2GHYA

Novel crystal form of the cole1 rom protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
57
structure length
57
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title Novel crystal form of the ColE1 Rom protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 24
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ghyA00
1PD3A 2IJJA 1RPRA 1GMGA 4DO2A 1ROPA 2IJKA 1F4MA 2IJHA 3K79A 1RPOA 1F4NA 1NKDA 1B6QA 1GTOA 2IJIA 2GHYA
chains in the Genus database with same CATH superfamily
3RWRD 2WWWA 3STZC 1ENVA 3ABTA 2KB1A 2HEPA 1YEWA 4OPHA 1SKVA 2H94A 2IJHA 3J80N 5E1AC 2EILC 1SETA 5LMUB 4DYLA 3JCZA 3QF7A 4TT3G 2XAQA 4I50B 2Q0AA 2HHHO 3ZBHA 2PI4A 1ORQC 2Y48A 3O9OA 4R6ZA 4JTAB 3N2GA 2EIMC 4ZOLA 2EINB 1ZTEA 4K8XA 1WLEA 5H9CA 3L70H 1TVKB 4LNUB 5CN0A 4X65O 4MW3A 4FPPA 1N34B 2KQXA 4QE9A 2JDIG 5KHIA 3JALB 1NR1A 4JI2O 1NKDA 1PL0A 4PI2A 1I08A 3SJAC 4WFBV 4GX0A 3OTFA 5LMNB 2HVJC 1B6QA 3STLC 3CRAA 1DF5A 4QE7A 4DV5O 1NH2D 1AR5A 1P84F 4UB6Z 1QCEA 2XASA 2QWPB 5F2VO 2XOKG 1VQ7V 4MVUA 4DR2O 2PYLA 1L0NH 1W0JG 5JWPA 4JI1O 2DYRB 2RN9A 4AQYB 2ZE7A 5BR8B 1WAZA 1J5EB 4YHHO 4X62O 2QM8A 1JCHA 1D2DA 4LFBB 3EVKA 1N36B 5JJNB 3AG3C 1SQFA 1XHXA 3ZRWB 3JD4A 4PELA 2CTWA 1FKAO 1XMOO 2QKSA 2EINC 3JSLA 4U7NA 1AR1B 1SQQH 1PP9H 1MNGA 1E1RG 4MTXA 2DOSA 3JALA 4DR5O 4LF6B 1K5QA 5EZYB 3UT5B 1M90W 4P9OA 1X4TA 1JPXA 3DGEA 4QNHB 4TOIA 2ZR3A 4LWSB 3CXCU 2A79B 3DXRB 1G1XB 1AP5A 4BW5A 1TUBA 2JS5A 3UCSC 3CPWU 4DR4O 5JCOA 4FM0A 1OCOC 2Q7GA 2K1EA 3SDLA 1B04A 4PI0A 5FNVB 3OD4A 4I9WA 4PD4F 2BOBC 3O65A 3H1LH 4UCSA 1YVWA 1OCZB 1TA8A 1WJZA 4JASA 4X66B 5CBFA 2ZE6A 4I5SA 4UB8Z 3CS5A 1S77D 4CC5A 3D3IA 4J7KA 1EN5A 4RUEA 3X2QB 4DW1A 3ZRWA 4DR6O 1YZBA 2DW4A 2D2CB 2LFRA 4GX1A 4LH6A 3T1HO 4B3MO 3TGUH 3MD0A 5LXTB 3OGCC 1RM1B 4MT8A 1PNMA 2YIDA 4B3TB 3AG1B 1AI7A 1N0NA 2JEXA 4WBNA 4IGGA 2BCCH 3MDSA 1XMQB 5DEDA 4TV8B 4FFBB 3UT5A 1Y4MA 3ZMZA 3K59A 2BSKA 5HFMA 4LWSA 4B3SO 4LF8B 2IM9A 5A9GA 4WFHA 2CDYA 1LUVA 5AG2A 2B1GA 1K73W 2Q68A 2BTQB 5KX5A 3AEIA 4F6RA 4H0LB 2HJDA 4W4LA 3BY6A 4DR1B 2NR5A 5FNVA 1X59A 4CS4A 5IYZB 4PA7A 4B3RO 1NS1A 3ZHUA 4MVRA 4DW0A 1BGYH 1B3QA 2Y4TA 4TV9B 2BTOA 2EIKB 5IWAO 2IU0A 4JGSA 4J7ZA 2WLLB 5EBMC 1NQTA 2JGDB 3JATB 2QDOA 3OW2U 3OM3B 2FMLA 4NB5A 1E1QG 4KP4A 3ASOB 2UUAO 1QR9A 1DLBA 2DN9A 1QLNA 5GTHZ 1TAEA 4WFAV 2R9AA 1L8DA 4EFBA 1NVPD 3KZIZ 1IBKB 4WCEV 2X6BA 4IHJB 1H2GA 4TV8A 3WG7C 4FFBA 5BMVB 5JVDB 3ASNB 3APOA 1Q86W 3RYIA 1OCCC 1CP9A 1VIBA 4B08A 1OV9A 2AHYA 1LUWA 5K1XA 2VQEB 1BZKA 1IDSA 3CJHB 2C2AA 4NTYA 1Q7YW 1AILA 5CBHA 1HR0B 3NXSA 4CH6A 2BTQA 1MSDA 3E2EA 2LQTA 2IH3C 4GYCB 2M6YA 1VQOV 1SQXH 3WB2A 5B1BC 1N33B 3APQA 1K97A 3OGIB 5IYZA 1NT2B 3ETGA 3RBZA 3ZIAG 2RJZA 2A06H 2PYJA 4TV9A 3ABLC 4JI5B 2QKCA 2WLLA 2H8PC 3A0RA 3T1CA 3JATA 4X89A 4JI6B 3E89A 3RT3C 1GK9A 3OFNG 2UXCB 3CCMV 2EX3A 1W0KG 4OX9B 3G67A 4GKKB 1UJWB 4H44B 1RFYA 1Q6HA 5E79Z 2ZNJA 3CCUV 3FAVB 3FB7C 1FAFA 4DUYO 2YDEA 4CS3A 2PZSA 2P4VA 5BXZA 3ZHQA 3OMAB 3DC6A 2B1IA 3RYHB 1I94B 3D36C 2ITDC 1GN4A 3L75H 3SPGA 2F1MA 1AJQA 3EXAA 5BMVA 4NXMO 1VQ6V 3T2MA 1S5HC 1HW7A 2OIGA 2OYQA 3SYQA 2WLJA 2QWRB 4DV1B 2JVDA 1SA0B 5B1AB 1U97A 3CJHA 4O4IA 2ITCC 3I56V 3VQXA 3NR7A 2D3OW 4ZHQB 2FL4A 4XDLA 1GN2A 4RAIA 3ZS8C 4O4HB 5L3CA 1HNWB 2FKXA 1DTOA 1V55C 4BIZA 2YEVB 4YY3B 2IH1C 2XAJA 1QHTA 1YJ9V 4DV3B 5LP6A 3FB5C 1GN6A 5IJ9B 3KKYA 4UUJC 3ZRVA 4D7TA 1Y6XA 4FFKA 4PV1B 1KP3A 1XNRO 2YXHA 3ZCCA 1FXKB 1R3KC 2OTJV 2DWEC 1KD1W 1O9HA 1NU1H 3RN4A 4RUFA 1VQNV 4JI3B 3TXQA 1OCRC 4OPAA 3SPHA 2ZE5A 4KHPB 4J7JA 2DMXA 2YI9A 1XI1A 3FKSG 3Q4HB 4HNAB 3L74H 4JI0B 5JJJB 4EKWA 5IJ0B 4YJ2B 4O4HA 3ML0A 2OWOA 1YI2V 1BHBA 4JYAB 2FB5A 3OR6C 1HNXB 3B77A 3QO5A 3G71V 1WP7A 4TSFG 2WLKA 2DWDC 5B1NA 2XAHA 4EEQA 4RQEA 3T1YO 1U96A 4JI8B 1F4MA 4N23A 2R9RB 4FM2A 5IJ9A 1FJGB 5DM6V 1KP2A 1FFXA 2EILB 3ZHRA 3CEIA 4B7KA 2UU9O 3JYCA 3S3WA 4FK5C 1Z5WA 1VP7A 2R9IA 3JAWB 2AHZA 1H38A 3H01A 2VQFB 4KUMA 2WAMA 3OTOO 1WP8A 2ZM6O 2DYSC 2MK3A 1N32B 3DTUB 4LC1A 3ZRXA 2EIMB 5IYBO 1P7GA 4NXNB 4FLZA 1Y74B 4X64O 2VWJA 3MHHC 3CMEV 3UQ8A 3FYEB 3OAAG 3OT7A 3QNEA 4LF5B 2Q5ZA 1R6NA 2WLHA 4EFEA 4RQFA 3Q4HA 2HFEC 4HNAA 5JH7B 2ADQB 3K9SA 2XTAA 1R3JC 2CAZC 3SPJA 5IJ0A 5A2QN 1FS0G 4MTOA 1NZ6A 2P4KA 1KUQA 2JRIA 4U3JA 2GUZA 1AI6A 5LOVA 1W2BU 1P7BA 2AGAA 2QA4V 1QQCA 1SQGA 1OZ0A 5LMUO 1NBMG 4AHCA 5KUMA 1IBMB 2RMKB 2QEXV 3K79A 1XL6A 1Q81W 3ZMSA 3TCUA 1B06A 1SS3A 2AW9A 4X1IB 2WLNA 1VQMV 2Q8VA 1IX9A 3ZHTA 1BHAA 1VF5B 3VQWA 2RDCA 3AG3B 1SZTA 3AK2A 4ICGA 4UCTA 1N34O 1RSOB 2W0FC 3HKBA 4BWAA 2LO1A 1WPXA 2GDSA 1XREA 3BRCA 3M99B 1P4RA 4MVMA 1EM1A 5EC2C 3RW0A 4FZ1A 2XAGA 5LMNO 4JAVA 3DSQA 2WLIA 2JS3A 3HKCB 3QO7A 4G27B 3JARA 3M7MX 2CE4A 4DR3B 2OIEA 3RYFA 4ABMA 2VS0A 3AK1A 2QWNB 1L0LH 5KAIZ 1AJPA 4GKJB 5JJEB 1CPYA 3QTCA 1I5YA 4NR1A 4O4JA 3BPZA 4GUNA 1EN4A 3FB6C 1QLEC 4J80A 4W4KA 1JQ0A 1CEZA 1KB9F 2P90A 3JAKA 4AQYO 3IJ4A 1J5EO 5FL7G 4DR7B 4LFBO 1ZUQA 1O9GA 5D5QA 1OCOB 2Q69A 4LCUC 1N36O 2GTSA 3BVOA 2P67A 2YSUB 2QE7G 4YIOA 4GLXA 4UCOA 2E5LB 1I7FA 3GVMA 2CH7B 2Q73A 2Y69C 2OCCC 3H1HH 2Y0IA 1N0JA 4GCZA 4I50A 4XBFA 1RSOA 1H2LA 4OGQB 4JI7B 2YICA 2P06A 4TQDA 3IAYA 5B5EZ 4L8JA 4LF6O 3G80A 2WSSG 1TVKA 4LNUA 3UKMA 1VARA 1V54C 2HLDG 1K5SA 4D6TH 3JAMN 3VBBA 