2GHYA

Novel crystal form of the cole1 rom protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
57
structure length
57
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title Novel crystal form of the ColE1 Rom protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 24
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ghyA00
1GMGA 1RPRA 1B6QA 2IJHA 1NKDA 1ROPA 1RPOA 2IJIA 1GTOA 2IJKA 4DO2A 2IJJA 1PD3A 3K79A 1F4MA 1F4NA 2GHYA
chains in the Genus database with same CATH superfamily
2JVDA 2XAQA 1AJQA 1JA8A 2Q69A 5IWAO 4RAIA 3ETDA 4DO2A 5J2TA 1JFFA 1NH2D 3HKBA 3F5WC 4JI3O 3RFRA 3LUTB 3OR6C 4B08A 5JJEB 5J9PC 2HHHO 3WB0A 2HVJC 1M57C 2ZKOA 3JAWB 1S5JA 5IJ0B 5JH7B 4I50B 2Q6AA 3IFXA 1SS3A 2ZCEA 1M93A 3AEIA 2YEVB 4L87A 1K4DC 2BE3A 1FJGO 5AG2A 2ZM6B 3ZBHA 1OCRC 3MD0A 1Q5OA 4KHPO 2UXBO 1IX9A 4DR4B 4BWAA 3JARA 1OCOC 5KMGA 4IIJB 2EULA 5HFMA 3ASNC 5KHJA 2DYSB 3KCYA 5KUKA 4FM1A 3D3IA 4X88A 1S76D 4O4HB 4FLVA 1GN3A 4LF8O 3AG7A 1H8HG 4IL6Z 2PTMA 3SPIA 4FLXA 4TV8A 1MG1A 3CE2A 1V9PA 1XHXA 4WF9V 3G80A 1HNXB 3CRAA 1YDXA 4EEQA 1XDCA 2HLDG 2Y69C 1UJWB 3CMEV 2UUBO 4K8XA 4LH6A 3FB6C 3ZX6A 1SRYA 5L3GA 1TUBB 1EZVH 1SA0B 2DYSC 3FD9A 3SYAA 1FD9A 2R9RB 1YITV 4LFCB 3CXCU 5IYZB 1IBLB 1CXZB 2KG7B 1IBKB 2EILB 1NQTA 2F95B 5BXZA 4Q20A 3D36A 5LMUB 1FYJA 2UUCO 4ZBMA 1NH2B 1WN7A 1MSDA 3BY6A 5EBLC 1XMOB 1YSCA 5L3CA 1ZAUA 3B8MA 1YJNV 3H1IH 1HWYA 3EHBB 4AILC 1LNQA 1N33O 4G2KA 4MT8A 3I5DA 4H44B 3ZRXA 2PF4E 3JAMN 1J5EB 4AI8A 2JEXA 5C93A 3UT5A 1SQQH 5CA0B 3ICXA 2EILC 3HKEA 2KSDA 2VRZA 2EIMC 1BS3A 3DXRB 3E86A 4X8AA 2YXLA 1BGYH 4DRXA 3RYIA 2E75B 3U11A 5LA6B 4DV1B 1Q6UA 3G4SV 1VF6A 2RNBA 3UQ8A 2QKSA 1QU7A 2HJFC 4MVOA 1OCCB 1MOFA 1ZLZA 5ITZA 1Y74A 1NTKH 4MVZA 2E74B 4LBEC 3ASOC 3Q4HA 3JASA 4LF7B 2PI5A 2P6JA 4EB6B 3N2GA 4WFEA 3NXSA 4DUYB 4WBNA 5IY5B 2X6AA 4QJFB 2GDSA 4I4TB 2CGNA 2HG5C 4YHHO 3CCSV 4ZIBA 4JI2O 1S0VA 2FTKA 2F23A 2N74A 3H1HH 1OCCC 1KQSU 2VS0A 2QWQB 1QVFU 5B1OA 4JI7O 1NTZH 4DR1B 1K97A 3LDEA 2QR4A 1IZ3A 1KBHA 2G38A 4B7KA 2YS8A 2EZOA 4WFHA 5IY5C 4JTDB 3ZN1A 4JI8O 4UVAA 3TK1A 2PI4A 2QGNA 4G27B 4GZRB 4FM0A 4ZHQB 2CAZC 1NU1H 5D5PA 3CCUV 1K92A 3L72H 2JS5A 2KKWA 3CP1A 1IVSA 3CB2A 3K9AA 4GKKO 3RBZA 4NXNB 4D6TH 2A3QA 4O4IB 4JV5B 1GK9A 1HR0B 4UCSA 3A2FA 4JI5O 2RMKB 4OXSA 3QF7A 2ITDC 3GWOA 2RN9A 5CBHA 3AG3B 1BHBA 3J81N 2B5UA 2P4VA 4JAAA 2OIGA 1BL8A 4NYKA 1IBLO 4LF6O 5FPRA 1VQ7V 2M6YA 4CZZA 2YSUB 4I9QA 3SR2C 2OTLV 3JD1A 1R3LC 4TSFG 1QLEC 5C8YA 1VQ8V 3RYHB 4HNAA 2LFSA 3SJCC 2A9HA 4X1IB 1M5IA 4MS2A 5D5QA 1PP9H 2YC0A 2PYLA 3KCXA 3ZHSA 4ABMA 3CD6V 3ABUA 1BT8A 1SESA 3BHPA 5H9CA 1FS0G 1VQKV 2GV9A 3R65A 3ETGA 4JI1B 4EKWA 4DR2O 1ZWIC 2WA4A 1KMIZ 3VQXA 1HDJA 4O2BA 1VQOV 3OUSA 4NTWA 4W4LA 4J7JA 3L75H 4RWUA 1OV9A 4DV1O 1IDSA 3OEHG 4UCOA 2WLMA 2Y4UA 3KG2A 4X64B 1Y6XA 3M99B 4B3SO 2AHYA 1WAZA 4WFBV 1SKVA 4JF3A 2LGWA 1EM1A 4X1KB 1K8AW 3ZMZA 3ABMB 1IBMO 2BCCH 1SF9A 4NR1A 2N04A 4MSWC 3RYFB 1VQ9V 4PI0A 4N21A 2DN9A 3OFNG 4DV7B 3FAVA 2ZE5A 4K0KB 1VQLV 2LJ2A 3B2EE 5B1BC 4X89A 1JVMA 4IYIA 1UPGA 4E4EA 4B3MB 4XDLA 3TGUH 1YCIA 4DR1O 2CH7A 1N34B 1Y67A 1IURA 4DR3B 4J10A 4DK1A 1QR9A 3ZHUA 4E2LA 5DM6V 3ABMC 1WPBA 2JS3A 2GTSA 1O9HA 3P3NA 3W7UA 4GLXA 5CB4B 5DN6G 3CCJV 1PKXA 3K03A 4FLZA 3H01A 2WLKA 1XMQB 1P7GA 3TCUA 1MZFA 4U7NA 1BSMA 2H94A 1DTOA 2VQFO 5B3SB 3JSLA 1ROPA 1GM8A 1YTFD 2EINB 1NVPD 1JJ2U 2ZIMA 1FXKA 3OTFA 4FZ0A 5LP6B 4YIPA 3SPGA 4FVMA 3WFVA 2XAFA 4X66B 3RT3C 3WG7B 1K9MW 1I0HA 2ILMA 1JCHA 1SQVH 4OPAA 4U3JA 2JK5C 1K4CC 2L6LA 2OWOA 3JAKA 3SPCA 1US6A 1EZJA 5B3SC 1RP3B 2DJVA 3K79A 2Q9LA 2N05A 1RPOA 2X6BA 1WA8B 3CYOA 4LF9B 2K1EA 4H33A 3C3TA 1P49A 4RQEA 4KFMA 4HBNA 3RYCB 3AG2B 1NJIW 4JI4O 4DV5B 2GHYA 1PM9A 4DYLA 1Q86W 1XEQA 4PDMA 3WG7C 3OMNB 4PDRA 2ADPA 2L35A 1ZSPA 2AZ0A 3CCQV 3ABTA 2WLLA 3GVMA 3HKDA 4P9PA 1RFYA 2DE0X 3OM3B 1E1RG 1WB7A 4DV6B 4HZ3A 2QKCA 4WCEV 2Q4PA 1BHAA 1XHZA 1FFXA 3A8TA 5F2VO 5EIBD 4JI6O 4LWSA 1V55B 4JYCA 2DWDC 5LGNA 1Z5WA 4BW5A 2P90A 1D5AA 4MVRA 1YTFB 3SYPA 4OGQB 5B5EZ 2A7WA 2FYUH 1WNSA 2GUZA 2ZR2A 1NVPB 5IYBO 5EYPB 3ZN0A 4DV4B 3IC7A 4FIPC 3F7YC 1G8MA 1VQPV 5TISZ 3FB5C 3SJQC 3HKCB 1WJZA 2O57A 1I94O 2FL4A 5IYCO 5IYDO 1V55C 3A0RA 5KHKA 3E83A 1Z5VA 5LYJB 3CXHF 3OMIB 1PD3A 1K3EA 3CS5A 1GN6A 4H0LB 4DV0O 4IGGA 1KKCA 5KAFZ 4DR7B 4X62O 5JQGA 3SGIA 4YY3O 2GSMB 2UUAO 1R6NA 4I9WA 4KUMA 1Y76A 1KP3A 4PA7A 3TXQA 1CPYA 1H2LA 2YIAA 4F6EA 1KC8W 1F4MA 1N32B 1OHHG 5LMNB 2XAHA 1YF2A 4MVSA 1OCOB 1DF5A 1MNGA 2WLIB 4G28B 1YJ9V 3ASNB 1HNZO 4ZOLB 3BAAA 4UB8Z 4F6RA 5IJ9A 3N27A 1GO3F 4KXRA 2QE7G 1Q7YW 5IJ0A 5JH7A 3SJAC 3BA8A 4D7SA 4MTXA 2WLNA 4YJ3B 4DW1A 3CMAV 4PELA 5FLXN 4B3RO 2YEVA 4Z1VA 3ZCCA 1PL4A 2ATKC 4FLWA 2VQEO 2Y69B 4CS3A 1TVKA 4X66O 2A0LA 1AR5A 1XOUA 2IW5A 2LP7A 3OAAG 1CP9A 4CS2A 3APOA 4YJ2B 1SZTA 5H2FZ 3ZRSA 4DR5O 2ZNIA 4FFBB 2JDIG 4N23A 3C3SA 1XL4A 1F23A 2DYRC 1YZBA 4LF9O 5EIBC 2UU9O 4OX9B 1BZKA 4UFZA 1R3KC 1Q82W 2P5OA 1I7FA 4LF5O 3CRQA 3OE7G 4R6ZA 2Q73A 1VP7A 3HB3B 2AHZA 1MSWD 3X2QB 1PL0A 1LR1A 2OYQA 3CJHA 3K5LA 3MHSC 3OMAB 2Q5ZA 2UXCB 1SETA 3APQA 1W0JG 1OCZB 1SA0A 4PJ0Z 4CH4A 2F4VB 4NXMB 1N0JA 4EFEA 4X9QA 3OR7C 3T4DA 2KG7A 2LGQA 1XBLA 3CWBH 2EIMB 4KP4A 1P7BA 3LNNA 4C7UA 3D3QA 4X65B 5BR8B 2WPDG 3X2QC 1L0NH 2E5LB 2ZDIA 