3OR6C

On the structural basis of modal gating behavior in k+channels - e71q
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVQTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or6C00
4QE7A 3SYAA 3LDEA 3E8GA 4MVQA 4GX5A 4J9YB 2OCCC 4G27B 4P9PA 2YEVA 5CBFA 2AHYA 2Q68A 5CBHA 1R3IC 4P2ZA 3ABKC 4MTFA 5B3SC 3SYOA 2JK5C 3TCUA 5B1AC 4BW5A 4R7CA 4P30A 2DWDC 4TWKA 3VOUA 5EBMC 4H37A 1K4CC 4PDMA 2A9HA 3EFFK 3X2QC 4I9WA 4RO2A 5B1BC 3LDDA 1QLEC 5BZBA 3SYPA 3K08A 4R6ZA 3E86A 3T4ZA 2HJFC 3K03A 1BL8A 4GX2A 3OUSA 4UUJC 5J9PC 2IH1C 1JVMA 1LNQA 4X89A 2EIKC 3FB8C 2QKSA 3F7YC 3IFXA 4PA7A 3FB5C 3E89A 4JTDB 1KKDA 3T1CA 3LNMB 2EILC 3AG2C 3SPIA 2A0LA 2ZD9A 3FB7C 2WLNA 4MS2A 3GB7C 2ITDC 4PDLA 4H33A 4MTOA 1XL6A 4MVRA 2Q6AA 3AG1C 4MVMA 3E8HA 5EC2C 4JTCB 3F5WC 3RVYA 1R3LC 3ASNC 2DYRC 4CBCA 2BOCC 2WLLA 3STLC 4X88A 1J95A 5KUKA 3JYCA 5KUMA 1OCOC 2WLLB 2X6CA 1OCCC 3E8FA 4PA3A 3OGCC 3SPHA 4GX1A 2NLJC 4RUEA 3IGAC 4J9ZB 3AG3C 5EK0A 4MVOA 2QTOA 3BEHA 4MVSA 2ITCC 4HYOA 3ABMC 2ZXWC 5EBLC 3TETA 3ZJZA 1G4YB 2X6AA 2HFEC 2Q67A 4MVUA 5EC1C 3OUFA 4RAIA 2EINC 3RW0A 2P7TC 2EIJC 4WFGA 4PA4A 5EBWC 3E8BA 3OR7C 1M57C 3SJQC 2X6BA 4PA9A 1OCRC 3K0DA 3K0GA 4GX0A 3SYQA 4F4LA 3ASOC 4RUFA 2HVKC 2W0FC 4X8AA 4QNHB 1V54C 4LCUC 2HVJC 1ORQC 3LUTB 1M56C 2HG5C 4PA6A 3RBZA 3UM7A 2WLHA 4P9OA 4XDLA 4G28B 2Q69A 2EIMC 4MSWC 4WFHA 3ABLC 4XDJA 3T4DA 1K4DC 4XDKA 3ZRSA 2WLJA 3F7VC 3T2MA 4EKWA 2Y69C 1R3JC 3HPLC 3KG2A 4WFEA 5IY5C 2IH3C 1V55C 3R65A 4LBEC 1S5HC 4JTAB 3SPJA 4PDRA 3FB6C 3RVZA 4KFMA 1OCZC 2K1EA 4PDVA 5CBGA 3LDCA 3PJSK 4HZ3A 3WG7C 3K06A 4WFFA 3STZC 2KB1A 2WLMA 4R8CA 3UKMA 4MTGA 1P7BA 1ZWIC 2A79B 4MVZA 4MW3A 3K04A 2AHZA 2WLIA 3AG4C 3OR6C 2H8PC 1R3KC 4MW8A 4R50A 2DWEC 4LP8A 4ZBMA 2DYSC 2WLIB 1XL4A 2R9RB 3SPGA 5E1AC 4QE9A 4OXSA 3SYCA 3SPCA 2BOBC 3E83A 2ATKC 4DXWA 2WLKA
chains in the Genus database with same CATH superfamily
4X1KA 1Q7YW 5LGTA 2K9PA 3U0ZA 5GTHZ 3FYIB 2EJ7A 2QGNA 3OTFA 4KL1A 4BW5A 3CB2A 1KD1W 3ZHVA 4UB8Z 2AW9A 3P32A 3ZRWB 1IDSA 1A32A 2XTAA 3L72H 4K8ZA 3H1HH 1MSDA 1ZL8B 4EFBA 3AG2C 2LO1A 4MS2A 4DV5O 1GH6A 2EULA 1KYOF 5CA0A 1N8RW 2HHHB 1FKAO 4MTOA 4B3RB 3HKCB 5KMGB 1F7YA 3AG2B 2UUBB 3AK3A 1FXKB 1GAXA 1H2SB 2JGDB 1AROP 1SQQH 3D8CA 1THZA 1LR1A 4X65B 4KP4A 4U7NA 4O4IA 2PUSA 1SA0A 1Z5WA 1TUBA 1WA8B 1N34B 2P7TC 1Q90D 4WFGA 3SJQC 2GUZB 3ZN1A 4PA9A 4F6EA 4LF5B 2YXLA 5JWPA 4KXRA 2LW7A 2UXDO 3OT7A 1K97A 2WLHA 3BABA 3LSQA 2BE3A 2Q7EA 3FD9A 2RDCA 1KC8W 5JJNB 4TQFA 2RNBA 1NTZH 3AEIA 3RVZA 3N2GA 1E1QG 1RFYA 2Q7HA 3STZC 2UU9O 5IJ0B 4K0KB 1WPBA 1GN2A 1V9PA 3BA9A 2IJJA 4NTWA 4DV0B 4HNAA 5B1BB 1R6NA 1H8EG 1NI8A 1SF9A 1PP9H 5BR8O 4NXNB 5CBFA 3N27A 4P2ZA 2UUAB 4LF7O 3Q4HA 3RGBA 1HDJA 4J41A 3SYOA 1F4MA 5LBQA 1H2LA 1AJNA 3T1HO 1XNQO 1ZAUA 1FAFA 4TWKA 1YEWA 1K4CC 1VQ6V 4I9WA 4H44B 1PV0A 3K08A 2WSSG 3ZHSA 4JYCA 1IXBA 1DF5A 2EZPA 3LNMB 3ZIAG 3A0BZ 2PYJA 3OD4A 4B7EA 1XHZA 2ZIOA 1S72V 2X0LA 4Z2WA 4X88A 3HKDB 3K59A 3BVOA 4YHHB 1GKFA 1SESA 2OTJV 4DV3B 2DQ3A 1WN7A 2ZE6A 4MVOA 2YXHA 4HYOA 1G4YB 5KAFZ 1AR1B 1VF7A 2EIMB 1DLBA 5K1XA 3HKBA 1YTFB 3OR7C 4GKJB 2KG7B 1HW7A 3DC6A 4DR4B 2EBOA 2MW2B 3JSLA 3L73H 4GX0A 4NTYA 2ZNJA 4IIJA 3LUTB 4UB6Z 4PA6A 3UM7A 4XDKA 1QR8A 4ZOLA 3LSSA 3GWOA 1HP8A 2IH3C 1S76D 5D5PA 3SPJA 1HR0B 1O9GA 3CE2A 3CSXA 3G6EV 2B1IA 2F95B 4L87A 1XNRB 4MW8A 1R3KC 3D3QA 1XMQO 3B77A 1Q81W 3RYFB 1GM9A 4ZHQA 5B1AC 3ZEDA 2XHBA 1BHBA 1VEWA 1WLEA 1QU7A 4P9PA 5B1AB 1PL4A 1FFXA 4DV1B 3D36A 2V1DA 1FJGB 4F6RA 4DW0A 3T4ZA 4DO2A 1JX9A 4IYHA 5LXTA 3IFXA 1KKDA 1AP6A 2NR5A 5LOVA 4DR6B 2VS0A 1I7FA 1IVSA 3NR7A 2YS8A 5KUKA 1R1BA 1HWYA 4PA3A 3AG3C 3CXCU 3CC2V 2FMLA 4EEQA 3AG7A 4ICGA 3JASA 3ABMC 3TETA 4O4HB 3CYOA 4I55B 3AG3B 1U97A 3OUFA 4G2KA 1AI5A 3ABMB 4DR5O 3LNNA 4UFZA 3RT3C 2LFRA 1NBMG 3SYQA 4F4LA 1MABG 4FLTA 4I0XB 2F66C 1MOFA 2QA4V 3SR2C 1CPYA 1Q6IA 1U96A 4XDLA 3T4DA 3IAYA 3FAVB 3FFQA 2E5LO 5LP6C 3L9DA 4U3FH 1US6A 1AR5A 1UJWB 3ZMTA 3ABTA 1K3EA 1OCZC 1PNMA 1Q6HA 2E75B 2H3OA 5H2FZ 4LF6B 2OCCB 4FLZA 1NVPB 1DF4A 5LP6B 1BMFG 1JR9A 4MTGA 1BS3A 4ZBMA 1K5SA 3JCUZ 4LR3A 2QTSA 2WWWA 2HKOA 1H2GA 1QR9A 5L3FA 2R9IA 1IZ3A 2N05A 4AHCA 4CC6A 3OMAB 5J2TA 2PI4A 3SYPA 3UT5A 3WB2A 1B06A 3K03A 1YHQV 1QLNA 1B3QA 4DR2O 1AILA 5GTIZ 1AR4A 1LUVA 4DV2B 2A0LA 1H2KA 3FB7C 1Y66A 2RMKB 1BGYH 3JALA 3DXRB 3GVMA 3PN1A 1CXZB 3OTOB 3OGCC 4J9ZB 4JI7O 5BXZA 2B5UA 1ENVA 3BEHA 1VQ7V 3H1KH 3J81N 4EFEA 3CRMA 1IBLO 3M7MX 1NS1A 2CTPA 4UCTA 4RAIA 3FKSG 3CD6V 2EIJC 1GN6A 4O2AB 5L3DA 2Y4TA 2DW4A 4YJ2B 2GSMB 2YIBD 2EIJB 2B1GA 1DK1A 2OYQA 4NVPA 2P4KA 4N21A 3CWBH 4BWAA 2QEXV 2UXNA 4UV9A 3TK1A 2Q69A 4JZGA 2Q8VA 3ABLC 3E22B 1VF6A 2KKWA 3JATB 5ITZA 1HNXO 3B09A 4JI6O 4GLXA 2K1EA 4DRXA 3T1YB 5A2QN 1EZJA 3K06A 4I4TA 5LHHA 4DV7O 4LFAB 3P3NA 4R8CA 2WLMA 4TV8A 1BQZA 3OR6C 4TOIA 5IJ9A 2JJ1G 2DWEC 1IBMO 4X62B 2ZKOA 2BOBC 2VQFO 4I5SA 4IHJB 1SQBH 1H2MA 1S0VA 3L70H 5C8YB 1P4RA 2CGNA 2PTMA 3MHSC 5CA1B 4YY3B 2ADPA 1B04A 2F93B 3S3WA 4NXMB 5B3SC 4GCZA 2EILB 3OM3B 3G4SV 4DR1O 2ETNA 4DUZB 4R7CA 4DV6B 4UV8A 4FIPC 5B3SB 1QLEC 4WF9V 1NH2B 3OFNG 3S3XA 1EFRG 1D5AA 4C7UA 1RSOA 3ZHTA 1JMKC 4E4EA 1WP7A 1XL6A 2DYRC 3H1JH 3K5OA 1F4NA 1GN4A 4CC5A 5KA6A 4X66B 1XUQA 2F23A 1HNWB 3E8FA 3SPHA 2FKXA 4DR7O 4BIOA 4YIOA 4O4JA 3H1LH 1AI4A 4MVUA 2HFEC 3L71H 5EYPA 4WBNA 3EVKA 3O9OA 1JPXA 1Y67A 3CCVV 4YIPA 4B3TB 2HEPA 3SJBC 1V54C 3SJCC 1N32B 2YSUB 1WP8A 1M1KW 1V54B 3JD0A 1MNGA 3QVNA 4X64O 3FB6C 2ODMA 4W4LA 5CBGA 1ZUQA 2PZSA 4WFFA 3ZRWA 4DR3O 5GONB 3CEIA 2BSKB 2WLIB 3SYCA 4JI2O 5E1AC 5LA6B 4DXWA 1W2BU 4ZKIA 1I94B 4NR1A 1QVGU 1K33A 3N2KA 1R6KA 1XMOB 2W6IG 3J7AU 4AI8A 1WNSA 1ZSPA 3M99B 2P67A 3RFRA 3JAMN 2GV9A 2CDYA 1BL8A 3JAKB 3SGIA 3UQ8A 1S5JA 5CB4B 2ZE7A 