3LDEA

High resolution open mthk pore structure crystallized in 100 mm k+ and further soaked in 100 mm na+.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Novel insights into K(+) selectivity from high-resolution structures of an open K(+) channel pore.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ldeA00
1JVMA 3TCUA 3PJSK 4F4LA 2W0FC 3ABKC 1KKDA 2A79B 2Q68A 3F7YC 3STLC 2EINC 2ATKC 2BOBC 3AG1C 4GX2A 3FB5C 3R65A 3SPJA 4MTOA 2JK5C 4LP8A 1R3KC 3LDDA 3WG7C 3LDEA 4PA6A 2HVKC 1V54C 4GX5A 5CBFA 1P7BA 3OUFA 4LCUC 5B3SC 2X6CA 2WLIA 4LBEC 5EC2C 1V55C 2Q69A 3E8BA 3OR7C 2A9HA 4MVSA 1M57C 4XDLA 2WLIB 5B1AC 4ZBMA 4JTAB 3UKMA 3SPHA 2HG5C 4JTDB 4WFEA 1G4YB 3T4ZA 1OCOC 2HVJC 2WLHA 4MVOA 4BW5A 2OCCC 3E89A 4XDJA 3SPIA 2WLKA 1J95A 2X6BA 1ORQC 4HYOA 4PA3A 3SYAA 3TETA 4MS2A 4X89A 2A0LA 3RVYA 3ASOC 3K04A 3OR6C 3JYCA 3K06A 4P9PA 4CBCA 3T2MA 2AHYA 3E86A 4PA7A 4J9ZB 3AG4C 4GX0A 2EIKC 4H33A 2NLJC 3LNMB 3RW0A 5CBGA 3GB7C 2WLMA 4MVUA 4PA9A 3E8HA 3OGCC 4R6ZA 1R3LC 3FB7C 2HFEC 3STZC 4RO2A 2DYRC 4WFHA 5BZBA 3RVZA 2Q67A 4WFFA 4MVZA 4P30A 4UUJC 2WLJA 3E8GA 3F5WC 5EBWC 5KUMA 3SYCA 4MVQA 4GX1A 2WLNA 2ZD9A 4PDMA 4RAIA 3T1CA 2DWDC 3T4DA 5E1AC 2KB1A 3ZJZA 3K03A 2HJFC 4MVMA 3HPLC 3KG2A 4R8CA 2EILC 5EC1C 4PA4A 4G27B 4HZ3A 2Y69C 5J9PC 4J9YB 5B1BC 4MW8A 3IGAC 3E83A 4X88A 3UM7A 4P9OA 2K1EA 4WFGA 2H8PC 4XDKA 1R3JC 2AHZA 3K08A 4EKWA 3RBZA 2Q6AA 4TWKA 3K0DA 3LDCA 4QE7A 2P7TC 1S5HC 4MTGA 3K0GA 5KUKA 1XL4A 1R3IC 2QKSA 4R7CA 4MW3A 3SJQC 1OCZC 4PDRA 3SYOA 3FB6C 4MVRA 1QLEC 4MTFA 1M56C 4KFMA 3AG2C 4R50A 3SYQA 5CBHA 5IY5C 2IH1C 3OUSA 5EBLC 4QNHB 3SYPA 3ABMC 2YEVA 4RUFA 4X8AA 3VOUA 5EBMC 2ITDC 4RUEA 2IH3C 3FB8C 1OCRC 1ZWIC 2EIJC 2ITCC 1OCCC 2ZXWC 3ABLC 4P2ZA 4PDLA 2X6AA 4QE9A 1K4DC 3SPCA 3IFXA 4H37A 3SPGA 3BEHA 3X2QC 2R9RB 3ZRSA 4PDVA 2BOCC 2QTOA 2DWEC 3EFFK 5EK0A 2DYSC 3AG3C 3F7VC 4I9WA 3E8FA 3LUTB 2EIMC 2WLLA 1K4CC 1XL6A 3ASNC 1LNQA 2WLLB 4G28B 4JTCB 4MSWC 1BL8A 4DXWA 4OXSA
chains in the Genus database with same CATH superfamily
4O4JB 1BT8A 2ZNJA 3OMAB 3CCQV 4DR6B 2Q68A 1H2GA 4KL1A 4D7TA 3AG1B 1V54C 4XBFA 2GTSA 1OCRB 1ZL8B 3O9OA 1JX9A 4XDLA 3K5OA 4Z1VA 1S77D 1JQ0A 3MAQA 1KKCA 5IJ9B 2OCCC 4EB6B 3SPIA 2QE7G 3JALA 5IE9A 2O57A 1W0JG 3ZX6A 2YSUB 1BGYH 5H2FZ 4GX0A 1SKVA 2LJ2A 3ZS8C 5IYZA 2XAGA 3BABA 4UUJC 3JATA 2R9IA 3LNNA 1VARA 1SF9A 1SRYA 1FXKB 2KB1A 4OGQB 3QVNA 4RQEA 4DUZB 5K1PA 3B4SA 3CCLV 2Y69C 2EILB 1DLBA 1QBZA 1NI8A 1Q8IA 2M6YA 4X1IB 3B2EE 1GK9A 2UXDB 2EZOA 1VF5B 1XHXA 3DC5A 4KFMA 2AGAA 4I50A 5IY5C 3MDSA 4KHPO 2CH7A 4DV3B 1RFYA 3OT7A 3CC4V 2YEVB 4FPPA 3UCSC 3DTUB 1KB9F 1QLNA 4PHZA 3SPCA 