3OR6C

On the structural basis of modal gating behavior in k+channels - e71q
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVQTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or6C00
2EILC 4MW8A 4PDLA 2AHYA 4ZBMA 3SPHA 3T1CA 1J95A 4RUEA 3TCUA 1OCCC 4H33A 2HJFC 2Y69C 2WLIB 2ZXWC 3STZC 2EIMC 3K04A 2OCCC 1OCZC 4PA4A 3SYQA 4I9WA 5CBHA 5CBFA 2WLLA 3K06A 1M57C 4P9PA 3OGCC 2R9RB 1R3KC 3SPCA 3SYAA 1R3IC 2H8PC 2X6CA 4PA6A 5EC2C 3FB7C 2WLMA 2ATKC 4GX2A 3ABMC 4RAIA 3SPGA 4CBCA 4UUJC 4XDKA 2A9HA 1K4CC 5EBWC 1M56C 3ASNC 3K0DA 4MS2A 3AG1C 4MVSA 3TETA 4QE9A 3AG2C 2HG5C 3ABKC 3F5WC 2W0FC 2DWEC 1QLEC 2HFEC 3RW0A 2WLKA 4R8CA 2WLJA 4X88A 3SJQC 4RO2A 2YEVA 3AG3C 3JYCA 4PA9A 1G4YB 3E8BA 3IFXA 4WFGA 4JTAB 4X89A 4RUFA 3UKMA 3X2QC 4MVUA 2NLJC 4R6ZA 3RVZA 2HVJC 3K0GA 1OCOC 2WLHA 4GX1A 4LP8A 3OUSA 3E86A 4HZ3A 4PDMA 4TWKA 3LUTB 4R50A 4G28B 4BW5A 4QNHB 1ORQC 3STLC 1R3JC 3BEHA 3E8GA 3FB8C 4MVZA 2QTOA 4MW3A 4WFFA 4PDVA 3ZRSA 4XDLA 4JTCB 4JTDB 4OXSA 2DYSC 1R3LC 3OR7C 3PJSK 2QKSA 4G27B 3SYPA 2X6BA 5EK0A 4MTGA 2EIJC 2EIKC 2IH3C 4X8AA 2A79B 3SPIA 5J9PC 3FB6C 4P9OA 2ZD9A 4R7CA 3T2MA 2Q6AA 3R65A 4MTFA 4F4LA 3E8HA 4PDRA 3LDDA 1ZWIC 3HPLC 2Q67A 3LNMB 5B3SC 1P7BA 2ITCC 4WFEA 4LCUC 2A0LA 2KB1A 1K4DC 4EKWA 3ASOC 3T4ZA 3RBZA 4P2ZA 1JVMA 4MTOA 4MSWC 3SYCA 4MVRA 2BOCC 2WLLB 4XDJA 1V55C 2Q68A 3LDCA 1KKDA 2ITDC 3LDEA 2HVKC 4DXWA 2DYRC 4PA3A 4KFMA 2P7TC 5EBLC 2DWDC 4WFHA 3OR6C 4GX0A 2EINC 3OUFA 2WLIA 3ZJZA 3E8FA 5IY5C 1OCRC 3K03A 3AG4C 3VOUA 2WLNA 1LNQA 1V54C 5BZBA 3WG7C 3ABLC 4MVOA 4PA7A 4MVMA 3EFFK 4J9YB 3E83A 1XL6A 3K08A 4HYOA 3GB7C 4GX5A 5B1BC 1XL4A 3KG2A 3SPJA 2X6AA 3E89A 3SYOA 1S5HC 2AHZA 5E1AC 5KUMA 1BL8A 3T4DA 4H37A 3F7YC 5EBMC 3IGAC 3UM7A 4QE7A 4MVQA 4P30A 5EC1C 2Q69A 5B1AC 4LBEC 5CBGA 2BOBC 3RVYA 4J9ZB 2IH1C 5KUKA 2JK5C 3F7VC 3FB5C 2K1EA
chains in the Genus database with same CATH superfamily
2YXYA 3B4SA 2DYRB 3T1YB 4JI1O 5LBQA 3LSSA 3T1HO 1JPXA 1BHBA 3AG4B 1WB8A 3DC6A 2GUZB 1X59A 3WU2Z 2BTQB 2UXXA 2ZNIA 2ATKC 4ZHQB 1DLBA 3CCEV 2OTLV 4Q6GA 4BIUA 3UCSC 2CH7A 4UCUA 1M9NA 3D36C 1Y4MA 1QU7A 3MDSA 2HFEC 2JS5A 2WLJA 2PZSA 3CD6V 3ETEA 3AG3C 5KMGB 4DR3B 2DMXA 3K59A 1VF6C 1RM1C 4DR2O 1H2GA 2Y69B 2M6YA 4JYAO 2A3QA 1WAZA 3STLC 3CC2V 3K5MA 4O4HA 5KAIZ 2PYJA 2A7WA 1H2SB 3B8NA 3ZRWB 5DN6G 3ZRXA 3TXQA 4B3MO 5LYJA 1ZWIC 4DV0B 3ETGA 5KHGA 2ITCC 1YJ9V 5B5EZ 2CTRA 3U0ZA 3U11A 3RGBA 3CCUV 4LC1A 2UUCO 2Q0AA 5LXTB 4DW1A 3CCLV 1VF5B 3LDCA 4X1IA 3L9DA 4CS3A 3OR6C 5LP6C 1ZUQA 1GRJA 2P5OA 5JJJB 5H6QA 3K79A 2LJ2A 3FYEB 3HKDA 1PL0A 2Q4PA 2ZCEA 3HKCA 3I55V 1MZFA 2RCVA 1MOFA 2YIAA 1QBZA 1DTOA 1QQCA 4LBEC 3ZRVA 3ETDA 5KUKA 5CB4B 3F7VC 3C90A 5B1AC 1VQPV 4NVPA 2UU9O 1PP9H 4LR3A 2Z5UA 3T1CA 1VQKV 2ZM6B 4JASA 5KHIA 4LNUA 2QWRB 1K8AW 4LF4B 4CH4A 1SS3A 3WB0A 1PKXA 2E74B 1RSOB 1AI4A 1G8MA 4LF7B 4EB6A 2LFRA 1L1FA 4GX2A 4X64O 1ZSPA 4AI8A 1XNRB 1YIJV 1RPRA 3JSLA 2Q5ZA 2HP8A 4GZRB 3L74H 2DWEC 1BQZA 3VBBA 5IYZA 2AZ2A 2FL4A 3JAKA 2Q7HA 1OCOC 1Q8IA 3E86A 1K7DA 2E76B 2MK3A 3BY6A 3OAAG 4KHPO 2YIDA 4XDLA 1K5SA 2M7WA 4FFKA 5J2UB 1BE3H 2DW4A 1VQNV 1WLEA 1AJQA 2Q7GA 3N27A 3Q4HA 4JI5O 2A79B 3H01A 4FVMA 3SPIA 1Z5VA 1XMQO 1JFFB 3HPLC 4O2BA 2YDEA 4WFEA 3RBZA 4P2ZA 5EYPB 1N36B 4JF3A 4NTYA 1XNQO 2W0XA 3BPZA 3SGIA 4YY3B 1JA8A 2OCHA 3ZJZA 2GSMB 4FM1A 2WLNA 4O4LB 3LNNA 1SA0A 2QWNB 1OCRB 3DSQA 3K58A 1AI7A 2H94A 3SPJA 1YJWV 3OGIB 2AHZA 1CXZB 2LFSA 2PTMA 3IGAC 2OT5A 3UM7A 1NJIW 4JI3B 5KX5A 2L35A 4I50B 4ZBMA 3B40A 1OCCC 2IU3A 2VWJA 2WLIB 5E79Z 3C3SA 2XAHA 3JSNA 1UFIA 4MTXA 4DV6B 2AGAA 1IBKO 5H6RA 3A0HZ 3K3WA 1K97A 1R3KC 3B77A 2HHHO 2DQ3A 2RDCA 5J2TA 1H8EG 4I55B 4QE9A 5HFLA 2XAFA 3A0RA 5LA6B 1TVKB 2YEVA 3ZS8C 1GH6A 5L3DA 1VQ9V 2DJVA 4DRXB 2ZXWB 4LFBO 3NR7A 2QTSA 4B3RB 1QR8A 4J80A 1ORQC 3E8GA 2UXCO 3KZIZ 4WFAV 2AXTZ 4O4JB 4EFEA 3CHXA 1YITV 2ZR2A 5B66Z 1AR4A 3RWRD 4X1YA 3OMIB 1W59A 4IHJA 2F23A 3HKBA 5B3SC 2Y4TA 1M1KW 1ZAUA 2QWOB 2F93B 1YZBA 2O57A 5BR8B 3VQXA 1MABG 5GONB 5CA0A 4XDJA 1V55C 3FAVA 1M4UA 2F43G 2Z0AA 2ZE7A 1H2KA 1LNQA 1V54C 4DR7O 1YJNV 2VRZA 5FPRA 4DR6B 2EIJB 2JGDB 1H2LA 3AG7A 5L3FA 3CCRV 3SYOA 1HNWB 3OT7A 5HFMA 1EZVH 3OM3B 1F51A 1JMKC 5EIBD 3HR0A 2JK5C 1S3JA 4PDLA 3RT3C 3SPHA 1YEWA 2Q9LA 2HEPA 1SETA 4GLXA 2ZDIC 3CYOA 1N8RW 1YF2A 4I9WA 3EXAA 3ZEDA 3K06A 2LQTA 2Q73A 1P4RA 3CPWU 2EULA 1K73W 3ZMTA 1NR7A 4B08A 3BFRA 1ZL8A 4B7EA 1AJPA 4IYIA 5IYBO 3ZHUA 1KP3A 2DN9A 3JAWB 4X89A 2NN4A 3L75H 1BSMA 3CMEV 4TOIA 4WCEV 4MT8A 4BW5A 1VARA 1D5AA 1GK9A 3ZRSA 2KG7B 4OXSA 2UUAB 3TJTA 4FFBB 5JJEB 1YXBA 2QKSA 2ZT9B 2X6BA 2PF4E 1WA8B 1BS3A 4DR3O 4E2LA 1VMGA 1P49A 2FMLA 3AG3B 1RM1B 4DV5B 3H1LH 3RYHB 1AROP 2LW7A 1KKDA 2ITDC 4L8JA 3JD3A 4J7ZA 5KMGA 2RN9A 1OCRC 3P3PA 1HNXB 2FYUH 1VP7A 2KSDA 4GCZA 2EZOA 3WB2A 3JAMN 4IYHA 1R6NA 1VQMV 3W7WA 4WFBV 2B1GA 4ABMA 1I5YA 2GDSA 3G6EV 3OMAB 1UJWB 4YJ2B 3CJHA 1V9PA 2BOBC 3ETQA 1DF4A 3S3XA 1YSCA 2P90A 4HNAB 5LP6B 3CCQV 1RP3B 5IJ0B 4EEQA 2ZE8A 2R9IA 4X20A 5CBHA 3JALB 3CC7V 4PA6A 4Z1MG 2XOKG 1ZX3A 4I9QA 4DV2B 4CC6A 1M56C 1PPJH 4G2KA 2VQFB 1TUEB 2ZM6O 1I94B 1NR1A 5B1AB 3CXCU 1M5IA 4F6EA 4DYLA 4LF8B 2HVJC 1E79G 1FD9A 2WLHA 4LF7O 1JX9A 3CWBH 2UUBO 4NXNO 4LFAB 4QJFB 1O9GA 1IXBA 2F4VO 1WPBA 1R3LC 1XNRO 1I0HA 3QO7A 1AP5A 2BE3A 4J7KA 3T2MA 4JI4O 5H2FZ 3RYCA 2LGWA 2A0LA 5L3BA 1Y76B 3EVKA 1OCOB 1TUBB 2Q68A 4YJ3A 1W2BU 5IY5C 3K03A 5GW7A 2Q8VA 4PA7A 2WAMA 4DV1B 4TQDA 3ABLB 5CA1B 2JGUA 3A2FA 3GB7C 1NTKH 4DK1A 2BCCH 1S5HC 1TA8A 4GKKB 4A5UB 1XEQA 5D5PA 4X66B 2X7RB 1NQTA 2VWKA 4YHHB 3CE2A 5B1OA 2AHYA 1KU9A 4JPRA 5C8YA 1B04A 2EIMC 2IM9A 5EYPA 1OCZC 5LOVB 1F23A 3VQYA 1VQ7V 1Z5WA 3SPCA 2R9RB 1R3IC 4JI3O 2YIBD 4CBCA 4O4LA 2QM7A 5DM6V 3TGUH 2HG5C 3ABKC 3ABUA 3RFRA 4RO2A 