3OR6C

On the structural basis of modal gating behavior in k+channels - e71q
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVQTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
molecule keywords antibody fab fragment heavy chain
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or6C00
2ATKC 3ABLC 4P9PA 2W0FC 5J9PC 3SYOA 2A79B 1G4YB 3PJSK 3T2MA 3OR7C 2AHYA 4PA4A 4ZBMA 3RVZA 4MSWC 3EFFK 4X89A 2JK5C 4JTAB 2HVJC 3F7VC 3GB7C 3LNMB 4P9OA 2WLIB 4GX0A 1K4CC 3K08A 2WLLB 3LDDA 4LP8A 4QE7A 4P30A 1ZWIC 3FB5C 2QKSA 3OUSA 4WFGA 3RBZA 3TCUA 3AG1C 3HPLC 4HYOA 2DYSC 4PDLA 3UM7A 1OCZC 2A9HA 2EIJC 3E8FA 4WFEA 5EK0A 4X8AA 4XDLA 2NLJC 4GX1A 1R3IC 1P7BA 3R65A 4MVSA 3STLC 4PA6A 3E8BA 3T4DA 2BOBC 2H8PC 2AHZA 3BEHA 3F7YC 5EBWC 4GX5A 3FB7C 3AG4C 3T1CA 4HZ3A 3OUFA 4R50A 2DWDC 4PDRA 2KB1A 1ORQC 2HJFC 4R8CA 3E83A 5E1AC 4MVRA 1XL4A 5EBLC 2YEVA 5CBGA 3SPHA 5B1AC 3E89A 1K4DC 4RAIA 4WFFA 3X2QC 2Q67A 5EC1C 2X6AA 2Y69C 4EKWA 4MW3A 4TWKA 3FB8C 3WG7C 2EINC 4PA7A 3UKMA 3STZC 4MW8A 4R7CA 3ASNC 1OCCC 3RVYA 4J9ZB 4RUEA 4BW5A 3AG3C 3K03A 4JTCB 2X6BA 3TETA 4GX2A 3K0GA 5KUKA 4UUJC 1OCRC 4MTGA 3SYPA 2BOCC 4H33A 4KFMA 2QTOA 3RW0A 4WFHA 3K06A 4MVOA 4MTFA 2DWEC 1R3JC 4RO2A 4P2ZA 4MVUA 1R3LC 3IFXA 2IH3C 2X6CA 3SPJA 5BZBA 2WLHA 4JTDB 2Q69A 2Q68A 1OCOC 4MS2A 3SJQC 4MTOA 3SPCA 3KG2A 4F4LA 3VOUA 1R3KC 4MVMA 2WLIA 3K04A 4OXSA 3OR6C 4PDMA 5CBFA 2A0LA 2ITDC 2HG5C 4H37A 5EBMC 2IH1C 1V54C 5EC2C 3ABMC 4G28B 4PDVA 5IY5C 1KKDA 4MVQA 2K1EA 1JVMA 4J9YB 4PA3A 4QE9A 3SYQA 3SPGA 4CBCA 1XL6A 1J95A 1M56C 1M57C 2ZXWC 2Q6AA 3LUTB 3FB6C 4QNHB 2WLKA 5CBHA 5B1BC 3ZRSA 3LDCA 4LCUC 2WLJA 4XDKA 3SPIA 2DYRC 4R6ZA 3ZJZA 2HVKC 2WLNA 1BL8A 2EIKC 3IGAC 3SYAA 4DXWA 5B3SC 1LNQA 2R9RB 2WLMA 4RUFA 3ABKC 2HFEC 3E8HA 3OGCC 1S5HC 2ITCC 2ZD9A 2P7TC 3LDEA 4G27B 2EILC 1QLEC 3ASOC 1V55C 5KUMA 2WLLA 4MVZA 3E86A 2OCCC 2EIMC 3T4ZA 4XDJA 4X88A 3SYCA 4LBEC 4PA9A 3K0DA 3F5WC 4I9WA 3AG2C 3JYCA 3E8GA
chains in the Genus database with same CATH superfamily
4P9PA 2XHBA 4W4KA 1V54B 3TXQA 4IIJA 3BY6A 1VF7A 3HKCB 2ADQB 3N2GB 5LGTA 4FFBA 2ZR2A 2OIEA 4LFCO 4QE7A 2WA4A 3FB5C 4WFGA 3RBZA 2DYSB 1AB3A 4D7SA 4HYOA 4PDLA 3ZHVA 1FFXA 1GN2A 1BS3A 4LWSA 3T4DA 4FZ0A 1Q6HA 3BEHA 2RJZA 4QIWF 1IDSA 3OMIB 2LGWA 2HJFC 3B40A 1NH2B 3F5TA 1R73A 5FNVA 2Y4TA 1FJGO 5BR8B 2UXBB 3ZRWB 4KHPB 1FXKC 4DR3O 4O4HB 3BPZA 1K34A 2X6BA 2HHHO 3HKBB 2BOCC 4X64O 3T1YO 3AG1B 4XBFA 4LFAO 1K73W 3SPJA 4I50A 1KYOF 1ZX3A 4F4LA 4PDMA 3H1JH 1JQ0A 1QHTA 1HW7A 3P32A 1ZSPA 1E79G 5L3EA 3ETQA 3ML0A 1NR7A 2CTQA 1K97A 4TQDA 4LCUC 2YDEA 4RUFA 1QR9A 4G27B 3H1LH 4IGGA 4QGPA 1GK9A 1JCHA 1M57B 3E86A 3VQXA 4OGQB 1NZ6A 3SYCA 4FLWA 2B5UA 3TXSA 3TGUH 1X59A 3JD2A 4NTYA 1M90W 3CP1A 4JI0B 2PI4A 2CGOA 3K3WA 2P4VA 1QCEA 1Q5OA 3DC5A 1K7DA 2H94A 5GW7A 3JASA 3CMAV 1KMIZ 1G1XB 2UUBO 1Q43A 1P49A 1SZTA 1VIBA 2ZCEA 1IBLO 2IBZH 4O4LB 2AHZA 3FX7A 4I7ZB 1AJNA 5EBWC 4UCVA 2M7WA 3OUFA 2F93B 3MDSA 2EZPA 3A0HZ 1K4DC 3KCYA 4UCOA 1L8DA 3CWBH 2Q0AA 4X65O 1NTZH 2RN9A 2LP7A 4DK1A 4WFAV 2YIAA 1H2KA 4ASUG 3QNEA 3N27A 3P30A 4DUZO 1GMGA 4MTFA 3JCUZ 2OCHA 2QM8A 2XAGA 2PF4E 2VQEB 2GTAA 4MS2A 4MTOA 3KG2A 4MVMA 3CB2A 1XNQO 1YTFB 3ABLB 1G6UA 2JS3A 1VQLV 4PA3A 2DN9A 3QO5A 5FPRA 3SPGA 3UO3A 4ZI7B 4CH4A 3RYHB 2GUZB 2YS8A 1KB9F 3JARA 1BL8A 5B3SC 1CXZB 2R9RB 3ZHTA 5IYDO 2ZD9A 4O4JB 2P7TC 1QLEC 1N32O 4XDJA 2R72A 2UU9B 3ABLC 4LC1A 3H1HH 1ZUQA 2JK5C 1J5EB 2BSKA 1AI5A 5FL7G 1F7YA 1N0JA 1EBOA 2RCVA 5LXTA 4FLYA 3OUSA 1L0LH 1V55B 4JI8O 1VF6C 1WPBA 1S3JA 2A9HA 3E22B 3EHBB 2ETNA 2OIGA 1PKXA 1JPXA 2HHHB 3AK1A 1MOFA 1ORQC 4LR3A 1BHBA 2IJJA 4LFAB 5TISZ 1O9GA 1Y4MA 3AG7A 1KP3A 3J81N 2JGDB 4TWKA 2YSUB 2ZNJA 4MW8A 3ABKB 3ETEA 3VQWA 4EB6B 3JASB 4MTGA 2Q5ZA 2RNBA 4X1YB 4ZOLA 3W7WA 1Q81W 4LFBB 4X1IB 5KHIA 1WN7A 2FYUH 1GH6A 3G80A 1FKAO 2ITDC 5EBMC 3CCMV 5L3FA 4G28B 2N04A 5KX5A 4QPJA 4PD4F 4DUZB 2AZ0A 3QO7A 1FAFA 1NJIW 3N2KA 1XOUA 4GLXA 1N34B 2ZXWC 3ZMZA 5KAIZ 2VQEO 1YTFD 4LF9B 1VMGA 1U96A 1WAZA 4IIJB 2DYRB 3D3IA 4YIPA 1BMFG 1SZXA 4DV0B 4YHHO 5KHKA 5CA0B 1YXBA 5FNVB 5HFLA 5DM6V 4F6RB 1V9PA 1UJWB 5EYPA 2A79B 3SR2C 4I9QA 3QO8A 3RVZA 1R6KA 2AHYA 4MSWC 2ADPA 2YICA 2HVJC 2YXLA 4I4TA 2WWWA 1ZWIC 2Q0OC 3GVMA 5E79Z 3ZMTA 1H2SB 1VQNV 1FXKA 5A9GA 4PHZA 4WCEV 2ODMA 3STLC 1P7GA 3UT5B 4UCRA 1M4UA 1J5EO 2ZR3A 1SF9A 3S3XA 2EULA 4LF8B 4JI1O 5ITZA 4WFFA 4LF4O 4IYHA 2Q7GA 3CEIA 2YI9A 3U0ZA 2QWRB 2E5LO 3BHPA 1VQ8V 2C2AA 2XAJA 1XNQB 1WA8B 4KFMA 3ZN1A 4JZGA 2JJ1G 2XTAA 1I7FA 1EN5A 4YIOA 3BA8A 4MVUA 3JAWA 5BZBA 2JDIG 1ZL8B 5KA6A 3WB2A 1JR9A 3HKDA 2YIBA 3G4SV 1P4RA 1QU7A 3DC6A 4RQFA 1AR5A 1V54C 4KL1A 1S0VA 1N8RW 3E35A 4PDVA 4DUYB 1JVMA 4X9QA 3SYQA 1F4NA 5B1AB 1RP3B 1M57C 1SQVH 4DV4O 2PGGA 1SETA 5CBHA 1HNZO 1K3EA 1GM8A 1LUWA 4DRXA 4QPKA 3SYAA 1GN4A 2L6LA 2UXNA 1XHZA 2GDSA 1YF2A 2IJHA 3M8AA 5LMUB 5JWPA 2FB5A 2LW1A 4DR1O 3DSQA 3K0DA 1NI8A 5JH7A 3PJSK 5CA3A 4JYAB 1AP6A 4JI7O 2LFRA 1G8MA 4N23A 4DR6B 2JGDA 3K08A 1JOYA 4FK5C 2QKSA 4BWAA 1NH2D 3AG1C 1JJ2U 3CJHB 2VQFB 1MABG 2GSMB 2JEUA 4PA6A 3E8BA 2BOBC 2JVDA 1OZ0A 3AG4C 3T1CA 4NKGB 4R50A 2Y48A 1QQCA 4JI2O 4JYCA 1I0HA 3SDLA 4NXNB 1SQGA 1QLNA 5AG2A 2CTWA 1AJQA 1WJZA 2LW7A 1SQPH 1HNXO 1HDJA 1AR4A 5LYJB 4J7JA 1EZVH 4BW5A 1Z2GA 3SGIA 4GX2A 4BW9A 1YI2V 3JATB 3CRAA 4DO2A 3MHSC 4OX9O 1H2GA 4JI1B 1R3JC 1YJWV 4H13B 4RO2A 2ARHA 2ZNIA 4LF8O 1WPXA 2Q69A 4ZKIA 1FS0G 4ZHQA 3OMNB 1NQTA 5BMVB 2HLDG 2RMKB 3H01A 4TV9B 5K1XA 4FVMA 2ZM6O 2VWKA 4F6RA 3JCZA 4QE9A 5D5PA 4YY3O 3AEIA 3WU2Z 3FYEB 3L72H 4J11A 5JJNB 4FLVA 3CXHF 2WAMA 4JI3O 1H8HG 3K5OA 1AP5A 2WPDG 4YJ2B 2YXYA 4I5SA 1S5HC 1TUBB 4X62O 5KMGA 1BZKA 5KHJA 3AG2C 4NYKA 5IY5B 4K3AA 4K0KB 4J41A 3THOA 2QWNB 3KCXA 4LF5O 3GB7C 1R6NA 3HKEB 3P3NA 4JYBA 4YXWG 