3OR7C 2GHYA 1FXHA 3LNMB 1K7DA 3GWKC 4LBEC 5EBLC 4K0KO 4R50A 4DV7B 1YTFB 2E75B 4X88A 1SRYA 1KC8W 2ZDIC 1XOUA 1AJNA 2CTRA 1OHHG 5H5NA 1T5EA 2IJIA 4I4TB 1M57C 5ITZB 1KKCA 4ASUG 4Z2WA 3LUTB 2ZCEA 3E22B 3CSXA 5B3SC 4MVSA 4FLUA 3L9DA 2UXXA 1H2MA 4X66O 3R65A 1XILA 1YJNV 4H33A 3G6EV 1Q82W 5KA5A 4UVAA 1GM9A 3SYOA 1M93A 5KAFZ 3C90A 5LA6B 1I0HA 3DC5A 4DK1A 2VRZA 3CCLV 1ROPA 1NTMH 2IJKA 1L1FA 3G4SV 2PY5A 4B3TO 2F4VB 2YS8A 1AVMA 4LH7A 3OMNB 5L3FA 3ZN0A 2ADPA 4L87A 5BZBA 3R66A 3SYPA 4JF3A 1XMQO 3QG5A 4LF9B 3FX7A 2HKOA 1NTZH 4R8CA 3HKEB 5CBGA 3OE7G 4ZI7B 3WG7B 4BR6A 1H8HG 4LF8O 5EZYA 2QKAA 1OCCB 3E86A 3B4SA 1LNQA 3H1JH 4IL6Z 5J2UB 3LNNA 5CA0B 2XHBA 3I5DA 5B66Z 5ITZA 4PA9A 5KLVH 3OUFA 3QVNA 4DR1O 3E22A 2YIBA 3DXRA 2CTQA 5FPOA 2ODMA 5DECA 1US6A 3SJCC 3K04A 2UXDB 1VQ9V 2N04A 2E74B 2A3QA 5B1BB 4TWKA 5JQGB 3JD0A 4MW8A 5LA6A 4FLVA 5LBQA 2LGWA 3ABLB 1NR7A 4PDVA 3PJSK 2LGQA 5GTIZ 4XDJA 1JVMA 4K35A 3UM7A 3FFQA 4X8AA 3B2EE 3B8MA 3PN1A 1K92A 1DF4A 3CRRA 1WPBA 4X1KB 2IU3A 5LXTA 4ZIBA 4O2AB 4E4EA 4PHZA 1ZSPA 1PKXA 2HP8A 2ZIMA 3K5NA 1ZL8B 4TUYB 1WB8A 4HYOA 2VQEO 3CWBH 4DV4B 4X1YB 1GM8A 5D5PA 4CZZA 3F7YC 4DV0B 1QVFU 4JZ2A 1HR0O 1MG1A 5J2UA 2QJ1A 4CH5A 5LHHA 4DV2B 4JPRA 1N33O 5CB4B 2ZXWC 2DQ3A 2UUAB 4JI5O 3CYOA 5JQGA 2LJ2A 4D7SA 3ZEDA 3CX5F 3VOUA 3OEEG 4J42A 1JFFB 2OT5A 4DXWA 4JI6O 1Y76B 2L6LA 5IY5C 2UXCO 1V55B 3ICXA 4OX9O 1XEQA 3A0HZ 2N05A 5J9PC 2ARHA 2EIJC 2CK3G 4JAAA 5CA1B 4PA6A 3IGAC 2JGDA 3CHXA 3SPCA 3TETA 4O2BB 2GTAA 1IURA 4YXWG 4O2AA 3K06A 3ABKC 1XNQB 1E79G 3AK3A 5LGTA 4LFCB 2BE3A 3D36A 3RYCB 1ZL8A 1SZXA 3P3PA 4DV1O 2QM7A 4LFAO 1VF7A 4E2LA 2UXBB 3E8GA 1YITV 5EK0A 4X1YA 4DV6B 1EN6A 4JI4B 4MS2A 1UPGA 4IHJA 3W7UA 5JVDA 4WFEA 4K3AA 1OCRB 2WPDG 2MW2B 2PF4E 2YIAA 1SQVH 2YI8A 2A7WA 4Q6GA 1MOFA 3ETQA 1UFIA 1HNWO 4HBNA 3LSUA 1PNLA 4YJ3B 4NYKA 3K0GA 3K57A 2X6AA 3MAQA 4DUYB 4YY3O 1M56C 3ABMC 2XAFA 4DO2A 1AROP 2E76B 1AI5A 4DV3O 5LL6Y 3D3QA 1M1KW 2ZKOA 3CXHF 2FYUH 5H2FZ 5BY1A 1BE3H 1EFRG 4NXMB 3E8FA 1SF9A 1PD3A 2Y4UA 5CA1A 2Q9LA 1G8MA 4Q20A 3AG7A 3FYIB 1URFA 4JV5B 4B7EA 2O57A 1MSWD 1D5NA 4J41A 1VF6A 4MVZA 1VQLV 4X9QA 3FAVA 1SQBH 1KECA 3RYCA 4JI3O 1H2KA 1Q5OA 4LF4B 3RYHA 4KHPO 5C8YB 3SYCA 5K1PA 2UUBB 2EBOA 3E83A 3LDEA 2DYSB 2XUMA 5LP6C 1S5LZ 3FD9A 1R73A 4I0XB 1K9MW 1YXBA 4U7OA 2UXNA 1K33A 4JI0O 2W0XA 1SA0A 3ZHVA 1XHZA 1NTKH 2IBZH 2X0LA 1HNZB 3GWOA 2RCVA 1IBLB 1KQSU 3T4DA 3ZJZA 3JSNA 4ZHQA 3EFFK 4ZBMA 2NN4A 4J11A 2RNBA 4JI8O 2ZIOA 3ETEA 1RPRA 1BS3A 2P6JA 1FJGO 1N4CA 5EIBD 2YEVA 3QO8A 3VQVA 2LW1A 4NVPA 1I5XA 3AG4C 1WA8B 2EJRA 2ZINA 3P32A 2CGNA 1K8AW 4A5UB 5IE9A 2VQFO 3CC2V 4IIJB 2EZPA 5C93A 5LYJB 1GM7A 1MZFA 3T4ZA 4J9ZB 2W6JG 1N32O 3IC9A 3HKDB 3K5OA 1FXKA 2L35A 1R6KA 5TISZ 5C8YA 4NXNO 4GZRB 4DUZB 3H1IH 1Y66A 4LF7B 4LF5O 2ZT9B 3CC7V 2V7QG 1S3JA 4FLXA 2CUGA 2ZNIA 1JOYA 2PUSA 1QNMA 2CGOA 2W6IG 1KBHA 3MHSC 1K4DC 4I9QA 3WB1A 5IYDO 2YUAA 1Q8IA 3CMAV 4PDMA 2UU9B 4P2ZA 2JIZG 1K4CC 4YJ2A 3N2GB 1H2SB 4ZOLB 4GX2A 1R6TA 5EYPB 1IBMO 1QLEB 1G4YB 4KXRA 4WFFA 2UUCB 1YSCA 1JJ2U 1YDXA 3ZX6A 4PDRA 1WA8A 4J10A 3ETDA 3BCCH 3HPLC 1R3LC 2P7TC 3U0ZA 4O4LB 1PNKA 5HFLA 3LSQA 1F23A 2LP7A 1J95A 4F6EA 1ZAUA 3HKDA 2Y69B 2PGGA 2OCCB 1WN7A 3JAWA 1JR9A 3K03A 4EB6B 1BSMA 1EZJA 2ILMA 3K9AA 4RWUA 4ZKIA 3F5TA 3AG2C 4DR3O 1Y74A 1FPOA 1Q90D 4P9PA 1V54B 1CXZB 2AZ0A 4C7UA 3H9VA 1OJHA 4GKJO 3WB0A 5JH7A 1WNSA 4R7CA 3C3TA 1WB7A 1XBLA 2BOCC 3P30A 3OUSA 5B1OA 1YJWV 5EYPA 1H8EG 4DR7O 3SJBC 1M57B 4IYHA 4PA4A 4UVBA 2HHHB 3E8HA 5FPRA 1VQ8V 5B3SB 3OMIB 4PDLA 1ZX3A 4BIUA 3JD1A 5BR8O 1FFTB 2E5LO 3BAAA 2YC0A 4GX5A 4KL1A 1NI8A 3A0BZ 4X65B 4O4LA 4X1IA 1GRJA 3JCUZ 2XNDG 1NH2B 4JI7O 3IFXA 3C3SA 5KUKA 4JI2B 4EB6A 3K0DA 3K3WA 2XT9A 1TUBB 2F95B 2QGNA 2CTPA 4I55B 2NLJC 4FMTA 4DV5B 3L73H 4CS2A 4DV7O 5KHKA 3CCSV 5L3DA 4DR2B 4XDKA 3HKCA 5IT9N 1PV0A 1KYOF 4JI1B 2F93B 1ZLZA 2PTMA 1KMIZ 2ZDIA 2Q7EA 1MABG 1W59A 4YHHB 4X62B 4CH3A 4HZ3A 2Y0PA 1YTFD 4HAMA 4F4LA 2PI5A 4FLYA 3ZRSA 1JMKC 1M4UA 1TGOA 1BCCH 4TQFA 4AI8A 3JD2A 5H6QA 3CCRV 4WBNB 1XMOB 2IJJA 2YIBD 2RQ6A 3LSSA 3J81N 2V4DA 3K5MA 1BMFG 1R1BA 4U3FH 1HDJA 3ZN1A 3JASB 1A32A 2BSKB 2F4VO 2WA3A 2KG7B 2Z3YA 1RPOA 4DR5B 1QBZA 4K0KB 2CH7A 4WFGA 5DN6G 2QTSA 2GBOA 3JD3A 5LGUA 2E3CA 2EULA 3WFVA 4LF9O 1FXVA 1ZWIC 4UCVA 4I55A 5FLXN 2WA4A 5KX5B 4NKGB 2ETNA 4FVMA 4F6RB 3BHPA 1LR1A 5JCOC 4UV8A 1KKDA 2DYRC 2GSMB 1NJIW 2YXLA 5LHIA 4QGPA 4P30A 4CC6A 2DJVA 1F51A 1YF2A 2Q6AA 4PJ0Z 1XUQA 4DR4B 1JJOA 2ZD9A 3SJQC 3UO3A 3H1KH 3RGBA 4FLTA 2X6CA 1KU9A 2JGUA 2LW7A 3GB7C 3I55V 2JEUA 3SPIA 3W7XA 2UXDO 5KHJA 1GMGA 4I4TA 4NTWA 4FM1A 4DR6B 2V1DA 2ZXWB 3CC4V 4MSWC 4FJCC 3CCQV 3UO2A 3T1HB 3CRQA 3L72H 4B3MB 1S0VA 4OXSA 1GN3A 1GKFA 1JX9A 1R3IC 4QIWF 5LHGA 1YIJV 1S76D 3JASA 3RYIB 1PM9A 2KG7A 4MVQA 5IY5B 2HG5C 3J7AU 2OTLV 4PA3A 1N8RW 2G38A 3KCXA 1PPJH 2EIJB 4AILC 1SC5B 1RP3B 2JJ2G 5KHHA 2QWOB 3OEHG 2FTKA 4UVCA 4B3SB 4NTXA 3ABKB 4DV4O 3RVYA 5L3GA 1IBKO 1V9PA 5KA6A 4DV0O 4BW9A 1OCZC 2QR4A 4N21A 2F43G 3LDCA 1BQZA 3U10A 3CCEV 5CMUA 4JTDB 3HKEA 3X2QC 4DV2O 1IZ3A 4ZI7A 4B3RB 2ZE8A 1HWYA 2GV9A 1BQ0A 4G2KA 1S72V 5IWAB 5CA0A 2N74A 2QM4A 1RM1C 1XL4A 4FZ0A 4H37A 2EZOA 1NVPB 3AG1C 1QVGU 2Z0AA 3BEHA 1FD9A 1Z2GA 1BL8A 4MTFA 4WF9V 1G6UA 4JYYA 1IXBA 3K5LA 2B5UA 1M56B 