1N0NA 3T1HO 3VQYA 4ASUG 4A5UB 1W2BU 1OCZC 3ASOB 3L70H 3TJTA 3BEHA 4K35A 3B40A 4U3FH 4LFBO 2DW4A 3EVKA 3E8BA 3K0GA 2QTSA 3U0ZA 4I0XA 4QNHB 2EBOA 5KHIA 1COWG 2R9IA 4JYAB 2PZSA 3FX7A 2V7QG 3UT5B 1G1XB 2H8PC 1XNRO 3T1YB 3JALA 3K5OA 3ZMVA 4BW9A 2EIKC 3D36C 2NR5A 3THOA 3G67A 2YIDA 3W7SA 4JPRA 3IJ4A 3GWKC 4MW3A 1VEWA 5KAIZ 2ZE7A 2P7TC 4BIUA 4AQYB 3RYIB 2DOSA 4F4LA 1ENVA 2W6IG 3QO7A 2UXDO 3OUFA 4DV3B 3QO8A 1X59A 2PGGA 3PJSK 1A32A 3CC7V 1JJOA 1XL6A 2BTQA 2Y4TA 3G6EV 2JEUA 3HR0A 1L0LH 2V4DA 3SPHA 3Q4HB 3JASB 3IAYA 1FAFA 2ITCC 3L71H 3N2GB 4MVMA 2ADQB 1S72V 5BZBA 5L3FA 4NTYA 1S5HC 2ZM6O 1VF6C 2OTJV 5CA1A 1Y66A 4GT1A 4DR4O 1ZUQA 3O65A 5L3EA 3R66A 5J2UB 4UVBA 4RUFA 2Q7EA 4U7OA 1GRJA 2Q7HA 1YHQV 4B3TB 3JATB 1AI6A 3E22A 3BVOA 4ZI7A 3CRMA 3VQVA 4FLUA 4BR6A 2ZE6A 2QTOA 4MTFA 4PHZA 4MTGA 3FKSG 2K9PA 2VWJA 5IT9N 1H8EG 4K8ZA 1JR9A 3A0HZ 2CTRA 5LOVA 3JD2A 4DXWA 1QLEB 5HFLA 1E1QG 1JMKC 1HNXO 2Z5UA 5BMVA 3MHHC 2EX3A 1KP2A 1NS1A 1J95A 4QE7A 3QTCA 1R6TA 2AXTZ 2F4VO 1K33A 4LFCO 1WB8A 3UCSC 1IBKO 3ML0A 1RSOA 1BE3H 1TA8A 4DR6B 1WLEA 5LMUO 2F66C 2PYJA 4TWKA 3VQWA 1H2SB 1YVWA 1ZL8A 4P2ZA 1XMOO 3IGAC 3PN1A 3UM7A 2YIBD 3CC2V 4O2AA 3JD3A 2F43G 1S77D 2E5LO 4UXNA 3DSQA 4LFAB 1HNWB 4GUNA 1J5EO 4TV9B 5C8YB 5KX5A 4HNAB 4QIWF 1DK1A 2GBOA 4IT5A 1GN2A 1SQFA 1PNKA 1XNQB 3KZIZ 3BCCH 4GX2A 4DUZB 4J9ZB 3M7MX 1B3QA 1P4RA 5B1BB 1PPJH 5LHIA 4O2BB 4J7KA 1U97A 2JGDA 3VOUA 4WFAV 2X0LA 3H1KH 3ZMUA 3N2KB 2ZIOA 1DLBA 2DQ0A 1AI4A 1AJPA 3JCUZ 5H6QA 4R8CA 1XUQA 3D8CA 4LF7O 4ICGA 4X1KA 3L9DA 1THZA 1Q81W 1VARA 5FNVB 2QM8A 4DUYO 4J9YB 2EJ7A 2HFEC 1JQ0A 4FFKA 2VWKA 2PUSA 2D2CB 1QNMA 5JVDA 4O4JA 5JJJB 1XI1A 3K59A 1F4NA 5LHHA 2IJHA 4AHCA 4X20A 4XBFA 1GH6A 4GYCB 2RCVA 1YXBA 4WFFA 4YIOA 2C2AA 3FAVB 4J11A 1Q43A 3UKMA 1SQPH 4X1YA 1SZXA 2A06H 1KECA 2DQ3A 2HP8A 2W0FC 1SQGA 2R70A 1NR1A 1R1BA 3J7AU 2WLHA 4B3TO 1R73A 1S5LZ 1FPOA 2KQXA 2LFRA 1B06A 1N36B 4FZ1A 5JCOA 5IWAB 3LDCA 2AW9A 4NXNO 2OIEA 5LP6A 4IHJA 4JI3B 4JV5O 3STZC 1HR0O 2LQTA 1NKDA 2HHHB 1R3IC 4L8JA 5LGTA 2FB5A 1AVMA 5GONA 1EN5A 3HPLC 1FXKB 1M56C 3AK3A 4JZGA 1LUVA 3OT7A 3ZHVA 1ORQC 2IJIA 3B09A 3LSSA 4TUYA 2CTWA 1FJGB 4KHPB 1I5XA 1XILA 1YIJV 1SERA 2UXBB 3ZS8C 2BSKA 4LNUB 3OGCC 4DR6O 4JYYA 4LH7A 4TQFA 1SQBH 3BFRA 4U3JB 1NT2B 3JAKB 1WP8A 3RYCA 1NZ6A 1VMGA 5A9GA 1RPRA 3E89A 1FXKC 4NTXA 1O9GA 3CX5F 5B1AB 4O4LA 5EBMC 5EC1C 3K57A 3ETEA 1MA1A 2IU3A 3RN4A 4I55A 5GTIZ 4JI1O 3DC5A 1BQZA 4GKJB 1XNQO 3FB7C 2PY5A 2UUBB 3SYQA 4PDLA 1Q3EA 2WLLB 1B6QA 1L8DA 2WWWA 2ODMA 3HKDB 3GB7C 1K73W 3ABLB 3ZIAG 2FMLA 1MABG 2EIJB 4X64O 2AGAA 3OTOB 1FFXB 4UVCA 3W7WA 3CSXA 5B1AC 4LC1A 5LXTA 2UUCB 4LWSB 1QBZA 5EYPA 4ZKIA 3UO2A 1JOYA 4OPHA 3RGBA 4HYOA 2QA4V 1BCCH 1H38A 1BQ0A 1N33B 3ZHTA 1N8RW 4DV7O 3WB2A 4K0KO 4JTAB 1GN4A 4UUJC 5H5NA 3ABLC 1KKDA 2EIJC 1VF7A 4QGPA 4DV2B 2ZD9A 1QHTA 4B3MO 3KKYA 3ZRWA 2ZE8A 3E8HA 2IU0A 3J80N 3O9OA 3U10A 1N34O 1N4CA 2OT5A 2HVKC 4DR3O 2JRIA 5EZYA 4QE9A 3OEEG 3FFQA 1V54C 2HKOA 1X4TA 3EFFK 3F7VC 2RJZA 5IDJA 1D2DA 4JAUA 5JQGB 1XMQO 1HP8A 5GTHZ 2RQ6A 1Y76B 4J80A 4ZOLA 1H2GA 2DYRB 3I56V 5E79Z 3JAWA 2NN4A 4I50A 1PV0A 2EZPA 3E35A 2XASA 5J2TB 1JFFB 2QJ1A 3HKBB 4YJ3A 2JGUA 4H13B 3K5MA 4YHHB 4F6RB 5IJ9B 4JI2B 2UXNA 3P3PA 4JYBA 1MMMA 2IM9A 1QLNA 2Q0AA 2ZT9B 2QDOA 4IIJA 4JI7B 2XAJA 4YJ2A 5LL6Y 2A79B 4FFBA 4TQDA 1TVKB 4O4HA 4HAMA 2ZXWB 5FL7G 3E8GA 4P9OA 3JARB 5KMGB 3JD4A 1YJWV 3BRCA 1AR4A 5L3DA 3RWRD 2HR3A 2YDEA 4JI8B 1Q8IA 1WPXA 2Y0PA 4DV5O 2Q0OC 3B77A 1KUQA 4LR3A 2ZINA 1F51A 4TV8B 2ZQMA 1URFA 4FLTA 1TUEB 1TUBA 4GKKB 3WU2Z 4UCTA 1MZEA 4GX5A 1BMFG 2CE4A 5IYZA 4DV6O 1Y4MA 1W0KG 4JI5B 4GKJO 1M1KW 2ZXWC 3CJHB 4FMTA 1K7DA 2CTPA 1H2NA 4NB5A 3L73H 4LF6B 5IE9A 1YEWA 1H2KA 2EIKB 1JPXA 3OTOO 3ZRVA 2CUGA 2OCHA 1AP6A 5LBQA 2XAGA 4DV4O 4CC6A 4MVQA 3CHXA 1L1FA 1FFTB 5CA0A 2MW2B 2LW7A 4Z2WA 5B66Z 1Q90D 3DXRA 2X6CA 3DC6A 1GTOA 1LUWA 4UV9A 5LA6A 2BOCC 3OW2U 4DR2B 2B1GA 4CH6A 4DV2O 3HKEB 1AB3A 4RO2A 4I0XB 3DGEA 1M9NA 5BY1A 2WSSG 5JJNB 2Q68A 1I08A 4DR7O 3H1JH 5H6RA 4DRXB 1AI7A 5K1XA 1R3JC 3JALB 4J41A 5DECA 2P67A 4R50A 1N32O 4FPPA 4EB6A 5LMNO 4FLYA 5ITZB 2ZDIC 4TOIA 1Y74B 2QEXV 1EN6A 1P84F 4B3SB 2FKXA 3H9VA 3MDSA 2BTOA 2D3OW 4EFBA 4J7ZA 2CDYA 3IC9A 4I4TA 2EJRA 4GX1A 3STLC 1G6UA 1S3JA 5EBWC 2XHBA 3DTUB 3ZHQA 2P4KA 1IBMB 3LSQA 2YXYA 1Q6HA 3T2MA 4WBNB 2BTQB 2OCCB 3K04A 3LNMB 2QWNB 4JZ2A 1AR1B 2DMXA 4PDVA 1VQNV 4CS4A 2MK3A 1UFIA 5FPOA 4KL1A 2F93B 5J2UA 1R6KA 1FXHA 4D7TA 1NI8A 2M7WA 3ABKB 2QSAA 3P32A 5CBGA 4I5SA 1VF5B 3JATA 3JD0A 4ZHQA 3I55V 5CA1B 3EXAA 3G71V 1PNLA 1NBMG 3RVZA 4JAVA 4BIOA 3NR7A 2OCCC 4OX9O 1GKFA 1E79G 2Y48A 2QM4A 3E22B 4ZI7B 1VQ6V 2QKAA 4O4IA 2WAMA 3ZEDA 2VQFB 1KD1W 4MTOA 5LOVB 3ABKC 3K0DA 2UXCO 1QQCA 4NKGB 3W7XA 1Q6IA 1JX9A 4UCVA 2LW1A 5BMVB 4NXMO 1K34A 1ZX3A 4UCRA 1VQMV 2F1MA 4IYHA 3SYOA 1AROP 2JJ1G 3CC4V 1RM1B 3BABA 3RYHA 2IH1C 1KU9A 4X1IA 4X65O 5BR8O 3G6BA 5E1AC 4UCUA 4JI0B 4BIZA 4CBCA 1RSOB 1AP5A 3CCMV 3L74H 5EK0A 3ZMSA 4LF4B 2DWEC 1ZL8B 1FXVA 1DGSA 3AG4B 1I5YA 4TV9A 2Q8VA 2YI9A 4XDKA 2IJJA 2RDCA 4JI4B 3QG5A 3CPWU 4O2AB 3F5TA 2IJKA 2ZNJA 1Z2GA 3S3XA 1G4YB 2JJ2G 2W6JG 3AG3C 5A2QN 4JYAO 1RM1C 5KX5B 3QNEA 4K3AA 4BAYA 1XREA 3T1YO 4Z1MG 2IH3C 2B9ZA 4JI6B 2NNUA 3N2KA 3AG4C 4AQYO 3B8NA 2AZ2A 