3RYFB 1GRJA 2Y4UA 3X2QC 1QR8A 3KKYA 1M93A 1MSDA 2DYSC 3VQYA 4LFBB 3A0BZ 4FMTA 2WLLB 1H2LA 1O9GA 3B8NA 1BL8A 1N36B 4TQFA 1H2NA 4LF9B 4OPAA 1GN2A 3ML0A 2P67A 4O4LA 2Q8VA 4LR3A 1FFXB 2QWNB 4GX2A 4MTOA 3RYCA 2QTSA 3VQVA 1G4YB 3IJ4A 2F43G 4X1YB 4UCVA 4TV9A 1Q82W 2XUMA 1IVSA 4MTXA 5EYPB 2GV9A 1R6NA 4LF4B 3N2KA 2Y0PA 4J9ZB 4FLTA 4DR3O 4O2AB 2F23A 3BA9A 3M8AA 4DW1A 1VQMV 1Z5WA 2WLMA 5EZYB 2N74A 3RVZA 4MVZA 4FLXA 1HNWO 3RGBA 1TAEA 2GDSA 4ZI7A 3CSXA 2YIBA 3L70H 2G38A 5CA0B 1GMGA 2H3OA 3CC2V 3OTFA 1MOFA 3CCUV 3LDCA 2P7TC 5L3EA 5CA3A 2KG7B 1FJGB 3FB6C 1QLEC 4IGGA 4O2BA 1HR0B 3J7AU 3MD0A 1Y6XA 2WSSG 1Q3EA 4FIPC 3H1IH 1JCHA 1TGOA 4I9QA 1GO3F 4UVBA 2YIBD 2BOCC 2QJ1A 4PDVA 5LMNB 1GAXA 3BAAA 5B5EZ 2UU9B 1I5YA 1SQVH 2JRIA 4HNAB 5J2TB 1ROPA 3TCUA 3PJSK 2A79B 4JI8O 3AG1C 1PP9H 2PUSA 3CWBH 4NXMO 5KX5A 2KSDA 4FLVA 3ZN1A 3ABLB 2QEXV 4J7ZA 1V55C 2A9HA 4LC1A 1M57C 2VQFO 4TUYB 1XNRO 2QWQB 1D5NA 2BTOA 1B6QA 1N32B 3AK1A 5IWAO 4HYOA 1KP3A 1VIBA 1P49A 3ASOC 4I55B 2JDIG 4CH5A 3ZRXA 2JS5A 4FZ0A 4DR7B 3RW0A 4FJCC 2FMLA 3CRCA 4LNUA 4UCSA 4MVUA 3JARA 2DW4A 5A9GA 1NH2D 4JAVA 1R3LC 4F6RA 3L9DA 1IX9A 4K3AA 1FXKC 2EULA 4GCZA 3T1CA 3RYHB 4X1KA 2A3QA 3A0RA 3OE7G 2VWKA 2EILC 4G27B 4J9YB 5JQGA 4X88A 4DRXB 1SQGA 2CE4A 1NJIW 4JGSA 3QF7A 4BAYA 5JVDB 4BW9A 3L75H 3ZEDA 4UCRA 2OYQA 2Q7GA 4YJ3A 4B08A 4J42A 2LW1A 4X20B 4AHCA 1BQZA 5JJJB 3W7XA 5LHIA 5LA6B 3ZMUA 3A8TA 1PL4A 3RFRA 4U7NA 4AI8A 1OCCC 1K8AW 1K4DC 2XAQA 4AILC 2JIZG 4JI7B 1IBMO 1TVKA 5L3BA 4I9WA 4JF3A 3W7TA 1R73A 1Y76B 1VMGA 3HKBA 1N8RW 3CX5F 2JS3A 3M7MX 5J2UA 3KCYA 2QR4A 2ATKC 2YDEA 3FB5C 4JYYA 3ABMB 2EJRA 5H6RA 4Z2WA 1K5QA 1PPJH 5B3SB 3OEHG 3KCXA 2PI4A 4JTDB 1N34B 4LFCO 3D36C 1X4TA 3OM3B 1FAFA 3WB2A 5LP6C 1NTZH 1XDCA 2ZE7A 4PA3A 5BY1A 3JALB 1J5EB 1QQCA 4CS4A 2AXTZ 2D3OW 1GTOA 2VQEB 1FD9A 2EIKC 5CBGA 5IYZB 4TOIA 2OTLV 4JZ2A 4WFFA 2WAMA 5KUMA 2UXDO 3F5WC 3D36A 1IBLO 2WLNA 2NR5A 3JATB 2JEUA 3D8CA 5LP6A 3OEEG 2HR3A 4DV3O 2UXXA 1QNMA 1XI1A 3CMEV 1XNQB 2Q6AA 1URFA 5KUKA 3APOA 4DR1B 4LFBO 2QM8A 2F93B 1OCZC 4JI3O 4W4KA 2GBOA 1JMKC 3B77A 1N36O 2YXLA 3CCSV 2YC0A 3VOUA 1ENVA 4I50B 2F4VB 3EXAA 2CH7B 4Q20A 1K34A 1IXBA 1W59A 1OHHG 1VEWA 4DR3B 2ZIMA 2L6LA 2Y69B 2H94A 1RM1B 5KHGA 1XMOO 4NTWA 3F7VC 1RPRA 2YUAA 2QWPB 3W7UA 1HNWB 1YSCA 1DF5A 5IYBO 4QPJA 2Z5UA 2P90A 2BOBC 4ZIBA 3W7SA 5IY5B 1PNMA 2QGNA 3SPJA 2LW7A 4LP8A 4ASUG 4O4LB 3A0HZ 4UFZA 2BSKA 4QGPA 4H44B 3RYCB 5EC2C 1YCIA 3HKCA 3JSLA 5JJEB 2LP7A 3N2GA 5C8YA 2DYSB 5L3DA 4TV9B 2X6BA 3TETA 5GONA 2WWWA 2ILMA 1NKDA 4JAUA 4H33A 3N2KB 4NKGB 1XILA 2P06A 3TK1A 1Q7YW 1X59A 2W0XA 3E8GA 3THOA 2UXBO 1HR0O 5L3FA 3ETEA 