2GHYA

Novel crystal form of the cole1 rom protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
57
structure length
57
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel crystal form of the ColE1 Rom protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulatory protein rop
total genus 24
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ghyA00
4DO2A 2IJIA 1GMGA 1ROPA 1RPRA 2IJJA 3K79A 1PD3A 1GTOA 1RPOA 2IJKA 1NKDA 2GHYA 1B6QA 1F4MA 1F4NA 2IJHA
chains in the Genus database with same CATH superfamily
3BEHA 4JTAB 2Q0OC 2EIJC 2ZE5A 2ZIMA 1KKDA 4DK1A 4HZ3A 4U3FH 4WFFA 3ZIAG 3CS5A 1EN6A 4XBFA 1J5EB 2CGNA 5JJEB 1KC8W 4Z1VA 3LNMB 2E74B 3AG1C 3LDEA 4N23A 3UO3A 4QNHB 3OTOB 2Q7GA 3EHBB 2EJRA 3FYIB 1H2GA 5LXTA 4JI5B 2P90A 3GWKC 4X65O 1NR7A 1FKAO 4KL1A 4JYCA 3GWOA 3LNNA 4KP4A 4O2BB 4TUYB 4F6RB 1BT8A 1QR9A 1N36B 4CH3A 1N8RW 1JFFA 2CUGA 4MW3A 3BCCH 3EFFK 1H8EG 4I7ZB 4YJ3A 5IYDO 1KMIZ 4I55B 4W4LA 2V7QG 1VQLV 3VQVA 3E83A 2ZT9B 4DR2B 4P9PA 3TCUA 3D3IA 3WB0A 5B66Z 1EFRG 1SKVA 1UFIA 2AHYA 2A0LA 1GTOA 4U3JB 5LOVA 3CCRV 4LWSA 2Q7EA 4DV7B 2BTQB 1QVGU 1R6KA 3RFRA 1WPBA 3R66A 5EBMC 1MZFA 5JH7A 1FJGO 1QLEC 2P7TC 3IC7A 4JI6B 2RDCA 3ASNB 4DR2O 4HAMA 3H1HH 5IJ0B 2WLMA 5EIBD 4JYBA 2HLDG 2UXXA 3RVYA 4PELA 2QWRB 2BSKA 3ZRVA 2YXLA 1FFTB 1XNRB 4JYAO 2Z0AA 2R72A 1W0JG 4WF9V 4PI0A 1AILA 3P30A 5B1BC 1Q43A 1YCIA 4YY3B 2PGGA 4DV5B 1XHZA 1MOFA 2X6AA 3OTFA 5FPRA 1N4CA 2GUZA 3PJSK 1K34A 1YVWA 2YIAA 4UCVA 3WU2Z 2CE4A 3ETEA 4DW0A 4XDLA 1DK1A 1M57C 1WA8A 4RUFA 3RGBA 2R70A 4QE7A 2KKWA 3JCZA 4CH5A 1FS0G 3BFRA 5H9CA 2DQ0A 4K0KO 3MD0A 5DECA 3BY6A 1GN6A 1D5NA 5JJNB 4F6RA 4LF7O 4I9QA 3AG1B 3X2QB 4DUZB 4P2ZA 1FD9A 3RYCA 5LYJA 1VQPV 4Q6GA 4DUZO 1Y74B 2OCHA 4J7KA 4B3MO 1V55C 1R73A 3L71H 4JTDB 2Q67A 3CWBH 1Y74A 4H37A 1WJZA 2YUAA 5HFMA 4MVOA 4ZIBA 1GO3F 1SQGA 1DTOA 3R65A 1YI2V 5LP6C 3CXCU 3JATB 3ZRWA 2VQEB 1OCRC 3ZHRA 4KUMA 4CH6A 3FFQA 1FYJA 2Q0AA 2F4VO 4CS4A 4RWUA 2X0LA 2YSUB 1E1RG 1QR8A 3HKEA 3VOUA 1G4YB 1RM1B 3AK2A 4N21A 4UUJC 1HR0O 4DR7O 4X66B 5EC2C 3ABLC 4JYAB 5K1PA 3B09A 2OTJV 3A0RA 3JCUZ 1VQOV 1PM9A 3SYQA 4X64B 5FL7G 5J2TB 3ZRXA 1K5QA 3EXAA 2B1IA 5CA0B 1S5JA 4DV3O 3CB2A 2P67A 1WN7A 4FFKA 3T1YO 4QJFB 1XQ8A 1RM1C 2LO1A 5JCOC 2Q69A 4U3JA 4UV9A 5LOVB 4BW9A 1GMGA 4O4HA 1DF4A 3OFNG 4FM1A 1IBKO 4WFAV 4J11A 3OAAG 3HKCA 3K9SA 3U10A 5JH7B 5GW7A 5LL6Y 4LNUA 1MNGA 5IY5C 1IURA 2UUCO 4NB5A 4LFCB 1SQPH 3VQYA 5LMUB 1BE3H 4DV1O 1WLEA 2QM7A 2MW2B 3RBZA 2P5OA 2A06H 1FPOA 5JJJB 4DXWA 2PYLA 3HKDA 2JGDA 3SJAC 1I94O 1TUBB 1CXZB 4FPPA 1VQ9V 4IIJA 4OX9O 1JOYA 3CC7V 1P4RA 2YICA 3DC6A 1U97A 4LFCO 3A0BZ 3B40A 3SJQC 3WB2A 1MG1A 4WFEA 4J9YB 3QO5A 3F5TA 3JATA 1VQ8V 1SQBH 2A3QA 2F23A 1Y66A 1IXBA 5KUKA 1JFFB 3H1IH 2PF4E 1JQ0A 3RYHA 5F2VO 2LQTA 3K5MA 1ZUQA 3DC5A 2WPDG 2K9PA 2VS0A 2ADPA 2ZDIC 5FLXN 1HNZO 1EBOA 2EINB 4X88A 4K0KB 1F51A 5HFLA 3MHHC 2WLHA 5B3SB 3ASOC 5KX5B 1ZSPA 4HNAB 2LW7A 5ITZA 1EM1A 3BA8A 1RSOA 1TVKA 4DR7B 2Q4PA 4O4LB 1XBLA 2IJIA 1ROPA 1K5SA 3CJHA 1MA1A 3ABLB 1PNLA 2XUMA 4JI8B 1BQ0A 1ZX3A 1MZEA 1GM7A 1M56B 5C8YA 3ZN1A 2D2CB 1XEQA 4X1YB 3ABTA 2HHHO 1TVKB 4ZHQB 1OV9A 1HNXB 1PV0A 2ZE6A 1E1QG 4DV6O 2CTPA 5E1AC 1A32A 3RYFB 4I9WA 2UUCB 3K03A 3ZS8C 3OMAB 1R6TA 1SS3A 2ZE7A 2DMXA 1N34B 2DYSB 3DSQA 4Z1MG 3E2EA 4UCOA 2V1DA 2P06A 2IH1C 5JCOA 4FZ1A 2JS3A 2Q9LA 4YHHB 5IJ0A 2XAHA 1YTFB 4E2LA 3ML0A 1S3JA 4HYOA 2L35A 1NKDA 2YIBD 3KCXA 3SPHA 4PI2A 5LMNB 3W7XA 2YXYA 1NVPD 1EZVH 1V54B 4YIOA 2AHZA 1KUQA 2YC0A 1IBMO 4FLVA 5B1AB 4IYIA 3FD9A 4NKGB 1Q3EA 1NR1A 1D5AA 3K08A 1GK9A 4UCSA 3T4DA 3L74H 5CA1B 4JI7O 2Q6AA 5B1NA 1XNQB 3QNEA 3LSSA 4GX0A 3CP1A 4EEQA 2QKAA 5LHIA 4I50B 3IC9A 3HKDB 2C2AA 2PI5A 1KQSU 3UO2A 5LMUO 2R9IA 2RCVA 4TUYA 3IFXA 3IJ4A 2LJ2A 1HR0B 3K9AA 3CJHB 2KB1A 4ZI7B 3APOA 4B3MB 1ZWIC 3TXSA 2GTSA 4YHHO 2B1GA 2JK5C 3SPIA 1DGSA 1IBLB 4NTWA 2W0FC 3HKCB 4GKKO 2R9RB 2LGQA 5C8YB 1K97A 3FKSG 4BW5A 5LA6A 4F4LA 2RN9A 5J9PC 4J7ZA 3JAMN 3I5DA 2BTQA 3ETQA 2HJFC 2EZPA 4AI8A 4JAUA 1LNQA 1S5HC 1SQVH 1Z5WA 4X62B 2HVJC 1I7FA 4TOIA 4TQFA 2IU3A 4UXNA 1P7GA 2OIGA 3L9DA 3JAKB 3AG3B 4OPAA 3IGAC 3F5WC 2ADQB 4DV2O 3TK1A 4B08A 4JI1B 2DWDC 2M7WA 2EIKC 3TJTA 2XASA 3CCVV 4O4LA 1NS1A 3K3WA 2PYJA 3CYOA 4X89A 1XOUA 2GV9A 3T1HB 2UXDB 1IX9A 4BAYA 3QVNA 3D36C 1KECA 5KX5A 2ITCC 2QM8A 3JARA 2YI9A 3AG4B 2B5UA 1SRYA 1OZ0A 2K1EA 2UUAO 4I0XA 3NXSA 5D5PA 2DWEC 1S72V 4OX9B 3H1JH 4DV2B 3P3NA 1JA8A 4EB6A 1WA8B 3ABKC 1B06A 2WLKA 4DRXA 2E76B 1ORQC 3AG2B 3CE2A 2F4VB 3T1CA 2JEXA 2F1MA 5LYJB 4DV3B 4D7SA 2WLJA 4WFBV 2RNBA 4YJ2A 1LR1A 2CTWA 1D2DA 1CP9A 4H13B 2DN9A 1MABG 4TV8B 4WBNB 1IBKB 1YXBA 2IM9A 3ZMSA 4JI4O 4LNUB 4AILC 4IIJB 4MTFA 3O65A 2IW5A 1AI7A 1XHXA 5A2QN 2CH7B 2CK3G 3ZHTA 1VQ5V 4NXMO 1PKXA 3ZMUA 2CH7A 3SYAA 2EILC 4CZZA 1M90W 1Q6UA 4DUYB 3U0ZA 1B04A 2AW9A 2DOSA 3AK1A 1OCZB 1Z5VA 2LGWA 1YTFD 4FLTA 4MT8A 4R50A 3OTOO 2CTQA 2DYRB 2BCCH 5CBFA 2ZNIA 4PA7A 1OCZC 1AP6A 2VWKA 2CDYA 2NNUA 4U7OA 2XTAA 4C7UA 3RT3C 1GRJA 1NVPB 5J2UA 2ZE8A 1WP7A 2P22C 4LF7B 1NH2D 1I0HA 1R3JC 4YXWG 2WSSG 5CMUA 1JVMA 1M4UA 2GSMB 1TA8A 1SA0B 2QTSA 3CRQA 5KMGB 1GN3A 3MHSC 3G4SV 1ENVA 2HKOA 5KHGA 3SYCA 2A79B 1K4CC 1JCHA 2NLJC 3JARB 4X1YA 2YEVB 5E79Z 4I55A 4WCEV 2PTMA 3RN4A 1I5YA 4DV7O 3H1LH 2YIBA 