1AVMA 1K5SA 1OJHA 4DR7B 3HKEA 2DYSC 1PM9A 3JD1A 4JI6B 5LMUO 3JARB 4DV2B 3L74H 2EJRA 5IT9N 3G71V 1PL0A 3GWOA 1SQBH 1RSOB 3CC7V 4EKWA 3WG7C 1PNKA 2AGAA 5B1OA 2JRIA 4X64B 4H33A 3I55V 2QTOA 2V7QG 4BIUA 4B3RB 5CN0A 4TSFG 4JI2B 3UO2A 3CYOA 1R3LC 3IFXA 2IH3C 4E2LA 2N05A 2QKAA 3VQVA 2H3OA 2CDYA 3OR6C 2A0LA 4JPRA 2LO1A 4LFCB 4IHJB 4O4LA 1KKDA 1WLEA 4MVQA 3RYCA 3X2QB 2HR3A 3JALA 2F4VO 5H5NA 1VF6A 1YDXA 1NU1H 4D7TA 4O2BA 4DR5B 5KHHA 3ZRSA 5HFMA 4FJCC 4DV6B 1S5LZ 4LNUA 5BY1A 1IURA 2O57A 5J2UA 4LF6B 1NS1A 5EZYA 4CH5A 2OTLV 4DR6O 2UXCO 2W0XA 4TQFA 5LHIA 4U7OA 4B3MO 2P90A 2A06H 2ZDIC 3CC4V 4PA4A 3T1HO 1F23A 4ZBMA 4X89A 1BCCH 2KKWA 3RYIB 3B8NA 1N4CA 3G6BA 2UXXA 1SRYA 4DW0A 1H2NA 3HPLC 3CRQA 2NNUA 3ICXA 5IYZA 4B3TO 3U11A 1HNXB 1S77D 1GKFA 4GX1A 1R3IC 1P7BA 2QM7A 2CUGA 2H8PC 2Q7EA 2GUZA 1QVFU 5LP6C 3F7YC 3GWKC 4GX5A 4JAVA 4CH6A 2KB1A 4BR6A 3BA9A 4LF7O 1XL4A 3K9AA 2QJ1A 4NB5A 3B2EE 4AI8A 4DR4O 4RAIA 1PV0A 2Q67A 5EC1C 2Y69C 4A5UB 1NTKH 3K9SA 2PY5A 1JFFB 1OCCC 4RUEA 5LBQA 2ZM6B 1FYJA 1VP7A 5B1BB 1US6A 1A32A 1YITV 3FD9A 3TJTA 4JI3B 3SJCC 5KA5A 3D36A 4O4IB 3H1KH 1MSWD 3L70H 3ZS8C 1PL4A 1M5IA 2QGNA 1D5AA 2K1EA 4X62B 2QDOA 5LOVA 1KKCA 3A0BZ 2PYJA 4B3RO 1J95A 3SJBC 1ZL8A 1B3QA 3FB6C 4QNHB 3DGEA 1VEWA 3EVKA 1IXMA 4HNAA 4CS2A 2HVKC 5JVDB 1Y76A 2ZKOA 1DK1A 1FXHA 2EILC 1D5NA 5L3CA 3O65A 2Q4PA 5ITZB 2FL4A 4EFBA 3T4ZA 4DV3O 3L9DA 5H9CA 3L71H 3JAKA 1TVKB 3B8MA 2YEVB 2BE3A 4PELA 4DV6O 4KXRA 4W4LA 5C8YA 5K1PA 4LP8A 5IJ0A 2UXCB 3IAYA 1NKDA 2GTSA 2KQXA 2JGUA 4YHHB 5JCOA 3O9OA 3ZRVA 2JS5A 1AI4A 3AG3B 4L8JA 3ZMSA 2Y4UA 3ETDA 1W59A 3T1HB 2Z0AA 1AJPA 3FAVB 3QF7A 5B5EZ 3OTOB 5H2FZ 3X2QC 1K5QA 3C90A 2UXDB 2F66C 3RYIA 4UB6Z 2CAZC 3AG3C 4CC5A 5F2VO 3W7TA 3SYPA 3CSXA 2BTQA 1B06A 4WBNA 1IXBA 4LNUB 3RW0A 3RYFB 4LF7B 4WBNB 1F51A 1X4TA 3SJAC 5GTHZ 5H6RA 5KX5B 5L3BA 4JTDB 4ZIBA 2KG7A 1WA8A 1Q90D 5LYJA 4RQEA 4LH6A 2DQ3A 4EFEA 3LSQA 2E5LB 2Q8VA 3QVNA 1Z5WA 3MD0A 4TV8B 3RYHA 1FFTB 1AROP 4UFZA 5LA6B 3CS5A 2Y0PA 1IX9A 1Y67A 3CMEV 5B66Z 1MNGA 4DR3B 3CXCU 3ZHUA 1WB8A 3OGCC 4CZZA 2IU3A 3ASOC 5IYZB 1VQKV 1V55C 3M7MX 1JFFA 4EEQA 4MVZA 1NBMG 2EJ7A 4JI5O 3BABA 4C7UA 1HR0B 1Y6XA 3OTFA 3M99B 3JYCA 3E8GA 2VWJA 2ZE8A 3OR7C 4TOIA 1PP9H 1OHHG 4P9OA 2N74A 1K4CC 2WLLB 4AQYB 1RFYA 2OWOA 3ZN0A 1Y74B 1SS3A 4DR4B 4UCSA 1B6QA 1OV9A 1S5JA 4DV3B 3P3PA 2D3OW 3E8FA 4J10A 1H2MA 1SQQH 3R65A 2E76B 5GONB 4HAMA 4FZ1A 3IJ4A 3WB1A 2CK3G 2X7RB 4GT1A 1SESA 4HNAB 1I5YA 4GCZA 3ZMVA 4DYLA 1RPOA 5LXTB 4LF4B 2W6IG 3CE2A 3D3QA 1GAXA 4KHPO 3WB0A 1MSDA 4J42A 1XBLA 2VQFO 1Z5VA 2B1IA 1EZJA 4J9ZB 5J2UB 3RVYA 3BAAA 5D5QA 2YXHA 4ZI7A 2IJIA 3N2GA 1UFIA 3OMAB 2Q68A 3JD0A 2YIBD 1K8AW 3ZEDA 3ABUA 4UCTA 3OW2U 1YJNV 3S3WA 1CPYA 1WP8A 5CMUA 5KLVH 5IWAB 2WLKA 4CS3A 1H38A 4XDKA 3FYIB 1SC5B 1M93A 2IM9A 1LNQA 1XEQA 1VQPV 4ICGA 2ITCC 1N36B 4I0XA 1M56B 1MG1A 2DQ0A 4FIPC 5J2TB 2ATKC 4WFBV 2AW9A 3ABMB 2QWOB 4JI7B 2XNDG 4JTAB 3LNMB 2NR5A 4P30A 2LFSA 2XAQA 3E2EA 2L35A 4Q6GA 4X1YA 1M9NA 3N2KB 3QTCA 5JVDA 4JI5B 4YJ3A 1IBLB 2EIJC 5JJEB 2B9ZA 4O4IA 4FLXA 4JAUA 3ASNB 1ZTEA 1DTOA 3CJHA 2IJKA 5A2QN 4FLUA 5B1AC 4O2BB 1HNZB 3U10A 1GN6A 4CH3A 4FLZA 2UUAO 3OM3B 5B3SB 3MHHC 1IVSA 4ZHQB 3APOA 1QVGU 3LSUA 4NXMO 2LQTA 1W0JG 2QA4V 4UV9A 3SPCA 2WSSG 1XNRO 5CBFA 4X66O 1HNWB 5IY5C 3E22A 3CCEV 2XAFA 4Z1MG 1DF5A 2ZINA 2AXTZ 3HR0A 4I50B 2X0LA 5DN6G 4JV5B 3K59A 1SERA 1IBKB 1JX9A 2EIKC 1XUQA 4DXWA 3BCCH 4GYCB 1JA8A 1Y76B 4GZRB 2P06A 3JSNA 1GO3F 1KECA 2ZE7A 1TUBA 1VQ7V 4LFBO 4TV8A 3ABTA 3OE7G 1QNMA 2G38A 3EFFK 3VQYA 2ILMA 1N36O 2WLIB 4B7KA 4FMTA 4TUYB 4Z1VA 2RDCA 5IYCO 4NTXA 4U3FH 1DGSA 2GV9A 1BHAA 4UCUA 1K92A 3JALB 4Z2WA 1IBMB 1KP2A 5LP6A 1Y74A 2MW2B 1XHXA 3W7UA 3CCRV 4GKJB 5LHGA 1XILA 1VQOV 2A7WA 1BSMA 2CGNA 4UVAA 4D6TH 1HWYA 1DLBA 3FB8C 1NVPD 3UKMA 2OT5A 4JZ2A 3ASNC 3LSSA 4DR2O 2GBOA 1PNLA 2MK3A 1S76D 3K0GA 4H44B 2UUCO 1N32B 1R1BA 1K33A 1SQXH 2XAHA 3LNNA 4KUMA 5JQGB 4MVOA 2R9AA 1R6TA 1SQFA 5FPOA 1D2DA 2EX3A 1GM9A 4B08A 1YVWA 1CEZA 1PPJH 3K04A 4OXSA 1Q6UA 2F23A 5KAFZ 4H37A 5EC2C 2IH1C 3AK3A 2ZE5A 3ABMC 1ZLZA 1AI6A 2P5OA 1KD1W 1CP9A 5LHHA 1UPGA 2P4KA 3K58A 1ROPA 1XMQO 2VRZA 1YCIA 4LF9O 4KP4A 5GONA 2OTJV 1GRJA 4ZOLB 4UXNA 2ZDIA 2R9IA 2EIKB 2EBOA 1U97A 1JJOA 2FMLA 1YHQV 1XNRB 3ZHQA 3LDEA 4X1IA 5J2TA 1FXKB 1FD9A 1AI7A 2WLLA 1HNWO 2OCCC 3RYFA 4FFBB 3T1YB 2Y0IA 4FFKA 4I0XB 5J9PC 3SYOA 4E4EA 5LMNB 1IBKO 3F7VC 4O2AB 3K79A 3LDDA 4X20B 4JI4B 4JASA 3OGIB 1E1RG 3RGBA 4I55A 4B3TB 5CB4A 4WFEA 3EXAA 4FPPA 4BIOA 3B09A 3IC7A 4PDRA 3HKDB 1QR8A 3E83A 2CTPA 1SA0B 5EBLC 3SPHA 4NXMB 5IJ9B 2ZE6A 4U3JB 5BR8O 5IYBO 2UXBO 2FTKA 3W7XA 1FXVA 1KUQA 1P84F 1H8EG 2EINC 1IBMO 1GN3A 2QE7G 4JF3A 1EFRG 1VQ9V 4IL6Z 3K5LA 4LH7A 4OPHA 2Q9LA 4X66B 4GKJO 1WNSA 4DV0O 4AHCA 5LL6Y 2DWEC 3OAAG 3K5MA 2X6CA 1LUVA 3W7SA 4JV5O 3KKYA 4DV5O 4GUNA 4TUYA 3CRMA 2WLIA 4EB6A 1RM1B 1F4MA 4PI2A 4UB8Z 3WFVA 1MZEA 3AG2B 2YIDA 5L3DA 5KMGB 2V4DA 1BGYH 4DV4B 3DXRA 1M56C 2Q6AA 3RT3C 3B77A 2EZOA 2WLJA 3CCQV 3PN1A 2DYRC 5JQGA 4CC6A 1ZAUA 4ABMA 3CRRA 1OCCB 4J80A 2QEXV 4TT3G 2ZXWB 2R70A 1N33B 3CHXA 5C8YB 4OX9B 4WF9V 3LDCA 2W6JG 3RN4A 3ZHSA 4UVBA 3ZHRA 2AZ2A 4J7ZA 1T5EA 2DJVA 2EIMB 4B3SB 1OCZB 3TCUA 1E1QG 1MMMA 3UM7A 2QWPB 1K9MW 1L0NH 1XDCA 1KQSU 1HR0O 1DF4A 2PUSA 3OEEG 2UUCB 2CE4A 1EN4A 1IZ3A 3CCVV 5LMNO 4DV7B 2UXDO 1FPOA 4JI4O 2BTQB 5JCOC 4PA7A 4Q20A 1PNMA 2YC0A 1JMKC 1TAEA 3K5NA 5IE9A 3TETA 3BVOA 2HKOA 1W0KG 4DR1B 4X1KA 5GTIZ 3G67A 3OEHG 2CTRA 4YJ3B 4P2ZA 3Q4HB 4JGSA 4RWUA 4JI8B 2CH7B 4JI6O 3JD4A 1R3KC 2P6JA 5DEDA 1RM1C 3HKCA 4IHJA 4U3JA 4PI0A 2D2CB 2Z5UA 1NVPB 4G2KA 2F95B 2OCCB 2P67A 3OT7A 4DV5B 2IU0A 3I5DA 1WB7A 5LP6B 3SPIA 4DRXB 3ZIAG 4FLTA 3J7AU 5LA6A 1TUEB 2EINB 1VQ4V 3ZBHA 4NXNO 5LOVB 4DV1O 