1JJOA 4JI7B 4MVUA 1OCCB 2GBOA 2NLJC 4DV6O 3E22B 4JYYA 4OPAA 4C7UA 3CRCA 4R50A 5H9CA 3E35A 3K5LA 3PN1A 2IJIA 1T5EA 4JYCA 4UV8A 1FFXA 2QJ1A 1N32B 3K9AA 3FKSG 4FM0A 1LR1A 4H44B 3LNMB 1X4TA 2QR4A 1P7BA 2V7QG 4O2AB 3BCCH 1Q86W 4DUZO 1AP6A 1WJZA 4NTXA 4NB5A 3ZHSA 2V4DA 4I4TA 3OEHG 5FNVA 4FLVA 2LP7A 5LA6A 1AB3A 1YDXA 4GX0A 4N21A 2CE4A 1LUWA 5BZBA 1B3QA 3QG5A 1NH2B 2QE7G 3KG2A 3ZMSA 2X6AA 5B3SB 5BR8O 5KUMA 4O4JA 2PGGA 5ITZA 5L3GA 2E5LB 2XAQA 2OIGA 2Q69A 3TK1A 1S5JA 4X65B 1EFRG 3APQA 3L72H 4AQYB 2LGQA 2K1EA 2WPDG 3ASOC 5BXZA 5IWAO 1V55B 2LW1A 1BQ0A 5EIBC 4RUEA 1JJ2U 4DV7O 4DR6O 1PV0A 4KP4A 1V54B 1YTFD 4HAMA 2P67A 1XILA 2H8PC 2X6CA 1AJNA 4XBFA 4UUJC 4U3JB 1K4CC 2B5UA 3UO3A 1NBMG 1J5EB 1QLEB 3IFXA 2QM4A 1G1XB 3RVZA 1XUQA 4L87A 1NI8A 3QO5A 3HKEA 4MW3A 4MVZA 3JCZA 2GHYA 3CMAV 1N33O 1SC5B 1WN7A 3ML0A 4DR5B 4B3TB 4JTCB 1R6KA 3AK3A 1N0NA 3SYPA 3BA9A 4GKJB 4FLYA 1K9MW 3LDDA 3CS5A 3N2KA 4Z1VA 1VF7A 3K5OA 3DTUB 4D7SA 5FPOA 1US6A 2HR3A 1KC8W 1HW7A 4EKWA 1IBMB 1JQ0A 1IXMA 2VS0A 2HLDG 1Y66A 3ABTA 1GN4A 3DXRB 2UUAO 2HVKC 2JIZG 4KFMA 2P7TC 1SQFA 2R70A 2X0LA 4UB8Z 3IAYA 1COWG 4JAAA 3QO8A 5GTIZ 3ABLC 2CGNA 4LF6B 3G4SV 1NVPD 4RQEA 1W0JG 2XT9A 4NXMO 1HWYA 3ZMZA 1XMOB 4DUYO 4MVQA 1XREA 1FXHA 1Q43A 4FPPA 2IH1C 1WA8A 4DR4B 3FB5C 4KXRA 4W4LA 4J41A 4MW8A 1J95A 4F6RB 4LFCB 5IJ9B 3D3QA 4H33A 3P32A 1HNXO 4UV9A 3STZC 1KQSU 3K04A 5LGTA 4TV9A 3UT5B 2LO1A 5A9GA 2ZR3A 3FYIB 1YTFB 1S5LZ 2Y0IA 4DV3B 2B1IA 2CUGA 2PI4A 3ABMB 2YSUB 1N4CA 3RYIA 4JI6O 4GYCB 3J80N 3W7SA 2BSKB 4UCVA 1G4YB 4TV8A 2L6LA 4R6ZA 5LHIA 4FMTA 5JH7A 4HNAA 4LF5B 3MAQA 2DYSC 1Y67A 1WB7A 5LMUB 4G27B 3GWOA 5EK0A 4JI0B 4JI1B 1FFTB 2FTKA 1M56B 2CH7B 3ZBHA 3N2GA 1Y74A 4I0XA 3JARB 4LF8O 2ZE5A 2P22C 1B06A 4WF9V 5AG2A 4LFAO 1DF5A 1EN6A 3CP1A 1Q90D 2Z3YA 3AEIA 5JVDA 3QF7A 5LMNO 4JI2B 2EINC 4O4HB 5JQGA 2OTJV 4DR1B 1MZEA 4DR2B 4ZOLA 2DQ0A 5LYJB 3BA8A 4LWSB 2UXNA 5DEDA 1HNZB 1NVPB 1WP8A 4X62O 2WWWA 5EC1C 4PD4F 3RYFA 2R9AA 3H1JH 3CRQA 1IBLO 4X1IB 3H1KH 4CH3A 5BMVA 1SQPH 3TCUA 4DO2A 2HJFC 5IY5B 1P7GA 2OCCC 3THOA 1H2MA 4K3AA 5CBFA 4GKKO 5GTHZ 3JASA 3J7AU 4H0LB 3OGCC 3HKDB 3HKCB 4X66O 3DC5A 4KUMA 1S76D 3C3TA 4MVSA 4WBNA 2W0FC 1VQLV 1QLEC 2QKAA 5FL7G 3CRRA 1S0VA 3SJQC 5JCOA 3CRAA 1PNLA 1SESA 1N34B 3OE7G 4J42A 2JJ2G 3CCMV 2EIMB 4J11A 1OCZB 1EM1A 3JATB 2QTOA 2Q7EA 3MD0A 4EB6B 1H2NA 1XOUA 4JZ2A 2NNUA 1IX9A 2EIKC 3T1YO 1FXKA 2JEXA 3CCSV 3P3NA 1K5QA 3JD4A 3ABKB 3LSUA 3K9SA 4LCUC 3ZN1A 5EZYA 4JI8B 1U97A 5IYZB 3JAKB 1Y6XA 3G6BA 1L0NH 2KKWA 1JR9A 2D2CB 4FZ0A 1XHXA 3IC9A 4DXWA 2FKXA 4OPHA 5L3CA 2N05A 4OX9B 5A2QN 1BZKA 3WG7C 2GUZA 2QA4V 3Q4HB 4ZI7B 4BIZA 2BTQA 3JD2A 4ZHQA 4O2BB 3QNEA 4H37A 4KHPB 3CX5F 3QTCA 4UB6Z 2XUMA 2EILC 4FLXA 2N74A 1DGSA 1QVFU 1XMQB 1OJHA 1XQ8A 1K34A 1K33A 4DV0O 1SA0B 1KMIZ 1I5XA 1PM9A 3ZMVA 4BW9A 3ZHRA 1VQ6V 3SJAC 1ENVA 1H8HG 3CEIA 3ABMC 2E5LO 4X65O 1XNQB 3ZRWA 5KA5A 1KD1W 4FLTA 4AQYO 5LHGA 3ASNC 1OZ0A 3CXHF 1YI2V 3AG1C 3AG2C 1Q7YW 4X1KB 3ASOB 2XHBA 1QCEA 5KX5B 1FAFA 3K5NA 2ZE6A 3E8BA 5LXTA 1MNGA 3K0GA 3FFQA 2CDYA 1ZLZA 4O4IB 2P4KA 2MW2B 1XBLA 1MA1A 3BRCA 5J2TB 1SKVA 1IVSA 4J10A 4P9OA 4CH5A 4D6TH 4PDRA 5CA3A 4LF4O 4NKGB 2YEVB 1IBKB 4QPKA 2RMKB 3SYCA 5CB4A 2W6JG 3BHPA 1MG1A 1I7FA 1RSOA 4MVMA 2ZDIA 4X1YB 1Q81W 4IHJB 2ZNJA 1AI5A 3HKBB 1IBMO 4Q20A 1A32A 5EBMC 2UXCB 2RQ6A 2QSAA 2YXHA 4LH7A 2YICA 4J9ZB 1F4MA 5CA0B 5IDJA 3FAVB 3TXSA 1SZTA 1DK1A 2WSSG 3QVNA 3OMNB 4B3SB 1JCHA 2ZKOA 4IGGA 4P9PA 1N36O 3NXSA 1SF9A 2PI5A 2WLMA 2OIEA 3GVMA 5J2UA 1QR9A 4XDKA 2A9HA 1VEWA 4DR4O 3K0DA 4YY3O 5KHHA 2UXDB 3CRMA 1JFFA 4LFCO 2H3OA 2WLKA 1R6TA 2DE0X 1S77D 4RUFA 2QWPB 3CB2A 1P84F 1Q5OA 1GN6A 1BGYH 4TWKA 1MSDA 1TAEA 4DV3O 3FB8C 4WFFA 4TT3G 2R72A 3UQ8A 2DOSA 3OR7C 3CSXA 5LHHA 4FZ1A 1GM7A 1ZL8B 3R65A 1SERA 3E8HA 3ZHTA 4U7OA 3JCUZ 2CTQA 4CS2A 2KB1A 1F4NA 1VQ8V 2PYLA 3HB3B 1EZJA 4JAUA 4GT1A 2WLLB 2ZIMA 3LDEA 4I50A 5EBLC 4UVAA 5LMUO 2D3OW 4JI0O 2WLIA 3E8FA 2DYSB 2RNBA 3P30A 3CC4V 5FLXN 1AI6A 4JGSA 5K1PA 3BABA 3AK1A 2P4VA 4B3RO 1BMFG 4NTWA 3H1HH 1GAXA 4I55A 4JI2O 1NT2B 4NYKA 3B09A 1TVKA 3G80A 2IJKA 3JARA 4DR1O 2EINB 4DRXA 1BHAA 1FYJA 4K8ZA 5KHKA 2ZIOA 4PA4A 5IE9A 4UCOA 1OV9A 3JD0A 3ZHQA 4DV4B 2OWOA 1HNZO 4TUYB 3R66A 1RFYA 4JAVA 4BR6A 1CEZA 3CJHB 3SDLA 1M90W 1GM9A 2QDOA 2EJRA 2GTAA 4FLZA 3W7TA 4LWSA 4PI2A 1NTZH 2XNDG 4UFZA 4H13B 1ZTEA 3ICXA 5GONA 3OUSA 1HNWO 3L70H 3L71H 2OCCB 5B1NA 1AILA 4X20B 4QNHB 1K92A 4PDVA 4PELA 3O9OA 1KBHA 1NU1H 3D8CA 1F7YA 1NZ6A 1U96A 3FB6C 2JGDA 4I7ZB 5DECA 3UO2A 1BT8A 4FLUA 3AK2A 2Y0PA 2PY5A 4UVBA 1N34O 4K0KB 4TQFA 2QWQB 1Q82W 4JV5B 4AILC 3OW2U 1HR0B 4RQFA 4PA3A 4LH6A 3VOUA 3WB1A 4K8XA 2XASA 2EIKB 3JD1A 1FPOA 4CS4A 1H38A 5B1BC 3JATA 4JI8O 2JVDA 3RYCB 2UUBB 4NXNB 1BL8A 2QKCA 1ROPA 2NR5A 2BTOA 4B7KA 3CCVV 3F7YC 4AHCA 5H5NA 1HP8A 3H9VA 1FS0G 2F4VB 4OX9O 3JAWA 4YJ3B 3BVOA 2F95B 2WA4A 1XI1A 4JI4B 1FJGB 4IT5A 3WG7B 2PUSA 3SYQA 2KQXA 2VQEB 1M57C 4DV5O 2UXBB 2KG7A 4FFBA 2Q0OC 4RAIA 2RJZA 4IIJB 3WFVA 4N23A 2OYQA 2IBZH 2V1DA 3D36A 4D7TA 3F5WC 4ZI7A 2ETNA 3FD9A 2EILB 5JCOC 1THZA 4QIWF 4JTAB 1VF6A 4CC5A 5C8YB 4UVCA 3RYHA 3X2QB 4GX1A 3VQVA 5JWPA 4G28B 2F1MA 3J81N 1EBOA 4ICGA 1FXKC 3ASNB 1M93A 1SQBH 2ZD9A 4JYBA 3AG1B 4R7CA 4MTFA 4F4LA 3AG2B 1LUVA 3OTOB 2FB5A 5KA6A 1KKCA 1K4DC 3T4ZA 4YJ2A 4PI0A 3E2EA 1Z2GA 1WP7A 1D2DA 2XAJA 5LGNA 4FJCC 2DYRC 4X1KA 4DV2O 4WFHA 5LP6A 4FLWA 4LF9B 5IJ0A 2VQFO 3AG4C 4YIPA 1FFXB 1RPOA 1I94O 4MVOA 3T1HB 3JALA 5TISZ 4U3FH 1XL4A 1PL4A 4O4IA 2HJDA 3OD4A 2JS3A 2QEXV 4BAYA 2QGNA 2YUAA 4CZZA 4I4TB 5FNVB 1SRYA 4UCTA 2Y69C 4FK5C 4UCSA 4IL6Z 4EFBA 4FM2A 4DUZB 2XAGA 4YIOA 4JYAB 2JJ1G 2Y4UA 3W7UA 1Q6IA 4QGPA 3SPGA 5ITZB 1CP9A 4UXNA 3RW0A 4R8CA 4B3SO 4B3MB 4DV1O 3JYCA 