3OR6C

On the structural basis of modal gating behavior in k+channels - e71q
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVQTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or6C00
1ZWIC 3E8BA 5B1BC 3OR6C 4QE7A 4EKWA 3K0GA 3SYQA 4WFEA 1K4CC 2WLKA 3IFXA 4GX1A 3T2MA 4MTOA 3OUFA 2EIKC 4F4LA 4X88A 3E86A 2Q67A 3SPGA 1S5HC 3BEHA 3LDEA 3ZRSA 2IH1C 3R65A 3SPHA 3UM7A 4J9YB 3SYCA 5KUMA 4MSWC 3EFFK 3FB6C 2QKSA 3K06A 4ZBMA 1JVMA 5EC2C 4CBCA 2Y69C 3TCUA 2ITCC 3K08A 4MW8A 5BZBA 2ZXWC 5EBMC 5E1AC 4XDLA 3PJSK 4GX0A 4H37A 4RUFA 4XDJA 2EIMC 3HPLC 2Q68A 1OCRC 4GX2A 2X6BA 4I9WA 1ORQC 2JK5C 4QE9A 4X8AA 2WLNA 1R3IC 2H8PC 4KFMA 2QTOA 4TWKA 4R6ZA 4DXWA 1OCOC 3ASOC 4QNHB 2EIJC 2HVKC 3ASNC 2P7TC 2R9RB 3F5WC 4MVMA 3STLC 3FB5C 3KG2A 3RVYA 4MTFA 4G28B 4LBEC 4PA4A 3LDDA 4R7CA 3E89A 4JTAB 2DYSC 2Q6AA 1XL4A 2EILC 3K04A 4G27B 4MW3A 3OUSA 3SPJA 5EC1C 3E8HA 2A79B 3E8FA 3TETA 3F7VC 4RO2A 2DWDC 4UUJC 4X89A 5EBWC 3SPCA 4P9OA 2DYRC 5J9PC 2WLIA 3OGCC 1XL6A 4P30A 4WFFA 3SYPA 1M56C 1J95A 5IY5C 4MVOA 1R3LC 4J9ZB 4PA7A 4PDMA 4PDLA 4H33A 2NLJC 1QLEC 2ZD9A 3FB7C 3LDCA 5B1AC 3VOUA 5B3SC 1K4DC 3LUTB 3RW0A 2W0FC 2Q69A 1R3KC 3SYAA 4R8CA 4PA6A 5CBHA 2KB1A 4WFHA 3K0DA 4OXSA 3RBZA 4MVQA 2ATKC 2WLIB 3LNMB 4MS2A 2OCCC 1OCZC 2BOBC 2WLMA 4PA3A 4R50A 4RAIA 4PA9A 3AG4C 1P7BA 1R3JC 2BOCC 2WLHA 3AG1C 3GB7C 4PDVA 3STZC 2WLLA 3AG2C 2HJFC 1M57C 2HFEC 3UKMA 2HVJC 5CBGA 5CBFA 1V55C 2AHYA 2DWEC 3SPIA 3AG3C 4MVZA 2HG5C 4JTCB 2X6AA 3F7YC 4MVSA 3T4ZA 1V54C 3ABKC 2A9HA 3K03A 4GX5A 3T4DA 2WLJA 3RVZA 1LNQA 3ABMC 3FB8C 4HZ3A 4MVUA 5EK0A 2A0LA 4LCUC 2ITDC 3WG7C 2WLLB 2X6CA 4MVRA 3ZJZA 1G4YB 5KUKA 3SYOA 3JYCA 3ABLC 4P2ZA 3X2QC 2IH3C 4WFGA 1KKDA 5EBLC 2EINC 4MTGA 3IGAC 2YEVA 3E8GA 4PDRA 2K1EA 4XDKA 3T1CA 4BW5A 1OCCC 4HYOA 4JTDB 4LP8A 3E83A 3OR7C 4RUEA 4P9PA 2AHZA 1BL8A 3SJQC
chains in the Genus database with same CATH superfamily
3SDLA 4O4IB 1K5SA 1IDSA 4FLVA 2YXLA 3CCUV 5GW7A 1S5HC 5EZYB 1UFIA 1H2LA 4K0KB 4YXWG 1Q7YW 4ZI7B 4ZBMA 4CBCA 5CN0A 1ZLZA 1HP8A 1N33O 2JEUA 1VF7A 1W59A 3JD0A 2RMKB 1YTFD 1EZVH 2OTLV 1NT2B 4LNUA 4CZZA 4LFAB 2IJIA 3O9OA 3P3NA 1RSOB 1SQFA 1YF2A 4OPHA 2EILC 3K04A 4NXMB 3TETA 1HNXB 4I9QA 5IJ0A 3F7VC 1Q8IA 3G80A 3N2KB 4FLXA 1COWG 2WA4A 4O2AA 1Y66A 2EJ7A 4RWUA 4PA7A 2BTQB 5LP6B 2W6JG 1XNRB 4TV9A 3VOUA 2A3QA 5J2UB 3RW0A 1R3KC 5BR8B 3OFNG 1M4UA 1QCEA 1BMFG 3H1JH 2IBZH 5CA0B 1OCZC 2WLMA 3ZRWB 4TV8A 3CEIA 5H5NA 2Q8VA 2YIBD 4JV5O 1QVGU 3B8NA 5JH7B 4PV1B 2PY5A 1PD3A 1NTZH 5LGUA 4DRXB 5CA1A 1J5EB 1YCIA 4X1KA 4JGSA 4HZ3A 4MVUA 3M99B 4UCOA 3G6BA 3FYEB 2XTAA 5FL7G 4JAAA 2GUZB 2JGUA 3I56V 2DOSA 4FIPC 1YSCA 1QR8A 4MTGA 4X1IA 2YEVA 1E1RG 2ZKOA 1PP9H 4AQYO 3K5LA 4ZOLB 1NH2B 4LC1A 3SJQC 3OR6C 5A2QN 3VQYA 4F4LA 4KP4A 3OMNB 2CTRA 3AK1A 1IBKB 2HKOA 4YIPA 4LFCO 4MSWC 3CJHB 1AB3A 4JI6B 2ITCC 2RN9A 4CS3A 4QGPA 4LF9O 2UUCO 1JR9A 4QPKA 1YI2V 1R6KA 2JGDB 5IDJA 1YITV 2UU9O 5KAIZ 4FFBB 1OHHG 4DR5O 2ARHA 3RVYA 3CS5A 2QTSA 2KQXA 3QO5A 3P30A 4FMTA 4IYIA 5IY5C 2ZXWB 2M6YA 1LUWA 1BT8A 3LDCA 5KHKA 1OCRB 2E74B 2YIBA 1BHAA 4GYCB 2DJVA 2XAHA 4TQDA 4JYCA 2UXDB 3LNMB 2PI4A 5KX5B 3NR7A 3AG2C 3D36C 5DN6G 2AZ2A 4F6EA 1GRJA 3SPIA 2P67A 3ETDA 2XAGA 1Y74B 3U10A 1R73A 1EFRG 3DC5A 1F51A 3FB8C 4I7ZB 4G2KA 3EHBB 1NTMH 1RM1C 4D7TA 2ZE5A 1ROPA 1US6A 3WG7B 1URFA 4GLXA 4BAYA 1FXVA 2P90A 3JD4A 4LH7A 1FPOA 1XOUA 2VWKA 4BW9A 3CCSV 5ITZB 4E4EA 4JI8B 1KUQA 3IFXA 3T2MA 2EIKC 1FKAO 1Y76B 1FFXB 3S3WA 1IBMB 3X2QB 4B3MB 4XDLA 3K59A 3A2FA 1HNZB 2RQ6A 2WPDG 3ASOC 4MTFA 1DF4A 4B3RO 3HKBA 3CHXA 4LF6O 2RNBA 3E8HA 4IIJA 3P3PA 2YSUB 4UUJC 3HKDA 3BY6A 4NTXA 2LW7A 5LXTA 4KHPO 5FNVA 5A9GA 4LFBB 3AG7A 5LOVB 3I5DA 5JJEB 1WAZA 1S5JA 4IGGA 2QR4A 4YY3B 3SYAA 2R72A 3JAKB 4KL1A 2Z3YA 2VQFB 3A0HZ 2N04A 4X65B 1LR1A 3EXAA 2CK3G 2ZM6O 4B7KA 3AG4C 1P7BA 1TUBB 2WLLA 1VQPV 4DUZO 1H2MA 1AROP 1V55C 5IT9N 2BTOA 5KHJA 3ICXA 2V4DA 4DV0B 3APQA 2ZCEA 1GAXA 5KHIA 3ZHQA 1VQOV 3CSXA 4O4IA 2PGGA 1ZTEA 5KUKA 4PJ0Z 1EBOA 2XOKG 4JYAB 1HR0O 5B1OA 1SS3A 5EZYA 2QM4A 3E8GA 1OCCC 4NR1A 4ZI7A 1Q6UA 1FXKB 1IX9A 2YXHA 4F6RB 1MZEA 2CTWA 2CDYA 4NTYA 1PNMA 1GKFA 1YEWA 3WFVA 1SKVA 1K97A 3ABKB 3RYFB 2KKWA 3BEHA 4I50B 3SPHA 4J9YB 2E5LB 1RPRA 3FB6C 1N32O 2AW9A 1RSOA 3DXRB 2AZ0A 1IURA 1TAEA 2QWOB 2EINB 2IJKA 1JJ2U 4XDJA 1FXHA 3N2KA 1XMOB 2B9ZA 4Z1VA 4ASUG 4X8AA 4WFBV 4JI8O 3OTOB 4FM2A 2RCVA 2BTQA 5LP6A 2YS8A 2PTMA 5LMUB 3JSNA 5J2UA 2P5OA 1H2KA 2F23A 2CTPA 1CP9A 5CA0A 3BFRA 2ODMA 1B6QA 3ZRWA 1MA1A 2QM8A 4D7SA 4JI4O 4LR3A 5JH7A 2Q4PA 1XNQB 5H6QA 1PKXA 3QNEA 2LW1A 4DR6B 1NR1A 4DV7O 1I94O 2GUZA 1CXZB 4MVZA 5IWAO 3CCLV 2A9HA 3K3WA 3T4DA 4ZOLA 3OEHG 2GDSA 2VS0A 3ZHVA 1YXBA 4JPRA 3TK1A 3CRRA 1QR9A 2YUAA 2F1MA 1VP7A 2Q7HA 1MSDA 2N74A 5B5EZ 2OCHA 3CJHA 1BL8A 1TUEB 1AVMA 4J7ZA 3ZHSA 1ZX3A 5IYDO 1QLNA 3AG3B 4GX1A 5KA6A 4DV0O 1EM1A 2C2AA 2O57A 1AJPA 3E86A 4LWSB 4O4JB 2JGDA 2B5UA 3IJ4A 4FFBA 4JYAO 1QVFU 1N8RW 3K5NA 3JALB 4B3TB 1MZFA 1N33B 1NI8A 5E1AC 2F66C 3JCUZ 4EFBA 2FYUH 1VQ4V 5B1BB 4KUMA 2EIJC 2X0LA 4RQFA 4O4LB 3K5MA 4PA4A 1FFTB 2Q6AA 1BSMA 3ZS8C 5F2VO 4MW3A 4Q6GA 2E5LO 4NXNO 1Y67A 1AI4A 3SJAC 5KX5A 4UVCA 2FMLA 4RQEA 3MD0A 2JS3A 3LSUA 1VQ6V 4IYHA 2F43G 1WA8B 1OCOB 1Y74A 2IU3A 3RBZA 2ZIOA 1WPXA 1S0VA 2DYSB 3CXHF 3AG1C 2WLHA 3ETEA 3STZC 4HAMA 1AI6A 1AR4A 4JI3O 2UUBB 4K35A 2QWPB 1ZUQA 2EZOA 2P06A 1QQCA 1V54C 4FJCC 4O2BB 2ZDIA 5LHHA 5LMNO 3VQXA 5ITZA 5B1AB 4JF3A 1TA8A 2XT9A 1B3QA 2H3OA 1XNQO 3OW2U 4EB6B 4JZGA 3ZMVA 1Y76A 3QO8A 1D2DA 5JCOC 1BHBA 1FFXA 2L35A 4B08A 4J11A 4AQYB 3CE2A 1M57B 1WN7A 3J80N 3J81N 1K4CC 1K33A 3HB3B 2NNUA 1VQ5V 3SPGA 3RWRD 3LDEA 1RPOA 4LFCB 2EULA 2LQTA 3ZHUA 2JJ1G 2A06H 3SYCA 3K06A 4A5UB 1NBMG 4ZKIA 2BE3A 3ZEDA 4LF9B 2UUCB 4BWAA 