3CCLV 4X88A 3D8CA 3ZRXA 3JATA 5FLXN 5IWAO 4CS4A 1XMOB 2UU9O 1G4YB 5EYPB 3D36C 2IW5A 4LF5B 4JYYA 3T2MA 4FM2A 1GM7A 1YSCA 2LGQA 1KBHA 3JAWB 4K8ZA 4MT8A 5C93A 1N33O 2LJ2A 3RYCB 2BSKB 4O4JA 5JJJB 1M1KW 3OFNG 2ZIOA 1Q3EA 2E74B 4LF6O 2DWDC 1NR1A 5E1AC 4BIZA 1YEWA 2BTOA 2P22C 3CCSV 3E89A 3CCJV 5JH7B 2X6AA 2V1DA 4B3SO 4MW3A 3MAQA 1Q82W 1SA0A 3J80N 5KUKA 4UUJC 2KSDA 1VARA 1AR1B 3UCSC 3ZX6A 3CCUV 4DV7O 3TK1A 3DTUB 3C3SA 2DMXA 1OCRB 2WLHA 4K0KO 1THZA 4K35A 2F1MA 4OPAA 1Y66A 2VS0A 1TVKA 3ETGA 4MTXA 1NT2B 2QTSA 4J9YB 5LGUA 1Q86W 3NR7A 1EM1A 2DOSA 1Q7YW 3LUTB 3JD3A 2PYLA 4DR5O 1N34O 5EZYB 2EILB 3R66A 2HJDA 2B1GA 2PI5A 3H1IH 2ZT9B 3IGAC 3K57A 3FFQA 2RQ6A 2WLMA 1VQ5V 4K8XA 5DECA 2EIMC 1KU9A 1VQ6V 1H2LA 2PTMA 2Q7HA 4B3MB 3CD6V 3AK2A 5CA1A 2XASA 1I08A 3FKSG 2QR4A 5EIBD 3L73H 1COWG 2Z3YA 4GX0A 2A3QA 3UT5A 2E75B 1RPRA 4UVCA 1AILA 1YZBA 3NXSA 4L87A 4DV1B 4XDLA 4MVSA 3A0RA 4YJ2A 2M6YA 1XMOO 3CRCA 3FB7C 2F4VB 2Y69B 5L3GA 1ENVA 1NTMH 1YIJV 1HP8A 3HKBA 5BMVA 2PZSA 3STZC 1Q6IA 5KHGA 4R7CA 2UUAB 1PD3A 1XI1A 4GKKB 3K03A 3Q4HA 4J7KA 5B1NA 4PJ0Z 3ZCCA 3JAKB 3APQA 2E3CA 4QJFB 1RSOA 3K06A 1S72V 1BQZA 4I55B 2OYQA 4B7EA 2ZQMA 2QM4A 4FM1A 1O9HA 3SJQC 3VOUA 4IYIA 4JAAA 1URFA 2DW4A 2HG5C 3ZRWA 1FFXB 2CH7A 4O4HA 1I94B 4HBNA 1LR1A 2XOKG 5IJ9A 4NTWA 1GTOA 2ZIMA 3ASOB 5B1BC 1I5XA 1MZFA 1KC8W 3H9VA 3ZJZA 4DK0A 3IC9A 2QWQB 3CX5F 1YJ9V 3HB3B 2Q73A 3QG5A 4I4TB 4JTCB 3I56V 2JIZG 2W0FC 3RFRA 1Q8IA 3FAVA 3BFRA 3KZIZ 2K9PA 1OCOB 4IT5A 2XUMA 4JYAO 2WA3A 1N0NA 2EIJB 4AILC 2F43G 1FJGB 3DXRB 4YY3B 3BRCA 1OCZC 4F6EA 5EK0A 4X8AA 2NLJC 2YI8A 4JI0O 3RWRD 3A8TA 1W2BU 3WG7B 4HZ3A 5CB4B 3CPWU 4R8CA 4MVRA 3OTOO 2DE0X 2YEVA 5CBGA 5CA0A 4UV8A 4X1KB 4PV1B 5IJ0B 1VF5B 1BE3H 4LWSB 3AG4B 4DR2B 2HP8A 1MA1A 1EN6A 4DUYO 3C3TA 5CA1B 1OCRC 4NR1A 3CC2V 1XQ8A 4N21A 4WFHA 2QSAA 4AQYO 4H0LB 3G6EV 1TGOA 4DR7O 3UQ8A 2BCCH 5LGNA 2GHYA 1OCOC 4U7NA 4X65B 5IDJA 3ZMUA 4DV2O 4GKKO 1QBZA 2KG7B 3L75H 4BAYA 4CBCA 1XL6A 1XMQB 1WP7A 2QKCA 3JSLA 4NVPA 1QLEB 1B04A 1BQ0A 3JAMN 2JJ2G 2FKXA 4R6ZA 2WLNA 1SKVA 5EIBC 3ABKC 2HFEC 3E8HA 5BXZA 3VBBA 1XREA 1I94O 3A2FA 5KUMA 1L1FA 1BT8A 1VQMV 2XT9A 2NN4A 2JEXA 4O2AA 3OD4A 3B4SA 4DW1A 4FM0A 4LBEC 4PA9A 5H6QA 2UUBB 4TV9A 1TA8A 2YUAA 3F5WC 4I9WA 4X20A 2HEPA
chains in the Genus database with same CATH topology
2W6JG 4P9PA 5CA3A 1V54B 4UVBA 3OR7C 3BY6A 1OHHG 2LFRA 5LGTA 2ZR2A 1G8MA 4P9OA 4N23A 1K4CC 3K08A 2WLLB 4QE7A 1JOYA 3ZN0A 3FB5C 4FK5C 2EIMB 2QKSA 1OCZB 4WFGA 1B6QA 2DYSB 3RBZA 1E1QG 3AG1C 4HYOA 3TCUA 4PDLA 1NH2D 3UM7A 1JJ2U 1MABG 2D3OW 3E8FA 1K9MW 2GSMB 3R65A 2JEUA 4PA6A 3E8BA 3T4DA 2BOBC 4HAMA 1KQSU 3BEHA 1DF4A 3OEEG 2CK3G 1OZ0A 2X7RB 3AG4C 4QIWF 3OMIB 4R50A 3T1CA 4GT1A 1SESA 2Y48A 2HJFC 1NH2B 3CCVV 4JYCA 1I5YA 4GCZA 1R73A 3ZMVA 1RPOA 1QLNA 2W6IG 3ZRWB 1AJQA 1FXKC 4PA7A 4Q20A 2B1IA 1PNMA 1EZJA 1K34A 4J9ZB 3RVYA 4BW5A 3TETA 2X6BA 4GX2A 1YI2V 2HKOA 2BOCC 4DO2A 3MHSC 1W0KG 1H2GA 3AG1B 4XBFA 3OEHG 1R3JC 1YJWV 4RO2A 1K73W 4P2ZA 2IJIA 3SPJA 4JGSA 1WPXA 2Q69A 3JD4A 3OMAB 4ZKIA 2Q68A 1FS0G 3JD0A 3OMNB 4F4LA 1NQTA 1R3KC 1K8AW 4PDMA 2P6JA 2HLDG 1RM1C 3ABUA 3H01A 1JQ0A 3P32A 3OW2U 1YJNV 2Z5UA 1NVPB 3JCZA 1E79G 4QE9A 5L3EA 4G2KA 3AEIA 1CPYA 5CMUA 3FYEB 3ML0A 1NR7A 2OCCB 1K97A 2WAMA 2P67A 2WLKA 1H38A 1H8HG 4LCUC 4XDKA 2IU0A 3FYIB 3SPIA 1LNQA 1VQPV 2WPDG 3ZIAG 4RUFA 4I5SA 1QR9A 1S5HC 2ITCC 1TUEB 4G27B 2EINB 1VQ4V 1GK9A 1JCHA 1MG1A 1M56B 1M57B 3E86A 3CCLV 2DQ0A 4X88A 3SYCA 2B5UA 3ZRXA 4FIPC 3AG2C 5IY5B 3JD2A 2ATKC 4WFBV 1M90W 3ABMB 3CP1A 1G4YB 2PI4A 2IW5A 3PJSK 3T2MA 3K3WA 2XNDG 4JTAB 1QCEA 3GB7C 3LNMB 1K7DA 1R6NA 4P30A 2H94A 4JYBA 4YXWG 2LFSA 2XAQA 1GM7A 5GW7A 1YSCA 3E2EA 1K5SA 1M9NA 2DYSC 3JD1A 3CMAV 4MT8A 5C93A 1SZTA 2EIJC 1M1KW 3OFNG 2EJRA 2AHZA 4JAUA 1AJNA 3ASNB 5EBWC 2M7WA 3OUFA 2DWDC 1NR1A 1DTOA 3G71V 1PL0A 5E1AC 4BIZA 2IJKA 2EZPA 3GWOA 5B1AC 3CCSV 3E89A 1K4DC 3CCJV 3CC7V 4EKWA 2X6AA 2V1DA 4MW3A 3WG7C 1Q82W 2LP7A 1PNKA 4WFAV 3OM3B 5B1OA 3MHHC 5B3SB 5KUKA 4UUJC 4ASUG 3QNEA 1AR1B 3P30A 4H33A 1QVGU 3I55V 2QTOA 2V7QG 4BIUA 1GMGA 3CCUV 5CN0A 3TK1A 3DTUB 4MTFA 4TSFG 1W0JG 3CYOA 1R3LC 2QM8A 2IH3C 1OCRB 2XAGA 3IFXA 2WLHA 4E2LA 1THZA 2QA4V 4UV9A 4MS2A 3SPCA 4MTOA 1Y66A 3KG2A 2WSSG 4MVMA 3ETGA 3OR6C 5CBFA 2A0LA 4JPRA 4MTXA 1YTFB 3ABLB 5IY5C 1KKDA 1VQLV 1WLEA 4MVQA 3CCEV 4J9YB 4PA3A 3QO5A 2XAFA 3X2QB 2HR3A 4Z1MG 1DF5A 5LGUA 1Q86W 3SPGA 1Q7YW 3LUTB 3JD3A 2X0LA 2EILB 3ZRSA 5HFMA 5DN6G 4FJCC 2B1GA 2PI5A 1SERA 1JX9A 1BL8A 2EIKC 3IGAC 4DXWA 5B3SC 2R9RB 2WLMA 1VQ5V 5IYDO 2ZD9A 2OTLV 2P7TC 1QLEC 1GO3F 2EIMC 1KECA 5LHIA 4U7OA 4XDJA 1VQ6V 3CD6V 3ABLC 2P90A 1VQ7V 2XASA 3ABTA 4LC1A 3OE7G 2ZDIC 3CC4V 3FKSG 4PA4A 1F23A 4ZBMA 3EFFK 4X89A 2JK5C 1AI5A 5FL7G 1COWG 2Z3YA 2WLIB 3B8NA 4GX0A 4FMTA 1EBOA 1RPRA 2UXXA 5IYCO 4UVCA 3OUSA 1SRYA 3NXSA 1V55B 3HPLC 1BHAA 1S3JA 1K92A 2NNUA 4L87A 2A9HA 4XDLA 1GKFA 1KP2A 4GX1A 1R3IC 1P7BA 3EHBB 4MVSA 1S77D 3A0RA 2QM7A 2H8PC 1QVFU 1PKXA 3W7UA 3F7YC 3CCRV 1JPXA 4GX5A 3FB7C 4JAVA 1MOFA 2KB1A 5LHGA 1ORQC 1VQOV 2Y69B 1XL4A 3K9AA 5L3GA 2IJJA 1BHBA 1Y4MA 4RAIA 1ENVA 4UVAA 2Q67A 5EC1C 1KP3A 2Y69C 1HWYA 1DLBA 1YIJV 4TWKA 3FB8C 1NVPD 2YSUB 3UKMA 3STZC 4MW8A 4R7CA 2OT5A 3ASNC 1OCCC 3ABKB 1PD3A 3ETEA 3LSSA 4RUEA 3K03A 1PNLA 2MK3A 5LBQA 1S76D 3K0GA 5B1NA 3ZCCA 4MTGA 1K33A 4QJFB 2XAHA 4KUMA 3W7WA 5B1BB 3K06A 4MVOA 1S72V 2ZQMA 1Q81W 1GM9A 1YITV 3SJQC 5KA5A 1CEZA 3D36A 3VOUA 3K04A 4OXSA 2DW4A 2ITDC 2HG5C 4H37A 5EBMC 2IH1C 5EC2C 3ZRWA 5L3FA 3CCMV 1MSWD 3ABMC 4G28B 1AI6A 2K1EA 4QPJA 1KD1W 1CP9A 5LHHA 3QO7A 2XOKG 1NJIW 1J95A 2ZXWC 3ZMZA 1ROPA 3FB6C 4QNHB 3DGEA 1GTOA 5B1BC 3ASOB 1IXMA 1YTFD 1I5XA 1KC8W 4KP4A 2OTJV 3ZJZA 2HVKC 2ZDIA 4UXNA 2R9IA 2EIKB 2DYRB 2EBOA 