2GHYA

Novel crystal form of the cole1 rom protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
57
structure length
57
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein rop
publication title Novel crystal form of the ColE1 Rom protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ghyA00
2IJHA 2GHYA 1RPOA 2IJJA 3K79A 1GMGA 1F4NA 1RPRA 1B6QA 1PD3A 1ROPA 1GTOA 2IJIA 4DO2A 1F4MA 2IJKA 1NKDA
chains in the Genus database with same CATH superfamily
2FTKA 3ABLB 4QNHB 4Z1MG 2NLJC 1R73A 2Y69B 5FNVB 3D3IA 2ZIMA 1F7YA 2L35A 2CGNA 1N33B 3CCMV 2HKOA 4G28B 2WA3A 2ARHA 1VQOV 2OTLV 3S3WA 1GO3F 4UV8A 1US6A 4I55A 3KG2A 4CH3A 3B77A 2EULA 1WPBA 3AG4C 3RW0A 3MHHC 5CA3A 3G71V 3ZBHA 3RT3C 4NTYA 2VWJA 5JQGB 3PJSK 3T1YB 4NXMO 1BS3A 3U10A 1RSOB 2BE3A 4ZOLA 2ZCEA 3AG2B 1WP7A 1A32A 1COWG 2P67A 4MSWC 2IM9A 4HYOA 4O4IA 3ZN1A 3IC7A 4MW8A 5LMNB 1YITV 1IXMA 3LSUA 4J10A 2UXBB 2UUAO 2N04A 3CE2A 3CD6V 1KUQA 1AJQA 3HB3B 4NR1A 1M93A 2BSKB 2YIBD 2ADPA 4J41A 4WFGA 2UU9O 4DV3O 4CH4A 2YEVB 2IU3A 5C8YB 2AXTZ 2BOCC 4PA9A 1TVKA 5B3SC 2Z5UA 3HR0A 1SRYA 5CBHA 4YHHO 4JYBA 2F23A 2NR5A 4D7SA 1N8RW 1BCCH 3I55V 3RWRD 5JH7B 4DR7O 1K4DC 4KL1A 4RO2A 2XASA 5CB4A 1Y4MA 3L74H 4UCRA 2E76B 4DUZO 4DV7B 2F1MA 5LP6B 3F7VC 4JI8O 4FZ1A 1FXKB 1RFYA 4J7ZA 5JJEB 1OCZC 5KUKA 4LH6A 1BE3H 2F93B 1E1RG 4EFBA 3ZS8C 5C8YA 1N32B 3CC4V 3FB8C 4WFAV 3ZIAG 4LFAO 2VQFO 1K5SA 1KMIZ 2C2AA 2UXNA 2WA4A 1FFXB 4UVAA 5JJNB 4J9ZB 3RYCB 1VQLV 1Y74A 5IY5B 4XBFA 3FAVB 2NNUA 4KFMA 2RNBA 1JOYA 3SPGA 4PDVA 1S5JA 1IBKB 4YY3O 3W7WA 3A0HZ 3JD2A 2QGNA 4DR5O 4LF4B 2CUGA 1BQ0A 4DR3B 5IYZB 4I9WA 1JMKC 1GTOA 4X62B 4JAVA 3ZJZA 2EIKB 2IU0A 2LJ2A 4RQFA 4L8JA 2WPDG 1B04A 4RAIA 5LA6A 1M57B 2V1DA 1OCRB 3CSXA 4ZHQB 3C3TA 3VQXA 4LFBO 3CCJV 3ABKB 3A8TA 3GVMA 3ASNB 2F4VO 4PA6A 1FPOA 1H8HG 2KSDA 5GTIZ 3WB1A 4NXNB 1N36B 2Q5ZA 3E35A 1KKDA 4LNUA 4P9OA 5JWPA 3ZMVA 1M4UA 3FKSG 1JFFB 1Z5WA 3A2FA 3CCQV 4GLXA 2Q67A 4NB5A 1RM1C 3LUTB 1Q90D 3OUFA 4X1IB 2F66C 3ZHVA 2GDSA 4B3TO 4DR6O 3MD0A 3BA8A 3VQVA 2GUZB 3MDSA 3JAWA 1IVSA 4BW5A 1IZ3A 1PV0A 3CCSV 2X6CA 3CX5F 4ASUG 5IYBO 5LBQA 3WU2Z 2ATKC 3H1HH 1TUBB 3DTUB 2ZXWB 1XBLA 3K59A 1VF5B 3N27A 2HFEC 3TXQA 2F95B 1NH2B 4TWKA 1NS1A 1ZUQA 3SJQC 3NXSA 1E1QG 2AHZA 4J80A 1OCCB 1QR9A 1OV9A 2ZNIA 2B5UA 2HLDG 1VQ8V 2HHHB 4TOIA 3AG1B 1XI1A 2DW4A 1M56B 4HNAB 4K0KB 2QJ1A 5LHHA 2UXDB 4Z1VA 1YDXA 2CE4A 4BIUA 1DK1A 1R3LC 2XAHA 1SQXH 4DUYB 3H01A 1X59A 4I0XA 1OJHA 3K06A 1TUBA 2LP7A 4PDMA 1SERA 5LYJA 1HNWB 3BABA 5DECA 1PPJH 1NTMH 5KMGA 2CTQA 1TUEB 2Q6AA 1AB3A 3C3SA 2H3OA 4MTOA 4L87A 2AHYA 3H1LH 4PDRA 3APQA 5HFLA 1Q5OA 3OEEG 3ASOB 3OTOB 1SQVH 3THOA 3AK1A 2ZNJA 1WB7A 1YI2V 1H2SB 3M8AA 1M9NA 1HW7A 3H1KH 3E22B 2DMXA 1B6QA 4AHCA 1EN5A 4DV1O 3E2EA 4H0LB 1VARA 1IBMO 1AR1B 2QSAA 1LUWA 4OPHA 3CXCU 3B8MA 3JARB 2HEPA 4UB6Z 4PI0A 1ZAUA 4MW3A 5EIBC 2GTSA 3LSQA 5H6QA 4ZI7B 4LR3A 1H2GA 1SQFA 3F5WC 4NXMB 3RFRA 1OCOC 2ZDIA 1I08A 3SJCC 1IXBA 1PM9A 4UCTA 2PZSA 4DK0A 5JVDB 1QLEB 4BW9A 3JSLA 4PA4A 4JGSA 3ZN0A 2CH7A 3CRMA 4MVSA 3CXHF 2UU9B 4DV3B 3WG7B 4J9YB 2AW9A 1BSMA 2JGDB 2GV9A 3VQWA 4O2AA 2XAGA 1WJZA 2WLLB 1K3EA 3J80N 4TV8A 1XNQO 4LF6B 1DLBA 2ZE8A 3CEIA 1MG1A 2B9ZA 5IWAB 5K1XA 5J2UB 1J5EB 2QR4A 5EZYB 1IBKO 2ILMA 2ZE7A 2Q0AA 1LNQA 2CK3G 1GAXA 1GN3A 3UKMA 2QKAA 4DR3O 4TSFG 4JI3O 2IJJA 4O2BB 3SYCA 3CCRV 1GK9A 3M7MX 2DYSC 2EIMC 2DOSA 4X62O 2BTQA 2NN4A 5KX5A 1Y76B 2DYRB 3B09A 2PGGA 5B1BC 4LFAB 2VQFB 2IJHA 3ZRXA 2D3OW 3RGBA 1YXBA 3ABMB 2QE7G 2V7QG 4DV6B 4H44B 3K58A 3G4SV 3WB0A 2F43G 4NXNO 2HJDA 5JJJB 2ODMA 4GZRB 4JYCA 1N36O 1D2DA 2EJ7A 3AG3C 4JI6B 3R65A 3CPWU 3CP1A 3JSNA 1VEWA 1M5IA 3TK1A 4DR1O 3OGIB 5KHGA 1MSWD 4O4JB 1AP5A 2Q9LA 3JD4A 4B7KA 5KAFZ 3K9AA 4JAAA 2Q73A 4QJFB 1Q6IA 2ITCC 4LFBB 1O9HA 1F4MA 2F4VB 3OUSA 1XL6A 2JS3A 4W4LA 1VQ5V 2E74B 4Z2WA 1VQPV 3D36C 3D3QA 3SYAA 1XMQO 4KHPB 3QO8A 2CAZC 2E75B 2P4VA 2QWPB 2LFRA 5BMVB 1FXHA 1BL8A 3KKYA 4FLWA 1YCIA 4LF8O 4FM0A 1BHAA 1WPXA 2CGOA 2RCVA 1BZKA 4JAUA 2HHHO 3DC5A 3OT7A 4B3TB 2EINB 4OX9B 3L75H 4K0KO 1H38A 1V55C 1S5LZ 3SJAC 1E79G 4WFFA 4UB8Z 3JCZA 1WP8A 3L70H 3N2KA 2W0XA 3RVZA 2WLHA 3EXAA 2BTOA 4YXWG 3ZRVA 5KHIA 5KAIZ 1QR8A 3E8HA 3CCLV 4I55B 3T1HO 2DQ0A 2DWDC 5KA5A 4DW0A 3PN1A 4P2ZA 1XREA 3CS5A 2B1IA 4DRXA 1NKDA 3RYHA 1NR7A 1P84F 3JAKA 4X64B 1R6TA 2H8PC 4ZOLB 3OTOO 5H5NA 1PNMA 1L0LH 2YICA 4O4IB 1R6KA 3QO5A 5E79Z 2ZR3A 1EM1A 3CCEV 4JI2B 1SA0A 1YHQV 1Q6HA 2YUAA 4FLYA 1XEQA 2N05A 3SYPA 4WBNA 1NTKH 1Z5VA 3H1IH 2PI4A 4O4LA 1S5HC 1ZX3A 4MVQA 4CS4A 2Z3YA 1LUVA 2W0FC 1TVKB 1QVFU 4DW1A 2YIBA 1MABG 2IH3C 4CH6A 5LXTA 1YTFD 4R8CA 5FPOA 5B1NA 5EBLC 1N4CA 2VQEB 2DE0X 4DV5B 1SC5B 3DGEA 1XMOO 1Q7YW 1HDJA 4XDKA 2Q7EA 1GKFA 5CB4B 1EN6A 1WA8A 4UFZA 3E8BA 3AG7A 1W0KG 1NR1A 1G8MA 2PI5A 1ORQC 2XNDG 4DV1B 2Y48A 2FMLA 2OWOA 5IDJA 5L3GA 1IBMB 2H94A 2DWEC 1JA8A 1W2BU 2AGAA 3L72H 4PDLA 4X1YA 1KECA 5LP6C 4X65B 3OMNB 3SYOA 3B40A 2X6BA 1FXKC 4GCZA 1S76D 4JYYA 2P7TC 4EB6A 5A2QN 1KYOF 1DF4A 4MTXA 5LMUB 5FL7G 2Z0AA 4UCSA 4LF6O 4I50A 2ZR2A 4BR6A 1U97A 5IWAO 5B66Z 1Y74B 3AG4B 2P5OA 5IJ9A 1H2NA 4K8XA 3FB7C 3FB6C 1J5EO 1KC8W 2IJIA 5CA1A 2AZ2A 4U3JA 4X1KA 2YS8A 1SZTA 5LGTA 1ZSPA 4O4HA 1R1BA 1XILA 5GONA 3MHSC 1NVPB 2Q4PA 4ZKIA 2LGQA 1CPYA 4JPRA 1I5YA 