1QHTA 3F5TA 2UU9B 5J2TB 5LOVA 3U11A 3ASNC 4DR5B 4AILC 2CAZC 2FKXA 2P4VA 4RO2A 2UUAO 3JAKA 2OT5A 2DYRC 3OAAG 1AR1B 5D5QA 3SYPA 4B3TO 1N0JA 2YXYA 1TUBA 4J9ZB 1HDJA 2PUSA 4H33A 2EIMB 1Q82W 2YIAA 4LF7O 4NB5A 1I5YA 3KCYA 4CC6A 3ZHRA 2Q73A 4OXSA 1M9NA 3RN4A 1E79G 1PM9A 3OGIB 4DW1A 1W0KG 5L3EA 2E76B 3CPWU 1JCHA 4EEQA 1Z5VA 4AHCA 4DV3O 3K03A 2WLJA 1FXKA 2ZT9B 3WB2A 1FAFA 1SF9A 4F6RA 2EBOA 2A0LA 4TSFG 2Z0AA 1Y6XA 1G4YB 2CGNA 2UXXA 1GO3F 1O9GA 3RYFA 4P2ZA 5KMGB 4I50A 2OCCB 2QDOA 2VQEO 1HNWO 3B09A 1VF5B 2LJ2A 4LP8A 5JQGA 3G71V 1GN4A 2UUBO 5KA5A 3DXRA 3E8BA 1R6NA 4GZRB 2JVDA 4GKJO 1NU1H 3L9DA 4FK5C 4YJ3B 4JAUA 5L3CA 3KKYA 4X88A 5LYJB 4TQFA 3LSSA 2OIGA 3W7TA 3OE7G 1Y4MA 3UT5B 3E35A 2K9PA 3ABLB 4CC5A 3JATB 3K08A 1YJWV 1SQGA 5H9CA 1P4RA 5LA6B 4I9WA 4I55B 1QBZA 2GV9A 2JDIG 3IC9A 3ABUA 1VQKV 1Q86W 4YJ2B 1G8MA 4LBEC 2JJ2G 4LH6A 4B3RB 4YHHO 4LF6B 1P7GA 3OUSA 4J10A 3SPCA 1I7FA 1DLBA 4KHPB 3OGCC 1GM9A 1B04A 4ZHQB 4X66O 1K5QA 4DV1O 1WB7A 4DR2O 3WB0A 5B3SC 3WB1A 5B66Z 2ATKC 1Q43A 4RAIA 2BOBC 2WSSG 3ZN0A 2ZM6B 3KCXA 1S72V 1GK9A 1H8HG 3OEEG 4DUZB 4DR3O 1GN6A 1M1KW 2YI9A 3RVZA 5EK0A 1CEZA 3RYHB 1KP3A 3PN1A 1HR0B 3DSQA 3SJCC 2LGQA 3GWOA 2HEPA 4LWSA 4O4JA 4UB8Z 4WFGA 5C93A 1NR7A 1QNMA 1IXMA 3IGAC 3C3SA 5H2FZ 4FZ0A 3BCCH 3ZRXA 5KAFZ 4DV5B 3D3IA 3JALA 3SJBC 1KKCA 3DC6A 4QE7A 3CC2V 2IU0A 5LHGA 1N36O 2Y48A 5JJJB 5FPOA 4N21A 2G38A 4O4LA 1N32B 2Y69C 4LF8O 4GT1A 4JI5O 1VMGA 3PJSK 4GX0A 3HPLC 2IM9A 3H01A 2X6BA 5L3BA 2E75B 1FJGO 1OV9A 3CX5F 1SRYA 3CB2A 4JTAB 2QGNA 2MK3A 1AP5A 2WAMA 5E79Z 2ETNA 4FPPA 1WA8A 1ZL8B 4IHJB 2Q7EA 1PNKA 4HBNA 4UVAA 3OM3B 4P30A 1NKDA 2DYRB 4J41A 3K5OA 3T1YO 1M56C 1R3LC 1NQTA 1SESA 1QLEC 4JI4B 1PL4A 4CS2A 3A0BZ 2CGOA 3LUTB 1F7YA 1GMGA 1IVSA 1VQLV 1TVKB 3L74H 4O2BA 2VWJA 2B1IA 1FYJA 1YHQV 2AXTZ 1R3JC 2EILB 4DK1A 4DV7B 1I94B 3UKMA 4EB6A 2UXNA 4LF4O 1L0LH 1K8AW 2DWEC 5IWAB 4JTCB 2X6AA 4MVSA 3CRMA 3ABMC 1SZTA 1IBLO 2HHHB 3AK3A 1VQ7V 3ZJZA 5L3DA 3JCZA 2YDEA 4ABMA 2E3CA 2Q7GA 1OCZB 4BW5A 3HKCB 5CMUA 3RT3C 2WA3A 3OR7C 4X9QA 1MOFA 1CPYA 3TGUH 2EJRA 3ZCCA 4I0XB 3H1HH 1XDCA 1W0JG 5J2TA 2IH1C 3R65A 4OGQB 1OJHA 3ZX6A 3ZBHA 4JZ2A 4PHZA 2Q5ZA 1JVMA 2BCCH 3HKEB 1VQMV 2CH7B 1NH2D 5BZBA 1Z5WA 3A0RA 4DV5O 4B3SB 4FFKA 2JK5C 5GTIZ 4J7KA 1B06A 3JD3A 4MVMA 3KZIZ 1WNSA 4UV8A 3LSQA 2R9AA 4AI8A 2F4VB 1VF6A 1WLEA 5IJ9B 4G27B 4QJFB 1K7DA 2JIZG 1R1BA 4NXNB 2DWDC 2ZIMA 5JWPA 4P9OA 3D8CA 4XBFA 3CMEV 4C7UA 1W2BU 2DN9A 4DO2A 3OD4A 3DGEA 1XBLA 3FB7C 3H1LH 3JAWB 1EN5A 2W0FC 1M90W 1AILA 2UXBO 4R50A 1VQ8V 3ZRVA 5H6RA 2JRIA 1YJ9V 3CCMV 5HFMA 4JI3B 1SQBH 4FVMA 4DYLA 1PPJH 5L3GA 5KMGA 3N27A 2HG5C 1AJNA 1GN2A 5IY5B 4GUNA 4FZ1A 4PELA 4DV6O 5LMNB 3B2EE 1AJQA 1JX9A 3JAMN 1THZA 3FX7A 4DRXA 1R6TA 3B8MA 4YJ3A 2QWNB 5EIBD 3JYCA 2OTJV 2ZQMA 5LYJA 1KKDA 3L73H 1KC8W 3AG2B 3E83A 2ZINA 3UT5A 2AHZA 1MNGA 3IAYA 1KYOF 3K0GA 3JATA 4U3FH 5C8YB 1PL0A 1L8DA 1SA0B 1SZXA 3P32A 1YTFB 5LA6A 4I55A 2HHHO 5JVDB 4GKKO 1RM1B 2PI5A 4YJ2A 1M93A 2QKSA 1S3JA 4OX9O 1D5NA 2QM7A 1H2SB 2Y69B 2L6LA 5LP6C 2GHYA 1X4TA 4H37A 1HW7A 5K1PA 3QG5A 4MTXA 2R9RB 3ETGA 5LGNA 4FM1A 4L8JA 4ZHQA 2PYLA 5JJNB 4E2LA 2EIKB 1XL4A 2GTSA 3QO7A 5EC1C 3E8FA 2F95B 2UUAB 3JARB 4PD4F 2KG7B 4W4LA 3Q4HB 5IYBO 2OYQA 1XL6A 4QIWF 1BGYH 2AGAA 4J80A 4MVOA 3CWBH 1M56B 4DR1O 1T5EA 4PDLA 2OWOA 4B3SO 2ZR3A 4WFAV 4LF7B 1O9HA 4UCTA 3ASOB 1WJZA 3UO3A 4WFHA 3W7XA 2WLIB 5IE9A 2F4VO 2XNDG 3RYHA 3GB7C 2RJZA 3I55V 3VBBA 1GM8A 1XI1A 4DUYO 1AI5A 3K58A 4DV3B 1BS3A 3G67A 1Q6IA 4X20B 4OPAA 4JI0O 2FL4A 4J7JA 3OT7A 2DQ0A 2IH3C 2VQEB 1HNWB 4PDRA 2R70A 3T1CA 4JI1B 3AG4B 2W0XA 4HYOA 4QPJA 1V55B 2VRZA 4GKJB 3CC4V 3JD1A 3OUFA 3QTCA 2XAFA 3ML0A 1NVPB 4DR7O 4PI0A 4EFEA 4UCVA 4DV2O 3HR0A 5EC2C 2ZXWC 1ZL8A 4IHJA 4RUFA 1OCCB 1OCRC 3FKSG 2WLNA 5IYZB 1VARA 2CE4A 4JASA 4TUYB 2HVKC 5L3FA 1F4NA 4HNAB 3STLC 4DV4O 1JA8A 1UPGA 4X62O 4YHHB 2DW4A 3CRAA 5EBWC 1SQXH 1TVKA 5KLVH 4L87A 1KQSU 5LL6Y 3D3QA 1J95A 3H9VA 1ZSPA 3CP1A 3L75H 1H2NA 4PDMA 4X66B 2ZD9A 1Q6HA 4DV1B 4DR2B 2Q0OC 2QSAA 3A8TA 1MG1A 2XAQA 3L70H 1PNLA 3CYOA 1K4DC 1SQVH 2Q69A 4JI7O 1BE3H 3W7SA 2LO1A 4MVQA 3IC7A 2Z5UA 3OMAB 4DR3B 1JJOA 4ICGA 5CBFA 3S3XA 3H1IH 3AEIA 3HKCA 3F7YC 3T4ZA 1H38A 1H8EG 2QKCA 4JI2O 4Q20A 2PF4E 5B1NA 1XMQO 1GN3A 1YVWA 4CH4A 3FAVB 4I0XA 3C90A 3UCSC 3X2QC 2CTQA 1FD9A 4W4KA 1XILA 3CRQA 1N4CA 2GBOA 3CRCA 4ZIBA 2XUMA 3HKEA 1N0NA 4I4TB 2CH7A 3SYQA 1Q81W 2P6JA 3BHPA 2D3OW 2QE7G 4DW0A 2UXCO 1N36B 1AI7A 3RFRA 4YIOA 3ZRSA 2D2CB 2KSDA 5KUMA 4LF8B 5IJ9A 2F93B 3RGBA 2Y4UA 3QF7A 4JI5B 4JI1O 1JFFB 3GVMA 1FJGB 2LP7A 4TWKA 2H8PC 1I08A 4R6ZA 2Q0AA 1VIBA 3E22B 4BR6A 3KG2A 5GONB 2Y0IA 4DR4O 1KBHA 4R7CA 3E89A 3JAWA 3H1KH 2ZE6A 5EYPB 3N2GB 1KU9A 2XASA 3BA8A 5J9PC 1A32A 3T1YB 2EX3A 1KB9F 1BQZA 2N05A 2XAJA 3ZMTA 1SQQH 2NLJC 1XQ8A 3RYCB 4J42A 1OZ0A 1JPXA 4WCEV 2QWQB 4R8CA 2EIJB 4H0LB 5CBHA 2QA4V 3K0DA 4MS2A 1TGOA 1XHZA 2IW5A 1FXKC 2HVJC 4U7OA 4TOIA 4CS4A 4LF4B 1AR5A 1DF5A 5CBGA 1YIJV 3GWKC 4FLTA 4Z1MG 4DK0A 3ABKC 3EVKA 4GX5A 1LNQA 3D36A 1IBLB 4U3JB 5C8YA 2ITDC 4K8XA 1SA0A 2X6CA 4MVRA 4LF5O 3TJTA 1SC5B 4N23A 1BZKA 5CB4B 2PYJA 2YC0A 1WP7A 1KD1W 2DMXA 1I5XA 2EINC 5JVDA 3AG1B 2Y4TA 3CCJV 1N34O 3L72H 1E1QG 4IL6Z 4EKWA 1MABG 1G6UA 2WLKA 1EN4A 1NVPD 2P4KA 1X59A 1V54B 2M7WA 2EZPA 3BVOA 3MDSA 4CH3A 2ADPA 2A7WA 4K0KO 4WBNB 5FLXN 3ZMUA 2H94A 4NKGB 3CCVV 1VQNV 4JYYA 1MMMA 2ZNJA 3G6EV 1ENVA 5EBMC 4UXNA 3U0ZA 3O65A 2JEXA 3JARA 1L0NH 2Q68A 3APOA 2KG7A 3Q4HA 1NJIW 5TISZ 1S76D 4KFMA 1R3IC 4BIUA 3M7MX 1QU7A 5K1XA 2ZNIA 4LFAO 4G28B 2BSKB 4NXMO 1HNXO 4K8ZA 2QWRB 2WLIA 2YIDA 3K57A 2W6IG 1DTOA 1XNRO 3OMIB 2Q9LA 1LUVA 1AP6A 4PA6A 5BR8O 3ASNB 4X1YB 2HR3A 4X20A 2UXBB 5IYCO 3BRCA 5LGTA 2GSMB 3ZHTA 3R66A 4B7EA 