4ZI7B 1MA1A 1YI2V 4JI8B 4IIJA 2JGDA 1H8HG 2B1GA 4PV1B 2ADQB 4LH7A 4GUNA 1S5HC 3B8MA 2VQFB 1XNRB 1EBOA 3G67A 3CYOA 2UU9O 2P22C 1W2BU 1M56C 2M7WA 3OUSA 4O2BB 4QNHB 1SS3A 3SYPA 4JASA 1BZKA 3DC6A 3AK2A 1K33A 3ZHRA 1CP9A 1WA8A 3NXSA 3CXHF 4TT3G 3D3IA 1NBMG 1M9NA 4I7ZB 3G71V 5D5PA 5D5QA 1HDJA 1WPBA 4DXWA 3EVKA 1QCEA 4PD4F 5KMGA 1BHBA 1QLEB 1AR5A 4L87A 1NH2B 1BQ0A 1BS3A 4NXNB 2ZNIA 1NR7A 2HJDA 4DR7O 4ZKIA 3SJCC 5B3SC 5KX5B 2XOKG 5LGTA 1L1FA 1Q6UA 3LSUA 4MVSA 4CS2A 1VQPV 2IM9A 1S76D 2Q7EA 3TGUH 2JJ2G 1B04A 1M90W 1JOYA 4DV4O 5KHKA 2Q73A 3BCCH 3KZIZ 2RN9A 2ZINA 3E22A 4U3JA 2PYLA 4YXWG 2N05A 5DEDA 4B3RB 4LNUB 1IBMB 1Y67A 3JARB 2ZDIA 3N27A 5BZBA 4DV0B 2PYJA 2Q67A 2ZKOA 1V55B 3JAWA 5LOVA 1M57B 4X62B 5LHGA 4F6RB 1K97A 1KU9A 4DV2O 2VWJA 5E1AC 3HKEA 2XTAA 4J7KA 4X1KB 2EBOA 4O4HA 2JVDA 2OWOA 5LGNA 3ASOB 3ZHUA 4P9OA 2H8PC 5JQGB 2OTJV 3PN1A 3WFVA 1K7DA 1R1BA 2MW2B 4JI7O 3L71H 5LMUB 1K73W 3CCMV 4LFCB 3EHBB 2GTAA 4YJ3B 3OMIB 1MNGA 3G6EV 2HP8A 5IDJA 4YJ2A 2YI8A 4YHHO 4N21A 1RM1C 4TQDA 4K8ZA 2JEXA 2Y48A 1YTFD 1UFIA 4JYBA 2P5OA 1SZXA 1TVKB 1N34O 3HKBB 1IBLB 2AW9A 3DSQA 4BWAA 2W0FC 2WA4A 1J5EO 4PELA 4FFBA 5J2UB 1Z5VA 2VQEO 2IJIA 3K3WA 2JK5C 4E2LA 2PZSA 3IC7A 3LDDA 4GYCB 4LCUC 1OCCB 4DUYB 1EN6A 3SJBC 3ZHQA 3P3PA 5H5NA 2HG5C 1RSOA 4GKKO 5C93A 1Q43A 4JI3B 2ETNA 4J7JA 3HB3B 3H9VA 4DV1O 1G6UA 3OR6C 1HW7A 3T2MA 2AHYA 2CUGA 4I0XA 4PA7A 1HNZO 3ZHTA 3BRCA 5GTIZ 1AI4A 5CMUA 3T1YO 4JI4B 1Q81W 2IBZH 1XNQO 1JA8A 2P6JA 1XMOB 2PI5A 4DR1O 2LO1A 4X66O 1M5IA 1Z2GA 1ZX3A 1VQ6V 2F4VO 5LP6B 2ZR3A 4TV8A 3IGAC 3UM7A 1VQ7V 2PTMA 4WFGA 5FPOA 1XMQO 4BIZA 3ETDA 4DO2A 2RMKB 4EKWA 2EIKB 2UUAB 1AB3A 3UT5A 1WP7A 1SQFA 4LH6A 3K5LA 4FM2A 2OCHA 1K9MW 3AG2C 4JPRA 1NZ6A 4U7OA 5EBMC 4RUEA 1YIJV 1F51A 5LXTA 2BE3A 2E75B 2F66C 1IXMA 2ZE5A 3BEHA 2Y4TA 1U96A 4CZZA 2QTOA 5L3CA 4E4EA 1SESA 1E1QG 5BXZA 2UUBO 1K4CC 4JV5B 3AG7A 1D5AA 1BCCH 2UXBB 1OCZB 1YEWA 5JJNB 2CAZC 1EN4A 2EINB 2R9AA 3OUFA 2BSKB 1K3EA 4JI2O 3RN4A 2CGOA 5ITZA 5B1AC 3SPHA 3HKCB 3CHXA 3ZBHA 3U11A 4DYLA 2UUCO 3N2GB 4W4LA 5C8YB 1AROP 2DOSA 1F23A 4J10A 3FD9A 3JYCA 5GONB 1BMFG 2K9PA 4L8JA 4JI0O 2N04A 3CEIA 2QDOA 2IJHA 1H2KA 2DYRC 1TUBA 1TA8A 2WLJA 3FAVA 5LHHA 4GX1A 4D6TH 2W6JG 4Z1MG 4YY3O 4JI5B 4DV6B 1FPOA 2R70A 1H2MA 4DR5B 5IT9N 4IIJB 2JGDB 2HLDG 4MW8A 5AG2A 4JI6B 2CTWA 3VQWA 3CB2A 3LSQA 2QA4V 4GLXA 3K0GA 4UV8A 3UO2A 1WB7A 2C2AA 3F5TA 3BY6A 4OX9B 3K59A 4DV4B 2ITDC 4NXNO 1AILA 4LF8O 1WNSA 1N4CA 2ZCEA 3K58A 1WA8B 1S3JA 1NU1H 2ZE6A 3HKDA 1GH6A 2ZR2A 2XNDG 2DMXA 4DV2B 3QG5A 3ZCCA 1M56B 3I5DA 5KMGB 3ABKB 3WG7C 1W0KG 4PA6A 4K35A 5A2QN 4GX5A 3K5NA 4LBEC 2Q69A 3RYIA 