1Q6UA 4I50A 1IBKB 2ZXWB 3C3TA 3MD0A 2AGAA 3U10A 2WLLA 1J95A 3CCSV 4QGPA 2ZCEA 1KQSU 2JS3A 4RUEA 2NLJC 1SZXA 3IGAC 5EK0A 3QF7A 5FNVA 4GUNA 3BY6A 4LF7B 3HKEB 4X20B 1WAZA 5IYBO 5LMNB 1VQLV 1FXKC 2CH7B 3QG5A 2XNDG 4D7SA 4DUYO 3WFVA 3QTCA 5IJ0A 5HFLA 2QKCA 2IU3A 1BSMA 2B9ZA 1YJNV 1KB9F 3ZHRA 1JFFB 2WA3A 3ZHUA 4JPRA 3CCUV 1BE3H 1VQ5V 2A7WA 3G67A 1K34A 1B6QA 2XAFA 5H6RA 1YSCA 4U3JB 3UKMA 2KSDA 4JI4O 3L74H 3AG4C 2UXBO 1TVKB 3WB0A 4O2BA 4EB6B 4B3MB 1YI2V 5KHJA 4J11A 3AG4B 2F4VO 2FTKA 1J5EB 4LFCB 4X1KB 2AHYA 5CBHA 4JAUA 2E3CA 1GM7A 4LNUB 3RWRD 3VOUA 2JDIG 5KHGA 5B1BC 3LDDA 2UXCO 3ASNB 4ZI7A 4JI3O 3JARA 4CH4A 1KECA 2IH1C 5BMVB 2DQ0A 1SQGA 3CXHF 2ZD9A 4LWSB 4Q6GA 2KG7A 5CA0B 1YITV 3ZN0A 5B1OA 2P06A 4GX1A 2QTOA 2WAMA 2ITCC 1SA0B 5IT9N 1N33O 3OAAG 5JQGB 4JI1B 2HHHO 4J10A 1SQFA 4B3RO 3RYFA 2UUBO 1ORQC 4JV5B 2Q7GA 1QVFU 4X1IB 1GTOA 4P9OA 5C93A 3CMEV 2EIMC 5B66Z 1NR7A 3K9AA 4JI0B 2P22C 1XEQA 4X9QA 4X65O 4LBEC 1S5HC 1FPOA 2IM9A 3NXSA 5B1NA 4FLXA 1P7GA 1N34O 3LDCA 4PV1B 3CJHA 4UVCA 1S5LZ 4B08A 5TISZ 2DN9A 1M93A 4LF4O 5CA3A 3OE7G 2IJIA 3ZMZA 2EZOA 1K73W 4DR5B 4TUYB 4D7TA 2VQEB 2F1MA 3ETGA 2QWOB 4MTFA 2PY5A 5J2UB 2YDEA 2QJ1A 4CH3A 3EFFK 5LYJA 4RQFA 2YIBA 5KLVH 2D3OW 2G38A 2QE7G 2YUAA 3RYHA 5JCOC 4O4HA 4CS4A 2CE4A 1JVMA 4K0KO 1XOUA 1VF5B 1G6UA 1N0NA 3T1CA 1VP7A 4DV0O 3SPIA 4JYYA 3GB7C 2ITDC 4PDLA 5H9CA 1ZLZA 2YIAA 3CCEV 2ZM6O 3OW2U 1M9NA 5IWAO 3RN4A 4UCUA 4UVBA 3FAVA 3QO7A 3OMNB 5KX5A 1L8DA 1SQVH 1FYJA 2L6LA 2Q67A 3RYIA 2ZE8A 4QJFB 1QCEA 4FLUA 5LP6A 3BFRA 3CCJV 4X8AA 1XI1A 4AILC 4YHHO 1NT2B 1QBZA 3A2FA 3ZRSA 4DV3O 5AG2A 4FM0A 4ZOLB 4PDRA 5LL6Y 2GHYA 4GKKO 5BY1A 3WG7C 1S77D 4WFBV 2JS5A 1H38A 2N74A 4J7JA 4GKJO 2A79B 1EN6A 1IBLB 2ZIMA 3WG7B 1MZEA 5JVDA 1Y74B 2A3QA 1VQNV 3E83A 1AJPA 4ZHQB 1YTFD 3JD3A 4MVQA 4J9YB 2OCCC 1EN5A 1QHTA 2Q68A 4B3SB 1Q5OA 1IURA 3B8NA 1HR0O 1FFXB 1W59A 4F6RB 4JYAB 1T5EA 4UCRA 5BZBA 1K5QA 2YIDA 1I08A 1XNRO 2VWKA 1N4CA 4FFBA 4CH5A 1KP2A 5LXTB 4AQYB 1YIJV 4O2AA 2JGUA 2DJVA 5JH7B 4YJ2A 3K5NA 1IX9A 1IBMB 4X1YB 4PD4F 2BTOA 2IJHA 3FX7A 4DV1O 1FJGO 4IYIA 3E22A 3VQYA 4LF8B 4J42A 1JOYA 1TA8A 4OX9B 2OTLV 3U11A 4MVSA 4JGSA 2BCCH 5KAIZ 4BR6A 2V7QG 3H01A 1GRJA 2QSAA 1KUQA 2VRZA 3E8BA 1QQCA 5IYZB 4DR6O 2ARHA 1BQ0A 5KA5A 1K9MW 4DV4O 1Q82W 4RUFA 1Y6XA 3K79A 1EM1A 1JCHA 4IHJA 2P5OA 3ZMSA 5FLXN 3F7VC 5CA1A 1DGSA 1PL0A 3HPLC 4WFEA 3R65A 2AZ0A 1RP3B 2ZQMA 2FYUH 3W7UA 3ABKB 2E76B 1M5IA 1R6TA 5CMUA 3GWKC 3RYCB 4NTXA 1XL4A 2R9RB 1VQ4V 1AP5A 1NR1A 2JIZG 5GW7A 1Z5VA 3K57A 5HFMA 1GO3F 1O9HA 4G27B 4BAYA 1EN4A 1GM8A 3W7XA 3ZCCA 3K58A 3P30A 1W0KG 4H37A 1URFA 4NB5A 3FYEB 4LF6O 2Z3YA 3TJTA 1NJIW 4HAMA 3JAWB 1VMGA 2QDOA 4JI5O 1OV9A 4PA7A 4J7ZA 5LMUB 2EILC 4LF9B 1NVPD 2UUCB 2WLNA 4H13B 4UCSA 2QM7A 3VQWA 2OT5A 4MVMA 1RM1C 3F5WC 2EINB 3MHHC 2C2AA 1M57B 3QO5A 1HNZB 3JALB 1N36B 4JI8O 1RM1B 4O4LB 2YC0A 3ASOB 1I5XA 2L35A 2RJZA 5EBLC 4N23A 4YJ3A 3SJAC 2LGWA 3OEHG 1OHHG 4TSFG 4PA4A 3KKYA 4IT5A 2LJ2A 4JYBA 2WA4A 4LH7A 3A0RA 4J80A 1PKXA 4KHPB 1SERA 2HR3A 2AZ2A 3E2EA 1R73A 4FZ0A 5IDJA 3CRCA 3OTOO 4FM2A 2UXXA 4DW1A 5DN6G 2Y69C 2CTQA 3OGIB 5ITZB 3EHBB 3CRRA 5DM6V 2EX3A 2Y69B 5KHIA 4HZ3A 5L3GA 2P6JA 2KB1A 4MVZA 4TV8B 2ZT9B 1N0JA 1SS3A 2ATKC 3G6BA 5CB4A 4DV5B 1SRYA 4E2LA 3B2EE 3CHXA 4GX5A 2CGOA 1YF2A 4UCOA 3BCCH 1L0NH 2MK3A 1BHAA 1YDXA 3O65A 3JD1A 1CP9A 4P30A 1WB8A 5EZYB 2F43G 4FK5C 2Z5UA 2DE0X 3T1YO 4LFAO 3E86A 3HKEA 1NKDA 3OUSA 3ZHQA 1LNQA 1ZL8A 4X89A 3FB8C 2QKSA 2QM8A 4X62O 4JASA 2QWPB 3HKCA 3THOA 5KMGA 3CP1A 4JI4B 3W7WA 2YEVB 3E8HA 1FXKA 3JCZA 4LFBO 3CC7V 2UXDB 3JYCA 1OCOC 3OMIB 4YY3O 4NXMO 1YVWA 2JGDA 2X6CA 5JJJB 1OCCC 4DV6O 4MTXA 4I9QA 1OCOB 1ROPA 1JFFA 1OCCB 2ZINA 1WA8A 2ZXWC 4O4JB 4FPPA 2Y0IA 2CTRA 3RW0A 2GUZA 2UU9B 2PYLA 5EBWC 2QWQB 2JJ2G 5IY5B 2UXCB 1F23A 2Z0AA 5EYPB 4WBNB 1E1RG 1OCRC 3K0DA 1NH2D 3BA8A 4H0LB 4EB6A 2HVKC 4QNHB 5JJEB 4U7OA 1XILA 1Z2GA 2OIGA 1OCRB 4X66O 2LW1A 5BR8B 1HNWO 4JAAA 2WLJA 1E79G 2DYSB 3KZIZ 1R3JC 3KG2A 4LNUA 1V55C 3T1HB 1XNQB 4PDVA 1V55B 4QPKA 2QWRB 4BIZA 4D6TH 4B3TO 5BMVA 1N33B 4TV9B 2A06H 4LWSA 1OJHA 1N32O 1Y76B 4UXNA 3B40A 5EIBC 4CZZA 1AB3A 3APOA 2BTQB 3N2KB 2JK5C 2XAJA 2DWDC 4DK0A 2A9HA 4RO2A 4FLVA 4RQEA 3K5MA 5IYDO 1QNMA 3F7YC 4JTDB 1UPGA 3BPZA 3B8MA 2LGQA 5LGNA 3MAQA 3TXQA 5JQGA 1I94O 1VIBA 1FXHA 3BHPA 3AG1C 2HLDG 4I50B 4LF4B 3HKDA 3A0HZ 5FPOA 3ASNC 1F51A 3IC9A 5KUMA 1FS0G 2WLLB 1XMOO 3AG1B 4X1IA 3G71V 4FLYA 1SZTA 5E79Z 3CRQA 1KP3A 1MSWD 4GZRB 1WPXA 4OPAA 1G8MA 1NTKH 1PM9A 4UVAA 3TXSA 5H5NA 5FNVB 2RN9A 3QO8A 3CCMV 2OCHA 3ZMVA 5KHHA 2P4VA 4FMTA 1XMQB 2Q5ZA 1IBKO 2DMXA 4PI0A 4JAVA 1DTOA 1NU1H 4TUYA 1FXVA 1YJWV 2HJDA 2R70A 4O4IB 2WPDG 2ZM6B 5J2UA 1TUBB 1YCIA 4OPHA 5IWAB 1BZKA 4PELA 5LMNO 2FB5A 4QPJA 2P90A 5CN0A 5FPRA 1NTMH 1VQ8V 2GTSA 2KQXA 2V4DA 4CS2A 1KMIZ 2Y4UA 2QR4A 4PI2A 4O2BB 4TQDA 4GYCB 5JCOA 3LDEA 4ABMA 3E8GA 5LHIA 3CCQV 5KHKA 1YJ9V 1YXBA 2JEUA 1ZX3A 2ZR2A 2LP7A 3N2GB 1TUEB 2M6YA 3R66A 3X2QC 1P49A 1L1FA 2E74B 5L3CA 4LF5O 3CS5A 3P3PA 4ZI7B 5IE9A 2GBOA 5J9PC 5L3EA 3X2QB 3IC7A 3JARB 2EIKC 4HNAB 3FB5C 2Q9LA 3OEEG 4PJ0Z 2CAZC 4B3MO 3J80N 4GKKB 1I5YA 4J7KA 4H33A 3H1IH 2EIKB 4MVRA 5EIBD 1J5EO 5EC2C 4LFCO 1R3LC 2ILMA 3LSUA 1JJOA 3Q4HB 2LQTA 2E5LB 2PI5A 2QM4A 4I55A 3ZJZA 1GK9A 1W0JG 5EC1C 3A8TA 2CUGA 2JRIA 3W7TA 3CRAA 1NZ6A 3CX5F 4NXNO 2XASA 1K92A 3K0GA 4I0XA 2UUAO 1Y74A 2W0FC 4LCUC 2HVJC 3EXAA 2D2CB 2Q0AA 5D5QA 4MSWC 1D5NA 4XDJA 1XDCA 3T2MA 4CS3A 4QIWF 4JTAB 3UO3A 4K35A 3HKBB 3M8AA 1COWG 3PJSK 1GN3A 2CTWA 3CJHB 4DR2B 4JI1O 2AHZA 4LP8A 2ZR3A 1EBOA 1PPJH 4NYKA 4IIJB 3JD2A 4KFMA 2R9AA 4FLWA 4JV5O 5FL7G 5JH7A 4TT3G 1AI7A 4DV4B 2N04A 1CEZA 4X1YA 4JI0O 1K8AW 1XQ8A 1UFIA 4RWUA 4JI7B 2W6JG 4DR4O 5LYJB 