2ZR3A 2XT9A 3JCZA 3FYEB 4PA4A 1AI5A 4DV3O 4QPJA 4JGSA 3H1LH 1GAXA 5KLVH 2JGDB 3RVYA 3RYFA 5FNVA 2XNDG 3CRRA 3QO5A 4PA9A 2P22C 5GW7A 1PNMA 2NLJC 2R9AA 3LDDA 2WLJA 5KA5A 5DEDA 5B1NA 3P30A 1OJHA 5L3BA 1AJNA 1I94B 1GMGA 4O4JB 5JVDB 1QVGU 4DW0A 2YIBA 2Q7GA 3CCLV 5CB4A 4X20B 3ZHRA 4DV0B 4PA6A 5CA3A 4Q6GA 5CN0A 1M56B 2CH7B 2E76B 4X62B 4YY3B 2YICA 2UUAB 4PA3A 2E3CA 1VQ5V 4X1YB 3VBBA 5KUMA 1DF4A 2YI8A 4XDJA 3SDLA 1VQ4V 1FKAO 4CH3A 3UO3A 3SPJA 3WB1A 3ETQA 4PV1B 3E2EA 1B04A 2B1IA 1HNZB 4NVPA 1OZ0A 1K5SA 2JIZG 3FYIB 2HEPA 4J42A 4B7EA 4FM2A 2CK3G 2ETNA 2QM7A 3ZMTA 4JTCB 4IHJB 4B3RB 3CCEV 1NR7A 2VQEB 3K5NA 4LNUA 1CEZA 1WA8A 1NTMH 4H37A 5GONB 4W4KA 2IBZH 1EN4A 1EFRG 2YXHA 1TGOA 4WFGA 3TXSA 2XOKG 2V1DA 4TT3G 4QPKA 4GX0A 4JASA 3CCVV 4TUYB 4DR5B 2W0XA 2YUAA 4I7ZB 4JI0O 3K9SA 4LCUC 2BSKB 2BOBC 4LF8B 2EINC 3AG1B 2H3OA 3W7TA 5JCOC 2Q67A 4LFAO 2UU9B 1HNWO 4LF4O 3CEIA 4LF5B 1EBOA 1M4UA 5LP6C 2ARHA 3TETA 4PI2A 1U96A 3K3WA 2KB1A 1SC5B 4RUEA 4MW8A 3JSNA 5KA6A 1QCEA 3RW0A 1ZTEA 4YXWG 2P06A 4O4LB 4P30A 2CGOA 1KB9F 4DUZO 4I55B 3AK2A 3FB8C 3K06A 1H2MA 3B4SA 4CH5A 2R72A 3AG1C 2QWRB 4DK0A 5JWPA 2LO1A 2UXXA 1TAEA 3K58A 4FK5C 1K5QA 3K08A 2CTQA 1XQ8A 3CCRV 3AG2C 2Z3YA 1V54B 1VIBA 3A0BZ 3JYCA 3OGIB 2GUZB 1WP7A 2X7RB 3T4ZA 4UV8A 1KYOF 3T1HB 3HKCA 5LXTB 3QVNA 1IXBA 2GTAA 4R7CA 1AILA 4LP8A 5LGUA 3T1CA 3AK1A 2QWOB 2WA3A 3LSUA 4LFBB 5LYJA 5KHGA 1IXMA 3ZJZA 3SJBC 3SYCA 2XTAA 4UB6Z 2QWPB 1YI2V 4FJCC 1GM9A 3OD4A 3BPZA 1XNRB 4MVUA 1W59A 1SQXH 3BA9A 1QR8A 4PD4F 1M57B 2HJDA 4CC5A 3E8FA 3M8AA 3ZRWB 2Z0AA 2WLIA 3C90A 4GCZA 2XUMA 5CBFA 5EZYB 3MAQA 3CRCA 1OCRB 3S3WA 1T5EA 4RQFA 5CMUA 1M90W 1D5NA 5EC2C 2UXDB 2Y0IA 5LHGA 1N36O 1GM7A 1F7YA 5KHHA 5K1PA 1HW7A
chains in the Genus database with same CATH topology
2WSSG 2XAQA 4UXNA 1AJQA 2Q68A 2Q69A 4RAIA 1K9MW 3ETDA 4DO2A 5H6RA 1NH2D 1JCHA 3F5WC 4QIWF 2JK5C 1AI7A 1K4CC 3LUTB 3SPCA 3OR6C 1R3JC 1EZJA 5B3SC 2P67A 3K79A 4R50A 1PNKA 5J9PC 2HVJC 1M57C 4FPPA 1RPOA 2X6BA 2ZDIC 3CYOA 2Q6AA 4GX2A 3IFXA 2K1EA 2QEXV 4H33A 2D3OW 3AEIA 2YEVB 4RQEA 4KFMA 4J9ZB 4L87A 1K4DC 2EJRA 4GX1A 1OCRC 1P4RA 3MD0A 3STLC 3AG2B 1NJIW 5EBWC 1S3JA 5B1BB 3DTUB 2GHYA 5LHIA 1Q86W 3LSQA 4PDMA 3WG7C 3T2MA 3VOUA 4WFAV 2X0LA 3OMNB 2OCCB 1OCOC 4PDRA 3ZMUA 3K04A 1DLBA 3LNMB 2DQ0A 3CCQV 5HFMA 3ASNC 1AI4A 2DYSB 3ABTA 5KUKA 1AJPA 2WLLA 5H6QA 4P9PA 3D3IA 4R8CA 1AR1B 4X88A 3OM3B 1S76D 1E1RG 4PDVA 1VQNV 1THZA 2MK3A 4HZ3A 1Q81W 1H8HG 4WCEV 2QM8A 1BHAA 1R6KA 3SPIA 1FXHA 4J9YB 1MG1A 2M7WA 3ABKB 2HFEC 1JQ0A 3P32A 5CBGA 1V55B 4WF9V 4I5SA 4JYCA 2DWDC 5LGNA 4BW5A 3JD0A 3I55V 2P90A 3G71V 2HLDG 2Y69C 1PNLA 4MVRA 1F4NA 1YTFB 5LHHA 3SYPA 1UJWB 1NBMG 3RVZA 2IJHA 4JAVA 3CMEV 2OCCC 2ZR2A 1NVPB 4XBFA 3FB6C 1SRYA 5IYBO 5L3GA 1GKFA 4WFFA 1E79G 3ZN0A 2C2AA 4RO2A 2Y48A 2DYSC 1VQ6V 3IC7A 4FIPC 3SYAA 1YITV 2R9RB 3F7YC 2WAMA 3CXCU 3UKMA 1G8MA 1VQPV 2EILB 1NQTA 1KECA 2DQ3A 3FB5C 4Q20A 1KD1W 3D36A 4MTOA 2W0FC 3SJQC 3ABKC 3K0DA 1NR1A 3W7XA 5IYCO 4ZBMA 5IYDO 1JX9A 1V55C 2WLHA 3A0RA 1NH2B 3BY6A 5EBLC 1R73A 1YSCA 3E83A 5L3CA 1K34A 2LFRA 3B8MA 1YJNV 3OMIB 1PD3A 1K3EA 1VQMV 1HWYA 3EHBB 1LNQA 3SYOA 1AROP 4G2KA 2JJ1G 3LDCA 4MT8A 1RM1B 3CC4V 3ZRXA 2GSMB 2JEXA 5C93A 1R6NA 4I9WA 3STZC 2IH1C 4KUMA 1KP3A 1NKDA 5E1AC 4PA7A 4BIZA 1CPYA 1R3IC 4CBCA 1KC8W 2EILC 1F4MA 5LGTA 1OHHG 2XAHA 4MVSA 3CCMV 1OCOB 3HPLC 1FXKB 5EK0A 2EIMC 1DF5A 3ZMSA 1M56C 2WLIB 2DWEC 4G28B 1FXVA 1ORQC 3AG4B 3E86A 4X8AA 1YJ9V 3ASNB 1I5YA 2IJIA 4XDKA 2IJJA 3LSSA 1I5XA 3G4SV 1YIJV 1SERA 2QKSA 3CPWU 2IJKA 1GO3F 3OGCC 2HJFC 4MVOA 1OCCB 2QE7G 1Q7YW 1MOFA 1G4YB 4MTXA 2JJ2G 2W6JG 2WLNA 3AG3C 4MVZA 3CMAV 1RM1C 3QNEA 4PELA 4BAYA 4LBEC 3ASOC 2YEVA 3ZCCA 2ATKC 4Z1MG 2IH3C 2Y69B 2PI5A 2P6JA 2A0LA 2IW5A 4WFEA 1RPRA 2LP7A 3NXSA 3E89A 1FXKC 3OAAG 5IY5B 1CP9A 2NNUA 5B1AB 2X6AA 5EBMC 5EC1C 4QJFB 3AG4C 1SZTA 3ETEA 3B8NA 2IU3A 2ZR3A 3ZRSA 2HG5C 3JCZA 3FYEB 4PA4A 1AI5A 2JDIG 4N23A 4QPJA 3CCSV 4JGSA 1S0VA 1XL4A 2FTKA 1F23A 2DYRC 3FB7C 1OCCC 3RVYA 2XNDG 1KQSU 1QVFU 1R3KC 3QO5A 3SYQA 5B1OA 1Q82W 4PA9A 1K97A 4PDLA 5GW7A 2WLLB 1B6QA 3LDEA 2WWWA 3OE7G 1PNMA 4R6ZA 3GB7C 1K73W 2NLJC 3ABLB 3HB3B 3ZIAG 2AHZA 1MABG 1MSWD 2EIJB 3LDDA 1PL0A 2WLJA 3X2QB 5KA5A 5B1NA 3MHSC 3OMAB 2EZOA 4UVCA 3P30A 4WFHA 5IY5C 5L3BA 4JTDB 3W7WA 3ZN1A 5B1AC 1AJNA 4LC1A 1QBZA 1SETA 4UVAA 1W0JG 3TK1A 1OCZB 2PI4A 1GMGA 4G27B 4ZKIA 1QVGU 3CCUV 1JOYA 3OR7C 4HYOA 3T4DA 1K92A 2QA4V 3CCLV 3CP1A 4PA6A 2EIMB 5CA3A 5CN0A 1H38A 1M56B 1N8RW 3K9AA 3RBZA 4KP4A 1P7BA 4JTAB 1GK9A 4UUJC 4PA3A 3ABLC 1KKDA 2WPDG 1VQ5V 3VBBA 2EIJC 3X2QC 5KUMA 2ZD9A 4OXSA 1DF4A 2ITDC 4XDJA 3GWOA 1VQ4V 2ZDIA 3ZRWA 5CBHA 3E8HA 3AG3B 2IU0A 3SPJA 1BHBA 4ASUG 2OT5A 2B5UA 1OCZC 2HVKC 1W2BU 3E2EA 3ASOB 2B1IA 3BEHA 1BL8A 1OZ0A 1K5SA 2JIZG 3FYIB 4QE9A 2DW4A 3E8BA 3OEEG 1V54C 3K0GA 2HKOA 4CZZA 1VQ7V 3F7VC 3EFFK 2YSUB 2CK3G 5IDJA 4QNHB 2QM7A 2EBOA 2OTLV 1COWG 2R9IA 3JD1A 4JAUA 3ZMTA 1R3LC 4JTCB 4TSFG 1QLEC 2V7QG 1VQ8V 2H8PC 2LFSA 2A9HA 4MS2A 3CCEV 1H2GA 3ZMVA 1NR7A 2DYRB 3I56V 2EIKC 1CEZA 4H37A 3CD6V 3ABUA 3W7SA 2EZPA 3E35A 4JPRA 2XASA 1EFRG 1SESA 4MW3A 4WFGA 2XOKG 2P7TC 2V1DA 4TT3G 5H9CA 4BIUA 4QPKA 4GX0A 4JASA 1FS0G 3CCVV 4F4LA 1VQKV 3R65A 1ENVA 3ETGA 2W6IG 4EKWA 3QO7A 3OUFA 3QO8A 