 1EM1A 3O9OA 1WJZA 3JALB 3QO5A 4AILC 1MABG 3CCSV 1GN3A 1TA8A 4UB6Z 1VQ5V 3KKYA 4PDLA 1IBKO 4UVAA 1GH6A 4GX0A 4YJ2B 1N32O 2BOCC 1LNQA 1DGSA 4B7KA 2D3OW 3ZJZA 4LFBO 1VEWA 4CH6A 4DR6B 2EINB 3ZN1A 1IVSA 1B3QA 3JD4A 1B04A 3OR6C 3MAQA 3RYHB 5CBGA 1YITV 4LF5B 4NVPA 4LF8O 2OYQA 3BA9A 1SA0A 4JV5O 2F4VB 2E74B 2ZXWC 3SJBC 1JA8A 2WLNA 3H1JH 5CA1B 1AP5A 2P90A 2R9RB 3AEIA 3OE7G 4R6ZA 4J80A 3W7TA 2E76B 3H1KH 5KA5A 1JCHA 1PL4A 4Z2WA 1W59A 1YCIA 1QHTA 1H2KA 4X1KB 4GKKO 1AILA 4J7JA 3IC7A 1SRYA 2A9HA 1FXKC 3CXHF 4WFGA 3HKEA 1US6A 3B4SA 3T1YB 3ICXA 1SQVH 2GUZA 2Y4TA 2NNUA 3BHPA 4IYHA 3AG1B 2X6BA 1IDSA 4FFBA 4LFBB 4IL6Z 4LNUA 1TGOA 3ZHSA 5L3CA 2UUCO 2QSAA 3QNEA 1H38A 4UVCA 3S3XA 3IFXA 3S3WA 1TUBA 4JI3B 1XNRB 2NN4A 3OT7A 1BE3H 1MNGA 1XEQA 4J42A 2XAGA 4HAMA 3J80N 1KKCA 2BTQA 3CJHB 3MHSC 3CRRA 4BR6A 3LSQA 1JR9A 4RUFA 3ASOC 3T2MA 3FYIB 4Z1VA 2ZKOA 3OUSA 1HNZO 3RW0A 1I08A 2ZINA 2AW9A 2IW5A 2QE7G 3JSNA 4RQFA 1L0NH 4IHJA 4AI8A 3T4DA 1U96A 3H1IH 3B8MA 3RVYA 3JCUZ 1S0VA 4UCRA 1SZTA 4CZZA 1GTOA 1NVPB 4AQYO 4GYCB 1VQLV 1PL0A 2UXDB 2UXBB 4FFKA 4GKKB 1WA8B 4HBNA 4KL1A 2UXCB 3ZMZA 4D7TA 3G6EV 2G38A 4K0KO 2YXYA 2ZE6A 1VF7A 3U10A 5KX5A 1KB9F 2YI9A 4MVRA 1V55C 2X7RB 2ZR2A 4U3JA 2CTWA 1IBLB 3CCEV 5H2FZ 5GONA 4ZIBA 5B3SC 1OJHA 3TETA 1SF9A 4OPHA 4J10A 4CS2A 2EIJB 3B09A 4X62B 1BHBA 4TSFG 3BABA 4JGSA 1KKDA 5A9GA 4JI8O 5BY1A 1NTMH 1NR1A 3TCUA 2HHHO 2VWKA 3JD3A 1KYOF 3SGIA 1SETA 1S3JA 5KUMA 3ASNB 3DC5A 2CE4A 4YXWG 1NH2B 3FAVA 3SJAC 2N04A 3ABLB 3LSSA 4QE9A 4GKJB 3G71V 2EINC 4GX2A 4X88A 2Q67A 4DR5B 4JF3A 1HNXB 4EFBA 2P4VA 4DV1O 1FFTB 4FZ1A 2IJJA 3D3IA 1VQ7V 3OMIB 1YF2A 2DYRB 3IJ4A 5CMUA 1SQBH 1N36B 2C2AA 5B1BB 1HR0B 3HKBB 4WFEA 3FB5C 5J2UA 5LMUO 2PYJA 1A32A 2YS8A 5K1PA 3E35A 1V54B 4X20B 5GTIZ 1J95A 4UCVA 4DW0A 1EZVH 1ZAUA 2WLIA 1JQ0A 3BAAA 2EBOA 3W7UA 5EBMC 3CCRV 1VQ6V 1Q6HA 2H94A 3T4ZA 1KMIZ 1BS3A 1XDCA 3UQ8A 1S77D 4G28B 2VQEO 1X4TA 1KQSU 2KSDA 4DR3O 4LH7A 5IWAB 4FPPA 2LJ2A 2Q0OC 1SC5B 1M1KW 5B1OA 3LDEA 4TUYA 4FLZA 2IU3A 2AHZA 3AG1C 1XMQB 4NXNB 1QLEB 4K8XA 3D3QA 3EHBB 3RYFB 4GZRB 2UUBB 4I0XB 4FLTA 2WLKA 2GV9A 2LFRA 1Y66A 1PNKA 2IH3C 4WFFA 5LBQA 3ETQA 3X2QB 1Y74A 3K79A 1YZBA 1WAZA 1U97A 1VF6A 2DQ3A 5EC1C 1N33O 5LMUB 3GVMA 3OAAG 1LUVA 3ZCCA 4JAUA 5EIBC 3FYEB 3M8AA 3UO3A 5BZBA 4X89A 1FD9A 1XL6A 1JX9A 2EIMC 3BY6A 5IY5B 4LF9B 4EB6B 2X0LA 4JYAO 2QDOA 1H2GA 1YTFD 5IYZB 1SESA 5KLVH 4YY3O 1Q82W 3JATB 1F4MA 2OT5A 2Y48A 1Y76B 3K59A 4CC6A 4DV4O 5LHHA 3K57A 4CC5A 1AJPA 3W7XA 4DR2O 2XTAA 5KA6A 3CCLV 1NR7A 2QWRB 1AVMA 3AK2A 4MS2A 3SPJA 2OCHA 5LYJA 5DN6G 2BTOA 5B1NA 1G6UA 2EIJC 4LH6A 5KHGA 4H33A 3ETEA 2UUAO 4ZKIA 3L70H 1XNQO 2DE0X 4TV9B 5JVDB 2ZM6O 1NJIW 4JI0B 4DV7B 1Q5OA 3ASNC 1R6TA 1YI2V 3OTOO 1E1QG 4I4TA 3ABLC 4MVMA 3D8CA 4DXWA 5LXTB 2W0FC 1WP8A 2B5UA 3SJCC 4AHCA 1IZ3A 2K9PA 4PJ0Z 2LP7A 4K3AA 3I56V 3RYIB 4CH4A 3CRAA 4FM1A 4O4HB 1THZA 1KP3A 4OGQB 1W0JG 4UCOA 4JYAB 2KKWA 3LNMB 2VWJA 1MSWD 4DR7B 4X1YA 4QGPA 4YJ3A 1GM8A 5L3EA 1J5EO 3QF7A 3BRCA 2CTPA 2DYRC 4B3RB 2WLHA 5J2TA 1HWYA 5JWPA 3DGEA 1GN6A 3RN4A 5B1BC 1WPXA 2JJ1G 4JI2B 1W2BU 1D5NA 1SS3A 2LFSA 1AJNA 1V54C 5EC2C 2IJHA 1GK9A 1IBMB 4DV6B 3WB1A 1WLEA 2WA3A 4YIOA 4F6RB 1NQTA 5KUKA 1XMOO 2UUAB 1VP7A 1GKFA 1H2MA 3ZN0A 2Q73A 2QM7A 4MW8A 4JI5B 2Y69B 4LC1A 4QNHB 2W6IG 1AI7A 5LOVA 2LQTA 1JVMA 4BIUA 3JAKB 2CTRA 3RVZA 2A0LA 2UXNA 4DV2B 3TJTA 4UVBA 1MZEA 2GTSA 2UXXA 3SYQA 1GAXA 3ZHRA 3BA8A 2F93B 4O4IA 1VQKV 1QLEC 3CP1A 1AI6A 4JYYA 4ZOLB 2JVDA 4ZHQB 1JOYA 2FB5A 4HNAA 5IJ0A 4X9QA 4DUZB 4LBEC 4BIZA 2Q4PA 2VRZA 5DECA 4EKWA 3DXRA 3JAWB 2VS0A 2P22C 2GHYA 5JCOC 3JD1A 1ZUQA 1M4UA 4PI0A 3X2QC 1NU1H 4MW3A 5LA6B 2P67A 1Q81W 1XI1A 1H2NA 2KQXA 3GB7C 2N05A 1JJ2U 2PZSA 5KMGA 3AK3A 1P4RA 2ATKC 2KG7A 3DTUB 4DR1B 2F4VO 1V55B 4DUYB 5IY5C 1URFA 2Q6AA 2QM8A 3ABMB 4NKGB 2JK5C 2LGWA 5GW7A 2QKSA 4B3TB 3ZIAG 1HNWB 1HW7A 4I55B 5KHKA 4MSWC 4DO2A 5LGUA 1O9HA 3SJQC 3SYOA 2JS3A 4BW9A 3OR7C 3T1YO 5C8YA 1RSOB 3I5DA 1FXHA 5DEDA 5CB4B 1K34A 3D36A 4O4JA 3CCVV 4WFHA 2H8PC 2HFEC 3CCUV 5JH7A 2IJKA 3EVKA 1XOUA 4JI3O 4FLVA 1G4YB 3R65A 1XNRO 2F23A 4PD4F 4WFBV 5BMVA 4BAYA 3APQA 1DF4A 5IDJA 4WFAV 2AZ2A 5FPRA 1H8HG 3UM7A 1AI4A 3B8NA 4N21A 2FMLA 4FIPC 1K5SA 3VOUA 4HZ3A 1YXBA 4DK1A 1S76D 3OGIB 1MSDA 1JMKC 2PUSA 3U0ZA 5B66Z 3TXQA 1D2DA 5LP6B 2UXDO 2UXBO 2CH7A 3T1CA 5JJJB 3RYHA 2JEUA 1VARA 4W4KA 1BHAA 2BOBC 2GUZB 4LF4B 2UXCO 3SYCA 4P9PA 4JAVA 1OV9A 2QTSA 3CMAV 3G6BA 5EBLC 3ABKB 4YIPA 2AHYA 3VQYA 3WB0A 5CA1A 4CH3A 4R8CA 2Q68A 4OX9O 3OGCC 1IBLO 4DRXA 2CGNA 3OEHG 5F2VO 1RM1B 1G8MA 4QPKA 2Y69C 2QM4A 2Q69A 4X62O 3CYOA 3E8HA 4WBNA 2ADQB 2QWNB 4QE7A 5FLXN 1Z5VA 3ZS8C 3FB8C 1EZJA 2EZPA 4IHJB 3CXCU 1RP3B 3TK1A 3OUFA 4J9ZB 3CCMV 3M7MX 3CHXA 1K4CC 4E4EA 3UT5A 4XDJA 1F4NA 4GKJO 5KHIA 5ITZA 4G2KA 3QO7A 2CTQA 4H44B 4DR5O 3ETGA 3E8BA 1PM9A 2EIMB 1HNXO 3P3PA 3CCQV 3WG7C 3CJHA 1SZXA 2LGQA 1R3KC 1CXZB 4LWSA 3THOA 5CBFA 