3D3IA 1YHQV 1BMFG 1FXHA 3LDEA 2EILC 5L3CA 1FXKB 1YJ9V 3HB3B 1AI7A 2WLLA 2OCCC 5HFLA 3T4ZA 5DM6V 5H9CA 1UJWB 4JTCB 3I56V 3B8MA 2JIZG 2W0FC 2YEVB 3SYOA 2A79B 5J9PC 4PELA 3QO8A 3RVZA 1R6KA 2AHYA 4MSWC 1OCOB 2HVJC 3F7VC 4LP8A 3K79A 3LDDA 2WWWA 2EIJB 1NKDA 1ZWIC 2F43G 4JASA 1E1RG 3ZMTA 1OCZC 1VQNV 1FXKA 4WCEV 5EK0A 4WFEA 4X8AA 2NLJC 4FPPA 3ZRVA 3STLC 1AI4A 3AG3B 1W2BU 3IC7A 3WG7B 4HZ3A 3ZMSA 2ZR3A 3ETDA 4PDRA 3CPWU 1QR8A 4R8CA 3E83A 1AJPA 4MVRA 5EBLC 2YEVA 5CBGA 3SPHA 4UV8A 4WFFA 3X2QC 1K5QA 5IYBO 2FTKA 3W7XA 1FXVA 1H8EG 2EINC 2QE7G 4JF3A 3AG4B 1EFRG 1VQ9V 3AG3C 1VQ8V 2C2AA 2XAJA 3W7TA 1OCRC 3SYPA 4KFMA 3ZN1A 2JJ1G 3CC2V 3RW0A 4N21A 4WFHA 2DWEC 3OAAG 4MVUA 1F51A 2X6CA 5H6RA 3W7SA 5BZBA 2JDIG 5KA6A 5L3BA 3G6EV 4JTDB 5LGNA 2GHYA 3G4SV 1OCOC 4U7NA 4RQEA 1P4RA 5IDJA 2WLIA 3ZMUA 4RQFA 2DQ3A 1RM1B 1F4MA 1V54C 3WFVA 1QBZA 1N8RW 1S0VA 3E35A 4PDVA 3LSQA 1JVMA 3AG2B 3MD0A 5L3DA 4BAYA 3SYQA 1F4NA 5B1AB 4CBCA 1FFTB 1XL6A 1AROP 1M56C 1M57C 2Q6AA 3B77A 1QLEB 1SETA 5CBHA 1K3EA 2EZOA 1GM8A 3CMEV 2WLJA 3CCQV 2JJ2G 2DYRC 4R6ZA 4QPKA 2WLNA 3SYAA 2UXNA 3CXCU 1OCCB 2HFEC 3ABKC 3E8HA 3OGCC 4CZZA 2IU3A 2QEXV 3VBBA 3ASOC 4TT3G 1V55C 5KUMA 2IJHA 1L1FA 1VQKV 2ZXWB 4MVZA 1NBMG 1VQMV 2JEXA 4WF9V 4LBEC 4PA9A 5H6QA 3K0DA 3F5WC 4I9WA 3LDCA 3M99B 3JYCA 3E8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  3ABL C;  4P9P A;  2W0F C;  5J9P C;  3SYO A;  2A79 B;  1G4Y B;  3PJS K;  3T2M A;  3OR7 C;  2AHY A;  4PA4 A;  4ZBM A;  3RVZ A;  4MSW C;  3EFF K;  4X89 A;  2JK5 C;  4JTA B;  2HVJ C;  3F7V C;  3GB7 C;  3LNM B;  4P9O A;  2WLI B;  4GX0 A;  1K4C C;  3K08 A;  2WLL B;  3LDD A;  4LP8 A;  4QE7 A;  4P30 A;  1ZWI C;  3FB5 C;  2QKS A;  3OUS A;  4WFG A;  3RBZ A;  3TCU A;  3AG1 C;  3HPL C;  4HYO A;  2DYS C;  4PDL A;  3UM7 A;  1OCZ C;  2A9H A;  2EIJ C;  3E8F A;  4WFE A;  5EK0 A;  4X8A A;  4XDL A;  2NLJ C;  4GX1 A;  1R3I C;  1P7B A;  3R65 A;  4MVS A;  3STL C;  4PA6 A;  3E8B A;  3T4D A;  2BOB C;  2H8P C;  2AHZ A;  3BEH A;  3F7Y C;  5EBW C;  4GX5 A;  3FB7 C;  3AG4 C;  3T1C A;  4HZ3 A;  3OUF A;  4R50 A;  2DWD C;  4PDR A;  2KB1 A;  1ORQ C;  2HJF C;  4R8C A;  3E83 A;  5E1A C;  4MVR A;  1XL4 A;  5EBL C;  2YEV A;  5CBG A;  3SPH A;  5B1A C;  3E89 A;  1K4D C;  4RAI A;  4WFF A;  3X2Q C;  2Q67 A;  5EC1 C;  2X6A A;  2Y69 C;  4EKW A;  4MW3 A;  4TWK A;  3FB8 C;  3WG7 C;  2EIN C;  4PA7 A;  3UKM A;  3STZ C;  4MW8 A;  4R7C A;  3ASN C;  1OCC C;  3RVY A;  4J9Z B;  4RUE A;  4BW5 A;  3AG3 C;  3K03 A;  4JTC B;  2X6B A;  3TET A;  4GX2 A;  3K0G A;  5KUK A;  4UUJ C;  1OCR C;  4MTG A;  3SYP A;  2BOC C;  4H33 A;  4KFM A;  2QTO A;  3RW0 A;  4WFH A;  3K06 A;  4MVO A;  4MTF A;  2DWE C;  1R3J C;  4RO2 A;  4P2Z A;  4MVU A;  1R3L C;  3IFX A;  2IH3 C;  2X6C A;  3SPJ A;  5BZB A;  2WLH A;  4JTD B;  2Q69 A;  2Q68 A;  1OCO C;  4MS2 A;  3SJQ C;  4MTO A;  3SPC A;  3KG2 A;  4F4L A;  3VOU A;  1R3K C;  4MVM A;  2WLI A;  3K04 A;  4OXS A;  3OR6 C;  4PDM A;  5CBF A;  2A0L A;  2ITD C;  2HG5 C;  4H37 A;  5EBM C;  2IH1 C;  1V54 C;  5EC2 C;  3ABM C;  4G28 B;  4PDV A;  5IY5 C;  1KKD A;  4MVQ A;  2K1E A;  1JVM A;  4J9Y B;  4PA3 A;  4QE9 A;  3SYQ A;  3SPG A;  4CBC A;  1XL6 A;  1J95 A;  1M56 C;  1M57 C;  2ZXW C;  2Q6A A;  3LUT B;  3FB6 C;  4QNH B;  2WLK A;  5CBH A;  5B1B C;  3ZRS A;  3LDC A;  4LCU C;  2WLJ A;  4XDK A;  3SPI A;  2DYR C;  4R6Z A;  3ZJZ A;  2HVK C;  2WLN A;  1BL8 A;  2EIK C;  3IGA C;  3SYA A;  4DXW A;  5B3S C;  1LNQ A;  2R9R B;  2WLM A;  4RUF A;  3ABK C;  2HFE C;  3E8H A;  3OGC C;  1S5H C;  2ITC C;  2ZD9 A;  2P7T C;  3LDE A;  4G27 B;  2EIL C;  1QLE C;  3ASO C;  1V55 C;  5KUM A;  2WLL A;  4MVZ A;  3E86 A;  2OCC C;  2EIM C;  3T4Z A;  4XDJ A;  4X88 A;  3SYC A;  4LBE C;  4PA9 A;  3K0D A;  3F5W C;  4I9W A;  3AG2 C;  3JYC A;  3E8G A; 
#chains in the Genus database with same CATH topology
 4P9P A;  2XHB A;  4W4K A;  1V54 B;  3TXQ A;  4IIJ A;  3BY6 A;  1VF7 A;  3HKC B;  2ADQ B;  3N2G B;  5LGT A;  4FFB A;  2ZR2 A;  2OIE A;  4LFC O;  4QE7 A;  2WA4 A;  3FB5 C;  4WFG A;  3RBZ A;  2DYS B;  1AB3 A;  4D7S A;  4HYO A;  4PDL A;  3ZHV A;  1FFX A;  1GN2 A;  1BS3 A;  4LWS A;  3T4D A;  4FZ0 A;  1Q6H A;  3BEH A;  2RJZ A;  4QIW F;  1IDS A;  3OMI B;  2LGW A;  2HJF C;  3B40 A;  1NH2 B;  3F5T A;  1R73 A;  5FNV A;  2Y4T A;  1FJG O;  5BR8 B;  2UXB B;  3ZRW B;  4KHP B;  1FXK C;  4DR3 O;  4O4H B;  3BPZ A;  1K34 A;  2X6B A;  2HHH O;  3HKB B;  2BOC C;  4X64 O;  3T1Y O;  3AG1 B;  4XBF A;  4LFA O;  1K73 W;  3SPJ A;  4I50 A;  1KYO F;  1ZX3 A;  4F4L A;  4PDM A;  3H1J H;  1JQ0 A;  1QHT A;  1HW7 A;  3P32 A;  1ZSP A;  1E79 G;  5L3E A;  3ETQ A;  3ML0 A;  1NR7 A;  2CTQ A;  1K97 A;  4TQD A;  4LCU C;  2YDE A;  4RUF A;  1QR9 A;  4G27 B;  3H1L H;  4IGG A;  4QGP A;  1GK9 A;  1JCH A;  1M57 B;  3E86 A;  3VQX A;  4OGQ B;  1NZ6 A;  3SYC A;  4FLW A;  2B5U A;  3TXS A;  3TGU H;  1X59 A;  3JD2 A;  4NTY A;  1M90 W;  3CP1 A;  4JI0 B;  2PI4 A;  2CGO A;  3K3W A;  2P4V A;  1QCE A;  1Q5O A;  3DC5 A;  1K7D A;  2H94 A;  5GW7 A;  3JAS A;  3CMA V;  1KMI Z;  1G1X B;  2UUB O;  1Q43 A;  1P49 A;  1SZT A;  1VIB A;  2ZCE A;  1IBL O;  2IBZ H;  4O4L B;  2AHZ A;  3FX7 A;  4I7Z B;  1AJN A;  5EBW C;  4UCV A;  2M7W A;  3OUF A;  2F93 B;  3MDS A;  2EZP A;  3A0H Z;  1K4D C;  3KCY A;  4UCO A;  1L8D A;  3CWB H;  2Q0A A;  4X65 O;  1NTZ H;  2RN9 A;  2LP7 A;  4DK1 A;  4WFA V;  2YIA A;  1H2K A;  4ASU G;  3QNE A;  3N27 A;  3P30 A;  4DUZ O;  1GMG A;  4MTF A;  3JCU Z;  2OCH A;  2QM8 A;  2XAG A;  2PF4 E;  2VQE B;  2GTA A;  4MS2 A;  4MTO A;  3KG2 A;  4MVM A;  3CB2 A;  1XNQ O;  1YTF B;  3ABL B;  1G6U A;  2JS3 A;  1VQL V;  4PA3 A;  2DN9 A;  3QO5 A;  5FPR A;  3SPG A;  3UO3 