1S0VA 4GCZA 1EN5A 3OUFA 3DGEA 3EVKA 4TWKA 4X65B 4LCUC 1EN4A 5LXTB 4X9QA 1JX9A 1AI5A 4DR1B 2WLLB 4K3AA 2Q8VA 2Z3YA 1SZXA 4RUEA 4JI3O 3W7TA 1QLEB 1HWYA 2YDEA 2WLLA 3CCMV 1RPRA 1YDXA 3CSXA 3CXHF 5B3SC 2CGOA 4H44B 1YJNV 3ZHUA 2ZM6B 2IJKA 3OM3B 1XREA 2QGNA 2Q68A 4UVBA 1CPYA 4DR6B 1PP9H 3H9VA 1Q82W 3ETGA 1K7DA 2MK3A 1TUEB 3SPCA 4FM0A 1N0JA 5DEDA 1N33O 3OEEG 4LR3A 5FNVA 4XDKA 2EIMC 2QA4V 1VQNV 3T2MA 2KSDA 2BOCC 4HBNA 1XI1A 1BGYH 5GONB 2Z5UA 4UB6Z 1NJIW 2EBOA 5EZYB 4B3RO 4MW8A 2X7RB 4W4KA 2OWOA 3ASOB 1URFA 1NH2B 1XILA 2M6YA 2ZINA 4ABMA 3QG5A 1F7YA 1ZAUA 1FXVA 1S76D 1H38A 4FMTA 5EBWC 4XDJA 3Q4HB 2EIKB 5L3GA 5KAFZ 4L8JA 3JD3A 2FB5A 1VF7A 4QE9A 4G2KA 2H3OA 4JV5O 1YIJV 2CTRA 3RYIB 1BSMA 4J42A 4YJ3B 4ASUG 3JD0A 4TSFG 2HJDA 4O4HB 4DR3O 2P4VA 3QTCA 2UUBB 3FAVB 3THOA 1BS3A 3ABKB 3VQWA 4PDVA 4MVQA 3L70H 5B1OA 4EFEA 1NT2B 4QGPA 2ZDIA 2ARHA 2N74A 5GTIZ 3FB5C 4WBNA 4DK0A 4GKJO 1OCCC 4JI7B 2JJ1G 5FNVB 4PA9A 4JI4B 5L3DA 5B1AC 1BZKA 4CBCA 1JPXA 5C93A 5KHKA 1OCOB 2JIZG 1XUQA 3S3XA 3CMAV 3U11A 3J81N 1Q7YW 4DR5B 1GH6A 4PD4F 2OCCC 4KFMA 2KG7A 4O4JB 4GX5A 3C90A 2IU0A 4GUNA 1IBLO 2JVDA 4FVMA 1KD1W 4LF6O 5IJ9A 1YZBA 2GUZB 2XT9A 2UU9O 4NTYA 4PA6A 4AHCA 2Y48A 3RW0A 3D8CA 3LUTB 3K5LA 3ZX6A 4J7JA 5LP6B 3VQXA 3TXQA 2EILB 4LBEC 3SGIA 3K06A 3FX7A 3G67A 2LFSA 1THZA 1DF5A 1JJ2U 2XOKG 3OR6C 4NXNO 4RQEA 1R1BA 3UKMA 5KHHA 4ZBMA 3BHPA 2UXCB 3SR2C 5A9GA 2ZD9A 3HB3B 3JAWA 4OGQB 4JI0O 3UT5B 1AR5A 1N32B 1XMQB 4PDRA 1H2LA 4DR1O 2WAMA 5JVDB 3K0DA 1GN4A 4DV4B 1Q6HA 3N2KA 3ICXA 4BWAA 4B7EA 1FFXA 3HKBA 1K4DC 2IBZH 1VQ6V 2QWQB 2UXDO 2YXHA 3N2GA 2F93B 2UXBO 4I50A 3S3WA 3GB7C 1IZ3A 3BAAA 4DR5O 4LH7A 1P7BA 1XNQO 3L72H 3AG3C 1KB9F 3E8FA 4TV9A 1PL4A 2XHBA 2KG7B 4O4JA 3BVOA 3J7AU 2FTKA 2E5LB 3IAYA 4TV8A 2GBOA 3WG7C 3L75H 5LMNO 4QPJA 3MAQA 3CEIA 2EX3A 3ZHQA 5BR8B 3CC4V 1B3QA 3W7WA 1R6NA 1Y67A 3CCUV 1OCCB 4R6ZA 1BHAA 1JJOA 1EZJA 5EYPA 1SETA 2QE7G 4X1KA 3DTUB 2XNDG 1GKFA 1H2KA 1OCRB 1QU7A 2BTOA 3OEHG 3WB1A 1VQ4V 3K04A 3E86A 3LSUA 3SYPA 4MTOA 4JI3B 3O9OA 4BIUA 2LFRA 2F43G 1OHHG 1Q81W 4ZOLA 1R3LC 2CAZC 5CA1A 3N2KB 4GZRB 4PA3A 3RVZA 2WLIA 2GTAA 2OT5A 4B3SB 1PPJH 3JSNA 2OYQA 1K3EA 1XDCA 3E22A 1YJ9V 4JYYA 2OIEA 3E8HA 1AR4A 2HVKC 4X1IA 3JAWB 3JAKA 5EZYA 1AVMA 2B9ZA 4FJCC 4O2BA 3BABA 3SPJA 5JVDA 1SF9A 3F7VC 3LDDA 3B2EE 5LP6A 4JAVA 4K35A 2P6JA 1O9HA 2JDIG 1P84F 1QNMA 4LF5O 2QKCA 3JASA 1HNWO 4ZOLB 4BIOA 4MVZA 4BR6A 4ZHQA 1N34O 3H1KH 2FMLA 1VF5B 3T4ZA 3K0GA 4B3TO 2YIDA 3N2GB 2H8PC 2ZQMA 4UCTA 4CS3A 3P32A 3ZEDA 2PUSA 4LP8A 1AI6A 5LGNA 4JTCB 2ZR2A 1VIBA 3CRMA 4KXRA 3ZHSA 5IY5B 2WLIB 3K5OA 3UCSC 4IHJB 2WA4A 4DR4B 1KP2A 3DXRA 3OGCC 1MSWD 4JZ2A 5CB4A 1UPGA 3LDCA 5BR8O 2QEXV 4X8AA 5ITZB 2QKSA 3ZRWB 1K8AW 4I4TA 5H6RA 1VQMV 4JI8O 2RQ6A 1Q90D 2F66C 5IJ9B 3OW2U 1NTMH 1M1KW 3WFVA 1GM8A 1BHBA 2HP8A 4NYKA 3PN1A 2GHYA 1QVFU 1QLNA 3ABMB 5B5EZ 3P3PA 5CBHA 2FYUH 3D3QA 2QWPB 4UCRA 4PA4A 1F4MA 4X62O 2G38A 4H0LB 1LUVA 2OTLV 4MVSA 5CBGA 2VRZA 1SZTA 5TISZ 4GX2A 3UT5A 3ZBHA 1M93A 1VF6A 2O57A 3UQ8A 1NTZH 4NR1A 4DR4O 4P30A 4UB8Z 5EK0A 4DR6O 5BMVB 1RFYA 5IE9A 4FLXA 5FPOA 4B7KA 2OCCB 4KHPO 1Q86W 4OPHA 3OMIB 3HKBB 4CS2A 3FB6C 4DR3B 3SJCC 4O4IA 5B1BB 1J95A 4KHPB 1IXMA 2X6CA 2Y4TA 2EZOA 5D5QA 1FXKA 1TUBA 4O4IB 5CA0A 4UCUA 3NR7A 4Q20A 2ZIOA 4E4EA 4O2AB 4X20A 3E8GA 2AXTZ 3KZIZ 1KYOF 2HHHB 1LUWA 1XL4A 3ZMTA 3OD4A 3E89A 5JQGB 1M56C 4MTGA 2E5LO 5KLVH 1W2BU 5GONA 1KU9A 1R3IC 1W59A 3APQA 3CMEV 5K1XA 1UJWB 2ZNJA 4DYLA 1GAXA 4IYHA 3T1YB 4FLWA 1IDSA 1YJWV 3G6BA 4UV8A 2QTOA 2ZXWB 1AR1B 5DN6G 2F95B 2IJHA 4IT5A 3CX5F 2DJVA 1HW7A 1RP3B 2HG5C 1M57B 4EKWA 2QSAA 2VWJA 1I5XA 4F6EA 2ZXWC 4B3SO 2YI8A 4WFGA 1L0LH 2Y0PA 4CH4A 4JZGA 1COWG 4PHZA 3SJBC 2ZCEA 3JALB 3K58A 2L6LA 4Z2WA 2ZR3A 1BCCH 1WB7A 1QBZA 4HNAA 1FXHA 1X59A 3CCEV 4AQYO 1AI4A 2V4DA 4R8CA 5KHIA 4RAIA 2FL4A 4CC5A 1YF2A 5LGTA 3M7MX 1V9PA 5BY1A 1H2SB 3JALA 5IYZB 2VQEO 1XNRO 1F4NA 3JD4A 4EB6B 1K73W 5LGUA 2HEPA 4JF3A 4TV9B 2AZ2A 4LFAO 1SQQH 1SC5B 4NXMB 3ABMC 3AG7A 2ETNA 3RWRD 2XAFA 2RMKB 3SYOA 1PNKA 2P4KA 5IWAO 3G80A 2QR4A 1BL8A 1FXKB 2EINC 1R3KC 1KP3A 2RJZA 3CC2V 5IYBO 1PL0A 3GVMA 1T5EA 4RO2A 3ZN0A 1M5IA 5BXZA 4JI2B 1WB8A 2YS8A 1H8HG 2BSKB 1Q8IA 4YIPA 1YSCA 4FZ0A 3RYIA 5BZBA 2YEVA 5LHGA 5KAIZ 2D3OW 5JQGA 1K9MW 4IL6Z 1HNZB 4RQFA 5L3FA 4LF4O 4DV6B 4ZI7A 3STLC 4GKKB 2Y69B 4GT1A 4FM2A 5JWPA 3G71V 3JYCA 3JSLA 2DQ3A 4LFBB 1SQXH 3K79A 1N32O 1VEWA 5H2FZ 4R7CA 2UXCO 4MTXA 2JGUA 1IBMB 2AZ0A 3QO7A 2BE3A 4DUYO 2IH3C 3AEIA 3ZMZA 4I4TB 1S77D 4X66O 4YJ2B 4DV0B 2HFEC 2QM4A 4D7TA 1AROP 3MDSA 4MVUA 1NZ6A 1U96A 4FFBA 4JI6O 2QWOB 4U7NA 4ZKIA 5KA6A 1FJGB 1WP8A 1DLBA 4NXNB 1VARA 2KQXA 5L3CA 4DV1B 4LF4B 1Z2GA 2E3CA 4IGGA 3HPLC 4DRXB 1VQ7V 5EC1C 5CB4B 4MVMA 4J9ZB 3RYCB 4B3RB 3B8NA 4GYCB 4I0XB 1PD3A 3HKEB 3JD1A 4J10A 3WG7B 4IHJA 4NTXA 1QQCA 2PZSA 1P49A 1G1XB 1GM9A 3HR0A 3SPGA 1K92A 4YY3O 4DV5O 1JR9A 2VQFB 5LBQA 3D36A 1Q6IA 3RYFA 3G6EV 4TT3G 1L1FA 2UUAB 3BRCA 5KA5A 2A9HA 3CCLV 1Y76B 1NTKH 3A0HZ 4FLZA 2PY5A 2JEUA 1AJNA 2ILMA 3ASNC 4DV4O 3OT7A 2DYSC 5LA6B 5KUMA 4LF5B 1G6UA 4UVAA 1YEWA 4J41A 4I5SA 1HNWB 2EIMB 2DYRC 3K5NA 3ZHVA 1PNMA 4LC1A 2UXNA 2ATKC 4QIWF 1IVSA 2QJ1A 3M99B 1NQTA 4PV1B 2Q5ZA 1M9NA 1NBMG 5CA3A 4JI5O 5BMVA 3E22B 2W0XA 4O2AA 4X20B 1OJHA 