5CA3A 3ABMB 1VQKV 4UV9A 1AR4A 3F5WC 3N27A 1EBOA 3F7VC 2AXTZ 4QPKA 3P3NA 4O4IB 3W7SA 4GKKO 1XNQO 4JYBA 4BIOA 3IC7A 2HR3A 4DK0A 4LFCO 4JAUA 2AZ2A 2F23A 1JA8A 3B09A 3ZMVA 2UXBO 2DE0X 1I94O 4X1KA 4DRXB 4DV6O 4JI4O 3B8NA 1Q3EA 1AI4A 4H13B 3CP1A 2HVKC 4K8ZA 4G28B 1Q6UA 1AB3A 4Z1MG 2EIKC 3RVZA 5IDJA 3KG2A 4TUYA 3CB2A 2R70A 1GO3F 4BAYA 2A9HA 4IYIA 5LP6B 1XDCA 1S5JA 4UCRA 4MTGA 3E8BA 1THZA 1GTOA 1P49A 2NNUA 5IYCO 2JK5C 2F66C 3ASOC 4GT1A 3KCYA 5CB4A 3HB3B 3K58A 5LGNA 2VWKA 4X20B 3BA9A 3THOA 1BT8A 3ZMUA 4LR3A 3W7WA 3A2FA 3ASNC 1JFFA 1Y76A 4UCUA 5L3BA 4LFAB 1HP8A 4I7ZB 1GH6A 2YXYA 3M8AA 2P5OA 4JV5O 1F7YA 4LP8A 2ATKC 3TK1A 4UFZA 1PL4A 3AG4B 5H6RA 2IW5A 1SERA 4O2BA 4LF4O 4DRXA 4IT5A 2UUBO 1TUEB 3U11A 1EZVH 3ZHSA 5KMGB 1Q43A 4FIPC 4CH4A 1Z5VA 1H2NA 2WLMA 3BFRA 3G6BA 1VMGA 1QU7A 3TJTA 1D5AA 1HNZO 3A8TA 3SYAA 1IBLO 1FFXB 1MA1A 1VF6C 4QJFB 1GAXA 4FLWA 1FYJA 4X20A 1Y67A 4JYAO 5GONB 4YJ3A 1HNXO 3CCJV 3L71H 5EBWC 3CCVV 1YCIA 1XNRB 4CBCA 1QR8A 3EHBB 1DGSA 1VQPV 1Q6IA 3N2KB 4UXNA 3TXSA 2QSAA 2QWQB 5B1AC 3ABUA 1VQ5V 1IXMA 2KKWA 5GW7A 1MZEA 2QTOA 3SR2C 3CD6V 3BABA 5J2TB 3BA8A 3RFRA 2ZQMA 3SGIA 4DUZO 1SESA 4JZGA 4LF7O 5KHGA 4U3JB 5KMGA 2OCHA 1K3EA 4JTCB 2GUZB 3CE2A 3HR0A 5LOVB 1MMMA 2Q7HA 2R72A 3VQYA 1AP6A 2A0LA 2DQ0A 3E35A 3CRMA 1IVSA 1XQ8A 2JJ1G 3AG2B 5L3EA 4I0XA 4RO2A 2B9ZA 2P22C 3T1YB 1F4NA 1YHQV 5EC1C 1VEWA 2Q0OC 1FXKC 1COWG 4YIPA 2EJ7A 3W7TA 3WU2Z 1K34A 5GONA 2M7WA 4JYCA 3S3XA 2UUCO 2Q67A 3HKBB 2K9PA 3B40A 3N2KA 4J9YB 4Z1VA 3OTOB 2ZM6B 1DK1A 2Q4PA 1M5IA 2WLIB 3LDDA 2KSDA 2ZR2A 3FB8C 3JARB 3CRCA 3D8CA 3RYFB 4X64B 1VQ4V 2HJFC 1M9NA 5J2TA 2H3OA 1SQPH 2Z5UA 4QPJA 4IIJA 2X7RB 2LFSA 5LYJA 4KFMA 5EIBC 3ZMTA 3K08A 4O4JB 3JAKB 4MVOA
chains in the Genus database with same CATH topology
3LSSA 3ZCCA 1FXKB 1R3KC 2OTJV 2DWEC 1BMFG 2WWWA 5LHHA 1KD1W 4JPRA 3ZN1A 3STZC 1ENVA 3ABTA 2KB1A 2Z3YA 1RPOA 2ZXWC 4RUFA 1QBZA 5DN6G 4WFGA 2H94A 2DQ3A 2IJHA 1VQNV 5E1AC 2EILC 3JD3A 1SETA 5LGUA 1OCRC 3SPHA 3CYOA 3WFVA 3JCZA 4TT3G 1FXVA 1ZWIC 2XAQA 3VOUA 3OEEG 2OT5A 4DXWA 3FKSG 5IY5C 1V55B 4UV8A 1KKDA 2DYRC 1ORQC 2PI4A 2GSMB 2Y48A 1NJIW 4R6ZA 5J9PC 4JTAB 5LHIA 2EIMC 4P30A 2EIJC 4EKWA 1F51A 2CK3G 2EINB 1WLEA 3IGAC 4PA6A 5H9CA 2Q6AA 3SPCA 5CN0A 3TETA 4MW3A 2ZD9A 3ML0A 4FPPA 3SJQC 1YI2V 1BHBA 4QE9A 2JDIG 3OR6C 4YXWG 3B77A 3K06A 3QO5A 3ABKC 2X6CA 3G71V 4TSFG 1E79G 1NR1A 2WLKA 5LGTA 1NKDA 1PL0A 2DWDC 3GB7C 2JEUA 5B1NA 3SPIA 4WFBV 3W7XA 2XAHA 4GX0A 4RQEA 1GMGA 1F4MA 3D36A 4N23A 2R9RB 2QM7A 2HVJC 1B6QA 4E2LA 3E8GA 2V1DA 1YITV 5EK0A 3STLC 5DM6V 1DF5A 1KP2A 2ZXWB 4MS2A 4MSWC 4QE7A 3CC4V 4FJCC 3W7UA 3CCQV 1S0VA 4OXSA 4WFEA 1GKFA 2EILB 1JX9A 1R3IC 4QIWF 1NH2D 3JYCA 1OCRB 2WPDG 1QCEA 4FK5C 2XASA 2R9IA 5LHGA 1YIJV 1S76D 2AHZA 2XOKG 1VQ7V 3H01A 1H38A 4MVUA 4MVQA 4KUMA 5IY5B 1MOFA 2HG5C 2WAMA 2OTLV 1W0JG 4PA3A 1N8RW 2DYRB 2DYSC 2MK3A 3DTUB 4LC1A 1PNLA 3ZRXA 2EIMB 2EIJB 3K0GA 2X6AA 5IYBO 2JJ2G 2QM8A 1JCHA 1M56C 3ABMC 2XAFA 3MHHC 4DO2A 1AROP 3CMEV 3FYEB 1AI5A 3OEHG 3OAAG 2FTKA 4UVCA 3QNEA 1M1KW 3AG3C 1R6NA 2WLHA 4RQFA 3ZRWB 2HFEC 3ABKB 3JD4A 4PELA 3RVYA 5L3GA 1EFRG 3E8FA 5KA6A 1PD3A 1OCZC 1R3JC 4N21A 2QKSA 3SPJA 1G8MA 4Q20A 2F43G 2EINC 3LDCA 4U7NA 1FS0G 3CCEV 4MTOA 5CMUA 3FYIB 4JTDB 3X2QC 1AR1B 1E1RG 4MTXA 1MSWD 1AI6A 1HWYA 1W2BU 1P7BA 4G2KA 4MVZA 1VQLV 2QA4V 1S72V 1K5QA 1KECA 1OZ0A 1RM1C 1XL4A 4H37A 1NBMG 5KUMA 1M90W 2QEXV 4P9OA 2EZOA 3K79A 1NVPB 1XL6A 3SYCA 3AG1C 3ZMSA 3TCUA 1Q81W 2EBOA 1JPXA 3DGEA 3E83A 3LDEA 4QNHB 1QVGU 3BEHA 2WLNA 2DYSB 2ZR3A 1BL8A 3CXCU 1VQMV 4MTFA 4WF9V 2A79B 1R73A 1K9MW 4U7OA 1BHAA 2B5UA 2UXNA 1M56B 5CA3A 3ABMB 4BW5A 1K33A 1VQKV 4UV9A 3CPWU 3AG3B 1SZTA 3F5WC 1OCOC 2W0FC 2K1EA 2X0LA 4I9WA 1EBOA 2BOBC 3GWOA 3F7VC 1WPXA 4QPKA 1OCZB 3W7SA 4JASA 1KQSU 3T4DA 5CBFA 3M99B 4I5SA 4JYBA 3ZJZA 3IC7A 1P4RA 2HR3A 3EFFK 4MVMA 4ZBMA 5EC2C 1S77D 3D3IA 3RW0A 4JAUA 3ETEA 1RPRA 4RUEA 3X2QB 2XAGA 2P6JA 4JAVA 3ZRWA 3ZMVA 2WLIA 2DW4A 3QO7A 4G27B 2LFRA 4GX1A 2YEVA 3QO8A 3B8NA 1I5XA 1AI4A 3CP1A 2HVKC 3MD0A 3OGCC 1RM1B 1AJPA 3AG4C 4MT8A 1PNMA 4G28B 2EJRA 3P32A 2EIKC 4Z1MG 3RVZA 1K8AW 1CPYA 3KG2A 5IDJA 3AG1B 1AI7A 1GO3F 1I5YA 4BAYA 2A9HA 2JEXA 3FB6C 1QLEC 3CC2V 2EZPA 1JQ0A 5C93A 1CEZA 1GM7A 4MTGA 2P90A 3E8BA 3T4ZA 1THZA 4J9ZB 2W6JG 1GTOA 2NNUA 1FXKA 5IYCO 1R6KA 5FL7G 1Y4MA 2JK5C 3ASOC 4GT1A 3ZMZA 3HB3B 5HFMA 1OCOB 2Q69A 5LGNA 4LCUC 1Y66A 2P67A 2YSUB 3CC7V 2QE7G 2V7QG 4WFHA 1S3JA 3ZMUA 2B1GA 2Y69C 1K73W 1JOYA 2OCCC 3W7WA 3ASNC 2Q68A 4GCZA 3AEIA 5L3BA 4XBFA 2W6IG 3BY6A 3MHSC 1K4DC 5IYDO 4LP8A 4PA7A 2ATKC 4MVRA 3CMAV 4PDMA 4P2ZA 3TK1A 2JIZG 3AG4B 1K4CC 2EIKB 2WSSG 5H6RA 2IU0A 3UKMA 2IW5A 4JGSA 1V54C 2HLDG 1K5SA 1SERA 3VBBA 3OR7C 2WLLB 5EBMC 4GX2A 1NQTA 2GHYA 1FXHA 1QLEB 1G4YB 3LNMB 3OW2U 1K7DA 4WFFA 1TUEB 1YSCA 1JJ2U 4LBEC 4MVOA 3OM3B 5EBLC 4R50A 4PDRA 4X88A 1YTFB 1SRYA 1KC8W 2ZDIC 1E1QG 4KP4A 4FIPC 3ASOB 3ETDA 1QR9A 3HPLC 1R3LC 1AJNA 1DLBA 1OHHG 1QLNA 2WLMA 2IJIA 2P7TC 1M57C 1PNKA 4WFAV 4ASUG 5HFLA 3LSQA 1F23A 1NVPD 3LUTB 2LP7A 1J95A 4WCEV 2X6BA 5B3SC 1H2GA 4MVSA 3SYAA 2Y69B 2OCCB 3WG7C 3ASNB 2UXXA 3R65A 1YJNV 1Q86W 1OCCC 1CP9A 3K03A 4H33A 3G6EV 2AHYA 4QJFB 1EZJA 1Q82W 5KA5A 4UVAA 3K9AA 1GM9A 3SYOA 4ZKIA 3CCJV 3AG2C 2C2AA 1Q7YW 