5EIBD 4GX5A 4X64B 1SERA 3WFVA 2A7WA 3W7WA 3HPLC 3A8TA 1N36O 4U3JB 2HJFC 4MTFA 1NVPD 3IC9A 1HR0O 1K73W 2X6CA 4Z1MG 1L8DA 5GONB 2YXHA 2VQFB 5HFMA 3LSUA 1Z5WA 4OX9B 1ENVA 3ABMC 2ETNA 3CS5A 4E2LA 3LNNA 2H3OA 3RBZA 2CUGA 4DV5B 2K1EA 2NR5A 5L3GA 1WA8A 4TT3G 3H01A 4U3FH 3WU2Z 2Q5ZA 2QKAA 2GTAA 4J11A 1WB7A 1V9PA 1Y67A 4PV1B 4W4LA 1PV0A 4UV8A 5IWAO 5IYCO 3ZRSA 1KD1W 2HKOA 4FK5C 4X1IB 4KXRA 1QVFU 2YXLA 1I94B 2BE3A 5K1XA 2FL4A 1XMQO 4NXNO 1AI5A 2E5LB 2RN9A 3JSLA 2YEVA 1GO3F 2E3CA 2Q7GA 3VQWA 2XOKG 3A2FA 2N74A 4TV8A 1YJ9V 1NKDA 2UUBO 3N2KA 4J41A 3NR7A 5IJ9B 2DW4A 1NTZH 4YHHB 1RPRA 1JFFB 4QPJA 3J81N 1N34B 1BZKA 5J9PC 1N4CA 2ZNIA 2EJRA 4NXMO 4I7ZB 3AG4B 1MG1A 1GMGA 4JZGA 4P2ZA 2WLIB 3CSXA 3OM3B 1DTOA 1XBLA 2F43G 3H1HH 5D5PA 1YJNV 2YIAA 5EZYB 1AJQA 4LF9O 3FB6C 2LW1A 3C3TA 1RFYA 2L35A 5LP6C 4GCZA 1N0JA 5LMNB 2DYSB 3CC2V 4DR4B 4B3MB 4FJCC 4C7UA 3K03A 2L6LA 4TUYB 4JI6B 3HKBA 3LUTB 2GBOA 3QO8A 4JI7O 3ABKC 3ZRWA 2OCCB 4R7CA 1N8RW 3AG2B 1SQXH 2EILB 4RUEA 2WLLB 4PDVA 3Q4HB 2WLJA 2ODMA 4LFCB 4F6EA 1RM1C 3UKMA 1OHHG 3BEHA 1NS1A 1QU7A 3JARA 2OWOA 3PJSK 3RYCB 3OD4A 1E1RG 2XASA 4NXMB 4JI0O 4DV7O 3ZHQA 2BSKB 3DSQA 4GUNA 2ZDIA 3RYFA 2JJ2G 1X59A 5CA0B 5A2QN 4I0XA 4LP8A 3FFQA 1Q90D 4DK0A 3BPZA 1OCZB 2HEPA 1HDJA 1QQCA 1K92A 1I5XA 4DR7O 2YI8A 1WPBA 4B3RO 2HR3A 3J7AU 1S5LZ 3JASA 1BL8A 1I0HA 3DC6A 2JDIG 3JYCA 4R50A 4A5UB 4ZI7A 4JI7B 4UCSA 1PD3A 4JI2O 4CS3A 1TAEA 4PA3A 4WF9V 2XUMA 3CB2A 3RT3C 4DV6O 1IBMO 1XUQA 5IYBO 3K3WA 4O2BB 5LHGA 4EB6A 1Y4MA 1EN5A 4JAAA 4LF6O 1OZ0A 2QTOA 2PF4E 3SPHA 4XBFA 4NR1A 3T1HO 1TUEB 3JCZA 4F4LA 4JI5O 2V7QG 1IXMA 1Y76A 1K4DC 1T5EA 3H9VA 3ABUA 3E22B 3OTFA 3FD9A 1P49A 5IT9N 1L0LH 4J9YB 3SR2C 4I4TB 4DV2O 1CPYA 4K8ZA 5HFLA 1M5IA 1AROP 2B9ZA 4LF7O 1ROPA 2JRIA 1PP9H 4NYKA 1R3JC 5B5EZ 1OCOB 2JGDA 3R66A 3AG3B 3HKCB 4X1YB 3BFRA 4YJ3B 4DUZO 2PY5A 3F5WC 2YIDA 3C90A 3FB7C 3E8GA 3ZHVA 4RWUA 2EIKB 1P84F 4PA7A 2ITDC 2A06H 1K9MW 3L72H 3VQVA 2AZ0A 2PYLA 3HB3B 1XQ8A 5TISZ 2XHBA 4O4LA 2WWWA 4IIJB 3AG4C 1YVWA 3E8FA 2ZR3A 5IYDO 1E79G 5LXTA 3K04A 5BR8B 2JIZG 2WPDG 2P4KA 5E1AC 4DR1O 4H37A 1M90W 4TWKA 3RYIA 2CDYA 3OW2U 3SPCA 5JQGB 4DUYO 3F5TA 1XHZA 4JI4B 1VQMV 4LF6B 2DWEC 5LOVB 4RQEA 3T1HB 4B3TO 1TVKA 5IE9A 5EYPA 1HNWO 2DYSC 2XAFA 3AG7A 1COWG 4J7ZA 5LGNA 2QA4V 2HLDG 4FZ0A 1FXKA 2IH1C 1VQ8V 1R1BA 4O4IB 1IXBA 3HKDB 2V4DA 4I50B 3STLC 3L73H 4MVUA 2OCCC 1AB3A 4LF7B 2B1GA 1I5YA 3AG2C 3FX7A 2IBZH 2EILC 3KCXA 4P30A 1QNMA 4UCTA 2LO1A 1MOFA 4O2AA 4PDMA 1UFIA 4F6RA 2EJ7A 4GLXA 1FJGB 4FLWA 1F7YA 1KC8W 1B06A 3K0DA 1ZL8B 5FNVB 5L3DA 3JAKA 1VF6C 2CGOA 2WAMA 5CN0A 3WG7B 3PN1A 2DOSA 1G1XB 5H6QA 4PA9A 3CMEV 3I55V 2KG7B 2UU9B 1BCCH 1R3IC 1AP6A 1K5QA 4ZOLA 4G27B 4FM0A 1VQPV 1FFXB 2EULA 1XHXA 2DJVA 2CAZC 4HYOA 1SKVA 3N2GB 1OCZC 3JAWA 4MTGA 4KHPO 1GN2A 4B3SB 4H13B 1FAFA 2DN9A 1QR8A 1UPGA 4QJFB 4U7OA 2F95B 5LHIA 4LF4O 3ABTA 1WNSA 5KAFZ 1M93A 2R72A 3CRMA 4Q6GA 4O4JB 1Y6XA 3N27A 3K58A 4MVZA 5JH7B 1PNMA 2EZOA 1I7FA 5H6RA 2NLJC 3RWRD 3ZRVA 2IM9A 1BGYH 1R73A 2OIEA 4I55A 1AR1B 4JYCA 3K06A 5D5QA 1MMMA 5KHJA 1VQOV 4DYLA 1D5AA 5BMVB 3JALA 2DWDC 4UCUA 5AG2A 1VIBA 2ADPA 3P30A 4IT5A 4UXNA 1SA0B 3RFRA 1RSOA 2RQ6A 3ZMSA 3QG5A 3UO2A 4YJ2A 1PPJH 4KP4A 2WA4A 3NXSA 4KUMA 2ZIOA 1Q8IA 5CB4A 5KHHA 1GRJA 4H0LB 1OCOC 4LFAB 2IJIA 3AG3C 3JD2A 1ZTEA 4L87A 1FS0G 2LW7A 4UV9A 3G80A 4GX1A 2QWOB 2CH7B 2EIKC 3CE2A 4KHPB 5BXZA 2E75B 2HG5C 3KZIZ 5LL6Y 1Q43A 3CCJV 3HKEB 4MVOA 2QGNA 2XNDG 4CBCA 3GWKC 4TQDA 1BQZA 2PGGA 4X64O 3VQXA 1NI8A 4CS4A 4FFBB 3TGUH 3LDCA 5FL7G 4LNUB 4X66B 4DRXB 2VQFO 3TXSA 3B77A 3QVNA 3CRQA 1TUBB 2Z0AA 3FKSG 3B2EE 3O65A 3CD6V 2BTQB 5LP6A 3P3NA 4X8AA 3M99B 4WBNB 4UB8Z 4X1KA 4DV5O 2P5OA 1IBKB 1YJWV 4JZ2A 4J7KA 2P06A 1N32B 2ZNJA 4LCUC 2WLMA 3H1LH 4FLUA 4JTCB 1NT2B 2KB1A 2O57A 2M6YA 3UT5B 1SQQH 2R9IA 2YUAA 4IGGA 5ITZB 1I94O 5H9CA 1BMFG 2DQ0A 4DV0O 4OPAA 1EFRG 1CP9A 2Q8VA 2E5LO 4X65O 2GDSA 4DW1A 4LWSB 3W7SA 2JGUA 4LF8B 2FTKA 1SQPH 1QR9A 2ARHA 4YHHO 3K0GA 4PELA 4JV5B 3JAMN 1N34O 3MD0A 5KX5B 4OXSA 2RCVA 2RNBA 2W0XA 4PA6A 2ITCC 1VF5B 1QBZA 5EBWC 3CPWU 5CA3A 1H2SB 1ORQC 2HJDA 4ASUG 2ZT9B 1RPOA 3OEEG 1MA1A 3K5NA 1YEWA 4BWAA 4BW5A 2AGAA 3OFNG 2Q9LA 5LMNO 1BT8A 4DR4O 4Q20A 2HP8A 1SQFA 4B3MO 3L74H 1ZX3A 1H8EG 1JJOA 4JI6O 3CRCA 1B6QA 2UUCB 3D36C 3FAVB 1AR4A 2EX3A 2YIBD 3L71H 3ZHTA 2YEVB 1M56B 2GSMB 4XDKA 1GN4A 4PA4A 2ZE7A 4TV8B 1GM7A 4D7SA 4DV0B 3E83A 4X65B 1W0KG 3N2KB 5B1AB 2IU0A 2YIBA 3SYAA 1FPOA 1N0NA 2R9AA 4LFCO 4PHZA 1WN7A 2ZE5A 1HNZB 1NH2D 3IAYA 3BVOA 5J2UB 4X1IA 1YDXA 1FKAO 3ZMUA 1BSMA 3MDSA 1KP2A
chains in the Genus database with same CATH topology