1EN5A 4B3RO 1JFFA 4IYIA 2MK3A 4DV0O 5EIBC 3ZRWA 3JASA 4X62O 2ODMA 3CCJV 4HBNA 2A0LA 1H38A 2RJZA 2Y0IA 3E86A 5KAFZ 4YHHB 3E22B 4U3JB 3LSSA 2E5LB 3VQXA 4LF7B 4DR4O 1AP6A 5B66Z 2UXCB 4R6ZA 4MT8A 5TISZ 2A7WA 3CJHA 4WFHA 3S3WA 2V7QG 5IJ0A 5LMUO 3BVOA 3JAWB 5LOVB 5KHJA 1G1XB 3KG2A 1EZJA 4NR1A 1YTFB 5JWPA 3HKEB 4O4HB 1Q86W 4FLZA 3K79A 1L8DA 2ZQMA 3RBZA 4R7CA 3SYOA 4GKKB 2DQ3A 2YXHA 5FNVA 2IH1C 2OT5A 1KC8W 4DV1B 1VQ8V 1JR9A 5LL6Y 4YJ2B 2ZXWC 1HNZB 2JJ1G 5EIBD 1AI7A 2RCVA 3I56V 2IU0A 3T1YB 3P30A 4DUYO 3AG3C 4O4IA 2E3CA 4JYAB 3JD2A 4X66B 2X0LA 3OGIB 1PNKA 5GW7A 4C7UA 4B3TO 1MG1A 2Z3YA 5BMVA 1OV9A 2EINC 3CC7V 2KKWA 2XAHA 4FFBB 3R65A 1R3KC 4LF6O 5BR8O 3LDEA 4DR2B 5E79Z 1XMQB 1AI6A 2X6CA 2WLIA 4JZGA 4BR6A 3R66A 4JI4O 3E8BA 5H9CA 4UVCA 3L72H 4DW0A 2CGNA 4LFAO 3T4ZA 2HVJC 1IDSA 1U97A 1Y74A 1HNXO 1RSOB 2WLKA 3ZN0A 1ORQC 1K5SA 2YICA 1FS0G 4X89A 1MZFA 1OJHA 3RVYA 5CA1A 1E1RG 1K92A 1SQXH 2NLJC 4I0XB 5GTHZ 2YS8A 3W7WA 2UUAO 2CTRA 1ZLZA 2VS0A 2UUBB 1I5XA 3DGEA 3A2FA 1AR1B 1YF2A 1MSWD 4PA4A 4GKJB 5B1OA 5J9PC 1UJWB 1BSMA 3H1JH 4TV8B 4ICGA 2DN9A 3B40A 4ZHQA 4TWKA 1Y4MA 4JI2B 1Q6HA 2FL4A 5JCOA 4JV5O 3UT5B 1Y66A 2UUCB 5CB4A 1OZ0A 4X9QA 5JH7A 2V1DA 5IYCO 4X8AA 1PNLA 2LFRA 4NVPA 4JI0B 1N0NA 1NR1A 4UCOA 4K0KB 3E35A 3IFXA 5LXTB 1XOUA 5L3GA 1B3QA 2LFSA 3T1HO 2IJKA 1XEQA 1DF4A 4JTCB 1SQQH 4CS3A 1S72V 1ZAUA 4F4LA 1PKXA 3ABKC 4YY3B 1KKDA 1F4MA 3CCEV 3AG2B 3CRMA 3JAKA 1I0HA 3CRRA 1IBKB 4UV9A 2HVKC 5CBFA 2OIGA 2YI9A 1QR9A 3OR7C 1S5LZ 1RP3B 3CRQA 5KHHA 2LGWA 2Q4PA 4UB8Z 5ITZB 4UB6Z 4NB5A 4FK5C 1J95A 2W6IG 4RQFA 4JI5O 4DV6O 4CBCA 4DR5O 1NTKH 1JJOA 4TSFG 2V4DA 4LF5B 4QIWF 3LNMB 4JI6O 2GHYA 4LF8B 1QU7A 5LBQA 1GKFA 2ARHA 2Q0AA 2QKCA 4CH4A 3QO7A 2ZDIC 1SA0A 1AI5A 3H1HH 1VQLV 2KQXA 1TUBB 5B1AB 4MVQA 4PDMA 3FAVB 1VP7A 3T4DA 3K03A 4IYHA 1KQSU 4OX9O 2PY5A 4HZ3A 2B1IA 4K8XA 2ZE8A 2EX3A 3E83A 4X65O 1P84F 2QKAA 2HHHO 1AR4A 1R3JC 3JCUZ 3H1LH 1FFTB 4ZOLA 4QE7A 1NVPB 1GM9A 1XL4A 2DQ0A 1NT2B 2QKSA 5K1XA 1VF6C 2DYRB 3OFNG 1JJ2U 5CBHA 1N33O 3JD4A 3SJAC 4LWSA 5KLVH 1Q6IA 3U0ZA 2P4VA 2QSAA 4PDLA 1KECA 4AQYB 1YITV 3I55V 2R9RB 4DR4B 1SC5B 3WB1A 1PD3A 1SQPH 3E8FA 4DK0A 4H13B 4G28B 1Q5OA 3HKDB 1SETA 1CEZA 1VF6A 1KYOF 3JAMN 1ZTEA 2XAFA 3E2EA 3BFRA 1H8EG 2E5LO 3TXQA 4LF7O 3BA8A 2UXCO 1XUQA 3G80A 2VRZA 3UKMA 3RYIB 3JD1A 3C3SA 3H01A 1JFFB 2IW5A 4WF9V 1ZSPA 2L35A 3ZMSA 1OCOB 3ZRWB 3CE2A 3JASB 2NNUA 1HP8A 3K04A 4P9PA 1UPGA 1F4NA 3AG4C 4IHJA 1P4RA 2B5UA 1GN3A 3OAAG 3ICXA 3GB7C 4PA9A 3WG7B 1MABG 5CN0A 2ADPA 3S3XA 4Q6GA 4DV5B 3CJHB 5EBWC 2WPDG 5IJ0B 2WA3A 4EFEA 3DXRA 1A32A 4UCUA 4B3TB 3ZJZA 4R8CA 1S5JA 2DJVA 5EC1C 1VQ9V 