3I56V 1Y76A 4OGQB 3APOA 4JZGA 4E4EA 5IYCO 1KECA 1TUBA 4PDMA 1GO3F 2UUCB 1R3JC 1BCCH 2ILMA 2A06H 3PJSK 3ZX6A 5IWAB 4YHHO 2UXDO 4MTGA 2CTPA 5CA1A 5J9PC 4DV7B 1WPXA 1KYOF 2Q6AA 3MHHC 1SQXH 2EX3A 3M99B 4LNUB 2XTAA 4MSWC 1R73A 5KLVH 5F2VO 4QPJA 3HKEB 3KKYA 1VIBA 3OUFA 4X9QA 2UU9B 1JOYA 2GTSA 1TGOA 5CMUA 5C93A 5LOVA 3EFFK 5KAFZ 4HYOA 4JI7O 1GTOA 3KCXA 4GX5A 3G67A 3N2KB 5CN0A 3ZMUA 3EHBB 5E1AC 1GKFA 1IDSA 1N33B 4W4KA 3M8AA 4QE7A 2YI9A 4DK0A 4X64B 1N0JA 3RVYA 1L8DA 1UPGA 1FKAO 5D5QA 2IJJA 1N32O 4J7JA 2IU0A 2YS8A 3A8TA 1URFA 3DGEA 1K3EA 1NKDA 3H1IH 3E22A 2AW9A 2AZ0A 3W7XA 2HKOA 1NTMH 5IT9N 2WLLA 4U7NA 1SQGA 2CTWA 3FB7C 3RN4A 5L3EA 3GWKC 1XDCA 4NR1A 1GM8A 1MMMA 2N04A 3G71V 4RWUA 3CCJV 1L0LH 2CK3G 4JI5B 1G6UA 2IJHA 4ZIBA 4O2AA 1W0KG 1GMGA 1D5NA 2EZPA 2P6JA 5K1XA 3X2QC 3OEEG 4DV4O 4LP8A 1HDJA 3L73H 4HZ3A 4NXMB 2E3CA 4TV9B 1CPYA 3BEHA 4ASUG 4DUYB 2GV9A 4PHZA 4TSFG 1S72V 4X8AA 1YHQV 3RYIB 5KHJA 5LGUA 3FX7A 2ADQB 4TUYA 2ZQMA 1VQ5V 3MHSC 1NS1A 1XHZA 4MTOA 4TV8B 1IZ3A 3O65A 3ZN0A 2JEUA 2C2AA 2EBOA 1E1QG 1EN4A 5JH7B 2G38A 2YXLA 4JI6B 4PJ0Z 3D3IA 2EJ7A 1QLNA 1J5EO 4J9YB 4DW0A 2IW5A 3N2GB 4K0KO 2YC0A 3A0BZ 4UCRA 1PNMA 5LL6Y 1Y74B 4GUNA 5IYDO 4I0XB 4JV5O 2ADPA 4U3JA 4FIPC 2HHHB 1GN3A 3I5DA 1HR0O 4DR5O 4B3TO 3F5TA 3U10A 2YIBA 3T4DA 3SJCC 4ZKIA 5JVDB 4GKJO 2P06A 2JRIA 1QVGU 1GN2A 4KL1A 3ZHVA 1VQ4V 2ZXWC 1AR5A 5JQGB 1I08A 4LFBB 4ZOLB 1KUQA 5B1BB 3SYAA 2B9ZA 5EC2C 2WA3A 3BAAA 1E1RG 1KB9F 1IURA 5LMNB 5EBWC 2ZINA 4MS2A 2CGOA 4YXWG 3TETA 4HBNA 3RYFB 5JJNB 1QHTA 4X88A 5BMVB 4WFGA 4PA9A 4LF6O 1FJGO 3UKMA 1YVWA 2E75B 2JDIG 4K35A 1OHHG 1PD3A 4CH6A 2VQEO 3DXRA 2UXBO 3LUTB 3SR2C 1PNKA 1SQVH 4X62B 3JASB 3IC7A 5BY1A 1XMOO 1M57B 4JTDB 1NH2D 1IBLB 1B6QA 2EIJC 2IH3C 3B2EE 2CAZC 3VQWA 1AR1B 3LSQA 4DR7B 1R1BA 4WBNB 1FXVA 3K57A 1Q3EA 2Q67A 1QNMA 2W6IG 3SJBC 3OFNG 4IIJA 1JVMA 4PV1B 4MVRA 1WNSA 2BOCC 2F66C 4Z2WA 1EN5A 1KP2A 1O9HA 3M7MX 4BIOA 3S3WA 3OTFA 1SQQH 2ARHA 2DWDC 4F6RA 5IJ9A 4I5SA 2K9PA 3KCYA 2YI8A 2QM8A 1YCIA 3ZIAG 1VQOV 1AVMA 1Q6HA 2Y48A 4BWAA 3UT5A 3E83A 1XL6A 3K08A 1FXKB 3OTOO 3ZCCA 1MSWD 1Q6UA 3B8MA 3E89A 5EZYB 1SZXA 2ODMA 3IJ4A 4P30A 5CBGA 4LF5O 4LF9O 2BSKA
chains in the Genus database with same CATH topology
2DYRB 5LBQA 3LSSA 3TCUA 1JPXA 4DO2A 3CCQV 2HJFC 5IY5B 1BHBA 3AG4B 3WG7B 2OCCC 3SYQA 2R9IA 5CBHA 5CBFA 3CC7V 1M57C 3OGCC 4PA6A 2UXXA 2ATKC 3CCEV 1DLBA 4RAIA 4Z1MG 2OTLV 2XOKG 4BIUA 4KUMA 1S76D 3WFVA 4N23A 1M56C 2V1DA 1M9NA 4MVSA 4G2KA 1TUEB 3D36A 1Y4MA 3F5WC 2W0FC 2HFEC 1QLEC 1NR1A 5B1AB 1VQLV 2WLJA 3CXCU 2EILB 5FL7G 1S0VA 3ETEA 3AG3C 3SJQC 3CD6V 1THZA 4QIWF 4JTAB 1RM1C 1PNLA 1H2GA 1SESA 2Y69B 3OE7G 4UVCA 2HVJC 2JJ2G 3X2QB 1E79G 2WLHA 2EIMB 4GX1A 1JX9A 3CCMV 1OCZB 4G28B 3STLC 4QJFB 2QTOA 3MD0A 3CC2V 1R3LC 1EBOA 2NNUA 3QO7A 3B8NA 3ZRWB 5DN6G 2EIKC 1FXKA 1FXKC 2JEXA 3ASNB 3ZRXA 3CCSV 2ZD9A 4JYBA 3AG1B 4R7CA 3T2MA 4MTFA 4F4LA 1K5QA 3AG2B 3JD4A 3ABKB 1ZWIC 3ETGA 2ITCC 5KA6A 4LCUC 2A0LA 3ZN1A 1K4DC 1YJ9V 3T4ZA 3CCUV 5L3BA 4LC1A 3E2EA 2XAJA 1OCOB 3CCLV 5LGNA 4FJCC 3LDCA 2Q68A 4DXWA 2DYRC 5L3CA 1W2BU 4WFHA 3OR6C 5IY5C 3K03A 3AG4C 5GW7A 1RPOA 3WG7C 2QA4V 4MVOA 4PA7A 2WAMA 5H6QA 3K79A 3ABLB 3GB7C 3FYEB 1XL4A 4BIZA 3JD2A 1PL0A 1S5HC 3QNEA 3I55V 4H37A 2QEXV 4BAYA 1MOFA 1QBZA 1DTOA 4LBEC 3ZRVA 2X7RB 1NQTA 3ETDA 5KUKA 3F7VC 5B1AC 1VQPV 4CZZA 2EILC 5B1OA 2AHYA 2Z5UA 3T1CA 1SRYA 1VQKV 4JPRA 4JASA 2Y69C 1QVFU 1K8AW 4FK5C 2EIMC 1K34A 1K33A 1OCZC 1I5XA 1PKXA 2XAGA 3ZMVA 1AI4A 1F23A 1G8MA 1VQ7V 1VQ6V 3SPCA 2R9RB 2JJ1G 2LFRA 1R3IC 1L1FA 1ENVA 3W7UA 1H8HG 4GX2A 3ABMC 3SPGA 4CBCA 3ZRWA 5KA5A 1KD1W 5LHGA 1CP9A 3ASNC 1OZ0A 1YI2V 1YIJV 2QM7A 3AG1C 1RPRA 4UXNA 5DM6V 3AG2C 2HG5C 3ABKC 3ABUA 1Q7YW 3RW0A 2DWEC 3ASOB 4R8CA 1QCEA 4RO2A 3JYCA 3VBBA 3E8BA 4MVUA 3I56V 1OCCB 2NLJC 3K0GA 1OCOC 5IYCO 1KECA 3E86A 1K7DA 4PDMA 1GO3F 4R50A 5H9CA 2MK3A 3E35A 1R3JC 2IJIA 3BY6A 3OAAG 4XDLA 4JYCA 1K5SA 2M7WA 3PJSK 4UV8A 2DW4A 1VQNV 1WLEA 1AJQA 3K9AA 3FKSG 4MTGA 2A79B 3H01A 3SPIA 5J9PC 1WPXA 4P9OA 2Q6AA 4PDRA 3MHHC 5CA3A 3HPLC 3LNMB 2V7QG 1P7BA 4WFEA 3M99B 1Q86W 2YEVB 4QPKA 3RBZA 4P2ZA 4MSWC 3SYCA 1R73A 4JF3A 3OEHG 4QPJA 2LP7A 2W6JG 4GX0A 4N21A 3OUFA 1MG1A 3ZJZA 1JOYA 2GSMB 2WLNA 5BZBA 5CMUA 5C93A 1OCRB 1NH2B 4MVMA 2QE7G 3EFFK 2ZDIA 4HYOA 1GTOA 1Q81W 1AI7A 2H94A 4GX5A 3KG2A 3SPJA 1YJWV 3ZMSA 2X6AA 1AI5A 5CN0A 3ZMUA 2AHZA 3EHBB 5E1AC 5B3SB 1GKFA 5KUMA 2LFSA 4Q20A 5EBMC 5L3GA 3IGAC 2OT5A 3UM7A 4QE7A 2XAQA 2Q69A 3TK1A 1NJIW 3RVYA 4J9ZB 1EFRG 1F4MA 2IJJA 3ASOC 2K1EA 2WPDG 1V55B 2IU0A 5IDJA 1SZTA 4ZBMA 4RUEA 1JJ2U 1OCCC 2IU3A 2WSSG 3OMNB 2WLIB 3DGEA 2XAHA 4KP4A 1K3EA 1NKDA 1JCHA 1V54B 1YTFD 4HAMA 4MTXA 2P67A 3W7XA 2HKOA 2WLLA 4U7NA 5H6RA 3K3WA 4P9PA 1K97A 1R3KC 2H8PC 2X6CA 3B77A 3NXSA 2PI5A 3FB7C 2WLMA 1AJNA 1QR9A 2DQ3A 4XBFA 5L3EA 4UUJC 4XDKA 2A9HA 1K4CC 1GM8A 1H8EG 3K0DA 2B5UA 3G71V 3CCJV 4QE9A 5HFLA 2CK3G 2XAFA 2IJHA 1NBMG 3A0RA 1W0KG 2WLKA 1GMGA 2YEVA 1QLEB 2EZPA 3IFXA 2P6JA 5L3DA 4RUFA 3X2QC 1VQ9V 1S77D 2ZXWB 3OEEG 3RVZA 4LP8A 4L87A 4HZ3A 4TWKA 3QO5A 1QR8A 1CPYA 1ORQC 3E8GA 3BEHA 3FB8C 3JCZA 4MVZA 4MW3A 4TT3G 4WFFA 2GHYA 4ASUG 3CMAV 4WFAV 3ML0A 4JTCB 3OR7C 1R6KA 1YITV 2ZR2A 5LHHA 1GM7A 4TSFG 3SYPA 1S72V 4X8AA 1YHQV 3OMIB 1K9MW 3R65A 1SERA 3E8HA 5LGUA 3LDDA 4U7OA 5B3SC 1M1KW 2ZQMA 3DTUB 1VQ5V 2KB1A 2HR3A 3MHSC 1KC8W 4EKWA 1F4NA 1VQ8V 1JQ0A 4MTOA 1IXMA 3HB3B 2HLDG 1EZJA 1Y66A 1MABG 3ABTA 2JEUA 4JAUA 3ZN0A 4GT1A 2WLLB 2C2AA 2EBOA 4XDJA 1V55C 3LDEA 2HVKC 2JIZG 2F43G 4KFMA 2P7TC 5EBLC 1E1QG 4UVAA 2X0LA 2D3OW 1COWG 2WLIA 3E8FA 2DYSB 3QO8A 1LNQA 1V54C 3P30A 3CC4V 3ABLC 1YJNV 3D3IA 1AI6A 1QLNA 2EIJB 4J9YB 3G4SV 4JGSA 1NVPD 5L3FA 3CCRV 4RQEA 2IW5A 1PNMA 1W0JG 