2YIAA 3J7AU 4K3AA 3BPZA 1K73W 2X7RB 1BMFG 3LNNA 1M1KW 5LA6B 1XNQB 1BHBA 1PNKA 3UM7A 2XAJA 4F4LA 4GKJB 3F7YC 1FJGB 4CS2A 3VOUA 2BOBC 3LDCA 5EBWC 4B7EA 2YXYA 4DV6O 5B3SB 4YJ2A 3HKDA 1M57C 4TQDA 1OCRC 3DXRA 1CP9A 2W6IG 4DV4O 1QLNA 4LNUB 2QM7A 1CEZA 3ASNC 1ZL8A 3JD1A 5AG2A 3K5MA 2LFSA 2QWRB 1XUQA 2UUBB 3K5OA 3ZX6A 4JI6O 1QHTA 5KLVH 4I5SA 1P49A 4JI3B 4X20A 3X2QB 3JAWB 1Q43A 2KKWA 1LR1A 4F6RA 4MTFA 4NYKA 4CC6A 4P9PA 1VQNV 1I94O 2R72A 4D6TH 2EBOA 5D5PA 2P4KA 1VMGA 3FB5C 1NBMG 3L73H 2IH1C 1Q3EA 5BXZA 1YJWV 2GHYA 4KHPO 1K5QA 1HNXO 4X8AA 2MK3A 2JEXA 4WFBV 1RPOA 4H37A 1VF7A 4DV0B 1MNGA 4DR1B 1X4TA 2O57A 4E4EA 4QE7A 3OD4A 1L8DA 4X66B 4OX9O 3GWOA 4RUFA 4TV9A 3NR7A 3AG1C 2A3QA 1D5NA 1M56C 4WFHA 5DN6G 1M90W 1KP3A 4HZ3A 4I0XB 1SS3A 3CRAA 3H9VA 2ZM6B 4LBEC 2M6YA 1JPXA 1FXVA 3ABUA 1F51A 4HAMA 4YIOA 5LYJB 1VQ7V 1XMQB 1UPGA 5KMGB 5B1AC 2OCHA 1AI7A 3JATB 4RUEA 1K92A 3TJTA 2IW5A 1W59A 2HVJC 1GN4A 4LF8B 4RWUA 2JIZG 4IIJA 1AI4A 1YIJV 2WSSG 3GB7C 1DF5A 3G6BA 4X64O 3LDEA 1MA1A 2ZT9B 5L3EA 1PL4A 4AQYB 3CC2V 2QWOB 4JI5O 1TAEA 2WLKA 1EZJA 3C90A 1YJNV 4W4KA 3P3NA 3ASOC 4YJ3A 4JI2O 3EFFK 2KG7A 2DN9A 2XAQA 4B3SB 3QVNA 1HNZB 3QG5A 3FX7A 1BGYH 3P3PA 1HWYA 4B08A 3T1HB 4LF9B 1GN6A 3SGIA 4BWAA 4LFCO 3RN4A 5J2TA 3JATA 4JI1O 4EFEA 2JK5C 5LHIA 1Y6XA 3FYEB 1NI8A 4PA3A 2VQEO 4NTWA 3ML0A 5JCOC 4DV5O 1WB8A 4P30A 2EX3A 5KA6A 1MMMA 3T4DA 4UVBA 1Q86W 2PYJA 2CH7B 1QLEC 4FLTA 1VQ9V 1WN7A 3RBZA 4BIOA 4LF7B 1J95A 4FIPC 4O2AB 4X65O 4I7ZB 4A5UB 2QTOA 3APOA 4TV8B 3SDLA 2UXCB 3T1CA 4ZIBA 1ROPA 5LMUO 1AJPA 1XMOB 1ZTEA 4R6ZA 3N2GA 1BQZA 1JVMA 5BR8O 3HKCA 1NH2D 3K79A 2QTSA 3CCUV 4ABMA 3KZIZ 5CBGA 4LCUC 4IYIA 5EYPA 1F4NA 1L1FA 4R50A 3Q4HA 1AROP 2A9HA 2JJ2G 3UT5A 1SKVA 4FFBA 5FLXN 2DQ3A 3SPJA 4D7TA 2A0LA 2WWWA 2BTQB 5KX5B 2YI9A 4AI8A 1PP9H 1EN4A 2DJVA 3RYIA 4RQEA 4MT8A 4IHJA 2DYRC 2OIGA 3O65A 4PHZA 2VWKA 4GKJO 1GMGA 4QPJA 3SPHA 1FJGO 4LH7A 2Q69A 2QEXV 3ABMC 4DV2O 5BY1A 1QCEA 4B3RO 2Q68A 2EIJC 1XOUA 3SPIA 2JS5A 4JTDB 4MTGA 5CA0A 3TXSA 1NZ6A 2UUBO 4NKGB 4OGQB 2WLJA 1VQ4V 1Q6UA 3K0DA 1R3JC 2GTAA 3ETGA 2Q8VA 1NJIW 3CCVV 2ZINA 3ZMUA 2ZIOA 3ZRWA 2CTPA 4PJ0Z 2A7WA 2IJKA 2JDIG 3ETDA 3K57A 3KCXA 4DV4B 2ADQB 4DR2B 2PF4E 3I56V 5L3FA 5EBMC 1V54B 1SQBH 4DV0O 4IYHA 2OT5A 1IX9A 1K9MW 1F23A 4CZZA 2K9PA 4X66O 5KUMA 2XHBA 4JI4O 1AJNA 1YF2A 3IGAC 1ZLZA 2EINC 4E2LA 4EEQA 3N2KB 1JX9A 2ITDC 4WFEA 1I94B 2G38A 2EIMB 3FYIB 3TETA 1YZBA 2ZM6O 1S0VA 1S77D 3I5DA 2EILC 5A9GA 4HBNA 5D5QA 1N0JA 4I9QA 3HKEA 1HNXB 4DRXB 3RYHB 2MW2B 2YSUB 1HR0B 3JAKB 2RN9A 1SQGA 1GM9A 2WAMA 1DTOA 4GUNA 3E8FA 3ETQA 4LWSA 2Q0OC 4FLUA 4AQYO 4LC1A 2CTWA 1SESA 1SA0B 1AR4A 3K9SA 4FZ0A 3QO7A 2PY5A 4JI7O 3HKBA 3W7SA 1FAFA 2RMKB 3ABLC 4GKKB 4WBNB 2Y69C 2Q7HA 4PI2A 4FLVA 1RP3B 4B3SO 1SQQH 1HNZO 4O4LB 1QQCA 3FD9A 3AK3A 3G6EV 2OCCB 1FKAO 3T2MA 5EC2C 3QNEA 2JEUA 3STLC 2YDEA 5LXTB 2ZKOA 5KHKA 4X88A 1GN2A 1XNRB 1TA8A 2QM4A 3IAYA 5IYCO 3G80A 2UUCB 3E8GA 4JI5B 1WA8B 4EKWA 5CMUA 2JRIA 4J7JA 4OXSA 2X6AA 1NT2B 1YVWA 3AG2C 4CS3A 1THZA 4Q6GA 3BCCH 3JALA 4X1YB 3ZMTA 1PL0A 4G27B 2Q7GA 4LF7O 2WLIB 2LO1A 3CJHA 4UVCA 4LFCB 4EB6B 4JI1B 4MVUA 5CBFA 2V4DA 4PA7A 5IJ0A 2UXCO 4I50B 4G2KA 1D5AA 3HPLC 3D36A 2YI8A 1WNSA 2OYQA 4PV1B 4QGPA 4IL6Z 2Y4TA 1KQSU 4I4TA 5IJ9B 4R7CA 4YIPA 4DR4B 2UXXA 3JASA 5CA1B 4UCUA 2R70A 4U3JB 4TUYA 3RYFA 4X1KB 4O4HB 5GONB 2ZQMA 1AR5A 3ZEDA 5J9PC 2E5LO 5DM6V 4GT1A 3K5LA 1FYJA 2QA4V 3ZHQA 5GTHZ 3OR7C 1YJ9V 2HG5C 2WLIA 4PELA 5HFMA 2PYLA 2X0LA 1JQ0A 3UO2A 4B3MB 5FNVA 4CBCA 3JYCA 1KU9A 5GW7A 5BR8B 4YJ2B 3HKDB 1MZFA 5B1OA 3W7TA 2BCCH 5L3CA 3DXRB 1GH6A 3CRRA 1DGSA 5LGNA 4JYAO 1VP7A 1ZL8B 1KKCA 4U3FH 3BAAA 4MVRA 3F5TA 2FKXA 3FFQA 5IY5C 3AEIA 3MAQA 4KP4A 3TCUA 4X20B 4C7UA 5LGUA 1H8EG 5JQGA 2KQXA 2RJZA 4F6RB 1RSOA 1L0NH 3CRQA 2OIEA 2R9AA 3X2QC 3OMAB 4DK1A 1PNLA 4DXWA 1QBZA 4J7KA 4N21A 2EIKC 1OZ0A 1SQPH 4JI0B 2LQTA 3ETEA 4JTAB 2WLMA 3BY6A 4DV2B 3CMAV 3OTFA 2BSKA 2P6JA 4B3RB 3BRCA 2YEVA 4FVMA 3ABKC 4DR2O 2HVKC 1QNMA 2FL4A 2CDYA 4U7OA 3K08A 1PKXA 3OEHG 1UJWB 1FD9A 3L9DA 2ZE6A 3ABTA 3EVKA 1I7FA 4TV9B 3QF7A 3J81N 5L3BA 5JH7A 1Y67A 1Q81W 3VQYA 1OCZB 3DC6A 4JV5B 4FMTA 3T4ZA 3GWKC 1K34A 5LP6A 2AZ0A 1FXKA 3OMIB 1WAZA 5TISZ 5B5EZ 5E1AC 3WFVA 1KB9F 2ZXWC 3JCUZ 5IT9N 1PD3A 4IIJB 5F2VO 4JASA 1HR0O 1N34O 2QWQB 3ZHTA 1FFXA 3E86A 2JGUA 3RYCA 1OCCC 3UCSC 4JI4B 5L3DA 3FAVA 3W7UA 1EBOA 4ZBMA 1XL4A 1NVPD 4YJ3B 2KG7B 1N0NA 3DSQA 1K33A 4GKKO 1G6UA 2P90A 2LW7A 2RQ6A 1XHZA 3CYOA 3STZC 5IYZA 3B2EE 1IBLO 3ZCCA 4CC5A 1GRJA 5C93A 4Q20A 1B06A 4K35A 5EC1C 4GX0A 2D2CB 3BA9A 1K7DA 5J2TB 4QE9A 1IDSA 4NVPA 4ZHQA 1XNRO 3K0GA 4BIZA 3U0ZA 1QU7A 2M7WA 2UUCO 4H13B 3IJ4A 3OW2U 1H2LA 2ZDIC 1RM1B 2Y0IA 4JI7B 4GYCB 1FFTB 1H2MA 1JFFA 1S3JA 3JD0A 3OM3B 4GX2A 3IC9A 1U96A 4X1IA 1JCHA 2Y0PA 4LF9O 1GM7A 2XUMA 3UQ8A 3D8CA 2GUZA 2YC0A 5H2FZ 1VQ6V 4FLZA 5H6RA 5FPRA 1RPRA 1I0HA 4FFKA 4UUJC 3IFXA 5B1AB 1XHXA 3N2GB 1EZVH 1N33O 1S72V 3HKCB 1Q82W 5EK0A 1KBHA 4OPAA 1NQTA 4QIWF 4DR4O 3G67A 3CB2A 1MOFA 4U7NA 2E3CA 2QKCA 1MSDA 4LF5B 3BVOA 4MVMA 2R9IA 5EYPB 3CC7V 2QDOA 3Q4HB 3UT5B 3ZHSA 3OAAG 2ETNA 4FFBB 2ZD9A 4KXRA 4HNAA 4MVOA 3T1YO 4F6EA 3K3WA 2EZPA 3U11A 2P06A 3ICXA 3W7XA 3RYIB 3OR6C 5IE9A 2WLNA 4B3MO 5LMNO 3WG7C 3JD3A 1Z2GA 4IHJB 2UXBO 