1K9MW 3MHHC 2NR5A 5KHHA 2XHBA 3CCEV 1UJWB 1KP2A 3AG3C 4MT8A 2LFSA 4DV6B 1J5EO 4X64B 3OTFA 1DK1A 2WWWA 3RYIB 3C3TA 5BMVB 4GCZA 2ZR2A 4NTWA 4XDKA 4O4HB 4JTDB 2Y0PA 5B1BC 1K3EA 3ETQA 4MTOA 2B1GA 2Q67A 1XEQA 1ZAUA 5IYZA 2P22C 1IBKO 3JASB 4GKKB 4TUYA 3FFQA 4HNAA 4OX9B 3FD9A 3TCUA 4JI6O 1YDXA 4MW8A 2ZE7A 3BA9A 3TXQA 1IZ3A 4QNHB 1OCOC 4UCUA 3AK2A 1GTOA 1NZ6A 2DYSC 3MAQA 3T1HB 3SPJA 4FLUA 1IXBA 4WFFA 4KXRA 4LNUB 4DR1B 3K9SA 2QEXV 5B1AC 3THOA 2YICA 3CXCU 5IJ0B 1M5IA 1WPBA 2UXDO 1JQ0A 2BOCC 3B77A 4O2AB 1M57C 2HFEC 3FAVA 3NXSA 4TV9B 2X7RB 4DUYB 3E2EA 5KHGA 3ABTA 3K9AA 3BPZA 2DE0X 4I4TA 4JI0B 4TV8B 3CD6V 4BIOA 5B3SB 4UV9A 1YZBA 2OIEA 1EN6A 3SYOA 3CCRV 5JQGB 4FM0A 1WP8A 1U96A 3J7AU 3ZIAG 5EBLC 1MSWD 1KMIZ 2K1EA 4U7NA 4CH5A 5CA1B 5AG2A 4NVPA 4X1KB 3B40A 5DM6V 1BCCH 1ZWIC 3SR2C 5DECA 4UB6Z 3UQ8A 4WFEA 1JFFA 1EZJA 4X64O 4DR7B 4X1IB 2YEVB 1BQ0A 4H13B 3BAAA 3E22A 4NYKA 1IBMO 4DV2B 2HP8A 5GONA 2HJDA 3UO2A 1PV0A 1NTKH 3CC7V 3JSLA 2IJHA 5EYPA 4B3MO 3N2GA 2EIMC 1U97A 4CH6A 1VF6C 4GX2A 1ORQC 2PZSA 1HNZO 2QTOA 4FLYA 4DV4B 2P7TC 3F5WC 3FB5C 2ZE8A 1Q3EA 4JYBA 4X62B 3RYCA 3CMAV 4I5SA 3LDDA 4UCRA 1K73W 4X89A 3TXSA 5GTHZ 3JD2A 2HLDG 3BABA 4LFBO 1S77D 4PI2A 4D6TH 4JAVA 4YY3O 4JI7B 3G4SV 3VQVA 1YJNV 2VQFO 4UCSA 3UM7A 2OCCC 4X65O 2V1DA 4U3JA 1SETA 4PA9A 3LNNA 3T1HO 2QJ1A 4PDVA 1GH6A 5FPRA 4BIZA 5CB4A 1HWYA 4K3AA 4H44B 3B4SA 2AHYA 1H2GA 3SGIA 4JI2B 2V7QG 4Z2WA 1QLEB 2NN4A 4LCUC 1XMQB 1P84F 3W7UA 3ABLC 1JMKC 1D5AA 3FYIB 4WBNA 1K34A 1K92A 1S5LZ 1WB8A 5JCOA 2QKAA 2ADQB 2UXCB 2RDCA 3CCQV 3ABMB 3M8AA 3EFFK 2BSKA 5HFLA 3QVNA 1XUQA 5DEDA 1XMOO 3MHSC 1RFYA 4QE9A 1NS1A 1DGSA 4DXWA 3DTUB 3ZN1A 3OTOO 1Q5OA 4WF9V 4DR4B 5LMUO 1FS0G 2FB5A 2A79B 2GTAA 1V9PA 2LGWA 4X1YA 4JV5B 4UVBA 4IT5A 4FLWA 1RP3B 2R9IA 5BY1A 3VQWA 1VQ9V 3W7WA 3HKBB 4IIJB 1F23A 3HKDB 2KB1A 5LXTB 1Z2GA 4FLZA 5EIBC 3K79A 4PA3A 5FNVB 2FTKA 1GM7A 3WU2Z 4DR6O 1I0HA 1SERA 2HJFC 1XREA 1F4MA 3RYIA 2JS5A 5D5PA 5BMVA 4UFZA 1P49A 1G1XB 2LFRA 1L1FA 1Q90D 4O4HA 5BXZA 3ZMZA 2MW2B 5LHIA 4TT3G 3ZMSA 2ILMA 2YI8A 2IJJA 3WG7C 2WLLB 4LF5B 3L71H 1JOYA 5CA3A 3JASA 2CUGA 5LBQA 1SQPH 2ZDIC 1VEWA 2DQ3A 1XHXA 1N34B 4RUEA 4P9PA 1KECA
chains in the Genus database with same CATH topology
1E1QG 1MOFA 1CPYA 1TUEB 4EKWA 1MABG 5IYDO 1QLNA 2EJRA 1K5SA 2WLKA 3AG3B 4GX1A 3ZCCA 2C2AA 5KA6A 1NVPD 1V54B 2M7WA 1AJPA 3E86A 3CCUV 5GW7A 2EZPA 1S5HC 1W0JG 2B5UA 2IH1C 3R65A 4YXWG 1Q7YW 3ZMUA 1QVFU 2H94A 1JVMA 4ZBMA 4CBCA 1N8RW 5CN0A 3CCVV 1VQNV 1VQMV 1NH2D 5BZBA 3G6EV 1ENVA 5EBMC 4UXNA 5E1AC 2JEXA 2JEUA 3A0RA 2Q68A 3JD0A 2JK5C 1NJIW 1S76D 4KFMA 1R3IC 1VQ4V 1YTFD 4BIUA 2OTLV 5B1BB 4KUMA 2EIJC 2X0LA 3JD3A 4MVMA 4RQFA 4CZZA 4UV8A 2IJIA 4G28B 3LSQA 4PA4A 1FFTB 2Q6AA 1WLEA 2EILC 3K04A 4G27B 4MW3A 4QJFB 3TETA 1K7DA 2JIZG 3F7VC 2DWDC 4P9OA 1AI4A 1COWG 4XBFA 2WLIA 3CMEV 4UVCA 1W2BU 1Y66A 2W6IG 1DTOA 4RQEA 3MD0A 4DO2A 4PA7A 2W6JG 3DGEA 3FB7C 1VQ6V 3OMIB 3VOUA 2F43G 3RW0A 2W0FC 1R3KC 1OCOB 4PA6A 1M90W 2IU3A 3ASNB 3OFNG 2HR3A 1QCEA 1BMFG 3RBZA 5IYCO 5LGTA 4R50A 1OCZC 1WPXA 2GSMB 2WLMA 3ZRWB 1VQ8V 3ZRVA 1S0VA 2DYSB 5H6RA 1K9MW 3AG1C 2WLHA 3MHHC 3ETEA 3CCMV 3STZC 5HFMA 1YJ9V 4HAMA 1AI6A 1QVGU 3B8NA 3CCEV 5L3GA 1UJWB 1KP2A 3AG3C 2HG5C 2EZOA 1PD3A 1AJNA 4MT8A 5LGUA 1V54C 2LFSA 4FJCC 4PELA 5IY5B 2ZDIA 5LHHA 4JGSA 4HZ3A 4MVUA 3M99B 5B1AB 1AJQA 4JF3A 3FYEB 1JX9A 1THZA 5FL7G 3B8MA 3OW2U 3I56V 3JYCA 3ZMVA 2WWWA 2ZQMA 3QO8A 4FIPC 4RUEA 2OTJV 1KKDA 1QR8A 4GCZA 2ZR2A 4MTGA 1KC8W 1BHBA 2YEVA 1E1RG 4XDKA 4JTDB 3AG2B 3E83A 1M57B 2AHZA 1NH2B 4LC1A 3SJQC 5B1BC 3OR6C 3K0GA 1K3EA 1PL0A 1K4CC 1K33A 3HB3B 4MTOA 3P32A 1YTFB 4F4LA 2NNUA 4KP4A 3OMNB 2B1GA 2Q67A 1VQ5V 3SPGA 3LDEA 1RPOA 2HKOA 2JJ1G 1RM1B 2PI5A 3SYCA 4MSWC 2QKSA 3K06A 1S3JA 1NBMG 4ZKIA 3TCUA 2QM7A 2ITCC 4MW8A 2Y69B 2GHYA 4H37A 4QPKA 1YI2V 1R6KA 1YITV 4QNHB 5IDJA 1OCOC 4MTXA 3ASNC 2R9RB 3ETGA 5LGNA 1OHHG 3RVYA 1GTOA 4E2LA 2EIKB 2DYSC 1XL4A 3QO5A 3QO7A 5EC1C 3SPJA 3E8FA 4RO2A 3P30A 2OT5A 4FMTA 2DYRC 3OAAG 1AR1B 5IYBO 3SYPA 1XL6A 4WFFA 4QIWF 5IY5C 4MVOA 4J9ZB 1M56B 2ZXWB 4PDLA 4H33A 2QEXV 2ZR3A 3LDCA 2EIMB 5B1AC 1OCRB 4WFAV 1Q82W 1I5YA 1BHAA 3CXCU 3ASOB 2XAHA 4JYCA 4WFHA 4OXSA 3W7XA 1M9NA 2WLIB 3LNMB 2PI4A 2XNDG 1JQ0A 2BOCC 3B77A 3GB7C 1E79G 3AG2C 1M57C 2HFEC 3NXSA 3I55V 3VBBA 1GM8A 5DN6G 1W0KG 2X7RB 5L3EA 3SPIA 3E2EA 3CPWU 1JCHA 1AI5A 2P67A 3ETDA 2XAGA 3ABTA 3K9AA 1R73A 3K03A 2WLJA 1EFRG 1FXKA 1F51A 3FB8C 2EBOA 2A0LA 4G2KA 3EHBB 4TSFG 1RM1C 3CD6V 5B3SB 4UV9A 1G4YB 1ROPA 3WG7B 2UXXA 1GO3F 3SYOA 3CCRV 4BAYA 4P2ZA 2DQ0A 2IH3C 3ZIAG 5EBLC 1FXVA 2P90A 2OCCB 1MSWD 4PDRA 2K1EA 3JD4A 4U7NA 3T1CA 3AG4B 4HYOA 4LP8A 4QPJA 5DM6V 3G71V 5KA5A 3CCSV 1ZWIC 3E8BA 1R6NA 4WFEA 1V55B 3IFXA 3T2MA 3CC4V 3JD1A 4FK5C 3OUFA 2EIKC 1EZJA 4JAUA 5L3CA 4X88A 2XAFA 3ML0A 1NVPB 2YEVB 3LSSA 3W7TA 3OE7G 1Y4MA 3E35A 5EC2C 3CC7V 3ABLB 3X2QB 3K08A 2IJHA 2ZXWC 1YJWV 4XDLA 4RUFA 2EIMC 5H9CA 1OCCB 1OCRC 4GX2A 1P4RA 4I9WA 1ORQC 3FKSG 2WLNA 1QBZA 2JDIG 2QTOA 2WPDG 3ASOC 4JASA 3ABUA 2HVKC 5L3FA 3CCJV 1VQKV 1F4NA 2P7TC 3F5WC 3STLC 1Q86W 3FB5C 4MTFA 1G8MA 1DF4A 2JJ2G 4JYBA 4LBEC 3CMAV 4I5SA 3LDDA 3OUSA 2DW4A 3E8HA 1K73W 2YSUB 3SPCA 4UUJC 4X89A 5EBWC 1DLBA 3BY6A 4L87A 3JD2A 1KQSU 2HLDG 3OGCC 1GM9A 1J95A 3CP1A 1S77D 4PDMA 2ZD9A 1K5QA 1MG1A 2XAQA 1PNLA 3CYOA 5B3SC 4JAVA 1K4DC 2Q69A 3SYAA 3G4SV 2Z3YA 1YJNV 3W7SA 4MVQA 2ATKC 3UM7A 2OCCC 2CK3G 2BOBC 3IC7A 2V1DA 2WSSG 4RAIA 1SETA 2Z5UA 4PA9A 3ZN0A 1GK9A 1H8HG 1P7BA 3AG4C 3OMAB 3OEEG 4PDVA 2WLLA 1VQPV 4BIZA 1HWYA 1AROP 5CBFA 1M1KW 1V55C 2AHYA 1H2GA 3AEIA 3F7YC 3T4ZA 1H38A 1H8EG 3RVZA 2V7QG 1VQOV 5EK0A 1QLEB 4Q20A 1CEZA 4LCUC 5B1NA 1KP3A 5KUKA 1EBOA 2XOKG 3W7UA 5B1OA 3ABLC 3GWOA 