3X2QC 1CEZA 5LHGA 4MW3A 3LDDA 1Y4MA 1OZ0A 2QTOA 2NNUA 3SPHA 4XBFA 3AG1B 3IGAC 2X6BA 2P67A 1Q81W 1TUEB 2P6JA 4N23A 3JCZA 3GB7C 4F4LA 2V7QG 1IXMA 5L3CA 1OCRB 1JJ2U 4QIWF 3QNEA 3ZMVA 1H38A 1P4RA 4UVCA 2ATKC 3IFXA 1K4DC 3E86A 3ABUA 3DTUB 1K7DA 1YIJV 1EBOA 4J9YB 1V55B 1CPYA 2ZD9A 2XAGA 4HAMA 5HFLA 1QCEA 1AROP 1F51A 5IY5C 2Q6AA 2XAHA 2QM8A 3ABMB 3F7VC 3MHSC 4XDLA 3LSQA 1OCCB 1ROPA 2JK5C 3ZRWB 4RUFA 5GW7A 2QKSA 3ASOC 1R3JC 1JPXA 1VQ9V 3ZIAG 3T2MA 3FYIB 3GWOA 5LGUA 4MSWC 4DO2A 1OCOB 1GM9A 3AG3B 4GT1A 3OUSA 2W6JG 3SJQC 2PI4A 3RW0A 3G4SV 4MT8A 2IW5A 2QE7G 3F5WC 4RQFA 3FB7C 3SYOA 3E8GA 3T4DA 2EIKB 2XAJA 1VQ4V 2P7TC 4PA7A 4U7NA 3B8MA 3OR7C 2ITDC 3RVYA 1K9MW 1M9NA 1S0VA 3SPIA 1SZTA 4CZZA 1GTOA 3HB3B 1NVPB 2MK3A 1FXHA 1R3LC 3F7YC 3K08A 3OMNB 1VQLV 1PL0A 2WWWA 3ZMTA 1K34A 3AG4C 4JYBA 3D36A 3E8FA 2ZR3A 4WFHA 4PDRA 3CCVV 2H8PC 2HFEC 2ZQMA 5IYDO 3CCUV 1E79G 1M57B 3K04A 2JIZG 5DM6V 3ZMZA 2IJKA 2WPDG 3G6EV 5E1AC 4JTAB 4H37A 1G4YB 3R65A 4TWKA 1M90W 1VQNV 3OW2U 3SPCA 2OTJV 1YSCA 3CC7V 1VQMV 3MHHC 2DWEC 2WLLA 4WFBV 4MVRA 1V55C 2X7RB 4RQEA 2ZR2A 4BAYA 3CCEV 2DYSC 1Q86W 2XAFA 1COWG 1DF4A 1R6NA 5IDJA 5B3SC 4WFAV 1K3EA 5LGNA 3TETA 2QA4V 1H8HG 2HLDG 1FXKA 2IH1C 3UM7A 1VQ8V 2EIJB 1AI4A 3B8NA 3STLC 4N21A 4FIPC 1K5SA 3VOUA 3EFFK 1BHBA 4HZ3A 2OCCC 4MVUA 4TSFG 4JGSA 4MTOA 1KKDA 1S76D 2B1GA 1I5YA 3AG2C 1YTFB 2EILC 4P30A 1NR1A 3TCUA 1MOFA 3JD3A 1QLNA 4PDMA 1SETA 1PNLA 4RAIA 1S3JA 5KUMA 3T1CA 3ASNB 2JEUA 1FXVA 4YXWG 1NH2B 1KC8W 1BHAA 2BOBC 3K0DA 1L1FA 3SYCA 4P9PA 3ABLB 3LSSA 4JAVA 4QE9A 3G71V 2EINC 3CMAV 4GX2A 5L3DA 3WG7B 2WAMA 5CN0A 5EBLC 5CBHA 4X88A 2Q67A 3ABKB 4JF3A 2AHYA 2V1DA 5H6QA 3K9AA 4PA9A 3CMEV 4R8CA 4UUJC 2Q68A 3I55V 1NBMG 1FFTB 3OGCC 1R3IC 1S72V 1K5QA 2X6AA 2IJJA 4G27B 3D3IA 1VQ7V 1VQPV 3OEHG 3OMIB 1P7BA 3ZMUA 2DYRB 1RM1B 1G8MA 5CMUA 4QPKA 2C2AA 2Y69C 5B1BB 2Q69A 4HYOA 4WFEA 3CYOA 3FB5C 1M56C 3OMAB 1DF5A 2PI5A 1OCZC 3VBBA 4KFMA 4MTGA 3E35A 3E8HA 1V54B 4QE7A 3FB8C 5B1AC 1EZJA 2EZPA 1J95A 3CXCU 1DLBA 2WLIA 1JQ0A 1QR8A 4QJFB 1KECA 3TK1A 3OUFA 4J9ZB 3CCMV 2EBOA 3W7UA 4U7OA 1K4CC 5EBMC 3CCRV 1VQ6V 5LHIA 2H94A 3T4ZA 4XDJA 1F4NA 3ABTA 1S77D 4G2KA 3QO7A 4G28B 1KQSU 3ETGA 1PKXA 3E8BA 3ML0A 2EIMB 4MVZA 3CCQV 1PNMA 3WG7C 2EZOA 4FPPA 4ZBMA 1K33A 2ZXWB 2NLJC 5H6RA 1M1KW 1R3KC 5B1OA 3LDEA 3ZRVA 5CBFA 1R73A 4GX5A 2IU3A 2AHZA 3AG1C 1AR1B 4JYCA 3K06A 1VQOV 1QLEB 1SERA 3WFVA 3W7WA 3HPLC 3EHBB 1OCRC 2DWDC 3SPGA 2HJFC 4MTFA 3JD0A 1NVPD 1QVGU 1K73W 2X6CA 4Z1MG 1S5HC 3KG2A 3P30A 5HFMA 4JPRA 2WLKA 1FXKB 4UXNA 2JEXA 2LFRA 1ENVA 1Y66A 1PNKA 3ZMSA 2IH3C 4JASA 3ABMC 4WFFA 5LBQA 4KP4A 4I9WA 1OCCC 3NXSA 4KUMA 4E2LA 3X2QB 3K79A 4WCEV 2XAQA 3RBZA 2OTLV 2K1EA 1OCOC 2IJIA 2DQ3A 3AG3C 5EC1C 5L3GA 3JD2A 3H01A 4TT3G 4L87A 1FS0G 4UV9A 3OAAG 3ZCCA 4GX1A 2CK3G 4JAUA 5LGTA 2EIKC 3FYEB 4FMTA 4UV8A 5IYCO 3ZRSA 5BZBA 5L3FA 1KD1W 2HG5C 2HKOA 4FK5C 4MTXA 4X89A 2QEXV 1QVFU 1XL6A 1JX9A 3CCJV 4MVOA 3E89A 2EIMC 3BY6A 2XNDG 2YSUB 5IY5B 4CBCA 4JTDB 1AI5A 2X0LA 3ASOB 2Z3YA 2YEVA 1H2GA 1GO3F 1YTFD 1M57C 2XOKG 1SESA 5L3BA 1YHQV 3SYPA 2M7WA 3LDCA 1YJ9V 1Q82W 1F4MA 1NKDA 5FL7G 2OT5A 2Z5UA 2ZDIC 3B77A 2Y48A 4I5SA 5LHHA 2DW4A 3FKSG 3CC4V 3CD6V 4RO2A 1RPRA 1AJPA 3W7XA 4MVSA 2B1IA 4QPJA 5EK0A 2A79B 4P9OA 5KA6A 1XL4A 3CCLV 1NR7A 1ZWIC 4X8AA 5J9PC 3M99B 2EJRA 4MS2A 3AG4B 1MG1A 3SPJA 1YJWV 1GMGA 1F23A 5DN6G 1UJWB 5B1NA 4P2ZA 2WLIB 2HVJC 2EIJC 3OM3B 4LCUC 1DTOA 1R6KA 2WLMA 3ETEA 4H33A 3A0RA 1Q7YW 4JTCB 2F43G 2KB1A 4ZKIA 1K8AW 2HVKC 3ZRXA 2R9IA 3P32A 1YJNV 1AJQA 3E2EA 5H9CA 1BMFG 2DQ0A 3STZC 3FB6C 1EFRG 1CP9A 1NJIW 4GCZA 2DYSB 3CC2V 4FJCC 3ASNC 3ETDA 1YI2V 1E1QG 2WSSG 3K03A 5B3SB 4MVQA 3ABLC 3W7SA 3LUTB 4MVMA 4DXWA 1K97A 2W0FC 2B5UA 3QO8A 5C93A 2FTKA 3ABKC 1QR9A 2LP7A 3ZRWA 3I56V 2OCCB 3QO5A 3K0GA 4PELA 4R7CA 1THZA 3AG2B 1MABG 1N8RW 1KP3A 2EILB 4RUEA 3MD0A 1W0JG 3CCSV 1MSWD 2WLLB 3LNMB 4OXSA 4PDVA 4PA6A 2ITCC 1GM8A 5L3EA 1VQ5V 2WLJA 4PDLA 1QBZA 4UVAA 4GX0A 2DYRC 5EBWC 3UKMA 1RM1C 2WLHA 3CPWU 1HWYA 2BOCC 3DGEA 1LNQA 5B1BC 1OHHG 1WPXA 3BEHA 2JJ1G 5CA3A 2D3OW 1ORQC 3ZJZA 1W2BU 2EINB 4ASUG 3ZN1A 2LFSA 1AJNA 1V54C 1RPOA 3OEEG 5EC2C 3PJSK 2IJHA 1E1RG 1GK9A 4BW5A 3OFNG 2XASA 3JD4A 3OR6C 1WLEA 4Q20A 1NQTA 2ZDIA 5KUKA 1H8EG 2JJ2G 1GKFA 3ZN0A 2QM7A 4MW8A 1B6QA 5CBGA 1YITV 2Y69B 4LP8A 4LC1A 4QNHB 2W6IG 2YEVB 1AI7A 1M56B 1JVMA 2GSMB 4XDKA 4BIUA 4PA4A 1OCZB 3RVZA 1GM7A 2A0LA 2UXNA 2ZXWC 1K92A 3E83A 1W0KG 4UVBA 2WLNA 1I5XA 5B1AB 2UXXA 3SYQA 2IU0A 2R9RB 2P90A 3AEIA 3OE7G 3SYAA 4R6ZA 3W7TA 1VQKV 1QLEC 3CP1A 2HR3A 1AI6A 5KA5A 1JCHA 1BL8A 1JOYA 2JDIG 3JYCA 4R50A 1PD3A 1NH2D 4PA3A 4LBEC 3IC7A 4BIZA 1SRYA 4EKWA 2A9HA 1FXKC 4WF9V 4WFGA 2GHYA 5IYBO 3K3WA 3JD1A 1KP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJH A;  2IJK A;  1GMG A;  2IJJ A;  1RPR A;  1PD3 A;  2GHY A;  1F4M A;  2IJI A;  1F4N A;  1B6Q A;  1NKD A;  1ROP A;  4DO2 A;  3K79 A;  1RPO A;  1GTO A; 
#chains in the Genus database with same CATH topology