4GX5A 1NU1H 1O9GA 4H33A 3LNMB 4QPKA 3OFNG 1YEWA 5LOVB 3LDDA 2GSMB 4JTCB 4TT3G 1JR9A 4IT5A 5CA0B 1ENVA 5DEDA 1URFA 1V9PA 2E5LB 4IGGA 1WLEA 2IBZH 4XDJA 2PUSA 1NTZH 2EZOA 1B3QA 2YXHA 3E22A 4WF9V 2LGWA 1AP6A 2UUAB 1XQ8A 4DV7O 1SETA 3ZRWB 3QTCA 5KHJA 2JVDA 1R3IC 4JZGA 4JI0O 2VRZA 3H1JH 4JYAB 3JARA 1KP2A 3P30A 2YXLA 3UO3A 1H2KA 1SF9A 5LOVA 1OCOB 1N32O 5JCOA 3SR2C 2FYUH 2K1EA 3M99B 4YHHB 1JJ2U 3CRCA 3BHPA 3CHXA 1QVGU 4UCVA 3RVYA 1EFRG 5KHHA 4ZI7A 3E83A 3KCYA 2PTMA 2XT9A 1V54C 5ITZB 4DR7B 4X9QA 3O9OA 2Y4UA 2HP8A 2R9RB 3P32A 2XAFA 5JVDA 4DUZB 5CN0A 1YSCA 4JI8B 1AVMA 1R3KC 2RDCA 1W0JG 4JV5O 4LF4O 2HJFC 2LW1A 3HKEB 1VF6C 3K5NA 2JGDA 1GM8A 3SPCA 5LHGA 3K04A 4KUMA 2WLLA 2YIDA 1FS0G 1BT8A 2EIJB 1P7BA 3CWBH 2VS0A 1T5EA 1VIBA 1AI5A 1P4RA 3LSSA 2P22C 4BAYA 3TGUH 4LWSB 4J11A 5ITZA 3VBBA 1ZWIC 5J2UA 3ZMSA 5K1PA 4FM1A 1CXZB 2XTAA 1XDCA 5EZYA 4YY3B 3HKBB 4DR5B 1MZEA 2DYSB 4J42A 1UFIA 3WB2A 4FPPA 5B1BB 4UCOA 1Y66A 2A79B 2KB1A 2QM8A 4O2BA 2CTRA 3JAMN 4MVZA 1Y76A 4GX1A 3A0RA 3S3XA 1I5XA 1SZXA 4AILC 5EIBD 1KD1W 2OCCC 2XOKG 1N34B 2W6JG 4FM2A 4TQFA 4JZ2A 3R66A 5LL6Y 3ZRSA 1YTFB 4JF3A 1HP8A 3AG3B 3ZMZA 1OHHG 3CMEV 2QWNB 2B1GA 2FB5A 3SYQA 1AI6A 2A06H 5H9CA 2N74A 3EHBB 4DO2A 3OE7G 3SJBC 3OGCC 4MS2A 4DYLA 1AILA 4LP8A 1R6NA 4FLXA 1IBLB 3JALB 5IYDO 1TGOA 3K03A 4DR6B 5BZBA 1IURA 1Q8IA 2EJRA 4O4JA 4ICGA 3CJHB 2UXDO 4UV9A 1VQKV 1JJOA 2EILB 2JJ1G 5IJ0B 4K8ZA 1P7GA 4X89A 1K8AW 4DUYO 4CH5A 1K4CC 4XDLA 1VF6A 4PD4F 2QKSA 2GBOA 4N23A 1K97A 4I4TB 1VQMV 3AK2A 4NTXA 4FK5C 4WCEV 3JASB 1HNWO 4UXNA 1G1XB 3B8NA 4TUYB 3RYFB 3ZHUA 2HR3A 2L6LA 5BMVA 3A0BZ 2OTJV 4LF5O 3L71H 3BFRA 3BEHA 1V55B 3E89A 4FJCC 1G4YB 2ZE5A 3ZHRA 3B4SA
chains in the Genus database with same CATH topology
2DYRB 2JK5C 5LHIA 2FTKA 3ABLB 4QNHB 5B1BC 4Z1MG 2NLJC 1R73A 2Y69B 3ABTA 2IJHA 3FYEB 3ZRXA 4PA3A 2D3OW 3ABMB 3ML0A 4P30A 3D3IA 5L3BA 2QE7G 2V7QG 1Q81W 3G4SV 1OCZB 5KA6A 4FMTA 3CCMV 2F43G 3T4ZA 1K34A 2HKOA 4G28B 3T4DA 4JYCA 4UVBA 1Q86W 1VQOV 2OTLV 1FXKA 1GO3F 3OMIB 4UV8A 1QLEC 3AG3C 3KG2A 3R65A 3CPWU 1VQ9V 3CP1A 3B77A 5E1AC 3RBZA 3AG4C 3TK1A 3WFVA 3RW0A 3MHHC 1J95A 5CA3A 4FIPC 3G71V 1MSWD 2ZXWC 1PD3A 2QTOA 4JASA 3JD4A 3PJSK 3T1CA 1ROPA 3K9AA 3AG2B 4QJFB 3E86A 1AJPA 1COWG 2P67A 2ITCC 4MSWC 4HYOA 1OCCC 4R6ZA 5L3DA 1F4MA 1JVMA 3IC7A 3ZN1A 4MW8A 3W7UA 1EBOA 4ZBMA 1YITV 1IXMA 1XL4A 1NH2D 3K79A 3OUSA 1XL6A 1NVPD 1VQ5V 1VQPV 3CCUV 3SYAA 3CD6V 1K33A 5CBGA 3QO8A 1AJQA 3HB3B 4WFGA 2P90A 4LCUC 3CYOA 2YEVB 3STZC 2LFRA 1F4NA 2IU3A 3ZCCA 1L1FA 2BOCC 5C93A 1FXHA 1BL8A 4Q20A 1AROP 2A9HA 2JJ2G 4PA9A 4R50A 5EC1C 4GX0A 1BHAA 1WPXA 2DQ3A 1K7DA 5B3SC 3SPJA 2Z5UA 2A0LA 2WWWA 4JAUA 1SRYA 4QE9A 5CBHA 2EINB 4JYBA 1H38A 1V55C 1E79G 1N8RW 4WFFA 3K0GA 3I55V 4RQEA 4BIZA 4MT8A 1K4DC 3JCZA 2DYRC 2XASA 4RO2A 1Y4MA 2M7WA 1GMGA 4QPJA 3SPHA 3RVZA 2WLHA 3OW2U 2Q69A 2QEXV 2ZDIC 3ABMC 1RM1B 3F7VC 1QCEA 4YXWG 3ZRVA 1FXKB 1FFTB 2Q68A 1QR8A 2EIJC 1S3JA 3E8HA 1OCZC 3CCLV 3SPIA 3JD0A 3OM3B 5KUKA 4GX2A 2DQ0A 2DWDC 1E1RG 4JTDB 4MTGA 4P2ZA 5KA5A 1JCHA 1GM7A 2B1IA 1NKDA 1NR7A 3CC4V 3FB8C 2WLJA 3ZIAG 4WFAV 1VQ4V 1K5SA 2C2AA 2UXNA 3K0DA 1VQ6V 2H8PC 5H6RA 1RPRA 1R3JC 4UVAA 4UUJC 3ETGA 3IFXA 1NJIW 4J9ZB 1PNMA 3CCVV 5B1AB 1VQLV 1R6KA 3QO5A 5IY5B 4XBFA 1S72V 2ZR3A 3CCEV 3ZMUA 1Q82W 5EK0A 2NNUA 4KFMA 3ZRWA 1YHQV 1JOYA 3SPGA 1NQTA 4QIWF 4PDVA 2IJKA 2JDIG 3SYPA 1MOFA 4U7NA 3ETDA 3W7WA 3JD2A 2PI4A 1S5HC 4MVQA 4MVMA 3I56V 2R9IA 5L3FA 4I9WA 2Z3YA 5EBMC 3CC7V 1GTOA 1V54B 2W0FC 3OAAG 4JAVA 1QVFU 2ZD9A 3ZJZA 2EIKB 1MABG 2IU0A 2IH3C 4RQFA 4MVOA 1YTFD 4R8CA 2OT5A 1K9MW 1F23A 2WPDG 5B1NA 4CZZA 3K3WA 2EZPA 4RAIA 5EBLC 1M57B 2V1DA 5KUMA 1OCRB 3DGEA 1Q7YW 3CCJV 3W7XA 4XDKA 1AJNA 3ABKB 2WLNA 3OR6C 3WG7C 3JD3A 3IGAC 3ASNB 1GKFA 4PA6A 1H8HG 2EINC 4E2LA 4GX5A 3E8BA 1JX9A 2ITDC 4WFEA 1W0KG 1NR1A 2EIMB 4H33A 3FYIB 1G8MA 3LNMB 2PI5A 3TETA 1ORQC 2XNDG 3E35A 4QPKA 1S0VA 1KKDA 1S77D 3OFNG 4P9OA 2Y48A 3ZMVA 5IDJA 2EILC 3FKSG 5L3GA 2H94A 2DWEC 3LDDA 3CCQV 2GSMB 4JTCB 4TT3G 2Q67A 1W2BU 4PDLA 1RM1C 1KECA 3LUTB 1ENVA 3OUFA 3OMNB 3SYOA 2X6BA 1FXKC 4GCZA 3MD0A 1S76D 1WLEA 2YSUB 2P7TC 1DF4A 4MTXA 4BW5A 5FL7G 1GM9A 3CCSV 2WAMA 2X6CA 4XDJA 1DTOA 4ASUG 3E8FA 5IYBO 2ZR2A 5LBQA 2EZOA 2ATKC 4WF9V 3AG4B 4LC1A 1SESA 3DTUB 3FB7C 1SETA 3ZRWB 3FB6C 2ZXWB 3QO7A 1KC8W 2IJIA 2HFEC 3W7SA 1R3IC 3ABLC 2Y69C 1SZTA 1NH2B 4TWKA 5LGTA 1KP2A 3P30A 3MHSC 3SJQC 1NVPB 3NXSA 1E1QG 2AHZA 4ZKIA 3G6EV 1OCCB 1CPYA 2OCCB 1QR9A 4JPRA 1I5YA 1OCOB 2B5UA 2HLDG 1VQ8V 3T2MA 2K1EA 3AG1B 5EC2C 2DW4A 3M99B 1JJ2U 3QNEA 2JEUA 3STLC 1M56B 1K73W 2X7RB 1QVGU 1BMFG 3RVYA 1EFRG 5LHHA 1M1KW 4X88A 3E83A 1BHBA 1V54C 1PNKA 3UM7A 2XAJA 4BIUA 4F4LA 2R9RB 1R3LC 5IYCO 3F7YC 2XAHA 3P32A 3H01A 2XAFA 3E8GA 2BOBC 3VOUA 3LDCA 5EBWC 4EKWA 5CMUA 5CN0A 1YSCA 5B3SB 4OXSA 1M57C 1OCRC 1R3KC 1W0JG 3K06A 2LP7A 1CP9A 2W6IG 4PDMA 1QLNA 2QM7A 1SERA 2X6AA 1CEZA 3ASNC 3AG2C 3JD1A 1THZA 2LFSA 2HJFC 1TUEB 2Q6AA 1GM8A 4I5SA 3SPCA 3ZMTA 1PL0A 4G27B 2WLIB 5LHGA 3K04A 4KUMA 2WLLA 4UVCA 3X2QB 4MTOA 4L87A 2AHYA 4PDRA 4MVUA 1FS0G 5HFLA 3OEEG 3ASOB 5CBFA 4PA7A 4MTFA 2EIJB 1P7BA 4G2KA 1YI2V 3HPLC 3D36A 1AI5A 1P4RA 3LSSA 4P9PA 4BAYA 1M9NA 1VQNV 3VBBA 1KQSU 1ZWIC 1B6QA 3ZMSA 4R7CA 2EBOA 3FB5C 3E2EA 