3K5MA 2X7RB 4IT5A 1DTOA 5BR8B 4LF6B 4RWUA 2BTQA 2B9ZA 4XDKA 4EEQA 5IYDO 2E76B 1QVGU 3UQ8A 3MHHC 5DM6V 1COWG 1R3IC 4LFAB 3SJQC 3SDLA 4JYAO 1HNXB 4MTFA 3QO5A 5HFLA 2HKOA 4CH6A 5FNVB 4B3SO 4PI0A 1RPOA 4QE9A 2X6AA 4DR2O 4H37A 1FXHA 2CTQA 2R72A 3AEIA 4BIOA 3L73H 4DK1A 3EFFK 3CMAV 1MZEA 1XL6A 2QWOB 4O4IB 3SGIA 2EIMB 3ZMTA 5HFMA 1YZBA 1JVMA 3ABUA 5BMVB 1WP8A 1NTMH 2Z0AA 1BE3H 1E79G 1P7BA 2ZXWB 2LQTA 3RWRD 5FPRA 2WLIB 4ZBMA 4WFEA 2WLHA 4BW5A 1WJZA 3AG3B 3Q4HA 4GZRB 4ABMA 1Y74B 2FB5A 3ETGA 3SYAA 1PV0A 2FYUH 2RNBA 3ABTA 3K9AA 1WAZA 2F95B 3O65A 4GKJO 2RQ6A 1LR1A 5CA1B 5KA5A 4X64O 1EM1A 3QNEA 4JI1B 1GM7A 3OGCC 5LYJA 3FB7C 1LUVA 1I94O 2HEPA 1N0JA 1ZUQA 3T1HB 4B3MO 4FLWA 4NYKA 3IAYA 3GWOA 4I4TA 4RAIA 4FZ1A 2DWDC 1M1KW 1FYJA 2P4KA 4MVMA 3HPLC 3GVMA 2EJ7A 1WLEA 5DN6G 2K1EA 4K0KO 2GUZA 5B1BB 2F1MA 4FLYA 1YVWA 4FLUA 3RT3C 2D2CB 1YJWV 1R6TA 3P32A 4ZHQB 3QTCA 3UO3A 3K9SA 4DV7O 1SQBH 1EZVH 5CB4B 4J80A 2PGGA 5JH7B 4WCEV 3FB8C 1OCRC 3IC9A 4YIPA 1IBKO 4B7KA 1AJNA 3SPGA 1FXVA 4WBNA 3G4SV 1CXZB 3OTOB 3CPWU 3ZMVA 3FX7A 3SR2C 2XT9A 3ZHSA 3L74H 3CS5A 1KUQA 1LNQA 4U3FH 4O4JA 4OPHA 1LUWA 2Q0OC 3WB0A 3STLC 1O9HA 2AZ0A 3JAKB 4LF5O 3AK3A 4X65B 1ZL8A 2HHHB 1IURA 2ZM6B 3WU2Z 5IJ9A 2EZPA 4EB6A 2OIEA 1OCOC 1QHTA 3E89A 1GN6A 2YIDA 1NVPD 1N33B 2QM7A 3K06A 3CCVV 1KP2A 3JSNA 4JYCA 5FL7G 4H0LB 3TXSA 5LGUA 2XAJA 1SA0B 3CXCU 1DK1A 3SYCA 5H6QA 1FXKA 2ZD9A 4NTYA 1SZTA 2DE0X 3VBBA 1TUEB 3ZRVA 3BHPA 1YDXA 4DR6O 1VQOV 2QWRB 1MMMA 2ZT9B 4X1IA 4AQYO 3QO8A 4NTXA 3K08A 3M99B 2E74B 1BHAA 4ZOLB 2NN4A 1YJ9V 2XASA 3P3NA 4FM0A 1US6A 2IJJA 4R50A 1AP5A 5EBLC 4J41A 2UXNA 2YEVA 4RUFA 1ZWIC 2ZIOA 3RYFA 1EFRG 4LWSB 2A06H 4FVMA 1L0NH 2EIJB 3J81N 1NQTA 1XBLA 4N23A 5EK0A 2EIMC 1THZA 2WLLA 2FTKA 1NS1A 3BPZA 3ASNB 5KAIZ 3STZC 4KHPB 3ZMZA 1FFXA 3F7YC 1YHQV 4IL6Z 4DUZO 3NR7A 1L0LH 1DGSA 2QM4A 4UXNA 4EFBA 2Q9LA 1D2DA 1V54B 4X1YA 2BCCH 4JTAB 3CRAA 4DV5O 1F7YA 5EYPA 1VQKV 4KP4A 2OCCB 2YIAA 1VQ5V 1YXBA 4O2AA 4B3SB 3FFQA 5EZYA 1KMIZ 2RDCA 4IHJB 3FKSG 3K57A 3E8HA 4B7EA 4BIUA 1M4UA 1SERA 3J80N 4A5UB 1KBHA 2YXYA 3C3TA 5KA6A 2IU3A 1GM8A 2XHBA 4LF9O 2HJFC 3DXRB 1V9PA 4CC6A 4WFBV 5CA0A 1VQNV 5B1BC 3H1KH 2CDYA 3AG4B 1Q90D 3OD4A 2BTQB 4D7SA 5JCOC 2KG7A 1GN4A 4MW3A 1FKAO 4QJFB 4MVRA 1AVMA 3GWKC 3SYQA 4LF4O 1VF7A 3ZHVA 3ABLC 2ITCC 4P2ZA 2LGQA 4X64B 4I5SA 4FM1A 2FKXA 4G2KA 1I94B 3X2QB 4HNAA 5J2TA 4B3MB 3FYEB 3MHSC 1VQ4V 4P30A 3G6BA 5KHIA 4YIOA 4WFAV 5FLXN 2CTPA 4JI1O 1WN7A 4TUYA 2JGUA 5F2VO 3ETQA 1AJPA 1FJGO 4MVOA 1KD1W 4XDJA 4DV7B 3Q4HB 4CC5A 4MS2A 4I55A 1WB8A 4PI2A 4NXMB 4UCTA 3APQA 1XHZA 1XQ8A 3TJTA 1P7GA 2PF4E 4GT1A 5LMNO 2HFEC 