 1CEZ A;  4EFE A;  1LR1 A;  3LDD A;  2XT9 A;  1IUR A;  4AQY B;  3K9S A;  5KAI Z;  3IGA C;  3AK1 A;  2P6J A;  4N23 A;  2QKC A;  1OCR B;  4QIW F;  3ZMV A;  4L8J A;  5IJ9 A;  3E86 A;  1K7D A;  1YIJ V;  1SQG A;  4K0K B;  1EBO A;  1WB8 A;  4ICG A;  1ZLZ A;  2ZD9 A;  1JFF A;  2A3Q A;  1QCE A;  1F51 A;  2XAH A;  3F7V C;  4XDL A;  1OCC B;  3ZRW B;  1JPX A;  1VQ9 V;  1KUQ A;  3GWO A;  3BCC H;  1GM9 A;  4GT1 A;  2W6J G;  2PI4 A;  3G4S V;  4MT8 A;  4X20 A;  2Q7H A;  1FYJ A;  3G67 A;  4EEQ A;  3EXA A;  2XAJ A;  1VQ4 V;  5JJN B;  2ZCE A;  2P7T C;  4U7N A;  5EZY A;  4B08 A;  3K5M A;  4NTX A;  4JI8 B;  1M9N A;  3B40 A;  3SPI A;  2HHH B;  3JAR B;  2MK3 A;  2BCC H;  1R3L C;  3F7Y C;  3K08 A;  1Y74 B;  3OMN B;  3ZMT A;  4JYB A;  1Q6I A;  4K35 A;  2F1M A;  4PDR A;  2ZQM A;  3A0H Z;  1M57 B;  1NZ6 A;  5DM6 V;  2FKX A;  2QR4 A;  4JTA B;  1VQN V;  2Q0A A;  3ZBH A;  2OTJ V;  2QWQ B;  1YSC A;  3ZX6 A;  3CC7 V;  2YC0 A;  2DMX A;  3MHH C;  2WLL A;  3Q4H A;  4DV1 B;  1Q86 W;  1R6N A;  1K3E A;  2QWP B;  1XIL A;  3CX5 F;  3L9D A;  5JCO A;  3K5L A;  3K5O A;  3JAS B;  3EFF K;  3APO A;  4MTO A;  4ZI7 B;  2Y0I A;  3RYC A;  3RGB A;  1YTF B;  2BSK A;  1QLN A;  1PNL A;  3KCY A;  4RAI A;  5GTH Z;  4BIO A;  5CA0 A;  1FXV A;  4I9Q A;  2MW2 B;  5BR8 O;  5LYJ B;  1L1F A;  3ZED A;  2ZE8 A;  2FYU H;  1MZF A;  5CBH A;  2VQE B;  4FLX A;  2ZIM A;  4DR3 B;  4JI4 O;  2RJZ A;  2V1D A;  4B7E A;  3K9A A;  4UUJ C;  3C3S A;  5IYZ A;  1NBM G;  4IYI A;  1KBH A;  1S72 V;  2QJ1 A;  3JAT A;  2X6A A;  4LR3 A;  4D6T H;  1VMG A;  1P7B A;  2YIC A;  4PI2 A;  3L75 H;  3U11 A;  4FM2 A;  2R70 A;  1M56 C;  3OMA B;  1DF5 A;  2PI5 A;  2F66 C;  3VBB A;  2JGD B;  4KFM A;  4O2B A;  1Q3E A;  5B1A C;  2AXT Z;  2D2C B;  1DLB A;  4UFZ A;  1Z2G A;  4FVM A;  3WB2 A;  1FJG O;  1KEC A;  4ABM A;  5J2T B;  1N33 B;  4DV3 O;  3E22 A;  4O4L B;  4TV9 A;  1ZSP A;  5JVD A;  1PKX A;  1P7G A;  3ML0 A;  1BQ0 A;  4ZBM A;  1K33 A;  2ZXW B;  2UU9 O;  4NTW A;  1EN6 A;  3HKC A;  1OCR C;  3CWB H;  3SPG A;  1TVK B;  5EYP B;  1QVG U;  3JD0 A;  4YY3 B;  4O4H A;  4JI1 O;  1S5H C;  3KG2 A;  4JPR A;  1KU9 A;  5FPO A;  4DV4 B;  1FXK B;  1EN4 A;  1HP8 A;  2JEX A;  2RDC A;  4NB5 A;  4B3S O;  4JAS A;  4TOI A;  4I9W A;  1OCC C;  5JJE B;  4DR2 B;  3SDL A;  1IX9 A;  4IIJ A;  4WCE V;  2XAQ A;  2OTL V;  3UCS C;  2ILM A;  4FLY A;  4O2A B;  4HNA B;  2YDE A;  5LGT A;  2CK3 G;  5IJ0 B;  5JQG A;  4FMT A;  2Y0P A;  1AR5 A;  5L3F A;  1XNQ B;  2OIG A;  4MTX A;  3DXR B;  2QEX V;  2Y4U A;  3E89 A;  2YSU B;  2ZM6 B;  4JTD B;  1Q6U A;  3ASO B;  2Z3Y A;  4DV3 B;  1H2L A;  1M57 C;  2PTM A;  5L3B A;  1YHQ V;  3OTO B;  3SYP A;  2M7W A;  3HKD A;  1O9G A;  4I50 A;  2Z5U A;  2ZDI C;  5KMG B;  4I5S A;  4DR6 O;  3CC4 V;  4RO2 A;  4MVS A;  2B1I A;  4ZHQ A;  1DK1 A;  5EK0 A;  2A79 B;  4P9O A;  2RMK B;  1XL4 A;  1ZWI C;  4CH5 A;  3CEI A;  1LUW A;  1WP7 A;  3HR0 A;  1J5E B;  4LFA O;  4JI1 B;  1F23 A;  2JS5 A;  1UJW B;  1ZL8 A;  2HVJ C;  5FNV A;  4NTY A;  1S5J A;  1R6K A;  3A0R A;  1Q7Y W;  3QTC A;  5E79 Z;  4LF5 O;  1K8A W;  2HVK C;  3ZRX A;  3ZHU A;  5LA6 A;  5H5N A;  1XRE A;  3P32 A;  3E2E A;  3STZ C;  4TQF A;  5C8Y B;  1FFX A;  3ETD A;  1XMO B;  2WSS G;  5B3S B;  4MVQ A;  3A0B Z;  4X66 O;  1K97 A;  1NTK H;  3N2G A;  2Q7E A;  5C93 A;  1EM1 A;  3O9O A;  1WJZ A;  3JAL B;  3QO5 A;  4AIL C;  1MAB G;  3CCS V;  1GN3 A;  1TA8 A;  4UB6 Z;  1VQ5 V;  3KKY A;  4PDL A;  1IBK O;  4UVA A;  1GH6 A;  4GX0 A;  4YJ2 B;  1N32 O;  2BOC C;  1LNQ A;  1DGS A;  4B7K A;  2D3O W;  3ZJZ A;  4LFB O;  1VEW A;  4CH6 A;  4DR6 B;  2EIN B;  3ZN1 A;  1IVS A;  1B3Q A;  3JD4 A;  1B04 A;  3OR6 C;  3MAQ A;  3RYH B;  5CBG A;  1YIT V;  4LF5 B;  4NVP A;  4LF8 O;  2OYQ A;  3BA9 A;  1SA0 A;  4JV5 O;  2F4V B;  2E74 B;  2ZXW C;  3SJB C;  1JA8 A;  2WLN A;  3H1J H;  5CA1 B;  1AP5 A;  2P90 A;  2R9R B;  3AEI A;  3OE7 G;  4R6Z A;  4J80 A;  3W7T A;  2E76 B;  3H1K H;  5KA5 A;  1JCH A;  1PL4 A;  4Z2W A;  1W59 A;  1YCI A;  1QHT A;  1H2K A;  4X1K B;  4GKK O;  1AIL A;  4J7J A;  3IC7 A;  1SRY A;  2A9H A;  1FXK C;  3CXH F;  4WFG A;  3HKE A;  1US6 A;  3B4S A;  3T1Y B;  3ICX A;  1SQV H;  2GUZ A;  2Y4T A;  2NNU A;  3BHP A;  4IYH A;  3AG1 B;  2X6B A;  1IDS A;  4FFB A;  4LFB B;  4IL6 Z;  4LNU A;  1TGO A;  3ZHS A;  5L3C A;  2UUC O;  2QSA A;  3QNE A;  1H38 A;  4UVC A;  3S3X A;  3IFX A;  3S3W A;  1TUB A;  4JI3 B;  1XNR B;  2NN4 A;  3OT7 A;  1BE3 H;  1MNG A;  1XEQ A;  4J42 A;  2XAG A;  4HAM A;  3J80 N;  1KKC A;  2BTQ A;  3CJH B;  3MHS C;  3CRR A;  4BR6 A;  3LSQ A;  1JR9 A;  4RUF A;  3ASO C;  3T2M A;  3FYI B;  4Z1V A;  2ZKO A;  3OUS A;  1HNZ O;  3RW0 A;  1I08 A;  2ZIN A;  2AW9 A;  2IW5 A;  2QE7 G;  3JSN A;  4RQF A;  1L0N H;  4IHJ A;  4AI8 A;  3T4D A;  1U96 A;  3H1I H;  3B8M A;  3RVY A;  3JCU Z;  1S0V A;  4UCR A;  1SZT A;  4CZZ A;  1GTO A;  1NVP B;  4AQY O;  4GYC B;  1VQL V;  1PL0 A;  2UXD B;  2UXB B;  4FFK A;  4GKK B;  1WA8 B;  4HBN A;  4KL1 A;  2UXC B;  3ZMZ A;  4D7T A;  3G6E V;  2G38 A;  4K0K O;  2YXY A;  2ZE6 A;  1VF7 A;  