2UXXA 1NBMG 2IH1C 1AR1B 2DYSB 3CXCU 1YJWV 2GHYA 3B8MA 1K5QA 2ZQMA 4X8AA 4FPPA 2MK3A 5B1BB 2JEXA 4WFBV 5J9PC 1Y66A 1RPOA 2A79B 2KB1A 2QM8A 5DM6V 4GT1A 4MW3A 4H37A 4MVZA 2QA4V 3LSQA 4GX1A 4QE7A 3A0RA 3OR7C 5H6QA 1I5XA 1YJ9V 2HG5C 2WLIA 1H2GA 4PELA 5HFMA 1KD1W 3F5WC 3GWOA 2OCCC 2X0LA 1JQ0A 2XOKG 4RUFA 1OCOC 2ZDIA 2W6JG 3AG1C 4CBCA 3JYCA 4WFHA 1M56C 3ZRSA 1YTFB 4JF3A 5DN6G 1M90W 5GW7A 1KP3A 1QLEB 3AG3B 4HZ3A 3ZMZA 1OHHG 3CMEV 5B1OA 4LBEC 3W7TA 2B1GA 5L3CA 3SYQA 1JPXA 1FXVA 3ABUA 5LGNA 1F51A 4PA4A 4HAMA 1AI6A 4JGSA 3ZN0A 1VQ7V 5H9CA 4DO2A 3EHBB 3OE7G 3OGCC 4MVRA 4MS2A 4MVSA 5B1AC 4LP8A 3WG7B 1AI7A 1R6NA 4J9YB 4RUEA 1K92A 5IY5C 2IW5A 5IYDO 3K03A 2HVJC 3AEIA 4KP4A 5BZBA 2EJRA 3TCUA 2XAGA 2JIZG 2WLLB 1K3EA 1AI4A 5LGUA 1YIJV 1H8EG 2WSSG 4UV9A 1DLBA 3GB7C 1VQKV 1DF5A 2EILB 2JJ1G 3LDEA 5L3EA 1MG1A 4X89A 1K8AW 1K4CC 4XDLA 3CC2V 2WLKA 3OMAB 1EZJA 3X2QC 1PNLA 2QKSA 1YJNV 4DXWA 4N23A 1K97A 1QBZA 4N21A 2EIKC 3ASOC 1OZ0A 1VQMV 3EFFK 4FK5C 2XAQA 4WCEV 3ETEA 4JTAB 2WLMA 3B8NA 3BY6A 4UXNA 3CMAV 2HR3A 2P6JA 1LNQA 2CK3G 2YEVA 3ABKC 2OTJV 1HWYA 3UKMA 2HVKC 3BEHA 1V55B 3E89A 4TSFG 2IJJA 4FJCC 4U7OA 3K08A 1G4YB 1PKXA 3SYCA 3CCRV 1GK9A 3OEHG 1UJWB 2EIMC 2DYSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJH A;  2GHY A;  1RPO A;  2IJJ A;  3K79 A;  1GMG A;  1F4N A;  1RPR A;  1B6Q A;  1PD3 A;  1ROP A;  1GTO A;  2IJI A;  4DO2 A;  1F4M A;  2IJK A;  1NKD A; 
#chains in the Genus database with same CATH topology
 2FTK A;  3ABL B;  4QNH B;  4Z1M G;  2NLJ C;  1R73 A;  2Y69 B;  5FNV B;  3D3I A;  2ZIM A;  1F7Y A;  2L35 A;  2CGN A;  1N33 B;  3CCM V;  2HKO A;  4G28 B;  2WA3 A;  2ARH A;  1VQO V;  2OTL V;  3S3W A;  1GO3 F;  4UV8 A;  1US6 A;  4I55 A;  3KG2 A;  4CH3 A;  3B77 A;  2EUL A;  1WPB A;  3AG4 C;  3RW0 A;  3MHH C;  5CA3 A;  3G71 V;  3ZBH A;  3RT3 C;  4NTY A;  2VWJ A;  5JQG B;  3PJS K;  3T1Y B;  4NXM O;  1BS3 A;  3U10 A;  1RSO B;  2BE3 A;  4ZOL A;  2ZCE A;  3AG2 B;  1WP7 A;  1A32 A;  1COW G;  2P67 A;  4MSW C;  2IM9 A;  4HYO A;  4O4I A;  3ZN1 A;  3IC7 A;  4MW8 A;  5LMN B;  1YIT V;  1IXM A;  3LSU A;  4J10 A;  2UXB B;  2UUA O;  2N04 A;  3CE2 A;  3CD6 V;  1KUQ A;  1AJQ A;  3HB3 B;  4NR1 A;  1M93 A;  2BSK B;  2YIB D;  2ADP A;  4J41 A;  4WFG A;  2UU9 O;  4DV3 O;  4CH4 A;  2YEV B;  2IU3 A;  5C8Y B;  2AXT Z;  2BOC C;  4PA9 A;  1TVK A;  5B3S C;  2Z5U A;  3HR0 A;  1SRY A;  5CBH A;  4YHH O;  4JYB A;  2F23 A;  2NR5 A;  4D7S A;  1N8R W;  1BCC H;  3I55 V;  3RWR D;  5JH7 B;  4DR7 O;  1K4D C;  4KL1 A;  4RO2 A;  2XAS A;  5CB4 A;  1Y4M A;  3L74 H;  4UCR A;  2E76 B;  4DUZ O;  4DV7 B;  2F1M A;  5LP6 B;  3F7V C;  4JI8 O;  4FZ1 A;  1FXK B;  1RFY A;  4J7Z A;  5JJE B;  1OCZ C;  5KUK A;  4LH6 A;  1BE3 H;  2F93 B;  1E1R G;  4EFB A;  3ZS8 C;  5C8Y A;  1N32 B;  3CC4 V;  3FB8 C;  4WFA V;  3ZIA G;  4LFA O;  2VQF O;  1K5S A;  1KMI Z;  2C2A A;  2UXN A;  2WA4 A;  1FFX B;  4UVA A;  5JJN B;  4J9Z B;  3RYC B;  1VQL V;  1Y74 A;  5IY5 B;  4XBF A;  3FAV B;  2NNU A;  4KFM A;  2RNB A;  1JOY A;  3SPG A;  4PDV A;  1S5J A;  1IBK B;  4YY3 O;  3W7W A;  3A0H Z;  3JD2 A;  2QGN A;  4DR5 O;  4LF4 B;  2CUG A;  1BQ0 A;  4DR3 B;  5IYZ B;  4I9W A;  1JMK C;  1GTO A;  4X62 B;  4JAV A;  3ZJZ A;  2EIK B;  2IU0 A;  2LJ2 A;  4RQF A;  4L8J A;  2WPD G;  1B04 A;  4RAI A;  5LA6 A;  1M57 B;  2V1D A;  1OCR B;  3CSX A;  4ZHQ B;  3C3T A;  3VQX A;  4LFB O;  3CCJ V;  3ABK B;  3A8T A;  3GVM A;  3ASN B;  2F4V O;  4PA6 A;  1FPO A;  1H8H G;  2KSD A;  5GTI Z;  3WB1 A;  4NXN B;  1N36 B;  2Q5Z A;  3E35 A;  1KKD A;  4LNU A;  4P9O A;  5JWP A;  3ZMV A;  1M4U A;  3FKS G;  1JFF B;  1Z5W A;  3A2F A;  3CCQ V;  4GLX A;  2Q67 A;  4NB5 A;  1RM1 C;  3LUT B;  1Q90 D;  3OUF A;  4X1I B;  2F66 C;  3ZHV A;  2GDS A;  4B3T O;  4DR6 O;  3MD0 A;  3BA8 A;  3VQV A;  2GUZ B;  3MDS A;  3JAW A;  1IVS A;  4BW5 A;  1IZ3 A;  1PV0 A;  3CCS V;  2X6C A;  3CX5 F;  4ASU G;  5IYB O;  5LBQ A;  3WU2 Z;  2ATK C;  3H1H H;  1TUB B;  3DTU B;  2ZXW B;  1XBL A;  3K59 A;  1VF5 B;  3N27 A;  2HFE C;  3TXQ A;  2F95 B;  1NH2 B;  4TWK A;  1NS1 A;  1ZUQ A;  3SJQ C;  3NXS A;  1E1Q G;  2AHZ A;  4J80 A;  1OCC B;  1QR9 A;  1OV9 A;  2ZNI A;  2B5U A;  2HLD G;  1VQ8 V;  2HHH B;  4TOI A;  3AG1 B;  1XI1 A;  2DW4 A;  1M56 B;  4HNA B;  4K0K B;  2QJ1 A;  5LHH A;  2UXD B;  4Z1V A;  1YDX A;  2CE4 A;  4BIU A;  1DK1 A;  1R3L C;  2XAH A;  1SQX H;  4DUY B;  3H01 A;  1X59 A;  4I0X A;  1OJH A;  3K06 A;  1TUB A;  2LP7 A;  4PDM A;  1SER A;  5LYJ A;  1HNW B;  3BAB A;  5DEC A;  1PPJ H;  1NTM H;  5KMG A;  2CTQ A;  1TUE B;  2Q6A A;  1AB3 A;  3C3S A;  2H3O A;  4MTO A;  4L87 A;  2AHY A;  3H1L H;  4PDR A;  3APQ A;  5HFL A;  1Q5O A;  3OEE G;  3ASO B;  3OTO B;  1SQV H;  3THO A;  3AK1 A;  2ZNJ A;  1WB7 A;  1YI2 V;  1H2S B;  3M8A A;  1M9N A;  1HW7 A;  3H1K H;  3E22 B;  2DMX A;  1B6Q A;  4AHC A;  1EN5 A;  4DV1 O;  3E2E A;  4H0L B;  1VAR A;  1IBM O;  1AR1 B;  2QSA A;  1LUW A;  4OPH A;  3CXC U;  3B8M A;  3JAR B;  2HEP A;  4UB6 Z;  4PI0 A;  1ZAU A;  4MW3 A;  5EIB C;  2GTS A;  3LSQ A;  5H6Q A;  4ZI7 B;  4LR3 A;  1H2G A;  1SQF A;  3F5W C;  4NXM B;  3RFR A;  1OCO C;  2ZDI A;  1I08 A;  3SJC C;  1IXB A;  1PM9 A;  4UCT A;  2PZS A;  4DK0 A;  5JVD