A;  4ZI7 B;  4CH4 A;  3RYH B;  2GUZ B;  2YS8 A;  1KB9 F;  3JAR A;  1BL8 A;  5B3S C;  1CXZ B;  2R9R B;  3ZHT A;  5IYD O;  2ZD9 A;  4O4J B;  2P7T C;  1QLE C;  1N32 O;  4XDJ A;  2R72 A;  2UU9 B;  3ABL C;  4LC1 A;  3H1H H;  1ZUQ A;  2JK5 C;  1J5E B;  2BSK A;  1AI5 A;  5FL7 G;  1F7Y A;  1N0J A;  1EBO A;  2RCV A;  5LXT A;  4FLY A;  3OUS A;  1L0L H;  1V55 B;  4JI8 O;  1VF6 C;  1WPB A;  1S3J A;  2A9H A;  3E22 B;  3EHB B;  2ETN A;  2OIG A;  1PKX A;  1JPX A;  2HHH B;  3AK1 A;  1MOF A;  1ORQ C;  4LR3 A;  1BHB A;  2IJJ A;  4LFA B;  5TIS Z;  1O9G A;  1Y4M A;  3AG7 A;  1KP3 A;  3J81 N;  2JGD B;  4TWK A;  2YSU B;  2ZNJ A;  4MW8 A;  3ABK B;  3ETE A;  3VQW A;  4EB6 B;  3JAS B;  4MTG A;  2Q5Z A;  2RNB A;  4X1Y B;  4ZOL A;  3W7W A;  1Q81 W;  4LFB B;  4X1I B;  5KHI A;  1WN7 A;  2FYU H;  1GH6 A;  3G80 A;  1FKA O;  2ITD C;  5EBM C;  3CCM V;  5L3F A;  4G28 B;  2N04 A;  5KX5 A;  4QPJ A;  4PD4 F;  4DUZ B;  2AZ0 A;  3QO7 A;  1FAF A;  1NJI W;  3N2K A;  1XOU A;  4GLX A;  1N34 B;  2ZXW C;  3ZMZ A;  5KAI Z;  2VQE O;  1YTF D;  4LF9 B;  1VMG A;  1U96 A;  1WAZ A;  4IIJ B;  2DYR B;  3D3I A;  4YIP A;  1BMF G;  1SZX A;  4DV0 B;  4YHH O;  5KHK A;  5CA0 B;  1YXB A;  5FNV B;  5HFL A;  5DM6 V;  4F6R B;  1V9P A;  1UJW B;  5EYP A;  2A79 B;  3SR2 C;  4I9Q A;  3QO8 A;  3RVZ A;  1R6K A;  2AHY A;  4MSW C;  2ADP A;  2YIC A;  2HVJ C;  2YXL A;  4I4T A;  2WWW A;  1ZWI C;  2Q0O C;  3GVM A;  5E79 Z;  3ZMT A;  1H2S B;  1VQN V;  1FXK A;  5A9G A;  4PHZ A;  4WCE V;  2ODM A;  3STL C;  1P7G A;  3UT5 B;  4UCR A;  1M4U A;  1J5E O;  2ZR3 A;  1SF9 A;  3S3X A;  2EUL A;  4LF8 B;  4JI1 O;  5ITZ A;  4WFF A;  4LF4 O;  4IYH A;  2Q7G A;  3CEI A;  2YI9 A;  3U0Z A;  2QWR B;  2E5L O;  3BHP A;  1VQ8 V;  2C2A A;  2XAJ A;  1XNQ B;  1WA8 B;  4KFM A;  3ZN1 A;  4JZG A;  2JJ1 G;  2XTA A;  1I7F A;  1EN5 A;  4YIO A;  3BA8 A;  4MVU A;  3JAW A;  5BZB A;  2JDI G;  1ZL8 B;  5KA6 A;  3WB2 A;  1JR9 A;  3HKD A;  2YIB A;  3G4S V;  1P4R A;  1QU7 A;  3DC6 A;  4RQF A;  1AR5 A;  1V54 C;  4KL1 A;  1S0V A;  1N8R W;  3E35 A;  4PDV A;  4DUY B;  1JVM A;  4X9Q A;  3SYQ A;  1F4N A;  5B1A B;  1RP3 B;  1M57 C;  1SQV H;  4DV4 O;  2PGG A;  1SET A;  5CBH A;  1HNZ O;  1K3E A;  1GM8 A;  1LUW A;  4DRX A;  4QPK A;  3SYA A;  1GN4 A;  2L6L A;  2UXN A;  1XHZ A;  2GDS A;  1YF2 A;  2IJH A;  3M8A A;  5LMU B;  5JWP A;  2FB5 A;  2LW1 A;  4DR1 O;  3DSQ A;  3K0D A;  1NI8 A;  5JH7 A;  3PJS K;  5CA3 A;  4JYA B;  1AP6 A;  4JI7 O;  2LFR A;  1G8M A;  4N23 A;  4DR6 B;  2JGD A;  3K08 A;  1JOY A;  4FK5 C;  2QKS A;  4BWA A;  1NH2 D;  3AG1 C;  1JJ2 U;  3CJH B;  2VQF B;  1MAB G;  2GSM B;  2JEU A;  4PA6 A;  3E8B A;  2BOB C;  2JVD A;  1OZ0 A;  3AG4 C;  3T1C A;  4NKG B;  4R50 A;  2Y48 A;  1QQC A;  4JI2 O;  4JYC A;  1I0H A;  3SDL A;  4NXN B;  1SQG A;  1QLN A;  5AG2 A;  2CTW A;  1AJQ A;  1WJZ A;  2LW7 A;  1SQP H;  1HNX O;  1HDJ A;  1AR4 A;  5LYJ B;  4J7J A;  1EZV H;  4BW5 A;  1Z2G A;  3SGI A;  4GX2 A;  4BW9 A;  1YI2 V;  3JAT B;  3CRA A;  4DO2 A;  3MHS C;  4OX9 O;  1H2G A;  4JI1 B;  1R3J C;  1YJW V;  4H13 B;  4RO2 A;  2ARH A;  2ZNI A;  4LF8 O;  1WPX A;  2Q69 A;  4ZKI A;  1FS0 G;  4ZHQ A;  3OMN B;  1NQT A;  5BMV B;  2HLD G;  2RMK B;  3H01 A;  4TV9 B;  5K1X A;  4FVM A;  2ZM6 O;  2VWK A;  4F6R A;  3JCZ A;  4QE9 A;  5D5P A;  4YY3 O;  3AEI A;  3WU2 Z;  3FYE B;  3L72 H;  4J11 A;  5JJN B;  4FLV A;  3CXH F;  2WAM A;  4JI3 O;  1H8H G;  3K5O A;  1AP5 A;  2WPD G;  4YJ2 B;  2YXY A;  4I5S A;  1S5H C;  1TUB B;  4X62 O;  5KMG A;  1BZK A;  5KHJ A;  3AG2 C;  4NYK A;  5IY5 B;  4K3A A;  4K0K B;  4J41 A;  3THO A;  2QWN B;  3KCX A;  4LF5 O;  3GB7 C;  1R6N A;  3HKE B;  3P3N A;  4JYB A;  4YXW G;  1AVM A;  1K5S A;  1OJH A;  4DR7 B;  3HKE A;  2DYS C;  1PM9 A;  3JD1 A;  4JI6 B;  5LMU O;  3JAR B;  4DV2 B;  3L74 H;  2EJR A;  5IT9 N;  3G71 V;  1PL0 A;  3GWO A;  1SQB H;  1RSO B;  3CC7 V;  4EKW A;  3WG7 C;  1PNK A;  2AGA A;  5B1O A;  2JRI A;  4X64 B;  4H33 A;  3I55 V;  2QTO A;  2V7Q G;  4BIU A;  4B3R B;  5CN0 A;  4TSF G;  4JI2 B;  3UO2 A;  3CYO A;  1R3L C;  3IFX A;  2IH3 C;  4E2L A;  2N05 A;  2QKA A;  3VQV A;  2H3O A;  2CDY A;  3OR6 C;  2A0L A;  4JPR A;  2LO1 A;  4LFC B;  4IHJ B;  4O4L A;  1KKD A;  1WLE A;  4MVQ A;  3RYC A;  3X2Q B;  2HR3 A;  3JAL A;  2F4V O;  5H5N A;  1VF6 A;  1YDX A;  1NU1 H;  4D7T A;  4O2B A;  4DR5 B;  5KHH A;  3ZRS A;  5HFM A;  4FJC C;  4DV6 B;  1S5L Z;  4LNU A;  5BY1 A;  1IUR A;  2O57 A;  5J2U A;  4LF6 B;  1NS1 A;  5EZY A;  4CH5 A;  2OTL V;  4DR6 O;  2UXC O;  2W0X A;  4TQF A;  5LHI A;  4U7O A;  4B3M O;  2P90 A;  2A06 H;  2ZDI C;  3CC4 V;  4PA4 A;  3T1H O;  1F23 A;  4ZBM A;  4X89 A;  1BCC H;  2KKW A;  3RYI B;  3B8N A;  1N4C A;  3G6B A;  2UXX A;  1SRY A;  4DW0 A;  1H2N A;  3HPL C;  3CRQ A;  2NNU A;  3ICX A;  5IYZ A;  4B3T O;  3U11 A;  1HNX B;  1S77 D;  1GKF A;  4GX1 A;  1R3I C;  1P7B A;  2QM7 A;  2CUG A;  2H8P C;  2Q7E A;  2GUZ A;  1QVF U;  5LP6 C;  3F7Y C;  3GWK C;  4GX5 A;  4JAV A;  4CH6 A;  2KB1 A;  4BR6 A;  3BA9 A;  4LF7 O;  1XL4 A;  3K9A A;  2QJ1 A;  4NB5 A;  3B2E E;  4AI8 A;  4DR4 O;  4RAI A;  1PV0 A;  2Q67 A;  5EC1 C;  2Y69 C;  4A5U B;  1NTK H;  3K9S A;  2PY5 A;  1JFF B;  1OCC C;  4RUE A;  5LBQ A;  2ZM6 B;  1FYJ A;  1VP7 A;  5B1B B;  1US6 A;  1A32 A;  1YIT V;  3FD9 A;  3TJT A;  4JI3 B;  3SJC C;  5KA5 A;  3D36 A;  4O4I B;  3H1K H;  1MSW D;  3L70 H;  3ZS8 C;  1PL4 A;  1M5I A;  2QGN A;  1D5A A;  2K1E A;  4X62 B;  2QDO A;  5LOV A;  1KKC A;  3A0B Z;  2PYJ A;  4B3R O;  1J95 A;  3SJB C;  1ZL8 A;  1B3Q A;  3FB6 C;  4QNH B;  3DGE A;  1VEW A;  3EVK A;  1IXM A;  4HNA A;  4CS2 A;  2HVK C;  5JVD B;  1Y76 A;  2ZKO A;  1DK1 A;  1FXH A;  2EIL