3X2QC 4WFGA 5C93A 1NR7A 1IXMA 3IGAC 3E8GA 3ZRXA 1S72V 1OCCC 3FYIB 1FXKB 3D3IA 1K34A 1K92A 4QE7A 3CC2V 3SYQA 2IU0A 1Q81W 2P6JA 2D3OW 1PNMA 1GKFA 3WFVA 2QE7G 1K97A 5LHGA 1AI7A 3ABKB 2Y48A 3CCQV 3BEHA 3ABMB 3ZRSA 3SPHA 4N21A 4J9YB 5KUMA 1RPRA 3EFFK 3FB6C 2Y69C 5HFLA 4GT1A 2EINB 2IJKA 1JJ2U 3PJSK 4GX0A 4XDJA 3HPLC 1FXHA 3H01A 3MHSC 2X6BA 4ASUG 5L3BA 4QE9A 2LP7A 4X8AA 4WFBV 4TWKA 2H8PC 4DXWA 3DTUB 4R6ZA 3ZN1A 3KG2A 4WF9V 1SRYA 4R7CA 3E89A 2MK3A 4JTAB 1FS0G 2WAMA 2A79B 4FPPA 2XASA 4UVBA 1CP9A 1PNKA 5J9PC 4UVAA 3OM3B 4P30A 1B6QA 1NKDA 2DYRB 2R9IA 3ZRWA 1M56C 1R3LC 1NQTA 1VQ9V 2XAJA 3ZMTA 1SESA 3W7WA 2NLJC 1QLEC 2QM8A 1OZ0A 1JPXA 4WCEV 3LUTB 1GMGA 4R8CA 2EIJB 1F23A 1VQLV 5H6QA 5CBHA 2QA4V 2KB1A 3K0DA 2B1IA 3K79A 4MS2A 4PA3A 2FTKA 1GM7A 1PKXA 3QNEA 1YHQV 1R3JC 2EILB 1SERA 2HJFC 1NR1A 2IW5A 3UKMA 1FXKC 2HVJC 4U7OA 1F4MA 2UXNA 1DF5A 5CBGA 1K8AW 2DWEC 1YIJV 4MVZA 2LFRA 4JTCB 2X6AA 1L1FA 4MVSA 4Z1MG 3CCLV 3ABKC 2A9HA 3ZMZA 5LHIA 4GX5A 3K3WA 3T4DA 1LNQA 3ABMC 3OEHG 4TT3G 3ZMSA 3D36A 1SZTA 2IJJA 2ITDC 4JPRA 3WG7C 3TK1A 2WLLB 2X6CA 4MVRA 3ZJZA 1QR9A 1VQ7V 5L3DA 3JCZA 4N23A 1JOYA 1KD1W 5CA3A 1I5XA 2EINC 1OCZB 5LBQA 4BW5A 5CMUA 2ZDIC 3AG1B 2DQ3A 3OR7C 1YSCA 4P9PA 1KECA 1BL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWI C;  3E8B A;  5B1B C;  3OR6 C;  4QE7 A;  4EKW A;  3K0G A;  3SYQ A;  4WFE A;  1K4C C;  2WLK A;  3IFX A;  4GX1 A;  3T2M A;  4MTO A;  3OUF A;  2EIK C;  4F4L A;  4X88 A;  3E86 A;  2Q67 A;  3SPG A;  1S5H C;  3BEH A;  3LDE A;  3ZRS A;  2IH1 C;  3R65 A;  3SPH A;  3UM7 A;  4J9Y B;  3SYC A;  5KUM A;  4MSW C;  3EFF K;  3FB6 C;  2QKS A;  3K06 A;  4ZBM A;  1JVM A;  5EC2 C;  4CBC A;  2Y69 C;  3TCU A;  2ITC C;  3K08 A;  4MW8 A;  5BZB A;  2ZXW C;  5EBM C;  5E1A C;  4XDL A;  3PJS K;  4GX0 A;  4H37 A;  4RUF A;  4XDJ A;  2EIM C;  3HPL C;  2Q68 A;  1OCR C;  4GX2 A;  2X6B A;  4I9W A;  1ORQ C;  2JK5 C;  4QE9 A;  4X8A A;  2WLN A;  1R3I C;  2H8P C;  4KFM A;  2QTO A;  4TWK A;  4R6Z A;  4DXW A;  1OCO C;  3ASO C;  4QNH B;  2EIJ C;  2HVK C;  3ASN C;  2P7T C;  2R9R B;  3F5W C;  4MVM A;  3STL C;  3FB5 C;  3KG2 A;  3RVY A;  4MTF A;  4G28 B;  4LBE C;  4PA4 A;  3LDD A;  4R7C A;  3E89 A;  4JTA B;  2DYS C;  2Q6A A;  1XL4 A;  2EIL C;  3K04 A;  4G27 B;  4MW3 A;  3OUS A;  3SPJ A;  5EC1 C;  3E8H A;  2A79 B;  3E8F A;  3TET A;  3F7V C;  4RO2 A;  2DWD C;  4UUJ C;  4X89 A;  5EBW C;  3SPC A;  4P9O A;  2DYR C;  5J9P C;  2WLI A;  3OGC C;  1XL6 A;  4P30 A;  4WFF A;  3SYP A;  1M56 C;  1J95 A;  5IY5 C;  4MVO A;  1R3L C;  4J9Z B;  4PA7 A;  4PDM A;  4PDL A;  4H33 A;  2NLJ C;  1QLE C;  2ZD9 A;  3FB7 C;  3LDC A;  5B1A C;  3VOU A;  5B3S C;  1K4D C;  3LUT B;  3RW0 A;  2W0F C;  2Q69 A;  1R3K C;  3SYA A;  4R8C A;  4PA6 A;  5CBH A;  2KB1 A;  4WFH A;  3K0D A;  4OXS A;  3RBZ A;  4MVQ A;  2ATK C;  2WLI B;  3LNM B;  4MS2 A;  2OCC C;  1OCZ C;  2BOB C;  2WLM A;  4PA3 A;  4R50 A;  4RAI A;  4PA9 A;  3AG4 C;  1P7B A;  1R3J C;  2BOC C;  2WLH A;  3AG1 C;  3GB7 C;  4PDV A;  3STZ C;  2WLL A;  3AG2 C;  2HJF C;  1M57 C;  2HFE C;  3UKM A;  2HVJ C;  5CBG A;  5CBF A;  1V55 C;  2AHY A;  2DWE C;  3SPI A;  3AG3 C;  4MVZ A;  2HG5 C;  4JTC B;  2X6A A;  3F7Y C;  4MVS A;  3T4Z A;  1V54 C;  3ABK C;  2A9H A;  3K03 A;  4GX5 A;  3T4D A;  2WLJ A;  3RVZ A;  1LNQ A;  3ABM C;  3FB8 C;  4HZ3 A;  4MVU A;  5EK0 A;  2A0L A;  4LCU C;  2ITD C;  3WG7 C;  2WLL B;  2X6C A;  4MVR A;  3ZJZ A;  1G4Y B;  5KUK A;  3SYO A;  3JYC A;  3ABL C;  4P2Z A;  3X2Q C;  2IH3 C;  4WFG A;  1KKD A;  5EBL C;  2EIN C;  4MTG A;  3IGA C;  2YEV A;  3E8G A;  4PDR A;  2K1E A;  4XDK A;  3T1C A;  4BW5 A;  1OCC C;  4HYO A;  4JTD B;  4LP8 A;  3E83 A;  3OR7 C;  4RUE A;  4P9P A;  2AHZ A;  1BL8 A;  3SJQ C; 
#chains in the Genus database with same CATH topology
 3SDL A;  4O4I B;  1K5S A;  1IDS A;  4FLV A;  2YXL A;  3CCU V;  5GW7 A;  1S5H C;  5EZY B;  1UFI A;  1H2L A;  4K0K B;  4YXW G;  1Q7Y W;  4ZI7 B;  4ZBM A;  4CBC A;  5CN0 A;  1ZLZ A;  1HP8 A;  1N33 O;  2JEU A;  1VF7 A;  1W59 A;  3JD0 A;  2RMK B;  1YTF D;  1EZV H;  2OTL V;  1NT2 B;  4LNU A;  4CZZ A;  4LFA B;  2IJI A;  3O9O A;  3P3N A;  1RSO B;  1SQF A;  1YF2 A;  4OPH A;  2EIL C;  3K04 A;  4NXM B;  3TET A;  1HNX B;  4I9Q A;  5IJ0 A;  3F7V C;  1Q8I A;  3G80 A;  3N2K B;  4FLX A;  1COW G;  2WA4 A;  4O2A A;  1Y66 A;  2EJ7 A;  4RWU A;  4PA7 A;  2BTQ B;  5LP6 B;  2W6J G;  1XNR B;  4TV9 A;  3VOU A;  2A3Q A;  5J2U B;  3RW0 A;  1R3K C;  5BR8 B;  3OFN G;  1M4U A;  1QCE A;  1BMF G;  3H1J H;  2IBZ H;  5CA0 B;  1OCZ C;  2WLM A;  3ZRW B;  4TV8 A;  3CEI A;  5H5N A;  2Q8V A;  2YIB D;  4JV5 O;  1QVG U;  3B8N A;  5JH7 B;  4PV1 B;  2PY5 A;  1PD3 A;  1NTZ H;  5LGU A;  4DRX B;  5CA1 A;  1J5E B;  1YCI A;  4X1K A;  4JGS A;  4HZ3 A;  4MVU A;  3M99 B;  4UCO A;  3G6B A;  3FYE B;  2XTA A;  5FL7 G;  4JAA A;  2GUZ B;  2JGU A;  3I56 V;  2DOS A;  4FIP C;  1YSC A;  1QR8 A;  4MTG A;  4X1I A;  2YEV A;  1E1R G;  2ZKO A;  1PP9 H;  4AQY O;  3K5L A;  4ZOL B;  1NH2 B;  4LC1 A;  3SJQ C;  3OR6 C;  5A2Q N;  3VQY A;  4F4L A;  4KP4 A;  3OMN B;  2CTR A;  3AK1 A;  1IBK B;  2HKO A;  4YIP A;  4LFC O;  4MSW C;  3CJH B;  1AB3 A;  4JI6 B;  2ITC C;  2RN9 A;  4CS3 A;  4QGP A;  4LF9 O;  2UUC O;  1JR9 A;  4QPK A;  1YI2 V;  1R6K A;  2JGD B;  5IDJ A;  1YIT V;  2UU9 O;  5KAI Z;  4FFB B;  1OHH G;  4DR5 O;  2ARH A;  3RVY A;  3CS5 A;  2QTS A;  2KQX A;  3QO5 A;  3P30 A;  4FMT A;  4IYI A;  5IY5 C;  2ZXW B;  2M6Y A;  1LUW A;  1BT8 A;  3LDC A;  5KHK A;  1OCR B;  2E74 B;  2YIB A;  1BHA A;  4GYC B;  2DJV A;  2XAH A;  4TQD A;  4JYC A;  2UXD B;  3LNM B;  2PI4 A;  5KX5 B;  3NR7 A;  3AG2 C;  3D36 C;  5DN6 G;  2AZ2 A;  4F6E A;  