B;  1QLE B;  4BW9 A;  3JSL A;  4PA4 A;  4JGS A;  3ZN0 A;  2CH7 A;  3CRM A;  4MVS A;  3CXH F;  2UU9 B;  4DV3 B;  3WG7 B;  4J9Y B;  2AW9 A;  1BSM A;  2JGD B;  2GV9 A;  3VQW A;  4O2A A;  2XAG A;  1WJZ A;  2WLL B;  1K3E A;  3J80 N;  4TV8 A;  1XNQ O;  4LF6 B;  1DLB A;  2ZE8 A;  3CEI A;  1MG1 A;  2B9Z A;  5IWA B;  5K1X A;  5J2U B;  1J5E B;  2QR4 A;  5EZY B;  1IBK O;  2ILM A;  2ZE7 A;  2Q0A A;  1LNQ A;  2CK3 G;  1GAX A;  1GN3 A;  3UKM A;  2QKA A;  4DR3 O;  4TSF G;  4JI3 O;  2IJJ A;  4O2B B;  3SYC A;  3CCR V;  1GK9 A;  3M7M X;  2DYS C;  2EIM C;  2DOS A;  4X62 O;  2BTQ A;  2NN4 A;  5KX5 A;  1Y76 B;  2DYR B;  3B09 A;  2PGG A;  5B1B C;  4LFA B;  2VQF B;  2IJH A;  3ZRX A;  2D3O W;  3RGB A;  1YXB A;  3ABM B;  2QE7 G;  2V7Q G;  4DV6 B;  4H44 B;  3K58 A;  3G4S V;  3WB0 A;  2F43 G;  4NXN O;  2HJD A;  5JJJ B;  2ODM A;  4GZR B;  4JYC A;  1N36 O;  1D2D A;  2EJ7 A;  3AG3 C;  4JI6 B;  3R65 A;  3CPW U;  3CP1 A;  3JSN A;  1VEW A;  1M5I A;  3TK1 A;  4DR1 O;  3OGI B;  5KHG A;  1MSW D;  4O4J B;  1AP5 A;  2Q9L A;  3JD4 A;  4B7K A;  5KAF Z;  3K9A A;  4JAA A;  2Q73 A;  4QJF B;  1Q6I A;  2ITC C;  4LFB B;  1O9H A;  1F4M A;  2F4V B;  3OUS A;  1XL6 A;  2JS3 A;  4W4L A;  1VQ5 V;  2E74 B;  4Z2W A;  1VQP V;  3D36 C;  3D3Q A;  3SYA A;  1XMQ O;  4KHP B;  3QO8 A;  2CAZ C;  2E75 B;  2P4V A;  2QWP B;  2LFR A;  5BMV B;  1FXH A;  1BL8 A;  3KKY A;  4FLW A;  1YCI A;  4LF8 O;  4FM0 A;  1BHA A;  1WPX A;  2CGO A;  2RCV A;  1BZK A;  4JAU A;  2HHH O;  3DC5 A;  3OT7 A;  4B3T B;  2EIN B;  4OX9 B;  3L75 H;  4K0K O;  1H38 A;  1V55 C;  1S5L Z;  3SJA C;  1E79 G;  4WFF A;  4UB8 Z;  3JCZ A;  1WP8 A;  3L70 H;  3N2K A;  2W0X A;  3RVZ A;  2WLH A;  3EXA A;  2BTO A;  4YXW G;  3ZRV A;  5KHI A;  5KAI Z;  1QR8 A;  3E8H A;  3CCL V;  4I55 B;  3T1H O;  2DQ0 A;  2DWD C;  5KA5 A;  4DW0 A;  3PN1 A;  4P2Z A;  1XRE A;  3CS5 A;  2B1I A;  4DRX A;  1NKD A;  3RYH A;  1NR7 A;  1P84 F;  3JAK A;  4X64 B;  1R6T A;  2H8P C;  4ZOL B;  3OTO O;  5H5N A;  1PNM A;  1L0L H;  2YIC A;  4O4I B;  1R6K A;  3QO5 A;  5E79 Z;  2ZR3 A;  1EM1 A;  3CCE V;  4JI2 B;  1SA0 A;  1YHQ V;  1Q6H A;  2YUA A;  4FLY A;  1XEQ A;  2N05 A;  3SYP A;  4WBN A;  1NTK H;  1Z5V A;  3H1I H;  2PI4 A;  4O4L A;  1S5H C;  1ZX3 A;  4MVQ A;  4CS4 A;  2Z3Y A;  1LUV A;  2W0F C;  1TVK B;  1QVF U;  4DW1 A;  2YIB A;  1MAB G;  2IH3 C;  4CH6 A;  5LXT A;  1YTF D;  4R8C A;  5FPO A;  5B1N A;  5EBL C;  1N4C A;  2VQE B;  2DE0 X;  4DV5 B;  1SC5 B;  3DGE A;  1XMO O;  1Q7Y W;  1HDJ A;  4XDK A;  2Q7E A;  1GKF A;  5CB4 B;  1EN6 A;  1WA8 A;  4UFZ A;  3E8B A;  3AG7 A;  1W0K G;  1NR1 A;  1G8M A;  2PI5 A;  1ORQ C;  2XND G;  4DV1 B;  2Y48 A;  2FML A;  2OWO A;  5IDJ A;  5L3G A;  1IBM B;  2H94 A;  2DWE C;  1JA8 A;  1W2B U;  2AGA A;  3L72 H;  4PDL A;  4X1Y A;  1KEC A;  5LP6 C;  4X65 B;  3OMN B;  3SYO A;  3B40 A;  2X6B A;  1FXK C;  4GCZ A;  1S76 D;  4JYY A;  2P7T C;  4EB6 A;  5A2Q N;  1KYO F;  1DF4 A;  4MTX A;  5LMU B;  5FL7 G;  2Z0A A;  4UCS A;  4LF6 O;  4I50 A;  2ZR2 A;  4BR6 A;  1U97 A;  5IWA O;  5B66 Z;  1Y74 B;  3AG4 B;  2P5O A;  5IJ9 A;  1H2N A;  4K8X A;  3FB7 C;  3FB6 C;  1J5E O;  1KC8 W;  2IJI A;  5CA1 A;  2AZ2 A;  4U3J A;  4X1K A;  2YS8 A;  1SZT A;  5LGT A;  1ZSP A;  4O4H A;  1R1B A;  1XIL A;  5GON A;  3MHS C;  1NVP B;  2Q4P A;  4ZKI A;  2LGQ A;  1CPY A;  4JPR A;  1I5Y A;  2YIA A;  3J7A U;  4K3A A;  3BPZ A;  1K73 W;  2X7R B;  1BMF G;  3LNN A;  1M1K W;  5LA6 B;  1XNQ B;  1BHB A;  1PNK A;  3UM7 A;  2XAJ A;  4F4L A;  4GKJ B;  3F7Y C;  1FJG B;  4CS2 A;  3VOU A;  2BOB C;  3LDC A;  5EBW C;  4B7E A;  2YXY A;  4DV6 O;  5B3S B;  4YJ2 A;  3HKD A;  1M57 C;  4TQD A;  1OCR C;  3DXR A;  1CP9 A;  2W6I G;  4DV4 O;  1QLN A;  4LNU B;  2QM7 A;  1CEZ A;  3ASN C;  1ZL8 A;  3JD1 A;  5AG2 A;  3K5M A;  2LFS A;  2QWR B;  1XUQ A;  2UUB B;  3K5O A;  3ZX6 A;  4JI6 O;  1QHT A;  5KLV H;  4I5S A;  1P49 A;  4JI3 B;  4X20 A;  3X2Q B;  3JAW B;  1Q43 A;  2KKW A;  1LR1 A;  4F6R A;  4MTF A;  4NYK A;  4CC6 A;  4P9P A;  1VQN V;  1I94 O;  2R72 A;  4D6T H;  2EBO A;  5D5P A;  2P4K A;  1VMG A;  3FB5 C;  1NBM G;  3L73 H;  2IH1 C;  1Q3E A;  5BXZ A;  1YJW V;  2GHY A;  4KHP O;  1K5Q A;  1HNX O;  4X8A A;  2MK3 A;  2JEX A;  4WFB V;  1RPO A;  4H37 A;  1VF7 A;  4DV0 B;  1MNG A;  4DR1 B;  1X4T A;  2O57 A;  4E4E A;  4QE7 A;  3OD4 A;  1L8D A;  4X66 B;  4OX9 O;  3GWO A;  4RUF A;  4TV9 A;  3NR7 A;  3AG1 C;  2A3Q A;  1D5N A;  1M56 C;  4WFH A;  5DN6 G;  1M90 W;  1KP3 A;  4HZ3 A;  4I0X B;  1SS3 A;  3CRA A;  3H9V A;  2ZM6 B;  4LBE C;  2M6Y A;  1JPX A;  1FXV A;  3ABU A;  1F51 A;  4HAM A;  4YIO A;  5LYJ B;  1VQ7 V;  1XMQ B;  1UPG A;  5KMG B;  5B1A C;  2OCH A;  1AI7 A;  3JAT B;  4RUE A;  1K92 A;  3TJT A;  2IW5 A;  1W59 A;  2HVJ C;  1GN4 A;  4LF8 B;  4RWU A;  2JIZ G;  4IIJ A;  1AI4 A;  1YIJ V;  2WSS G;  3GB7 C;  1DF5 A;  3G6B A;  4X64 O;  3LDE A;  1MA1 A;  2ZT9 B;  5L3E A;  1PL4 A;  4AQY B;  3CC2 V;  2QWO B;  4JI5 O;  1TAE A;  2WLK A;  1EZJ A;  3C90 A;  1YJN V;  4W4K A;  3P3N A;  3ASO C;  4YJ3 A;  4JI2 O;  3EFF K;  2KG7 A;  2DN9 A;  2XAQ A;  4B3S B;  3QVN A;  1HNZ B;  3QG5 A;  3FX7 A;  1BGY H;  3P3P A;  1HWY A;  4B08 A;  3T1H B;  4LF9 B;  1GN6 A;  3SGI A;  