2GSMB 4RO2A 5DECA 5LYJB 2CK3G 1PL0A 4FFKA 3OW2U 1S0VA 3C90A 3RYHA 4KUMA 1I08A 1CPYA 5IWAB 4I4TB 3HR0A 4HAMA 3CP1A 4DRXA 1T5EA 1I7FA 4F6EA 4KXRA 4UVAA 5JVDA 2AHZA 3OTOO 3FYIB 2GUZB 3K0DA 3B09A 4MTGA 1YJNV 4CH3A 4X20A 2AZ2A 3JD3A 3U10A 4PDRA 1AJQA 4JAAA 5LA6A 4J11A 1N32O 1HWYA 1XREA 1IZ3A 1H2SB 1JPXA 3CD6V 3ABMC 1WPXA 3JD0A 3JCZA 2IH3C 4QPKA 2EIJC 4PJ0Z 1R6KA 2Q7HA 1QVFU 2Q5ZA 1B06A 2ZM6O 3ZRSA 1Y76A 1PM9A 4WBNB 1G8MA 2DWEC 3CCRV 5B1NA 3D3QA 3LUTB 3ASNC 3ZIAG 3OMNB 4MSWC 4OXSA
chains in the Genus database with same CATH topology
1JVMA 1YSCA 3ZCCA 1DF5A 3ABUA 3OMAB 3CCQV 5IYBO 1M56B 2Q68A 4QPJA 2Z5UA 2P90A 3ABKB 2BOBC 1H2GA 3W7SA 5IY5B 1PNMA 3SPJA 4ASUG 4LP8A 3WG7C 3AG1B 1W0KG 1E79G 4PA6A 1V54C 4GX5A 4XBFA 1P7BA 1OCRB 5EC2C 2ZXWB 4LBEC 2Q69A 1JX9A 4XDLA 1S77D 2WLIB 1JQ0A 4ZBMA 2MK3A 4WFEA 2LP7A 2WLHA 4BW5A 2OCCC 2DYSB 3AG3B 5L3DA 3SPIA 3ZRWA 3CCJV 2QE7G 2X6BA 3ETGA 3SYAA 3TETA 1W0JG 2WWWA 2A0LA 2YSUB 3ABTA 3K9AA 1H38A 3E86A 1NKDA 4GX0A 4JAUA 4H33A 5KA5A 3LSSA 3QNEA 3TK1A 1GM7A 1Q7YW 3OGCC 4R6ZA 3FB7C 4MT8A 2XAGA 4WFHA 2V7QG 4UUJC 3E8GA 2R9IA 3GWOA 1SRYA 4RAIA 2DWDC 5L3FA 1FXKB 2KB1A 3ETEA 1M1KW 4MVMA 3HPLC 1EZJA 3KG2A 1YI2V 4RQEA 1YTFB 1H8HG 1WLEA 3CCLV 5DN6G 2Y69C 2EILB 2B1GA 1Q86W 1DLBA 2K1EA 1QBZA 3K79A 2ZQMA 5B1BB 3RBZA 1YJWV 1S5HC 3P32A 3B8MA 1EBOA 1GK9A 4R7CA 3CYOA 3SYOA 2EZOA 1W2BU 1M56C 4KFMA 2DQ3A 5IY5C 2M7WA 2IH1C 3OUSA 4QNHB 2OT5A 3SYPA 1KC8W 4JASA 1VQ8V 4WCEV 3CC4V 2YEVB 3FB8C 1OCRC 1K33A 4FPPA 3DTUB 2ZXWC 1QLNA 2JJ1G 1AJNA 3SPCA 3SPGA 1AI7A 1CP9A 1FXVA 3NXSA 3I56V 3G4SV 2IU0A 3CPWU 3X2QC 3ZMVA 1QR8A 3P30A 4TT3G 3D3IA 2DYSC 3AG3C 1NBMG 1M9NA 3G71V 1LNQA 4FMTA 2WLLB 3JD2A 2X0LA 1PNKA 3B8NA 1BL8A 4DXWA 1QCEA 5GW7A 1MG1A 2Z3YA 1BHBA 1QLEB 3STLC 2EINC 3ML0A 2P67A 3CC7V 4L87A 1NH2B 2XAHA 4GX2A 3R65A 4MTOA 1R3KC 1NR7A 3LDEA 4ZKIA 1AI6A 5B3SC 2X6CA 2WLIA 2XOKG 5LGTA 3E8BA 1L1FA 5H9CA 4UVCA 4MVSA 2EZPA 1VQPV 1G4YB 3T4ZA 2F43G 1OCOC 2HVJC 1S76D 1Q82W 3E89A 2WLKA 3ZN0A 4MTXA 1ORQC 2JJ2G 1K5SA 1FS0G 4X89A 1M90W 1NVPD 1R6NA 2QM7A 3RVYA 1JOYA 3K06A 3CCVV 1KP2A 1E1RG 1K92A 4J9ZB 4JYCA 5FL7G 2NLJC 4YXWG 1VQMV 2WLMA 3W7WA 5LGUA 2ZDIA 2XAJA 5BZBA 3RVZA 2Q67A 1V55B 4MVZA 3CXCU 3SYCA 1M57B 1I5XA 5H6QA 5LHGA 1K97A 1FXKA 3DGEA 2ZD9A 3VBBA 1SZTA 1TUEB 5E1AC 3ZRVA 1AR1B 1MSWD 1VQOV 2EBOA 4PA4A 5B1OA 5LGNA 5J9PC 1UJWB 3ASOB 4P9OA 2H8PC 1GMGA 2OTJV 3CC2V 3QO8A 3K08A 3WFVA 3M99B 1MOFA 1K7DA 4TWKA 3CCUV 3LDCA 1Y4MA 2P7TC 1BHAA 5L3EA 5CA3A 1K73W 1YJ9V 3CCMV 3FB6C 2XASA 1Y66A 3EHBB 1QLEC 1OZ0A 2IJJA 4R50A 3OMIB 3MD0A 5EBLC 2V1DA 5IYCO 2WSSG 3G6EV 2UXNA 2YEVA 4RUFA 4X8AA 