3SYOA 5IYDO 4FIPC 1BMFG 1HWYA 3ZMZA 4MVQA 3OM3B 5HFMA 1FXHA 1F51A 4FPPA 2IH1C 2JK5C 3FB5C 3T4DA 4ZKIA 1S3JA 4MW8A 2IJKA 4PDLA 3SPHA 1J95A 1QVGU 4H33A 2EINB 3P32A 4UV9A 1VQ4V 2ZXWC 1BHAA 1SETA 3STZC 1KQSU 2ZDIC 3CYOA 3K04A 1N8RW 5LGTA 4PA4A 4I9WA 3JD0A 3K06A 1P4RA 5B1BB 3CPWU 2ZR3A 3FYIB 3SYAA 1K73W 5EC2C 3ZMTA 1YTFB 1NR7A 1E1RG 2B1IA 1AJPA 2PI4A 3ABMB 5EBWC 2YSUB 5IYBO 4MS2A 4JAVA 1CEZA 4YXWG 3TETA 1M90W 1GM9A 1KP3A 2EJRA 3W7SA 3W7TA 4X88A 4WFGA 4PA9A 1G4YB 3UKMA 2XNDG 4X89A 3CMEV 2JDIG 1OHHG 4R6ZA 1PD3A 4WCEV 3OUSA 2OCCB 3LUTB 5B1NA 1PNKA 4MT8A 5LHIA 4BW5A 4QNHB 4FMTA 1K92A 1GK9A 3ZRSA 4PDVA 3IC7A 4PELA 1M57B 4JTDB 4OXSA 1NH2D 2DYSC 2QKSA 4G27B 1B6QA 3GWOA 2X6BA 5EK0A 2EIJC 2IH3C 1FFTB 2FTKA 1M56B 3FB6C 1AR1B 3LSQA 1FXVA 4E2LA 2Q67A 4UVBA 2W6IG 3AG3B 1RM1B 4WF9V 3OFNG 1Q82W 1JVMA 1DF5A 4MVRA 2BOCC 1AROP 3CP1A 1KP2A 2Z3YA 3AEIA 2ITDC 3OW2U 1KKDA 3JD3A 4RQFA 4PA3A 2DWDC 2EINC 4I5SA 1OCRC 2QM8A 3VOUA 2OTJV 3ZIAG 1VQOV 2Y48A 2XASA 4GCZA 2EIKB 2EZOA 3JD1A 3E83A 1XL6A 1R6NA 1FXKB 3K08A 3W7WA 1VQMV 1H38A 5B1BC 3ZCCA 4WFBV 2B1GA 1MSWD 2DQ0A 3B8MA 3E89A 1I5YA 2UXNA 1BL8A 1ROPA 3G6EV 3CCVV 3F7YC 3OMAB 1NVPB 1UJWB 2WWWA 5EC1C 4P30A 1FS0G 5CBGA 2BOBC 1DF4A 1YSCA 2P90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL C;  4MW8 A;  4PDL A;  2AHY A;  4ZBM A;  3SPH A;  3T1C A;  1J95 A;  4RUE A;  3TCU A;  1OCC C;  4H33 A;  2HJF C;  2Y69 C;  2WLI B;  2ZXW C;  3STZ C;  2EIM C;  3K04 A;  2OCC C;  1OCZ C;  4PA4 A;  3SYQ A;  4I9W A;  5CBH A;  5CBF A;  2WLL A;  3K06 A;  1M57 C;  4P9P A;  3OGC C;  2R9R B;  1R3K C;  3SPC A;  3SYA A;  1R3I C;  2H8P C;  2X6C A;  4PA6 A;  5EC2 C;  3FB7 C;  2WLM A;  2ATK C;  4GX2 A;  3ABM C;  4RAI A;  3SPG A;  4CBC A;  4UUJ C;  4XDK A;  2A9H A;  1K4C C;  5EBW C;  1M56 C;  3ASN C;  3K0D A;  4MS2 A;  3AG1 C;  4MVS A;  3TET A;  4QE9 A;  3AG2 C;  2HG5 C;  3ABK C;  3F5W C;  2W0F C;  2DWE C;  1QLE C;  2HFE C;  3RW0 A;  2WLK A;  4R8C A;  2WLJ A;  4X88 A;  3SJQ C;  4RO2 A;  2YEV A;  3AG3 C;  3JYC A;  4PA9 A;  1G4Y B;  3E8B A;  3IFX A;  4WFG A;  4JTA B;  4X89 A;  4RUF A;  3UKM A;  3X2Q C;  4MVU A;  2NLJ C;  4R6Z A;  3RVZ A;  2HVJ C;  3K0G A;  1OCO C;  2WLH A;  4GX1 A;  4LP8 A;  3OUS A;  3E86 A;  4HZ3 A;  4PDM A;  4TWK A;  3LUT B;  4R50 A;  4G28 B;  4BW5 A;  4QNH B;  1ORQ C;  3STL C;  1R3J C;  3BEH A;  3E8G A;  3FB8 C;  4MVZ A;  2QTO A;  4MW3 A;  4WFF A;  4PDV A;  3ZRS A;  4XDL A;  4JTC B;  4JTD B;  4OXS A;  2DYS C;  1R3L C;  3OR7 C;  3PJS K;  2QKS A;  4G27 B;  3SYP A;  2X6B A;  5EK0 A;  4MTG A;  2EIJ C;  2EIK C;  2IH3 C;  4X8A A;  2A79 B;  3SPI A;  5J9P C;  3FB6 C;  4P9O A;  2ZD9 A;  4R7C A;  3T2M A;  2Q6A A;  3R65 A;  4MTF A;  4F4L A;  3E8H A;  4PDR A;  3LDD A;  1ZWI C;  3HPL C;  2Q67 A;  3LNM B;  5B3S C;  1P7B A;  2ITC C;  4WFE A;  4LCU C;  2A0L A;  2KB1 A;  1K4D C;  4EKW A;  3ASO C;  3T4Z A;  3RBZ A;  4P2Z A;  1JVM A;  4MTO A;  4MSW C;  3SYC A;  4MVR A;  2BOC C;  2WLL B;  4XDJ A;  1V55 C;  2Q68 A;  3LDC A;  1KKD A;  2ITD C;  3LDE A;  2HVK C;  4DXW A;  2DYR C;  4PA3 A;  4KFM A;  2P7T C;  5EBL C;  2DWD C;  4WFH A;  3OR6 C;  4GX0 A;  2EIN C;  3OUF A;  2WLI A;  3ZJZ A;  3E8F A;  5IY5 C;  1OCR C;  3K03 A;  3AG4 C;  3VOU A;  2WLN A;  1LNQ A;  1V54 C;  5BZB A;  3WG7 C;  3ABL C;  4MVO A;  4PA7 A;  4MVM A;  3EFF K;  4J9Y B;  3E83 A;  1XL6 A;  3K08 A;  4HYO A;  3GB7 C;  4GX5 A;  5B1B C;  1XL4 A;  3KG2 A;  3SPJ A;  2X6A A;  3E89 A;  3SYO A;  1S5H C;  2AHZ A;  5E1A C;  5KUM A;  1BL8 A;  3T4D A;  4H37 A;  3F7Y C;  5EBM C;  3IGA C;  3UM7 A;  4QE7 A;  4MVQ A;  4P30 A;  5EC1 C;  2Q69 A;  5B1A C;  4LBE C;  5CBG A;  2BOB C;  3RVY A;  4J9Z B;  2IH1 C;  5KUK A;  2JK5 C;  3F7V C;  3FB5 C;  2K1E A; 
#chains in the Genus database with same CATH topology
 2YXY A;  3B4S A;  2DYR B;  3T1Y B;  4JI1 O;  5LBQ A;  3LSS A;  3T1H O;  1JPX A;  1BHB A;  3AG4 B;  1WB8 A;  3DC6 A;  2GUZ B;  1X59 A;  3WU2 Z;  2BTQ B;  2UXX A;  2ZNI A;  2ATK C;  4ZHQ B;  1DLB A;  3CCE V;  2OTL V;  4Q6G A;  4BIU A;  3UCS C;  2CH7 A;  4UCU A;  1M9N A;  3D36 C;  1Y4M A;  1QU7 A;  3MDS A;  2HFE C;  2JS5 A;  2WLJ A;  2PZS A;  3CD6 V;  3ETE A;  3AG3 C;  5KMG B;  4DR3 B;  2DMX A;  3K59 A;  1VF6 C;  1RM1 C;  4DR2 O;  1H2G A;  2Y69 B;  2M6Y A;  4JYA O;  2A3Q A;  1WAZ A;  3STL C;  3CC2 V;  3K5M A;  4O4H A;  5KAI Z;  2PYJ A;  2A7W A;  1H2S B;  3B8N A;  3ZRW B;  5DN6 G;  3ZRX A;  3TXQ A;  4B3M O;  5LYJ A;  1ZWI C;  4DV0 B;  3ETG A;  5KHG A;  2ITC C;  1YJ9 V;  5B5E Z;  2CTR A;  3U0Z A;  3U11 A;  3RGB A;  3CCU V;  4LC1 A;  2UUC O;  2Q0A A;  5LXT B;  4DW1 A;  3CCL V;  1VF5 B;  3LDC A;  4X1I A;  3L9D A;  4CS3 A;  3OR6 C;  5LP6 C;  1ZUQ A;  1GRJ A;  2P5O A;  5JJJ B;  5H6Q A;  3K79 A;  2LJ2 A;  3FYE B;  3HKD A;  1PL0 A;  2Q4P A;  2ZCE A;  3HKC A;  3I55 V;  1MZF A;  2RCV A;  1MOF A;  2YIA A;  1QBZ A;  1DTO A;  1QQC A;  4LBE C;  3ZRV A;  3ETD A;  5KUK A;  5CB4 B;  3F7V C;  3C90 A;  5B1A C;  1VQP V;  4NVP A;  2UU9 O;  1PP9 H;  4LR3 A;  2Z5U A;  3T1C A;  1VQK V;  2ZM6 B;  4JAS A;  5KHI A;  4LNU A;  2QWR B;  1K8A W;  4LF4 B;  4CH4 A;  1SS3 A;  3WB0 A;  1PKX A;  2E74 B;  1RSO B;  1AI4 A;  1G8M A;  4LF7 B;  4EB6 A;  2LFR A;  1L1F A;  4GX2 A;  4X64 O;  1ZSP A;  4AI8 A;  1XNR B;  1YIJ V;  1RPR A;  3JSL A;  2Q5Z A;  2HP8 A;  4GZR B;  3L74 H;  2DWE C;  1BQZ A;  3VBB A;  5IYZ A;  2AZ2 A;  2FL4 A;  3JAK A;  2Q7H A;  1OCO C;  1Q8I A;  3E86 A;  1K7D A;  2E76 B;  2MK3 A;  3BY6 A;  3OAA G;  4KHP O;  2YID A;  4XDL A;  1K5S A;  2M7W A;  4FFK A;  5J2U B;  1BE3 H;  2DW4 A;  1VQN V;  1WLE A;  1AJQ A;  2Q7G A;  3N27 A;  3Q4H A;  4JI5 O;  2A79 B;  3H01 A;  4FVM A;  3SPI A;  