5EYPB 4X64O 3OE7G 2XAQA 1X4TA 2UU9B 2Q7HA 3K59A 3CPWU 3STZC 3KKYA 3BPZA 2NR5A 2E75B 2XAGA 3LSQA 4DW1A 2DE0X 2NN4A 1N0NA 4D6TH 2EIJB 3OUSA 4LWSB 4DV0O 1VP7A 1MMMA 5IYZA 4LFAB 1OCOC 1W0KG 1ZL8B 3H01A 4FIPC 2WA3A 4P9OA 2A7WA 3JD2A 4PDLA 4UFZA 4JPRA 2JGDB 3E35A 3K57A 3QF7A 1V55B 3ZMVA 2W6JG 5H5NA 4LF9B 1V54C 4AQYB 4BIZA 4JAAA 3X2QC 3CD6V 3DXRB 1YHQV 1TAEA 1WAZA 3T1HO 2JJ2G 3I55V 5EBLC 1WNSA 4WFHA 3CRAA 3ETDA 3B4SA 1US6A 4JI1O 4CC6A 1KKCA 4JASA 4ICGA 1AP5A 1QHTA 5KHJA 4MVRA 4FLYA 4GLXA 2LW1A 1FXKC 1KBHA 5IT9N 3C3TA 1AJQA 2DW4A 3W7UA 4G28B 3KCYA 2R9AA 5IWAB 1VQKV 1QCEA 4FLUA 3CCSV 3OMNB 1FFXB 1Y76A 3B77A 1XMOO 2JRIA 3ZJZA 1RSOB 5CN0A 3QO8A 1F23A 1SA0A 4LF8B 2Y69C 3C3SA 5AG2A 1RPOA 2XAJA 4JGSA 4X1IB 2UUBO 1Y6XA 2LP7A 1HNXO 5J2UB 1H2NA 4NVPA 4LF9O 3SDLA 3B8MA 1Y4MA 3JASB 3N27A 1SQFA 1J5EO 1N33B 3TETA 4G27B 3UM7A 3M8AA 3ZCCA 1XMQO 4PJ0Z 3KG2A 1B6QA 2BOBC 4LF6B 4FK5C 2WLNA 3AG2C 5IDJA 4J80A 3W7SA 1I08A 4QPKA 1L0NH 2HR3A 2ZM6O 1Q5OA 4EFBA 1XMOB 1BQZA 2X6BA 3BA9A 4OXSA 4B3TB 1GN2A 2QDOA 2EJ7A 2UXBB 2W6IG 3RYHB 4L87A 1TGOA 1YITV 1E79G 3A8TA 1VF6C 2PI4A 5IYCO 5GTHZ 4K8XA 3E8BA 2FKXA 4LF8O 1L8DA 1AJPA 1WPXA 1ZL8A 3CCQV 3FYEB 2N04A 1VMGA 2EULA 4K8ZA 3CRRA 3ABUA 3CCJV 2Y0IA 4X1KB 1SESA 2ZKOA 3AG4C 5KMGA 4H33A 3ZRSA 2N05A 4LH6A 3AK3A 3Q4HA 5H6QA 1NU1H 1JMKC 5EIBC 2ITDC 2Q73A 4FFBB 4MS2A 2Y4UA 4TQDA 1ZLZA 3FAVA 4PDMA 1FAFA 3J80N 4GKJB 1MSDA 1I94B 1K33A 2JS5A 1AB3A 2IJJA 4JI0B 4JV5B 1O9GA 2AGAA 1N36O 2QWNB 1G8MA 2H94A 3OR7C 5DM6V 5L3BA 3F7YC 4MSWC 2GDSA 1S5LZ 2VQFO 1XL6A 4LFBO 3A2FA 4A5UB 3VBBA 3FB7C 1HP8A 3FB8C 4GX1A 1SERA 5J2TA 3OGIB 3CRCA 5L3EA 1H2MA 1HDJA 3L73H 1BMFG 5LHHA 4UVCA 2WWWA 1CEZA 1ZTEA 2ODMA 3I56V 3TGUH 1NI8A 4DO2A 4JI2O 3CHXA
chains in the Genus database with same CATH topology
3BEHA 3W7XA 2OCCC 2YEVA 4JTAB 5LHGA 2D3OW 4KFMA 2EIJC 1NVPD 4GX5A 1K9MW 4RQFA 1V54B 5L3FA 1KKDA 2AHZA 2IU0A 4HZ3A 1KD1W 4WFFA 3ZIAG 5B1AB 3STLC 2Y69B 4GT1A 1NR1A 3K08A 1GK9A 3T4DA 4XBFA 2Q6AA 4PA6A 3G71V 1KC8W 3JYCA 3LNMB 5B1NA 2DQ3A 3AG1C 3LDEA 4N23A 4QNHB 2Y48A 3QNEA 3RW0A 3K79A 3LSSA 3EHBB 3LUTB 4GX0A 3CP1A 2EJRA 3FYIB 1H2GA 2EILB 5LHIA 2P90A 4LBEC 4R7CA 1NR7A 3K06A 4MTXA 2C2AA 3QO7A 4JYCA 2PI5A 2LFSA 1THZA 1DF5A 1JJ2U 2XOKG 3GWOA 3OR6C 1KQSU 4KP4A 4RQEA 3UKMA 2IH3C 3AEIA 4ZBMA 3ZMZA 1QR9A 2R9IA 1S77D 2ZD9A 3HB3B 3IFXA 1N8RW 4PDRA 3K9AA 4MW3A 2HFEC 3EFFK 1H8EG 2KB1A 5IYDO 1AROP 4MVUA 2V7QG 2WAMA 1ZWIC 3K0DA 1VQLV 4U7NA 4ZKIA 3E83A 5KA6A 2B1GA 1K4DC 2JK5C 4P9PA 3SPIA 3D3IA 3TCUA 1VQ6V 2W0FC 1EFRG 1DLBA 2R9RB 5L3CA 1K97A 3FKSG 4BW5A 4F4LA 2AHYA 2A0LA 1GTOA 5J9PC 3CCRV 3GB7C 3HPLC 1VQ7V 1P7BA 2HJFC 2EZPA 5EC1C 4JAUA 1LNQA 4MVMA 1S5HC 4J9ZB 3B8NA 2HVJC 1QVGU 1R6KA 1PD3A 3E8FA 3AG3C 3JD1A 5EBMC 1QLEC 2P7TC 2IU3A 3IC7A 3WG7B 4UXNA 3AG3B 2FTKA 3ASNB 3IGAC 4HAMA 3F5WC 1GM9A 3SPGA 1K92A 2WLMA 3WG7C 4JYBA 4QPJA 5LBQA 2HLDG 3D36A 3TK1A 2UXXA 3RVYA 2M7WA 2DWDC 2EIKC 4PELA 2XASA 4TT3G 1L1FA 3G6EV 3CCVV 3CC4V 3ZRVA 3W7WA 5KA5A 3K3WA 1FFTB 2A9HA 3CYOA 1R6NA 3CCLV 4X89A 3CCUV 1OCCB 4R6ZA 1BHAA 1W0JG 1EZJA 1SETA 4BAYA 2QE7G 4WF9V 1KECA 3DTUB 2XNDG 2ITCC 1GKFA 2JEUA 2QM8A 1OCRB 3OEHG 3P30A 1AJNA 3ASNC 3AG4B 1VQ4V 2B5UA 1SRYA 1OZ0A 2K1EA 5B1BC 3K04A 3E86A 2DYSC 3SYPA 3NXSA 4MTOA 1MOFA 2DWEC 5KUMA 2X6AA 4UVAA 1S72V 4I5SA 4BIUA 3PJSK 1K34A 2LFRA 3ABKC 2WLKA 2EIMB 2F43G 1OHHG 2DYRC 1Q81W 3ETEA 1ORQC 4XDLA 1R3LC 3AG2B 1M57C 4RUFA 4PA3A 3T1CA 1PNMA 4LC1A 4QE7A 2WLIA 3RVZA 2UXNA 2ATKC 2OT5A 4QIWF 2JEXA 3M99B 1NQTA 1K3EA 3JCZA 1FS0G 1YJ9V 2WLJA 5H9CA 2DQ0A 1M9NA 3E8HA 1NBMG 5CA3A 2HVKC 4WFBV 3MD0A 4FJCC 3BY6A 1CP9A 3OE7G 2XAQA 3AG1B 3X2QB 1MABG 4P2ZA 3SPJA 1VQPV 3ZMSA 3CPWU 3F7VC 3STZC 3LDDA 2XAGA 3LSQA 1V55C 1R73A 4JAVA 2P6JA 4JTDB 2Q67A 2JDIG 4MTFA 4H37A 2IW5A 1AI7A 4MVZA 5HFMA 4MVOA 2CK3G 1VQ5V 1GO3F 3T4ZA 2EIJB 1DTOA 3R65A 3K0GA 1YI2V 3OUSA 1PKXA 3ZMUA 3CXCU 3SYAA 2EILC 4CZZA 1OCOC 2H8PC 2ZQMA 3ZRWA 1W0KG 1OCRC 4KUMA 3H01A 4FIPC 1M90W 4P9OA 3JD2A 4PDLA 4JPRA 3E35A 2X0LA 3P32A 1OCZB 1YTFD 3ZMVA 1V55B 4LP8A 1AI6A 4MT8A 4R50A 5LGNA 2W6JG 2DYRB 1E1RG 2YSUB 2ZR2A 1QR8A 4JTCB 5CBFA 1V54C 3VOUA 4BIZA 1G4YB 1OCZC 4PA7A 5IY5B 1RM1B 2NNUA 4N21A 2WLIB 4UUJC 4U7OA 3X2QC 3CD6V 1YHQV 2JJ2G 1KP2A 5EC2C 3I55V 1NVPB 3ABLC 5EBLC 4WFHA 3OGCC 1MSWD 3ETDA 2OTJV 1NH2D 1R3JC 4YXWG 3LDCA 2WSSG 2QEXV 3A0RA 4X8AA 1VQOV 3SYQA 5CMUA 5FL7G 3ZRXA 1JVMA 1K5QA 2GSMB 2QKSA 3ZRWB 2B1IA 1K8AW 4JASA 2P67A 5H6RA 3MHSC 1VQMV 3G4SV 4MVRA 1ENVA 2HKOA 4QJFB 3SYCA 1RM1C 3OW2U 1FXKC 2Q69A 2A79B 1K4CC 4UV9A 1M1KW 1JCHA 3WFVA 2NLJC 1GM8A 1BHBA 1AJQA 1GMGA 2GHYA 1QVFU 2DW4A 3ABMB 1DF4A 3OFNG 2YEVB 4G28B 3W7UA 5CBHA 1QLNA 4WCEV 4WFAV 1VQKV 3OAAG 1QCEA 3CCSV 1I5YA 3OMNB 4PA4A 1F4MA 5GW7A 2OTLV 5IY5C 4MVSA 3B77A 5CBGA 1S0VA 3ZJZA 1SZTA 5CN0A 4GX2A 3QO8A 1F23A 4GCZA 2Y69C 1WLEA 3OUFA 2QM7A 1RPOA 2XAJA 3DGEA 4P30A 3RBZA 4JGSA 4TWKA 5EK0A 4LCUC 4DXWA 2LP7A 2OCCB 1JX9A 1AI5A 1Q86W 3OMIB 3B8MA 3FB6C 2WLLB 1VQ9V 4FPPA 1Y4MA 2Z3YA 5B1BB 1J95A 4RUEA 3W7TA 1IXMA 1QLEB 2X6CA 1JOYA 3TETA 3CC7V 1HWYA 1P4RA 2EZOA 4G27B 3UM7A 1FXKA 2WLLA 3ZCCA 3CCMV 1RPRA 5B3SC 3KG2A 1B6QA 1YJNV 2BOBC 2IJKA 3OM3B 2Q68A 4UVBA 1CPYA 4Q20A 4FK5C 2WLNA 3AG2C 5IDJA 1Q82W 3ETGA 3SJQC 3W7SA 3E8GA 