1SKVA 2HJFC 4JF3A 1KKCA 3RYHB 2DOSA 2PF4E 4BW9A 3I56V 4Z1MG 3E89A 2XOKG 4FFKA 3SDLA 3JD4A 3VQXA 5A9GA 3D36C 5IYZA 2VQEO 2Q6AA 5IYCO 3DXRA 2OIEA 4L8JA 4LC1A 4IL6Z 1HNXB 5KX5B 1KU9A 4JI6B 2QWNB 3CPWU 4MT8A 3RYIB 4DV7B 5LOVB 4NKGB 2X6BA 4K8XA 3ICXA 2NNUA 2O57A 3IJ4A 4FZ1A 1L0LH 1X59A 1OCZB 3RYCA 2VQFB 4JI5B 2FL4A 4B7KA 2HG5C 2IU0A 3RBZA 2XAHA 4A5UB 4G28B 2Q73A 1VQOV 1P84F 3AK2A 1K4DC 3JATA 3H9VA 2GTAA 1VQKV 3JASB 4DR1B 3ZS8C 3ABUA 1FD9A 4JI8B 3D3IA 1LUWA 2IBZH 1P7BA 1ZWIC 4MW3A 3VQVA 4R50A 1PNKA 4ASUG 3JAWA 3C90A 2YICA 5C8YA 4IGGA 5JVDB 3ZRVA 2WLKA 1MMMA 3SYAA 3TGUH 1XBLA 5K1PA 3ABKC 4LH6A 2XAQA 2LFSA 2H94A 3E35A 3CC4V 4FVMA 4DR7B 2YXYA 5LHGA 5EBMC 3ML0A 4O4LA 4PDMA 1BT8A 1PD3A 4R6ZA 4GX2A 1YZBA 1FFTB 4FFBB 3G80A 3VBBA 3I5DA 1KBHA 1S3JA 4WFAV 1VQMV 1G1XB 2HP8A 3K5LA 3RVYA 3STLC 4B3SO 1AVMA 1H8HG 2YI8A 3ZMUA 3AK1A 5J2TB 1IXMA 3F5TA 4JYAO 3UT5B 4X64B 1SQPH 1JJ2U 2XUMA 2X7RB 2EINC 3ABLB 4AQYO 1VQPV 2RQ6A 1M57C 4DR3B 2JEXA 4BIUA 3KCYA 5DECA 4JI2B 3ASOC 5B5EZ 1NQTA 2R72A 4OGQB 2ZNIA 4JZ2A 4WFHA 2JVDA 4EKWA 4LF8O 4OX9O 4DYLA 1H2NA 4LFBB 1AJQA 3K9SA 2OWOA 2EJRA 3MDSA 2Q0OC 3QNEA 2XT9A 4KUMA 5EZYA 2ZDIA 4DV2O 1WB7A 4UCVA 1TAEA 5GONA 2BSKA 2WLIA 1I0HA 4DK1A 5LA6A 1ZTEA 3UCSC 5LGUA 3SPGA 1VF6C 4OXSA 3KCXA 3BAAA 3ETQA 3SPCA 1QLEB 1EZVH 1XHXA 2RCVA 4QE7A 3DGEA 1TGOA 1BCCH 2Y0PA 2ZE5A 1VQ9V 2YEVA 1M4UA 1R3IC 3ZX6A 1MZFA 3HR0A 3TCUA 4CH6A 3K3WA 1K7DA 1JQ0A 4DRXB 3CCLV 1SQXH 4I4TB 3WB1A 1Q3EA 5H6QA 3JAKA 2DYRB 1MG1A 2PGGA 5IJ9B 4UUJC 4ZIBA 3L75H 2GDSA 1X4TA 4FM1A 5DEDA 1WJZA 2XAGA 3BRCA 4DUYB 2Q4PA 2W0XA 3W7SA 2ZDIC 1MA1A 1D2DA 2M7WA 3CCRV 3ZRXA 4JTCB 2Y48A 4CBCA 2BOCC 1Y4MA 2CK3G 1Q8IA 3DTUB 4I7ZB 3HB3B 1OZ0A 4W4KA 4X20A 2QKAA 3ETEA 3ETDA 2IW5A 1Q86W 3DC5A 2X6AA 4Q20A 1RSOB 2CH7A 4K3AA 4YJ3B 1PNLA 4GT1A 5LMUO 2NN4A 1RPRA 4LF9O 2UXBB 2UUCO 3B4SA 1JA8A 3DSQA 4WCEV 1Q43A 5L3BA 1M56C 2F4VB 4TV9A 4FJCC 4DUZO 1HNZO 1RPOA 1N36O 1Y76A 3WU2Z 4XBFA 3ZBHA 1M56B 3C3SA 2AXTZ 1M90W 5IY5C 3UO2A 2ADQB 2BTQA 5F2VO 3JSNA 1SETA 2YI9A 1XREA 4U3JA 1AI6A 4PHZA 2VWJA 4JI3B 1TVKA 4Z1VA 3K04A 2H8PC 3CMAV 2IJKA 3I55V 1GMGA 3APQA 2DYSC 4YXWG 1SC5B 4QE9A 4KHPO 1VARA 4HBNA
chains in the Genus database with same CATH topology
1YTFD 1S0VA 1P4RA 3LDEA 3JD3A 5LHIA 3E8GA 4MVQA 5LGTA 1Q7YW 3CCQV 4J9YB 3MHSC 2OCCC 2Q68A 1YJ9V 3FYIB 2JEUA 5B3SC 4GCZA 2EILB 2ZR2A 3B8NA 2LP7A 3OM3B 3G4SV 4BW5A 1KD1W 1TUEB 4R7CA 4UV8A 3X2QC 4FIPC 1L1FA 5B3SB 1QLEC 5BZBA 4WF9V 1K5QA 3P32A 3ZRWB 5L3CA 1NH2B 3OFNG 1EFRG 5J9PC 5L3EA 3X2QB 3IC7A 2EIKC 1KP2A 3FB5C 3OEEG 1YIJV 3AG2C 1I5YA 4MS2A 1N8RW 4H33A 4MTOA 1XL6A 2EIKB 4MVRA 5EC2C 1R3LC 3AG2B 2DYRC 1F4NA 1FXKB 5KA6A 2IJHA 3E8FA 3SPHA 1AROP 1JOYA 2PI5A 2OTLV 1THZA 4KP4A 4MVSA 4JGSA 4U7NA 1AI4A 2V7QG 3ZJZA 1GK9A 4MVUA 2HFEC 1W0JG 5EC1C 3H01A 2P7TC 3W7TA 4WFGA 3SJQC 3E8BA 3ZN1A 4PA9A 1JPXA 2XASA 3CCVV 1K92A 5KA5A 3K0GA 1K9MW 1Q82W 4RUFA 2W0FC 1V54C 3K79A 4LCUC 1JCHA 2HVJC 1K97A 2WLHA 2YSUB 3ZMSA 1M1KW 3LSQA 4MSWC 4XDJA 1V54B 3JD0A 3F7VC 3T2MA 1KC8W 1PL0A 3HPLC 4WFEA 4QIWF 3R65A 3AEIA 4JTAB 3RVZA 3FB6C 1E1QG 5CBGA 2ZQMA 1COWG 3PJSK 4WFFA 3STZC 3W7UA 3ABKB 3ZRWA 2AHZA 5CMUA 4LP8A 2WLIB 2ZR3A 1XL4A 1EBOA 2IJJA 2R9RB 5E1AC 3SYCA 1VQ4V 3JD2A 4KFMA 1NR1A 2JIZG 4DXWA 5B1BB 5GW7A 1W2BU 1R6NA 4ZKIA 5FL7G 5HFMA 1GO3F 1QVGU 1H8EG 4TT3G 4G27B 4BAYA 1GM8A 3W7XA 1K33A 1AI7A 5CBFA 3ZCCA 4P2ZA 1CEZA 1R6KA 1K8AW 3SYOA 1F4MA 2W6IG 5LBQA 1AJNA 3P30A 1W0KG 4TWKA 2W6JG 1K4CC 4H37A 3FYEB 3M99B 1VQ6V 4I9WA 2P67A 3K08A 2WSSG 2Z3YA 2HJFC 1NJIW 1BL8A 4HAMA 4JF3A 4JYCA 3I56V 1DF5A 2EZPA 4PA7A 4Z1MG 3E89A 2XOKG 3LNMB 3ZIAG 2EILC 1NVPD 3JD4A 2WLNA 2ZXWB 2QM7A 3MD0A 1S72V 2X0LA 2Q6AA 2OT5A 4MVMA 5IYCO 1RM1C 3F5WC 2EINB 2WLLA 3MHHC 4X88A 1J95A 3CCSV 2C2AA 1M57B 3QO5A 1KQSU 1GKFA 1SESA 2OTJV 4RUEA 2NLJC 1RM1B 3IGAC 2DQ3A 5EK0A 4MVOA 4LC1A 3ASOB 3BY6A 4HYOA 1I5XA 5EBLC 4N23A 1G4YB 3OEHG 3CPWU 1AR1B 5IYBO 2EIMB 4MT8A 1VQLV 1DLBA 1YTFB 1FXKC 1OHHG 4TSFG 2XNDG 4PA4A 3OR7C 4JYBA 2X6BA 3WFVA 2EBOA 2NNUA 5HFLA 4GX0A 1OCZB 3A0RA 1PKXA 1SERA 2HR3A 2IU3A 3LUTB 3E2EA 2HG5C 1R73A 4PA6A 2IU0A 3RBZA 3UM7A 2XAHA 1YJNV 5IDJA 4G28B 1VQOV 1K4DC 4XDKA 1QR8A 2UXXA 3LSSA 3GWOA 5DN6G 2Y69C 1VQKV 2IH3C 1S76D 3SPJA 4JPRA 3CCUV 3ABUA 1VQ5V 3EHBB 3G6EV 5DM6V 2B1IA 2Y69B 3D3IA 4HZ3A 1K34A 1B6QA 2XAFA 5L3GA 2P6JA 5H6RA 1YSCA 2KB1A 3UKMA 1P7BA 1ZWIC 4L87A 4MVZA 4MW3A 3AG4C 4MW8A 1PNKA 4R50A 1R3KC 4ASUG 3B77A 1Q81W 1GM9A 1YI2V 2ATKC 5B1AC 3ZRVA 2WLKA 1SRYA 3AG4B 1BHBA 4E2LA 3SYAA 1WLEA 2FTKA 4GX5A 4P9PA 2AHYA 2MK3A 4JAUA 5B1AB 5CBHA 1BHAA 3ABKC 1GM7A 2XAQA 3D36A 2V1DA 2LFSA 2H94A 3E35A 3CC4V 3JD1A 1CP9A 4P30A 3VOUA 5LHGA 5EBMC 2F43G 3ML0A 4FK5C 2JDIG 4PDMA 2Z5UA 5B1BC 3LDDA 3ASNB 1PD3A 4R6ZA 3E86A 3T4ZA 4DO2A 1NKDA 1JX9A 4GX2A 3OUSA 1KECA 2IH1C 1LNQA 4X89A 1FFTB 3FB8C 2QKSA 2QM8A 3IFXA 2DQ0A 1KKDA 4JASA 3VBBA 2ZD9A 1S3JA 4WFAV 1VQMV 3CP1A 3W7WA 2YEVB 3E8HA 1FXKA 3RVYA 3JCZA 1YITV 3CC7V 3STLC 3ZN0A 5B1OA 5KUKA 3JYCA 1OCOC 3OMIB 1HWYA 2X6CA 1OCCC 1H8HG 4PA3A 4GX1A 3ZMUA 3AG3C 3CXCU 4MTXA 1IXMA 3CC2V 2QTOA 1OCOB 1ROPA 2WAMA 1OCCB 2ITCC 3ABMC 2ZXWC 3TETA 1JJ2U 3CYOA 4FPPA 3AG3B 2X7RB 3OUFA 2EINC 3RW0A 3ABLB 4G2KA 1VQPV 1AI5A 5EBWC 3ABMB 1M57C 2JJ2G 3OAAG 5IY5B 2JEXA 2LFRA 1F23A 4BIUA 1E1RG 1OCRC 3K0DA 1NH2D 1NBMG 3SYQA 4F4LA 1MABG 3ASOC 2HVKC 4QNHB 4U7OA 1ORQC 1MOFA 1QVFU 2QA4V 1NQTA 1OCRB 1CPYA 1GTOA 4P9OA 4XDLA 5C93A 3CMEV 4WFHA 2EIMC 3T4DA 1NR7A 2WLJA 1E79G 4EKWA 2DYSB 3K9AA 1R3JC 3KG2A 1UJWB 1V55C 4LBEC 1S5HC 3ZMTA 1AJQA 3ABTA 2EJRA 3NXSA 3QNEA 1K3EA 1OCZC 1PNMA 4KUMA 4PDVA 5B1NA 3LDCA 2OCCB 1NVPB 2ZDIA 1DF4A 1V55B 4UVCA 1BMFG 4MTGA 4QPKA 2WLIA 4ZBMA 4BIZA 5LGUA 5CA3A 