1Z5V A;  1XMQ O;  1JFF B;  3HPL C;  4O2B A;  2YDE A;  4WFE A;  3RBZ A;  4P2Z A;  5EYP B;  1N36 B;  4JF3 A;  4NTY A;  1XNQ O;  2W0X A;  3BPZ A;  3SGI A;  4YY3 B;  1JA8 A;  2OCH A;  3ZJZ A;  2GSM B;  4FM1 A;  2WLN A;  4O4L B;  3LNN A;  1SA0 A;  2QWN B;  1OCR B;  3DSQ A;  3K58 A;  1AI7 A;  2H94 A;  3SPJ A;  1YJW V;  3OGI B;  2AHZ A;  1CXZ B;  2LFS A;  2PTM A;  3IGA C;  2OT5 A;  3UM7 A;  1NJI W;  4JI3 B;  5KX5 A;  2L35 A;  4I50 B;  4ZBM A;  3B40 A;  1OCC C;  2IU3 A;  2VWJ A;  2WLI B;  5E79 Z;  3C3S A;  2XAH A;  3JSN A;  1UFI A;  4MTX A;  4DV6 B;  2AGA A;  1IBK O;  5H6R A;  3A0H Z;  3K3W A;  1K97 A;  1R3K C;  3B77 A;  2HHH O;  2DQ3 A;  2RDC A;  5J2T A;  1H8E G;  4I55 B;  4QE9 A;  5HFL A;  2XAF A;  3A0R A;  5LA6 B;  1TVK B;  2YEV A;  3ZS8 C;  1GH6 A;  5L3D A;  1VQ9 V;  2DJV A;  4DRX B;  2ZXW B;  4LFB O;  3NR7 A;  2QTS A;  4B3R B;  1QR8 A;  4J80 A;  1ORQ C;  3E8G A;  2UXC O;  3KZI Z;  4WFA V;  2AXT Z;  4O4J B;  4EFE A;  3CHX A;  1YIT V;  2ZR2 A;  5B66 Z;  1AR4 A;  3RWR D;  4X1Y A;  3OMI B;  1W59 A;  4IHJ A;  2F23 A;  3HKB A;  5B3S C;  2Y4T A;  1M1K W;  1ZAU A;  2QWO B;  2F93 B;  1YZB A;  2O57 A;  5BR8 B;  3VQX A;  1MAB G;  5GON B;  5CA0 A;  4XDJ A;  1V55 C;  3FAV A;  1M4U A;  2F43 G;  2Z0A A;  2ZE7 A;  1H2K A;  1LNQ A;  1V54 C;  4DR7 O;  1YJN V;  2VRZ A;  5FPR A;  4DR6 B;  2EIJ B;  2JGD B;  1H2L A;  3AG7 A;  5L3F A;  3CCR V;  3SYO A;  1HNW B;  3OT7 A;  5HFM A;  1EZV H;  3OM3 B;  1F51 A;  1JMK C;  5EIB D;  3HR0 A;  2JK5 C;  1S3J A;  4PDL A;  3RT3 C;  3SPH A;  1YEW A;  2Q9L A;  2HEP A;  1SET A;  4GLX A;  2ZDI C;  3CYO A;  1N8R W;  1YF2 A;  4I9W A;  3EXA A;  3ZED A;  3K06 A;  2LQT A;  2Q73 A;  1P4R A;  3CPW U;  2EUL A;  1K73 W;  3ZMT A;  1NR7 A;  4B08 A;  3BFR A;  1ZL8 A;  4B7E A;  1AJP A;  4IYI A;  5IYB O;  3ZHU A;  1KP3 A;  2DN9 A;  3JAW B;  4X89 A;  2NN4 A;  3L75 H;  1BSM A;  3CME V;  4TOI A;  4WCE V;  4MT8 A;  4BW5 A;  1VAR A;  1D5A A;  1GK9 A;  3ZRS A;  2KG7 B;  4OXS A;  2UUA B;  3TJT A;  4FFB B;  5JJE B;  1YXB A;  2QKS A;  2ZT9 B;  2X6B A;  2PF4 E;  1WA8 B;  1BS3 A;  4DR3 O;  4E2L A;  1VMG A;  1P49 A;  2FML A;  3AG3 B;  1RM1 B;  4DV5 B;  3H1L H;  3RYH B;  1ARO P;  2LW7 A;  1KKD A;  2ITD C;  4L8J A;  3JD3 A;  4J7Z A;  5KMG A;  2RN9 A;  1OCR C;  3P3P A;  1HNX B;  2FYU H;  1VP7 A;  2KSD A;  4GCZ A;  2EZO A;  3WB2 A;  3JAM N;  4IYH A;  1R6N A;  1VQM V;  3W7W A;  4WFB V;  2B1G A;  4ABM A;  1I5Y A;  2GDS A;  3G6E V;  3OMA B;  1UJW B;  4YJ2 B;  3CJH A;  1V9P A;  2BOB C;  3ETQ A;  1DF4 A;  3S3X A;  1YSC A;  2P90 A;  4HNA B;  5LP6 B;  3CCQ V;  1RP3 B;  5IJ0 B;  4EEQ A;  2ZE8 A;  2R9I A;  4X20 A;  5CBH A;  3JAL B;  3CC7 V;  4PA6 A;  4Z1M G;  2XOK G;  1ZX3 A;  4I9Q A;  4DV2 B;  4CC6 A;  1M56 C;  1PPJ H;  4G2K A;  2VQF B;  1TUE B;  2ZM6 O;  1I94 B;  1NR1 A;  5B1A B;  3CXC U;  1M5I A;  4F6E A;  4DYL A;  4LF8 B;  2HVJ C;  1E79 G;  1FD9 A;  2WLH A;  4LF7 O;  1JX9 A;  3CWB H;  2UUB O;  4NXN O;  4LFA B;  4QJF B;  1O9G A;  1IXB A;  2F4V O;  1WPB A;  1R3L C;  1XNR O;  1I0H A;  3QO7 A;  1AP5 A;  2BE3 A;  4J7K A;  3T2M A;  4JI4 O;  5H2F Z;  3RYC A;  2LGW A;  2A0L A;  5L3B A;  1Y76 B;  3EVK A;  1OCO B;  1TUB B;  2Q68 A;  4YJ3 A;  1W2B U;  5IY5 C;  3K03 A;  5GW7 A;  2Q8V A;  4PA7 A;  2WAM A;  4DV1 B;  4TQD A;  3ABL B;  5CA1 B;  2JGU A;  3A2F A;  3GB7 C;  1NTK H;  4DK1 A;  2BCC H;  1S5H C;  1TA8 A;  4GKK B;  4A5U B;  1XEQ A;  5D5P A;  4X66 B;  2X7R B;  1NQT A;  2VWK A;  4YHH B;  3CE2 A;  5B1O A;  2AHY A;  1KU9 A;  4JPR A;  5C8Y A;  1B04 A;  2EIM C;  2IM9 A;  5EYP A;  1OCZ C;  5LOV B;  1F23 A;  3VQY A;  1VQ7 V;  1Z5W A;  3SPC A;  2R9R B;  1R3I C;  4JI3 O;  2YIB D;  4CBC A;  4O4L A;  2QM7 A;  5DM6 V;  3TGU H;  2HG5 C;  3ABK C;  3ABU A;  3RFR A;  4RO2 A;  1JJO A;  4JI7 B;  4MVU A;  1OCC B;  2GBO A;  2NLJ C;  4DV6 O;  3E22 B;  4JYY A;  4OPA A;  4C7U A;  3CRC A;  4R50 A;  5H9C A;  3E35 A;  3K5L A;  3PN1 A;  2IJI A;  1T5E A;  4JYC A;  4UV8 A;  1FFX A;  2QJ1 A;  1N32 B;  3K9A A;  3FKS G;  4FM0 A;  1LR1 A;  4H44 B;  3LNM B;  1X4T A;  2QR4 A;  1P7B A;  2V7Q G;  4O2A B;  3BCC H;  1Q86 W;  4DUZ O;  1AP6 A;  1WJZ A;  4NTX A;  4NB5 A;  3ZHS A;  2V4D A;  4I4T A;  3OEH G;  5FNV A;  4FLV A;  2LP7 A;  5LA6 A;  1AB3 A;  1YDX A;  4GX0 A;  4N21 A;  2CE4 A;  1LUW A;  5BZB A;  1B3Q A;  3QG5 A;  1NH2 B;  2QE7 G;  3KG2 A;  3ZMS A;  2X6A A;  5B3S B;  5BR8 O;  5KUM A;  4O4J A;  2PGG A;  5ITZ A;  5L3G A;  2E5L B;  2XAQ A;  2OIG A;  2Q69 A;  3TK1 A;  1S5J A;  4X65 B;  1EFR G;  3APQ A;  3L72 H;  4AQY B;  2LGQ A;  2K1E A;  2WPD G;  3ASO C;  5BXZ A;  5IWA O;  1V55 B;  2LW1 A;  1BQ0 A;  5EIB C;  4RUE A;  1JJ2 U;  4DV7 O;  4DR6 O;  1PV0 A;  4KP4 A;  1V54 B;  1YTF D;  4HAM A;  2P67 A;  1XIL A;  2H8P C;  2X6C A;  1AJN A;  4XBF A;  4UUJ C;  4U3J B;  1K4C C;  2B5U A;  3UO3 A;  1NBM G;  1J5E B;  1QLE B;  3IFX A;  2QM4 A;  1G1X B;  3RVZ A;  1XUQ A;  4L87 A;  1NI8 A;  3QO5 A;  3HKE A;  4MW3 A;  4MVZ A;  3JCZ A;  2GHY A;  3CMA V;  1N33 O;  1SC5 B;  1WN7 A;  3ML0 A;  4DR5 B;  4B3T B;  4JTC B;  1R6K A;  3AK3 A;  1N0N A;  3SYP A;  3BA9 A;  4GKJ B;  4FLY A;  1K9M W;  3LDD A;  3CS5 A;  3N2K A;  4Z1V A;  1VF7 A;  3K5O A;  3DTU B;  4D7S A;  5FPO A;  1US6 A;  2HR3 A;  1KC8 W;  1HW7 A;  4EKW A;  1IBM B;  1JQ0 A;  1IXM A;  2VS0 A;  2HLD G;  1Y66 A;  3ABT A;  1GN4 A;  3DXR B;  2UUA O;  2HVK C;  2JIZ G;  4KFM A;  2P7T C;  1SQF A;  2R70 A;  2X0L A;  4UB8 Z;  3IAY A;  1COW G;  4JAA A;  3QO8 A;  5GTI Z;  3ABL C;  2CGN A;  4LF6 B;  3G4S V;  1NVP D;  4RQE A;  1W0J G;  2XT9 A;  4NXM O;  1HWY A;  3ZMZ A;  1XMO B;  4DUY O;  4MVQ A;  1XRE A;  1FXH A;  1Q43 A;  4FPP A;  