3U10 A;  5KX5 A;  1KB9 F;  2YI9 A;  4MVR A;  1V55 C;  2X7R B;  2ZR2 A;  4U3J A;  2CTW A;  1IBL B;  3CCE V;  5H2F Z;  5GON A;  4ZIB A;  5B3S C;  1OJH A;  3TET A;  1SF9 A;  4OPH A;  4J10 A;  4CS2 A;  2EIJ B;  3B09 A;  4X62 B;  1BHB A;  4TSF G;  3BAB A;  4JGS A;  1KKD A;  5A9G A;  4JI8 O;  5BY1 A;  1NTM H;  1NR1 A;  3TCU A;  2HHH O;  2VWK A;  3JD3 A;  1KYO F;  3SGI A;  1SET A;  1S3J A;  5KUM A;  3ASN B;  3DC5 A;  2CE4 A;  4YXW G;  1NH2 B;  3FAV A;  3SJA C;  2N04 A;  3ABL B;  3LSS A;  4QE9 A;  4GKJ B;  3G71 V;  2EIN C;  4GX2 A;  4X88 A;  2Q67 A;  4DR5 B;  4JF3 A;  1HNX B;  4EFB A;  2P4V A;  4DV1 O;  1FFT B;  4FZ1 A;  2IJJ A;  3D3I A;  1VQ7 V;  3OMI B;  1YF2 A;  2DYR B;  3IJ4 A;  5CMU A;  1SQB H;  1N36 B;  2C2A A;  5B1B B;  1HR0 B;  3HKB B;  4WFE A;  3FB5 C;  5J2U A;  5LMU O;  2PYJ A;  1A32 A;  2YS8 A;  5K1P A;  3E35 A;  1V54 B;  4X20 B;  5GTI Z;  1J95 A;  4UCV A;  4DW0 A;  1EZV H;  1ZAU A;  2WLI A;  1JQ0 A;  3BAA A;  2EBO A;  3W7U A;  5EBM C;  3CCR V;  1VQ6 V;  1Q6H A;  2H94 A;  3T4Z A;  1KMI Z;  1BS3 A;  1XDC A;  3UQ8 A;  1S77 D;  4G28 B;  2VQE O;  1X4T A;  1KQS U;  2KSD A;  4DR3 O;  4LH7 A;  5IWA B;  4FPP A;  2LJ2 A;  2Q0O C;  1SC5 B;  1M1K W;  5B1O A;  3LDE A;  4TUY A;  4FLZ A;  2IU3 A;  2AHZ A;  3AG1 C;  1XMQ B;  4NXN B;  1QLE B;  4K8X A;  3D3Q A;  3EHB B;  3RYF B;  4GZR B;  2UUB B;  4I0X B;  4FLT A;  2WLK A;  2GV9 A;  2LFR A;  1Y66 A;  1PNK A;  2IH3 C;  4WFF A;  5LBQ A;  3ETQ A;  3X2Q B;  1Y74 A;  3K79 A;  1YZB A;  1WAZ A;  1U97 A;  1VF6 A;  2DQ3 A;  5EC1 C;  1N33 O;  5LMU B;  3GVM A;  3OAA G;  1LUV A;  3ZCC A;  4JAU A;  5EIB C;  3FYE B;  3M8A A;  3UO3 A;  5BZB A;  4X89 A;  1FD9 A;  1XL6 A;  1JX9 A;  2EIM C;  3BY6 A;  5IY5 B;  4LF9 B;  4EB6 B;  2X0L A;  4JYA O;  2QDO A;  1H2G A;  1YTF D;  5IYZ B;  1SES A;  5KLV H;  4YY3 O;  1Q82 W;  3JAT B;  1F4M A;  2OT5 A;  2Y48 A;  1Y76 B;  3K59 A;  4CC6 A;  4DV4 O;  5LHH A;  3K57 A;  4CC5 A;  1AJP A;  3W7X A;  4DR2 O;  2XTA A;  5KA6 A;  3CCL V;  1NR7 A;  2QWR B;  1AVM A;  3AK2 A;  4MS2 A;  3SPJ A;  2OCH A;  5LYJ A;  5DN6 G;  2BTO A;  5B1N A;  1G6U A;  2EIJ C;  4LH6 A;  5KHG A;  4H33 A;  3ETE A;  2UUA O;  4ZKI A;  3L70 H;  1XNQ O;  2DE0 X;  4TV9 B;  5JVD B;  2ZM6 O;  1NJI W;  4JI0 B;  4DV7 B;  1Q5O A;  3ASN C;  1R6T A;  1YI2 V;  3OTO O;  1E1Q G;  4I4T A;  3ABL C;  4MVM A;  3D8C A;  4DXW A;  5LXT B;  2W0F C;  1WP8 A;  2B5U A;  3SJC C;  4AHC A;  1IZ3 A;  2K9P A;  4PJ0 Z;  2LP7 A;  4K3A A;  3I56 V;  3RYI B;  4CH4 A;  3CRA A;  4FM1 A;  4O4H B;  1THZ A;  1KP3 A;  4OGQ B;  1W0J G;  4UCO A;  4JYA B;  2KKW A;  3LNM B;  2VWJ A;  1MSW D;  4DR7 B;  4X1Y A;  4QGP A;  4YJ3 A;  1GM8 A;  5L3E A;  1J5E O;  3QF7 A;  3BRC A;  2CTP A;  2DYR C;  4B3R B;  2WLH A;  5J2T A;  1HWY A;  5JWP A;  3DGE A;  1GN6 A;  3RN4 A;  5B1B C;  1WPX A;  2JJ1 G;  4JI2 B;  1W2B U;  1D5N A;  1SS3 A;  2LFS A;  1AJN A;  1V54 C;  5EC2 C;  2IJH A;  1GK9 A;  1IBM B;  4DV6 B;  3WB1 A;  1WLE A;  2WA3 A;  4YIO A;  4F6R B;  1NQT A;  5KUK A;  1XMO O;  2UUA B;  1VP7 A;  1GKF A;  1H2M A;  3ZN0 A;  2Q73 A;  2QM7 A;  4MW8 A;  4JI5 B;  2Y69 B;  4LC1 A;  4QNH B;  2W6I G;  1AI7 A;  5LOV A;  2LQT A;  1JVM A;  4BIU A;  3JAK B;  2CTR A;  3RVZ A;  2A0L A;  2UXN A;  4DV2 B;  3TJT A;  4UVB A;  1MZE A;  2GTS A;  2UXX A;  3SYQ A;  1GAX A;  3ZHR A;  3BA8 A;  2F93 B;  4O4I A;  1VQK V;  1QLE C;  3CP1 A;  1AI6 A;  4JYY A;  4ZOL B;  2JVD A;  4ZHQ B;  1JOY A;  2FB5 A;  4HNA A;  5IJ0 A;  4X9Q A;  4DUZ B;  4LBE C;  4BIZ A;  2Q4P A;  2VRZ A;  5DEC A;  4EKW A;  3DXR A;  3JAW B;  2VS0 A;  2P22 C;  2GHY A;  5JCO C;  3JD1 A;  1ZUQ A;  1M4U A;  4PI0 A;  3X2Q C;  1NU1 H;  4MW3 A;  5LA6 B;  2P67 A;  1Q81 W;  1XI1 A;  1H2N A;  2KQX A;  3GB7 C;  2N05 A;  1JJ2 U;  2PZS A;  5KMG A;  3AK3 A;  1P4R A;  2ATK C;  2KG7 A;  3DTU B;  4DR1 B;  2F4V O;  1V55 B;  4DUY B;  5IY5 C;  1URF A;  2Q6A A;  2QM8 A;  3ABM B;  4NKG B;  2JK5 C;  2LGW A;  5GW7 A;  2QKS A;  4B3T B;  3ZIA G;  1HNW B;  1HW7 A;  4I55 B;  5KHK A;  4MSW C;  4DO2 A;  5LGU A;  1O9H A;  3SJQ C;  3SYO A;  2JS3 A;  4BW9 A;  3OR7 C;  3T1Y O;  5C8Y A;  1RSO B;  3I5D A;  1FXH A;  5DED A;  5CB4 B;  1K34 A;  3D36 A;  4O4J A;  3CCV V;  4WFH A;  2H8P C;  2HFE C;  3CCU V;  5JH7 A;  2IJK A;  3EVK A;  1XOU A;  4JI3 O;  4FLV A;  1G4Y B;  3R65 A;  1XNR O;  2F23 A;  4PD4 F;  4WFB V;  5BMV A;  4BAY A;  3APQ A;  1DF4 A;  5IDJ A;  4WFA V;  2AZ2 A;  5FPR A;  1H8H G;  3UM7 A;  1AI4 A;  3B8N A;  4N21 A;  2FML A;  4FIP C;  1K5S A;  3VOU A;  4HZ3 A;  1YXB A;  4DK1 A;  1S76 D;  3OGI B;  1MSD A;  1JMK C;  2PUS A;  3U0Z A;  5B66 Z;  3TXQ A;  1D2D A;  5LP6 B;  2UXD O;  2UXB O;  2CH7 A;  3T1C A;  5JJJ B;  3RYH A;  2JEU A;  1VAR A;  4W4K A;  1BHA A;  2BOB C;  2GUZ B;  4LF4 B;  2UXC O;  3SYC A;  4P9P A;  4JAV A;  1OV9 A;  2QTS A;  3CMA V;  3G6B A;  5EBL C;  3ABK B;  