1ZWIC 4LCUC 2UXNA 3PJSK 2BOBC 3CC7V 2EINC 4JYBA 3AG1B 1VQOV 3OUSA 1XL6A 1QLNA 3W7TA 2Q67A 3G6EV 2JEUA 1EBOA 2XAJA 3TETA 3SPHA 3K3WA 2KB1A 3OEHG 2A79B 4RUEA 2WLMA 2ITCC 4HAMA 4MW8A 3KG2A 4MVMA 2ZXWB 5FL7G 3E8GA 1QCEA 4P9OA 5KA6A 3JD4A 3RW0A 1YJWV 3M99B 5L3DA 4YXWG 2AHYA 4P30A 2HR3A 1S72V 5BZBA 4WFBV 5L3FA 4JF3A 3K06A 3FB8C 1S5HC 1K8AW 1WPXA 2OTJV 3ZMZA 1Y66A 3ABMB 4GT1A 5L3EA 3B77A 3AG1C 4MSWC 1VQ9V 4UVBA 4RUFA 1F51A 2UXXA 2ZQMA 1TUEB 4N21A 3OFNG 4FK5C 4U7OA 1K5QA 3K08A 1YHQV 1AI6A 4GX5A 1VQLV 1BMFG 3CCRV 3AG2C 5B1BC 1Y4MA 1W0KG 2Z3YA 1V54B 2QTOA 4MTFA 3JYCA 1M1KW 4X89A 1JVMA 2ZXWC 4FMTA 4MTGA 3FKSG 2X7RB 1H8EG 3T4ZA 4XDLA 4UV8A 3JD2A 1K7DA 4DXWA 1QLEB 5HFLA 1E1QG 4R7CA 4LP8A 2Z5UA 5LGUA 1QR9A 4E2LA 3T1CA 5DM6V 3MHHC 3ABMC 3W7UA 1IXMA 2EIKB 3ZJZA 1JPXA 5DN6G 3SYCA 1KP2A 1PKXA 3CCJV 3K03A 1J95A 4QE7A 3ZRVA 1YI2V 3H01A 2WLKA 5LBQA 2XAGA 4FJCC 1GM9A 3TCUA 1K33A 4MVQA 4U7NA 2H94A 4MVUA 1L1FA 1DTOA 1FFTB 5B3SB 1QR8A 3ML0A 1ROPA 1GM8A 1M57B 1YTFD 2EINB 1WLEA 3E8FA 3ZRWB 1NVPD 1JJ2U 1FXKA 4TWKA 2WLIA 4GCZA 2X6CA 5CBFA 4P2ZA 3SPGA 3IGAC 1GTOA 3UM7A 3WFVA 4UV9A 1OCRB 4RQFA 2BOCC 5CMUA 3OW2U 5EC2C 1M90W 3CC2V 2XAFA 5LHGA 2B1GA 1GM7A 3JD3A 2F43G 3WG7B 3DGEA 1M9NA 1S77D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMG A;  1RPR A;  1B6Q A;  2IJH A;  1NKD A;  1ROP A;  1RPO A;  2IJI A;  1GTO A;  2IJK A;  4DO2 A;  2IJJ A;  1PD3 A;  3K79 A;  1F4M A;  1F4N A;  2GHY A; 
#chains in the Genus database with same CATH topology
 2JVD A;  2XAQ A;  1AJQ A;  1JA8 A;  2Q69 A;  5IWA O;  4RAI A;  3ETD A;  4DO2 A;  5J2T A;  1JFF A;  1NH2 D;  3HKB A;  3F5W C;  4JI3 O;  3RFR A;  3LUT B;  3OR6 C;  4B08 A;  5JJE B;  5J9P C;  2HHH O;  3WB0 A;  2HVJ C;  1M57 C;  2ZKO A;  3JAW B;  1S5J A;  5IJ0 B;  5JH7 B;  4I50 B;  2Q6A A;  3IFX A;  1SS3 A;  2ZCE A;  1M93 A;  3AEI A;  2YEV B;  4L87 A;  1K4D C;  2BE3 A;  1FJG O;  5AG2 A;  2ZM6 B;  3ZBH A;  1OCR C;  3MD0 A;  1Q5O A;  4KHP O;  2UXB O;  1IX9 A;  4DR4 B;  4BWA A;  3JAR A;  1OCO C;  5KMG A;  4IIJ B;  2EUL A;  5HFM A;  3ASN C;  5KHJ A;  2DYS B;  3KCY A;  5KUK A;  4FM1 A;  3D3I A;  4X88 A;  1S76 D;  4O4H B;  4FLV A;  1GN3 A;  4LF8 O;  3AG7 A;  1H8H G;  4IL6 Z;  2PTM A;  3SPI A;  4FLX A;  4TV8 A;  1MG1 A;  3CE2 A;  1V9P A;  1XHX A;  4WF9 V;  3G80 A;  1HNX B;  3CRA A;  1YDX A;  4EEQ A;  1XDC A;  2HLD G;  2Y69 C;  1UJW B;  3CME V;  2UUB O;  4K8X A;  4LH6 A;  3FB6 C;  3ZX6 A;  1SRY A;  5L3G A;  1TUB B;  1EZV H;  1SA0 B;  2DYS C;  3FD9 A;  3SYA A;  1FD9 A;  2R9R B;  1YIT V;  4LFC B;  3CXC U;  5IYZ B;  1IBL B;  1CXZ B;  2KG7 B;  1IBK B;  2EIL B;  1NQT A;  2F95 B;  5BXZ A;  4Q20 A;  3D36 A;  5LMU B;  1FYJ A;  2UUC O;  4ZBM A;  1NH2 B;  1WN7 A;  1MSD A;  3BY6 A;  5EBL C;  1XMO B;  1YSC A;  5L3C A;  1ZAU A;  3B8M A;  1YJN V;  3H1I H;  1HWY A;  3EHB B;  4AIL C;  1LNQ A;  1N33 O;  4G2K A;  4MT8 A;  3I5D A;  4H44 B;  3ZRX A;  2PF4 E;  3JAM N;  1J5E B;  4AI8 A;  2JEX A;  5C93 A;  3UT5 A;  1SQQ H;  5CA0 B;  3ICX A;  2EIL C;  3HKE A;  2KSD A;  2VRZ A;  2EIM C;  1BS3 A;  3DXR B;  3E86 A;  4X8A A;  2YXL A;  1BGY H;  4DRX A;  3RYI A;  2E75 B;  3U11 A;  5LA6 B;  4DV1 B;  1Q6U A;  3G4S V;  1VF6 A;  2RNB A;  3UQ8 A;  2QKS A;  1QU7 A;  2HJF C;  4MVO A;  1OCC B;  1MOF A;  1ZLZ A;  5ITZ A;  1Y74 A;  1NTK H;  4MVZ A;  2E74 B;  4LBE C;  3ASO C;  3Q4H A;  3JAS A;  4LF7 B;  2PI5 A;  2P6J A;  4EB6 B;  3N2G A;  4WFE A;  3NXS A;  4DUY B;  4WBN A;  5IY5 B;  2X6A A;  4QJF B;  2GDS A;  4I4T B;  2CGN A;  2HG5 C;  4YHH O;  3CCS V;  4ZIB A;  4JI2 O;  1S0V A;  2FTK A;  2F23 A;  2N74 A;  3H1H H;  1OCC C;  1KQS U;  2VS0 A;  2QWQ B;  1QVF U;  5B1O A;  4JI7 O;  1NTZ H;  4DR1 B;  1K97 A;  3LDE A;  2QR4 A;  1IZ3 A;  1KBH A;  2G38 A;  4B7K A;  2YS8 A;  2EZO A;  4WFH A;  5IY5 C;  4JTD B;  3ZN1 A;  4JI8 O;  4UVA A;  3TK1 A;  2PI4 A;  2QGN A;  4G27 B;  4GZR B;  4FM0 A;  4ZHQ B;  2CAZ C;  1NU1 H;  5D5P A;  3CCU V;  1K92 A;  3L72 H;  2JS5 A;  2KKW A;  3CP1 A;  1IVS A;  3CB2 A;  3K9A A;  4GKK O;  3RBZ A;  4NXN B;  4D6T H;  2A3Q A;  4O4I B;  4JV5 B;  1GK9 A;  1HR0 B;  4UCS A;  3A2F A;  4JI5 O;  2RMK B;  4OXS A;  3QF7 A;  2ITD C;  3GWO A;  2RN9 A;  5CBH A;  3AG3 B;  1BHB A;  3J81 N;  2B5U A;  2P4V A;  4JAA A;  2OIG A;  1BL8 A;  4NYK A;  1IBL O;  4LF6 O;  5FPR A;  1VQ7 V;  2M6Y A;  4CZZ A;  2YSU B;  4I9Q A;  3SR2 C;  2OTL V;  3JD1 A;  1R3L C;  4TSF G;  1QLE C;  5C8Y A;  1VQ8 V;  3RYH B;  4HNA A;  2LFS A;  3SJC C;  2A9H A;  4X1I B;  1M5I A;  4MS2 A;  5D5Q A;  1PP9 H;  2YC0 A;  2PYL A;  3KCX A;  3ZHS A;  4ABM A;  3CD6 V;  3ABU A;  1BT8 A;  1SES A;  3BHP A;  5H9C A;  1FS0 G;  1VQK V;  2GV9 A;  3R65 A;  3ETG A;  4JI1 B;  4EKW A;  4DR2 O;  1ZWI C;  2WA4 A;  1KMI Z;  3VQX A;  1HDJ A;  4O2B A;  1VQO V;  3OUS A;  4NTW A;  4W4L A;  4J7J A;  3L75 H;  4RWU A;  1OV9 A;  4DV1 O;  1IDS A;  3OEH G;  4UCO A;  2WLM A;  2Y4U A;  3KG2 A;  4X64 B;  1Y6X A;  3M99 B;  4B3S O;  2AHY A;  1WAZ A;  4WFB V;  1SKV A;  4JF3 A;  2LGW A;  1EM1 A;  4X1K B;  1K8A W;  3ZMZ A;  3ABM B;  1IBM O;  2BCC H;  1SF9 A;  4NR1 A;  2N04 A;  4MSW C;  3RYF B;  1VQ9 V;  4PI0 A;  4N21 A;  2DN9 A;  3OFN G;  4DV7 B;  3FAV A;  2ZE5 A;  4K0K B;  1VQL