2IH1 C;  1WA8 A;  4DR4 B;  3FB5 C;  4KXR A;  4W4L A;  4J41 A;  4MW8 A;  1J95 A;  4F6R B;  4LFC B;  5IJ9 B;  3D3Q A;  4H33 A;  3P32 A;  1HNX O;  4UV9 A;  3STZ C;  1KQS U;  3K04 A;  5LGT A;  4TV9 A;  3UT5 B;  2LO1 A;  5A9G A;  2ZR3 A;  3FYI B;  1YTF B;  1S5L Z;  2Y0I A;  4DV3 B;  2B1I A;  2CUG A;  2PI4 A;  3ABM B;  2YSU B;  1N4C A;  3RYI A;  4JI6 O;  4GYC B;  3J80 N;  3W7S A;  2BSK B;  4UCV A;  1G4Y B;  4TV8 A;  2L6L A;  4R6Z A;  5LHI A;  4FMT A;  5JH7 A;  4HNA A;  4LF5 B;  3MAQ A;  2DYS C;  1Y67 A;  1WB7 A;  5LMU B;  4G27 B;  3GWO A;  5EK0 A;  4JI0 B;  4JI1 B;  1FFT B;  2FTK A;  1M56 B;  2CH7 B;  3ZBH A;  3N2G A;  1Y74 A;  4I0X A;  3JAR B;  4LF8 O;  2ZE5 A;  2P22 C;  1B06 A;  4WF9 V;  5AG2 A;  4LFA O;  1DF5 A;  1EN6 A;  3CP1 A;  1Q90 D;  2Z3Y A;  3AEI A;  5JVD A;  3QF7 A;  5LMN O;  4JI2 B;  2EIN C;  4O4H B;  5JQG A;  2OTJ V;  4DR1 B;  1MZE A;  4DR2 B;  4ZOL A;  2DQ0 A;  5LYJ B;  3BA8 A;  4LWS B;  2UXN A;  5DED A;  1HNZ B;  1NVP B;  1WP8 A;  4X62 O;  2WWW A;  5EC1 C;  4PD4 F;  3RYF A;  2R9A A;  3H1J H;  3CRQ A;  1IBL O;  4X1I B;  3H1K H;  4CH3 A;  5BMV A;  1SQP H;  3TCU A;  4DO2 A;  2HJF C;  5IY5 B;  1P7G A;  2OCC C;  3THO A;  1H2M A;  4K3A A;  5CBF A;  4GKK O;  5GTH Z;  3JAS A;  3J7A U;  4H0L B;  3OGC C;  3HKD B;  3HKC B;  4X66 O;  3DC5 A;  4KUM A;  1S76 D;  3C3T A;  4MVS A;  4WBN A;  2W0F C;  1VQL V;  1QLE C;  2QKA A;  5FL7 G;  3CRR A;  1S0V A;  3SJQ C;  5JCO A;  3CRA A;  1PNL A;  1SES A;  1N34 B;  3OE7 G;  4J42 A;  2JJ2 G;  3CCM V;  2EIM B;  4J11 A;  1OCZ B;  1EM1 A;  3JAT B;  2QTO A;  2Q7E A;  3MD0 A;  4EB6 B;  1H2N A;  1XOU A;  4JZ2 A;  2NNU A;  1IX9 A;  2EIK C;  3T1Y O;  1FXK A;  2JEX A;  3CCS V;  3P3N A;  1K5Q A;  3JD4 A;  3ABK B;  3LSU A;  3K9S A;  4LCU C;  3ZN1 A;  5EZY A;  4JI8 B;  1U97 A;  5IYZ B;  3JAK B;  1Y6X A;  3G6B A;  1L0N H;  2KKW A;  1JR9 A;  2D2C B;  4FZ0 A;  1XHX A;  3IC9 A;  4DXW A;  2FKX A;  4OPH A;  5L3C A;  2N05 A;  4OX9 B;  5A2Q N;  1BZK A;  3WG7 C;  2GUZ A;  2QA4 V;  3Q4H B;  4ZI7 B;  4BIZ A;  2BTQ A;  3JD2 A;  4ZHQ A;  4O2B B;  3QNE A;  4H37 A;  4KHP B;  3CX5 F;  3QTC A;  4UB6 Z;  2XUM A;  2EIL C;  4FLX A;  2N74 A;  1DGS A;  1QVF U;  1XMQ B;  1OJH A;  1XQ8 A;  1K34 A;  1K33 A;  4DV0 O;  1SA0 B;  1KMI Z;  1I5X A;  1PM9 A;  3ZMV A;  4BW9 A;  3ZHR A;  1VQ6 V;  3SJA C;  1ENV A;  1H8H G;  3CEI A;  3ABM C;  2E5L O;  4X65 O;  1XNQ B;  3ZRW A;  5KA5 A;  1KD1 W;  4FLT A;  4AQY O;  5LHG A;  3ASN C;  1OZ0 A;  3CXH F;  1YI2 V;  3AG1 C;  3AG2 C;  1Q7Y W;  4X1K B;  3ASO B;  2XHB A;  1QCE A;  5KX5 B;  1FAF A;  3K5N A;  2ZE6 A;  3E8B A;  5LXT A;  1MNG A;  3K0G A;  3FFQ A;  2CDY A;  1ZLZ A;  4O4I B;  2P4K A;  2MW2 B;  1XBL A;  1MA1 A;  3BRC A;  5J2T B;  1SKV A;  1IVS A;  4J10 A;  4P9O A;  4CH5 A;  4D6T H;  4PDR A;  5CA3 A;  4LF4 O;  4NKG B;  2YEV B;  1IBK B;  4QPK A;  2RMK B;  3SYC A;  5CB4 A;  2W6J G;  3BHP A;  1MG1 A;  1I7F A;  1RSO A;  4MVM A;  2ZDI A;  4X1Y B;  1Q81 W;  4IHJ B;  2ZNJ A;  1AI5 A;  3HKB B;  1IBM O;  4Q20 A;  1A32 A;  5EBM C;  2UXC B;  2RQ6 A;  2QSA A;  2YXH A;  4LH7 A;  2YIC A;  4J9Z B;  1F4M A;  5CA0 B;  5IDJ A;  3FAV B;  3TXS A;  1SZT A;  1DK1 A;  2WSS G;  3QVN A;  3OMN B;  4B3S B;  1JCH A;  2ZKO A;  4IGG A;  4P9P A;  1N36 O;  3NXS A;  1SF9 A;  2PI5 A;  2WLM A;  2OIE A;  3GVM A;  5J2U A;  1QR9 A;  4XDK A;  2A9H A;  1VEW A;  4DR4 O;  3K0D A;  4YY3 O;  5KHH A;  2UXD B;  3CRM A;  1JFF A;  4LFC O;  2H3O A;  2WLK A;  1R6T A;  2DE0 X;  1S77 D;  4RUF A;  2QWP B;  3CB2 A;  1P84 F;  1Q5O A;  1GN6 A;  1BGY H;  4TWK A;  1MSD A;  1TAE A;  4DV3 O;  3FB8 C;  4WFF A;  4TT3 G;  2R72 A;  3UQ8 A;  2DOS A;  3OR7 C;  3CSX A;  5LHH A;  4FZ1 A;  1GM7 A;  1ZL8 B;  3R65 A;  1SER A;  3E8H A;  3ZHT A;  4U7O A;  3JCU Z;  2CTQ A;  4CS2 A;  2KB1 A;  1F4N A;  1VQ8 V;  2PYL A;  3HB3 B;  1EZJ A;  4JAU A;  4GT1 A;  2WLL B;  2ZIM A;  3LDE A;  4I50 A;  5EBL C;  4UVA A;  5LMU O;  2D3O W;  4JI0 O;  2WLI A;  3E8F A;  2DYS B;  2RNB A;  3P30 A;  3CC4 V;  5FLX N;  1AI6 A;  4JGS A;  5K1P A;  3BAB A;  3AK1 A;  2P4V A;  4B3R O;  1BMF G;  4NTW A;  3H1H H;  1GAX A;  4I55 A;  4JI2 O;  1NT2 B;  4NYK A;  3B09 A;  1TVK A;  3G80 A;  2IJK A;  3JAR A;  4DR1 O;  2EIN B;  4DRX A;  1BHA A;  1FYJ A;  4K8Z A;  5KHK A;  2ZIO A;  4PA4 A;  5IE9 A;  4UCO A;  1OV9 A;  3JD0 A;  3ZHQ A;  4DV4 B;  2OWO A;  1HNZ O;  4TUY B;  3R66 A;  1RFY A;  4JAV A;  4BR6 A;  1CEZ A;  3CJH B;  3SDL A;  1M90 W;  1GM9 A;  2QDO A;  2EJR A;  2GTA A;  4FLZ A;  3W7T A;  4LWS A;  4PI2 A;  1NTZ H;  2XND G;  4UFZ A;  4H13 B;  1ZTE A;  3ICX A;  5GON A;  3OUS A;  1HNW O;  3L70 H;  3L71 H;  2OCC B;  5B1N A;  1AIL A;  4X20 B;  4QNH B;  1K92 A;  4PDV A;  4PEL A;  3O9O A;  1KBH A;  1NU1 H;  3D8C A;  1F7Y A;  1NZ6 A;  1U96 A;  3FB6 C;  2JGD A;  4I7Z B;  5DEC A;  3UO2 A;  1BT8 A;  4FLU A;  3AK2 A;  2Y0P A;  2PY5 A;  4UVB A;  1N34 O;  4K0K B;  4TQF A;  2QWQ B;  1Q82 W;  4JV5 B;  4AIL C;  3OW2 U;  1HR0 B;  4RQF A;  4PA3 A;  4LH6 A;  3VOU A;  3WB1 A;  4K8X A;  2XAS A;  2EIK B;  3JD1 A;  1FPO A;  4CS4 A;  1H38 A;  5B1B C;  3JAT A;  4JI8 O;  2JVD A;  3RYC B;  2UUB B;  4NXN B;  1BL8 A;  2QKC A;  1ROP A;  2NR5 A;  2BTO A;  4B7K A;  3CCV V;  3F7Y C;  4AHC A;  5H5N A;  1HP8 A;  3H9V A;  1FS0 G;  2F4V B;  4OX9 O;  3JAW A;  4YJ3 B;  3BVO A;  2F95 B;  2WA4 A;  1XI1 A;  4JI4 B;  1FJG B;  4IT5 A;  3WG7 B;  2PUS A;  3SYQ A;  2KQX A;  2VQE B;  1M57 C;  4DV5 O;  2UXB B;  2KG7 A;  4FFB A;  2Q0O C;  4RAI A;  2RJZ A;  4IIJ B;  3WFV A;  4N23 A;  2OYQ A;  2IBZ H;  2V1D A;  3D36 A;  4D7T A;  3F5W C;  4ZI7 A;  2ETN A;  3FD9 A;  2EIL B;  5JCO C;  1THZ A;  4QIW F;  4JTA B;  