4BWA A;  4LFC O;  3RN4 A;  5J2T A;  3JAT A;  4JI1 O;  4EFE A;  2JK5 C;  5LHI A;  1Y6X A;  3FYE B;  1NI8 A;  4PA3 A;  2VQE O;  4NTW A;  3ML0 A;  5JCO C;  4DV5 O;  1WB8 A;  4P30 A;  2EX3 A;  5KA6 A;  1MMM A;  3T4D A;  4UVB A;  1Q86 W;  2PYJ A;  2CH7 B;  1QLE C;  4FLT A;  1VQ9 V;  1WN7 A;  3RBZ A;  4BIO A;  4LF7 B;  1J95 A;  4FIP C;  4O2A B;  4X65 O;  4I7Z B;  4A5U B;  2QTO A;  3APO A;  4TV8 B;  3SDL A;  2UXC B;  3T1C A;  4ZIB A;  1ROP A;  5LMU O;  1AJP A;  1XMO B;  1ZTE A;  4R6Z A;  3N2G A;  1BQZ A;  1JVM A;  5BR8 O;  3HKC A;  1NH2 D;  3K79 A;  2QTS A;  3CCU V;  4ABM A;  3KZI Z;  5CBG A;  4LCU C;  4IYI A;  5EYP A;  1F4N A;  1L1F A;  4R50 A;  3Q4H A;  1ARO P;  2A9H A;  2JJ2 G;  3UT5 A;  1SKV A;  4FFB A;  5FLX N;  2DQ3 A;  3SPJ A;  4D7T A;  2A0L A;  2WWW A;  2BTQ B;  5KX5 B;  2YI9 A;  4AI8 A;  1PP9 H;  1EN4 A;  2DJV A;  3RYI A;  4RQE A;  4MT8 A;  4IHJ A;  2DYR C;  2OIG A;  3O65 A;  4PHZ A;  2VWK A;  4GKJ O;  1GMG A;  4QPJ A;  3SPH A;  1FJG O;  4LH7 A;  2Q69 A;  2QEX V;  3ABM C;  4DV2 O;  5BY1 A;  1QCE A;  4B3R O;  2Q68 A;  2EIJ C;  1XOU A;  3SPI A;  2JS5 A;  4JTD B;  4MTG A;  5CA0 A;  3TXS A;  1NZ6 A;  2UUB O;  4NKG B;  4OGQ B;  2WLJ A;  1VQ4 V;  1Q6U A;  3K0D A;  1R3J C;  2GTA A;  3ETG A;  2Q8V A;  1NJI W;  3CCV V;  2ZIN A;  3ZMU A;  2ZIO A;  3ZRW A;  2CTP A;  4PJ0 Z;  2A7W A;  2IJK A;  2JDI G;  3ETD A;  3K57 A;  3KCX A;  4DV4 B;  2ADQ B;  4DR2 B;  2PF4 E;  3I56 V;  5L3F A;  5EBM C;  1V54 B;  1SQB H;  4DV0 O;  4IYH A;  2OT5 A;  1IX9 A;  1K9M W;  1F23 A;  4CZZ A;  2K9P A;  4X66 O;  5KUM A;  2XHB A;  4JI4 O;  1AJN A;  1YF2 A;  3IGA C;  1ZLZ A;  2EIN C;  4E2L A;  4EEQ A;  3N2K B;  1JX9 A;  2ITD C;  4WFE A;  1I94 B;  2G38 A;  2EIM B;  3FYI B;  3TET A;  1YZB A;  2ZM6 O;  1S0V A;  1S77 D;  3I5D A;  2EIL C;  5A9G A;  4HBN A;  5D5Q A;  1N0J A;  4I9Q A;  3HKE A;  1HNX B;  4DRX B;  3RYH B;  2MW2 B;  2YSU B;  1HR0 B;  3JAK B;  2RN9 A;  1SQG A;  1GM9 A;  2WAM A;  1DTO A;  4GUN A;  3E8F A;  3ETQ A;  4LWS A;  2Q0O C;  4FLU A;  4AQY O;  4LC1 A;  2CTW A;  1SES A;  1SA0 B;  1AR4 A;  3K9S A;  4FZ0 A;  3QO7 A;  2PY5 A;  4JI7 O;  3HKB A;  3W7S A;  1FAF A;  2RMK B;  3ABL C;  4GKK B;  4WBN B;  2Y69 C;  2Q7H A;  4PI2 A;  4FLV A;  1RP3 B;  4B3S O;  1SQQ H;  1HNZ O;  4O4L B;  1QQC A;  3FD9 A;  3AK3 A;  3G6E V;  2OCC B;  1FKA O;  3T2M A;  5EC2 C;  3QNE A;  2JEU A;  3STL C;  2YDE A;  5LXT B;  2ZKO A;  5KHK A;  4X88 A;  1GN2 A;  1XNR B;  1TA8 A;  2QM4 A;  3IAY A;  5IYC O;  3G80 A;  2UUC B;  3E8G A;  4JI5 B;  1WA8 B;  4EKW A;  5CMU A;  2JRI A;  4J7J A;  4OXS A;  2X6A A;  1NT2 B;  1YVW A;  3AG2 C;  4CS3 A;  1THZ A;  4Q6G A;  3BCC H;  3JAL A;  4X1Y B;  3ZMT A;  1PL0 A;  4G27 B;  2Q7G A;  4LF7 O;  2WLI B;  2LO1 A;  3CJH A;  4UVC A;  4LFC B;  4EB6 B;  4JI1 B;  4MVU A;  5CBF A;  2V4D A;  4PA7 A;  5IJ0 A;  2UXC O;  4I50 B;  4G2K A;  1D5A A;  3HPL C;  3D36 A;  2YI8 A;  1WNS A;  2OYQ A;  4PV1 B;  4QGP A;  4IL6 Z;  2Y4T A;  1KQS U;  4I4T A;  5IJ9 B;  4R7C A;  4YIP A;  4DR4 B;  2UXX A;  3JAS A;  5CA1 B;  4UCU A;  2R70 A;  4U3J B;  4TUY A;  3RYF A;  4X1K B;  4O4H B;  5GON B;  2ZQM A;  1AR5 A;  3ZED A;  5J9P C;  2E5L O;  5DM6 V;  4GT1 A;  3K5L A;  1FYJ A;  2QA4 V;  3ZHQ A;  5GTH Z;  3OR7 C;  1YJ9 V;  2HG5 C;  2WLI A;  4PEL A;  5HFM A;  2PYL A;  2X0L A;  1JQ0 A;  3UO2 A;  4B3M B;  5FNV A;  4CBC A;  3JYC A;  1KU9 A;  5GW7 A;  5BR8 B;  4YJ2 B;  3HKD B;  1MZF A;  5B1O A;  3W7T A;  2BCC H;  5L3C A;  3DXR B;  1GH6 A;  3CRR A;  1DGS A;  5LGN A;  4JYA O;  1VP7 A;  1ZL8 B;  1KKC A;  4U3F H;  3BAA A;  4MVR A;  3F5T A;  2FKX A;  3FFQ A;  5IY5 C;  3AEI A;  3MAQ A;  4KP4 A;  3TCU A;  4X20 B;  4C7U A;  5LGU A;  1H8E G;  5JQG A;  2KQX A;  2RJZ A;  4F6R B;  1RSO A;  1L0N H;  3CRQ A;  2OIE A;  2R9A A;  3X2Q C;  3OMA B;  4DK1 A;  1PNL A;  4DXW A;  1QBZ A;  4J7K A;  4N21 A;  2EIK C;  1OZ0 A;  1SQP H;  4JI0 B;  2LQT A;  3ETE A;  4JTA B;  2WLM A;  3BY6 A;  4DV2 B;  3CMA V;  3OTF A;  2BSK A;  2P6J A;  4B3R B;  3BRC A;  2YEV A;  4FVM A;  3ABK C;  4DR2 O;  2HVK C;  1QNM A;  2FL4 A;  2CDY A;  4U7O A;  3K08 A;  1PKX A;  3OEH G;  1UJW B;  1FD9 A;  3L9D A;  2ZE6 A;  3ABT A;  3EVK A;  1I7F A;  4TV9 B;  3QF7 A;  3J81 N;  5L3B A;  5JH7 A;  1Y67 A;  1Q81 W;  3VQY A;  1OCZ B;  3DC6 A;  4JV5 B;  4FMT A;  3T4Z A;  3GWK C;  1K34 A;  5LP6 A;  2AZ0 A;  1FXK A;  3OMI B;  1WAZ A;  5TIS Z;  5B5E Z;  5E1A C;  3WFV A;  1KB9 F;  2ZXW C;  3JCU Z;  5IT9 N;  1PD3 A;  4IIJ B;  5F2V O;  4JAS A;  1HR0 O;  1N34 O;  2QWQ B;  3ZHT A;  1FFX A;  3E86 A;  2JGU A;  3RYC A;  1OCC C;  3UCS C;  4JI4 B;  5L3D A;  3FAV A;  3W7U A;  1EBO A;  4ZBM A;  1XL4 A;  1NVP D;  4YJ3 B;  2KG7 B;  1N0N A;  3DSQ A;  1K33 A;  4GKK O;  1G6U A;  2P90 A;  2LW7 A;  2RQ6 A;  1XHZ A;  3CYO A;  3STZ C;  5IYZ A;  3B2E E;  1IBL O;  3ZCC A;  4CC5 A;  1GRJ A;  5C93 A;  4Q20 A;  1B06 A;  4K35 A;  5EC1 C;  4GX0 A;  2D2C B;  3BA9 A;  1K7D A;  5J2T B;  4QE9 A;  1IDS A;  4NVP A;  4ZHQ A;  1XNR O;  3K0G A;  4BIZ A;  3U0Z A;  1QU7 A;  2M7W A;  2UUC O;  4H13 B;  3IJ4 A;  3OW2 U;  1H2L A;  2ZDI C;  1RM1 B;  2Y0I A;  4JI7 B;  4GYC B;  1FFT B;  1H2M A;  1JFF A;  1S3J A;  3JD0 A;  3OM3 B;  