5EBWC 5CBHA 3CCVV 3NXSA 4CBCA 3E2EA 4P9PA 3CCLV 1V54B 1QR8A 3EHBB 2IH3C 1ROPA 1L1FA 2IJKA 3G4SV 1VQPV 1VQOV 5B1BC 4UXNA 1K97A 3RBZA 3ETGA 3OMNB 3ZIAG 5B1AC 4R7CA 3ABUA 5L3FA 3ZN0A 4L87A 5BZBA 3SYPA 1VQ5V 4JF3A 2BOCC 1IXMA 3ABLC 3P30A 5GW7A 3OUSA 2QTOA 5B1OA 2WLLA 3I55V 1YJWV 2H8PC 3CD6V 1H8EG 3A0RA 3T1CA 1M57B 4X89A 2ZQMA 3E89A 4PA4A 4UVBA 1GK9A 2HKOA 1SESA 3OFNG 3E8HA 3CCMV 1VQ8V 4R8CA 1W0KG 5CBGA 3OE7G 5B3SB 3OMIB 3WG7B 1K3EA 4PDLA 4JTCB 1UJWB 1H8HG 4BIUA 3JD1A 3CCUV 1FFTB 1OCCB 3E86A 3FB7C 1LNQA 4GX5A 2A0LA 2DQ0A 3OMAB 2B1IA 4PA9A 3E35A 2ITDC 3OUFA 2JJ1G 3AG2B 3SPGA 5L3EA 1AJQA 2XNDG 1NH2B 4RO2A 3IFXA 5KUKA 1VQ6V 3T2MA 1S5HC 3K04A 1VQ9V 3K0DA 1F4NA 3K3WA 2WLJA 5EC1C 3SYQA 1YHQV 5B1BB 1FXKC 4TWKA 1COWG 5B1AB 3W7TA 3JD0A 1K34A 4MW8A 2M7WA 4JYCA 2NLJC 2ITCC 3I56V 4FMTA 2Q67A 5LBQA 3ABLB 1NR7A 4PDVA 3PJSK 2D3OW 3CCSV 4XDJA 1JVMA 5L3DA 3UM7A 4X8AA 4XDKA 4XDLA 3B8MA 4RAIA 4J9YB 1K92A 5L3CA 1DF4A 2WLIB 3LDDA 1DTOA 2IU3A 2ZDIA 2ZR2A 3FB8C 1V55C 4BIZA 2YEVB 1MABG 2IH1C 1PKXA 1VQ4V 2XAJA 2HJFC 4HZ3A 1YTFD 4HAMA 4F4LA 1M9NA 1YJ9V 2PI5A 2Z5UA 4QPJA 3ZRSA 2X7RB 3FB5C 2LFSA 4HYOA 4KFMA 3ZMTA 3K08A 1GM8A 4UUJC 3ZRVA 3JD2A 5H6QA 4CZZA 3CCRV 3F7YC 1QVFU 1KP3A 2IJJA 1MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  2IJJ A;  1RPR A;  1GMG A;  4DO2 A;  1ROP A;  2IJK A;  1F4M A;  2IJH A;  3K79 A;  1RPO A;  1F4N A;  1NKD A;  1B6Q A;  1GTO A;  2IJI A;  2GHY A; 
#chains in the Genus database with same CATH topology
 3RWR D;  2WWW A;  3STZ C;  1ENV A;  3ABT A;  2KB1 A;  2HEP A;  1YEW A;  4OPH A;  1SKV A;  2H94 A;  2IJH A;  3J80 N;  5E1A C;  2EIL C;  1SET A;  5LMU B;  4DYL A;  3JCZ A;  3QF7 A;  4TT3 G;  2XAQ A;  4I50 B;  2Q0A A;  2HHH O;  3ZBH A;  2PI4 A;  1ORQ C;  2Y48 A;  3O9O A;  4R6Z A;  4JTA B;  3N2G A;  2EIM C;  4ZOL A;  2EIN B;  1ZTE A;  4K8X A;  1WLE A;  5H9C A;  3L70 H;  1TVK B;  4LNU B;  5CN0 A;  4X65 O;  4MW3 A;  4FPP A;  1N34 B;  2KQX A;  4QE9 A;  2JDI G;  5KHI A;  3JAL B;  1NR1 A;  4JI2 O;  1NKD A;  1PL0 A;  4PI2 A;  1I08 A;  3SJA C;  4WFB V;  4GX0 A;  3OTF A;  5LMN B;  2HVJ C;  1B6Q A;  3STL C;  3CRA A;  1DF5 A;  4QE7 A;  4DV5 O;  1NH2 D;  1AR5 A;  1P84 F;  4UB6 Z;  1QCE A;  2XAS A;  2QWP B;  5F2V O;  2XOK G;  1VQ7 V;  4MVU A;  4DR2 O;  2PYL A;  1L0N H;  1W0J G;  5JWP A;  4JI1 O;  2DYR B;  2RN9 A;  4AQY B;  2ZE7 A;  5BR8 B;  1WAZ A;  1J5E B;  4YHH O;  4X62 O;  2QM8 A;  1JCH A;  1D2D A;  4LFB B;  3EVK A;  1N36 B;  5JJN B;  3AG3 C;  1SQF A;  1XHX A;  3ZRW B;  3JD4 A;  4PEL A;  2CTW A;  1FKA O;  1XMO O;  2QKS A;  2EIN C;  3JSL A;  4U7N A;  1AR1 B;  1SQQ H;  1PP9 H;  1MNG A;  1E1R G;  4MTX A;  2DOS A;  3JAL A;  4DR5 O;  4LF6 B;  1K5Q A;  5EZY B;  3UT5 B;  1M90 W;  4P9O A;  1X4T A;  1JPX A;  3DGE A;  4QNH B;  4TOI A;  2ZR3 A;  4LWS B;  3CXC U;  2A79 B;  3DXR B;  1G1X B;  1AP5 A;  4BW5 A;  1TUB A;  2JS5 A;  3UCS C;  3CPW U;  4DR4 O;  5JCO A;  4FM0 A;  1OCO C;  2Q7G A;  2K1E A;  3SDL A;  1B04 A;  4PI0 A;  5FNV B;  3OD4 A;  4I9W A;  4PD4 F;  2BOB C;  3O65 A;  3H1L H;  4UCS A;  1YVW A;  1OCZ B;  1TA8 A;  1WJZ A;  4JAS A;  4X66 B;  5CBF A;  2ZE6 A;  4I5S A;  4UB8 Z;  3CS5 A;  1S77 D;  4CC5 A;  3D3I A;  4J7K A;  1EN5 A;  4RUE A;  3X2Q B;  4DW1 A;  3ZRW A;  4DR6 O;  1YZB A;  2DW4 A;  2D2C B;  2LFR A;  4GX1 A;  4LH6 A;  3T1H O;  4B3M O;  3TGU H;  3MD0 A;  5LXT B;  3OGC C;  1RM1 B;  4MT8 A;  1PNM A;  2YID A;  4B3T B;  3AG1 B;  1AI7 A;  1N0N A;  2JEX A;  4WBN A;  4IGG A;  2BCC H;  3MDS A;  1XMQ B;  5DED A;  4TV8 B;  4FFB B;  3UT5 A;  1Y4M A;  3ZMZ A;  3K59 A;  2BSK A;  5HFM A;  4LWS A;  4B3S O;  4LF8 B;  2IM9 A;  5A9G A;  4WFH A;  2CDY A;  1LUV A;  5AG2 A;  2B1G A;  1K73 W;  2Q68 A;  2BTQ B;  5KX5 A;  3AEI A;  4F6R A;  4H0L B;  2HJD A;  4W4L A;  3BY6 A;  4DR1 B;  2NR5 A;  5FNV A;  1X59 A;  4CS4 A;  5IYZ B;  4PA7 A;  4B3R O;  1NS1 A;  3ZHU A;  4MVR A;  4DW0 A;  1BGY H;  1B3Q A;  2Y4T A;  4TV9 B;  2BTO A;  2EIK B;  5IWA O;  2IU0 A;  4JGS A;  4J7Z A;  2WLL B;  5EBM C;  1NQT A;  2JGD B;  3JAT B;  2QDO A;  3OW2 U;  3OM3 B;  2FML A;  4NB5 A;  1E1Q G;  4KP4 A;  3ASO B;  2UUA O;  1QR9 A;  1DLB A;  2DN9 A;  1QLN A;  5GTH Z;  1TAE A;  4WFA V;  2R9A A;  1L8D A;  4EFB A;  1NVP D;  3KZI Z;  1IBK B;  4WCE V;  2X6B A;  4IHJ B;  1H2G A;  4TV8 A;  3WG7 C;  4FFB A;  5BMV B;  5JVD B;  3ASN B;  3APO A;  1Q86 W;  3RYI A;  1OCC C;  1CP9 A;  1VIB A;  4B08 A;  1OV9 A;  2AHY A;  1LUW A;  5K1X A;  2VQE B;  1BZK A;  1IDS A;  3CJH B;  2C2A A;  4NTY A;  1Q7Y W;  1AIL A;  5CBH A;  1HR0 B;  3NXS A;  4CH6 A;  2BTQ A;  1MSD A;  3E2E A;  2LQT A;  2IH3 C;  4GYC B;  2M6Y A;  1VQO V;  1SQX H;  3WB2 A;  5B1B C;  1N33 B;  3APQ A;  1K97 A;  3OGI B;  5IYZ A;  1NT2 B;  3ETG A;  3RBZ A;  3ZIA G;  2RJZ A;  2A06 H;  2PYJ A;  4TV9 A;  3ABL C;  4JI5 B;  2QKC A;  2WLL A;  2H8P C;  3A0R A;  3T1C A;  3JAT A;  4X89 A;  4JI6 B;  3E89 A;  3RT3 C;  1GK9 A;  3OFN G;  2UXC B;  3CCM V;  2EX3 A;  1W0K G;  4OX9 B;  3G67 A;  4GKK B;  1UJW B;  4H44 B;  1RFY A;  1Q6H A;  5E79 Z;  2ZNJ A;  3CCU V;  3FAV B;  3FB7 C;  1FAF A;  4DUY O;  2YDE A;  4CS3 A;  2PZS A;  2P4V A;  5BXZ A;  3ZHQ A;  3OMA B;  3DC6 A;  2B1I A;  3RYH B;  1I94 B;  