3OE7G 2IJIA 3ZMZA 3SPGA 2EZOA 4OXSA 1K5SA 3SPCA 1QLEB 1K73W 4QE7A 2WWWA 3DGEA 2HKOA 3ETGA 4UXNA 1VQ9V 2YEVA 1R3IC 1H2GA 1QR9A 4CZZA 5L3FA 4MTFA 2R9IA 2JK5C 3TCUA 2XAJA 3K3WA 1K7DA 2DWDC 2PI4A 1JQ0A 2A9HA 3EFFK 3OMAB 3CCLV 4RO2A 4RQFA 5H6QA 3SYPA 2DYRB 2D3OW 2QE7G 1MG1A 3K03A 4RQEA 1YHQV 4UUJC 1QLNA 5IYDO 1JVMA 3F7YC 4JTDB 3T1CA 2XAGA 3B8MA 3SPIA 2A0LA 3FB7C 3GB7C 5LGNA 2ITDC 4PDLA 3W7SA 1FXHA 2ZDIC 3AG1C 2HLDG 2M7WA 5H9CA 3CCRV 3ZRXA 1Y66A 4JTCB 2Y48A 3ASNC 4CBCA 1F51A 2BOCC 3CCEV 1Y4MA 5KUMA 3OW2U 1M9NA 1FS0G 2CK3G 2WLLB 3AG1B 3G71V 3OGCC 1SZTA 1KP3A 4J9ZB 4UVBA 1MSWD 3DTUB 1WPXA 2B5UA 1ENVA 1G8MA 3BEHA 3OMNB 3QO7A 4UVAA 3HB3B 1OZ0A 1VQ7V 3ETDA 3ETEA 2IW5A 1Q86W 2X6AA 2Q67A 3QO8A 4Q20A 4RAIA 4QJFB 3CCMV 1PNLA 1QCEA 3FKSG 4GT1A 3ZMVA 2EIJC 3CD6V 5L3DA 1RPRA 2DW4A 3CCJV 4FMTA 2GSMB 4WCEV 2EIJB 5L3BA 4X8AA 2B1GA 1M56C 4JAVA 4N21A 4FJCC 1DTOA 1QBZA 2QEXV 2UXNA 4UV9A 1RPOA 3TK1A 2Q69A 3ABLC 1FXVA 1YJWV 4XBFA 3ZRSA 1M56B 1M90W 5IY5C 2WPDG 4PDRA 1SETA 2K1EA 2GHYA 4PELA 1AI6A 3WG7C 4QPJA 2P90A 1S77D 1EZJA 3K06A 5LHHA 4WFBV 5CN0A 4R8CA 2WLMA 1H38A 2A79B 1VQ8V 3K04A 3OR6C 2H8PC 2JJ1G 3CMAV 2DWEC 2IJKA 3I55V 1GMGA 3WG7B 2DYSC 4YXWG 4QE9A 1VQNV 2BOBC 3E83A 4I5SA 1AJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QE7 A;  3SYA A;  3LDE A;  3E8G A;  4MVQ A;  4GX5 A;  4J9Y B;  2OCC C;  4G27 B;  4P9P A;  2YEV A;  5CBF A;  2AHY A;  2Q68 A;  5CBH A;  1R3I C;  4P2Z A;  3ABK C;  4MTF A;  5B3S C;  3SYO A;  2JK5 C;  3TCU A;  5B1A C;  4BW5 A;  4R7C A;  4P30 A;  2DWD C;  4TWK A;  3VOU A;  5EBM C;  4H37 A;  1K4C C;  4PDM A;  2A9H A;  3EFF K;  3X2Q C;  4I9W A;  4RO2 A;  5B1B C;  3LDD A;  1QLE C;  5BZB A;  3SYP A;  3K08 A;  4R6Z A;  3E86 A;  3T4Z A;  2HJF C;  3K03 A;  1BL8 A;  4GX2 A;  3OUS A;  4UUJ C;  5J9P C;  2IH1 C;  1JVM A;  1LNQ A;  4X89 A;  2EIK C;  3FB8 C;  2QKS A;  3F7Y C;  3IFX A;  4PA7 A;  3FB5 C;  3E89 A;  4JTD B;  1KKD A;  3T1C A;  3LNM B;  2EIL C;  3AG2 C;  3SPI A;  2A0L A;  2ZD9 A;  3FB7 C;  2WLN A;  4MS2 A;  3GB7 C;  2ITD C;  4PDL A;  4H33 A;  4MTO A;  1XL6 A;  4MVR A;  2Q6A A;  3AG1 C;  4MVM A;  3E8H A;  5EC2 C;  4JTC B;  3F5W C;  3RVY A;  1R3L C;  3ASN C;  2DYR C;  4CBC A;  2BOC C;  2WLL A;  3STL C;  4X88 A;  1J95 A;  5KUK A;  3JYC A;  5KUM A;  1OCO C;  2WLL B;  2X6C A;  1OCC C;  3E8F A;  4PA3 A;  3OGC C;  3SPH A;  4GX1 A;  2NLJ C;  4RUE A;  3IGA C;  4J9Z B;  3AG3 C;  5EK0 A;  4MVO A;  2QTO A;  3BEH A;  4MVS A;  2ITC C;  4HYO A;  3ABM C;  2ZXW C;  5EBL C;  3TET A;  3ZJZ A;  1G4Y B;  2X6A A;  2HFE C;  2Q67 A;  4MVU A;  5EC1 C;  3OUF A;  4RAI A;  2EIN C;  3RW0 A;  2P7T C;  2EIJ C;  4WFG A;  4PA4 A;  5EBW C;  3E8B A;  3OR7 C;  1M57 C;  3SJQ C;  2X6B A;  4PA9 A;  1OCR C;  3K0D A;  3K0G A;  4GX0 A;  3SYQ A;  4F4L A;  3ASO C;  4RUF A;  2HVK C;  2W0F C;  4X8A A;  4QNH B;  1V54 C;  4LCU C;  2HVJ C;  1ORQ C;  3LUT B;  1M56 C;  2HG5 C;  4PA6 A;  3RBZ A;  3UM7 A;  2WLH A;  4P9O A;  4XDL A;  4G28 B;  2Q69 A;  2EIM C;  4MSW C;  4WFH A;  3ABL C;  4XDJ A;  3T4D A;  1K4D C;  4XDK A;  3ZRS A;  2WLJ A;  3F7V C;  3T2M A;  4EKW A;  2Y69 C;  1R3J C;  3HPL C;  3KG2 A;  4WFE A;  5IY5 C;  2IH3 C;  1V55 C;  3R65 A;  4LBE C;  1S5H C;  4JTA B;  3SPJ A;  4PDR A;  3FB6 C;  3RVZ A;  4KFM A;  1OCZ C;  2K1E A;  4PDV A;  5CBG A;  3LDC A;  3PJS K;  4HZ3 A;  3WG7 C;  3K06 A;  4WFF A;  3STZ C;  2KB1 A;  2WLM A;  4R8C A;  3UKM A;  4MTG A;  1P7B A;  1ZWI C;  2A79 B;  4MVZ A;  4MW3 A;  3K04 A;  2AHZ A;  2WLI A;  3AG4 C;  3OR6 C;  2H8P C;  1R3K C;  4MW8 A;  4R50 A;  2DWE C;  4LP8 A;  4ZBM A;  2DYS C;  2WLI B;  1XL4 A;  2R9R B;  3SPG A;  5E1A C;  4QE9 A;  4OXS A;  3SYC A;  3SPC A;  2BOB C;  3E83 A;  2ATK C;  4DXW A;  2WLK A; 
#chains in the Genus database with same CATH topology
 4X1K A;  1Q7Y W;  5LGT A;  2K9P A;  3U0Z A;  5GTH Z;  3FYI B;  2EJ7 A;  2QGN A;  3OTF A;  4KL1 A;  4BW5 A;  3CB2 A;  1KD1 W;  3ZHV A;  4UB8 Z;  2AW9 A;  3P32 A;  3ZRW B;  1IDS A;  1A32 A;  2XTA A;  3L72 H;  4K8Z A;  3H1H H;  1MSD A;  1ZL8 B;  4EFB A;  3AG2 C;  2LO1 A;  4MS2 A;  4DV5 O;  1GH6 A;  2EUL A;  1KYO F;  5CA0 A;  1N8R W;  2HHH B;  1FKA O;  4MTO A;  4B3R B;  3HKC B;  5KMG B;  1F7Y A;  3AG2 B;  2UUB B;  3AK3 A;  1FXK B;  1GAX A;  1H2S B;  2JGD B;  1ARO P;  1SQQ H;  3D8C A;  1THZ A;  1LR1 A;  4X65 B;  4KP4 A;  4U7N A;  4O4I A;  2PUS A;  1SA0 A;  1Z5W A;  1TUB A;  1WA8 B;  1N34 B;  2P7T C;  1Q90 D;  4WFG A;  3SJQ C;  2GUZ B;  3ZN1 A;  4PA9 A;  4F6E A;  4LF5 B;  2YXL A;  5JWP A;  4KXR A;  2LW7 A;  2UXD O;  3OT7 A;  1K97 A;  2WLH A;  3BAB A;  3LSQ A;  2BE3 A;  2Q7E A;  3FD9 A;  2RDC A;  1KC8 W;  5JJN B;  4TQF A;  2RNB A;  1NTZ H;  3AEI A;  3RVZ A;  3N2G A;  1E1Q G;  1RFY A;  2Q7H A;  3STZ C;  2UU9 O;  5IJ0 B;  4K0K B;  1WPB A;  1GN2 A;  1V9P A;  3BA9 A;  2IJJ A;  4NTW A;  4DV0 B;  4HNA A;  5B1B B;  1R6N A;  1H8E G;  1NI8 A;  1SF9 A;  1PP9 H;  5BR8 O;  4NXN B;  5CBF A;  3N27 A;  4P2Z A;  2UUA B;  4LF7 O;  3Q4H A;  3RGB A;  1HDJ A;  4J41 A;  3SYO A;  1F4M A;  5LBQ A;  1H2L A;  1AJN A;  3T1H O;  1XNQ O;  1ZAU A;  1FAF A;  4TWK A;  1YEW A;  1K4C C;  1VQ6 V;  4I9W A;  4H44 B;  1PV0 A;  3K08 A;  2WSS G;  3ZHS A;  4JYC A;  1IXB A;  1DF5 A;  2EZP A;  3LNM B;  3ZIA G;  3A0B Z;  2PYJ A;  3OD4 A;  4B7E A;  1XHZ A;  2ZIO A;  1S72 V;  2X0L A;  4Z2W A;  4X88 A;  3HKD B;  3K59 A;  3BVO A;  4YHH B;  1GKF A;  1SES A;  2OTJ V;  4DV3 B;  2DQ3 A;  1WN7 A;  2ZE6 A;  4MVO A;  2YXH A;  4HYO A;  1G4Y B;  5KAF Z;  1AR1 B;  1VF7 A;  2EIM B;  1DLB A;  5K1X A;  3HKB A;  1YTF B;  3OR7 C;  4GKJ B;  2KG7 B;  1HW7 A;  3DC6 A;  4DR4 B;  2EBO A;  2MW2 B;  3JSL A;  3L73 H;  4GX0 A;  