V;  2LJ2 A;  3B2E E;  5B1B C;  4X89 A;  1JVM A;  4IYI A;  1UPG A;  4E4E A;  4B3M B;  4XDL A;  3TGU H;  1YCI A;  4DR1 O;  2CH7 A;  1N34 B;  1Y67 A;  1IUR A;  4DR3 B;  4J10 A;  4DK1 A;  1QR9 A;  3ZHU A;  4E2L A;  5DM6 V;  3ABM C;  1WPB A;  2JS3 A;  2GTS A;  1O9H A;  3P3N A;  3W7U A;  4GLX A;  5CB4 B;  5DN6 G;  3CCJ V;  1PKX A;  3K03 A;  4FLZ A;  3H01 A;  2WLK A;  1XMQ B;  1P7G A;  3TCU A;  1MZF A;  4U7N A;  1BSM A;  2H94 A;  1DTO A;  2VQF O;  5B3S B;  3JSL A;  1ROP A;  1GM8 A;  1YTF D;  2EIN B;  1NVP D;  1JJ2 U;  2ZIM A;  1FXK A;  3OTF A;  4FZ0 A;  5LP6 B;  4YIP A;  3SPG A;  4FVM A;  3WFV A;  2XAF A;  4X66 B;  3RT3 C;  3WG7 B;  1K9M W;  1I0H A;  2ILM A;  1JCH A;  1SQV H;  4OPA A;  4U3J A;  2JK5 C;  1K4C C;  2L6L A;  2OWO A;  3JAK A;  3SPC A;  1US6 A;  1EZJ A;  5B3S C;  1RP3 B;  2DJV A;  3K79 A;  2Q9L A;  2N05 A;  1RPO A;  2X6B A;  1WA8 B;  3CYO A;  4LF9 B;  2K1E A;  4H33 A;  3C3T A;  1P49 A;  4RQE A;  4KFM A;  4HBN A;  3RYC B;  3AG2 B;  1NJI W;  4JI4 O;  4DV5 B;  2GHY A;  1PM9 A;  4DYL A;  1Q86 W;  1XEQ A;  4PDM A;  3WG7 C;  3OMN B;  4PDR A;  2ADP A;  2L35 A;  1ZSP A;  2AZ0 A;  3CCQ V;  3ABT A;  2WLL A;  3GVM A;  3HKD A;  4P9P A;  1RFY A;  2DE0 X;  3OM3 B;  1E1R G;  1WB7 A;  4DV6 B;  4HZ3 A;  2QKC A;  4WCE V;  2Q4P A;  1BHA A;  1XHZ A;  1FFX A;  3A8T A;  5F2V O;  5EIB D;  4JI6 O;  4LWS A;  1V55 B;  4JYC A;  2DWD C;  5LGN A;  1Z5W A;  4BW5 A;  2P90 A;  1D5A A;  4MVR A;  1YTF B;  3SYP A;  4OGQ B;  5B5E Z;  2A7W A;  2FYU H;  1WNS A;  2GUZ A;  2ZR2 A;  1NVP B;  5IYB O;  5EYP B;  3ZN0 A;  4DV4 B;  3IC7 A;  4FIP C;  3F7Y C;  1G8M A;  1VQP V;  5TIS Z;  3FB5 C;  3SJQ C;  3HKC B;  1WJZ A;  2O57 A;  1I94 O;  2FL4 A;  5IYC O;  5IYD O;  1V55 C;  3A0R A;  5KHK A;  3E83 A;  1Z5V A;  5LYJ B;  3CXH F;  3OMI B;  1PD3 A;  1K3E A;  3CS5 A;  1GN6 A;  4H0L B;  4DV0 O;  4IGG A;  1KKC A;  5KAF Z;  4DR7 B;  4X62 O;  5JQG A;  3SGI A;  4YY3 O;  2GSM B;  2UUA O;  1R6N A;  4I9W A;  4KUM A;  1Y76 A;  1KP3 A;  4PA7 A;  3TXQ A;  1CPY A;  1H2L A;  2YIA A;  4F6E A;  1KC8 W;  1F4M A;  1N32 B;  1OHH G;  5LMN B;  2XAH A;  1YF2 A;  4MVS A;  1OCO B;  1DF5 A;  1MNG A;  2WLI B;  4G28 B;  1YJ9 V;  3ASN B;  1HNZ O;  4ZOL B;  3BAA A;  4UB8 Z;  4F6R A;  5IJ9 A;  3N27 A;  1GO3 F;  4KXR A;  2QE7 G;  1Q7Y W;  5IJ0 A;  5JH7 A;  3SJA C;  3BA8 A;  4D7S A;  4MTX A;  2WLN A;  4YJ3 B;  4DW1 A;  3CMA V;  4PEL A;  5FLX N;  4B3R O;  2YEV A;  4Z1V A;  3ZCC A;  1PL4 A;  2ATK C;  4FLW A;  2VQE O;  2Y69 B;  4CS3 A;  1TVK A;  4X66 O;  2A0L A;  1AR5 A;  1XOU A;  2IW5 A;  2LP7 A;  3OAA G;  1CP9 A;  4CS2 A;  3APO A;  4YJ2 B;  1SZT A;  5H2F Z;  3ZRS A;  4DR5 O;  2ZNI A;  4FFB B;  2JDI G;  4N23 A;  3C3S A;  1XL4 A;  1F23 A;  2DYR C;  1YZB A;  4LF9 O;  5EIB C;  2UU9 O;  4OX9 B;  1BZK A;  4UFZ A;  1R3K C;  1Q82 W;  2P5O A;  1I7F A;  4LF5 O;  3CRQ A;  3OE7 G;  4R6Z A;  2Q73 A;  1VP7 A;  3HB3 B;  2AHZ A;  1MSW D;  3X2Q B;  1PL0 A;  1LR1 A;  2OYQ A;  3CJH A;  3K5L A;  3MHS C;  3OMA B;  2Q5Z A;  2UXC B;  1SET A;  3APQ A;  1W0J G;  1OCZ B;  1SA0 A;  4PJ0 Z;  4CH4 A;  2F4V B;  4NXM B;  1N0J A;  4EFE A;  4X9Q A;  3OR7 C;  3T4D A;  2KG7 A;  2LGQ A;  1XBL A;  3CWB H;  2EIM B;  4KP4 A;  1P7B A;  3LNN A;  4C7U A;  3D3Q A;  4X65 B;  5BR8 B;  2WPD G;  3X2Q C;  1L0N H;  2E5L B;  2ZDI A;  1N0N A;  3T1H O;  3VQY A;  4ASU G;  4A5U B;  1W2B U;  1OCZ C;  3ASO B;  3L70 H;  3TJT A;  3BEH A;  4K35 A;  3B40 A;  4U3F H;  4LFB O;  2DW4 A;  3EVK A;  3E8B A;  3K0G A;  2QTS A;  3U0Z A;  4I0X A;  4QNH B;  2EBO A;  5KHI A;  1COW G;  2R9I A;  4JYA B;  2PZS A;  3FX7 A;  2V7Q G;  3UT5 B;  1G1X B;  2H8P C;  1XNR O;  3T1Y B;  3JAL A;  3K5O A;  3ZMV A;  4BW9 A;  2EIK C;  3D36 C;  2NR5 A;  3THO A;  3G67 A;  2YID A;  3W7S A;  4JPR A;  3IJ4 A;  3GWK C;  4MW3 A;  1VEW A;  5KAI Z;  2ZE7 A;  2P7T C;  4BIU A;  4AQY B;  3RYI B;  2DOS A;  4F4L A;  1ENV A;  2W6I G;  3QO7 A;  2UXD O;  3OUF A;  4DV3 B;  3QO8 A;  1X59 A;  2PGG A;  3PJS K;  1A32 A;  3CC7 V;  1JJO A;  1XL6 A;  2BTQ A;  2Y4T A;  3G6E V;  2JEU A;  3HR0 A;  1L0L H;  2V4D A;  3SPH A;  3Q4H B;  3JAS B;  3IAY A;  1FAF A;  2ITC C;  3L71 H;  3N2G B;  4MVM A;  2ADQ B;  1S72 V;  5BZB A;  5L3F A;  4NTY A;  1S5H C;  2ZM6 O;  1VF6 C;  2OTJ V;  5CA1 A;  1Y66 A;  4GT1 A;  4DR4 O;  1ZUQ A;  3O65 A;  5L3E A;  3R66 A;  5J2U B;  4UVB A;  4RUF A;  2Q7E A;  4U7O A;  1GRJ A;  2Q7H A;  1YHQ V;  4B3T B;  3JAT B;  1AI6 A;  3E22 A;  3BVO A;  4ZI7 A;  3CRM A;  3VQV A;  4FLU A;  4BR6 A;  2ZE6 A;  2QTO A;  4MTF A;  4PHZ A;  4MTG A;  3FKS G;  2K9P A;  2VWJ A;  5IT9 N;  1H8E G;  4K8Z A;  1JR9 A;  3A0H Z;  2CTR A;  5LOV A;  3JD2 A;  4DXW A;  1QLE B;  5HFL A;  1E1Q G;  1JMK C;  1HNX O;  2Z5U A;  5BMV A;  3MHH C;  2EX3 A;  1KP2 A;  1NS1 A;  1J95 A;  4QE7 A;  3QTC A;  1R6T A;  2AXT Z;  2F4V O;  1K33 A;  4LFC O;  1WB8 A;  3UCS C;  1IBK O;  3ML0 A;  1RSO A;  1BE3 H;  1TA8 A;  4DR6 B;  1WLE A;  5LMU O;  2F66 C;  2PYJ A;  4TWK A;  3VQW A;  1H2S B;  1YVW A;  1ZL8 A;  4P2Z A;  1XMO O;  3IGA C;  3PN1 A;  3UM7 A;  2YIB D;  3CC2 V;  4O2A A;  3JD3 A;  2F43 G;  1S77 D;  2E5L O;  4UXN A;  3DSQ A;  4LFA B;  1HNW B;  4GUN A;  1J5E O;  4TV9 B;  5C8Y B;  5KX5 