3D36 C;  2ITD C;  1GN4 A;  3L75 H;  3SPG A;  2F1M A;  1AJQ A;  3EXA A;  5BMV A;  4NXM O;  1VQ6 V;  3T2M A;  1S5H C;  1HW7 A;  2OIG A;  2OYQ A;  3SYQ A;  2WLJ A;  2QWR B;  4DV1 B;  2JVD A;  1SA0 B;  5B1A B;  1U97 A;  3CJH A;  4O4I A;  2ITC C;  3I56 V;  3VQX A;  3NR7 A;  2D3O W;  4ZHQ B;  2FL4 A;  4XDL A;  1GN2 A;  4RAI A;  3ZS8 C;  4O4H B;  5L3C A;  1HNW B;  2FKX A;  1DTO A;  1V55 C;  4BIZ A;  2YEV B;  4YY3 B;  2IH1 C;  2XAJ A;  1QHT A;  1YJ9 V;  4DV3 B;  5LP6 A;  3FB5 C;  1GN6 A;  5IJ9 B;  3KKY A;  4UUJ C;  3ZRV A;  4D7T A;  1Y6X A;  4FFK A;  4PV1 B;  1KP3 A;  1XNR O;  2YXH A;  3ZCC A;  1FXK B;  1R3K C;  2OTJ V;  2DWE C;  1KD1 W;  1O9H A;  1NU1 H;  3RN4 A;  4RUF A;  1VQN V;  4JI3 B;  3TXQ A;  1OCR C;  4OPA A;  3SPH A;  2ZE5 A;  4KHP B;  4J7J A;  2DMX A;  2YI9 A;  1XI1 A;  3FKS G;  3Q4H B;  4HNA B;  3L74 H;  4JI0 B;  5JJJ B;  4EKW A;  5IJ0 B;  4YJ2 B;  4O4H A;  3ML0 A;  2OWO A;  1YI2 V;  1BHB A;  4JYA B;  2FB5 A;  3OR6 C;  1HNX B;  3B77 A;  3QO5 A;  3G71 V;  1WP7 A;  4TSF G;  2WLK A;  2DWD C;  5B1N A;  2XAH A;  4EEQ A;  4RQE A;  3T1Y O;  1U96 A;  4JI8 B;  1F4M A;  4N23 A;  2R9R B;  4FM2 A;  5IJ9 A;  1FJG B;  5DM6 V;  1KP2 A;  1FFX A;  2EIL B;  3ZHR A;  3CEI A;  4B7K A;  2UU9 O;  3JYC A;  3S3W A;  4FK5 C;  1Z5W A;  1VP7 A;  2R9I A;  3JAW B;  2AHZ A;  1H38 A;  3H01 A;  2VQF B;  4KUM A;  2WAM A;  3OTO O;  1WP8 A;  2ZM6 O;  2DYS C;  2MK3 A;  1N32 B;  3DTU B;  4LC1 A;  3ZRX A;  2EIM B;  5IYB O;  1P7G A;  4NXN B;  4FLZ A;  1Y74 B;  4X64 O;  2VWJ A;  3MHH C;  3CME V;  3UQ8 A;  3FYE B;  3OAA G;  3OT7 A;  3QNE A;  4LF5 B;  2Q5Z A;  1R6N A;  2WLH A;  4EFE A;  4RQF A;  3Q4H A;  2HFE C;  4HNA A;  5JH7 B;  2ADQ B;  3K9S A;  2XTA A;  1R3J C;  2CAZ C;  3SPJ A;  5IJ0 A;  5A2Q N;  1FS0 G;  4MTO A;  1NZ6 A;  2P4K A;  1KUQ A;  2JRI A;  4U3J A;  2GUZ A;  1AI6 A;  5LOV A;  1W2B U;  1P7B A;  2AGA A;  2QA4 V;  1QQC A;  1SQG A;  1OZ0 A;  5LMU O;  1NBM G;  4AHC A;  5KUM A;  1IBM B;  2RMK B;  2QEX V;  3K79 A;  1XL6 A;  1Q81 W;  3ZMS A;  3TCU A;  1B06 A;  1SS3 A;  2AW9 A;  4X1I B;  2WLN A;  1VQM V;  2Q8V A;  1IX9 A;  3ZHT A;  1BHA A;  1VF5 B;  3VQW A;  2RDC A;  3AG3 B;  1SZT A;  3AK2 A;  4ICG A;  4UCT A;  1N34 O;  1RSO B;  2W0F C;  3HKB A;  4BWA A;  2LO1 A;  1WPX A;  2GDS A;  1XRE A;  3BRC A;  3M99 B;  1P4R A;  4MVM A;  1EM1 A;  5EC2 C;  3RW0 A;  4FZ1 A;  2XAG A;  5LMN O;  4JAV A;  3DSQ A;  2WLI A;  2JS3 A;  3HKC B;  3QO7 A;  4G27 B;  3JAR A;  3M7M X;  2CE4 A;  4DR3 B;  2OIE A;  3RYF A;  4ABM A;  2VS0 A;  3AK1 A;  2QWN B;  1L0L H;  5KAI Z;  1AJP A;  4GKJ B;  5JJE B;  1CPY A;  3QTC A;  1I5Y A;  4NR1 A;  4O4J A;  3BPZ A;  4GUN A;  1EN4 A;  3FB6 C;  1QLE C;  4J80 A;  4W4K A;  1JQ0 A;  1CEZ A;  1KB9 F;  2P90 A;  3JAK A;  4AQY O;  3IJ4 A;  1J5E O;  5FL7 G;  4DR7 B;  4LFB O;  1ZUQ A;  1O9G A;  5D5Q A;  1OCO B;  2Q69 A;  4LCU C;  1N36 O;  2GTS A;  3BVO A;  2P67 A;  2YSU B;  2QE7 G;  4YIO A;  4GLX A;  4UCO A;  2E5L B;  1I7F A;  3GVM A;  2CH7 B;  2Q73 A;  2Y69 C;  2OCC C;  3H1H H;  2Y0I A;  1N0J A;  4GCZ A;  4I50 A;  4XBF A;  1RSO A;  1H2L A;  4OGQ B;  4JI7 B;  2YIC A;  2P06 A;  4TQD A;  3IAY A;  5B5E Z;  4L8J A;  4LF6 O;  3G80 A;  2WSS G;  1TVK A;  4LNU A;  3UKM A;  1VAR A;  1V54 C;  2HLD G;  1K5S A;  4D6T H;  3JAM N;  3VBB A;  3OR7 C;  2GHY A;  1FXH A;  3LNM B;  1K7D A;  3GWK C;  4LBE C;  5EBL C;  4K0K O;  4R50 A;  4DV7 B;  1YTF B;  2E75 B;  4X88 A;  1SRY A;  1KC8 W;  2ZDI C;  1XOU A;  1AJN A;  2CTR A;  1OHH G;  5H5N A;  1T5E A;  2IJI A;  4I4T B;  1M57 C;  5ITZ B;  1KKC A;  4ASU G;  4Z2W A;  3LUT B;  2ZCE A;  3E22 B;  3CSX A;  5B3S C;  4MVS A;  4FLU A;  3L9D A;  2UXX A;  1H2M A;  4X66 O;  3R65 A;  1XIL A;  1YJN V;  4H33 A;  3G6E V;  1Q82 W;  5KA5 A;  4UVA A;  1GM9 A;  3SYO A;  1M93 A;  5KAF Z;  3C90 A;  5LA6 B;  1I0H A;  3DC5 A;  4DK1 A;  2VRZ A;  3CCL V;  1ROP A;  1NTM H;  2IJK A;  1L1F A;  3G4S V;  2PY5 A;  4B3T O;  2F4V B;  2YS8 A;  1AVM A;  4LH7 A;  3OMN B;  5L3F A;  3ZN0 A;  2ADP A;  4L87 A;  5BZB A;  3R66 A;  3SYP A;  4JF3 A;  1XMQ O;  3QG5 A;  4LF9 B;  3FX7 A;  2HKO A;  1NTZ H;  4R8C A;  3HKE B;  5CBG A;  3OE7 G;  4ZI7 B;  3WG7 B;  4BR6 A;  1H8H G;  4LF8 O;  5EZY A;  2QKA A;  1OCC B;  3E86 A;  3B4S A;  1LNQ A;  3H1J H;  4IL6 Z;  5J2U B;  3LNN A;  5CA0 B;  2XHB A;  3I5D A;  5B66 Z;  5ITZ A;  4PA9 A;  5KLV H;  3OUF A;  3QVN A;  4DR1 O;  3E22 A;  2YIB A;  3DXR A;  2CTQ A;  5FPO A;  2ODM A;  5DEC A;  1US6 A;  3SJC C;  3K04 A;  2UXD B;  1VQ9 V;  2N04 A;  2E74 B;  2A3Q A;  5B1B B;  4TWK A;  5JQG B;  3JD0 A;  4MW8 A;  5LA6 A;  4FLV A;  5LBQ A;  2LGW A;  3ABL B;  1NR7 A;  4PDV A;  3PJS K;  2LGQ A;  5GTI Z;  4XDJ A;  1JVM A;  4K35 A;  3UM7 A;  3FFQ A;  4X8A A;  3B2E E;  3B8M A;  3PN1 A;  1K92 A;  1DF4 A;  3CRR A;  1WPB A;  4X1K B;  2IU3 A;  5LXT A;  4ZIB A;  4O2A B;  4E4E A;  4PHZ A;  1ZSP A;  1PKX A;  2HP8 A;  2ZIM A;  3K5N A;  1ZL8 B;  4TUY B;  1WB8 A;  4HYO A;  2VQE O;  3CWB H;  4DV4 B;  4X1Y B;  1GM8 A;  5D5P A;  4CZZ A;  3F7Y C;  4DV0 B;  1QVF U;  4JZ2 A;  1HR0 O;  1MG1 A;  5J2U A;  2QJ1 A;  4CH5 A;  5LHH A;  4DV2 B;  4JPR A;  1N33 O;  5CB4 B;  2ZXW C;  2DQ3 A;  2UUA B;  4JI5 O;  3CYO