4NTY A;  2ZNJ A;  4IIJ A;  3LUT B;  4UB6 Z;  4PA6 A;  3UM7 A;  4XDK A;  1QR8 A;  4ZOL A;  3LSS A;  3GWO A;  1HP8 A;  2IH3 C;  1S76 D;  5D5P A;  3SPJ A;  1HR0 B;  1O9G A;  3CE2 A;  3CSX A;  3G6E V;  2B1I A;  2F95 B;  4L87 A;  1XNR B;  4MW8 A;  1R3K C;  3D3Q A;  1XMQ O;  3B77 A;  1Q81 W;  3RYF B;  1GM9 A;  4ZHQ A;  5B1A C;  3ZED A;  2XHB A;  1BHB A;  1VEW A;  1WLE A;  1QU7 A;  4P9P A;  5B1A B;  1PL4 A;  1FFX A;  4DV1 B;  3D36 A;  2V1D A;  1FJG B;  4F6R A;  4DW0 A;  3T4Z A;  4DO2 A;  1JX9 A;  4IYH A;  5LXT A;  3IFX A;  1KKD A;  1AP6 A;  2NR5 A;  5LOV A;  4DR6 B;  2VS0 A;  1I7F A;  1IVS A;  3NR7 A;  2YS8 A;  5KUK A;  1R1B A;  1HWY A;  4PA3 A;  3AG3 C;  3CXC U;  3CC2 V;  2FML A;  4EEQ A;  3AG7 A;  4ICG A;  3JAS A;  3ABM C;  3TET A;  4O4H B;  3CYO A;  4I55 B;  3AG3 B;  1U97 A;  3OUF A;  4G2K A;  1AI5 A;  3ABM B;  4DR5 O;  3LNN A;  4UFZ A;  3RT3 C;  2LFR A;  1NBM G;  3SYQ A;  4F4L A;  1MAB G;  4FLT A;  4I0X B;  2F66 C;  1MOF A;  2QA4 V;  3SR2 C;  1CPY A;  1Q6I A;  1U96 A;  4XDL A;  3T4D A;  3IAY A;  3FAV B;  3FFQ A;  2E5L O;  5LP6 C;  3L9D A;  4U3F H;  1US6 A;  1AR5 A;  1UJW B;  3ZMT A;  3ABT A;  1K3E A;  1OCZ C;  1PNM A;  1Q6H A;  2E75 B;  2H3O A;  5H2F Z;  4LF6 B;  2OCC B;  4FLZ A;  1NVP B;  1DF4 A;  5LP6 B;  1BMF G;  1JR9 A;  4MTG A;  1BS3 A;  4ZBM A;  1K5S A;  3JCU Z;  4LR3 A;  2QTS A;  2WWW A;  2HKO A;  1H2G A;  1QR9 A;  5L3F A;  2R9I A;  1IZ3 A;  2N05 A;  4AHC A;  4CC6 A;  3OMA B;  5J2T A;  2PI4 A;  3SYP A;  3UT5 A;  3WB2 A;  1B06 A;  3K03 A;  1YHQ V;  1QLN A;  1B3Q A;  4DR2 O;  1AIL A;  5GTI Z;  1AR4 A;  1LUV A;  4DV2 B;  2A0L A;  1H2K A;  3FB7 C;  1Y66 A;  2RMK B;  1BGY H;  3JAL A;  3DXR B;  3GVM A;  3PN1 A;  1CXZ B;  3OTO B;  3OGC C;  4J9Z B;  4JI7 O;  5BXZ A;  2B5U A;  1ENV A;  3BEH A;  1VQ7 V;  3H1K H;  3J81 N;  4EFE A;  3CRM A;  1IBL O;  3M7M X;  1NS1 A;  2CTP A;  4UCT A;  4RAI A;  3FKS G;  3CD6 V;  2EIJ C;  1GN6 A;  4O2A B;  5L3D A;  2Y4T A;  2DW4 A;  4YJ2 B;  2GSM B;  2YIB D;  2EIJ B;  2B1G A;  1DK1 A;  2OYQ A;  4NVP A;  2P4K A;  4N21 A;  3CWB H;  4BWA A;  2QEX V;  2UXN A;  4UV9 A;  3TK1 A;  2Q69 A;  4JZG A;  2Q8V A;  3ABL C;  3E22 B;  1VF6 A;  2KKW A;  3JAT B;  5ITZ A;  1HNX O;  3B09 A;  4JI6 O;  4GLX A;  2K1E A;  4DRX A;  3T1Y B;  5A2Q N;  1EZJ A;  3K06 A;  4I4T A;  5LHH A;  4DV7 O;  4LFA B;  3P3N A;  4R8C A;  2WLM A;  4TV8 A;  1BQZ A;  3OR6 C;  4TOI A;  5IJ9 A;  2JJ1 G;  2DWE C;  1IBM O;  4X62 B;  2ZKO A;  2BOB C;  2VQF O;  4I5S A;  4IHJ B;  1SQB H;  1H2M A;  1S0V A;  3L70 H;  5C8Y B;  1P4R A;  2CGN A;  2PTM A;  3MHS C;  5CA1 B;  4YY3 B;  2ADP A;  1B04 A;  2F93 B;  3S3W A;  4NXM B;  5B3S C;  4GCZ A;  2EIL B;  3OM3 B;  3G4S V;  4DR1 O;  2ETN A;  4DUZ B;  4R7C A;  4DV6 B;  4UV8 A;  4FIP C;  5B3S B;  1QLE C;  4WF9 V;  1NH2 B;  3OFN G;  3S3X A;  1EFR G;  1D5A A;  4C7U A;  1RSO A;  3ZHT A;  1JMK C;  4E4E A;  1WP7 A;  1XL6 A;  2DYR C;  3H1J H;  3K5O A;  1F4N A;  1GN4 A;  4CC5 A;  5KA6 A;  4X66 B;  1XUQ A;  2F23 A;  1HNW B;  3E8F A;  3SPH A;  2FKX A;  4DR7 O;  4BIO A;  4YIO A;  4O4J A;  3H1L H;  1AI4 A;  4MVU A;  2HFE C;  3L71 H;  5EYP A;  4WBN A;  3EVK A;  3O9O A;  1JPX A;  1Y67 A;  3CCV V;  4YIP A;  4B3T B;  2HEP A;  3SJB C;  1V54 C;  3SJC C;  1N32 B;  2YSU B;  1WP8 A;  1M1K W;  1V54 B;  3JD0 A;  1MNG A;  3QVN A;  4X64 O;  3FB6 C;  2ODM A;  4W4L A;  5CBG A;  1ZUQ A;  2PZS A;  4WFF A;  3ZRW A;  4DR3 O;  5GON B;  3CEI A;  2BSK B;  2WLI B;  3SYC A;  4JI2 O;  5E1A C;  5LA6 B;  4DXW A;  1W2B U;  4ZKI A;  1I94 B;  4NR1 A;  1QVG U;  1K33 A;  3N2K A;  1R6K A;  1XMO B;  2W6I G;  3J7A U;  4AI8 A;  1WNS A;  1ZSP A;  3M99 B;  2P67 A;  3RFR A;  3JAM N;  2GV9 A;  2CDY A;  1BL8 A;  3JAK B;  3SGI A;  3UQ8 A;  1S5J A;  5CB4 B;  2ZE7 A;  1Q6U A;  4I50 A;  1IBK B;  2ZXW B;  3C3T A;  3MD0 A;  2AGA A;  3U10 A;  2WLL A;  1J95 A;  3CCS V;  4QGP A;  2ZCE A;  1KQS U;  2JS3 A;  4RUE A;  2NLJ C;  1SZX A;  3IGA C;  5EK0 A;  3QF7 A;  5FNV A;  4GUN A;  3BY6 A;  4LF7 B;  3HKE B;  4X20 B;  1WAZ A;  5IYB O;  5LMN B;  1VQL V;  1FXK C;  2CH7 B;  3QG5 A;  2XND G;  4D7S A;  4DUY O;  3WFV A;  3QTC A;  5IJ0 A;  5HFL A;  2QKC A;  2IU3 A;  1BSM A;  2B9Z A;  1YJN V;  1KB9 F;  3ZHR A;  1JFF B;  2WA3 A;  3ZHU A;  4JPR A;  3CCU V;  1BE3 H;  1VQ5 V;  2A7W A;  3G67 A;  1K34 A;  1B6Q A;  2XAF A;  5H6R A;  1YSC A;  4U3J B;  3UKM A;  2KSD A;  4JI4 O;  3L74 H;  3AG4 C;  2UXB O;  1TVK B;  3WB0 A;  4O2B A;  4EB6 B;  4B3M B;  1YI2 V;  5KHJ A;  4J11 A;  3AG4 B;  2F4V O;  2FTK A;  1J5E B;  4LFC B;  4X1K B;  2AHY A;  5CBH A;  4JAU A;  2E3C A;  1GM7 A;  4LNU B;  3RWR D;  3VOU A;  2JDI G;  5KHG A;  5B1B C;  3LDD A;  2UXC O;  3ASN B;  4ZI7 A;  4JI3 O;  3JAR A;  4CH4 A;  1KEC A;  2IH1 C;  5BMV B;  2DQ0 A;  1SQG A;  3CXH F;  2ZD9 A;  4LWS B;  4Q6G A;  2KG7 A;  5CA0 B;  1YIT V;  3ZN0 A;  5B1O A;  2P06 A;  4GX1 A;  2QTO A;  2WAM A;  2ITC C;  1SA0 B;  5IT9 N;  1N33 O;  3OAA G;  5JQG B;  4JI1 B;  2HHH O;  4J10 A;  1SQF A;  4B3R O;  3RYF A;  2UUB O;  1ORQ C;  4JV5 B;  2Q7G A;  1QVF U;  4X1I B;  1GTO A;  4P9O A;  5C93 A;  3CME V;  2EIM C;  5B66 Z;  1NR7 A;  3K9A A;  4JI0 B;  2P22 C;  1XEQ A;  4X9Q A;  4X65 O;  4LBE C;  1S5H C;  1FPO A;  2IM9 A;  3NXS A;  5B1N A;  4FLX A;  1P7G A;  1N34 O;  3LDC A;  4PV1 B;  3CJH A;  4UVC A;  1S5L Z;  4B08 A;  5TIS Z;  2DN9 A;  1M93 A;  4LF4 O;  5CA3 A;  3OE7 G;  2IJI A;  3ZMZ A;  2EZO A;  1K73 W;  4DR5 B;  4TUY B;  4D7T A;  2VQE B;  2F1M A;  3ETG A;  2QWO B;  4MTF A;  2PY5 A;  5J2U B;  2YDE A;  2QJ1 A;  4CH3 A;  3EFF K;  5LYJ A;  4RQF A;  2YIB A;  5KLV H;  2D3O W;  2G38 A;  2QE7 G;  2YUA A;  3RYH A;  5JCO C;  