4YIP A;  2AHY A;  3VQY A;  3WB0 A;  5CA1 A;  4CH3 A;  4R8C A;  2Q68 A;  4OX9 O;  3OGC C;  1IBL O;  4DRX A;  2CGN A;  3OEH G;  5F2V O;  1RM1 B;  1G8M A;  4QPK A;  2Y69 C;  2QM4 A;  2Q69 A;  4X62 O;  3CYO A;  3E8H A;  4WBN A;  2ADQ B;  2QWN B;  4QE7 A;  5FLX N;  1Z5V A;  3ZS8 C;  3FB8 C;  1EZJ A;  2EZP A;  4IHJ B;  3CXC U;  1RP3 B;  3TK1 A;  3OUF A;  4J9Z B;  3CCM V;  3M7M X;  3CHX A;  1K4C C;  4E4E A;  3UT5 A;  4XDJ A;  1F4N A;  4GKJ O;  5KHI A;  5ITZ A;  4G2K A;  3QO7 A;  2CTQ A;  4H44 B;  4DR5 O;  3ETG A;  3E8B A;  1PM9 A;  2EIM B;  1HNX O;  3P3P A;  3CCQ V;  3WG7 C;  3CJH A;  1SZX A;  2LGQ A;  1R3K C;  1CXZ B;  4LWS A;  3THO A;  5CBF A;  5EIB D;  4GX5 A;  4X64 B;  1SER A;  3WFV A;  2A7W A;  3W7W A;  3HPL C;  3A8T A;  1N36 O;  4U3J B;  2HJF C;  4MTF A;  1NVP D;  3IC9 A;  1HR0 O;  1K73 W;  2X6C A;  4Z1M G;  1L8D A;  5GON B;  2YXH A;  2VQF B;  5HFM A;  3LSU A;  1Z5W A;  4OX9 B;  1ENV A;  3ABM C;  2ETN A;  3CS5 A;  4E2L A;  3LNN A;  2H3O A;  3RBZ A;  2CUG A;  4DV5 B;  2K1E A;  2NR5 A;  5L3G A;  1WA8 A;  4TT3 G;  3H01 A;  4U3F H;  3WU2 Z;  2Q5Z A;  2QKA A;  2GTA A;  4J11 A;  1WB7 A;  1V9P A;  1Y67 A;  4PV1 B;  4W4L A;  1PV0 A;  4UV8 A;  5IWA O;  5IYC O;  3ZRS A;  1KD1 W;  2HKO A;  4FK5 C;  4X1I B;  4KXR A;  1QVF U;  2YXL A;  1I94 B;  2BE3 A;  5K1X A;  2FL4 A;  1XMQ O;  4NXN O;  1AI5 A;  2E5L B;  2RN9 A;  3JSL A;  2YEV A;  1GO3 F;  2E3C A;  2Q7G A;  3VQW A;  2XOK G;  3A2F A;  2N74 A;  4TV8 A;  1YJ9 V;  1NKD A;  2UUB O;  3N2K A;  4J41 A;  3NR7 A;  5IJ9 B;  2DW4 A;  1NTZ H;  4YHH B;  1RPR A;  1JFF B;  4QPJ A;  3J81 N;  1N34 B;  1BZK A;  5J9P C;  1N4C A;  2ZNI A;  2EJR A;  4NXM O;  4I7Z B;  3AG4 B;  1MG1 A;  1GMG A;  4JZG A;  4P2Z A;  2WLI B;  3CSX A;  3OM3 B;  1DTO A;  1XBL A;  2F43 G;  3H1H H;  5D5P A;  1YJN V;  2YIA A;  5EZY B;  1AJQ A;  4LF9 O;  3FB6 C;  2LW1 A;  3C3T A;  1RFY A;  2L35 A;  5LP6 C;  4GCZ A;  1N0J A;  5LMN B;  2DYS B;  3CC2 V;  4DR4 B;  4B3M B;  4FJC C;  4C7U A;  3K03 A;  2L6L A;  4TUY B;  4JI6 B;  3HKB A;  3LUT B;  2GBO A;  3QO8 A;  4JI7 O;  3ABK C;  3ZRW A;  2OCC B;  4R7C A;  1N8R W;  3AG2 B;  1SQX H;  2EIL B;  4RUE A;  2WLL B;  4PDV A;  3Q4H B;  2WLJ A;  2ODM A;  4LFC B;  4F6E A;  1RM1 C;  3UKM A;  1OHH G;  3BEH A;  1NS1 A;  1QU7 A;  3JAR A;  2OWO A;  3PJS K;  3RYC B;  3OD4 A;  1E1R G;  2XAS A;  4NXM B;  4JI0 O;  4DV7 O;  3ZHQ A;  2BSK B;  3DSQ A;  4GUN A;  2ZDI A;  3RYF A;  2JJ2 G;  1X59 A;  5CA0 B;  5A2Q N;  4I0X A;  4LP8 A;  3FFQ A;  1Q90 D;  4DK0 A;  3BPZ A;  1OCZ B;  2HEP A;  1HDJ A;  1QQC A;  1K92 A;  1I5X A;  4DR7 O;  2YI8 A;  1WPB A;  4B3R O;  2HR3 A;  3J7A U;  1S5L Z;  3JAS A;  1BL8 A;  1I0H A;  3DC6 A;  2JDI G;  3JYC A;  4R50 A;  4A5U B;  4ZI7 A;  4JI7 B;  4UCS A;  1PD3 A;  4JI2 O;  4CS3 A;  1TAE A;  4PA3 A;  4WF9 V;  2XUM A;  3CB2 A;  3RT3 C;  4DV6 O;  1IBM O;  1XUQ A;  5IYB O;  3K3W A;  4O2B B;  5LHG A;  4EB6 A;  1Y4M A;  1EN5 A;  4JAA A;  4LF6 O;  1OZ0 A;  2QTO A;  2PF4 E;  3SPH A;  4XBF A;  4NR1 A;  3T1H O;  1TUE B;  3JCZ A;  4F4L A;  4JI5 O;  2V7Q G;  1IXM A;  1Y76 A;  1K4D C;  1T5E A;  3H9V A;  3ABU A;  3E22 B;  3OTF A;  3FD9 A;  1P49 A;  5IT9 N;  1L0L H;  4J9Y B;  3SR2 C;  4I4T B;  4DV2 O;  1CPY A;  4K8Z A;  5HFL A;  1M5I A;  1ARO P;  2B9Z A;  4LF7 O;  1ROP A;  2JRI A;  1PP9 H;  4NYK A;  1R3J C;  5B5E Z;  1OCO B;  2JGD A;  3R66 A;  3AG3 B;  3HKC B;  4X1Y B;  3BFR A;  4YJ3 B;  4DUZ O;  2PY5 A;  3F5W C;  2YID A;  3C90 A;  3FB7 C;  3E8G A;  3ZHV A;  4RWU A;  2EIK B;  1P84 F;  4PA7 A;  2ITD C;  2A06 H;  1K9M W;  3L72 H;  3VQV A;  2AZ0 A;  2PYL A;  3HB3 B;  1XQ8 A;  5TIS Z;  2XHB A;  4O4L A;  2WWW A;  4IIJ B;  3AG4 C;  1YVW A;  3E8F A;  2ZR3 A;  5IYD O;  1E79 G;  5LXT A;  3K04 A;  5BR8 B;  2JIZ G;  2WPD G;  2P4K A;  5E1A C;  4DR1 O;  4H37 A;  1M90 W;  4TWK A;  3RYI A;  2CDY A;  3OW2 U;  3SPC A;  5JQG B;  4DUY O;  3F5T A;  1XHZ A;  4JI4 B;  1VQM V;  4LF6 B;  2DWE C;  5LOV B;  4RQE A;  3T1H B;  4B3T O;  1TVK A;  5IE9 A;  5EYP A;  1HNW O;  2DYS C;  2XAF A;  3AG7 A;  1COW G;  4J7Z A;  5LGN A;  2QA4 V;  2HLD G;  4FZ0 A;  1FXK A;  2IH1 C;  1VQ8 V;  1R1B A;  4O4I B;  1IXB A;  3HKD B;  2V4D A;  4I50 B;  3STL C;  3L73 H;  4MVU A;  2OCC C;  1AB3 A;  4LF7 B;  2B1G A;  1I5Y A;  3AG2 C;  3FX7 A;  2IBZ H;  2EIL C;  3KCX A;  4P30 A;  1QNM A;  4UCT A;  2LO1 A;  1MOF A;  4O2A A;  4PDM A;  1UFI A;  4F6R A;  2EJ7 A;  4GLX A;  1FJG B;  4FLW A;  1F7Y A;  1KC8 W;  1B06 A;  3K0D A;  1ZL8 B;  5FNV B;  5L3D A;  3JAK A;  1VF6 C;  2CGO A;  2WAM A;  5CN0 A;  3WG7 B;  3PN1 A;  2DOS A;  1G1X B;  5H6Q A;  4PA9 A;  3CME V;  3I55 V;  2KG7 B;  2UU9 B;  1BCC H;  1R3I C;  1AP6 A;  1K5Q A;  4ZOL A;  4G27 B;  4FM0 A;  1VQP V;  1FFX B;  2EUL A;  1XHX A;  2DJV A;  2CAZ C;  4HYO A;  1SKV A;  3N2G B;  1OCZ C;  3JAW A;  4MTG A;  4KHP O;  1GN2 A;  4B3S