4QPKA 1MG1A 2HR3A 1K7DA 4WFEA 4J9YB 2X6BA 2MK3A 1TUEB 3SPCA 4OXSA 3QO5A 1XL4A 3ZMTA 3OEEG 3E89A 4XDKA 1VQ8V 1M56C 2EIMC 4MTGA 2W6IG 2QA4V 1W2BU 1Y66A 4L87A 1VQNV 3T2MA 1R3IC 5KUKA 1YITV 2BOCC 3CMEV 1E79G 1JQ0A 1UJWB 2Z5UA 1NJIW 2PI4A 5IYCO 2EBOA 3E8BA 2WPDG 4MW8A 1AJPA 2X7RB 2ZDIC 3ASOB 1YJWV 4UV8A 2QTOA 2ZXWB 1EBOA 2EINB 5DN6G 1AR1B 1WPXA 2IJHA 1NH2B 4X88A 1F51A 3FYEB 3CCQV 5HFLA 1FXVA 1S76D 2HG5C 1M57B 3MHHC 3ABUA 4FMTA 5EBWC 4XDJA 2WLHA 4EKWA 5B3SB 3ASOC 1I5XA 3CCJV 1SESA 2ZXWC 3AG4C 2EIKB 4H33A 3ZRSA 4WFGA 5L3GA 3JD3A 5H6QA 4QE9A 4G2KA 1YIJV 1COWG 2IJIA 1ROPA 1K5SA 4ASUG 2ITDC 2ZR3A 3ABLB 1PNLA 3JD0A 1QBZA 1GM7A 1M56B 4MS2A 1FXHA 3CCEV 4PDMA 4TSFG 3ZN1A 1AI4A 1K33A 3ABTA 2IJJA 4R8CA 4RAIA 3ABKB 5LGTA 1E1QG 1G8MA 2H94A 3OR7C 4PDVA 5E1AC 4MVQA 5B1OA 4I9WA 5DM6V 1F4NA 3JD4A 1K73W 5LGUA 2ZDIA 5L3BA 3F7YC 3K03A 3OMAB 4MSWC 4JF3A 2DYSB 1XL6A 3FB5C 4Z1MG 3ABMC 3E2EA 1OCCC 2V1DA 3VBBA 2XAFA 3FB7C 2JJ1G 3FB8C 3SYOA 1PNKA 4GX1A 4PA9A 2IH1C 1SERA 5L3DA 5B1AC 5L3EA 1BL8A 1FXKB 2EINC 1R3KC 4CBCA 1JPXA 1KP3A 5C93A 3CC2V 5IYBO 1BMFG 2XAHA 5LHHA 1YTFB 1PL0A 4UVCA 2WWWA 4E2LA 3ML0A 1CEZA 4RO2A 1OCOB 3ZN0A 2JIZG 1S3JA 4HYOA 1NKDA 1H38A 3I56V 1H8HG 4DO2A 3SPHA 1YSCA 3CMAV 5BZBA 1Q7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO2 A;  2IJI A;  1GMG A;  1ROP A;  1RPR A;  2IJJ A;  3K79 A;  1PD3 A;  1GTO A;  1RPO A;  2IJK A;  1NKD A;  2GHY A;  1B6Q A;  1F4M A;  1F4N A;  2IJH A; 
#chains in the Genus database with same CATH topology
 3BEH A;  4JTA B;  2Q0O C;  2EIJ C;  2ZE5 A;  2ZIM A;  1KKD A;  4DK1 A;  4HZ3 A;  4U3F H;  4WFF A;  3ZIA G;  3CS5 A;  1EN6 A;  4XBF A;  1J5E B;  2CGN A;  5JJE B;  1KC8 W;  4Z1V A;  3LNM B;  2E74 B;  3AG1 C;  3LDE A;  4N23 A;  3UO3 A;  4QNH B;  3OTO B;  2Q7G A;  3EHB B;  2EJR A;  3FYI B;  1H2G A;  5LXT A;  4JI5 B;  2P90 A;  3GWK C;  4X65 O;  1NR7 A;  1FKA O;  4KL1 A;  4JYC A;  3GWO A;  3LNN A;  4KP4 A;  4O2B B;  4TUY B;  4F6R B;  1BT8 A;  1QR9 A;  1N36 B;  4CH3 A;  1N8R W;  1JFF A;  2CUG A;  4MW3 A;  3BCC H;  3EFF K;  1H8E G;  4I7Z B;  4YJ3 A;  5IYD O;  1KMI Z;  4I55 B;  4W4L A;  2V7Q G;  1VQL V;  3VQV A;  3E83 A;  2ZT9 B;  4DR2 B;  4P9P A;  3TCU A;  3D3I A;  3WB0 A;  5B66 Z;  1EFR G;  1SKV A;  1UFI A;  2AHY A;  2A0L A;  1GTO A;  4U3J B;  5LOV A;  3CCR V;  4LWS A;  2Q7E A;  4DV7 B;  2BTQ B;  1QVG U;  1R6K A;  3RFR A;  1WPB A;  3R66 A;  5EBM C;  1MZF A;  5JH7 A;  1FJG O;  1QLE C;  2P7T C;  3IC7 A;  4JI6 B;  2RDC A;  3ASN B;  4DR2 O;  4HAM A;  3H1H H;  5IJ0 B;  2WLM A;  5EIB D;  4JYB A;  2HLD G;  2UXX A;  3RVY A;  4PEL A;  2QWR B;  2BSK A;  3ZRV A;  2YXL A;  1FFT B;  1XNR B;  4JYA O;  2Z0A A;  2R72 A;  1W0J G;  4WF9 V;  4PI0 A;  1AIL A;  3P30 A;  5B1B C;  1Q43 A;  1YCI A;  4YY3 B;  2PGG A;  4DV5 B;  1XHZ A;  1MOF A;  2X6A A;  3OTF A;  5FPR A;  1N4C A;  2GUZ A;  3PJS K;  1K34 A;  1YVW A;  2YIA A;  4UCV A;  3WU2 Z;  2CE4 A;  3ETE A;  4DW0 A;  4XDL A;  1DK1 A;  1M57 C;  1WA8 A;  4RUF A;  3RGB A;  2R70 A;  4QE7 A;  2KKW A;  3JCZ A;  4CH5 A;  1FS0 G;  3BFR A;  5H9C A;  2DQ0 A;  4K0K O;  3MD0 A;  5DEC A;  3BY6 A;  1GN6 A;  1D5N A;  5JJN B;  4F6R A;  4LF7 O;  4I9Q A;  3AG1 B;  3X2Q B;  4DUZ B;  4P2Z A;  1FD9 A;  3RYC A;  5LYJ A;  1VQP V;  4Q6G A;  4DUZ O;  1Y74 B;  2OCH A;  4J7K A;  4B3M O;  1V55 C;  1R73 A;  3L71 H;  4JTD B;  2Q67 A;  3CWB H;  1Y74 A;  4H37 A;  1WJZ A;  2YUA A;  5HFM A;  4MVO A;  4ZIB A;  1GO3 F;  1SQG A;  1DTO A;  3R65 A;  1YI2 V;  5LP6 C;  3CXC U;  3JAT B;  3ZRW A;  2VQE B;  1OCR C;  3ZHR A;  4KUM A;  4CH6 A;  3FFQ A;  1FYJ A;  2Q0A A;  2F4V O;  4CS4 A;  4RWU A;  2X0L A;  2YSU B;  1E1R G;  1QR8 A;  3HKE A;  3VOU A;  1G4Y B;  1RM1 B;  3AK2 A;  4N21 A;  4UUJ C;  1HR0 O;  4DR7 O;  4X66 B;  5EC2 C;  3ABL C;  4JYA B;  5K1P A;  3B09 A;  2OTJ V;  3A0R A;  3JCU Z;  1VQO V;  1PM9 A;  3SYQ A;  4X64 B;  5FL7 G;  5J2T B;  3ZRX A;  1K5Q A;  3EXA A;  2B1I A;  5CA0 B;  1S5J A;  4DV3 O;  3CB2 A;  2P67 A;  1WN7 A;  4FFK A;  3T1Y O;  4QJF B;  1XQ8 A;  1RM1 C;  2LO1 A;  5JCO C;  2Q69 A;  4U3J A;  4UV9 A;  5LOV B;  4BW9 A;  1GMG A;  4O4H A;  1DF4 A;  3OFN G;  4FM1 A;  1IBK O;  4WFA V;  4J11 A;  3OAA G;  3HKC A;  3K9S A;  3U10 A;  5JH7 B;  5GW7 A;  5LL6 Y;  4LNU A;  1MNG A;  5IY5 C;  1IUR A;  2UUC O;  4NB5 A;  4LFC B;  1SQP H;  3VQY A;  5LMU B;  1BE3 H;  4DV1 O;  1WLE A;  2QM7 A;  2MW2 B;  3RBZ A;  2P5O A;  2A06 H;  1FPO A;  5JJJ B;  4DXW A;  2PYL A;  3HKD A;  2JGD A;  3SJA C;  1I94 O;  1TUB B;  1CXZ B;  4FPP A;  1VQ9 V;  4IIJ A;  4OX9 O;  1JOY A;  3CC7 V;  1P4R A;  2YIC A;  3DC6 A;  1U97 A;  4LFC O;  3A0B Z;  3B40 A;  3SJQ C;  3WB2 A;  1MG1 A;  4WFE A;  4J9Y B;  3QO5 A;  3F5T A;  3JAT A;  1VQ8 V;  1SQB H;  2A3Q A;  2F23 A;  1Y66 A;  1IXB A;  5KUK A;  1JFF B;  3H1I H;  2PF4 E;  1JQ0 A;  3RYH A;  5F2V O;  2LQT A;  3K5M A;  1ZUQ A;  3DC5 A;  2WPD G;  2K9P A;  2VS0 A;  2ADP A;  2ZDI C;  5FLX N;  1HNZ O;  1EBO A;  2EIN B;  4X88 A;  4K0K B;  1F51 A;  5HFL A;  3MHH C;  2WLH A;  5B3S B;  3ASO C;  5KX5 B;  1ZSP A;  4HNA B;  2LW7 A;  5ITZ A;  1EM1 A;  3BA8 A;  1RSO A;  1TVK A;  4DR7 B;  2Q4P A;  4O4L B;  1XBL A;  2IJI A;  1ROP A;  1K5S A;  3CJH A;  1MA1 A;  3ABL