4GX2 A;  3IC9 A;  1U96 A;  4X1I A;  1JCH A;  2Y0P A;  4LF9 O;  1GM7 A;  2XUM A;  3UQ8 A;  3D8C A;  2GUZ A;  2YC0 A;  5H2F Z;  1VQ6 V;  4FLZ A;  5H6R A;  5FPR A;  1RPR A;  1I0H A;  4FFK A;  4UUJ C;  3IFX A;  5B1A B;  1XHX A;  3N2G B;  1EZV H;  1N33 O;  1S72 V;  3HKC B;  1Q82 W;  5EK0 A;  1KBH A;  4OPA A;  1NQT A;  4QIW F;  4DR4 O;  3G67 A;  3CB2 A;  1MOF A;  4U7N A;  2E3C A;  2QKC A;  1MSD A;  4LF5 B;  3BVO A;  4MVM A;  2R9I A;  5EYP B;  3CC7 V;  2QDO A;  3Q4H B;  3UT5 B;  3ZHS A;  3OAA G;  2ETN A;  4FFB B;  2ZD9 A;  4KXR A;  4HNA A;  4MVO A;  3T1Y O;  4F6E A;  3K3W A;  2EZP A;  3U11 A;  2P06 A;  3ICX A;  3W7X A;  3RYI B;  3OR6 C;  5IE9 A;  2WLN A;  4B3M O;  5LMN O;  3WG7 C;  3JD3 A;  1Z2G A;  4IHJ B;  2UXB O;  4GX5 A;  1NU1 H;  1O9G A;  4H33 A;  3LNM B;  4QPK A;  3OFN G;  1YEW A;  5LOV B;  3LDD A;  2GSM B;  4JTC B;  4TT3 G;  1JR9 A;  4IT5 A;  5CA0 B;  1ENV A;  5DED A;  1URF A;  1V9P A;  2E5L B;  4IGG A;  1WLE A;  2IBZ H;  4XDJ A;  2PUS A;  1NTZ H;  2EZO A;  1B3Q A;  2YXH A;  3E22 A;  4WF9 V;  2LGW A;  1AP6 A;  2UUA B;  1XQ8 A;  4DV7 O;  1SET A;  3ZRW B;  3QTC A;  5KHJ A;  2JVD A;  1R3I C;  4JZG A;  4JI0 O;  2VRZ A;  3H1J H;  4JYA B;  3JAR A;  1KP2 A;  3P30 A;  2YXL A;  3UO3 A;  1H2K A;  1SF9 A;  5LOV A;  1OCO B;  1N32 O;  5JCO A;  3SR2 C;  2FYU H;  2K1E A;  3M99 B;  4YHH B;  1JJ2 U;  3CRC A;  3BHP A;  3CHX A;  1QVG U;  4UCV A;  3RVY A;  1EFR G;  5KHH A;  4ZI7 A;  3E83 A;  3KCY A;  2PTM A;  2XT9 A;  1V54 C;  5ITZ B;  4DR7 B;  4X9Q A;  3O9O A;  2Y4U A;  2HP8 A;  2R9R B;  3P32 A;  2XAF A;  5JVD A;  4DUZ B;  5CN0 A;  1YSC A;  4JI8 B;  1AVM A;  1R3K C;  2RDC A;  1W0J G;  4JV5 O;  4LF4 O;  2HJF C;  2LW1 A;  3HKE B;  1VF6 C;  3K5N A;  2JGD A;  1GM8 A;  3SPC A;  5LHG A;  3K04 A;  4KUM A;  2WLL A;  2YID A;  1FS0 G;  1BT8 A;  2EIJ B;  1P7B A;  3CWB H;  2VS0 A;  1T5E A;  1VIB A;  1AI5 A;  1P4R A;  3LSS A;  2P22 C;  4BAY A;  3TGU H;  4LWS B;  4J11 A;  5ITZ A;  3VBB A;  1ZWI C;  5J2U A;  3ZMS A;  5K1P A;  4FM1 A;  1CXZ B;  2XTA A;  1XDC A;  5EZY A;  4YY3 B;  3HKB B;  4DR5 B;  1MZE A;  2DYS B;  4J42 A;  1UFI A;  3WB2 A;  4FPP A;  5B1B B;  4UCO A;  1Y66 A;  2A79 B;  2KB1 A;  2QM8 A;  4O2B A;  2CTR A;  3JAM N;  4MVZ A;  1Y76 A;  4GX1 A;  3A0R A;  3S3X A;  1I5X A;  1SZX A;  4AIL C;  5EIB D;  1KD1 W;  2OCC C;  2XOK G;  1N34 B;  2W6J G;  4FM2 A;  4TQF A;  4JZ2 A;  3R66 A;  5LL6 Y;  3ZRS A;  1YTF B;  4JF3 A;  1HP8 A;  3AG3 B;  3ZMZ A;  1OHH G;  3CME V;  2QWN B;  2B1G A;  2FB5 A;  3SYQ A;  1AI6 A;  2A06 H;  5H9C A;  2N74 A;  3EHB B;  4DO2 A;  3OE7 G;  3SJB C;  3OGC C;  4MS2 A;  4DYL A;  1AIL A;  4LP8 A;  1R6N A;  4FLX A;  1IBL B;  3JAL B;  5IYD O;  1TGO A;  3K03 A;  4DR6 B;  5BZB A;  1IUR A;  1Q8I A;  2EJR A;  4O4J A;  4ICG A;  3CJH B;  2UXD O;  4UV9 A;  1VQK V;  1JJO A;  2EIL B;  2JJ1 G;  5IJ0 B;  4K8Z A;  1P7G A;  4X89 A;  1K8A W;  4DUY O;  4CH5 A;  1K4C C;  4XDL A;  1VF6 A;  4PD4 F;  2QKS A;  2GBO A;  4N23 A;  1K97 A;  4I4T B;  1VQM V;  3AK2 A;  4NTX A;  4FK5 C;  4WCE V;  3JAS B;  1HNW O;  4UXN A;  1G1X B;  3B8N A;  4TUY B;  3RYF B;  3ZHU A;  2HR3 A;  2L6L A;  5BMV A;  3A0B Z;  2OTJ V;  4LF5 O;  3L71 H;  3BFR A;  3BEH A;  1V55 B;  3E89 A;  4FJC C;  1G4Y B;  2ZE5 A;  3ZHR A;  3B4S A; 
#chains in the Genus database with same CATH homology
 2DYR B;  2JK5 C;  5LHI A;  2FTK A;  3ABL B;  4QNH B;  5B1B C;  4Z1M G;  2NLJ C;  1R73 A;  2Y69 B;  3ABT A;  2IJH A;  3FYE B;  3ZRX A;  4PA3 A;  2D3O W;  3ABM B;  3ML0 A;  4P30 A;  3D3I A;  5L3B A;  2QE7 G;  2V7Q G;  1Q81 W;  3G4S V;  1OCZ B;  5KA6 A;  4FMT A;  3CCM V;  2F43 G;  3T4Z A;  1K34 A;  2HKO A;  4G28 B;  3T4D A;  4JYC A;  4UVB A;  1Q86 W;  1VQO V;  2OTL V;  1FXK A;  1GO3 F;  3OMI B;  4UV8 A;  1QLE C;  3AG3 C;  3KG2 A;  3R65 A;  3CPW U;  1VQ9 V;  3CP1 A;  3B77 A;  5E1A C;  3RBZ A;  3AG4 C;  3TK1 A;  3WFV A;  3RW0 A;  3MHH C;  1J95 A;  5CA3 A;  4FIP C;  3G71 V;  1MSW D;  2ZXW C;  1PD3 A;  2QTO A;  4JAS A;  3JD4 A;  3PJS K;  3T1C A;  1ROP A;  3K9A A;  3AG2 B;  4QJF B;  3E86 A;  1AJP A;  1COW G;  2P67 A;  2ITC C;  4MSW C;  4HYO A;  1OCC C;  4R6Z A;  5L3D A;  1F4M A;  1JVM A;  3IC7 A;  3ZN1 A;  4MW8 A;  3W7U A;  1EBO A;  4ZBM A;  1YIT V;  1IXM A;  1XL4 A;  1NH2 D;  3K79 A;  3OUS A;  1XL6 A;  1NVP D;  1VQ5 V;  1VQP V;  3CCU V;  3SYA A;  3CD6 V;  1K33 A;  5CBG A;  3QO8 A;  1AJQ A;  3HB3 B;  4WFG A;  2P90 A;  4LCU C;  3CYO A;  2YEV B;  3STZ C;  2LFR A;  1F4N A;  2IU3 A;  3ZCC A;  1L1F A;  2BOC C;  5C93 A;  1FXH A;  1BL8 A;  4Q20 A;  1ARO P;  2A9H A;  2JJ2 G;  4PA9 A;  4R50 A;  5EC1 C;  4GX0 A;  1BHA A;  1WPX A;  2DQ3 A;  1K7D A;  5B3S C;  3SPJ A;  2Z5U A;  2A0L A;  2WWW A;  4JAU A;  1SRY A;  4QE9 A;  5CBH A;  2EIN B;  4JYB A;  1H38 A;  1V55 C;  1E79 G;  1N8R W;  4WFF A;  3K0G A;  3I55 V;  4RQE A;  4BIZ A;  4MT8 A;  1K4D C;  3JCZ A;  2DYR C;  2XAS A;  4RO2 A;  1Y4M A;  2M7W A;  1GMG A;  4QPJ A;  3SPH A;  3RVZ A;  2WLH A;  3OW2 U;  2Q69 A;  2QEX V;  2ZDI C;  3ABM C;  1RM1 B;  3F7V C;  1QCE A;  4YXW G;  3ZRV A;  1FXK B;  1FFT B;  2Q68 A;  1QR8 A;  2EIJ C;  1S3J A;  3E8H A;  1OCZ C;  3CCL V;  3SPI A;  3JD0 A;  3OM3 B;  5KUK A;  4GX2 A;  2DQ0 