1VF6 A;  4CC5 A;  5C8Y B;  4UVC A;  3RYH A;  3X2Q B;  4GX1 A;  3VQV A;  5JWP A;  4G28 B;  2F1M A;  3J81 N;  1EBO A;  4ICG A;  1FXK C;  3ASN B;  1M93 A;  1SQB H;  2ZD9 A;  4JYB A;  3AG1 B;  4R7C A;  4MTF A;  4F4L A;  3AG2 B;  1LUV A;  3OTO B;  2FB5 A;  5KA6 A;  1KKC A;  1K4D C;  3T4Z A;  4YJ2 A;  4PI0 A;  3E2E A;  1Z2G A;  1WP7 A;  1D2D A;  2XAJ A;  5LGN A;  4FJC C;  2DYR C;  4X1K A;  4DV2 O;  4WFH A;  5LP6 A;  4FLW A;  4LF9 B;  5IJ0 A;  2VQF O;  3AG4 C;  4YIP A;  1FFX B;  1RPO A;  1I94 O;  4MVO A;  3T1H B;  3JAL A;  5TIS Z;  4U3F H;  1XL4 A;  1PL4 A;  4O4I A;  2HJD A;  3OD4 A;  2JS3 A;  2QEX V;  4BAY A;  2QGN A;  2YUA A;  4CZZ A;  4I4T B;  5FNV B;  1SRY A;  4UCT A;  2Y69 C;  4FK5 C;  4UCS A;  4IL6 Z;  4EFB A;  4FM2 A;  4DUZ B;  2XAG A;  4YIO A;  4JYA B;  2JJ1 G;  2Y4U A;  3W7U A;  1Q6I A;  4QGP A;  3SPG A;  5ITZ B;  1CP9 A;  4UXN A;  3RW0 A;  4R8C A;  4B3S O;  4B3M B;  4DV1 O;  3JYC A;  3I56 V;  1Y76 A;  4OGQ B;  3APO A;  4JZG A;  4E4E A;  5IYC O;  1KEC A;  1TUB A;  4PDM A;  1GO3 F;  2UUC B;  1R3J C;  1BCC H;  2ILM A;  2A06 H;  3PJS K;  3ZX6 A;  5IWA B;  4YHH O;  2UXD O;  4MTG A;  2CTP A;  5CA1 A;  5J9P C;  4DV7 B;  1WPX A;  1KYO F;  2Q6A A;  3MHH C;  1SQX H;  2EX3 A;  3M99 B;  4LNU B;  2XTA A;  4MSW C;  1R73 A;  5KLV H;  5F2V O;  4QPJ A;  3HKE B;  3KKY A;  1VIB A;  3OUF A;  4X9Q A;  2UU9 B;  1JOY A;  2GTS A;  1TGO A;  5CMU A;  5C93 A;  5LOV A;  3EFF K;  5KAF Z;  4HYO A;  4JI7 O;  1GTO A;  3KCX A;  4GX5 A;  3G67 A;  3N2K B;  5CN0 A;  3ZMU A;  3EHB B;  5E1A C;  1GKF A;  1IDS A;  1N33 B;  4W4K A;  3M8A A;  4QE7 A;  2YI9 A;  4DK0 A;  4X64 B;  1N0J A;  3RVY A;  1L8D A;  1UPG A;  1FKA O;  5D5Q A;  2IJJ A;  1N32 O;  4J7J A;  2IU0 A;  2YS8 A;  3A8T A;  1URF A;  3DGE A;  1K3E A;  1NKD A;  3H1I H;  3E22 A;  2AW9 A;  2AZ0 A;  3W7X A;  2HKO A;  1NTM H;  5IT9 N;  2WLL A;  4U7N A;  1SQG A;  2CTW A;  3FB7 C;  3RN4 A;  5L3E A;  3GWK C;  1XDC A;  4NR1 A;  1GM8 A;  1MMM A;  2N04 A;  3G71 V;  4RWU A;  3CCJ V;  1L0L H;  2CK3 G;  4JI5 B;  1G6U A;  2IJH A;  4ZIB A;  4O2A A;  1W0K G;  1GMG A;  1D5N A;  2EZP A;  2P6J A;  5K1X A;  3X2Q C;  3OEE G;  4DV4 O;  4LP8 A;  1HDJ A;  3L73 H;  4HZ3 A;  4NXM B;  2E3C A;  4TV9 B;  1CPY A;  3BEH A;  4ASU G;  4DUY B;  2GV9 A;  4PHZ A;  4TSF G;  1S72 V;  4X8A A;  1YHQ V;  3RYI B;  5KHJ A;  5LGU A;  3FX7 A;  2ADQ B;  4TUY A;  2ZQM A;  1VQ5 V;  3MHS C;  1NS1 A;  1XHZ A;  4MTO A;  4TV8 B;  1IZ3 A;  3O65 A;  3ZN0 A;  2JEU A;  2C2A A;  2EBO A;  1E1Q G;  1EN4 A;  5JH7 B;  2G38 A;  2YXL A;  4JI6 B;  4PJ0 Z;  3D3I A;  2EJ7 A;  1QLN A;  1J5E O;  4J9Y B;  4DW0 A;  2IW5 A;  3N2G B;  4K0K O;  2YC0 A;  3A0B Z;  4UCR A;  1PNM A;  5LL6 Y;  1Y74 B;  4GUN A;  5IYD O;  4I0X B;  4JV5 O;  2ADP A;  4U3J A;  4FIP C;  2HHH B;  1GN3 A;  3I5D A;  1HR0 O;  4DR5 O;  4B3T O;  3F5T A;  3U10 A;  2YIB A;  3T4D A;  3SJC C;  4ZKI A;  5JVD B;  4GKJ O;  2P06 A;  2JRI A;  1QVG U;  1GN2 A;  4KL1 A;  3ZHV A;  1VQ4 V;  2ZXW C;  1AR5 A;  5JQG B;  1I08 A;  4LFB B;  4ZOL B;  1KUQ A;  5B1B B;  3SYA A;  2B9Z A;  5EC2 C;  2WA3 A;  3BAA A;  1E1R G;  1KB9 F;  1IUR A;  5LMN B;  5EBW C;  2ZIN A;  4MS2 A;  2CGO A;  4YXW G;  3TET A;  4HBN A;  3RYF B;  5JJN B;  1QHT A;  4X88 A;  5BMV B;  4WFG A;  4PA9 A;  4LF6 O;  1FJG O;  3UKM A;  1YVW A;  2E75 B;  2JDI G;  4K35 A;  1OHH G;  1PD3 A;  4CH6 A;  2VQE O;  3DXR A;  2UXB O;  3LUT B;  3SR2 C;  1PNK A;  1SQV H;  4X62 B;  3JAS B;  3IC7 A;  5BY1 A;  1XMO O;  1M57 B;  4JTD B;  1NH2 D;  1IBL B;  1B6Q A;  2EIJ C;  2IH3 C;  3B2E E;  2CAZ C;  3VQW A;  1AR1 B;  3LSQ A;  4DR7 B;  1R1B A;  4WBN B;  1FXV A;  3K57 A;  1Q3E A;  2Q67 A;  1QNM A;  2W6I G;  3SJB C;  3OFN G;  4IIJ A;  1JVM A;  4PV1 B;  4MVR A;  1WNS A;  2BOC C;  2F66 C;  4Z2W A;  1EN5 A;  1KP2 A;  1O9H A;  3M7M X;  4BIO A;  3S3W A;  3OTF A;  1SQQ H;  2ARH A;  2DWD C;  4F6R A;  5IJ9 A;  4I5S A;  2K9P A;  3KCY A;  2YI8 A;  2QM8 A;  1YCI A;  3ZIA G;  1VQO V;  1AVM A;  1Q6H A;  2Y48 A;  4BWA A;  3UT5 A;  3E83 A;  1XL6 A;  3K08 A;  1FXK B;  3OTO O;  3ZCC A;  1MSW D;  1Q6U A;  3B8M A;  3E89 A;  5EZY B;  1SZX A;  2ODM A;  3IJ4 A;  4P30 A;  5CBG A;  4LF5 O;  4LF9 O;  2BSK A; 
#chains in the Genus database with same CATH homology
 2DYR B;  5LBQ A;  3LSS A;  3TCU A;  1JPX A;  4DO2 A;  3CCQ V;  2HJF C;  5IY5 B;  1BHB A;  3AG4 B;  3WG7 B;  2OCC C;  3SYQ A;  2R9I A;  5CBH A;  5CBF A;  3CC7 V;  1M57 C;  3OGC C;  4PA6 A;  2UXX A;  2ATK C;  3CCE V;  1DLB A;  4RAI A;  4Z1M G;  2OTL V;  2XOK G;  4BIU A;  4KUM A;  1S76 D;  3WFV A;  4N23 A;  1M56 C;  2V1D A;  1M9N A;  4MVS A;  4G2K A;  1TUE B;  3D36 A;  1Y4M A;  3F5W C;  2W0F C;  2HFE C;  1QLE C;  1NR1 A;  5B1A B;  1VQL V;  2WLJ A;  3CXC U;  2EIL B;  5FL7 G;  1S0V A;  3ETE A;  3AG3 C;  3SJQ C;  3CD6 V;  1THZ A;  4QIW F;  4JTA B;  1RM1 C;  1PNL A;  1H2G A;  1SES A;  2Y69 B;  3OE7 G;  4UVC A;  2HVJ C;  2JJ2 G;  3X2Q B;  1E79 G;  2WLH A;  2EIM B;  4GX1 A;  1JX9 A;  3CCM V;  1OCZ B;  4G28 B;  3STL C;  4QJF B;  2QTO A;  3MD0 A;  3CC2 V;  1R3L C;  1EBO A;  2NNU A;  3QO7 A;  3B8N A;  3ZRW B;  5DN6 G;  2EIK C;  1FXK A;  1FXK C;  2JEX A;  3ASN B;  3ZRX A;  3CCS V;  2ZD9 A;  4JYB A;  3AG1 B;  4R7C A;  3T2M A;  4MTF A;  4F4L A;  1K5Q A;  3AG2 B;  3JD4 A;  3ABK B;  1ZWI C;  3ETG A;  2ITC C;  5KA6 A;  4LCU C;  2A0L A;  3ZN1 A;  1K4D C;  1YJ9 V;  3T4Z A;  3CCU V;  5L3B A;  4LC1 A;  3E2E A;  2XAJ A;  1OCO B;  3CCL V;  5LGN A;  4FJC C;  3LDC A;  2Q68 A;  4DXW A;  2DYR C;  5L3C A;  1W2B U;  4WFH A;  3OR6 C;  5IY5 C;  3K03 A;  3AG4 C;  5GW7 A;  1RPO A;  3WG7 C;  2QA4 V;  4MVO A;  4PA7 A;  2WAM A;  5H6Q A;  3K79 