B;  1PNL A;  2XUM A;  4JI8 B;  1BQ0 A;  1ZX3 A;  1MZE A;  1GM7 A;  1M56 B;  5C8Y A;  3ZN1 A;  2D2C B;  1XEQ A;  4X1Y B;  3ABT A;  2HHH O;  1TVK B;  4ZHQ B;  1OV9 A;  1HNX B;  1PV0 A;  2ZE6 A;  1E1Q G;  4DV6 O;  2CTP A;  5E1A C;  1A32 A;  3RYF B;  4I9W A;  2UUC B;  3K03 A;  3ZS8 C;  3OMA B;  1R6T A;  1SS3 A;  2ZE7 A;  2DMX A;  1N34 B;  2DYS B;  3DSQ A;  4Z1M G;  3E2E A;  4UCO A;  2V1D A;  2P06 A;  2IH1 C;  5JCO A;  4FZ1 A;  2JS3 A;  2Q9L A;  4YHH B;  5IJ0 A;  2XAH A;  1YTF B;  4E2L A;  3ML0 A;  1S3J A;  4HYO A;  2L35 A;  1NKD A;  2YIB D;  3KCX A;  3SPH A;  4PI2 A;  5LMN B;  3W7X A;  2YXY A;  1NVP D;  1EZV H;  1V54 B;  4YIO A;  2AHZ A;  1KUQ A;  2YC0 A;  1IBM O;  4FLV A;  5B1A B;  4IYI A;  3FD9 A;  4NKG B;  1Q3E A;  1NR1 A;  1D5A A;  3K08 A;  1GK9 A;  4UCS A;  3T4D A;  3L74 H;  5CA1 B;  4JI7 O;  2Q6A A;  5B1N A;  1XNQ B;  3QNE A;  3LSS A;  4GX0 A;  3CP1 A;  4EEQ A;  2QKA A;  5LHI A;  4I50 B;  3IC9 A;  3HKD B;  2C2A A;  2PI5 A;  1KQS U;  3UO2 A;  5LMU O;  2R9I A;  2RCV A;  4TUY A;  3IFX A;  3IJ4 A;  2LJ2 A;  1HR0 B;  3K9A A;  3CJH B;  2KB1 A;  4ZI7 B;  3APO A;  4B3M B;  1ZWI C;  3TXS A;  2GTS A;  4YHH O;  2B1G A;  2JK5 C;  3SPI A;  1DGS A;  1IBL B;  4NTW A;  2W0F C;  3HKC B;  4GKK O;  2R9R B;  2LGQ A;  5C8Y B;  1K97 A;  3FKS G;  4BW5 A;  5LA6 A;  4F4L A;  2RN9 A;  5J9P C;  4J7Z A;  3JAM N;  3I5D A;  2BTQ A;  3ETQ A;  2HJF C;  2EZP A;  4AI8 A;  4JAU A;  1LNQ A;  1S5H C;  1SQV H;  1Z5W A;  4X62 B;  2HVJ C;  1I7F A;  4TOI A;  4TQF A;  2IU3 A;  4UXN A;  1P7G A;  2OIG A;  3L9D A;  3JAK B;  3AG3 B;  4OPA A;  3IGA C;  3F5W C;  2ADQ B;  4DV2 O;  3TK1 A;  4B08 A;  4JI1 B;  2DWD C;  2M7W A;  2EIK C;  3TJT A;  2XAS A;  3CCV V;  4O4L A;  1NS1 A;  3K3W A;  2PYJ A;  3CYO A;  4X89 A;  1XOU A;  2GV9 A;  3T1H B;  2UXD B;  1IX9 A;  4BAY A;  3QVN A;  3D36 C;  1KEC A;  5KX5 A;  2ITC C;  2QM8 A;  3JAR A;  2YI9 A;  3AG4 B;  2B5U A;  1SRY A;  1OZ0 A;  2K1E A;  2UUA O;  4I0X A;  3NXS A;  5D5P A;  2DWE C;  1S72 V;  4OX9 B;  3H1J H;  4DV2 B;  3P3N A;  1JA8 A;  4EB6 A;  1WA8 B;  3ABK C;  1B06 A;  2WLK A;  4DRX A;  2E76 B;  1ORQ C;  3AG2 B;  3CE2 A;  2F4V B;  3T1C A;  2JEX A;  2F1M A;  5LYJ B;  4DV3 B;  4D7S A;  2WLJ A;  4WFB V;  2RNB A;  4YJ2 A;  1LR1 A;  2CTW A;  1D2D A;  1CP9 A;  4H13 B;  2DN9 A;  1MAB G;  4TV8 B;  4WBN B;  1IBK B;  1YXB A;  2IM9 A;  3ZMS A;  4JI4 O;  4LNU B;  4AIL C;  4IIJ B;  4MTF A;  3O65 A;  2IW5 A;  1AI7 A;  1XHX A;  5A2Q N;  2CH7 B;  2CK3 G;  3ZHT A;  1VQ5 V;  4NXM O;  1PKX A;  3ZMU A;  2CH7 A;  3SYA A;  2EIL C;  4CZZ A;  1M90 W;  1Q6U A;  4DUY B;  3U0Z A;  1B04 A;  2AW9 A;  2DOS A;  3AK1 A;  1OCZ B;  1Z5V A;  2LGW A;  1YTF D;  4FLT A;  4MT8 A;  4R50 A;  3OTO O;  2CTQ A;  2DYR B;  2BCC H;  5CBF A;  2ZNI A;  4PA7 A;  1OCZ C;  1AP6 A;  2VWK A;  2CDY A;  2NNU A;  4U7O A;  2XTA A;  4C7U A;  3RT3 C;  1GRJ A;  1NVP B;  5J2U A;  2ZE8 A;  1WP7 A;  2P22 C;  4LF7 B;  1NH2 D;  1I0H A;  1R3J C;  4YXW G;  2WSS G;  5CMU A;  1JVM A;  1M4U A;  2GSM B;  1TA8 A;  1SA0 B;  2QTS A;  3CRQ A;  5KMG B;  1GN3 A;  3MHS C;  3G4S V;  1ENV A;  2HKO A;  5KHG A;  3SYC A;  2A79 B;  1K4C C;  1JCH A;  2NLJ C;  3JAR B;  4X1Y A;  2YEV B;  5E79 Z;  4I55 A;  4WCE V;  2PTM A;  3RN4 A;  1I5Y A;  4DV7 O;  3H1L H;  2YIB A;  1S0V A;  4GCZ A;  1EN5 A;  3OUF A;  3DGE A;  3EVK A;  4TWK A;  4X65 B;  4LCU C;  1EN4 A;  5LXT B;  4X9Q A;  1JX9 A;  1AI5 A;  4DR1 B;  2WLL B;  4K3A A;  2Q8V A;  2Z3Y A;  1SZX A;  4RUE A;  4JI3 O;  3W7T A;  1QLE B;  1HWY A;  2YDE A;  2WLL A;  3CCM V;  1RPR A;  1YDX A;  3CSX A;  3CXH F;  5B3S C;  2CGO A;  4H44 B;  1YJN V;  3ZHU A;  2ZM6 B;  2IJK A;  3OM3 B;  1XRE A;  2QGN A;  2Q68 A;  4UVB A;  1CPY A;  4DR6 B;  1PP9 H;  3H9V A;  1Q82 W;  3ETG A;  1K7D A;  2MK3 A;  1TUE B;  3SPC A;  4FM0 A;  1N0J A;  5DED A;  1N33 O;  3OEE G;  4LR3 A;  5FNV A;  4XDK A;  2EIM C;  2QA4 V;  1VQN V;  3T2M A;  2KSD A;  2BOC C;  4HBN A;  1XI1 A;  1BGY H;  5GON B;  2Z5U A;  4UB6 Z;  1NJI W;  2EBO A;  5EZY B;  4B3R O;  4MW8 A;  2X7R B;  4W4K A;  2OWO A;  3ASO B;  1URF A;  1NH2 B;  1XIL A;  2M6Y A;  2ZIN A;  4ABM A;  3QG5 A;  1F7Y A;  1ZAU A;  1FXV A;  1S76 D;  1H38 A;  4FMT A;  5EBW C;  4XDJ A;  3Q4H B;  2EIK B;  5L3G A;  5KAF Z;  4L8J A;  3JD3 A;  2FB5 A;  1VF7 A;  4QE9 A;  4G2K A;  2H3O A;  4JV5 O;  1YIJ V;  2CTR A;  3RYI B;  1BSM A;  4J42 A;  4YJ3 B;  4ASU G;  3JD0 A;  4TSF G;  2HJD A;  4O4H B;  4DR3 O;  2P4V A;  3QTC A;  2UUB B;  3FAV B;  3THO A;  1BS3 A;  3ABK B;  3VQW A;  4PDV A;  4MVQ A;  3L70 H;  5B1O A;  4EFE A;  1NT2 B;  4QGP A;  2ZDI A;  2ARH A;  2N74 A;  5GTI Z;  3FB5 C;  4WBN A;  4DK0 A;  4GKJ O;  1OCC C;  4JI7 B;  2JJ1 G;  5FNV B;  4PA9 A;  4JI4 B;  5L3D A;  5B1A C;  1BZK A;  4CBC A;  1JPX A;  5C93 A;  5KHK A;  1OCO B;  2JIZ G;  1XUQ A;  3S3X A;  3CMA V;  3U11 A;  3J81 N;  1Q7Y W;  4DR5 B;  1GH6 A;  4PD4 F;  2OCC C;  4KFM A;  2KG7 A;  4O4J B;  4GX5 A;  3C90 A;  2IU0 A;  4GUN A;  1IBL O;  2JVD A;  4FVM A;  1KD1 W;  4LF6 O;  5IJ9 A;  1YZB A;  2GUZ B;  2XT9 A;  2UU9 O;  4NTY A;  4PA6 A;  4AHC A;  2Y48 A;  3RW0 A;  3D8C A;  3LUT B;  3K5L A;  3ZX6 A;  4J7J A;  5LP6 B;  3VQX A;  3TXQ A;  2EIL B;  4LBE