4O4H A;  4CS4 A;  2CE4 A;  1JVM A;  4K0K O;  1XOU A;  1VF5 B;  1G6U A;  1N0N A;  3T1C A;  1VP7 A;  4DV0 O;  3SPI A;  4JYY A;  3GB7 C;  2ITD C;  4PDL A;  5H9C A;  1ZLZ A;  2YIA A;  3CCE V;  2ZM6 O;  3OW2 U;  1M9N A;  5IWA O;  3RN4 A;  4UCU A;  4UVB A;  3FAV A;  3QO7 A;  3OMN B;  5KX5 A;  1L8D A;  1SQV H;  1FYJ A;  2L6L A;  2Q67 A;  3RYI A;  2ZE8 A;  4QJF B;  1QCE A;  4FLU A;  5LP6 A;  3BFR A;  3CCJ V;  4X8A A;  1XI1 A;  4AIL C;  4YHH O;  1NT2 B;  1QBZ A;  3A2F A;  3ZRS A;  4DV3 O;  5AG2 A;  4FM0 A;  4ZOL B;  4PDR A;  5LL6 Y;  2GHY A;  4GKK O;  5BY1 A;  3WG7 C;  1S77 D;  4WFB V;  2JS5 A;  1H38 A;  2N74 A;  4J7J A;  4GKJ O;  2A79 B;  1EN6 A;  1IBL B;  2ZIM A;  3WG7 B;  1MZE A;  5JVD A;  1Y74 B;  2A3Q A;  1VQN V;  3E83 A;  1AJP A;  4ZHQ B;  1YTF D;  3JD3 A;  4MVQ A;  4J9Y B;  2OCC C;  1EN5 A;  1QHT A;  2Q68 A;  4B3S B;  1Q5O A;  1IUR A;  3B8N A;  1HR0 O;  1FFX B;  1W59 A;  4F6R B;  4JYA B;  1T5E A;  4UCR A;  5BZB A;  1K5Q A;  2YID A;  1I08 A;  1XNR O;  2VWK A;  1N4C A;  4FFB A;  4CH5 A;  1KP2 A;  5LXT B;  4AQY B;  1YIJ V;  4O2A A;  2JGU A;  2DJV A;  5JH7 B;  4YJ2 A;  3K5N A;  1IX9 A;  1IBM B;  4X1Y B;  4PD4 F;  2BTO A;  2IJH A;  3FX7 A;  4DV1 O;  1FJG O;  4IYI A;  3E22 A;  3VQY A;  4LF8 B;  4J42 A;  1JOY A;  1TA8 A;  4OX9 B;  2OTL V;  3U11 A;  4MVS A;  4JGS A;  2BCC H;  5KAI Z;  4BR6 A;  2V7Q G;  3H01 A;  1GRJ A;  2QSA A;  1KUQ A;  2VRZ A;  3E8B A;  1QQC A;  5IYZ B;  4DR6 O;  2ARH A;  1BQ0 A;  5KA5 A;  1K9M W;  4DV4 O;  1Q82 W;  4RUF A;  1Y6X A;  3K79 A;  1EM1 A;  1JCH A;  4IHJ A;  2P5O A;  3ZMS A;  5FLX N;  3F7V C;  5CA1 A;  1DGS A;  1PL0 A;  3HPL C;  4WFE A;  3R65 A;  2AZ0 A;  1RP3 B;  2ZQM A;  2FYU H;  3W7U A;  3ABK B;  2E76 B;  1M5I A;  1R6T A;  5CMU A;  3GWK C;  3RYC B;  4NTX A;  1XL4 A;  2R9R B;  1VQ4 V;  1AP5 A;  1NR1 A;  2JIZ G;  5GW7 A;  1Z5V A;  3K57 A;  5HFM A;  1GO3 F;  1O9H A;  4G27 B;  4BAY A;  1EN4 A;  1GM8 A;  3W7X A;  3ZCC A;  3K58 A;  3P30 A;  1W0K G;  4H37 A;  1URF A;  4NB5 A;  3FYE B;  4LF6 O;  2Z3Y A;  3TJT A;  1NJI W;  4HAM A;  3JAW B;  1VMG A;  2QDO A;  4JI5 O;  1OV9 A;  4PA7 A;  4J7Z A;  5LMU B;  2EIL C;  4LF9 B;  1NVP D;  2UUC B;  2WLN A;  4H13 B;  4UCS A;  2QM7 A;  3VQW A;  2OT5 A;  4MVM A;  1RM1 C;  3F5W C;  2EIN B;  3MHH C;  2C2A A;  1M57 B;  3QO5 A;  1HNZ B;  3JAL B;  1N36 B;  4JI8 O;  1RM1 B;  4O4L B;  2YC0 A;  3ASO B;  1I5X A;  2L35 A;  2RJZ A;  5EBL C;  4N23 A;  4YJ3 A;  3SJA C;  2LGW A;  3OEH G;  1OHH G;  4TSF G;  4PA4 A;  3KKY A;  4IT5 A;  2LJ2 A;  4JYB A;  2WA4 A;  4LH7 A;  3A0R A;  4J80 A;  1PKX A;  4KHP B;  1SER A;  2HR3 A;  2AZ2 A;  3E2E A;  1R73 A;  4FZ0 A;  5IDJ A;  3CRC A;  3OTO O;  4FM2 A;  2UXX A;  4DW1 A;  5DN6 G;  2Y69 C;  2CTQ A;  3OGI B;  5ITZ B;  3EHB B;  3CRR A;  5DM6 V;  2EX3 A;  2Y69 B;  5KHI A;  4HZ3 A;  5L3G A;  2P6J A;  2KB1 A;  4MVZ A;  4TV8 B;  2ZT9 B;  1N0J A;  1SS3 A;  2ATK C;  3G6B A;  5CB4 A;  4DV5 B;  1SRY A;  4E2L A;  3B2E E;  3CHX A;  4GX5 A;  2CGO A;  1YF2 A;  4UCO A;  3BCC H;  1L0N H;  2MK3 A;  1BHA A;  1YDX A;  3O65 A;  3JD1 A;  1CP9 A;  4P30 A;  1WB8 A;  5EZY B;  2F43 G;  4FK5 C;  2Z5U A;  2DE0 X;  3T1Y O;  4LFA O;  3E86 A;  3HKE A;  1NKD A;  3OUS A;  3ZHQ A;  1LNQ A;  1ZL8 A;  4X89 A;  3FB8 C;  2QKS A;  2QM8 A;  4X62 O;  4JAS A;  2QWP B;  3HKC A;  3THO A;  5KMG A;  3CP1 A;  4JI4 B;  3W7W A;  2YEV B;  3E8H A;  1FXK A;  3JCZ A;  4LFB O;  3CC7 V;  2UXD B;  3JYC A;  1OCO C;  3OMI B;  4YY3 O;  4NXM O;  1YVW A;  2JGD A;  2X6C A;  5JJJ B;  1OCC C;  4DV6 O;  4MTX A;  4I9Q A;  1OCO B;  1ROP A;  1JFF A;  1OCC B;  2ZIN A;  1WA8 A;  2ZXW C;  4O4J B;  4FPP A;  2Y0I A;  2CTR A;  3RW0 A;  2GUZ A;  2UU9 B;  2PYL A;  5EBW C;  2QWQ B;  2JJ2 G;  5IY5 B;  2UXC B;  1F23 A;  2Z0A A;  5EYP B;  4WBN B;  1E1R G;  1OCR C;  3K0D A;  1NH2 D;  3BA8 A;  4H0L B;  4EB6 A;  2HVK C;  4QNH B;  5JJE B;  4U7O A;  1XIL A;  1Z2G A;  2OIG A;  1OCR B;  4X66 O;  2LW1 A;  5BR8 B;  1HNW O;  4JAA A;  2WLJ A;  1E79 G;  2DYS B;  3KZI Z;  1R3J C;  3KG2 A;  4LNU A;  1V55 C;  3T1H B;  1XNQ B;  4PDV A;  1V55 B;  4QPK A;  2QWR B;  4BIZ A;  4D6T H;  4B3T O;  5BMV A;  1N33 B;  4TV9 B;  2A06 H;  4LWS A;  1OJH A;  1N32 O;  1Y76 B;  4UXN A;  3B40 A;  5EIB C;  4CZZ A;  1AB3 A;  3APO A;  2BTQ B;  3N2K B;  2JK5 C;  2XAJ A;  2DWD C;  4DK0 A;  2A9H A;  4RO2 A;  4FLV A;  4RQE A;  3K5M A;  5IYD O;  1QNM A;  3F7Y C;  4JTD B;  1UPG A;  3BPZ A;  3B8M A;  2LGQ A;  5LGN A;  3MAQ A;  3TXQ A;  5JQG A;  1I94 O;  1VIB A;  1FXH A;  3BHP A;  3AG1 C;  2HLD G;  4I50 B;  4LF4 B;  3HKD A;  3A0H Z;  5FPO A;  3ASN C;  1F51 A;  3IC9 A;  5KUM A;  1FS0 G;  2WLL B;  1XMO O;  3AG1 B;  4X1I A;  3G71 V;  4FLY A;  1SZT A;  5E79 Z;  3CRQ A;  1KP3 A;  1MSW D;  4GZR B;  1WPX A;  4OPA A;  1G8M A;  1NTK H;  1PM9 A;  4UVA A;  3TXS A;  5H5N A;  5FNV B;  2RN9 A;  3QO8 A;  3CCM V;  2OCH A;  3ZMV A;  5KHH A;  2P4V A;  4FMT A;  1XMQ B;  2Q5Z A;  1IBK O;  2DMX A;  4PI0 A;  4JAV A;  1DTO A;  1NU1 H;  4TUY A;  1FXV A;  1YJW V;  2HJD A;  2R70 A;  4O4I B;  2WPD G;  2ZM6 B;  5J2U A;  1TUB B;  1YCI A;  4OPH A;  5IWA B;  1BZK A;  4PEL A;  5LMN O;  2FB5 A;  4QPJ A;  2P90 A;  5CN0 A;  5FPR A;  1NTM H;  1VQ8 V;  2GTS A;  2KQX A;  2V4D A;  4CS2 A;  1KMI Z;  2Y4U A;  2QR4 A;  4PI2 A;  4O2B B;  4TQD A;  4GYC B;  5JCO A;  3LDE A;  4ABM A;  3E8G A;  5LHI A;  3CCQ V;  5KHK A;  1YJ9 V;  1YXB A;  2JEU A;  1ZX3 A;  2ZR2 A;  2LP7 A;  3N2G B;  1TUE B;  2M6Y A;  3R66 A;  3X2Q C;  1P49 A;  1L1F A;  2E74 B;  5L3C A;  4LF5 O;  3CS5 A;  3P3P A;  4ZI7 B;  5IE9 A;  2GBO A;  5J9P C;  5L3E A;  3X2Q B;  3IC7 A;  3JAR B;  2EIK C;  4HNA B;  3FB5 C;  