C;  1D5N A;  5L3C A;  3O65 A;  2Q4P A;  5ITZ B;  2FL4 A;  4EFB A;  3T4Z A;  4DV3 O;  3L9D A;  5H9C A;  3L71 H;  3JAK A;  1TVK B;  3B8M A;  2YEV B;  2BE3 A;  4PEL A;  4DV6 O;  4KXR A;  4W4L A;  5C8Y A;  5K1P A;  4LP8 A;  5IJ0 A;  2UXC B;  3IAY A;  1NKD A;  2GTS A;  2KQX A;  2JGU A;  4YHH B;  5JCO A;  3O9O A;  3ZRV A;  2JS5 A;  1AI4 A;  3AG3 B;  4L8J A;  3ZMS A;  2Y4U A;  3ETD A;  1W59 A;  3T1H B;  2Z0A A;  1AJP A;  3FAV B;  3QF7 A;  5B5E Z;  3OTO B;  5H2F Z;  3X2Q C;  1K5Q A;  3C90 A;  2UXD B;  2F66 C;  3RYI A;  4UB6 Z;  2CAZ C;  3AG3 C;  4CC5 A;  5F2V O;  3W7T A;  3SYP A;  3CSX A;  2BTQ A;  1B06 A;  4WBN A;  1IXB A;  4LNU B;  3RW0 A;  3RYF B;  4LF7 B;  4WBN B;  1F51 A;  1X4T A;  3SJA C;  5GTH Z;  5H6R A;  5KX5 B;  5L3B A;  4JTD B;  4ZIB A;  2KG7 A;  1WA8 A;  1Q90 D;  5LYJ A;  4RQE A;  4LH6 A;  2DQ3 A;  4EFE A;  3LSQ A;  2E5L B;  2Q8V A;  3QVN A;  1Z5W A;  3MD0 A;  4TV8 B;  3RYH A;  1FFT B;  1ARO P;  4UFZ A;  5LA6 B;  3CS5 A;  2Y0P A;  1IX9 A;  1Y67 A;  3CME V;  5B66 Z;  1MNG A;  4DR3 B;  3CXC U;  3ZHU A;  1WB8 A;  3OGC C;  4CZZ A;  2IU3 A;  3ASO C;  5IYZ B;  1VQK V;  1V55 C;  3M7M X;  1JFF A;  4EEQ A;  4MVZ A;  1NBM G;  2EJ7 A;  4JI5 O;  3BAB A;  4C7U A;  1HR0 B;  1Y6X A;  3OTF A;  3M99 B;  3JYC A;  3E8G A;  2VWJ A;  2ZE8 A;  3OR7 C;  4TOI A;  1PP9 H;  1OHH G;  4P9O A;  2N74 A;  1K4C C;  2WLL B;  4AQY B;  1RFY A;  2OWO A;  3ZN0 A;  1Y74 B;  1SS3 A;  4DR4 B;  4UCS A;  1B6Q A;  1OV9 A;  1S5J A;  4DV3 B;  3P3P A;  2D3O W;  3E8F A;  4J10 A;  1H2M A;  1SQQ H;  3R65 A;  2E76 B;  5GON B;  4HAM A;  4FZ1 A;  3IJ4 A;  3WB1 A;  2CK3 G;  2X7R B;  4GT1 A;  1SES A;  4HNA B;  1I5Y A;  4GCZ A;  3ZMV A;  4DYL A;  1RPO A;  5LXT B;  4LF4 B;  2W6I G;  3CE2 A;  3D3Q A;  1GAX A;  4KHP O;  3WB0 A;  1MSD A;  4J42 A;  1XBL A;  2VQF O;  1Z5V A;  2B1I A;  1EZJ A;  4J9Z B;  5J2U B;  3RVY A;  3BAA A;  5D5Q A;  2YXH A;  4ZI7 A;  2IJI A;  3N2G A;  1UFI A;  3OMA B;  2Q68 A;  3JD0 A;  2YIB D;  1K8A W;  3ZED A;  3ABU A;  4UCT A;  3OW2 U;  1YJN V;  3S3W A;  1CPY A;  1WP8 A;  5CMU A;  5KLV H;  5IWA B;  2WLK A;  4CS3 A;  1H38 A;  4XDK A;  3FYI B;  1SC5 B;  1M93 A;  2IM9 A;  1LNQ A;  1XEQ A;  1VQP V;  4ICG A;  2ITC C;  1N36 B;  4I0X A;  1M56 B;  1MG1 A;  2DQ0 A;  4FIP C;  5J2T B;  2ATK C;  4WFB V;  2AW9 A;  3ABM B;  2QWO B;  4JI7 B;  2XND G;  4JTA B;  3LNM B;  2NR5 A;  4P30 A;  2LFS A;  2XAQ A;  3E2E A;  2L35 A;  4Q6G A;  4X1Y A;  1M9N A;  3N2K B;  3QTC A;  5JVD A;  4JI5 B;  4YJ3 A;  1IBL B;  2EIJ C;  5JJE B;  2B9Z A;  4O4I A;  4FLX A;  4JAU A;  3ASN B;  1ZTE A;  1DTO A;  3CJH A;  2IJK A;  5A2Q N;  4FLU A;  5B1A C;  4O2B B;  1HNZ B;  3U10 A;  1GN6 A;  4CH3 A;  4FLZ A;  2UUA O;  3OM3 B;  5B3S B;  3MHH C;  1IVS A;  4ZHQ B;  3APO A;  1QVG U;  3LSU A;  4NXM O;  2LQT A;  1W0J G;  2QA4 V;  4UV9 A;  3SPC A;  2WSS G;  1XNR O;  5CBF A;  4X66 O;  1HNW B;  5IY5 C;  3E22 A;  3CCE V;  2XAF A;  4Z1M G;  1DF5 A;  2ZIN A;  2AXT Z;  3HR0 A;  4I50 B;  2X0L A;  5DN6 G;  4JV5 B;  3K59 A;  1SER A;  1IBK B;  1JX9 A;  2EIK C;  1XUQ A;  4DXW A;  3BCC H;  4GYC B;  1JA8 A;  1Y76 B;  4GZR B;  2P06 A;  3JSN A;  1GO3 F;  1KEC A;  2ZE7 A;  1TUB A;  1VQ7 V;  4LFB O;  4TV8 A;  3ABT A;  3OE7 G;  1QNM A;  2G38 A;  3EFF K;  3VQY A;  2ILM A;  1N36 O;  2WLI B;  4B7K A;  4FMT A;  4TUY B;  4Z1V A;  2RDC A;  5IYC O;  4NTX A;  4U3F H;  1DGS A;  2GV9 A;  1BHA A;  4UCU A;  1K92 A;  3JAL B;  4Z2W A;  1IBM B;  1KP2 A;  5LP6 A;  1Y74 A;  2MW2 B;  1XHX A;  3W7U A;  3CCR V;  4GKJ B;  5LHG A;  1XIL A;  1VQO V;  2A7W A;  1BSM A;  2CGN A;  4UVA A;  4D6T H;  1HWY A;  1DLB A;  3FB8 C;  1NVP D;  3UKM A;  2OT5 A;  4JZ2 A;  3ASN C;  3LSS A;  4DR2 O;  2GBO A;  1PNL A;  2MK3 A;  1S76 D;  3K0G A;  4H44 B;  2UUC O;  1N32 B;  1R1B A;  1K33 A;  1SQX H;  2XAH A;  3LNN A;  4KUM A;  5JQG B;  4MVO A;  2R9A A;  1R6T A;  1SQF A;  5FPO A;  1D2D A;  2EX3 A;  1GM9 A;  4B08 A;  1YVW A;  1CEZ A;  1PPJ H;  3K04 A;  4OXS A;  1Q6U A;  2F23 A;  5KAF Z;  4H37 A;  5EC2 C;  2IH1 C;  3AK3 A;  2ZE5 A;  3ABM C;  1ZLZ A;  1AI6 A;  2P5O A;  1KD1 W;  1CP9 A;  5LHH A;  1UPG A;  2P4K A;  3K58 A;  1ROP A;  1XMQ O;  2VRZ A;  1YCI A;  4LF9 O;  4KP4 A;  5GON A;  2OTJ V;  1GRJ A;  4ZOL B;  4UXN A;  2ZDI A;  2R9I A;  2EIK B;  2EBO A;  1U97 A;  1JJO A;  2FML A;  1YHQ V;  1XNR B;  3ZHQ A;  3LDE A;  4X1I A;  5J2T A;  1FXK B;  1FD9 A;  1AI7 A;  2WLL A;  1HNW O;  2OCC C;  3RYF A;  4FFB B;  3T1Y B;  2Y0I A;  4FFK A;  4I0X B;  5J9P C;  3SYO A;  4E4E A;  5LMN B;  1IBK O;  3F7V C;  4O2A B;  3K79 A;  3LDD A;  4X20 B;  4JI4 B;  4JAS A;  3OGI B;  1E1R G;  3RGB A;  4I55 A;  4B3T B;  5CB4 A;  4WFE A;  3EXA A;  4FPP A;  4BIO A;  3B09 A;  3IC7 A;  4PDR A;  3HKD B;  1QR8 A;  3E83 A;  2CTP A;  1SA0 B;  5EBL C;  3SPH A;  4NXM B;  5IJ9 B;  2ZE6 A;  4U3J B;  5BR8 O;  5IYB O;  2UXB O;  2FTK A;  3W7X A;  1FXV A;  1KUQ A;  1P84 F;  1H8E G;  2EIN C;  1IBM O;  1GN3 A;  2QE7 G;  4JF3 A;  1EFR G;  1VQ9 V;  4IL6 Z;  3K5L A;  4LH7 A;  4OPH A;  2Q9L A;  4X66 B;  4GKJ O;  1WNS A;  4DV0 O;  4AHC A;  5LL6 Y;  2DWE C;  3OAA G;  3K5M A;  2X6C A;  1LUV A;  3W7S A;  4JV5 O;  3KKY A;  4DV5 O;  4GUN A;  4TUY A;  3CRM A;  2WLI A;  4EB6 A;  1RM1 B;  1F4M A;  4PI2 A;  4UB8 Z;  3WFV A;  1MZE A;  3AG2 B;  2YID A;  5L3D A;  5KMG B;  2V4D A;  1BGY H;  4DV4 B;  3DXR A;  1M56 C;  2Q6A A;  3RT3 C;  3B77 A;  2EZO A;  2WLJ A;  3CCQ V;  3PN1 A;  2DYR C;  5JQG A;  4CC6 A;  1ZAU A;  4ABM A;  3CRR A;  1OCC B;  4J80 A;  2QEX V;  4TT3 G;  2ZXW B;  2R70 A;  1N33 B;  3CHX A;  5C8Y B;  4OX9 B;  4WF9 V;  3LDC A;  2W6J G;  3RN4 A;  3ZHS A;  4UVB A;  3ZHR A;  2AZ2 A;  4J7Z A;  1T5E A;  