B;  4H13 B;  1FAF A;  2DN9 A;  1QR8 A;  1UPG A;  4QJF B;  4U7O A;  2F95 B;  5LHI A;  4LF4 O;  3ABT A;  1WNS A;  5KAF Z;  1M93 A;  2R72 A;  3CRM A;  4Q6G A;  4O4J B;  1Y6X A;  3N27 A;  3K58 A;  4MVZ A;  5JH7 B;  1PNM A;  2EZO A;  1I7F A;  5H6R A;  2NLJ C;  3RWR D;  3ZRV A;  2IM9 A;  1BGY H;  1R73 A;  2OIE A;  4I55 A;  1AR1 B;  4JYC A;  3K06 A;  5D5Q A;  1MMM A;  5KHJ A;  1VQO V;  4DYL A;  1D5A A;  5BMV B;  3JAL A;  2DWD C;  4UCU A;  5AG2 A;  1VIB A;  2ADP A;  3P30 A;  4IT5 A;  4UXN A;  1SA0 B;  3RFR A;  1RSO A;  2RQ6 A;  3ZMS A;  3QG5 A;  3UO2 A;  4YJ2 A;  1PPJ H;  4KP4 A;  2WA4 A;  3NXS A;  4KUM A;  2ZIO A;  1Q8I A;  5CB4 A;  5KHH A;  1GRJ A;  4H0L B;  1OCO C;  4LFA B;  2IJI A;  3AG3 C;  3JD2 A;  1ZTE A;  4L87 A;  1FS0 G;  2LW7 A;  4UV9 A;  3G80 A;  4GX1 A;  2QWO B;  2CH7 B;  2EIK C;  3CE2 A;  4KHP B;  5BXZ A;  2E75 B;  2HG5 C;  3KZI Z;  5LL6 Y;  1Q43 A;  3CCJ V;  3HKE B;  4MVO A;  2QGN A;  2XND G;  4CBC A;  3GWK C;  4TQD A;  1BQZ A;  2PGG A;  4X64 O;  3VQX A;  1NI8 A;  4CS4 A;  4FFB B;  3TGU H;  3LDC A;  5FL7 G;  4LNU B;  4X66 B;  4DRX B;  2VQF O;  3TXS A;  3B77 A;  3QVN A;  3CRQ A;  1TUB B;  2Z0A A;  3FKS G;  3B2E E;  3O65 A;  3CD6 V;  2BTQ B;  5LP6 A;  3P3N A;  4X8A A;  3M99 B;  4WBN B;  4UB8 Z;  4X1K A;  4DV5 O;  2P5O A;  1IBK B;  1YJW V;  4JZ2 A;  4J7K A;  2P06 A;  1N32 B;  2ZNJ A;  4LCU C;  2WLM A;  3H1L H;  4FLU A;  4JTC B;  1NT2 B;  2KB1 A;  2O57 A;  2M6Y A;  3UT5 B;  1SQQ H;  2R9I A;  2YUA A;  4IGG A;  5ITZ B;  1I94 O;  5H9C A;  1BMF G;  2DQ0 A;  4DV0 O;  4OPA A;  1EFR G;  1CP9 A;  2Q8V A;  2E5L O;  4X65 O;  2GDS A;  4DW1 A;  4LWS B;  3W7S A;  2JGU A;  4LF8 B;  2FTK A;  1SQP H;  1QR9 A;  2ARH A;  4YHH O;  3K0G A;  4PEL A;  4JV5 B;  3JAM N;  1N34 O;  3MD0 A;  5KX5 B;  4OXS A;  2RCV A;  2RNB A;  2W0X A;  4PA6 A;  2ITC C;  1VF5 B;  1QBZ A;  5EBW C;  3CPW U;  5CA3 A;  1H2S B;  1ORQ C;  2HJD A;  4ASU G;  2ZT9 B;  1RPO A;  3OEE G;  1MA1 A;  3K5N A;  1YEW A;  4BWA A;  4BW5 A;  2AGA A;  3OFN G;  2Q9L A;  5LMN O;  1BT8 A;  4DR4 O;  4Q20 A;  2HP8 A;  1SQF A;  4B3M O;  3L74 H;  1ZX3 A;  1H8E G;  1JJO A;  4JI6 O;  3CRC A;  1B6Q A;  2UUC B;  3D36 C;  3FAV B;  1AR4 A;  2EX3 A;  2YIB D;  3L71 H;  3ZHT A;  2YEV B;  1M56 B;  2GSM B;  4XDK A;  1GN4 A;  4PA4 A;  2ZE7 A;  4TV8 B;  1GM7 A;  4D7S A;  4DV0 B;  3E83 A;  4X65 B;  1W0K G;  3N2K B;  5B1A B;  2IU0 A;  2YIB A;  3SYA A;  1FPO A;  1N0N A;  2R9A A;  4LFC O;  4PHZ A;  1WN7 A;  2ZE5 A;  1HNZ B;  1NH2 D;  3IAY A;  3BVO A;  5J2U B;  4X1I A;  1YDX A;  1FKA O;  3ZMU A;  1BSM A;  3MDS A;  1KP2 A; 
#chains in the Genus database with same CATH homology
 3X2Q C;  1CEZ A;  5LHG A;  4MW3 A;  3LDD A;  1Y4M A;  1OZ0 A;  2QTO A;  2NNU A;  3SPH A;  4XBF A;  3AG1 B;  3IGA C;  2X6B A;  2P67 A;  1Q81 W;  1TUE B;  2P6J A;  4N23 A;  3JCZ A;  3GB7 C;  4F4L A;  2V7Q G;  1IXM A;  5L3C A;  1OCR B;  1JJ2 U;  4QIW F;  3QNE A;  3ZMV A;  1H38 A;  1P4R A;  4UVC A;  2ATK C;  3IFX A;  1K4D C;  3E86 A;  3ABU A;  3DTU B;  1K7D A;  1YIJ V;  1EBO A;  4J9Y B;  1V55 B;  1CPY A;  2ZD9 A;  2XAG A;  4HAM A;  5HFL A;  1QCE A;  1ARO P;  1F51 A;  5IY5 C;  2Q6A A;  2XAH A;  2QM8 A;  3ABM B;  3F7V C;  3MHS C;  4XDL A;  3LSQ A;  1OCC B;  1ROP A;  2JK5 C;  3ZRW B;  4RUF A;  5GW7 A;  2QKS A;  3ASO C;  1R3J C;  1JPX A;  1VQ9 V;  3ZIA G;  3T2M A;  3FYI B;  3GWO A;  5LGU A;  4MSW C;  4DO2 A;  1OCO B;  1GM9 A;  3AG3 B;  4GT1 A;  3OUS A;  2W6J G;  3SJQ C;  2PI4 A;  3RW0 A;  3G4S V;  4MT8 A;  2IW5 A;  2QE7 G;  3F5W C;  4RQF A;  3FB7 C;  3SYO A;  3E8G A;  3T4D A;  2EIK B;  2XAJ A;  1VQ4 V;  2P7T C;  4PA7 A;  4U7N A;  3B8M A;  3OR7 C;  2ITD C;  3RVY A;  1K9M W;  1M9N A;  1S0V A;  3SPI A;  1SZT A;  4CZZ A;  1GTO A;  3HB3 B;  1NVP B;  2MK3 A;  1FXH A;  1R3L C;  3F7Y C;  3K08 A;  3OMN B;  1VQL V;  1PL0 A;  2WWW A;  3ZMT A;  1K34 A;  3AG4 C;  4JYB A;  3D36 A;  3E8F A;  2ZR3 A;  4WFH A;  4PDR A;  3CCV V;  2H8P C;  2HFE C;  2ZQM A;  5IYD O;  3CCU V;  1E79 G;  1M57 B;  3K04 A;  2JIZ G;  5DM6 V;  3ZMZ A;  2IJK A;  2WPD G;  3G6E V;  5E1A C;  4JTA B;  4H37 A;  1G4Y B;  3R65 A;  4TWK A;  1M90 W;  1VQN V;  3OW2 U;  3SPC A;  2OTJ V;  1YSC A;  3CC7 V;  1VQM V;  3MHH C;  2DWE C;  2WLL A;  4WFB V;  4MVR A;  1V55 C;  2X7R B;  4RQE A;  2ZR2 A;  4BAY A;  3CCE V;  2DYS C;  1Q86 W;  2XAF A;  1COW G;  1DF4 A;  1R6N A;  5IDJ A;  5B3S C;  4WFA V;  1K3E A;  5LGN A;  3TET A;  2QA4 V;  1H8H G;  2HLD G;  1FXK A;  2IH1 C;  3UM7 A;  1VQ8 V;  2EIJ B;  1AI4 A;  3B8N A;  3STL C;  4N21 A;  4FIP C;  1K5S A;  3VOU A;  3EFF K;  1BHB A;  4HZ3 A;  2OCC C;  4MVU A;  4TSF G;  4JGS A;  4MTO A;  1KKD A;  1S76 D;  2B1G A;  1I5Y A;  3AG2 C;  1YTF B;  2EIL C;  4P30 A;  1NR1 A;  3TCU A;  1MOF A;  3JD3 A;  1QLN A;  4PDM A;  1SET A;  1PNL A;  4RAI A;  1S3J A;  5KUM A;  3T1C A;  3ASN B;  2JEU A;  