A;  5JQG A;  2LJ2 A;  4D7S A;  3ZED A;  3CX5 F;  3VOU A;  3OEE G;  4J42 A;  1JFF B;  2OT5 A;  4DXW A;  4JI6 O;  1Y76 B;  2L6L A;  5IY5 C;  2UXC O;  1V55 B;  3ICX A;  4OX9 O;  1XEQ A;  3A0H Z;  2N05 A;  5J9P C;  2ARH A;  2EIJ C;  2CK3 G;  4JAA A;  5CA1 B;  4PA6 A;  3IGA C;  2JGD A;  3CHX A;  3SPC A;  3TET A;  4O2B B;  2GTA A;  1IUR A;  4YXW G;  4O2A A;  3K06 A;  3ABK C;  1XNQ B;  1E79 G;  3AK3 A;  5LGT A;  4LFC B;  2BE3 A;  3D36 A;  3RYC B;  1ZL8 A;  1SZX A;  3P3P A;  4DV1 O;  2QM7 A;  4LFA O;  1VF7 A;  4E2L A;  2UXB B;  3E8G A;  1YIT V;  5EK0 A;  4X1Y A;  4DV6 B;  1EN6 A;  4JI4 B;  4MS2 A;  1UPG A;  4IHJ A;  3W7U A;  5JVD A;  4WFE A;  4K3A A;  1OCR B;  2WPD G;  2MW2 B;  2PF4 E;  2YIA A;  1SQV H;  2YI8 A;  2A7W A;  4Q6G A;  1MOF A;  3ETQ A;  1UFI A;  1HNW O;  4HBN A;  3LSU A;  1PNL A;  4YJ3 B;  4NYK A;  3K0G A;  3K57 A;  2X6A A;  3MAQ A;  4DUY B;  4YY3 O;  1M56 C;  3ABM C;  2XAF A;  4DO2 A;  1ARO P;  2E76 B;  1AI5 A;  4DV3 O;  5LL6 Y;  3D3Q A;  1M1K W;  2ZKO A;  3CXH F;  2FYU H;  5H2F Z;  5BY1 A;  1BE3 H;  1EFR G;  4NXM B;  3E8F A;  1SF9 A;  1PD3 A;  2Y4U A;  5CA1 A;  2Q9L A;  1G8M A;  4Q20 A;  3AG7 A;  3FYI B;  1URF A;  4JV5 B;  4B7E A;  2O57 A;  1MSW D;  1D5N A;  4J41 A;  1VF6 A;  4MVZ A;  1VQL V;  4X9Q A;  3FAV A;  1SQB H;  1KEC A;  3RYC A;  4JI3 O;  1H2K A;  1Q5O A;  4LF4 B;  3RYH A;  4KHP O;  5C8Y B;  3SYC A;  5K1P A;  2UUB B;  2EBO A;  3E83 A;  3LDE A;  2DYS B;  2XUM A;  5LP6 C;  1S5L Z;  3FD9 A;  1R73 A;  4I0X B;  1K9M W;  1YXB A;  4U7O A;  2UXN A;  1K33 A;  4JI0 O;  2W0X A;  1SA0 A;  3ZHV A;  1XHZ A;  1NTK H;  2IBZ H;  2X0L A;  1HNZ B;  3GWO A;  2RCV A;  1IBL B;  1KQS U;  3T4D A;  3ZJZ A;  3JSN A;  4ZHQ A;  3EFF K;  4ZBM A;  2NN4 A;  4J11 A;  2RNB A;  4JI8 O;  2ZIO A;  3ETE A;  1RPR A;  1BS3 A;  2P6J A;  1FJG O;  1N4C A;  5EIB D;  2YEV A;  3QO8 A;  3VQV A;  2LW1 A;  4NVP A;  1I5X A;  3AG4 C;  1WA8 B;  2EJR A;  2ZIN A;  3P32 A;  2CGN A;  1K8A W;  4A5U B;  5IE9 A;  2VQF O;  3CC2 V;  4IIJ B;  2EZP A;  5C93 A;  5LYJ B;  1GM7 A;  1MZF A;  3T4Z A;  4J9Z B;  2W6J G;  1N32 O;  3IC9 A;  3HKD B;  3K5O A;  1FXK A;  2L35 A;  1R6K A;  5TIS Z;  5C8Y A;  4NXN O;  4GZR B;  4DUZ B;  3H1I H;  1Y66 A;  4LF7 B;  4LF5 O;  2ZT9 B;  3CC7 V;  2V7Q G;  1S3J A;  4FLX A;  2CUG A;  2ZNI A;  1JOY A;  2PUS A;  1QNM A;  2CGO A;  2W6I G;  1KBH A;  3MHS C;  1K4D C;  4I9Q A;  3WB1 A;  5IYD O;  2YUA A;  1Q8I A;  3CMA V;  4PDM A;  2UU9 B;  4P2Z A;  2JIZ G;  1K4C C;  4YJ2 A;  3N2G B;  1H2S B;  4ZOL B;  4GX2 A;  1R6T A;  5EYP B;  1IBM O;  1QLE B;  1G4Y B;  4KXR A;  4WFF A;  2UUC B;  1YSC A;  1JJ2 U;  1YDX A;  3ZX6 A;  4PDR A;  1WA8 A;  4J10 A;  3ETD A;  3BCC H;  3HPL C;  1R3L C;  2P7T C;  3U0Z A;  4O4L B;  1PNK A;  5HFL A;  3LSQ A;  1F23 A;  2LP7 A;  1J95 A;  4F6E A;  1ZAU A;  3HKD A;  2Y69 B;  2PGG A;  2OCC B;  1WN7 A;  3JAW A;  1JR9 A;  3K03 A;  4EB6 B;  1BSM A;  1EZJ A;  2ILM A;  3K9A A;  4RWU A;  4ZKI A;  3F5T A;  3AG2 C;  4DR3 O;  1Y74 A;  1FPO A;  1Q90 D;  4P9P A;  1V54 B;  1CXZ B;  2AZ0 A;  4C7U A;  3H9V A;  1OJH A;  4GKJ O;  3WB0 A;  5JH7 A;  1WNS A;  4R7C A;  3C3T A;  1WB7 A;  1XBL A;  2BOC C;  3P30 A;  3OUS A;  5B1O A;  1YJW V;  5EYP A;  1H8E G;  4DR7 O;  3SJB C;  1M57 B;  4IYH A;  4PA4 A;  4UVB A;  2HHH B;  3E8H A;  5FPR A;  1VQ8 V;  5B3S B;  3OMI B;  4PDL A;  1ZX3 A;  4BIU A;  3JD1 A;  5BR8 O;  1FFT B;  2E5L O;  3BAA A;  2YC0 A;  4GX5 A;  4KL1 A;  1NI8 A;  3A0B Z;  4X65 B;  4O4L A;  4X1I A;  1GRJ A;  3JCU Z;  2XND G;  1NH2 B;  4JI7 O;  3IFX A;  3C3S A;  5KUK A;  4JI2 B;  4EB6 A;  3K0D A;  3K3W A;  2XT9 A;  1TUB B;  2F95 B;  2QGN A;  2CTP A;  4I55 B;  2NLJ C;  4FMT A;  4DV5 B;  3L73 H;  4CS2 A;  4DV7 O;  5KHK A;  3CCS V;  5L3D A;  4DR2 B;  4XDK A;  3HKC A;  5IT9 N;  1PV0 A;  1KYO F;  4JI1 B;  2F93 B;  1ZLZ A;  2PTM A;  1KMI Z;  2ZDI A;  2Q7E A;  1MAB G;  1W59 A;  4YHH B;  4X62 B;  4CH3 A;  4HZ3 A;  2Y0P A;  1YTF D;  4HAM A;  4F4L A;  2PI5 A;  4FLY A;  3ZRS A;  1JMK C;  1M4U A;  1TGO A;  1BCC H;  4TQF A;  4AI8 A;  3JD2 A;  5H6Q A;  3CCR V;  4WBN B;  1XMO B;  2IJJ A;  2YIB D;  2RQ6 A;  3LSS A;  3J81 N;  2V4D A;  3K5M A;  1BMF G;  1R1B A;  4U3F H;  1HDJ A;  3ZN1 A;  3JAS B;  1A32 A;  2BSK B;  2F4V O;  2WA3 A;  2KG7 B;  2Z3Y A;  1RPO A;  4DR5 B;  1QBZ A;  4K0K B;  2CH7 A;  4WFG A;  5DN6 G;  2QTS A;  2GBO A;  3JD3 A;  5LGU A;  2E3C A;  2EUL A;  3WFV A;  4LF9 O;  1FXV A;  1ZWI C;  4UCV A;  4I55 A;  5FLX N;  2WA4 A;  5KX5 B;  4NKG B;  2ETN A;  4FVM A;  4F6R B;  3BHP A;  1LR1 A;  5JCO C;  4UV8 A;  1KKD A;  2DYR C;  2GSM B;  1NJI W;  2YXL A;  5LHI A;  4QGP A;  4P30 A;  4CC6 A;  2DJV A;  1F51 A;  1YF2 A;  2Q6A A;  4PJ0 Z;  1XUQ A;  4DR4 B;  1JJO A;  2ZD9 A;  3SJQ C;  3UO3 A;  3H1K H;  3RGB A;  4FLT A;  2X6C A;  1KU9 A;  2JGU A;  2LW7 A;  3GB7 C;  3I55 V;  2JEU A;  3SPI A;  3W7X A;  2UXD O;  5KHJ A;  1GMG A;  4I4T A;  4NTW A;  4FM1 A;  4DR6 B;  2V1D A;  2ZXW B;  3CC4 V;  4MSW C;  4FJC C;  3CCQ V;  3UO2 A;  3T1H B;  3CRQ A;  3L72 H;  4B3M B;  1S0V A;  4OXS A;  1GN3 A;  1GKF A;  1JX9 A;  1R3I C;  4QIW F;  5LHG A;  1YIJ V;  1S76 D;  3JAS A;  3RYI B;  1PM9 A;  2KG7 A;  4MVQ A;  5IY5 B;  