1GRJ A;  3SPI A;  2P67 A;  3ETD A;  2XAG A;  1Y74 B;  3U10 A;  1R73 A;  1EFR G;  3DC5 A;  1F51 A;  3FB8 C;  4I7Z B;  4G2K A;  3EHB B;  1NTM H;  1RM1 C;  4D7T A;  2ZE5 A;  1ROP A;  1US6 A;  3WG7 B;  1URF A;  4GLX A;  4BAY A;  1FXV A;  2P90 A;  3JD4 A;  4LH7 A;  1FPO A;  1XOU A;  2VWK A;  4BW9 A;  3CCS V;  5ITZ B;  4E4E A;  4JI8 B;  1KUQ A;  3IFX A;  3T2M A;  2EIK C;  1FKA O;  1Y76 B;  1FFX B;  3S3W A;  1IBM B;  3X2Q B;  4B3M B;  4XDL A;  3K59 A;  3A2F A;  1HNZ B;  2RQ6 A;  2WPD G;  3ASO C;  4MTF A;  1DF4 A;  4B3R O;  3HKB A;  3CHX A;  4LF6 O;  2RNB A;  3E8H A;  4IIJ A;  3P3P A;  2YSU B;  4UUJ C;  3HKD A;  3BY6 A;  4NTX A;  2LW7 A;  5LXT A;  4KHP O;  5FNV A;  5A9G A;  4LFB B;  3AG7 A;  5LOV B;  3I5D A;  5JJE B;  1WAZ A;  1S5J A;  4IGG A;  2QR4 A;  4YY3 B;  3SYA A;  2R72 A;  3JAK B;  4KL1 A;  2Z3Y A;  2VQF B;  3A0H Z;  2N04 A;  4X65 B;  1LR1 A;  3EXA A;  2CK3 G;  2ZM6 O;  4B7K A;  3AG4 C;  1P7B A;  1TUB B;  2WLL A;  1VQP V;  4DUZ O;  1H2M A;  1ARO P;  1V55 C;  5IT9 N;  2BTO A;  5KHJ A;  3ICX A;  2V4D A;  4DV0 B;  3APQ A;  2ZCE A;  1GAX A;  5KHI A;  3ZHQ A;  1VQO V;  3CSX A;  4O4I A;  2PGG A;  1ZTE A;  5KUK A;  4PJ0 Z;  1EBO A;  2XOK G;  4JYA B;  1HR0 O;  5B1O A;  1SS3 A;  5EZY A;  2QM4 A;  3E8G A;  1OCC C;  4NR1 A;  4ZI7 A;  1Q6U A;  1FXK B;  1IX9 A;  2YXH A;  4F6R B;  1MZE A;  2CTW A;  2CDY A;  4NTY A;  1PNM A;  1GKF A;  1YEW A;  3WFV A;  1SKV A;  1K97 A;  3ABK B;  3RYF B;  2KKW A;  3BEH A;  4I50 B;  3SPH A;  4J9Y B;  2E5L B;  1RPR A;  3FB6 C;  1N32 O;  2AW9 A;  1RSO A;  3DXR B;  2AZ0 A;  1IUR A;  1TAE A;  2QWO B;  2EIN B;  2IJK A;  1JJ2 U;  4XDJ A;  1FXH A;  3N2K A;  1XMO B;  2B9Z A;  4Z1V A;  4ASU G;  4X8A A;  4WFB V;  4JI8 O;  3OTO B;  4FM2 A;  2RCV A;  2BTQ A;  5LP6 A;  2YS8 A;  2PTM A;  5LMU B;  3JSN A;  5J2U A;  2P5O A;  1H2K A;  2F23 A;  2CTP A;  1CP9 A;  5CA0 A;  3BFR A;  2ODM A;  1B6Q A;  3ZRW A;  1MA1 A;  2QM8 A;  4D7S A;  4JI4 O;  4LR3 A;  5JH7 A;  2Q4P A;  1XNQ B;  5H6Q A;  1PKX A;  3QNE A;  2LW1 A;  4DR6 B;  1NR1 A;  4DV7 O;  1I94 O;  2GUZ A;  1CXZ B;  4MVZ A;  5IWA O;  3CCL V;  2A9H A;  3K3W A;  3T4D A;  4ZOL A;  3OEH G;  2GDS A;  2VS0 A;  3ZHV A;  1YXB A;  4JPR A;  3TK1 A;  3CRR A;  1QR9 A;  2YUA A;  2F1M A;  1VP7 A;  2Q7H A;  1MSD A;  2N74 A;  5B5E Z;  2OCH A;  3CJH A;  1BL8 A;  1TUE B;  1AVM A;  4J7Z A;  3ZHS A;  1ZX3 A;  5IYD O;  1QLN A;  3AG3 B;  4GX1 A;  5KA6 A;  4DV0 O;  1EM1 A;  2C2A A;  2O57 A;  1AJP A;  3E86 A;  4LWS B;  4O4J B;  2JGD A;  2B5U A;  3IJ4 A;  4FFB A;  4JYA O;  1QVF U;  1N8R W;  3K5N A;  3JAL B;  4B3T B;  1MZF A;  1N33 B;  1NI8 A;  5E1A C;  2F66 C;  3JCU Z;  4EFB A;  2FYU H;  1VQ4 V;  5B1B B;  4KUM A;  2EIJ C;  2X0L A;  4RQF A;  4O4L B;  3K5M A;  4PA4 A;  1FFT B;  2Q6A A;  1BSM A;  3ZS8 C;  5F2V O;  4MW3 A;  4Q6G A;  2E5L O;  4NXN O;  1Y67 A;  1AI4 A;  3SJA C;  5KX5 A;  4UVC A;  2FML A;  4RQE A;  3MD0 A;  2JS3 A;  3LSU A;  1VQ6 V;  4IYH A;  2F43 G;  1WA8 B;  1OCO B;  1Y74 A;  2IU3 A;  3RBZ A;  2ZIO A;  1WPX A;  1S0V A;  2DYS B;  3CXH F;  3AG1 C;  2WLH A;  3ETE A;  3STZ C;  4HAM A;  1AI6 A;  1AR4 A;  4JI3 O;  2UUB B;  4K35 A;  2QWP B;  1ZUQ A;  2EZO A;  2P06 A;  1QQC A;  1V54 C;  4FJC C;  4O2B B;  2ZDI A;  5LHH A;  5LMN O;  3VQX A;  5ITZ A;  5B1A B;  4JF3 A;  1TA8 A;  2XT9 A;  1B3Q A;  2H3O A;  1XNQ O;  3OW2 U;  4EB6 B;  4JZG A;  3ZMV A;  1Y76 A;  3QO8 A;  1D2D A;  5JCO C;  1BHB A;  1FFX A;  2L35 A;  4B08 A;  4J11 A;  4AQY B;  3CE2 A;  1M57 B;  1WN7 A;  3J80 N;  3J81 N;  1K4C C;  1K33 A;  3HB3 B;  2NNU A;  1VQ5 V;  3SPG A;  3RWR D;  3LDE A;  1RPO A;  4LFC B;  2EUL A;  2LQT A;  3ZHU A;  2JJ1 G;  2A06 H;  3SYC A;  3K06 A;  4A5U B;  1NBM G;  4ZKI A;  2BE3 A;  3ZED A;  4LF9 B;  2UUC B;  4BWA A;  1QHT A;  3F5T A;  2UU9 B;  5J2T B;  5LOV A;  3U11 A;  3ASN C;  4DR5 B;  4AIL C;  2CAZ C;  2FKX A;  2P4V A;  4RO2 A;  2UUA O;  3JAK A;  2OT5 A;  2DYR C;  3OAA G;  1AR1 B;  5D5Q A;  3SYP A;  4B3T O;  1N0J A;  2YXY A;  1TUB A;  4J9Z B;  1HDJ A;  2PUS A;  4H33 A;  2EIM B;  1Q82 W;  2YIA A;  4LF7 O;  4NB5 A;  1I5Y A;  3KCY A;  4CC6 A;  3ZHR A;  2Q73 A;  4OXS A;  1M9N A;  3RN4 A;  1E79 G;  1PM9 A;  3OGI B;  4DW1 A;  1W0K G;  5L3E A;  2E76 B;  3CPW U;  1JCH A;  4EEQ A;  1Z5V A;  4AHC A;  4DV3 O;  3K03 A;  2WLJ A;  1FXK A;  2ZT9 B;  3WB2 A;  1FAF A;  1SF9 A;  4F6R A;  2EBO A;  2A0L A;  4TSF G;  2Z0A A;  1Y6X A;  1G4Y B;  2CGN A;  2UXX A;  1GO3 F;  1O9G A;  3RYF A;  4P2Z A;  5KMG B;  4I50 A;  2OCC B;  2QDO A;  2VQE O;  1HNW O;  3B09 A;  1VF5 B;  2LJ2 A;  4LP8 A;  5JQG A;  3G71 V;  1GN4 A;  2UUB O;  5KA5 A;  3DXR A;  3E8B A;  1R6N A;  4GZR B;  2JVD A;  4GKJ O;  1NU1 H;  3L9D A;  4FK5 C;  4YJ3 B;  4JAU A;  5L3C A;  3KKY A;  4X88 A;  5LYJ B;  4TQF A;  3LSS A;  2OIG A;  3W7T A;  3OE7 G;  1Y4M A;  3UT5 B;  3E35 A;  2K9P A;  3ABL B;  4CC5 A;  3JAT B;  3K08 A;  1YJW V;  1SQG A;  5H9C A;  1P4R A;  5LA6 B;  4I9W A;  4I55 B;  1QBZ A;  2GV9 A;  2JDI G;  3IC9 A;  3ABU A;  1VQK V;  1Q86 W;  4YJ2 B;  1G8M A;  4LBE C;  2JJ2 G;  4LH6 A;  4B3R B;  4YHH O;  4LF6 B;  1P7G A;  3OUS A;  4J10 A;  3SPC A;  1I7F A;  1DLB A;  4KHP B;  3OGC C;  1GM9 A;  1B04 A;  4ZHQ B;  4X66 O;  1K5Q A;  4DV1 O;  1WB7 A;  4DR2 O;  3WB0 A;  5B3S C;  3WB1 A;  5B66 Z;  2ATK C;  1Q43 A;  4RAI A;  2BOB C;  2WSS G;  3ZN0 A;  2ZM6 B;  3KCX A;  1S72 V;  1GK9 A;  1H8H G;  3OEE G;  4DUZ B;  4DR3 O;  1GN6 A;  1M1K W;  2YI9 A;  3RVZ A;  5EK0 A;  1CEZ A;  3RYH B;  1KP3 A;  3PN1 A;  1HR0 B;  3DSQ A;  3SJC C;  2LGQ A;  3GWO A;  2HEP A;  4LWS A;  4O4J A;  4UB8 Z;  4WFG A;  5C93 A;  1NR7 A;  1QNM A;  1IXM A;  3IGA C;  3C3S A;  