1FXV A;  4YXW G;  1NH2 B;  1KC8 W;  1BHA A;  2BOB C;  3K0D A;  1L1F A;  3SYC A;  4P9P A;  3ABL B;  3LSS A;  4JAV A;  4QE9 A;  3G71 V;  2EIN C;  3CMA V;  4GX2 A;  5L3D A;  3WG7 B;  2WAM A;  5CN0 A;  5EBL C;  5CBH A;  4X88 A;  2Q67 A;  3ABK B;  4JF3 A;  2AHY A;  2V1D A;  5H6Q A;  3K9A A;  4PA9 A;  3CME V;  4R8C A;  4UUJ C;  2Q68 A;  3I55 V;  1NBM G;  1FFT B;  3OGC C;  1R3I C;  1S72 V;  1K5Q A;  2X6A A;  2IJJ A;  4G27 B;  3D3I A;  1VQ7 V;  1VQP V;  3OEH G;  3OMI B;  1P7B A;  3ZMU A;  2DYR B;  1RM1 B;  1G8M A;  5CMU A;  4QPK A;  2C2A A;  2Y69 C;  5B1B B;  2Q69 A;  4HYO A;  4WFE A;  3CYO A;  3FB5 C;  1M56 C;  3OMA B;  1DF5 A;  2PI5 A;  1OCZ C;  3VBB A;  4KFM A;  4MTG A;  3E35 A;  3E8H A;  1V54 B;  4QE7 A;  3FB8 C;  5B1A C;  1EZJ A;  2EZP A;  1J95 A;  3CXC U;  1DLB A;  2WLI A;  1JQ0 A;  1QR8 A;  4QJF B;  1KEC A;  3TK1 A;  3OUF A;  4J9Z B;  3CCM V;  2EBO A;  3W7U A;  4U7O A;  1K4C C;  5EBM C;  3CCR V;  1VQ6 V;  5LHI A;  2H94 A;  3T4Z A;  4XDJ A;  1F4N A;  3ABT A;  1S77 D;  4G2K A;  3QO7 A;  4G28 B;  1KQS U;  3ETG A;  1PKX A;  3E8B A;  3ML0 A;  2EIM B;  4MVZ A;  3CCQ V;  1PNM A;  3WG7 C;  2EZO A;  4FPP A;  4ZBM A;  1K33 A;  2ZXW B;  2NLJ C;  5H6R A;  1M1K W;  1R3K C;  5B1O A;  3LDE A;  3ZRV A;  5CBF A;  1R73 A;  4GX5 A;  2IU3 A;  2AHZ A;  3AG1 C;  1AR1 B;  4JYC A;  3K06 A;  1VQO V;  1QLE B;  1SER A;  3WFV A;  3W7W A;  3HPL C;  3EHB B;  1OCR C;  2DWD C;  3SPG A;  2HJF C;  4MTF A;  3JD0 A;  1NVP D;  1QVG U;  1K73 W;  2X6C A;  4Z1M G;  1S5H C;  3KG2 A;  3P30 A;  5HFM A;  4JPR A;  2WLK A;  1FXK B;  4UXN A;  2JEX A;  2LFR A;  1ENV A;  1Y66 A;  1PNK A;  3ZMS A;  2IH3 C;  4JAS A;  3ABM C;  4WFF A;  5LBQ A;  4KP4 A;  4I9W A;  1OCC C;  3NXS A;  4KUM A;  4E2L A;  3X2Q B;  3K79 A;  4WCE V;  2XAQ A;  3RBZ A;  2OTL V;  2K1E A;  1OCO C;  2IJI A;  2DQ3 A;  3AG3 C;  5EC1 C;  5L3G A;  3JD2 A;  3H01 A;  4TT3 G;  4L87 A;  1FS0 G;  4UV9 A;  3OAA G;  3ZCC A;  4GX1 A;  2CK3 G;  4JAU A;  5LGT A;  2EIK C;  3FYE B;  4FMT A;  4UV8 A;  5IYC O;  3ZRS A;  5BZB A;  5L3F A;  1KD1 W;  2HG5 C;  2HKO A;  4FK5 C;  4MTX A;  4X89 A;  2QEX V;  1QVF U;  1XL6 A;  1JX9 A;  3CCJ V;  4MVO A;  3E89 A;  2EIM C;  3BY6 A;  2XND G;  2YSU B;  5IY5 B;  4CBC A;  4JTD B;  1AI5 A;  2X0L A;  3ASO B;  2Z3Y A;  2YEV A;  1H2G A;  1GO3 F;  1YTF D;  1M57 C;  2XOK G;  1SES A;  5L3B A;  1YHQ V;  3SYP A;  2M7W A;  3LDC A;  1YJ9 V;  1Q82 W;  1F4M A;  1NKD A;  5FL7 G;  2OT5 A;  2Z5U A;  2ZDI C;  3B77 A;  2Y48 A;  4I5S A;  5LHH A;  2DW4 A;  3FKS G;  3CC4 V;  3CD6 V;  4RO2 A;  1RPR A;  1AJP A;  3W7X A;  4MVS A;  2B1I A;  4QPJ A;  5EK0 A;  2A79 B;  4P9O A;  5KA6 A;  1XL4 A;  3CCL V;  1NR7 A;  1ZWI C;  4X8A A;  5J9P C;  3M99 B;  2EJR A;  4MS2 A;  3AG4 B;  1MG1 A;  3SPJ A;  1YJW V;  1GMG A;  1F23 A;  5DN6 G;  1UJW B;  5B1N A;  4P2Z A;  2WLI B;  2HVJ C;  2EIJ C;  3OM3 B;  4LCU C;  1DTO A;  1R6K A;  2WLM A;  3ETE A;  4H33 A;  3A0R A;  1Q7Y W;  4JTC B;  2F43 G;  2KB1 A;  4ZKI A;  1K8A W;  2HVK C;  3ZRX A;  2R9I A;  3P32 A;  1YJN V;  1AJQ A;  3E2E A;  5H9C A;  1BMF G;  2DQ0 A;  3STZ C;  3FB6 C;  1EFR G;  1CP9 A;  1NJI W;  4GCZ A;  2DYS B;  3CC2 V;  4FJC C;  3ASN C;  3ETD A;  1YI2 V;  1E1Q G;  2WSS G;  3K03 A;  5B3S B;  4MVQ A;  3ABL C;  3W7S A;  3LUT B;  4MVM A;  4DXW A;  1K97 A;  2W0F C;  2B5U A;  3QO8 A;  5C93 A;  2FTK A;  3ABK C;  1QR9 A;  2LP7 A;  3ZRW A;  3I56 V;  2OCC B;  3QO5 A;  3K0G A;  4PEL A;  4R7C A;  1THZ A;  3AG2 B;  1MAB G;  1N8R W;  1KP3 A;  2EIL B;  4RUE A;  3MD0 A;  1W0J G;  3CCS V;  1MSW D;  2WLL B;  3LNM B;  4OXS A;  4PDV A;  4PA6 A;  2ITC C;  1GM8 A;  5L3E A;  1VQ5 V;  2WLJ A;  4PDL A;  1QBZ A;  4UVA A;  4GX0 A;  2DYR C;  5EBW C;  3UKM A;  1RM1 C;  2WLH A;  3CPW U;  1HWY A;  2BOC C;  3DGE A;  1LNQ A;  5B1B C;  1OHH G;  1WPX A;  3BEH A;  2JJ1 G;  5CA3 A;  2D3O W;  1ORQ C;  3ZJZ A;  1W2B U;  2EIN B;  4ASU G;  3ZN1 A;  2LFS A;  1AJN A;  1V54 C;  1RPO A;  3OEE G;  5EC2 C;  3PJS K;  2IJH A;  1E1R G;  1GK9 A;  4BW5 A;  3OFN G;  2XAS A;  3JD4 A;  3OR6 C;  1WLE A;  4Q20 A;  1NQT A;  2ZDI A;  5KUK A;  1H8E G;  2JJ2 G;  1GKF A;  3ZN0 A;  2QM7 A;  4MW8 A;  1B6Q A;  5CBG A;  1YIT V;  2Y69 B;  4LP8 A;  4LC1 A;  4QNH B;  2W6I G;  2YEV B;  1AI7 A;  1M56 B;  1JVM A;  2GSM B;  4XDK A;  4BIU A;  4PA4 A;  1OCZ B;  3RVZ A;  1GM7 A;  2A0L A;  2UXN A;  2ZXW C;  1K92 A;  3E83 A;  1W0K G;  4UVB A;  2WLN A;  1I5X A;  5B1A B;  2UXX A;  3SYQ A;  2IU0 A;  2R9R B;  2P90 A;  3AEI A;  3OE7 G;  3SYA A;  4R6Z A;  3W7T A;  1VQK V;  1QLE C;  3CP1 A;  2HR3 A;  1AI6 A;  5KA5 A;  1JCH A;  1BL8 A;  1JOY A;  2JDI G;  3JYC A;  4R50 A;  1PD3 A;  1NH2 D;  4PA3 A;  4LBE C;  3IC7 A;  4BIZ A;  1SRY A;  4EKW A;  2A9H A;  1FXK C;  4WF9 V;  4WFG A;  2GHY A;  5IYB O;  3K3W A;  3JD1 A;  1KP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...