2HG5 C;  3J7A U;  2OTL V;  4PA3 A;  1N8R W;  2G38 A;  3KCX A;  1PPJ H;  2EIJ B;  4AIL C;  1SC5 B;  1RP3 B;  2JJ2 G;  5KHH A;  2QWO B;  3OEH G;  2FTK A;  4UVC A;  4B3S B;  4NTX A;  3ABK B;  4DV4 O;  3RVY A;  5L3G A;  1IBK O;  1V9P A;  5KA6 A;  4DV0 O;  4BW9 A;  1OCZ C;  2QR4 A;  4N21 A;  2F43 G;  3LDC A;  1BQZ A;  3U10 A;  3CCE V;  5CMU A;  4JTD B;  3HKE A;  3X2Q C;  4DV2 O;  1IZ3 A;  4ZI7 A;  4B3R B;  2ZE8 A;  1HWY A;  2GV9 A;  1BQ0 A;  4G2K A;  1S72 V;  5IWA B;  5CA0 A;  2N74 A;  2QM4 A;  1RM1 C;  1XL4 A;  4FZ0 A;  4H37 A;  2EZO A;  1NVP B;  3AG1 C;  1QVG U;  2Z0A A;  3BEH A;  1FD9 A;  1Z2G A;  1BL8 A;  4MTF A;  4WF9 V;  1G6U A;  4JYY A;  1IXB A;  3K5L A;  2B5U A;  1M56 B;  5CA3 A;  3ABM B;  1VQK V;  4UV9 A;  1AR4 A;  3F5W C;  3N27 A;  1EBO A;  3F7V C;  2AXT Z;  4QPK A;  3P3N A;  4O4I B;  3W7S A;  4GKK O;  1XNQ O;  4JYB A;  4BIO A;  3IC7 A;  2HR3 A;  4DK0 A;  4LFC O;  4JAU A;  2AZ2 A;  2F23 A;  1JA8 A;  3B09 A;  3ZMV A;  2UXB O;  2DE0 X;  1I94 O;  4X1K A;  4DRX B;  4DV6 O;  4JI4 O;  3B8N A;  1Q3E A;  1AI4 A;  4H13 B;  3CP1 A;  2HVK C;  4K8Z A;  4G28 B;  1Q6U A;  1AB3 A;  4Z1M G;  2EIK C;  3RVZ A;  5IDJ A;  3KG2 A;  4TUY A;  3CB2 A;  2R70 A;  1GO3 F;  4BAY A;  2A9H A;  4IYI A;  5LP6 B;  1XDC A;  1S5J A;  4UCR A;  4MTG A;  3E8B A;  1THZ A;  1GTO A;  1P49 A;  2NNU A;  5IYC O;  2JK5 C;  2F66 C;  3ASO C;  4GT1 A;  3KCY A;  5CB4 A;  3HB3 B;  3K58 A;  5LGN A;  2VWK A;  4X20 B;  3BA9 A;  3THO A;  1BT8 A;  3ZMU A;  4LR3 A;  3W7W A;  3A2F A;  3ASN C;  1JFF A;  1Y76 A;  4UCU A;  5L3B A;  4LFA B;  1HP8 A;  4I7Z B;  1GH6 A;  2YXY A;  3M8A A;  2P5O A;  4JV5 O;  1F7Y A;  4LP8 A;  2ATK C;  3TK1 A;  4UFZ A;  1PL4 A;  3AG4 B;  5H6R A;  2IW5 A;  1SER A;  4O2B A;  4LF4 O;  4DRX A;  4IT5 A;  2UUB O;  1TUE B;  3U11 A;  1EZV H;  3ZHS A;  5KMG B;  1Q43 A;  4FIP C;  4CH4 A;  1Z5V A;  1H2N A;  2WLM A;  3BFR A;  3G6B A;  1VMG A;  1QU7 A;  3TJT A;  1D5A A;  1HNZ O;  3A8T A;  3SYA A;  1IBL O;  1FFX B;  1MA1 A;  1VF6 C;  4QJF B;  1GAX A;  4FLW A;  1FYJ A;  4X20 A;  1Y67 A;  4JYA O;  5GON B;  4YJ3 A;  1HNX O;  3CCJ V;  3L71 H;  5EBW C;  3CCV V;  1YCI A;  1XNR B;  4CBC A;  1QR8 A;  3EHB B;  1DGS A;  1VQP V;  1Q6I A;  3N2K B;  4UXN A;  3TXS A;  2QSA A;  2QWQ B;  5B1A C;  3ABU A;  1VQ5 V;  1IXM A;  2KKW A;  5GW7 A;  1MZE A;  2QTO A;  3SR2 C;  3CD6 V;  3BAB A;  5J2T B;  3BA8 A;  3RFR A;  2ZQM A;  3SGI A;  4DUZ O;  1SES A;  4JZG A;  4LF7 O;  5KHG A;  4U3J B;  5KMG A;  2OCH A;  1K3E A;  4JTC B;  2GUZ B;  3CE2 A;  3HR0 A;  5LOV B;  1MMM A;  2Q7H A;  2R72 A;  3VQY A;  1AP6 A;  2A0L A;  2DQ0 A;  3E35 A;  3CRM A;  1IVS A;  1XQ8 A;  2JJ1 G;  3AG2 B;  5L3E A;  4I0X A;  4RO2 A;  2B9Z A;  2P22 C;  3T1Y B;  1F4N A;  1YHQ V;  5EC1 C;  1VEW A;  2Q0O C;  1FXK C;  1COW G;  4YIP A;  2EJ7 A;  3W7T A;  3WU2 Z;  1K34 A;  5GON A;  2M7W A;  4JYC A;  3S3X A;  2UUC O;  2Q67 A;  3HKB B;  2K9P A;  3B40 A;  3N2K A;  4J9Y B;  4Z1V A;  3OTO B;  2ZM6 B;  1DK1 A;  2Q4P A;  1M5I A;  2WLI B;  3LDD A;  2KSD A;  2ZR2 A;  3FB8 C;  3JAR B;  3CRC A;  3D8C A;  3RYF B;  4X64 B;  1VQ4 V;  2HJF C;  1M9N A;  5J2T A;  2H3O A;  1SQP H;  2Z5U A;  4QPJ A;  4IIJ A;  2X7R B;  2LFS A;  5LYJ A;  4KFM A;  5EIB C;  3ZMT A;  3K08 A;  4O4J B;  3JAK B;  4MVO A; 
#chains in the Genus database with same CATH homology
 3LSS A;  3ZCC A;  1FXK B;  1R3K C;  2OTJ V;  2DWE C;  1BMF G;  2WWW A;  5LHH A;  1KD1 W;  4JPR A;  3ZN1 A;  3STZ C;  1ENV A;  3ABT A;  2KB1 A;  2Z3Y A;  1RPO A;  2ZXW C;  4RUF A;  1QBZ A;  5DN6 G;  4WFG A;  2H94 A;  2DQ3 A;  2IJH A;  1VQN V;  5E1A C;  2EIL C;  3JD3 A;  1SET A;  5LGU A;  1OCR C;  3SPH A;  3CYO A;  3WFV A;  3JCZ A;  4TT3 G;  1FXV A;  1ZWI C;  2XAQ A;  3VOU A;  3OEE G;  2OT5 A;  4DXW A;  3FKS G;  5IY5 C;  1V55 B;  4UV8 A;  1KKD A;  2DYR C;  1ORQ C;  2PI4 A;  2GSM B;  2Y48 A;  1NJI W;  4R6Z A;  5J9P C;  4JTA B;  5LHI A;  2EIM C;  4P30 A;  2EIJ C;  4EKW A;  1F51 A;  2CK3 G;  2EIN B;  1WLE A;  3IGA C;  4PA6 A;  5H9C A;  2Q6A A;  3SPC A;  5CN0 A;  3TET A;  4MW3 A;  2ZD9 A;  3ML0 A;  4FPP A;  3SJQ C;  1YI2 V;  1BHB A;  4QE9 A;  2JDI G;  3OR6 C;  4YXW G;  3B77 A;  3K06 A;  3QO5 A;  3ABK C;  2X6C A;  3G71 V;  4TSF G;  1E79 G;  1NR1 A;  2WLK A;  5LGT A;  1NKD A;  1PL0 A;  2DWD C;  3GB7 C;  2JEU A;  5B1N A;  3SPI A;  4WFB V;  3W7X A;  2XAH A;  4GX0 A;  4RQE A;  1GMG A;  1F4M A;  3D36 A;  4N23 A;  2R9R B;  2QM7 A;  2HVJ C;  1B6Q A;  4E2L A;  3E8G A;  2V1D A;  1YIT V;  5EK0 A;  3STL C;  5DM6 V;  1DF5 A;  1KP2 A;  2ZXW B;  4MS2 A;  4MSW C;  4QE7 A;  3CC4 V;  4FJC C;  3W7U A;  3CCQ V;  1S0V A;  4OXS A;  4WFE A;  1GKF A;  2EIL B;  1JX9 A;  1R3I C;  4QIW F;  1NH2 D;  3JYC A;  1OCR B;  2WPD G;  1QCE A;  4FK5 C;  2XAS A;  2R9I A;  5LHG A;  1YIJ V;  1S76 D;  2AHZ A;  2XOK G;  1VQ7 V;  3H01 A;  1H38 A;  4MVU A;  4MVQ A;  4KUM A;  5IY5 B;  1MOF A;  2HG5 C;  2WAM A;  2OTL V;  1W0J G;  4PA3 A;  1N8R W;  2DYR B;  2DYS C;  2MK3 A;  3DTU B;  4LC1 A;  1PNL A;  3ZRX A;  2EIM B;  2EIJ B;  3K0G A;  2X6A A;  5IYB O;  2JJ2 G;  2QM8 A;  1JCH A;  1M56 C;  3ABM C;  2XAF A;  3MHH C;  4DO2 A;  1ARO P;  3CME V;  3FYE B;  1AI5 A;  3OEH G;  3OAA G;  2FTK A;  