A;  4HNA B;  4QIW F;  1DK1 A;  2GBO A;  4IT5 A;  1GN2 A;  1SQF A;  1PNK A;  1XNQ B;  3KZI Z;  3BCC H;  4GX2 A;  4DUZ B;  4J9Z B;  3M7M X;  1B3Q A;  1P4R A;  5B1B B;  1PPJ H;  5LHI A;  4O2B B;  4J7K A;  1U97 A;  2JGD A;  3VOU A;  4WFA V;  2X0L A;  3H1K H;  3ZMU A;  3N2K B;  2ZIO A;  1DLB A;  2DQ0 A;  1AI4 A;  1AJP A;  3JCU Z;  5H6Q A;  4R8C A;  1XUQ A;  3D8C A;  4LF7 O;  4ICG A;  4X1K A;  3L9D A;  1THZ A;  1Q81 W;  1VAR A;  5FNV B;  2QM8 A;  4DUY O;  4J9Y B;  2EJ7 A;  2HFE C;  1JQ0 A;  4FFK A;  2VWK A;  2PUS A;  2D2C B;  1QNM A;  5JVD A;  4O4J A;  5JJJ B;  1XI1 A;  3K59 A;  1F4N A;  5LHH A;  2IJH A;  4AHC A;  4X20 A;  4XBF A;  1GH6 A;  4GYC B;  2RCV A;  1YXB A;  4WFF A;  4YIO A;  2C2A A;  3FAV B;  4J11 A;  1Q43 A;  3UKM A;  1SQP H;  4X1Y A;  1SZX A;  2A06 H;  1KEC A;  2DQ3 A;  2HP8 A;  2W0F C;  1SQG A;  2R70 A;  1NR1 A;  1R1B A;  3J7A U;  2WLH A;  4B3T O;  1R73 A;  1S5L Z;  1FPO A;  2KQX A;  2LFR A;  1B06 A;  1N36 B;  4FZ1 A;  5JCO A;  5IWA B;  3LDC A;  2AW9 A;  4NXN O;  2OIE A;  5LP6 A;  4IHJ A;  4JI3 B;  4JV5 O;  3STZ C;  1HR0 O;  2LQT A;  1NKD A;  2HHH B;  1R3I C;  4L8J A;  5LGT A;  2FB5 A;  1AVM A;  5GON A;  1EN5 A;  3HPL C;  1FXK B;  1M56 C;  3AK3 A;  4JZG A;  1LUV A;  3OT7 A;  3ZHV A;  1ORQ C;  2IJI A;  3B09 A;  3LSS A;  4TUY A;  2CTW A;  1FJG B;  4KHP B;  1I5X A;  1XIL A;  1YIJ V;  1SER A;  2UXB B;  3ZS8 C;  2BSK A;  4LNU B;  3OGC C;  4DR6 O;  4JYY A;  4LH7 A;  4TQF A;  1SQB H;  3BFR A;  4U3J B;  1NT2 B;  3JAK B;  1WP8 A;  3RYC A;  1NZ6 A;  1VMG A;  5A9G A;  1RPR A;  3E89 A;  1FXK C;  4NTX A;  1O9G A;  3CX5 F;  5B1A B;  4O4L A;  5EBM C;  5EC1 C;  3K57 A;  3ETE A;  1MA1 A;  2IU3 A;  3RN4 A;  4I55 A;  5GTI Z;  4JI1 O;  3DC5 A;  1BQZ A;  4GKJ B;  1XNQ O;  3FB7 C;  2PY5 A;  2UUB B;  3SYQ A;  4PDL A;  1Q3E A;  2WLL B;  1B6Q A;  1L8D A;  2WWW A;  2ODM A;  3HKD B;  3GB7 C;  1K73 W;  3ABL B;  3ZIA G;  2FML A;  1MAB G;  2EIJ B;  4X64 O;  2AGA A;  3OTO B;  1FFX B;  4UVC A;  3W7W A;  3CSX A;  5B1A C;  4LC1 A;  5LXT A;  2UUC B;  4LWS B;  1QBZ A;  5EYP A;  4ZKI A;  3UO2 A;  1JOY A;  4OPH A;  3RGB A;  4HYO A;  2QA4 V;  1BCC H;  1H38 A;  1BQ0 A;  1N33 B;  3ZHT A;  1N8R W;  4DV7 O;  3WB2 A;  4K0K O;  4JTA B;  1GN4 A;  4UUJ C;  5H5N A;  3ABL C;  1KKD A;  2EIJ C;  1VF7 A;  4QGP A;  4DV2 B;  2ZD9 A;  1QHT A;  4B3M O;  3KKY A;  3ZRW A;  2ZE8 A;  3E8H A;  2IU0 A;  3J80 N;  3O9O A;  3U10 A;  1N34 O;  1N4C A;  2OT5 A;  2HVK C;  4DR3 O;  2JRI A;  5EZY A;  4QE9 A;  3OEE G;  3FFQ A;  1V54 C;  2HKO A;  1X4T A;  3EFF K;  3F7V C;  2RJZ A;  5IDJ A;  1D2D A;  4JAU A;  5JQG B;  1XMQ O;  1HP8 A;  5GTH Z;  2RQ6 A;  1Y76 B;  4J80 A;  4ZOL A;  1H2G A;  2DYR B;  3I56 V;  5E79 Z;  3JAW A;  2NN4 A;  4I50 A;  1PV0 A;  2EZP A;  3E35 A;  2XAS A;  5J2T B;  1JFF B;  2QJ1 A;  3HKB B;  4YJ3 A;  2JGU A;  4H13 B;  3K5M A;  4YHH B;  4F6R B;  5IJ9 B;  4JI2 B;  2UXN A;  3P3P A;  4JYB A;  1MMM A;  2IM9 A;  1QLN A;  2Q0A A;  2ZT9 B;  2QDO A;  4IIJ A;  4JI7 B;  2XAJ A;  4YJ2 A;  5LL6 Y;  2A79 B;  4FFB A;  4TQD A;  1TVK B;  4O4H A;  4HAM A;  2ZXW B;  5FL7 G;  3E8G A;  4P9O A;  3JAR B;  5KMG B;  3JD4 A;  1YJW V;  3BRC A;  1AR4 A;  5L3D A;  3RWR D;  2HR3 A;  2YDE A;  4JI8 B;  1Q8I A;  1WPX A;  2Y0P A;  4DV5 O;  2Q0O C;  3B77 A;  1KUQ A;  4LR3 A;  2ZIN A;  1F51 A;  4TV8 B;  2ZQM A;  1URF A;  4FLT A;  1TUE B;  1TUB A;  4GKK B;  3WU2 Z;  4UCT A;  1MZE A;  4GX5 A;  1BMF G;  2CE4 A;  5IYZ A;  4DV6 O;  1Y4M A;  1W0K G;  4JI5 B;  4GKJ O;  1M1K W;  2ZXW C;  3CJH B;  4FMT A;  1K7D A;  2CTP A;  1H2N A;  4NB5 A;  3L73 H;  4LF6 B;  5IE9 A;  1YEW A;  1H2K A;  2EIK B;  1JPX A;  3OTO O;  3ZRV A;  2CUG A;  2OCH A;  1AP6 A;  5LBQ A;  2XAG A;  4DV4 O;  4CC6 A;  4MVQ A;  3CHX A;  1L1F A;  1FFT B;  5CA0 A;  2MW2 B;  2LW7 A;  4Z2W A;  5B66 Z;  1Q90 D;  3DXR A;  2X6C A;  3DC6 A;  1GTO A;  1LUW A;  4UV9 A;  5LA6 A;  2BOC C;  3OW2 U;  4DR2 B;  2B1G A;  4CH6 A;  4DV2 O;  3HKE B;  1AB3 A;  4RO2 A;  4I0X B;  3DGE A;  1M9N A;  5BY1 A;  2WSS G;  5JJN B;  2Q68 A;  1I08 A;  4DR7 O;  3H1J H;  5H6R A;  4DRX B;  1AI7 A;  5K1X A;  1R3J C;  3JAL B;  4J41 A;  5DEC A;  2P67 A;  4R50 A;  1N32 O;  4FPP A;  4EB6 A;  5LMN O;  4FLY A;  5ITZ B;  2ZDI C;  4TOI A;  1Y74 B;  2QEX V;  1EN6 A;  1P84 F;  4B3S B;  2FKX A;  3H9V A;  3MDS A;  2BTO A;  2D3O W;  4EFB A;  4J7Z A;  2CDY A;  3IC9 A;  4I4T A;  2EJR A;  4GX1 A;  3STL C;  1G6U A;  1S3J A;  5EBW C;  2XHB A;  3DTU B;  3ZHQ A;  2P4K A;  1IBM B;  3LSQ A;  2YXY A;  1Q6H A;  3T2M A;  4WBN B;  2BTQ B;  2OCC B;  3K04 A;  3LNM B;  2QWN B;  4JZ2 A;  1AR1 B;  2DMX A;  4PDV A;  1VQN V;  4CS4 A;  2MK3 A;  1UFI A;  5FPO A;  4KL1 A;  2F93 B;  5J2U A;  1R6K A;  1FXH A;  4D7T A;  1NI8 A;  2M7W A;  3ABK B;  2QSA A;  3P32 A;  5CBG A;  4I5S A;  1VF5 B;  3JAT A;  3JD0 A;  4ZHQ A;  3I55 V;  5CA1 B;  3EXA A;  3G71 V;  1PNL A;  1NBM G;  3RVZ A;  4JAV A;  4BIO A;  3NR7 A;  2OCC C;  4OX9 O;  1GKF A;  1E79 G;  2Y48 A;  2QM4 A;  3E22 B;  4ZI7 B;  1VQ6 V;  2QKA A;  4O4I A;  2WAM A;  3ZED A;  2VQF B;  1KD1 W;  4MTO A;  5LOV B;  3ABK C;  3K0D A;  2UXC O;  1QQC A;  4NKG B;  3W7X A;  1Q6I A;  1JX9 A;  4UCV A;  2LW1 A;  5BMV B;  