2DJV A;  2EIM B;  4B3S B;  1OCZ B;  3TCU A;  1E1Q G;  1MMM A;  3UM7 A;  2QWP B;  1K9M W;  1L0N H;  1XDC A;  1KQS U;  1HR0 O;  1DF4 A;  2PUS A;  3OEE G;  2UUC B;  2CE4 A;  1EN4 A;  1IZ3 A;  3CCV V;  5LMN O;  4DV7 B;  2UXD O;  1FPO A;  4JI4 O;  2BTQ B;  5JCO C;  4PA7 A;  4Q20 A;  1PNM A;  2YC0 A;  1JMK C;  1TAE A;  3K5N A;  5IE9 A;  3TET A;  3BVO A;  2HKO A;  1W0K G;  4DR1 B;  4X1K A;  5GTI Z;  3G67 A;  3OEH G;  2CTR A;  4YJ3 B;  4P2Z A;  3Q4H B;  4JGS A;  4RWU A;  4JI8 B;  2CH7 B;  4JI6 O;  3JD4 A;  1R3K C;  2P6J A;  5DED A;  1RM1 C;  3HKC A;  4IHJ A;  4U3J A;  4PI0 A;  2D2C B;  2Z5U A;  1NVP B;  4G2K A;  2F95 B;  2OCC B;  2P67 A;  3OT7 A;  4DV5 B;  2IU0 A;  3I5D A;  1WB7 A;  5LP6 B;  3SPI A;  4DRX B;  3ZIA G;  4FLT A;  3J7A U;  5LA6 A;  1TUE B;  2EIN B;  1VQ4 V;  3ZBH A;  4NXN O;  5LOV B;  4DV1 O;  3CCL V;  4X88 A;  3D8C A;  3ZRX A;  3JAT A;  5FLX N;  5IWA O;  4CS4 A;  1XMO B;  2UU9 O;  1G4Y B;  5EYP B;  3D36 C;  2IW5 A;  4LF5 B;  4JYY A;  3T2M A;  4FM2 A;  1GM7 A;  1YSC A;  2LGQ A;  1KBH A;  3JAW B;  4K8Z A;  4MT8 A;  5C93 A;  1N33 O;  2LJ2 A;  3RYC B;  2BSK B;  4O4J A;  5JJJ B;  1M1K W;  3OFN G;  2ZIO A;  1Q3E A;  2E74 B;  4LF6 O;  2DWD C;  1NR1 A;  5E1A C;  4BIZ A;  1YEW A;  2BTO A;  2P22 C;  3CCS V;  3E89 A;  3CCJ V;  5JH7 B;  2X6A A;  2V1D A;  4B3S O;  4MW3 A;  3MAQ A;  1Q82 W;  1SA0 A;  3J80 N;  5KUK A;  4UUJ C;  2KSD A;  1VAR A;  1AR1 B;  3UCS C;  3ZX6 A;  3CCU V;  4DV7 O;  3TK1 A;  3DTU B;  3C3S A;  2DMX A;  1OCR B;  2WLH A;  4K0K O;  1THZ A;  4K35 A;  2F1M A;  4OPA A;  1Y66 A;  2VS0 A;  1TVK A;  3ETG A;  4MTX A;  1NT2 B;  2QTS A;  4J9Y B;  5LGU A;  1Q86 W;  3NR7 A;  1EM1 A;  2DOS A;  1Q7Y W;  3LUT B;  3JD3 A;  2PYL A;  4DR5 O;  1N34 O;  5EZY B;  2EIL B;  3R66 A;  2HJD A;  2B1G A;  2PI5 A;  3H1I H;  2ZT9 B;  3IGA C;  3K57 A;  3FFQ A;  2RQ6 A;  2WLM A;  1VQ5 V;  4K8X A;  5DEC A;  2EIM C;  1KU9 A;  1VQ6 V;  1H2L A;  2PTM A;  2Q7H A;  4B3M B;  3CD6 V;  3AK2 A;  5CA1 A;  2XAS A;  1I08 A;  3FKS G;  2QR4 A;  5EIB D;  3L73 H;  1COW G;  2Z3Y A;  4GX0 A;  2A3Q A;  3UT5 A;  2E75 B;  1RPR A;  4UVC A;  1AIL A;  1YZB A;  3NXS A;  4L87 A;  4DV1 B;  4XDL A;  4MVS A;  3A0R A;  4YJ2 A;  2M6Y A;  1XMO O;  3CRC A;  3FB7 C;  2F4V B;  2Y69 B;  5L3G A;  1ENV A;  1NTM H;  1YIJ V;  1HP8 A;  3HKB A;  5BMV A;  2PZS A;  3STZ C;  1Q6I A;  5KHG A;  4R7C A;  2UUA B;  1PD3 A;  1XI1 A;  4GKK B;  3K03 A;  3Q4H A;  4J7K A;  5B1N A;  4PJ0 Z;  3ZCC A;  3JAK B;  3APQ A;  2E3C A;  4QJF B;  1RSO A;  3K06 A;  1S72 V;  1BQZ A;  4I55 B;  2OYQ A;  4B7E A;  2ZQM A;  2QM4 A;  4FM1 A;  1O9H A;  3SJQ C;  3VOU A;  4IYI A;  4JAA A;  1URF A;  2DW4 A;  2HG5 C;  3ZRW A;  1FFX B;  2CH7 A;  4O4H A;  1I94 B;  4HBN A;  1LR1 A;  2XOK G;  5IJ9 A;  4NTW A;  1GTO A;  2ZIM A;  3ASO B;  5B1B C;  1I5X A;  1MZF A;  1KC8 W;  3H9V A;  3ZJZ A;  4DK0 A;  3IC9 A;  2QWQ B;  3CX5 F;  1YJ9 V;  3HB3 B;  2Q73 A;  3QG5 A;  4I4T B;  4JTC B;  3I56 V;  2JIZ G;  2W0F C;  3RFR A;  1Q8I A;  3FAV A;  3BFR A;  3KZI Z;  2K9P A;  1OCO B;  4IT5 A;  2XUM A;  4JYA O;  2WA3 A;  1N0N A;  2EIJ B;  4AIL C;  2F43 G;  1FJG B;  3DXR B;  4YY3 B;  3BRC A;  1OCZ C;  4F6E A;  5EK0 A;  4X8A A;  2NLJ C;  2YI8 A;  4JI0 O;  3RWR D;  3A8T A;  1W2B U;  3WG7 B;  4HZ3 A;  5CB4 B;  3CPW U;  4R8C A;  4MVR A;  3OTO O;  2DE0 X;  2YEV A;  5CBG A;  5CA0 A;  4UV8 A;  4X1K B;  4PV1 B;  5IJ0 B;  1VF5 B;  1BE3 H;  4LWS B;  3AG4 B;  4DR2 B;  2HP8 A;  1MA1 A;  1EN6 A;  4DUY O;  3C3T A;  5CA1 B;  1OCR C;  4NR1 A;  3CC2 V;  1XQ8 A;  4N21 A;  4WFH A;  2QSA A;  4AQY O;  4H0L B;  3G6E V;  1TGO A;  4DR7 O;  3UQ8 A;  2BCC H;  5LGN A;  2GHY A;  1OCO C;  4U7N A;  4X65 B;  5IDJ A;  3ZMU A;  4DV2 O;  4GKK O;  1QBZ A;  2KG7 B;  3L75 H;  4BAY A;  4CBC A;  1XL6 A;  1XMQ B;  1WP7 A;  2QKC A;  3JSL A;  4NVP A;  1QLE B;  1B04 A;  1BQ0 A;  3JAM N;  2JJ2 G;  2FKX A;  4R6Z A;  2WLN A;  1SKV A;  5EIB C;  3ABK C;  2HFE C;  3E8H A;  5BXZ A;  3VBB A;  1XRE A;  1I94 O;  3A2F A;  5KUM A;  1L1F A;  1BT8 A;  1VQM V;  2XT9 A;  2NN4 A;  2JEX A;  4O2A A;  3OD4 A;  3B4S A;  4DW1 A;  4FM0 A;  4LBE C;  4PA9 A;  5H6Q A;  2UUB B;  4TV9 A;  1TA8 A;  2YUA A;  3F5W C;  4I9W A;  4X20 A;  2HEP A; 
#chains in the Genus database with same CATH homology
 2W6J G;  4P9P A;  5CA3 A;  1V54 B;  4UVB A;  3OR7 C;  3BY6 A;  1OHH G;  2LFR A;  5LGT A;  2ZR2 A;  1G8M A;  4P9O A;  4N23 A;  1K4C C;  3K08 A;  2WLL B;  4QE7 A;  1JOY A;  3ZN0 A;  3FB5 C;  4FK5 C;  2EIM B;  2QKS A;  1OCZ B;  4WFG A;  1B6Q A;  2DYS B;  3RBZ A;  1E1Q G;  3AG1 C;  4HYO A;  3TCU A;  4PDL A;  1NH2 D;  3UM7 A;  1JJ2 U;  1MAB G;  2D3O W;  3E8F A;  1K9M W;  2GSM B;  3R65 A;  2JEU A;  4PA6 A;  3E8B A;  3T4D A;  2BOB C;  4HAM A;  1KQS U;  3BEH A;  1DF4 A;  3OEE G;  2CK3 G;  1OZ0 A;  2X7R B;  3AG4 C;  4QIW F;  3OMI B;  4R50 A;  3T1C A;  4GT1 A;  1SES A;  2Y48 A;  2HJF C;  1NH2 B;  3CCV V;  4JYC A;  1I5Y A;  4GCZ A;  1R73 A;  3ZMV A;  1RPO A;  1QLN A;  2W6I G;  3ZRW B;  1AJQ A;  1FXK C;  4PA7 A;  4Q20 A;  2B1I A;  1PNM A;  1EZJ A;  1K34 A;  4J9Z B;  3RVY A;  4BW5 A;  3TET A;  2X6B A;  4GX2 A;  1YI2 V;  2HKO A;  2BOC C;  4DO2 A;  3MHS C;  1W0K G;  1H2G A;  3AG1 B;  4XBF A;  3OEH G;  1R3J C;  1YJW V;  4RO2 A;  1K73 W;  4P2Z A;  2IJI A;  3SPJ A;  4JGS A;  1WPX A;  2Q69 A;  3JD4 A;  3OMA B;  4ZKI A;  2Q68 A;  1FS0 G;  3JD0 A;  3OMN B;  4F4L A;  1NQT A;  1R3K C;  1K8A W;  4PDM A;  2P6J A;  2HLD G;  1RM1 C;  3ABU A;  3H01 A;  1JQ0 A;  3P32 A;  3OW2 U;  1YJN V;  2Z5U A;  1NVP B;  3JCZ A;  1E79 G;  4QE9 A;  5L3E A;  4G2K A;  3AEI A;  1CPY A;  5CMU A;  3FYE B;  3ML0 A;  1NR7 A;  2OCC B;  1K97 A;  