C;  3SGI A;  3K06 A;  3FX7 A;  3G67 A;  2LFS A;  1THZ A;  1DF5 A;  1JJ2 U;  2XOK G;  3OR6 C;  4NXN O;  4RQE A;  1R1B A;  3UKM A;  5KHH A;  4ZBM A;  3BHP A;  2UXC B;  3SR2 C;  5A9G A;  2ZD9 A;  3HB3 B;  3JAW A;  4OGQ B;  4JI0 O;  3UT5 B;  1AR5 A;  1N32 B;  1XMQ B;  4PDR A;  1H2L A;  4DR1 O;  2WAM A;  5JVD B;  3K0D A;  1GN4 A;  4DV4 B;  1Q6H A;  3N2K A;  3ICX A;  4BWA A;  4B7E A;  1FFX A;  3HKB A;  1K4D C;  2IBZ H;  1VQ6 V;  2QWQ B;  2UXD O;  2YXH A;  3N2G A;  2F93 B;  2UXB O;  4I50 A;  3S3W A;  3GB7 C;  1IZ3 A;  3BAA A;  4DR5 O;  4LH7 A;  1P7B A;  1XNQ O;  3L72 H;  3AG3 C;  1KB9 F;  3E8F A;  4TV9 A;  1PL4 A;  2XHB A;  2KG7 B;  4O4J A;  3BVO A;  3J7A U;  2FTK A;  2E5L B;  3IAY A;  4TV8 A;  2GBO A;  3WG7 C;  3L75 H;  5LMN O;  4QPJ A;  3MAQ A;  3CEI A;  2EX3 A;  3ZHQ A;  5BR8 B;  3CC4 V;  1B3Q A;  3W7W A;  1R6N A;  1Y67 A;  3CCU V;  1OCC B;  4R6Z A;  1BHA A;  1JJO A;  1EZJ A;  5EYP A;  1SET A;  2QE7 G;  4X1K A;  3DTU B;  2XND G;  1GKF A;  1H2K A;  1OCR B;  1QU7 A;  2BTO A;  3OEH G;  3WB1 A;  1VQ4 V;  3K04 A;  3E86 A;  3LSU A;  3SYP A;  4MTO A;  4JI3 B;  3O9O A;  4BIU A;  2LFR A;  2F43 G;  1OHH G;  1Q81 W;  4ZOL A;  1R3L C;  2CAZ C;  5CA1 A;  3N2K B;  4GZR B;  4PA3 A;  3RVZ A;  2WLI A;  2GTA A;  2OT5 A;  4B3S B;  1PPJ H;  3JSN A;  2OYQ A;  1K3E A;  1XDC A;  3E22 A;  1YJ9 V;  4JYY A;  2OIE A;  3E8H A;  1AR4 A;  2HVK C;  4X1I A;  3JAW B;  3JAK A;  5EZY A;  1AVM A;  2B9Z A;  4FJC C;  4O2B A;  3BAB A;  3SPJ A;  5JVD A;  1SF9 A;  3F7V C;  3LDD A;  3B2E E;  5LP6 A;  4JAV A;  4K35 A;  2P6J A;  1O9H A;  2JDI G;  1P84 F;  1QNM A;  4LF5 O;  2QKC A;  3JAS A;  1HNW O;  4ZOL B;  4BIO A;  4MVZ A;  4BR6 A;  4ZHQ A;  1N34 O;  3H1K H;  2FML A;  1VF5 B;  3T4Z A;  3K0G A;  4B3T O;  2YID A;  3N2G B;  2H8P C;  2ZQM A;  4UCT A;  4CS3 A;  3P32 A;  3ZED A;  2PUS A;  4LP8 A;  1AI6 A;  5LGN A;  4JTC B;  2ZR2 A;  1VIB A;  3CRM A;  4KXR A;  3ZHS A;  5IY5 B;  2WLI B;  3K5O A;  3UCS C;  4IHJ B;  2WA4 A;  4DR4 B;  1KP2 A;  3DXR A;  3OGC C;  1MSW D;  4JZ2 A;  5CB4 A;  1UPG A;  3LDC A;  5BR8 O;  2QEX V;  4X8A A;  5ITZ B;  2QKS A;  3ZRW B;  1K8A W;  4I4T A;  5H6R A;  1VQM V;  4JI8 O;  2RQ6 A;  1Q90 D;  2F66 C;  5IJ9 B;  3OW2 U;  1NTM H;  1M1K W;  3WFV A;  1GM8 A;  1BHB A;  2HP8 A;  4NYK A;  3PN1 A;  2GHY A;  1QVF U;  1QLN A;  3ABM B;  5B5E Z;  3P3P A;  5CBH A;  2FYU H;  3D3Q A;  2QWP B;  4UCR A;  4PA4 A;  1F4M A;  4X62 O;  2G38 A;  4H0L B;  1LUV A;  2OTL V;  4MVS A;  5CBG A;  2VRZ A;  1SZT A;  5TIS Z;  4GX2 A;  3UT5 A;  3ZBH A;  1M93 A;  1VF6 A;  2O57 A;  3UQ8 A;  1NTZ H;  4NR1 A;  4DR4 O;  4P30 A;  4UB8 Z;  5EK0 A;  4DR6 O;  5BMV B;  1RFY A;  5IE9 A;  4FLX A;  5FPO A;  4B7K A;  2OCC B;  4KHP O;  1Q86 W;  4OPH A;  3OMI B;  3HKB B;  4CS2 A;  3FB6 C;  4DR3 B;  3SJC C;  4O4I A;  5B1B B;  1J95 A;  4KHP B;  1IXM A;  2X6C A;  2Y4T A;  2EZO A;  5D5Q A;  1FXK A;  1TUB A;  4O4I B;  5CA0 A;  4UCU A;  3NR7 A;  4Q20 A;  2ZIO A;  4E4E A;  4O2A B;  4X20 A;  3E8G A;  2AXT Z;  3KZI Z;  1KYO F;  2HHH B;  1LUW A;  1XL4 A;  3ZMT A;  3OD4 A;  3E89 A;  5JQG B;  1M56 C;  4MTG A;  2E5L O;  5KLV H;  1W2B U;  5GON A;  1KU9 A;  1R3I C;  1W59 A;  3APQ A;  3CME V;  5K1X A;  1UJW B;  2ZNJ A;  4DYL A;  1GAX A;  4IYH A;  3T1Y B;  4FLW A;  1IDS A;  1YJW V;  3G6B A;  4UV8 A;  2QTO A;  2ZXW B;  1AR1 B;  5DN6 G;  2F95 B;  2IJH A;  4IT5 A;  3CX5 F;  2DJV A;  1HW7 A;  1RP3 B;  2HG5 C;  1M57 B;  4EKW A;  2QSA A;  2VWJ A;  1I5X A;  4F6E A;  2ZXW C;  4B3S O;  2YI8 A;  4WFG A;  1L0L H;  2Y0P A;  4CH4 A;  4JZG A;  1COW G;  4PHZ A;  3SJB C;  2ZCE A;  3JAL B;  3K58 A;  2L6L A;  4Z2W A;  2ZR3 A;  1BCC H;  1WB7 A;  1QBZ A;  4HNA A;  1FXH A;  1X59 A;  3CCE V;  4AQY O;  1AI4 A;  2V4D A;  4R8C A;  5KHI A;  4RAI A;  2FL4 A;  4CC5 A;  1YF2 A;  5LGT A;  3M7M X;  1V9P A;  5BY1 A;  1H2S B;  3JAL A;  5IYZ B;  2VQE O;  1XNR O;  1F4N A;  3JD4 A;  4EB6 B;  1K73 W;  5LGU A;  2HEP A;  4JF3 A;  4TV9 B;  2AZ2 A;  4LFA O;  1SQQ H;  1SC5 B;  4NXM B;  3ABM C;  3AG7 A;  2ETN A;  3RWR D;  2XAF A;  2RMK B;  3SYO A;  1PNK A;  2P4K A;  5IWA O;  3G80 A;  2QR4 A;  1BL8 A;  1FXK B;  2EIN C;  1R3K C;  1KP3 A;  2RJZ A;  3CC2 V;  5IYB O;  1PL0 A;  3GVM A;  1T5E A;  4RO2 A;  3ZN0 A;  1M5I A;  5BXZ A;  4JI2 B;  1WB8 A;  2YS8 A;  1H8H G;  2BSK B;  1Q8I A;  4YIP A;  1YSC A;  4FZ0 A;  3RYI A;  5BZB A;  2YEV A;  5LHG A;  5KAI Z;  2D3O W;  5JQG A;  1K9M W;  4IL6 Z;  1HNZ B;  4RQF A;  5L3F A;  4LF4 O;  4DV6 B;  4ZI7 A;  3STL C;  4GKK B;  2Y69 B;  4GT1 A;  4FM2 A;  5JWP A;  3G71 V;  3JYC A;  3JSL A;  2DQ3 A;  4LFB B;  1SQX H;  3K79 A;  1N32 O;  1VEW A;  5H2F Z;  4R7C A;  2UXC O;  4MTX A;  2JGU A;  1IBM B;  2AZ0 A;  3QO7 A;  2BE3 A;  4DUY O;  2IH3 C;  3AEI A;  3ZMZ A;  4I4T B;  1S77 D;  4X66 O;  4YJ2 B;  4DV0 B;  2HFE C;  2QM4 A;  4D7T A;  1ARO P;  3MDS A;  4MVU A;  1NZ6 A;  1U96 A;  4FFB A;  4JI6 O;  2QWO B;  4U7N A;  4ZKI A;  5KA6 A;  1FJG B;  1WP8 A;  1DLB A;  4NXN B;  1VAR A;  2KQX A;  5L3C A;  4DV1 B;  4LF4 B;  1Z2G A;  2E3C A;  4IGG A;  3HPL C;  4DRX B;  1VQ7 V;  5EC1 C;  5CB4 B;  4MVM A;  4J9Z B;  3RYC B;  4B3R B;  3B8N A;  4GYC B;  4I0X B;  1PD3 A;  3HKE B;  3JD1 A;  4J10 