A;  3ABL B;  3GB7 C;  3FYE B;  1XL4 A;  4BIZ A;  3JD2 A;  1PL0 A;  1S5H C;  3QNE A;  3I55 V;  4H37 A;  2QEX V;  4BAY A;  1MOF A;  1QBZ A;  1DTO A;  4LBE C;  3ZRV A;  2X7R B;  1NQT A;  3ETD A;  5KUK A;  3F7V C;  5B1A C;  1VQP V;  4CZZ A;  2EIL C;  5B1O A;  2AHY A;  2Z5U A;  3T1C A;  1SRY A;  1VQK V;  4JPR A;  4JAS A;  2Y69 C;  1QVF U;  1K8A W;  4FK5 C;  2EIM C;  1K34 A;  1K33 A;  1OCZ C;  1I5X A;  1PKX A;  2XAG A;  3ZMV A;  1AI4 A;  1F23 A;  1G8M A;  1VQ7 V;  1VQ6 V;  3SPC A;  2R9R B;  2JJ1 G;  2LFR A;  1R3I C;  1L1F A;  1ENV A;  3W7U A;  1H8H G;  4GX2 A;  3ABM C;  3SPG A;  4CBC A;  3ZRW A;  5KA5 A;  1KD1 W;  5LHG A;  1CP9 A;  3ASN C;  1OZ0 A;  1YI2 V;  1YIJ V;  2QM7 A;  3AG1 C;  1RPR A;  4UXN A;  5DM6 V;  3AG2 C;  2HG5 C;  3ABK C;  3ABU A;  1Q7Y W;  3RW0 A;  2DWE C;  3ASO B;  4R8C A;  1QCE A;  4RO2 A;  3JYC A;  3VBB A;  3E8B A;  4MVU A;  3I56 V;  1OCC B;  2NLJ C;  3K0G A;  1OCO C;  5IYC O;  1KEC A;  3E86 A;  1K7D A;  4PDM A;  1GO3 F;  4R50 A;  5H9C A;  2MK3 A;  3E35 A;  1R3J C;  2IJI A;  3BY6 A;  3OAA G;  4XDL A;  4JYC A;  1K5S A;  2M7W A;  3PJS K;  4UV8 A;  2DW4 A;  1VQN V;  1WLE A;  1AJQ A;  3K9A A;  3FKS G;  4MTG A;  2A79 B;  3H01 A;  3SPI A;  5J9P C;  1WPX A;  4P9O A;  2Q6A A;  4PDR A;  3MHH C;  5CA3 A;  3HPL C;  3LNM B;  2V7Q G;  1P7B A;  4WFE A;  3M99 B;  1Q86 W;  2YEV B;  4QPK A;  3RBZ A;  4P2Z A;  4MSW C;  3SYC A;  1R73 A;  4JF3 A;  3OEH G;  4QPJ A;  2LP7 A;  2W6J G;  4GX0 A;  4N21 A;  3OUF A;  1MG1 A;  3ZJZ A;  1JOY A;  2GSM B;  2WLN A;  5BZB A;  5CMU A;  5C93 A;  1OCR B;  1NH2 B;  4MVM A;  2QE7 G;  3EFF K;  2ZDI A;  4HYO A;  1GTO A;  1Q81 W;  1AI7 A;  2H94 A;  4GX5 A;  3KG2 A;  3SPJ A;  1YJW V;  3ZMS A;  2X6A A;  1AI5 A;  5CN0 A;  3ZMU A;  2AHZ A;  3EHB B;  5E1A C;  5B3S B;  1GKF A;  5KUM A;  2LFS A;  4Q20 A;  5EBM C;  5L3G A;  3IGA C;  2OT5 A;  3UM7 A;  4QE7 A;  2XAQ A;  2Q69 A;  3TK1 A;  1NJI W;  3RVY A;  4J9Z B;  1EFR G;  1F4M A;  2IJJ A;  3ASO C;  2K1E A;  2WPD G;  1V55 B;  2IU0 A;  5IDJ A;  1SZT A;  4ZBM A;  4RUE A;  1JJ2 U;  1OCC C;  2IU3 A;  2WSS G;  3OMN B;  2WLI B;  3DGE A;  2XAH A;  4KP4 A;  1K3E A;  1NKD A;  1JCH A;  1V54 B;  1YTF D;  4HAM A;  4MTX A;  2P67 A;  3W7X A;  2HKO A;  2WLL A;  4U7N A;  5H6R A;  3K3W A;  4P9P A;  1K97 A;  1R3K C;  2H8P C;  2X6C A;  3B77 A;  3NXS A;  2PI5 A;  3FB7 C;  2WLM A;  1AJN A;  1QR9 A;  2DQ3 A;  4XBF A;  5L3E A;  4UUJ C;  4XDK A;  2A9H A;  1K4C C;  1GM8 A;  1H8E G;  3K0D A;  2B5U A;  3G71 V;  3CCJ V;  4QE9 A;  5HFL A;  2CK3 G;  2XAF A;  2IJH A;  1NBM G;  3A0R A;  1W0K G;  2WLK A;  1GMG A;  2YEV A;  1QLE B;  2EZP A;  3IFX A;  2P6J A;  5L3D A;  4RUF A;  3X2Q C;  1VQ9 V;  1S77 D;  2ZXW B;  3OEE G;  3RVZ A;  4LP8 A;  4L87 A;  4HZ3 A;  4TWK A;  3QO5 A;  1QR8 A;  1CPY A;  1ORQ C;  3E8G A;  3BEH A;  3FB8 C;  3JCZ A;  4MVZ A;  4MW3 A;  4TT3 G;  4WFF A;  2GHY A;  4ASU G;  3CMA V;  4WFA V;  3ML0 A;  4JTC B;  3OR7 C;  1R6K A;  1YIT V;  2ZR2 A;  5LHH A;  1GM7 A;  4TSF G;  3SYP A;  1S72 V;  4X8A A;  1YHQ V;  3OMI B;  1K9M W;  3R65 A;  1SER A;  3E8H A;  5LGU A;  3LDD A;  4U7O A;  5B3S C;  1M1K W;  2ZQM A;  3DTU B;  1VQ5 V;  2KB1 A;  2HR3 A;  3MHS C;  1KC8 W;  4EKW A;  1F4N A;  1VQ8 V;  1JQ0 A;  4MTO A;  1IXM A;  3HB3 B;  2HLD G;  1EZJ A;  1Y66 A;  1MAB G;  3ABT A;  2JEU A;  4JAU A;  3ZN0 A;  4GT1 A;  2WLL B;  2C2A A;  2EBO A;  4XDJ A;  1V55 C;  3LDE A;  2HVK C;  2JIZ G;  2F43 G;  4KFM A;  2P7T C;  5EBL C;  1E1Q G;  4UVA A;  2X0L A;  2D3O W;  1COW G;  2WLI A;  3E8F A;  2DYS B;  3QO8 A;  1LNQ A;  1V54 C;  3P30 A;  3CC4 V;  3ABL C;  1YJN V;  3D3I A;  1AI6 A;  1QLN A;  2EIJ B;  4J9Y B;  3G4S V;  4JGS A;  1NVP D;  5L3F A;  3CCR V;  4RQE A;  2IW5 A;  1PNM A;  1W0J G;  3SYO A;  5IYD O;  4FIP C;  1BMF G;  1HWY A;  3ZMZ A;  4MVQ A;  3OM3 B;  5HFM A;  1FXH A;  1F51 A;  4FPP A;  2IH1 C;  2JK5 C;  3FB5 C;  3T4D A;  4ZKI A;  1S3J A;  4MW8 A;  2IJK A;  4PDL A;  3SPH A;  1J95 A;  1QVG U;  4H33 A;  2EIN B;  3P32 A;  4UV9 A;  1VQ4 V;  2ZXW C;  1BHA A;  1SET A;  3STZ C;  1KQS U;  2ZDI C;  3CYO A;  3K04 A;  1N8R W;  5LGT A;  4PA4 A;  4I9W A;  3JD0 A;  3K06 A;  1P4R A;  5B1B B;  3CPW U;  2ZR3 A;  3FYI B;  3SYA A;  1K73 W;  5EC2 C;  3ZMT A;  1YTF B;  1NR7 A;  1E1R G;  2B1I A;  1AJP A;  2PI4 A;  3ABM B;  5EBW C;  2YSU B;  5IYB O;  4MS2 A;  4JAV A;  1CEZ A;  4YXW G;  3TET A;  1M90 W;  1GM9 A;  1KP3 A;  2EJR A;  3W7S A;  3W7T A;  4X88 A;  4WFG A;  4PA9 A;  1G4Y B;  3UKM A;  2XND G;  4X89 A;  3CME V;  2JDI G;  1OHH G;  4R6Z A;  1PD3 A;  4WCE V;  3OUS A;  2OCC B;  3LUT B;  5B1N A;  1PNK A;  4MT8 A;  5LHI A;  4BW5 A;  4QNH B;  4FMT A;  1K92 A;  1GK9 A;  3ZRS A;  4PDV A;  3IC7 A;  4PEL A;  1M57 B;  4JTD B;  4OXS A;  1NH2 D;  2DYS C;  2QKS A;  4G27 B;  1B6Q A;  3GWO A;  2X6B A;  5EK0 A;  2EIJ C;  2IH3 C;  1FFT B;  2FTK A;  1M56 B;  3FB6 C;  1AR1 B;  3LSQ A;  1FXV A;  4E2L A;  2Q67 A;  4UVB A;  2W6I G;  3AG3 B;  1RM1 B;  4WF9 V;  3OFN G;  1Q82 W;  1JVM A;  1DF5 A;  4MVR A;  2BOC C;  1ARO P;  3CP1 A;  1KP2 A;  2Z3Y A;  3AEI A;  2ITD C;  3OW2 U;  1KKD A;  3JD3 A;  4RQF A;  4PA3 A;  2DWD C;  2EIN C;  4I5S A;  1OCR C;  2QM8 A;  3VOU A;  2OTJ V;  3ZIA G;  1VQO V;  2Y48 A;  2XAS A;  4GCZ A;  2EIK B;  2EZO A;  3JD1 A;  3E83 A;  1XL6 A;  1R6N A;  1FXK B;  3K08 A;  3W7W A;  1VQM V;  1H38 A;  5B1B C;  3ZCC A;  4WFB V;  2B1G A;  1MSW D;  2DQ0 A;  3B8M A;  3E89 A;  1I5Y A;  2UXN A;  1BL8 A;  1ROP A;  3G6E V;  3CCV V;  3F7Y C;  3OMA B;  1NVP B;  1UJW B;  2WWW A;  5EC1 C;  4P30 A;  1FS0 G;  5CBG A;  2BOB C;  1DF4 A;  1YSC A;  2P90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...