2Q9L A;  3OEE G;  4PJ0 Z;  2CAZ C;  4B3M O;  3J80 N;  4GKK B;  1I5Y A;  4J7K A;  4H33 A;  3H1I H;  2EIK B;  4MVR A;  5EIB D;  1J5E O;  5EC2 C;  4LFC O;  1R3L C;  2ILM A;  3LSU A;  1JJO A;  3Q4H B;  2LQT A;  2E5L B;  2PI5 A;  2QM4 A;  4I55 A;  3ZJZ A;  1GK9 A;  1W0J G;  5EC1 C;  3A8T A;  2CUG A;  2JRI A;  3W7T A;  3CRA A;  1NZ6 A;  3CX5 F;  4NXN O;  2XAS A;  1K92 A;  3K0G A;  4I0X A;  2UUA O;  1Y74 A;  2W0F C;  4LCU C;  2HVJ C;  3EXA A;  2D2C B;  2Q0A A;  5D5Q A;  4MSW C;  1D5N A;  4XDJ A;  1XDC A;  3T2M A;  4CS3 A;  4QIW F;  4JTA B;  3UO3 A;  4K35 A;  3HKB B;  3M8A A;  1COW G;  3PJS K;  1GN3 A;  2CTW A;  3CJH B;  4DR2 B;  4JI1 O;  2AHZ A;  4LP8 A;  2ZR3 A;  1EBO A;  1PPJ H;  4NYK A;  4IIJ B;  3JD2 A;  4KFM A;  2R9A A;  4FLW A;  4JV5 O;  5FL7 G;  5JH7 A;  4TT3 G;  1AI7 A;  4DV4 B;  2N04 A;  1CEZ A;  4X1Y A;  4JI0 O;  1K8A W;  1XQ8 A;  1UFI A;  4RWU A;  4JI7 B;  2W6J G;  4DR4 O;  5LYJ B;  1SKV A;  2HJF C;  4JF3 A;  1KKC A;  3RYH B;  2DOS A;  2PF4 E;  4BW9 A;  3I56 V;  4Z1M G;  3E89 A;  2XOK G;  4FFK A;  3SDL A;  3JD4 A;  3VQX A;  5A9G A;  3D36 C;  5IYZ A;  2VQE O;  2Q6A A;  5IYC O;  3DXR A;  2OIE A;  4L8J A;  4LC1 A;  4IL6 Z;  1HNX B;  5KX5 B;  1KU9 A;  4JI6 B;  2QWN B;  3CPW U;  4MT8 A;  3RYI B;  4DV7 B;  5LOV B;  4NKG B;  2X6B A;  4K8X A;  3ICX A;  2NNU A;  2O57 A;  3IJ4 A;  4FZ1 A;  1L0L H;  1X59 A;  1OCZ B;  3RYC A;  2VQF B;  4JI5 B;  2FL4 A;  4B7K A;  2HG5 C;  2IU0 A;  3RBZ A;  2XAH A;  4A5U B;  4G28 B;  2Q73 A;  1VQO V;  1P84 F;  3AK2 A;  1K4D C;  3JAT A;  3H9V A;  2GTA A;  1VQK V;  3JAS B;  4DR1 B;  3ZS8 C;  3ABU A;  1FD9 A;  4JI8 B;  3D3I A;  1LUW A;  2IBZ H;  1P7B A;  1ZWI C;  4MW3 A;  3VQV A;  4R50 A;  1PNK A;  4ASU G;  3JAW A;  3C90 A;  2YIC A;  5C8Y A;  4IGG A;  5JVD B;  3ZRV A;  2WLK A;  1MMM A;  3SYA A;  3TGU H;  1XBL A;  5K1P A;  3ABK C;  4LH6 A;  2XAQ A;  2LFS A;  2H94 A;  3E35 A;  3CC4 V;  4FVM A;  4DR7 B;  2YXY A;  5LHG A;  5EBM C;  3ML0 A;  4O4L A;  4PDM A;  1BT8 A;  1PD3 A;  4R6Z A;  4GX2 A;  1YZB A;  1FFT B;  4FFB B;  3G80 A;  3VBB A;  3I5D A;  1KBH A;  1S3J A;  4WFA V;  1VQM V;  1G1X B;  2HP8 A;  3K5L A;  3RVY A;  3STL C;  4B3S O;  1AVM A;  1H8H G;  2YI8 A;  3ZMU A;  3AK1 A;  5J2T B;  1IXM A;  3F5T A;  4JYA O;  3UT5 B;  4X64 B;  1SQP H;  1JJ2 U;  2XUM A;  2X7R B;  2EIN C;  3ABL B;  4AQY O;  1VQP V;  2RQ6 A;  1M57 C;  4DR3 B;  2JEX A;  4BIU A;  3KCY A;  5DEC A;  4JI2 B;  3ASO C;  5B5E Z;  1NQT A;  2R72 A;  4OGQ B;  2ZNI A;  4JZ2 A;  4WFH A;  2JVD A;  4EKW A;  4LF8 O;  4OX9 O;  4DYL A;  1H2N A;  4LFB B;  1AJQ A;  3K9S A;  2OWO A;  2EJR A;  3MDS A;  2Q0O C;  3QNE A;  2XT9 A;  4KUM A;  5EZY A;  2ZDI A;  4DV2 O;  1WB7 A;  4UCV A;  1TAE A;  5GON A;  2BSK A;  2WLI A;  1I0H A;  4DK1 A;  5LA6 A;  1ZTE A;  3UCS C;  5LGU A;  3SPG A;  1VF6 C;  4OXS A;  3KCX A;  3BAA A;  3ETQ A;  3SPC A;  1QLE B;  1EZV H;  1XHX A;  2RCV A;  4QE7 A;  3DGE A;  1TGO A;  1BCC H;  2Y0P A;  2ZE5 A;  1VQ9 V;  2YEV A;  1M4U A;  1R3I C;  3ZX6 A;  1MZF A;  3HR0 A;  3TCU A;  4CH6 A;  3K3W A;  1K7D A;  1JQ0 A;  4DRX B;  3CCL V;  1SQX H;  4I4T B;  3WB1 A;  1Q3E A;  5H6Q A;  3JAK A;  2DYR B;  1MG1 A;  2PGG A;  5IJ9 B;  4UUJ C;  4ZIB A;  3L75 H;  2GDS A;  1X4T A;  4FM1 A;  5DED A;  1WJZ A;  2XAG A;  3BRC A;  4DUY B;  2Q4P A;  2W0X A;  3W7S A;  2ZDI C;  1MA1 A;  1D2D A;  2M7W A;  3CCR V;  3ZRX A;  4JTC B;  2Y48 A;  4CBC A;  2BOC C;  1Y4M A;  2CK3 G;  1Q8I A;  3DTU B;  4I7Z B;  3HB3 B;  1OZ0 A;  4W4K A;  4X20 A;  2QKA A;  3ETE A;  3ETD A;  2IW5 A;  1Q86 W;  3DC5 A;  2X6A A;  4Q20 A;  1RSO B;  2CH7 A;  4K3A A;  4YJ3 B;  1PNL A;  4GT1 A;  5LMU O;  2NN4 A;  1RPR A;  4LF9 O;  2UXB B;  2UUC O;  3B4S A;  1JA8 A;  3DSQ A;  4WCE V;  1Q43 A;  5L3B A;  1M56 C;  2F4V B;  4TV9 A;  4FJC C;  4DUZ O;  1HNZ O;  1RPO A;  1N36 O;  1Y76 A;  3WU2 Z;  4XBF A;  3ZBH A;  1M56 B;  3C3S A;  2AXT Z;  1M90 W;  5IY5 C;  3UO2 A;  2ADQ B;  2BTQ A;  5F2V O;  3JSN A;  1SET A;  2YI9 A;  1XRE A;  4U3J A;  1AI6 A;  4PHZ A;  2VWJ A;  4JI3 B;  1TVK A;  4Z1V A;  3K04 A;  2H8P C;  3CMA V;  2IJK A;  3I55 V;  1GMG A;  3APQ A;  2DYS C;  4YXW G;  1SC5 B;  4QE9 A;  4KHP O;  1VAR A;  4HBN A; 
#chains in the Genus database with same CATH homology
 1YTF D;  1S0V A;  1P4R A;  3LDE A;  3JD3 A;  5LHI A;  3E8G A;  4MVQ A;  5LGT A;  1Q7Y W;  3CCQ V;  4J9Y B;  3MHS C;  2OCC C;  2Q68 A;  1YJ9 V;  3FYI B;  2JEU A;  5B3S C;  4GCZ A;  2EIL B;  2ZR2 A;  3B8N A;  2LP7 A;  3OM3 B;  3G4S V;  4BW5 A;  1KD1 W;  1TUE B;  4R7C A;  4UV8 A;  3X2Q C;  4FIP C;  1L1F A;  5B3S B;  1QLE C;  5BZB A;  4WF9 V;  1K5Q A;  3P32 A;  3ZRW B;  5L3C A;  1NH2 B;  3OFN G;  1EFR G;  5J9P C;  5L3E A;  3X2Q B;  3IC7 A;  2EIK C;  1KP2 A;  3FB5 C;  3OEE G;  1YIJ V;  3AG2 C;  1I5Y A;  4MS2 A;  1N8R W;  4H33 A;  4MTO A;  1XL6 A;  2EIK B;  4MVR A;  5EC2 C;  1R3L C;  3AG2 B;  2DYR C;  1F4N A;  1FXK B;  5KA6 A;  2IJH A;  3E8F A;  3SPH A;  1ARO P;  1JOY A;  2PI5 A;  2OTL V;  1THZ A;  4KP4 A;  4MVS A;  4JGS A;  4U7N A;  1AI4 A;  2V7Q G;  3ZJZ A;  1GK9 A;  4MVU A;  2HFE C;  1W0J G;  5EC1 C;  3H01 A;  2P7T C;  3W7T A;  4WFG A;  3SJQ C;  3E8B A;  3ZN1 A;  4PA9 A;  1JPX A;  2XAS A;  3CCV V;  1K92 A;  5KA5 A;  3K0G A;  1K9M W;  1Q82 W;  4RUF A;  2W0F C;  1V54 C;  3K79 A;  4LCU C;  1JCH A;  2HVJ C;  1K97 A;  2WLH A;  2YSU B;  3ZMS A;  1M1K W;  3LSQ A;  4MSW C;  4XDJ A;  1V54 B;  3JD0 A;  3F7V C;  3T2M A;  1KC8 W;  1PL0 A;  3HPL C;  4WFE A;  4QIW F;  3R65 A;  3AEI A;  4JTA B;  3RVZ A;  3FB6 C;  1E1Q G;  5CBG A;  2ZQM A;  1COW G;  3PJS K;  4WFF A;  3STZ C;  3W7U A;  3ABK B;  3ZRW A;  2AHZ A;  5CMU A;  4LP8 