5H2F Z;  4FZ0 A;  3BCC H;  3ZRX A;  5KAF Z;  4DV5 B;  3D3I A;  3JAL A;  3SJB C;  1KKC A;  3DC6 A;  4QE7 A;  3CC2 V;  2IU0 A;  5LHG A;  1N36 O;  2Y48 A;  5JJJ B;  5FPO A;  4N21 A;  2G38 A;  4O4L A;  1N32 B;  2Y69 C;  4LF8 O;  4GT1 A;  4JI5 O;  1VMG A;  3PJS K;  4GX0 A;  3HPL C;  2IM9 A;  3H01 A;  2X6B A;  5L3B A;  2E75 B;  1FJG O;  1OV9 A;  3CX5 F;  1SRY A;  3CB2 A;  4JTA B;  2QGN A;  2MK3 A;  1AP5 A;  2WAM A;  5E79 Z;  2ETN A;  4FPP A;  1WA8 A;  1ZL8 B;  4IHJ B;  2Q7E A;  1PNK A;  4HBN A;  4UVA A;  3OM3 B;  4P30 A;  1NKD A;  2DYR B;  4J41 A;  3K5O A;  3T1Y O;  1M56 C;  1R3L C;  1NQT A;  1SES A;  1QLE C;  4JI4 B;  1PL4 A;  4CS2 A;  3A0B Z;  2CGO A;  3LUT B;  1F7Y A;  1GMG A;  1IVS A;  1VQL V;  1TVK B;  3L74 H;  4O2B A;  2VWJ A;  2B1I A;  1FYJ A;  1YHQ V;  2AXT Z;  1R3J C;  2EIL B;  4DK1 A;  4DV7 B;  1I94 B;  3UKM A;  4EB6 A;  2UXN A;  4LF4 O;  1L0L H;  1K8A W;  2DWE C;  5IWA B;  4JTC B;  2X6A A;  4MVS A;  3CRM A;  3ABM C;  1SZT A;  1IBL O;  2HHH B;  3AK3 A;  1VQ7 V;  3ZJZ A;  5L3D A;  3JCZ A;  2YDE A;  4ABM A;  2E3C A;  2Q7G A;  1OCZ B;  4BW5 A;  3HKC B;  5CMU A;  3RT3 C;  2WA3 A;  3OR7 C;  4X9Q A;  1MOF A;  1CPY A;  3TGU H;  2EJR A;  3ZCC A;  4I0X B;  3H1H H;  1XDC A;  1W0J G;  5J2T A;  2IH1 C;  3R65 A;  4OGQ B;  1OJH A;  3ZX6 A;  3ZBH A;  4JZ2 A;  4PHZ A;  2Q5Z A;  1JVM A;  2BCC H;  3HKE B;  1VQM V;  2CH7 B;  1NH2 D;  5BZB A;  1Z5W A;  3A0R A;  4DV5 O;  4B3S B;  4FFK A;  2JK5 C;  5GTI Z;  4J7K A;  1B06 A;  3JD3 A;  4MVM A;  3KZI Z;  1WNS A;  4UV8 A;  3LSQ A;  2R9A A;  4AI8 A;  2F4V B;  1VF6 A;  1WLE A;  5IJ9 B;  4G27 B;  4QJF B;  1K7D A;  2JIZ G;  1R1B A;  4NXN B;  2DWD C;  2ZIM A;  5JWP A;  4P9O A;  3D8C A;  4XBF A;  3CME V;  4C7U A;  1W2B U;  2DN9 A;  4DO2 A;  3OD4 A;  3DGE A;  1XBL A;  3FB7 C;  3H1L H;  3JAW B;  1EN5 A;  2W0F C;  1M90 W;  1AIL A;  2UXB O;  4R50 A;  1VQ8 V;  3ZRV A;  5H6R A;  2JRI A;  1YJ9 V;  3CCM V;  5HFM A;  4JI3 B;  1SQB H;  4FVM A;  4DYL A;  1PPJ H;  5L3G A;  5KMG A;  3N27 A;  2HG5 C;  1AJN A;  1GN2 A;  5IY5 B;  4GUN A;  4FZ1 A;  4PEL A;  4DV6 O;  5LMN B;  3B2E E;  1AJQ A;  1JX9 A;  3JAM N;  1THZ A;  3FX7 A;  4DRX A;  1R6T A;  3B8M A;  4YJ3 A;  2QWN B;  5EIB D;  3JYC A;  2OTJ V;  2ZQM A;  5LYJ A;  1KKD A;  3L73 H;  1KC8 W;  3AG2 B;  3E83 A;  2ZIN A;  3UT5 A;  2AHZ A;  1MNG A;  3IAY A;  1KYO F;  3K0G A;  3JAT A;  4U3F H;  5C8Y B;  1PL0 A;  1L8D A;  1SA0 B;  1SZX A;  3P32 A;  1YTF B;  5LA6 A;  4I55 A;  2HHH O;  5JVD B;  4GKK O;  1RM1 B;  2PI5 A;  4YJ2 A;  1M93 A;  2QKS A;  1S3J A;  4OX9 O;  1D5N A;  2QM7 A;  1H2S B;  2Y69 B;  2L6L A;  5LP6 C;  2GHY A;  1X4T A;  4H37 A;  1HW7 A;  5K1P A;  3QG5 A;  4MTX A;  2R9R B;  3ETG A;  5LGN A;  4FM1 A;  4L8J A;  4ZHQ A;  2PYL A;  5JJN B;  4E2L A;  2EIK B;  1XL4 A;  2GTS A;  3QO7 A;  5EC1 C;  3E8F A;  2F95 B;  2UUA B;  3JAR B;  4PD4 F;  2KG7 B;  4W4L A;  3Q4H B;  5IYB O;  2OYQ A;  1XL6 A;  4QIW F;  1BGY H;  2AGA A;  4J80 A;  4MVO A;  3CWB H;  1M56 B;  4DR1 O;  1T5E A;  4PDL A;  2OWO A;  4B3S O;  2ZR3 A;  4WFA V;  4LF7 B;  1O9H A;  4UCT A;  3ASO B;  1WJZ A;  3UO3 A;  4WFH A;  3W7X A;  2WLI B;  5IE9 A;  2F4V O;  2XND G;  3RYH A;  3GB7 C;  2RJZ A;  3I55 V;  3VBB A;  1GM8 A;  1XI1 A;  4DUY O;  1AI5 A;  3K58 A;  4DV3 B;  1BS3 A;  3G67 A;  1Q6I A;  4X20 B;  4OPA A;  4JI0 O;  2FL4 A;  4J7J A;  3OT7 A;  2DQ0 A;  2IH3 C;  2VQE B;  1HNW B;  4PDR A;  2R70 A;  3T1C A;  4JI1 B;  3AG4 B;  2W0X A;  4HYO A;  4QPJ A;  1V55 B;  2VRZ A;  4GKJ B;  3CC4 V;  3JD1 A;  3OUF A;  3QTC A;  2XAF A;  3ML0 A;  1NVP B;  4DR7 O;  4PI0 A;  4EFE A;  4UCV A;  4DV2 O;  3HR0 A;  5EC2 C;  2ZXW C;  1ZL8 A;  4IHJ A;  4RUF A;  1OCC B;  1OCR C;  3FKS G;  2WLN A;  5IYZ B;  1VAR A;  2CE4 A;  4JAS A;  4TUY B;  2HVK C;  5L3F A;  1F4N A;  4HNA B;  3STL C;  4DV4 O;  1JA8 A;  1UPG A;  4X62 O;  4YHH B;  2DW4 A;  3CRA A;  5EBW C;  1SQX H;  1TVK A;  5KLV H;  4L87 A;  1KQS U;  5LL6 Y;  3D3Q A;  1J95 A;  3H9V A;  1ZSP A;  3CP1 A;  3L75 H;  1H2N A;  4PDM A;  4X66 B;  2ZD9 A;  1Q6H A;  4DV1 B;  4DR2 B;  2Q0O C;  2QSA A;  3A8T A;  1MG1 A;  2XAQ A;  3L70 H;  1PNL A;  3CYO A;  1K4D C;  1SQV H;  2Q69 A;  4JI7 O;  1BE3 H;  3W7S A;  2LO1 A;  4MVQ A;  3IC7 A;  2Z5U A;  3OMA B;  4DR3 B;  1JJO A;  4ICG A;  5CBF A;  3S3X A;  3H1I H;  3AEI A;  3HKC A;  3F7Y C;  3T4Z A;  1H38 A;  1H8E G;  2QKC A;  4JI2 O;  4Q20 A;  2PF4 E;  5B1N A;  1XMQ O;  1GN3 A;  1YVW A;  4CH4 A;  3FAV B;  4I0X A;  3C90 A;  3UCS C;  3X2Q C;  2CTQ A;  1FD9 A;  4W4K A;  1XIL A;  3CRQ A;  1N4C A;  2GBO A;  3CRC A;  4ZIB A;  2XUM A;  3HKE A;  1N0N A;  4I4T B;  2CH7 A;  3SYQ A;  1Q81 W;  2P6J A;  3BHP A;  2D3O W;  2QE7 G;  4DW0 A;  2UXC O;  1N36 B;  1AI7 A;  3RFR A;  4YIO A;  3ZRS A;  2D2C B;  2KSD A;  5KUM A;  4LF8 B;  5IJ9 A;  2F93 B;  3RGB A;  2Y4U A;  3QF7 A;  4JI5 B;  4JI1 O;  1JFF B;  3GVM A;  1FJG B;  2LP7 A;  4TWK A;  2H8P C;  1I08 A;  4R6Z A;  2Q0A A;  1VIB A;  3E22 B;  4BR6 A;  3KG2 A;  5GON B;  2Y0I A;  4DR4 O;  1KBH A;  4R7C A;  3E89 A;  3JAW A;  3H1K H;  2ZE6 A;  5EYP B;  3N2G B;  1KU9 A;  2XAS A;  3BA8 A;  5J9P C;  1A32 A;  3T1Y B;  2EX3 A;  1KB9 F;  1BQZ A;  2N05 A;  2XAJ A;  3ZMT A;  1SQQ H;  2NLJ C;  1XQ8 A;  3RYC B;  4J42 A;  1OZ0 A;  1JPX A;  4WCE V;  2QWQ B;  4R8C A;  2EIJ B;  4H0L B;  5CBH A;  2QA4 V;  3K0D A;  4MS2 A;  1TGO A;  1XHZ A;  2IW5 A;  1FXK C;  2HVJ C;  4U7O A;  4TOI A;  4CS4 A;  4LF4 B;  1AR5 A;  1DF5 A;  5CBG A;  1YIJ V;  3GWK C;  4FLT A;  4Z1M G;  4DK0 A;  3ABK C;  3EVK A;  4GX5 A;  1LNQ A;  3D36 A;  1IBL B;  4U3J B;  5C8Y A;  2ITD C;  4K8X A;  1SA0 A;  2X6C A;  4MVR A;  4LF5 O;  3TJT A;  