A;  2DWD C;  1E1R G;  4JTD B;  4MTG A;  4P2Z A;  5KA5 A;  1JCH A;  1GM7 A;  2B1I A;  1NKD A;  1NR7 A;  3CC4 V;  3FB8 C;  2WLJ A;  3ZIA G;  4WFA V;  1VQ4 V;  1K5S A;  2C2A A;  2UXN A;  3K0D A;  1VQ6 V;  2H8P C;  5H6R A;  1RPR A;  1R3J C;  4UVA A;  4UUJ C;  3ETG A;  3IFX A;  1NJI W;  4J9Z B;  1PNM A;  3CCV V;  5B1A B;  1VQL V;  1R6K A;  3QO5 A;  5IY5 B;  4XBF A;  1S72 V;  2ZR3 A;  3CCE V;  3ZMU A;  1Q82 W;  5EK0 A;  2NNU A;  4KFM A;  3ZRW A;  1YHQ V;  1JOY A;  3SPG A;  1NQT A;  4QIW F;  4PDV A;  2IJK A;  2JDI G;  3SYP A;  1MOF A;  4U7N A;  3ETD A;  3W7W A;  3JD2 A;  2PI4 A;  1S5H C;  4MVQ A;  4MVM A;  3I56 V;  2R9I A;  5L3F A;  4I9W A;  2Z3Y A;  5EBM C;  3CC7 V;  1GTO A;  1V54 B;  2W0F C;  3OAA G;  4JAV A;  1QVF U;  2ZD9 A;  3ZJZ A;  2EIK B;  1MAB G;  2IU0 A;  2IH3 C;  4RQF A;  4MVO A;  1YTF D;  4R8C A;  2OT5 A;  1K9M W;  1F23 A;  2WPD G;  5B1N A;  4CZZ A;  3K3W A;  2EZP A;  4RAI A;  5EBL C;  1M57 B;  2V1D A;  5KUM A;  1OCR B;  3DGE A;  1Q7Y W;  3CCJ V;  3W7X A;  4XDK A;  1AJN A;  3ABK B;  2WLN A;  3OR6 C;  3WG7 C;  3JD3 A;  3IGA C;  3ASN B;  1GKF A;  4PA6 A;  1H8H G;  2EIN C;  4E2L A;  4GX5 A;  3E8B A;  1JX9 A;  2ITD C;  4WFE A;  1W0K G;  1NR1 A;  2EIM B;  4H33 A;  3FYI B;  1G8M A;  3LNM B;  2PI5 A;  3TET A;  1ORQ C;  2XND G;  3E35 A;  4QPK A;  1S0V A;  1KKD A;  1S77 D;  3OFN G;  4P9O A;  2Y48 A;  3ZMV A;  5IDJ A;  2EIL C;  3FKS G;  5L3G A;  2H94 A;  2DWE C;  3LDD A;  3CCQ V;  2GSM B;  4JTC B;  4TT3 G;  2Q67 A;  1W2B U;  4PDL A;  1RM1 C;  1KEC A;  3LUT B;  1ENV A;  3OUF A;  3OMN B;  3SYO A;  2X6B A;  1FXK C;  4GCZ A;  3MD0 A;  1S76 D;  1WLE A;  2YSU B;  2P7T C;  1DF4 A;  4MTX A;  4BW5 A;  5FL7 G;  1GM9 A;  3CCS V;  2WAM A;  2X6C A;  4XDJ A;  1DTO A;  4ASU G;  3E8F A;  5IYB O;  2ZR2 A;  5LBQ A;  2EZO A;  2ATK C;  4WF9 V;  3AG4 B;  4LC1 A;  1SES A;  3DTU B;  3FB7 C;  1SET A;  3ZRW B;  3FB6 C;  2ZXW B;  3QO7 A;  1KC8 W;  2IJI A;  2HFE C;  3W7S A;  1R3I C;  3ABL C;  2Y69 C;  1SZT A;  1NH2 B;  4TWK A;  5LGT A;  1KP2 A;  3P30 A;  3MHS C;  3SJQ C;  1NVP B;  3NXS A;  1E1Q G;  2AHZ A;  4ZKI A;  3G6E V;  1OCC B;  1CPY A;  2OCC B;  1QR9 A;  4JPR A;  1I5Y A;  1OCO B;  2B5U A;  2HLD G;  1VQ8 V;  3T2M A;  2K1E A;  3AG1 B;  5EC2 C;  2DW4 A;  3M99 B;  1JJ2 U;  3QNE A;  2JEU A;  3STL C;  1M56 B;  1K73 W;  2X7R B;  1QVG U;  1BMF G;  3RVY A;  1EFR G;  5LHH A;  1M1K W;  4X88 A;  3E83 A;  1BHB A;  1V54 C;  1PNK A;  3UM7 A;  2XAJ A;  4BIU A;  4F4L A;  2R9R B;  1R3L C;  5IYC O;  3F7Y C;  2XAH A;  3P32 A;  3H01 A;  2XAF A;  3E8G A;  2BOB C;  3VOU A;  3LDC A;  5EBW C;  4EKW A;  5CMU A;  5CN0 A;  1YSC A;  5B3S B;  4OXS A;  1M57 C;  1OCR C;  1R3K C;  1W0J G;  3K06 A;  2LP7 A;  1CP9 A;  2W6I G;  4PDM A;  1QLN A;  2QM7 A;  1SER A;  2X6A A;  1CEZ A;  3ASN C;  3AG2 C;  3JD1 A;  1THZ A;  2LFS A;  2HJF C;  1TUE B;  2Q6A A;  1GM8 A;  4I5S A;  3SPC A;  3ZMT A;  1PL0 A;  4G27 B;  2WLI B;  5LHG A;  3K04 A;  4KUM A;  2WLL A;  4UVC A;  3X2Q B;  4MTO A;  4L87 A;  2AHY A;  4PDR A;  4MVU A;  1FS0 G;  5HFL A;  3OEE G;  3ASO B;  5CBF A;  4PA7 A;  4MTF A;  2EIJ B;  1P7B A;  4G2K A;  1YI2 V;  3HPL C;  3D36 A;  1AI5 A;  1P4R A;  3LSS A;  4P9P A;  4BAY A;  1M9N A;  1VQN V;  3VBB A;  1KQS U;  1ZWI C;  1B6Q A;  3ZMS A;  4R7C A;  2EBO A;  3FB5 C;  3E2E A;  2UXX A;  1NBM G;  2IH1 C;  1AR1 B;  2DYS B;  3CXC U;  1YJW V;  2GHY A;  3B8M A;  1K5Q A;  2ZQM A;  4X8A A;  4FPP A;  2MK3 A;  5B1B B;  2JEX A;  4WFB V;  5J9P C;  1Y66 A;  1RPO A;  2A79 B;  2KB1 A;  2QM8 A;  5DM6 V;  4GT1 A;  4MW3 A;  4H37 A;  4MVZ A;  2QA4 V;  3LSQ A;  4GX1 A;  4QE7 A;  3A0R A;  3OR7 C;  5H6Q A;  1I5X A;  1YJ9 V;  2HG5 C;  2WLI A;  1H2G A;  4PEL A;  5HFM A;  1KD1 W;  3F5W C;  3GWO A;  2OCC C;  2X0L A;  1JQ0 A;  2XOK G;  4RUF A;  1OCO C;  2ZDI A;  2W6J G;  3AG1 C;  4CBC A;  3JYC A;  4WFH A;  1M56 C;  3ZRS A;  1YTF B;  4JF3 A;  5DN6 G;  1M90 W;  5GW7 A;  1KP3 A;  1QLE B;  3AG3 B;  4HZ3 A;  3ZMZ A;  1OHH G;  3CME V;  5B1O A;  4LBE C;  3W7T A;  2B1G A;  5L3C A;  3SYQ A;  1JPX A;  1FXV A;  3ABU A;  5LGN A;  1F51 A;  4PA4 A;  4HAM A;  1AI6 A;  4JGS A;  3ZN0 A;  1VQ7 V;  5H9C A;  4DO2 A;  3EHB B;  3OE7 G;  3OGC C;  4MVR A;  4MS2 A;  4MVS A;  5B1A C;  4LP8 A;  3WG7 B;  1AI7 A;  1R6N A;  4J9Y B;  4RUE A;  1K92 A;  5IY5 C;  2IW5 A;  5IYD O;  3K03 A;  2HVJ C;  3AEI A;  4KP4 A;  5BZB A;  2EJR A;  3TCU A;  2XAG A;  2JIZ G;  2WLL B;  1K3E A;  1AI4 A;  5LGU A;  1YIJ V;  1H8E G;  2WSS G;  4UV9 A;  1DLB A;  3GB7 C;  1VQK V;  1DF5 A;  2EIL B;  2JJ1 G;  3LDE A;  5L3E A;  1MG1 A;  4X89 A;  1K8A W;  1K4C C;  4XDL A;  3CC2 V;  2WLK A;  3OMA B;  1EZJ A;  3X2Q C;  1PNL A;  2QKS A;  1YJN V;  4DXW A;  4N23 A;  1K97 A;  1QBZ A;  4N21 A;  2EIK C;  3ASO C;  1OZ0 A;  1VQM V;  3EFF K;  4FK5 C;  2XAQ A;  4WCE V;  3ETE A;  4JTA B;  2WLM A;  3B8N A;  3BY6 A;  4UXN A;  3CMA V;  2HR3 A;  2P6J A;  1LNQ A;  2CK3 G;  2YEV A;  3ABK C;  2OTJ V;  1HWY A;  3UKM A;  2HVK C;  3BEH A;  1V55 B;  3E89 A;  4TSF G;  2IJJ A;  4FJC C;  4U7O A;  3K08 A;  1G4Y B;  1PKX A;  3SYC A;  3CCR V;  1GK9 A;  3OEH G;  1UJW B;  2EIM C;  2DYS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...