4UVC A;  3QNE A;  1M1K W;  3AG3 C;  1R6N A;  2WLH A;  4RQF A;  3ZRW B;  2HFE C;  3ABK B;  3JD4 A;  4PEL A;  3RVY A;  5L3G A;  1EFR G;  3E8F A;  5KA6 A;  1PD3 A;  1OCZ C;  1R3J C;  4N21 A;  2QKS A;  3SPJ A;  1G8M A;  4Q20 A;  2F43 G;  2EIN C;  3LDC A;  4U7N A;  1FS0 G;  3CCE V;  4MTO A;  5CMU A;  3FYI B;  4JTD B;  3X2Q C;  1AR1 B;  1E1R G;  4MTX A;  1MSW D;  1AI6 A;  1HWY A;  1W2B U;  1P7B A;  4G2K A;  4MVZ A;  1VQL V;  2QA4 V;  1S72 V;  1K5Q A;  1KEC A;  1OZ0 A;  1RM1 C;  1XL4 A;  4H37 A;  1NBM G;  5KUM A;  1M90 W;  2QEX V;  4P9O A;  2EZO A;  3K79 A;  1NVP B;  1XL6 A;  3SYC A;  3AG1 C;  3ZMS A;  3TCU A;  1Q81 W;  2EBO A;  1JPX A;  3DGE A;  3E83 A;  3LDE A;  4QNH B;  1QVG U;  3BEH A;  2WLN A;  2DYS B;  2ZR3 A;  1BL8 A;  3CXC U;  1VQM V;  4MTF A;  4WF9 V;  2A79 B;  1R73 A;  1K9M W;  4U7O A;  1BHA A;  2B5U A;  2UXN A;  1M56 B;  5CA3 A;  3ABM B;  4BW5 A;  1K33 A;  1VQK V;  4UV9 A;  3CPW U;  3AG3 B;  1SZT A;  3F5W C;  1OCO C;  2W0F C;  2K1E A;  2X0L A;  4I9W A;  1EBO A;  2BOB C;  3GWO A;  3F7V C;  1WPX A;  4QPK A;  1OCZ B;  3W7S A;  4JAS A;  1KQS U;  3T4D A;  5CBF A;  3M99 B;  4I5S A;  4JYB A;  3ZJZ A;  3IC7 A;  1P4R A;  2HR3 A;  3EFF K;  4MVM A;  4ZBM A;  5EC2 C;  1S77 D;  3D3I A;  3RW0 A;  4JAU A;  3ETE A;  1RPR A;  4RUE A;  3X2Q B;  2XAG A;  2P6J A;  4JAV A;  3ZRW A;  3ZMV A;  2WLI A;  2DW4 A;  3QO7 A;  4G27 B;  2LFR A;  4GX1 A;  2YEV A;  3QO8 A;  3B8N A;  1I5X A;  1AI4 A;  3CP1 A;  2HVK C;  3MD0 A;  3OGC C;  1RM1 B;  1AJP A;  3AG4 C;  4MT8 A;  1PNM A;  4G28 B;  2EJR A;  3P32 A;  2EIK C;  4Z1M G;  3RVZ A;  1K8A W;  1CPY A;  3KG2 A;  5IDJ A;  3AG1 B;  1AI7 A;  1GO3 F;  1I5Y A;  4BAY A;  2A9H A;  2JEX A;  3FB6 C;  1QLE C;  3CC2 V;  2EZP A;  1JQ0 A;  5C93 A;  1CEZ A;  1GM7 A;  4MTG A;  2P90 A;  3E8B A;  3T4Z A;  1THZ A;  4J9Z B;  2W6J G;  1GTO A;  2NNU A;  1FXK A;  5IYC O;  1R6K A;  5FL7 G;  1Y4M A;  2JK5 C;  3ASO C;  4GT1 A;  3ZMZ A;  3HB3 B;  5HFM A;  1OCO B;  2Q69 A;  5LGN A;  4LCU C;  1Y66 A;  2P67 A;  2YSU B;  3CC7 V;  2QE7 G;  2V7Q G;  4WFH A;  1S3J A;  3ZMU A;  2B1G A;  2Y69 C;  1K73 W;  1JOY A;  2OCC C;  3W7W A;  3ASN C;  2Q68 A;  4GCZ A;  3AEI A;  5L3B A;  4XBF A;  2W6I G;  3BY6 A;  3MHS C;  1K4D C;  5IYD O;  4LP8 A;  4PA7 A;  2ATK C;  4MVR A;  3CMA V;  4PDM A;  4P2Z A;  3TK1 A;  2JIZ G;  3AG4 B;  1K4C C;  2EIK B;  2WSS G;  5H6R A;  2IU0 A;  3UKM A;  2IW5 A;  4JGS A;  1V54 C;  2HLD G;  1K5S A;  1SER A;  3VBB A;  3OR7 C;  2WLL B;  5EBM C;  4GX2 A;  1NQT A;  2GHY A;  1FXH A;  1QLE B;  1G4Y B;  3LNM B;  3OW2 U;  1K7D A;  4WFF A;  1TUE B;  1YSC A;  1JJ2 U;  4LBE C;  4MVO A;  3OM3 B;  5EBL C;  4R50 A;  4PDR A;  4X88 A;  1YTF B;  1SRY A;  1KC8 W;  2ZDI C;  1E1Q G;  4KP4 A;  4FIP C;  3ASO B;  3ETD A;  1QR9 A;  3HPL C;  1R3L C;  1AJN A;  1DLB A;  1OHH G;  1QLN A;  2WLM A;  2IJI A;  2P7T C;  1M57 C;  1PNK A;  4WFA V;  4ASU G;  5HFL A;  3LSQ A;  1F23 A;  1NVP D;  3LUT B;  2LP7 A;  1J95 A;  4WCE V;  2X6B A;  5B3S C;  1H2G A;  4MVS A;  3SYA A;  2Y69 B;  2OCC B;  3WG7 C;  3ASN B;  2UXX A;  3R65 A;  1YJN V;  1Q86 W;  1OCC C;  1CP9 A;  3K03 A;  4H33 A;  3G6E V;  2AHY A;  4QJF B;  1EZJ A;  1Q82 W;  5KA5 A;  4UVA A;  3K9A A;  1GM9 A;  3SYO A;  4ZKI A;  3CCJ V;  3AG2 C;  2C2A A;  1Q7Y W;  5EBW C;  5CBH A;  3CCV V;  3NXS A;  4CBC A;  3E2E A;  4P9P A;  3CCL V;  1V54 B;  1QR8 A;  3EHB B;  2IH3 C;  1ROP A;  1L1F A;  2IJK A;  3G4S V;  1VQP V;  1VQO V;  5B1B C;  4UXN A;  1K97 A;  3RBZ A;  3ETG A;  3OMN B;  3ZIA G;  5B1A C;  4R7C A;  3ABU A;  5L3F A;  3ZN0 A;  4L87 A;  5BZB A;  3SYP A;  1VQ5 V;  4JF3 A;  2BOC C;  1IXM A;  3ABL C;  3P30 A;  5GW7 A;  3OUS A;  2QTO A;  5B1O A;  2WLL A;  3I55 V;  1YJW V;  2H8P C;  3CD6 V;  1H8E G;  3A0R A;  3T1C A;  1M57 B;  4X89 A;  2ZQM A;  3E89 A;  4PA4 A;  4UVB A;  1GK9 A;  2HKO A;  1SES A;  3OFN G;  3E8H A;  3CCM V;  1VQ8 V;  4R8C A;  1W0K G;  5CBG A;  3OE7 G;  5B3S B;  3OMI B;  3WG7 B;  1K3E A;  4PDL A;  4JTC B;  1UJW B;  1H8H G;  4BIU A;  3JD1 A;  3CCU V;  1FFT B;  1OCC B;  3E86 A;  3FB7 C;  1LNQ A;  4GX5 A;  2A0L A;  2DQ0 A;  3OMA B;  2B1I A;  4PA9 A;  3E35 A;  2ITD C;  3OUF A;  2JJ1 G;  3AG2 B;  3SPG A;  5L3E A;  1AJQ A;  2XND G;  1NH2 B;  4RO2 A;  3IFX A;  5KUK A;  1VQ6 V;  3T2M A;  1S5H C;  3K04 A;  1VQ9 V;  3K0D A;  1F4N A;  3K3W A;  2WLJ A;  5EC1 C;  3SYQ A;  1YHQ V;  5B1B B;  1FXK C;  4TWK A;  1COW G;  5B1A B;  3W7T A;  3JD0 A;  1K34 A;  4MW8 A;  2M7W A;  4JYC A;  2NLJ C;  2ITC C;  3I56 V;  4FMT A;  2Q67 A;  5LBQ A;  3ABL B;  1NR7 A;  4PDV A;  3PJS K;  2D3O W;  3CCS V;  4XDJ A;  1JVM A;  5L3D A;  3UM7 A;  4X8A A;  4XDK A;  4XDL A;  3B8M A;  4RAI A;  4J9Y B;  1K92 A;  5L3C A;  1DF4 A;  2WLI B;  3LDD A;  1DTO A;  2IU3 A;  2ZDI A;  2ZR2 A;  3FB8 C;  1V55 C;  4BIZ A;  2YEV B;  1MAB G;  2IH1 C;  1PKX A;  1VQ4 V;  2XAJ A;  2HJF C;  4HZ3 A;  1YTF D;  4HAM A;  4F4L A;  1M9N A;  1YJ9 V;  2PI5 A;  2Z5U A;  4QPJ A;  3ZRS A;  2X7R B;  3FB5 C;  2LFS A;  4HYO A;  4KFM A;  3ZMT A;  3K08 A;  1GM8 A;  4UUJ C;  3ZRV A;  3JD2 A;  5H6Q A;  4CZZ A;  3CCR V;  3F7Y C;  1QVF U;  1KP3 A;  2IJJ A;  1MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...