1SC5 B;  4N23 A;  1BZK A;  5CB4 B;  2PYJ A;  2YC0 A;  1WP7 A;  1KD1 W;  2DMX A;  1I5X A;  2EIN C;  5JVD A;  3AG1 B;  2Y4T A;  3CCJ V;  1N34 O;  3L72 H;  1E1Q G;  4IL6 Z;  4EKW A;  1MAB G;  1G6U A;  2WLK A;  1EN4 A;  1NVP D;  2P4K A;  1X59 A;  1V54 B;  2M7W A;  2EZP A;  3BVO A;  3MDS A;  4CH3 A;  2ADP A;  2A7W A;  4K0K O;  4WBN B;  5FLX N;  3ZMU A;  2H94 A;  4NKG B;  3CCV V;  1VQN V;  4JYY A;  1MMM A;  2ZNJ A;  3G6E V;  1ENV A;  5EBM C;  4UXN A;  3U0Z A;  3O65 A;  2JEX A;  3JAR A;  1L0N H;  2Q68 A;  3APO A;  2KG7 A;  3Q4H A;  1NJI W;  5TIS Z;  1S76 D;  4KFM A;  1R3I C;  4BIU A;  3M7M X;  1QU7 A;  5K1X A;  2ZNI A;  4LFA O;  4G28 B;  2BSK B;  4NXM O;  1HNX O;  4K8Z A;  2QWR B;  2WLI A;  2YID A;  3K57 A;  2W6I G;  1DTO A;  1XNR O;  3OMI B;  2Q9L A;  1LUV A;  1AP6 A;  4PA6 A;  5BR8 O;  3ASN B;  4X1Y B;  2HR3 A;  4X20 A;  2UXB B;  5IYC O;  3BRC A;  5LGT A;  2GSM B;  3ZHT A;  3R66 A;  4B7E A;  1K9M W;  3MHH C;  2NR5 A;  5KHH A;  2XHB A;  3CCE V;  1UJW B;  1KP2 A;  3AG3 C;  4MT8 A;  2LFS A;  4DV6 B;  1J5E O;  4X64 B;  3OTF A;  1DK1 A;  2WWW A;  3RYI B;  3C3T A;  5BMV B;  4GCZ A;  2ZR2 A;  4NTW A;  4XDK A;  4O4H B;  4JTD B;  2Y0P A;  5B1B C;  1K3E A;  3ETQ A;  4MTO A;  2B1G A;  2Q67 A;  1XEQ A;  1ZAU A;  5IYZ A;  2P22 C;  1IBK O;  3JAS B;  4GKK B;  4TUY A;  3FFQ A;  4HNA A;  4OX9 B;  3FD9 A;  3TCU A;  4JI6 O;  1YDX A;  4MW8 A;  2ZE7 A;  3BA9 A;  3TXQ A;  1IZ3 A;  4QNH B;  1OCO C;  4UCU A;  3AK2 A;  1GTO A;  1NZ6 A;  2DYS C;  3MAQ A;  3T1H B;  3SPJ A;  4FLU A;  1IXB A;  4WFF A;  4KXR A;  4LNU B;  4DR1 B;  3K9S A;  2QEX V;  5B1A C;  3THO A;  2YIC A;  3CXC U;  5IJ0 B;  1M5I A;  1WPB A;  2UXD O;  1JQ0 A;  2BOC C;  3B77 A;  4O2A B;  1M57 C;  2HFE C;  3FAV A;  3NXS A;  4TV9 B;  2X7R B;  4DUY B;  3E2E A;  5KHG A;  3ABT A;  3K9A A;  3BPZ A;  2DE0 X;  4I4T A;  4JI0 B;  4TV8 B;  3CD6 V;  4BIO A;  5B3S B;  4UV9 A;  1YZB A;  2OIE A;  1EN6 A;  3SYO A;  3CCR V;  5JQG B;  4FM0 A;  1WP8 A;  1U96 A;  3J7A U;  3ZIA G;  5EBL C;  1MSW D;  1KMI Z;  2K1E A;  4U7N A;  4CH5 A;  5CA1 B;  5AG2 A;  4NVP A;  4X1K B;  3B40 A;  5DM6 V;  1BCC H;  1ZWI C;  3SR2 C;  5DEC A;  4UB6 Z;  3UQ8 A;  4WFE A;  1JFF A;  1EZJ A;  4X64 O;  4DR7 B;  4X1I B;  2YEV B;  1BQ0 A;  4H13 B;  3BAA A;  3E22 A;  4NYK A;  1IBM O;  4DV2 B;  2HP8 A;  5GON A;  2HJD A;  3UO2 A;  1PV0 A;  1NTK H;  3CC7 V;  3JSL A;  2IJH A;  5EYP A;  4B3M O;  3N2G A;  2EIM C;  1U97 A;  4CH6 A;  1VF6 C;  4GX2 A;  1ORQ C;  2PZS A;  1HNZ O;  2QTO A;  4FLY A;  4DV4 B;  2P7T C;  3F5W C;  3FB5 C;  2ZE8 A;  1Q3E A;  4JYB A;  4X62 B;  3RYC A;  3CMA V;  4I5S A;  3LDD A;  4UCR A;  1K73 W;  4X89 A;  3TXS A;  5GTH Z;  3JD2 A;  2HLD G;  3BAB A;  4LFB O;  1S77 D;  4PI2 A;  4D6T H;  4JAV A;  4YY3 O;  4JI7 B;  3G4S V;  3VQV A;  1YJN V;  2VQF O;  4UCS A;  3UM7 A;  2OCC C;  4X65 O;  2V1D A;  4U3J A;  1SET A;  4PA9 A;  3LNN A;  3T1H O;  2QJ1 A;  4PDV A;  1GH6 A;  5FPR A;  4BIZ A;  5CB4 A;  1HWY A;  4K3A A;  4H44 B;  3B4S A;  2AHY A;  1H2G A;  3SGI A;  4JI2 B;  2V7Q G;  4Z2W A;  1QLE B;  2NN4 A;  4LCU C;  1XMQ B;  1P84 F;  3W7U A;  3ABL C;  1JMK C;  1D5A A;  3FYI B;  4WBN A;  1K34 A;  1K92 A;  1S5L Z;  1WB8 A;  5JCO A;  2QKA A;  2ADQ B;  2UXC B;  2RDC A;  3CCQ V;  3ABM B;  3M8A A;  3EFF K;  2BSK A;  5HFL A;  3QVN A;  1XUQ A;  5DED A;  1XMO O;  3MHS C;  1RFY A;  4QE9 A;  1NS1 A;  1DGS A;  4DXW A;  3DTU B;  3ZN1 A;  3OTO O;  1Q5O A;  4WF9 V;  4DR4 B;  5LMU O;  1FS0 G;  2FB5 A;  2A79 B;  2GTA A;  1V9P A;  2LGW A;  4X1Y A;  4JV5 B;  4UVB A;  4IT5 A;  4FLW A;  1RP3 B;  2R9I A;  5BY1 A;  3VQW A;  1VQ9 V;  3W7W A;  3HKB B;  4IIJ B;  1F23 A;  3HKD B;  2KB1 A;  5LXT B;  1Z2G A;  4FLZ A;  5EIB C;  3K79 A;  4PA3 A;  5FNV B;  2FTK A;  1GM7 A;  3WU2 Z;  4DR6 O;  1I0H A;  1SER A;  2HJF C;  1XRE A;  1F4M A;  3RYI A;  2JS5 A;  5D5P A;  5BMV A;  4UFZ A;  1P49 A;  1G1X B;  2LFR A;  1L1F A;  1Q90 D;  4O4H A;  5BXZ A;  3ZMZ A;  2MW2 B;  5LHI A;  4TT3 G;  3ZMS A;  2ILM A;  2YI8 A;  2IJJ A;  3WG7 C;  2WLL B;  4LF5 B;  3L71 H;  1JOY A;  5CA3 A;  3JAS A;  2CUG A;  5LBQ A;  1SQP H;  2ZDI C;  1VEW A;  2DQ3 A;  1XHX A;  1N34 B;  4RUE A;  4P9P A;  1KEC A; 
#chains in the Genus database with same CATH homology
 1E1Q G;  1MOF A;  1CPY A;  1TUE B;  4EKW A;  1MAB G;  5IYD O;  1QLN A;  2EJR A;  1K5S A;  2WLK A;  3AG3 B;  4GX1 A;  3ZCC A;  2C2A A;  5KA6 A;  1NVP D;  1V54 B;  2M7W A;  1AJP A;  3E86 A;  3CCU V;  5GW7 A;  2EZP A;  1S5H C;  1W0J G;  2B5U A;  2IH1 C;  3R65 A;  4YXW G;  1Q7Y W;  3ZMU A;  1QVF U;  2H94 A;  1JVM A;  4ZBM A;  4CBC A;  1N8R W;  5CN0 A;  3CCV V;  1VQN V;  1VQM V;  1NH2 D;  5BZB A;  3G6E V;  1ENV A;  5EBM C;  4UXN A;  5E1A C;  2JEX A;  2JEU A;  3A0R A;  2Q68 A;  3JD0 A;  2JK5 C;  1NJI W;  1S76 D;  4KFM A;  1R3I C;  1VQ4 V;  1YTF D;  4BIU A;  2OTL V;  5B1B B;  4KUM A;  2EIJ C;  2X0L A;  3JD3 A;  4MVM A;  4RQF A;  4CZZ A;  4UV8 A;  2IJI A;  4G28 B;  3LSQ A;  4PA4 A;  1FFT B;  2Q6A A;  1WLE A;  2EIL C;  3K04 A;  4G27 B;  4MW3 A;  4QJF B;  3TET A;  1K7D A;  2JIZ G;  3F7V C;  2DWD C;  4P9O A;  1AI4 A;  1COW G;  4XBF A;  2WLI A;  3CME V;  4UVC A;  1W2B U;  1Y66 A;  2W6I G;  1DTO A;  4RQE A;  3MD0 A;  4DO2 A;  4PA7 A;  2W6J G;  3DGE A;  3FB7 C;  1VQ6 V;  3OMI B;  3VOU A;  2F43 G;  3RW0 A;  2W0F C;  1R3K C;  1OCO B;  4PA6 A;  1M90 W;  2IU3 A;  3ASN B;  3OFN G;  2HR3 A;  1QCE A;  1BMF G;  3RBZ A;  5IYC O;  5LGT A;  4R50 A;  1OCZ C;  1WPX A;  2GSM B;  2WLM A;  3ZRW B;  1VQ8 V;  3ZRV A;  1S0V A;  2DYS B;  5H6R A;  1K9M W;  3AG1 C;  2WLH A;  3MHH C;  3ETE A;  3CCM V;  3STZ C;  5HFM A;  1YJ9 V;  4HAM A;  1AI6 