2WAM A;  2P67 A;  2WLK A;  1H38 A;  1H8H G;  4LCU C;  4XDK A;  2IU0 A;  3FYI B;  3SPI A;  1LNQ A;  1VQP V;  2WPD G;  3ZIA G;  4RUF A;  4I5S A;  1QR9 A;  1S5H C;  2ITC C;  1TUE B;  4G27 B;  2EIN B;  1VQ4 V;  1GK9 A;  1JCH A;  1MG1 A;  1M56 B;  1M57 B;  3E86 A;  3CCL V;  2DQ0 A;  4X88 A;  3SYC A;  2B5U A;  3ZRX A;  4FIP C;  3AG2 C;  5IY5 B;  3JD2 A;  2ATK C;  4WFB V;  1M90 W;  3ABM B;  3CP1 A;  1G4Y B;  2PI4 A;  2IW5 A;  3PJS K;  3T2M A;  3K3W A;  2XND G;  4JTA B;  1QCE A;  3GB7 C;  3LNM B;  1K7D A;  1R6N A;  4P30 A;  2H94 A;  4JYB A;  4YXW G;  2LFS A;  2XAQ A;  1GM7 A;  5GW7 A;  1YSC A;  3E2E A;  1K5S A;  1M9N A;  2DYS C;  3JD1 A;  3CMA V;  4MT8 A;  5C93 A;  1SZT A;  2EIJ C;  1M1K W;  3OFN G;  2EJR A;  2AHZ A;  4JAU A;  1AJN A;  3ASN B;  5EBW C;  2M7W A;  3OUF A;  2DWD C;  1NR1 A;  1DTO A;  3G71 V;  1PL0 A;  5E1A C;  4BIZ A;  2IJK A;  2EZP A;  3GWO A;  5B1A C;  3CCS V;  3E89 A;  1K4D C;  3CCJ V;  3CC7 V;  4EKW A;  2X6A A;  2V1D A;  4MW3 A;  3WG7 C;  1Q82 W;  2LP7 A;  1PNK A;  4WFA V;  3OM3 B;  5B1O A;  3MHH C;  5B3S B;  5KUK A;  4UUJ C;  4ASU G;  3QNE A;  1AR1 B;  3P30 A;  4H33 A;  1QVG U;  3I55 V;  2QTO A;  2V7Q G;  4BIU A;  1GMG A;  3CCU V;  5CN0 A;  3TK1 A;  3DTU B;  4MTF A;  4TSF G;  1W0J G;  3CYO A;  1R3L C;  2QM8 A;  2IH3 C;  1OCR B;  2XAG A;  3IFX A;  2WLH A;  4E2L A;  1THZ A;  2QA4 V;  4UV9 A;  4MS2 A;  3SPC A;  4MTO A;  1Y66 A;  3KG2 A;  2WSS G;  4MVM A;  3ETG A;  3OR6 C;  5CBF A;  2A0L A;  4JPR A;  4MTX A;  1YTF B;  3ABL B;  5IY5 C;  1KKD A;  1VQL V;  1WLE A;  4MVQ A;  3CCE V;  4J9Y B;  4PA3 A;  3QO5 A;  2XAF A;  3X2Q B;  2HR3 A;  4Z1M G;  1DF5 A;  5LGU A;  1Q86 W;  3SPG A;  1Q7Y W;  3LUT B;  3JD3 A;  2X0L A;  2EIL B;  3ZRS A;  5HFM A;  5DN6 G;  4FJC C;  2B1G A;  2PI5 A;  1SER A;  1JX9 A;  1BL8 A;  2EIK C;  3IGA C;  4DXW A;  5B3S C;  2R9R B;  2WLM A;  1VQ5 V;  5IYD O;  2ZD9 A;  2OTL V;  2P7T C;  1QLE C;  1GO3 F;  2EIM C;  1KEC A;  5LHI A;  4U7O A;  4XDJ A;  1VQ6 V;  3CD6 V;  3ABL C;  2P90 A;  1VQ7 V;  2XAS A;  3ABT A;  4LC1 A;  3OE7 G;  2ZDI C;  3CC4 V;  3FKS G;  4PA4 A;  1F23 A;  4ZBM A;  3EFF K;  4X89 A;  2JK5 C;  1AI5 A;  5FL7 G;  1COW G;  2Z3Y A;  2WLI B;  3B8N A;  4GX0 A;  4FMT A;  1EBO A;  1RPR A;  2UXX A;  5IYC O;  4UVC A;  3OUS A;  1SRY A;  3NXS A;  1V55 B;  3HPL C;  1BHA A;  1S3J A;  1K92 A;  2NNU A;  4L87 A;  2A9H A;  4XDL A;  1GKF A;  1KP2 A;  4GX1 A;  1R3I C;  1P7B A;  3EHB B;  4MVS A;  1S77 D;  3A0R A;  2QM7 A;  2H8P C;  1QVF U;  1PKX A;  3W7U A;  3F7Y C;  3CCR V;  1JPX A;  4GX5 A;  3FB7 C;  4JAV A;  1MOF A;  2KB1 A;  5LHG A;  1ORQ C;  1VQO V;  2Y69 B;  1XL4 A;  3K9A A;  5L3G A;  2IJJ A;  1BHB A;  1Y4M A;  4RAI A;  1ENV A;  4UVA A;  2Q67 A;  5EC1 C;  1KP3 A;  2Y69 C;  1HWY A;  1DLB A;  1YIJ V;  4TWK A;  3FB8 C;  1NVP D;  2YSU B;  3UKM A;  3STZ C;  4MW8 A;  4R7C A;  2OT5 A;  3ASN C;  1OCC C;  3ABK B;  1PD3 A;  3ETE A;  3LSS A;  4RUE A;  3K03 A;  1PNL A;  2MK3 A;  5LBQ A;  1S76 D;  3K0G A;  5B1N A;  3ZCC A;  4MTG A;  1K33 A;  4QJF B;  2XAH A;  4KUM A;  3W7W A;  5B1B B;  3K06 A;  4MVO A;  1S72 V;  2ZQM A;  1Q81 W;  1GM9 A;  1YIT V;  3SJQ C;  5KA5 A;  1CEZ A;  3D36 A;  3VOU A;  3K04 A;  4OXS A;  2DW4 A;  2ITD C;  2HG5 C;  4H37 A;  5EBM C;  2IH1 C;  5EC2 C;  3ZRW A;  5L3F A;  3CCM V;  1MSW D;  3ABM C;  4G28 B;  1AI6 A;  2K1E A;  4QPJ A;  1KD1 W;  1CP9 A;  5LHH A;  3QO7 A;  2XOK G;  1NJI W;  1J95 A;  2ZXW C;  3ZMZ A;  1ROP A;  3FB6 C;  4QNH B;  3DGE A;  1GTO A;  5B1B C;  3ASO B;  1IXM A;  1YTF D;  1I5X A;  1KC8 W;  4KP4 A;  2OTJ V;  3ZJZ A;  2HVK C;  2ZDI A;  4UXN A;  2R9I A;  2EIK B;  2DYR B;  2EBO A;  3D3I A;  1YHQ V;  1BMF G;  1FXH A;  3LDE A;  2EIL C;  5L3C A;  1FXK B;  1YJ9 V;  3HB3 B;  1AI7 A;  2WLL A;  2OCC C;  5HFL A;  3T4Z A;  5DM6 V;  5H9C A;  1UJW B;  4JTC B;  3I56 V;  3B8M A;  2JIZ G;  2W0F C;  2YEV B;  3SYO A;  2A79 B;  5J9P C;  4PEL A;  3QO8 A;  3RVZ A;  1R6K A;  2AHY A;  4MSW C;  1OCO B;  2HVJ C;  3F7V C;  4LP8 A;  3K79 A;  3LDD A;  2WWW A;  2EIJ B;  1NKD A;  1ZWI C;  2F43 G;  4JAS A;  1E1R G;  3ZMT A;  1OCZ C;  1VQN V;  1FXK A;  4WCE V;  5EK0 A;  4WFE A;  4X8A A;  2NLJ C;  4FPP A;  3ZRV A;  3STL C;  1AI4 A;  3AG3 B;  1W2B U;  3IC7 A;  3WG7 B;  4HZ3 A;  3ZMS A;  2ZR3 A;  3ETD A;  4PDR A;  3CPW U;  1QR8 A;  4R8C A;  3E83 A;  1AJP A;  4MVR A;  5EBL C;  2YEV A;  5CBG A;  3SPH A;  4UV8 A;  4WFF A;  3X2Q C;  1K5Q A;  5IYB O;  2FTK A;  3W7X A;  1FXV A;  1H8E G;  2EIN C;  2QE7 G;  4JF3 A;  3AG4 B;  1EFR G;  1VQ9 V;  3AG3 C;  1VQ8 V;  2C2A A;  2XAJ A;  3W7T A;  1OCR C;  3SYP A;  4KFM A;  3ZN1 A;  2JJ1 G;  3CC2 V;  3RW0 A;  4N21 A;  4WFH A;  2DWE C;  3OAA G;  4MVU A;  1F51 A;  2X6C A;  5H6R A;  3W7S A;  5BZB A;  2JDI G;  5KA6 A;  5L3B A;  3G6E V;  4JTD B;  5LGN A;  2GHY A;  3G4S V;  1OCO C;  4U7N A;  4RQE A;  1P4R A;  5IDJ A;  2WLI A;  3ZMU A;  4RQF A;  2DQ3 A;  1RM1 B;  1F4M A;  1V54 C;  3WFV A;  1QBZ A;  1N8R W;  1S0V A;  3E35 A;  4PDV A;  3LSQ A;  1JVM A;  3AG2 B;  3MD0 A;  5L3D A;  4BAY A;  3SYQ A;  1F4N A;  5B1A B;  4CBC A;  1FFT B;  1XL6 A;  1ARO P;  1M56 C;  1M57 C;  2Q6A A;  3B77 A;  1QLE B;  1SET A;  5CBH A;  1K3E A;  2EZO A;  1GM8 A;  3CME V;  2WLJ A;  3CCQ V;  2JJ2 G;  2DYR C;  4R6Z A;  4QPK A;  2WLN A;  3SYA A;  2UXN A;  3CXC U;  1OCC B;  2HFE C;  3ABK C;  3E8H A;  3OGC C;  4CZZ A;  2IU3 A;  2QEX V;  3VBB A;  3ASO C;  4TT3 G;  1V55 C;  5KUM A;  2IJH A;  1L1F A;  1VQK V;  2ZXW B;  4MVZ A;  1NBM G;  1VQM V;  2JEX A;  4WF9 V;  4LBE C;  4PA9 A;  5H6Q A;  3K0D A;  3F5W C;  4I9W A;  3LDC A;  3M99 B;  3JYC A;  3E8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...