4NXM O;  1K34 A;  1ZX3 A;  4UCR A;  1VQM V;  2F1M A;  4IYH A;  3SYO A;  1ARO P;  2JJ1 G;  3CC4 V;  1RM1 B;  3BAB A;  3RYH A;  2IH1 C;  1KU9 A;  4X1I A;  4X65 O;  5BR8 O;  3G6B A;  5E1A C;  4UCU A;  4JI0 B;  4BIZ A;  4CBC A;  1RSO B;  1AP5 A;  3CCM V;  3L74 H;  5EK0 A;  3ZMS A;  4LF4 B;  2DWE C;  1ZL8 B;  1FXV A;  1DGS A;  3AG4 B;  1I5Y A;  4TV9 A;  2Q8V A;  2YI9 A;  4XDK A;  2IJJ A;  2RDC A;  4JI4 B;  3QG5 A;  3CPW U;  4O2A B;  3F5T A;  2IJK A;  2ZNJ A;  1Z2G A;  3S3X A;  1G4Y B;  2JJ2 G;  2W6J G;  3AG3 C;  5A2Q N;  4JYA O;  1RM1 C;  5KX5 B;  3QNE A;  4K3A A;  4BAY A;  1XRE A;  3T1Y O;  4Z1M G;  2IH3 C;  2B9Z A;  4JI6 B;  2NNU A;  3N2K A;  3AG4 C;  4AQY O;  3B8N A;  2AZ2 A;  2ZR3 A;  2XT9 A;  3JCZ A;  3FYE B;  4PA4 A;  1AI5 A;  4DV3 O;  4QPJ A;  4JGS A;  3H1L H;  1GAX A;  5KLV H;  2JGD B;  3RVY A;  3RYF A;  5FNV A;  2XND G;  3CRR A;  3QO5 A;  4PA9 A;  2P22 C;  5GW7 A;  1PNM A;  2NLJ C;  2R9A A;  3LDD A;  2WLJ A;  5KA5 A;  5DED A;  5B1N A;  3P30 A;  1OJH A;  5L3B A;  1AJN A;  1I94 B;  1GMG A;  4O4J B;  5JVD B;  1QVG U;  4DW0 A;  2YIB A;  2Q7G A;  3CCL V;  5CB4 A;  4X20 B;  3ZHR A;  4DV0 B;  4PA6 A;  5CA3 A;  4Q6G A;  5CN0 A;  1M56 B;  2CH7 B;  2E76 B;  4X62 B;  4YY3 B;  2YIC A;  2UUA B;  4PA3 A;  2E3C A;  1VQ5 V;  4X1Y B;  3VBB A;  5KUM A;  1DF4 A;  2YI8 A;  4XDJ A;  3SDL A;  1VQ4 V;  1FKA O;  4CH3 A;  3UO3 A;  3SPJ A;  3WB1 A;  3ETQ A;  4PV1 B;  3E2E A;  1B04 A;  2B1I A;  1HNZ B;  4NVP A;  1OZ0 A;  1K5S A;  2JIZ G;  3FYI B;  2HEP A;  4J42 A;  4B7E A;  4FM2 A;  2CK3 G;  2ETN A;  2QM7 A;  3ZMT A;  4JTC B;  4IHJ B;  4B3R B;  3CCE V;  1NR7 A;  2VQE B;  3K5N A;  4LNU A;  1CEZ A;  1WA8 A;  1NTM H;  4H37 A;  5GON B;  4W4K A;  2IBZ H;  1EN4 A;  1EFR G;  2YXH A;  1TGO A;  4WFG A;  3TXS A;  2XOK G;  2V1D A;  4TT3 G;  4QPK A;  4GX0 A;  4JAS A;  3CCV V;  4TUY B;  4DR5 B;  2W0X A;  2YUA A;  4I7Z B;  4JI0 O;  3K9S A;  4LCU C;  2BSK B;  2BOB C;  4LF8 B;  2EIN C;  3AG1 B;  2H3O A;  3W7T A;  5JCO C;  2Q67 A;  4LFA O;  2UU9 B;  1HNW O;  4LF4 O;  3CEI A;  4LF5 B;  1EBO A;  1M4U A;  5LP6 C;  2ARH A;  3TET A;  4PI2 A;  1U96 A;  3K3W A;  2KB1 A;  1SC5 B;  4RUE A;  4MW8 A;  3JSN A;  5KA6 A;  1QCE A;  3RW0 A;  1ZTE A;  4YXW G;  2P06 A;  4O4L B;  4P30 A;  2CGO A;  1KB9 F;  4DUZ O;  4I55 B;  3AK2 A;  3FB8 C;  3K06 A;  1H2M A;  3B4S A;  4CH5 A;  2R72 A;  3AG1 C;  2QWR B;  4DK0 A;  5JWP A;  2LO1 A;  2UXX A;  1TAE A;  3K58 A;  4FK5 C;  1K5Q A;  3K08 A;  2CTQ A;  1XQ8 A;  3CCR V;  3AG2 C;  2Z3Y A;  1V54 B;  1VIB A;  3A0B Z;  3JYC A;  3OGI B;  2GUZ B;  1WP7 A;  2X7R B;  3T4Z A;  4UV8 A;  1KYO F;  3T1H B;  3HKC A;  5LXT B;  3QVN A;  1IXB A;  2GTA A;  4R7C A;  1AIL A;  4LP8 A;  5LGU A;  3T1C A;  3AK1 A;  2QWO B;  2WA3 A;  3LSU A;  4LFB B;  5LYJ A;  5KHG A;  1IXM A;  3ZJZ A;  3SJB C;  3SYC A;  2XTA A;  4UB6 Z;  2QWP B;  1YI2 V;  4FJC C;  1GM9 A;  3OD4 A;  3BPZ A;  1XNR B;  4MVU A;  1W59 A;  1SQX H;  3BA9 A;  1QR8 A;  4PD4 F;  1M57 B;  2HJD A;  4CC5 A;  3E8F A;  3M8A A;  3ZRW B;  2Z0A A;  2WLI A;  3C90 A;  4GCZ A;  2XUM A;  5CBF A;  5EZY B;  3MAQ A;  3CRC A;  1OCR B;  3S3W A;  1T5E A;  4RQF A;  5CMU A;  1M90 W;  1D5N A;  5EC2 C;  2UXD B;  2Y0I A;  5LHG A;  1N36 O;  1GM7 A;  1F7Y A;  5KHH A;  5K1P A;  1HW7 A; 
#chains in the Genus database with same CATH homology
 2WSS G;  2XAQ A;  4UXN A;  1AJQ A;  2Q68 A;  2Q69 A;  4RAI A;  1K9M W;  3ETD A;  4DO2 A;  5H6R A;  1NH2 D;  1JCH A;  3F5W C;  4QIW F;  2JK5 C;  1AI7 A;  1K4C C;  3LUT B;  3SPC A;  3OR6 C;  1R3J C;  1EZJ A;  5B3S C;  2P67 A;  3K79 A;  4R50 A;  1PNK A;  5J9P C;  2HVJ C;  1M57 C;  4FPP A;  1RPO A;  2X6B A;  2ZDI C;  3CYO A;  2Q6A A;  4GX2 A;  3IFX A;  2K1E A;  2QEX V;  4H33 A;  2D3O W;  3AEI A;  2YEV B;  4RQE A;  4KFM A;  4J9Z B;  4L87 A;  1K4D C;  2EJR A;  4GX1 A;  1OCR C;  1P4R A;  3MD0 A;  3STL C;  3AG2 B;  1NJI W;  5EBW C;  1S3J A;  5B1B B;  3DTU B;  2GHY A;  5LHI A;  1Q86 W;  3LSQ A;  4PDM A;  3WG7 C;  3T2M A;  3VOU A;  4WFA V;  2X0L A;  3OMN B;  2OCC B;  1OCO C;  4PDR A;  3ZMU A;  3K04 A;  1DLB A;  3LNM B;  2DQ0 A;  3CCQ V;  5HFM A;  3ASN C;  1AI4 A;  2DYS B;  3ABT A;  5KUK A;  1AJP A;  2WLL A;  5H6Q A;  4P9P A;  3D3I A;  4R8C A;  1AR1 B;  4X88 A;  3OM3 B;  1S76 D;  1E1R G;  4PDV A;  1VQN V;  1THZ A;  2MK3 A;  4HZ3 A;  1Q81 W;  1H8H G;  4WCE V;  2QM8 A;  1BHA A;  1R6K A;  3SPI A;  1FXH A;  4J9Y B;  1MG1 A;  2M7W A;  3ABK B;  2HFE C;  1JQ0 A;  3P32 A;  5CBG A;  1V55 B;  4WF9 V;  4I5S A;  4JYC A;  2DWD C;  5LGN A;  4BW5 A;  3JD0 A;  3I55 V;  2P90 A;  3G71 V;  2HLD G;  2Y69 C;  1PNL A;  4MVR A;  1F4N A;  1YTF B;  5LHH A;  3SYP A;  1UJW B;  1NBM G;  3RVZ A;  2IJH A;  4JAV A;  3CME V;  2OCC C;  2ZR2 A;  1NVP B;  4XBF A;  3FB6 C;  1SRY A;  5IYB O;  5L3G A;  1GKF A;  4WFF A;  1E79 G;  3ZN0 A;  2C2A A;  4RO2 A;  2Y48 A;  2DYS C;  1VQ6 V;  3IC7 A;  4FIP C;  3SYA A;  1YIT V;  2R9R B;  3F7Y C;  2WAM A;  3CXC U;  3UKM A;  1G8M A;  1VQP V;  2EIL B;  1NQT A;  1KEC A;  2DQ3 A;  3FB5 C;  4Q20 A;  1KD1 W;  3D36 A;  4MTO A;  2W0F C;  3SJQ C;  3ABK C;  3K0D A;  1NR1 A;  3W7X A;  5IYC O;  4ZBM A;  5IYD O;  1JX9 A;  1V55 C;  2WLH A;  3A0R A;  1NH2 B;  