A;  2WLI B;  2ZR3 A;  1XL4 A;  1EBO A;  2IJJ A;  2R9R B;  5E1A C;  3SYC A;  1VQ4 V;  3JD2 A;  4KFM A;  1NR1 A;  2JIZ G;  4DXW A;  5B1B B;  5GW7 A;  1W2B U;  1R6N A;  4ZKI A;  5FL7 G;  5HFM A;  1GO3 F;  1QVG U;  1H8E G;  4TT3 G;  4G27 B;  4BAY A;  1GM8 A;  3W7X A;  1K33 A;  1AI7 A;  5CBF A;  3ZCC A;  4P2Z A;  1CEZ A;  1R6K A;  1K8A W;  3SYO A;  1F4M A;  2W6I G;  5LBQ A;  1AJN A;  3P30 A;  1W0K G;  4TWK A;  2W6J G;  1K4C C;  4H37 A;  3FYE B;  3M99 B;  1VQ6 V;  4I9W A;  2P67 A;  3K08 A;  2WSS G;  2Z3Y A;  2HJF C;  1NJI W;  1BL8 A;  4HAM A;  4JF3 A;  4JYC A;  3I56 V;  1DF5 A;  2EZP A;  4PA7 A;  4Z1M G;  3E89 A;  2XOK G;  3LNM B;  3ZIA G;  2EIL C;  1NVP D;  3JD4 A;  2WLN A;  2ZXW B;  2QM7 A;  3MD0 A;  1S72 V;  2X0L A;  2Q6A A;  2OT5 A;  4MVM A;  5IYC O;  1RM1 C;  3F5W C;  2EIN B;  2WLL A;  3MHH C;  4X88 A;  1J95 A;  3CCS V;  2C2A A;  1M57 B;  3QO5 A;  1KQS U;  1GKF A;  1SES A;  2OTJ V;  4RUE A;  2NLJ C;  1RM1 B;  3IGA C;  2DQ3 A;  5EK0 A;  4MVO A;  4LC1 A;  3ASO B;  3BY6 A;  4HYO A;  1I5X A;  5EBL C;  4N23 A;  1G4Y B;  3OEH G;  3CPW U;  1AR1 B;  5IYB O;  2EIM B;  4MT8 A;  1VQL V;  1DLB A;  1YTF B;  1FXK C;  1OHH G;  4TSF G;  2XND G;  4PA4 A;  3OR7 C;  4JYB A;  2X6B A;  3WFV A;  2EBO A;  2NNU A;  5HFL A;  4GX0 A;  1OCZ B;  3A0R A;  1PKX A;  1SER A;  2HR3 A;  2IU3 A;  3LUT B;  3E2E A;  2HG5 C;  1R73 A;  4PA6 A;  2IU0 A;  3RBZ A;  3UM7 A;  2XAH A;  1YJN V;  5IDJ A;  4G28 B;  1VQO V;  1K4D C;  4XDK A;  1QR8 A;  2UXX A;  3LSS A;  3GWO A;  5DN6 G;  2Y69 C;  1VQK V;  2IH3 C;  1S76 D;  3SPJ A;  4JPR A;  3CCU V;  3ABU A;  1VQ5 V;  3EHB B;  3G6E V;  5DM6 V;  2B1I A;  2Y69 B;  3D3I A;  4HZ3 A;  1K34 A;  1B6Q A;  2XAF A;  5L3G A;  2P6J A;  5H6R A;  1YSC A;  2KB1 A;  3UKM A;  1P7B A;  1ZWI C;  4L87 A;  4MVZ A;  4MW3 A;  3AG4 C;  4MW8 A;  1PNK A;  4R50 A;  1R3K C;  4ASU G;  3B77 A;  1Q81 W;  1GM9 A;  1YI2 V;  2ATK C;  5B1A C;  3ZRV A;  2WLK A;  1SRY A;  3AG4 B;  1BHB A;  4E2L A;  3SYA A;  1WLE A;  2FTK A;  4GX5 A;  4P9P A;  2AHY A;  2MK3 A;  4JAU A;  5B1A B;  5CBH A;  1BHA A;  3ABK C;  1GM7 A;  2XAQ A;  3D36 A;  2V1D A;  2LFS A;  2H94 A;  3E35 A;  3CC4 V;  3JD1 A;  1CP9 A;  4P30 A;  3VOU A;  5LHG A;  5EBM C;  2F43 G;  3ML0 A;  4FK5 C;  2JDI G;  4PDM A;  2Z5U A;  5B1B C;  3LDD A;  3ASN B;  1PD3 A;  4R6Z A;  3E86 A;  3T4Z A;  4DO2 A;  1NKD A;  1JX9 A;  4GX2 A;  3OUS A;  1KEC A;  2IH1 C;  1LNQ A;  4X89 A;  1FFT B;  3FB8 C;  2QKS A;  2QM8 A;  3IFX A;  2DQ0 A;  1KKD A;  4JAS A;  3VBB A;  2ZD9 A;  1S3J A;  4WFA V;  1VQM V;  3CP1 A;  3W7W A;  2YEV B;  3E8H A;  1FXK A;  3RVY A;  3JCZ A;  1YIT V;  3CC7 V;  3STL C;  3ZN0 A;  5B1O A;  5KUK A;  3JYC A;  1OCO C;  3OMI B;  1HWY A;  2X6C A;  1OCC C;  1H8H G;  4PA3 A;  4GX1 A;  3ZMU A;  3AG3 C;  3CXC U;  4MTX A;  1IXM A;  3CC2 V;  2QTO A;  1OCO B;  1ROP A;  2WAM A;  1OCC B;  2ITC C;  3ABM C;  2ZXW C;  3TET A;  1JJ2 U;  3CYO A;  4FPP A;  3AG3 B;  2X7R B;  3OUF A;  2EIN C;  3RW0 A;  3ABL B;  4G2K A;  1VQP V;  1AI5 A;  5EBW C;  3ABM B;  1M57 C;  2JJ2 G;  3OAA G;  5IY5 B;  2JEX A;  2LFR A;  1F23 A;  4BIU A;  1E1R G;  1OCR C;  3K0D A;  1NH2 D;  1NBM G;  3SYQ A;  4F4L A;  1MAB G;  3ASO C;  2HVK C;  4QNH B;  4U7O A;  1ORQ C;  1MOF A;  1QVF U;  2QA4 V;  1NQT A;  1OCR B;  1CPY A;  1GTO A;  4P9O A;  4XDL A;  5C93 A;  3CME V;  4WFH A;  2EIM C;  3T4D A;  1NR7 A;  2WLJ A;  1E79 G;  4EKW A;  2DYS B;  3K9A A;  1R3J C;  3KG2 A;  1UJW B;  1V55 C;  4LBE C;  1S5H C;  3ZMT A;  1AJQ A;  3ABT A;  2EJR A;  3NXS A;  3QNE A;  1K3E A;  1OCZ C;  1PNM A;  4KUM A;  4PDV A;  5B1N A;  3LDC A;  2OCC B;  1NVP B;  2ZDI A;  1DF4 A;  1V55 B;  4UVC A;  1BMF G;  4MTG A;  4QPK A;  2WLI A;  4ZBM A;  4BIZ A;  5LGU A;  5CA3 A;  3OE7 G;  2IJI A;  3ZMZ A;  3SPG A;  2EZO A;  4OXS A;  1K5S A;  3SPC A;  1QLE B;  1K73 W;  4QE7 A;  2WWW A;  3DGE A;  2HKO A;  3ETG A;  4UXN A;  1VQ9 V;  2YEV A;  1R3I C;  1H2G A;  1QR9 A;  4CZZ A;  5L3F A;  4MTF A;  2R9I A;  2JK5 C;  3TCU A;  2XAJ A;  3K3W A;  1K7D A;  2DWD C;  2PI4 A;  1JQ0 A;  2A9H A;  3EFF K;  3OMA B;  3CCL V;  4RO2 A;  4RQF A;  5H6Q A;  3SYP A;  2DYR B;  2D3O W;  2QE7 G;  1MG1 A;  3K03 A;  4RQE A;  1YHQ V;  4UUJ C;  1QLN A;  5IYD O;  1JVM A;  3F7Y C;  4JTD B;  3T1C A;  2XAG A;  3B8M A;  3SPI A;  2A0L A;  3FB7 C;  3GB7 C;  5LGN A;  2ITD C;  4PDL A;  3W7S A;  1FXH A;  2ZDI C;  3AG1 C;  2HLD G;  2M7W A;  5H9C A;  3CCR V;  3ZRX A;  1Y66 A;  4JTC B;  2Y48 A;  3ASN C;  4CBC A;  1F51 A;  2BOC C;  3CCE V;  1Y4M A;  5KUM A;  3OW2 U;  1M9N A;  1FS0 G;  2CK3 G;  2WLL B;  3AG1 B;  3G71 V;  3OGC C;  1SZT A;  1KP3 A;  4J9Z B;  4UVB A;  1MSW D;  3DTU B;  1WPX A;  2B5U A;  1ENV A;  1G8M A;  3BEH A;  3OMN B;  3QO7 A;  4UVA A;  3HB3 B;  1OZ0 A;  1VQ7 V;  3ETD A;  3ETE A;  2IW5 A;  1Q86 W;  2X6A A;  2Q67 A;  3QO8 A;  4Q20 A;  4RAI A;  4QJF B;  3CCM V;  1PNL A;  1QCE A;  3FKS G;  4GT1 A;  3ZMV A;  2EIJ C;  3CD6 V;  5L3D A;  1RPR A;  2DW4 A;  3CCJ V;  4FMT A;  2GSM B;  4WCE V;  2EIJ B;  5L3B A;  4X8A A;  2B1G A;  1M56 C;  4JAV A;  4N21 A;  4FJC C;  1DTO A;  1QBZ A;  2QEX V;  2UXN A;  4UV9 A;  1RPO A;  3TK1 A;  2Q69 A;  3ABL C;  1FXV A;  1YJW V;  4XBF A;  3ZRS A;  1M56 B;  1M90 W;  5IY5 C;  2WPD G;  4PDR A;  1SET A;  2K1E A;  2GHY A;  4PEL A;  1AI6 A;  3WG7 C;  4QPJ A;  2P90 A;  1S77 D;  1EZJ A;  3K06 A;  5LHH A;  4WFB V;  5CN0 A;  4R8C A;  2WLM A;  1H38 A;  2A79 B;  1VQ8 V;  3K04 A;  3OR6 C;  2H8P C;  2JJ1 G;  3CMA V;  2DWE C;  2IJK A;  3I55 V;  1GMG A;  3WG7 B;  2DYS C;  4YXW G;  4QE9 A;  1VQN V;  2BOB C;  3E83 A;  4I5S A;  1AJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...