A;  1QVG U;  3B8N A;  3CCE V;  5L3G A;  1UJW B;  1KP2 A;  3AG3 C;  2HG5 C;  2EZO A;  1PD3 A;  1AJN A;  4MT8 A;  5LGU A;  1V54 C;  2LFS A;  4FJC C;  4PEL A;  5IY5 B;  2ZDI A;  5LHH A;  4JGS A;  4HZ3 A;  4MVU A;  3M99 B;  5B1A B;  1AJQ A;  4JF3 A;  3FYE B;  1JX9 A;  1THZ A;  5FL7 G;  3B8M A;  3OW2 U;  3I56 V;  3JYC A;  3ZMV A;  2WWW A;  2ZQM A;  3QO8 A;  4FIP C;  4RUE A;  2OTJ V;  1KKD A;  1QR8 A;  4GCZ A;  2ZR2 A;  4MTG A;  1KC8 W;  1BHB A;  2YEV A;  1E1R G;  4XDK A;  4JTD B;  3AG2 B;  3E83 A;  1M57 B;  2AHZ A;  1NH2 B;  4LC1 A;  3SJQ C;  5B1B C;  3OR6 C;  3K0G A;  1K3E A;  1PL0 A;  1K4C C;  1K33 A;  3HB3 B;  4MTO A;  3P32 A;  1YTF B;  4F4L A;  2NNU A;  4KP4 A;  3OMN B;  2B1G A;  2Q67 A;  1VQ5 V;  3SPG A;  3LDE A;  1RPO A;  2HKO A;  2JJ1 G;  1RM1 B;  2PI5 A;  3SYC A;  4MSW C;  2QKS A;  3K06 A;  1S3J A;  1NBM G;  4ZKI A;  3TCU A;  2QM7 A;  2ITC C;  4MW8 A;  2Y69 B;  2GHY A;  4H37 A;  4QPK A;  1YI2 V;  1R6K A;  1YIT V;  4QNH B;  5IDJ A;  1OCO C;  4MTX A;  3ASN C;  2R9R B;  3ETG A;  5LGN A;  1OHH G;  3RVY A;  1GTO A;  4E2L A;  2EIK B;  2DYS C;  1XL4 A;  3QO5 A;  3QO7 A;  5EC1 C;  3SPJ A;  3E8F A;  4RO2 A;  3P30 A;  2OT5 A;  4FMT A;  2DYR C;  3OAA G;  1AR1 B;  5IYB O;  3SYP A;  1XL6 A;  4WFF A;  4QIW F;  5IY5 C;  4MVO A;  4J9Z B;  1M56 B;  2ZXW B;  4PDL A;  4H33 A;  2QEX V;  2ZR3 A;  3LDC A;  2EIM B;  5B1A C;  1OCR B;  4WFA V;  1Q82 W;  1I5Y A;  1BHA A;  3CXC U;  3ASO B;  2XAH A;  4JYC A;  4WFH A;  4OXS A;  3W7X A;  1M9N A;  2WLI B;  3LNM B;  2PI4 A;  2XND G;  1JQ0 A;  2BOC C;  3B77 A;  3GB7 C;  1E79 G;  3AG2 C;  1M57 C;  2HFE C;  3NXS A;  3I55 V;  3VBB A;  1GM8 A;  5DN6 G;  1W0K G;  2X7R B;  5L3E A;  3SPI A;  3E2E A;  3CPW U;  1JCH A;  1AI5 A;  2P67 A;  3ETD A;  2XAG A;  3ABT A;  3K9A A;  1R73 A;  3K03 A;  2WLJ A;  1EFR G;  1FXK A;  1F51 A;  3FB8 C;  2EBO A;  2A0L A;  4G2K A;  3EHB B;  4TSF G;  1RM1 C;  3CD6 V;  5B3S B;  4UV9 A;  1G4Y B;  1ROP A;  3WG7 B;  2UXX A;  1GO3 F;  3SYO A;  3CCR V;  4BAY A;  4P2Z A;  2DQ0 A;  2IH3 C;  3ZIA G;  5EBL C;  1FXV A;  2P90 A;  2OCC B;  1MSW D;  4PDR A;  2K1E A;  3JD4 A;  4U7N A;  3T1C A;  3AG4 B;  4HYO A;  4LP8 A;  4QPJ A;  5DM6 V;  3G71 V;  5KA5 A;  3CCS V;  1ZWI C;  3E8B A;  1R6N A;  4WFE A;  1V55 B;  3IFX A;  3T2M A;  3CC4 V;  3JD1 A;  4FK5 C;  3OUF A;  2EIK C;  1EZJ A;  4JAU A;  5L3C A;  4X88 A;  2XAF A;  3ML0 A;  1NVP B;  2YEV B;  3LSS A;  3W7T A;  3OE7 G;  1Y4M A;  3E35 A;  5EC2 C;  3CC7 V;  3ABL B;  3X2Q B;  3K08 A;  2IJH A;  2ZXW C;  1YJW V;  4XDL A;  4RUF A;  2EIM C;  5H9C A;  1OCC B;  1OCR C;  4GX2 A;  1P4R A;  4I9W A;  1ORQ C;  3FKS G;  2WLN A;  1QBZ A;  2JDI G;  2QTO A;  2WPD G;  3ASO C;  4JAS A;  3ABU A;  2HVK C;  5L3F A;  3CCJ V;  1VQK V;  1F4N A;  2P7T C;  3F5W C;  3STL C;  1Q86 W;  3FB5 C;  4MTF A;  1G8M A;  1DF4 A;  2JJ2 G;  4JYB A;  4LBE C;  3CMA V;  4I5S A;  3LDD A;  3OUS A;  2DW4 A;  3E8H A;  1K73 W;  2YSU B;  3SPC A;  4UUJ C;  4X89 A;  5EBW C;  1DLB A;  3BY6 A;  4L87 A;  3JD2 A;  1KQS U;  2HLD G;  3OGC C;  1GM9 A;  1J95 A;  3CP1 A;  1S77 D;  4PDM A;  2ZD9 A;  1K5Q A;  1MG1 A;  2XAQ A;  1PNL A;  3CYO A;  5B3S C;  4JAV A;  1K4D C;  2Q69 A;  3SYA A;  3G4S V;  2Z3Y A;  1YJN V;  3W7S A;  4MVQ A;  2ATK C;  3UM7 A;  2OCC C;  2CK3 G;  2BOB C;  3IC7 A;  2V1D A;  2WSS G;  4RAI A;  1SET A;  2Z5U A;  4PA9 A;  3ZN0 A;  1GK9 A;  1H8H G;  1P7B A;  3AG4 C;  3OMA B;  3OEE G;  4PDV A;  2WLL A;  1VQP V;  4BIZ A;  1HWY A;  1ARO P;  5CBF A;  1M1K W;  1V55 C;  2AHY A;  1H2G A;  3AEI A;  3F7Y C;  3T4Z A;  1H38 A;  1H8E G;  3RVZ A;  2V7Q G;  1VQO V;  5EK0 A;  1QLE B;  4Q20 A;  1CEZ A;  4LCU C;  5B1N A;  1KP3 A;  5KUK A;  1EBO A;  2XOK G;  3W7U A;  5B1O A;  3ABL C;  3GWO A;  3X2Q C;  4WFG A;  5C93 A;  1NR7 A;  1IXM A;  3IGA C;  3E8G A;  3ZRX A;  1S72 V;  1OCC C;  3FYI B;  1FXK B;  3D3I A;  1K34 A;  1K92 A;  4QE7 A;  3CC2 V;  3SYQ A;  2IU0 A;  1Q81 W;  2P6J A;  2D3O W;  1PNM A;  1GKF A;  3WFV A;  2QE7 G;  1K97 A;  5LHG A;  1AI7 A;  3ABK B;  2Y48 A;  3CCQ V;  3BEH A;  3ABM B;  3ZRS A;  3SPH A;  4N21 A;  4J9Y B;  5KUM A;  1RPR A;  3EFF K;  3FB6 C;  2Y69 C;  5HFL A;  4GT1 A;  2EIN B;  2IJK A;  1JJ2 U;  3PJS K;  4GX0 A;  4XDJ A;  3HPL C;  1FXH A;  3H01 A;  3MHS C;  2X6B A;  4ASU G;  5L3B A;  4QE9 A;  2LP7 A;  4X8A A;  4WFB V;  4TWK A;  2H8P C;  4DXW A;  3DTU B;  4R6Z A;  3ZN1 A;  3KG2 A;  4WF9 V;  1SRY A;  4R7C A;  3E89 A;  2MK3 A;  4JTA B;  1FS0 G;  2WAM A;  2A79 B;  4FPP A;  2XAS A;  4UVB A;  1CP9 A;  1PNK A;  5J9P C;  4UVA A;  3OM3 B;  4P30 A;  1B6Q A;  1NKD A;  2DYR B;  2R9I A;  3ZRW A;  1M56 C;  1R3L C;  1NQT A;  1VQ9 V;  2XAJ A;  3ZMT A;  1SES A;  3W7W A;  2NLJ C;  1QLE C;  2QM8 A;  1OZ0 A;  1JPX A;  4WCE V;  3LUT B;  1GMG A;  4R8C A;  2EIJ B;  1F23 A;  1VQL V;  5H6Q A;  5CBH A;  2QA4 V;  2KB1 A;  3K0D A;  2B1I A;  3K79 A;  4MS2 A;  4PA3 A;  2FTK A;  1GM7 A;  1PKX A;  3QNE A;  1YHQ V;  1R3J C;  2EIL B;  1SER A;  2HJF C;  1NR1 A;  2IW5 A;  3UKM A;  1FXK C;  2HVJ C;  4U7O A;  1F4M A;  2UXN A;  1DF5 A;  5CBG A;  1K8A W;  2DWE C;  1YIJ V;  4MVZ A;  2LFR A;  4JTC B;  2X6A A;  1L1F A;  4MVS A;  4Z1M G;  3CCL V;  3ABK C;  2A9H A;  3ZMZ A;  5LHI A;  4GX5 A;  3K3W A;  3T4D A;  1LNQ A;  3ABM C;  3OEH G;  4TT3 G;  3ZMS A;  3D36 A;  1SZT A;  2IJJ A;  2ITD C;  4JPR A;  3WG7 C;  3TK1 A;  2WLL B;  2X6C A;  4MVR A;  3ZJZ A;  1QR9 A;  1VQ7 V;  5L3D A;  3JCZ A;  4N23 A;  1JOY A;  1KD1 W;  5CA3 A;  1I5X A;  2EIN C;  1OCZ B;  5LBQ A;  4BW5 A;  5CMU A;  2ZDI C;  3AG1 B;  2DQ3 A;  3OR7 C;  1YSC A;  4P9P A;  1KEC A;  1BL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...