3BY6 A;  5EBL C;  1R73 A;  1YSC A;  3E83 A;  5L3C A;  1K34 A;  2LFR A;  3B8M A;  1YJN V;  3OMI B;  1PD3 A;  1K3E A;  1VQM V;  1HWY A;  3EHB B;  1LNQ A;  3SYO A;  1ARO P;  4G2K A;  2JJ1 G;  3LDC A;  4MT8 A;  1RM1 B;  3CC4 V;  3ZRX A;  2GSM B;  2JEX A;  5C93 A;  1R6N A;  4I9W A;  3STZ C;  2IH1 C;  4KUM A;  1KP3 A;  1NKD A;  5E1A C;  4PA7 A;  4BIZ A;  1CPY A;  1R3I C;  4CBC A;  1KC8 W;  2EIL C;  1F4M A;  5LGT A;  1OHH G;  2XAH A;  4MVS A;  3CCM V;  1OCO B;  3HPL C;  1FXK B;  5EK0 A;  2EIM C;  1DF5 A;  3ZMS A;  1M56 C;  2WLI B;  2DWE C;  4G28 B;  1FXV A;  1ORQ C;  3AG4 B;  3E86 A;  4X8A A;  1YJ9 V;  3ASN B;  1I5Y A;  2IJI A;  4XDK A;  2IJJ A;  3LSS A;  1I5X A;  3G4S V;  1YIJ V;  1SER A;  2QKS A;  3CPW U;  2IJK A;  1GO3 F;  3OGC C;  2HJF C;  4MVO A;  1OCC B;  2QE7 G;  1Q7Y W;  1MOF A;  1G4Y B;  4MTX A;  2JJ2 G;  2W6J G;  2WLN A;  3AG3 C;  4MVZ A;  3CMA V;  1RM1 C;  3QNE A;  4PEL A;  4BAY A;  4LBE C;  3ASO C;  2YEV A;  3ZCC A;  2ATK C;  4Z1M G;  2IH3 C;  2Y69 B;  2PI5 A;  2P6J A;  2A0L A;  2IW5 A;  4WFE A;  1RPR A;  2LP7 A;  3NXS A;  3E89 A;  1FXK C;  3OAA G;  5IY5 B;  1CP9 A;  2NNU A;  5B1A B;  2X6A A;  5EBM C;  5EC1 C;  4QJF B;  3AG4 C;  1SZT A;  3ETE A;  3B8N A;  2IU3 A;  2ZR3 A;  3ZRS A;  2HG5 C;  3JCZ A;  3FYE B;  4PA4 A;  1AI5 A;  2JDI G;  4N23 A;  4QPJ A;  3CCS V;  4JGS A;  1S0V A;  1XL4 A;  2FTK A;  1F23 A;  2DYR C;  3FB7 C;  1OCC C;  3RVY A;  2XND G;  1KQS U;  1QVF U;  1R3K C;  3QO5 A;  3SYQ A;  5B1O A;  1Q82 W;  4PA9 A;  1K97 A;  4PDL A;  5GW7 A;  2WLL B;  1B6Q A;  3LDE A;  2WWW A;  3OE7 G;  1PNM A;  4R6Z A;  3GB7 C;  1K73 W;  2NLJ C;  3ABL B;  3HB3 B;  3ZIA G;  2AHZ A;  1MAB G;  1MSW D;  2EIJ B;  3LDD A;  1PL0 A;  2WLJ A;  3X2Q B;  5KA5 A;  5B1N A;  3MHS C;  3OMA B;  2EZO A;  4UVC A;  3P30 A;  4WFH A;  5IY5 C;  5L3B A;  4JTD B;  3W7W A;  3ZN1 A;  5B1A C;  1AJN A;  4LC1 A;  1QBZ A;  1SET A;  4UVA A;  1W0J G;  3TK1 A;  1OCZ B;  2PI4 A;  1GMG A;  4G27 B;  4ZKI A;  1QVG U;  3CCU V;  1JOY A;  3OR7 C;  4HYO A;  3T4D A;  1K92 A;  2QA4 V;  3CCL V;  3CP1 A;  4PA6 A;  2EIM B;  5CA3 A;  5CN0 A;  1H38 A;  1M56 B;  1N8R W;  3K9A A;  3RBZ A;  4KP4 A;  1P7B A;  4JTA B;  1GK9 A;  4UUJ C;  4PA3 A;  3ABL C;  1KKD A;  2WPD G;  1VQ5 V;  3VBB A;  2EIJ C;  3X2Q C;  5KUM A;  2ZD9 A;  4OXS A;  1DF4 A;  2ITD C;  4XDJ A;  3GWO A;  1VQ4 V;  2ZDI A;  3ZRW A;  5CBH A;  3E8H A;  3AG3 B;  2IU0 A;  3SPJ A;  1BHB A;  4ASU G;  2OT5 A;  2B5U A;  1OCZ C;  2HVK C;  1W2B U;  3E2E A;  3ASO B;  2B1I A;  3BEH A;  1BL8 A;  1OZ0 A;  1K5S A;  2JIZ G;  3FYI B;  4QE9 A;  2DW4 A;  3E8B A;  3OEE G;  1V54 C;  3K0G A;  2HKO A;  4CZZ A;  1VQ7 V;  3F7V C;  3EFF K;  2YSU B;  2CK3 G;  5IDJ A;  4QNH B;  2QM7 A;  2EBO A;  2OTL V;  1COW G;  2R9I A;  3JD1 A;  4JAU A;  3ZMT A;  1R3L C;  4JTC B;  4TSF G;  1QLE C;  2V7Q G;  1VQ8 V;  2H8P C;  2LFS A;  2A9H A;  4MS2 A;  3CCE V;  1H2G A;  3ZMV A;  1NR7 A;  2DYR B;  3I56 V;  2EIK C;  1CEZ A;  4H37 A;  3CD6 V;  3ABU A;  3W7S A;  2EZP A;  3E35 A;  4JPR A;  2XAS A;  1EFR G;  1SES A;  4MW3 A;  4WFG A;  2XOK G;  2P7T C;  2V1D A;  4TT3 G;  5H9C A;  4BIU A;  4QPK A;  4GX0 A;  4JAS A;  1FS0 G;  3CCV V;  4F4L A;  1VQK V;  3R65 A;  1ENV A;  3ETG A;  2W6I G;  4EKW A;  3QO7 A;  3OUF A;  3QO8 A;  1ZWI C;  4LCU C;  2UXN A;  3PJS K;  2BOB C;  3CC7 V;  2EIN C;  4JYB A;  3AG1 B;  1VQO V;  3OUS A;  1XL6 A;  1QLN A;  3W7T A;  2Q67 A;  3G6E V;  2JEU A;  1EBO A;  2XAJ A;  3TET A;  3SPH A;  3K3W A;  2KB1 A;  3OEH G;  2A79 B;  4RUE A;  2WLM A;  2ITC C;  4HAM A;  4MW8 A;  3KG2 A;  4MVM A;  2ZXW B;  5FL7 G;  3E8G A;  1QCE A;  4P9O A;  5KA6 A;  3JD4 A;  3RW0 A;  1YJW V;  3M99 B;  5L3D A;  4YXW G;  2AHY A;  4P30 A;  2HR3 A;  1S72 V;  5BZB A;  4WFB V;  5L3F A;  4JF3 A;  3K06 A;  3FB8 C;  1S5H C;  1K8A W;  1WPX A;  2OTJ V;  3ZMZ A;  1Y66 A;  3ABM B;  4GT1 A;  5L3E A;  3B77 A;  3AG1 C;  4MSW C;  1VQ9 V;  4UVB A;  4RUF A;  1F51 A;  2UXX A;  2ZQM A;  1TUE B;  4N21 A;  3OFN G;  4FK5 C;  4U7O A;  1K5Q A;  3K08 A;  1YHQ V;  1AI6 A;  4GX5 A;  1VQL V;  1BMF G;  3CCR V;  3AG2 C;  5B1B C;  1Y4M A;  1W0K G;  2Z3Y A;  1V54 B;  2QTO A;  4MTF A;  3JYC A;  1M1K W;  4X89 A;  1JVM A;  2ZXW C;  4FMT A;  4MTG A;  3FKS G;  2X7R B;  1H8E G;  3T4Z A;  4XDL A;  4UV8 A;  3JD2 A;  1K7D A;  4DXW A;  1QLE B;  5HFL A;  1E1Q G;  4R7C A;  4LP8 A;  2Z5U A;  5LGU A;  1QR9 A;  4E2L A;  3T1C A;  5DM6 V;  3MHH C;  3ABM C;  3W7U A;  1IXM A;  2EIK B;  3ZJZ A;  1JPX A;  5DN6 G;  3SYC A;  1KP2 A;  1PKX A;  3CCJ V;  3K03 A;  1J95 A;  4QE7 A;  3ZRV A;  1YI2 V;  3H01 A;  2WLK A;  5LBQ A;  2XAG A;  4FJC C;  1GM9 A;  3TCU A;  1K33 A;  4MVQ A;  4U7N A;  2H94 A;  4MVU A;  1L1F A;  1DTO A;  1FFT B;  5B3S B;  1QR8 A;  3ML0 A;  1ROP A;  1GM8 A;  1M57 B;  1YTF D;  2EIN B;  1WLE A;  3E8F A;  3ZRW B;  1NVP D;  1JJ2 U;  1FXK A;  4TWK A;  2WLI A;  4GCZ A;  2X6C A;  5CBF A;  4P2Z A;  3SPG A;  3IGA C;  1GTO A;  3UM7 A;  3WFV A;  4UV9 A;  1OCR B;  4RQF A;  2BOC C;  5CMU A;  3OW2 U;  5EC2 C;  1M90 W;  3CC2 V;  2XAF A;  5LHG A;  2B1G A;  1GM7 A;  3JD3 A;  2F43 G;  3WG7 B;  3DGE A;  1M9N A;  1S77 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...