A;  3WG7 B;  4IHJ A;  4NTX A;  1QQC A;  2PZS A;  1P49 A;  1G1X B;  1GM9 A;  3HR0 A;  3SPG A;  1K92 A;  4YY3 O;  4DV5 O;  1JR9 A;  2VQF B;  5LBQ A;  3D36 A;  1Q6I A;  3RYF A;  3G6E V;  4TT3 G;  1L1F A;  2UUA B;  3BRC A;  5KA5 A;  2A9H A;  3CCL V;  1Y76 B;  1NTK H;  3A0H Z;  4FLZ A;  2PY5 A;  2JEU A;  1AJN A;  2ILM A;  3ASN C;  4DV4 O;  3OT7 A;  2DYS C;  5LA6 B;  5KUM A;  4LF5 B;  1G6U A;  4UVA A;  1YEW A;  4J41 A;  4I5S A;  1HNW B;  2EIM B;  2DYR C;  3K5N A;  3ZHV A;  1PNM A;  4LC1 A;  2UXN A;  2ATK C;  4QIW F;  1IVS A;  2QJ1 A;  3M99 B;  1NQT A;  4PV1 B;  2Q5Z A;  1M9N A;  1NBM G;  5CA3 A;  4JI5 O;  5BMV A;  3E22 B;  2W0X A;  4O2A A;  4X20 B;  1OJH A;  5EYP B;  4X64 O;  3OE7 G;  2XAQ A;  1X4T A;  2UU9 B;  2Q7H A;  3K59 A;  3CPW U;  3STZ C;  3KKY A;  3BPZ A;  2NR5 A;  2E75 B;  2XAG A;  3LSQ A;  4DW1 A;  2DE0 X;  2NN4 A;  1N0N A;  4D6T H;  2EIJ B;  3OUS A;  4LWS B;  4DV0 O;  1VP7 A;  1MMM A;  5IYZ A;  4LFA B;  1OCO C;  1W0K G;  1ZL8 B;  3H01 A;  4FIP C;  2WA3 A;  4P9O A;  2A7W A;  3JD2 A;  4PDL A;  4UFZ A;  4JPR A;  2JGD B;  3E35 A;  3K57 A;  3QF7 A;  1V55 B;  3ZMV A;  2W6J G;  5H5N A;  4LF9 B;  1V54 C;  4AQY B;  4BIZ A;  4JAA A;  3X2Q C;  3CD6 V;  3DXR B;  1YHQ V;  1TAE A;  1WAZ A;  3T1H O;  2JJ2 G;  3I55 V;  5EBL C;  1WNS A;  4WFH A;  3CRA A;  3ETD A;  3B4S A;  1US6 A;  4JI1 O;  4CC6 A;  1KKC A;  4JAS A;  4ICG A;  1AP5 A;  1QHT A;  5KHJ A;  4MVR A;  4FLY A;  4GLX A;  2LW1 A;  1FXK C;  1KBH A;  5IT9 N;  3C3T A;  1AJQ A;  2DW4 A;  3W7U A;  4G28 B;  3KCY A;  2R9A A;  5IWA B;  1VQK V;  1QCE A;  4FLU A;  3CCS V;  3OMN B;  1FFX B;  1Y76 A;  3B77 A;  1XMO O;  2JRI A;  3ZJZ A;  1RSO B;  5CN0 A;  3QO8 A;  1F23 A;  1SA0 A;  4LF8 B;  2Y69 C;  3C3S A;  5AG2 A;  1RPO A;  2XAJ A;  4JGS A;  4X1I B;  2UUB O;  1Y6X A;  2LP7 A;  1HNX O;  5J2U B;  1H2N A;  4NVP A;  4LF9 O;  3SDL A;  3B8M A;  1Y4M A;  3JAS B;  3N27 A;  1SQF A;  1J5E O;  1N33 B;  3TET A;  4G27 B;  3UM7 A;  3M8A A;  3ZCC A;  1XMQ O;  4PJ0 Z;  3KG2 A;  1B6Q A;  2BOB C;  4LF6 B;  4FK5 C;  2WLN A;  3AG2 C;  5IDJ A;  4J80 A;  3W7S A;  1I08 A;  4QPK A;  1L0N H;  2HR3 A;  2ZM6 O;  1Q5O A;  4EFB A;  1XMO B;  1BQZ A;  2X6B A;  3BA9 A;  4OXS A;  4B3T B;  1GN2 A;  2QDO A;  2EJ7 A;  2UXB B;  2W6I G;  3RYH B;  4L87 A;  1TGO A;  1YIT V;  1E79 G;  3A8T A;  1VF6 C;  2PI4 A;  5IYC O;  5GTH Z;  4K8X A;  3E8B A;  2FKX A;  4LF8 O;  1L8D A;  1AJP A;  1WPX A;  1ZL8 A;  3CCQ V;  3FYE B;  2N04 A;  1VMG A;  2EUL A;  4K8Z A;  3CRR A;  3ABU A;  3CCJ V;  2Y0I A;  4X1K B;  1SES A;  2ZKO A;  3AG4 C;  5KMG A;  4H33 A;  3ZRS A;  2N05 A;  4LH6 A;  3AK3 A;  3Q4H A;  5H6Q A;  1NU1 H;  1JMK C;  5EIB C;  2ITD C;  2Q73 A;  4FFB B;  4MS2 A;  2Y4U A;  4TQD A;  1ZLZ A;  3FAV A;  4PDM A;  1FAF A;  3J80 N;  4GKJ B;  1MSD A;  1I94 B;  1K33 A;  2JS5 A;  1AB3 A;  2IJJ A;  4JI0 B;  4JV5 B;  1O9G A;  2AGA A;  1N36 O;  2QWN B;  1G8M A;  2H94 A;  3OR7 C;  5DM6 V;  5L3B A;  3F7Y C;  4MSW C;  2GDS A;  1S5L Z;  2VQF O;  1XL6 A;  4LFB O;  3A2F A;  4A5U B;  3VBB A;  3FB7 C;  1HP8 A;  3FB8 C;  4GX1 A;  1SER A;  5J2T A;  3OGI B;  3CRC A;  5L3E A;  1H2M A;  1HDJ A;  3L73 H;  1BMF G;  5LHH A;  4UVC A;  2WWW A;  1CEZ A;  1ZTE A;  2ODM A;  3I56 V;  3TGU H;  1NI8 A;  4DO2 A;  4JI2 O;  3CHX A; 
#chains in the Genus database with same CATH homology
 3BEH A;  3W7X A;  2OCC C;  2YEV A;  4JTA B;  5LHG A;  2D3O W;  4KFM A;  2EIJ C;  1NVP D;  4GX5 A;  1K9M W;  4RQF A;  1V54 B;  5L3F A;  1KKD A;  2AHZ A;  2IU0 A;  4HZ3 A;  1KD1 W;  4WFF A;  3ZIA G;  5B1A B;  3STL C;  2Y69 B;  4GT1 A;  1NR1 A;  3K08 A;  1GK9 A;  3T4D A;  4XBF A;  2Q6A A;  4PA6 A;  3G71 V;  1KC8 W;  3JYC A;  3LNM B;  5B1N A;  2DQ3 A;  3AG1 C;  3LDE A;  4N23 A;  4QNH B;  2Y48 A;  3QNE A;  3RW0 A;  3K79 A;  3LSS A;  3EHB B;  3LUT B;  4GX0 A;  3CP1 A;  2EJR A;  3FYI B;  1H2G A;  2EIL B;  5LHI A;  2P90 A;  4LBE C;  4R7C A;  1NR7 A;  3K06 A;  4MTX A;  2C2A A;  3QO7 A;  4JYC A;  2PI5 A;  2LFS A;  1THZ A;  1DF5 A;  1JJ2 U;  2XOK G;  3GWO A;  3OR6 C;  1KQS U;  4KP4 A;  4RQE A;  3UKM A;  2IH3 C;  3AEI A;  4ZBM A;  3ZMZ A;  1QR9 A;  2R9I A;  1S77 D;  2ZD9 A;  3HB3 B;  3IFX A;  1N8R W;  4PDR A;  3K9A A;  4MW3 A;  2HFE C;  3EFF K;  1H8E G;  2KB1 A;  5IYD O;  1ARO P;  4MVU A;  2V7Q G;  2WAM A;  1ZWI C;  3K0D A;  1VQL V;  4U7N A;  4ZKI A;  3E83 A;  5KA6 A;  2B1G A;  1K4D C;  2JK5 C;  4P9P A;  3SPI A;  3D3I A;  3TCU A;  1VQ6 V;  2W0F C;  1EFR G;  1DLB A;  2R9R B;  5L3C A;  1K97 A;  3FKS G;  4BW5 A;  4F4L A;  2AHY A;  2A0L A;  1GTO A;  5J9P C;  3CCR V;  3GB7 C;  3HPL C;  1VQ7 V;  1P7B A;  2HJF C;  2EZP A;  5EC1 C;  4JAU A;  1LNQ A;  4MVM A;  1S5H C;  4J9Z B;  3B8N A;  2HVJ C;  1QVG U;  1R6K A;  1PD3 A;  3E8F A;  3AG3 C;  3JD1 A;  5EBM C;  1QLE C;  2P7T C;  2IU3 A;  3IC7 A;  3WG7 B;  4UXN A;  3AG3 B;  2FTK A;  3ASN B;  3IGA C;  4HAM A;  3F5W C;  1GM9 A;  3SPG A;  1K92 A;  2WLM A;  3WG7 C;  4JYB A;  4QPJ A;  5LBQ A;  2HLD G;  3D36 A;  3TK1 A;  2UXX A;  3RVY A;  2M7W A;  2DWD C;  2EIK C;  4PEL A;  2XAS A;  4TT3 G;  1L1F A;  3G6E V;  3CCV V;  3CC4 V;  3ZRV A;  3W7W A;  5KA5 A;  3K3W A;  1FFT B;  2A9H A;  3CYO A;  1R6N A;  3CCL V;  4X89 A;  3CCU V;  1OCC B;  4R6Z A;  1BHA A;  1W0J G;  1EZJ A;  1SET A;  4BAY A;  2QE7 G;  4WF9 V;  1KEC A;  3DTU B;  2XND G;  2ITC C;  1GKF A;  2JEU A;  2QM8 A;  1OCR B;  3OEH G;  3P30 A;  1AJN A;  3ASN C;  3AG4 B;  1VQ4 V;  2B5U A;  1SRY A;  1OZ0 A;  2K1E A;  5B1B C;  3K04 A;  3E86 A;  2DYS C;  3SYP A;  3NXS A;  4MTO A;  1MOF A;  2DWE C;  5KUM A;  2X6A A;  4UVA A;  1S72 V;  4I5S A;  4BIU A;  3PJS K;  1K34 A;  2LFR A;  3ABK C;  2WLK A;  2EIM B;  2F43 G;  1OHH G;  2DYR C;  1Q81 W;  3ETE A;  1ORQ C;  4XDL A;  1R3L C;  3AG2 B;  1M57 C;  4RUF A;  4PA3 A;  3T1C A;  1PNM A;  4LC1 A;  4QE7 A;  2WLI A;  3RVZ A;  2UXN A;  2ATK C;  2OT5 A;  4QIW F;  2JEX A;  3M99 B;  1NQT A;  1K3E A;  3JCZ A;  1FS0 G;  1YJ9 V;  2WLJ A;  5H9C A;  2DQ0 A;  1M9N A;  3E8H A;  1NBM G;  5CA3 A;  2HVK C;  4WFB V;  3MD0 A;  4FJC C;  3BY6 A;  1CP9 A;  3OE7 G;  2XAQ A;  3AG1 B;  3X2Q B;  1MAB G;  4P2Z A;  3SPJ A;  1VQP V;  3ZMS A;  3CPW U;  3F7V C;  3STZ C;  3LDD A;  2XAG A;  3LSQ A;  1V55 C;  1R73 A;  4JAV A;  2P6J A;  4JTD B;  2Q67 A;  2JDI G;  4MTF A;  4H37 A;  2IW5 A;  1AI7 A;  4MVZ A;  5HFM A;  4MVO A;  2CK3 G;  1VQ5 V;  1GO3 F;  3T4Z A;  2EIJ B;  1DTO A;  3R65 A;  3K0G A;  1YI2 V;  3OUS A;  1PKX A;  3ZMU A;  3CXC U;  3SYA A;  2EIL C;  4CZZ A;  1OCO C;  2H8P C;  2ZQM A;  3ZRW A;  1W0K G;  1OCR C;  4KUM A;  3H01 A;  4FIP C;  1M90 W;  4P9O A;  3JD2 A;  4PDL A;  4JPR A;  3E35 A;  2X0L A;  3P32 A;  1OCZ B;  1YTF D;  3ZMV A;  1V55 B;  4LP8 A;  1AI6 A;  4MT8 A;  4R50 A;  5LGN A;  2W6J G;  2DYR B;  1E1R G;  2YSU B;  2ZR2 A;  1QR8 A;  4JTC B;  5CBF A;  1V54 C;  3VOU A;  4BIZ A;  1G4Y B;  1OCZ C;  4PA7 A;  5IY5 B;  1RM1 B;  2NNU A;  4N21 A;  2WLI B;  4UUJ C;  4U7O A;  3X2Q C;  3CD6 V;  1YHQ V;  2JJ2 G;  1KP2 A;  5EC2 C;  3I55 V;  1NVP B;  3ABL C;  5EBL C;  4WFH A;  3OGC C;  1MSW D;  3ETD A;  2OTJ V;  1NH2 D;  1R3J C;  4YXW G;  3LDC A;  2WSS G;  2QEX V;  3A0R A;  4X8A A;  1VQO V;  3SYQ A;  5CMU A;  5FL7 G;  3ZRX A;  1JVM A;  1K5Q A;  2GSM B;  2QKS A;  3ZRW B;  2B1I A;  1K8A W;  4JAS A;  2P67 A;  5H6R A;  3MHS C;  1VQM V;  3G4S V;  4MVR A;  1ENV A;  2HKO A;  4QJF B;  3SYC A;  1RM1 C;  3OW2 U;  1FXK C;  2Q69 A;  2A79 B;  1K4C C;  4UV9 A;  1M1K W;  1JCH A;  3WFV A;  2NLJ C;  1GM8 A;  1BHB A;  1AJQ A;  1GMG A;  2GHY A;  1QVF U;  2DW4 A;  3ABM B;  1DF4 A;  3OFN G;  2YEV B;  4G28 B;  3W7U A;  5CBH A;  1QLN A;  4WCE V;  4WFA V;  1VQK V;  3OAA G;  1QCE A;  3CCS V;  1I5Y A;  3OMN B;  4PA4 A;  1F4M A;  5GW7 A;  2OTL V;  5IY5 C;  4MVS A;  3B77 A;  5CBG A;  1S0V A;  3ZJZ A;  1SZT A;  5CN0 A;  4GX2 A;  3QO8 A;  1F23 A;  4GCZ A;  2Y69 C;  1WLE A;  3OUF A;  2QM7 A;  1RPO A;  2XAJ A;  3DGE A;  4P30 A;  3RBZ A;  4JGS A;  4TWK A;  5EK0 A;  4LCU C;  4DXW A;  2LP7 A;  2OCC B;  1JX9 A;  1AI5 A;  1Q86 W;  3OMI B;  3B8M A;  3FB6 C;  2WLL B;  1VQ9 V;  4FPP A;  1Y4M A;  2Z3Y A;  5B1B B;  1J95 A;  4RUE A;  3W7T A;  1IXM A;  1QLE B;  2X6C A;  1JOY A;  3TET A;  3CC7 V;  1HWY A;  1P4R A;  2EZO A;  4G27 B;  3UM7 A;  1FXK A;  2WLL A;  3ZCC A;  3CCM V;  1RPR A;  5B3S C;  3KG2 A;  1B6Q A;  1YJN V;  2BOB C;  2IJK A;  3OM3 B;  2Q68 A;  4UVB A;  1CPY A;  4Q20 A;  4FK5 C;  2WLN A;  3AG2 C;  5IDJ A;  1Q82 W;  3ETG A;  3SJQ C;  3W7S A;  3E8G A;  4QPK A;  1MG1 A;  2HR3 A;  1K7D A;  4WFE A;  4J9Y B;  2X6B A;  2MK3 A;  1TUE B;  3SPC A;  4OXS A;  3QO5 A;  1XL4 A;  3ZMT A;  3OEE G;  3E89 A;  4XDK A;  1VQ8 V;  1M56 C;  2EIM C;  4MTG A;  2W6I G;  2QA4 V;  1W2B U;  1Y66 A;  4L87 A;  1VQN V;  3T2M A;  1R3I C;  5KUK A;  1YIT V;  2BOC C;  3CME V;  1E79 G;  1JQ0 A;  1UJW B;  2Z5U A;  1NJI W;  2PI4 A;  5IYC O;  2EBO A;  3E8B A;  2WPD G;  4MW8 A;  1AJP A;  2X7R B;  2ZDI C;  3ASO B;  1YJW V;  4UV8 A;  2QTO A;  2ZXW B;  1EBO A;  2EIN B;  5DN6 G;  1AR1 B;  1WPX A;  2IJH A;  1NH2 B;  4X88 A;  1F51 A;  3FYE B;  3CCQ V;  5HFL A;  1FXV A;  1S76 D;  2HG5 C;  1M57 B;  3MHH C;  3ABU A;  4FMT A;  5EBW C;  4XDJ A;  2WLH A;  4EKW A;  5B3S B;  3ASO C;  1I5X A;  3CCJ V;  1SES A;  2ZXW C;  3AG4 C;  2EIK B;  4H33 A;  3ZRS A;  4WFG A;  5L3G A;  3JD3 A;  5H6Q A;  4QE9 A;  4G2K A;  1YIJ V;  1COW G;  2IJI A;  1ROP A;  1K5S A;  4ASU G;  2ITD C;  2ZR3 A;  3ABL B;  1PNL A;  3JD0 A;  1QBZ A;  1GM7 A;  1M56 B;  4MS2 A;  1FXH A;  3CCE V;  4PDM A;  4TSF G;  3ZN1 A;  1AI4 A;  1K33 A;  3ABT A;  2IJJ A;  4R8C A;  4RAI A;  3ABK B;  5LGT A;  1E1Q G;  1G8M A;  2H94 A;  3OR7 C;  4PDV A;  5E1A C;  4MVQ A;  5B1O A;  4I9W A;  5DM6 V;  1F4N A;  3JD4 A;  1K73 W;  5LGU A;  2ZDI A;  5L3B A;  3F7Y C;  3K03 A;  3OMA B;  4MSW C;  4JF3 A;  2DYS B;  1XL6 A;  3FB5 C;  4Z1M G;  3ABM C;  3E2E A;  1OCC C;  2V1D A;  3VBB A;  2XAF A;  3FB7 C;  2JJ1 G;  3FB8 C;  3SYO A;  1PNK A;  4GX1 A;  4PA9 A;  2IH1 C;  1SER A;  5L3D A;  5B1A C;  5L3E A;  1BL8 A;  1FXK B;  2EIN C;  1R3K C;  4CBC A;  1JPX A;  1KP3 A;  5C93 A;  3CC2 V;  5IYB O;  1BMF G;  2XAH A;  5LHH A;  1YTF B;  1PL0 A;  4UVC A;  2WWW A;  4E2L A;  3ML0 A;  1CEZ A;  4RO2 A;  1OCO B;  3ZN0 A;  2JIZ G;  1S3J A;  4HYO A;  1NKD A;  1H38 A;  3I56 V;  1H8H G;  4DO2 A;  3SPH A;  1YSC A;  3CMA V;  5BZB A;  1Q7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...