1PNLA 5IDJA 2LFRA 4FIPC 1ZWIC 1NR1A 1EFRG 4N21A 1RM1C 1JCHA 3E35A 2JEXA 3IFXA 2EIJB 1GO3F 2Y48A 4UVBA 5L3GA 1YTFD 1NQTA 4N23A 2BOCC 4PDVA 4JYBA 2LFSA 5EK0A 2EIMC 1THZA 2WLLA 2IJKA 2FTKA 1I5YA 1DF4A 4JTCB 3ASNB 1ROPA 3STZC 3TCUA 1S72V 3PJSK 4F4LA 1PKXA 2W0FC 3ABKC 3ZMZA 1KKDA 2A79B 1F4MA 3CCEV 4PELA 3F7YC 1YHQV 3AG2B 3AG1C 2IJIA 3K3WA 2JK5C 4E2LA 3IC7A 3LDDA 4UV9A 2HVKC 3ZN1A 5CBFA 4LCUC 4UXNA 3ABLB 2QEXV 1OCCB 1QR9A 1V55C 1V54B 3OR7C 2A9HA 4LC1A 1M57C 4JTAB 2HG5C 5C93A 1B6QA 4FK5C 1J95A 2W6IG 4KP4A 4RQFA 1VQKV 2OCCB 3HB3B 4HYOA 1KP3A 1VQ5V 3ASOC 3OR6C 4CBCA 2JDIG 3T2MA 4TSFG 2AHYA 4PA7A 3ZRXA 4QIWF 3LNMB 3RW0A 2GHYA 4FJCC 5LBQA 1AI4A 4MVUA 5CMUA 1GKFA 3FKSG 1Q81W 3E8HA 2DW4A 4BIUA 1NH2D 4JAVA 1R3LC 3QO7A 2ZDIC 2P6JA 1SERA 2PI5A 1AI5A 1VQLV 5B1AB 1FXKC 4MVQA 5KA6A 2IU3A 4GCZA 1GM8A 4PDMA 3T1CA 3T4DA 1VQ6V 3A0RA 3K03A 2HJFC 3OE7G 1KQSU 2EILC 4G27B 4HZ3A 2B1IA 2ZR3A 4WFBV 1VQNV 4J9YB 5B1BC 3IGAC 3E83A 4X88A 3UM7A 1VQ7V 4WFGA 4BIZA 3ETDA 1R3JC 4DO2A 3AG4B 4JGSA 4EKWA 2EIKB 1NJIW 4BAYA 1FFTB 4QE7A 1NVPB 1GM9A 1XL4A 2DQ0A 2QKSA 4MW3A 4QJFB 4MVRA 2DYRB 1K9MW 3OFNG 3W7XA 3AG2C 5LHIA 1JJ2U 3SYQA 4JPRA 5CBHA 4U7OA 3ZMUA 5EBMC 3JD4A 4RUEA 1YIJV 4U7NA 1F51A 3ABLC 2ITCC 1OCCC 4P2ZA 4PDLA 1K8AW 1KECA 1YITV 1K4DC 2XAQA 1IXMA 2JIZG 3BEHA 4I5SA 3I55V 2R9RB 4CZZA 2QTOA 5L3CA 4G2KA 1SESA 1PD3A 4I9WA 4JF3A 1E1QG 3X2QB 3E8FA 1R73A 5L3BA 3W7TA 1K4CC 3FYEB 4G28B 1N8RW 3MHSC 1SETA 1CEZA 1VQ4V 4P30A 1OCZB 2ATKC 3FB5C 4WFAV 2EINB 2XAFA 3ABMB 2EJRA 5H6RA 3E2EA 3OUFA 1K5QA 1H8EG 1K3EA 5B3SB 3OEHG 5B1AC 3UKMA 3SPHA 2PI4A 4JTDB 3JD1A 3H01A 1AJPA 2IW5A 4WF9V 4MVOA 1KD1W 4XDJA 3OM3B 3ZMSA 1OCOB 3ZRWB 1AROP 4PA3A 1F23A 2NNUA 4MS2A 3K04A 2D3OW 3JYCA 1GTOA 4P9PA 1BMFG 1F4NA 3AG4C 2EIKC 1P4RA 5CBGA 2B5UA 3OAAG 3GB7C 4PA9A 3WG7B 1MABG 4GT1A 2IJHA 5CN0A 2HFEC 2GSMB 2OTLV 4RO2A 2DYRC 4WFFA 2CK3G 2WAMA 1PL0A 2WLJA 5KUMA 3F5WC 5EBWC 3OW2U 2WPDG 1S0VA 5LHHA 3D36A 4GX1A 2WLNA 4KUMA 1CPYA 2JEUA 2W6JG 4Z1MG 3ZJZA 4HAMA 3OEEG 2HR3A 4R8CA 3CP1A 5EC1C 1VQ9V 2X7RB 2UXXA 2HLDG 4MW8A 1DTOA 3CMEV 4UVAA 4XDKA 2AHZA 3LSQA 5IYDO 2Q6AA 3FYIB 3K0DA 1QVGU 2QA4V 3MHHC 4MTGA 3K0GA 5KUKA 1YJNV 5DM6V 4UV8A 1COWG 1R3IC 2QM8A 3SJQC 3JD3A 1OCZC 4PDRA 1AJQA 2C2AA 4MTFA 3QO5A 1HWYA 3BY6A 5HFLA 3B77A 2HKOA 3CCSV 1JPXA 3CD6V 3ABMC 3VOUA 1ENVA 1WPXA 3JD0A 3JCZA 2ITDC 4Q20A 2IH3C 1K34A 4QPKA 1OHHG 2EIJC 1RPOA 4QE9A 1R6KA 2X6AA 4H37A 1QVFU 1FXHA 2Y69B 2H94A 1RM1B 3AEIA 3ZRSA 1G8MA 1S3JA 2DWEC 3EFFK 3CCRV 5B1NA 3F7VC 1RPRA 3CMAV 3LUTB 1XL6A 3ASNC 3ZIAG 3W7UA 2EIMB 3ZMTA 2ZR2A 3OMNB 4MSWC 5HFMA 2XNDG 4OXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVM A;  3TCU A;  3PJS K;  4F4L A;  2W0F C;  3ABK C;  1KKD A;  2A79 B;  2Q68 A;  3F7Y C;  3STL C;  2EIN C;  2ATK C;  2BOB C;  3AG1 C;  4GX2 A;  3FB5 C;  3R65 A;  3SPJ A;  4MTO A;  2JK5 C;  4LP8 A;  1R3K C;  3LDD A;  3WG7 C;  3LDE A;  4PA6 A;  2HVK C;  1V54 C;  4GX5 A;  5CBF A;  1P7B A;  3OUF A;  4LCU C;  5B3S C;  2X6C A;  2WLI A;  4LBE C;  5EC2 C;  1V55 C;  2Q69 A;  3E8B A;  3OR7 C;  2A9H A;  4MVS A;  1M57 C;  4XDL A;  2WLI B;  5B1A C;  4ZBM A;  4JTA B;  3UKM A;  3SPH A;  2HG5 C;  4JTD B;  4WFE A;  1G4Y B;  3T4Z A;  1OCO C;  2HVJ C;  2WLH A;  4MVO A;  4BW5 A;  2OCC C;  3E89 A;  4XDJ A;  3SPI A;  2WLK A;  1J95 A;  2X6B A;  1ORQ C;  4HYO A;  4PA3 A;  3SYA A;  3TET A;  4MS2 A;  4X89 A;  2A0L A;  3RVY A;  3ASO C;  3K04 A;  3OR6 C;  3JYC A;  3K06 A;  4P9P A;  4CBC A;  3T2M A;  2AHY A;  3E86 A;  4PA7 A;  4J9Z B;  3AG4 C;  4GX0 A;  2EIK C;  4H33 A;  2NLJ C;  3LNM B;  3RW0 A;  5CBG A;  3GB7 C;  2WLM A;  4MVU A;  4PA9 A;  3E8H A;  3OGC C;  4R6Z A;  1R3L C;  3FB7 C;  2HFE C;  3STZ C;  4RO2 A;  2DYR C;  4WFH A;  5BZB A;  3RVZ A;  2Q67 A;  4WFF A;  4MVZ A;  4P30 A;  4UUJ C;  2WLJ A;  3E8G A;  3F5W C;  5EBW C;  5KUM A;  3SYC A;  4MVQ A;  4GX1 A;  2WLN A;  2ZD9 A;  4PDM A;  4RAI A;  3T1C A;  2DWD C;  3T4D A;  5E1A C;  2KB1 A;  3ZJZ A;  3K03 A;  2HJF C;  4MVM A;  3HPL C;  3KG2 A;  4R8C A;  2EIL C;  5EC1 C;  4PA4 A;  4G27 B;  4HZ3 A;  2Y69 C;  5J9P C;  4J9Y B;  5B1B C;  4MW8 A;  3IGA C;  3E83 A;  4X88 A;  3UM7 A;  4P9O A;  2K1E A;  4WFG A;  2H8P C;  4XDK A;  1R3J C;  2AHZ A;  3K08 A;  4EKW A;  3RBZ A;  2Q6A A;  4TWK A;  3K0D A;  3LDC A;  4QE7 A;  2P7T C;  1S5H C;  4MTG A;  3K0G A;  5KUK A;  1XL4 A;  1R3I C;  2QKS A;  4R7C A;  4MW3 A;  3SJQ C;  1OCZ C;  4PDR A;  3SYO A;  3FB6 C;  4MVR A;  1QLE C;  4MTF A;  1M56 C;  4KFM A;  3AG2 C;  4R50 A;  3SYQ A;  5CBH A;  5IY5 C;  2IH1 C;  3OUS A;  5EBL C;  4QNH B;  3SYP A;  3ABM C;  2YEV A;  4RUF A;  4X8A A;  3VOU A;  5EBM C;  2ITD C;  4RUE A;  2IH3 C;  3FB8 C;  1OCR C;  1ZWI C;  2EIJ C;  2ITC C;  1OCC C;  2ZXW C;  3ABL C;  4P2Z A;  4PDL A;  2X6A A;  4QE9 A;  1K4D C;  3SPC A;  3IFX A;  4H37 A;  3SPG A;  3BEH A;  3X2Q C;  2R9R B;  3ZRS A;  4PDV A;  2BOC C;  2QTO A;  2DWE C;  3EFF K;  5EK0 A;  2DYS C;  3AG3 C;  3F7V C;  4I9W A;  3E8F A;  3LUT B;  2EIM C;  2WLL A;  1K4C C;  1XL6 A;  3ASN C;  1LNQ A;  2WLL B;  4G28 B;  4JTC B;  4MSW C;  1BL8 A;  4DXW A;  4OXS A; 
#chains in the Genus database with same CATH topology
 4O4J B;  1BT8 A;  2ZNJ A;  3OMA B;  3CCQ V;  4DR6 B;  2Q68 A;  1H2G A;  4KL1 A;  4D7T A;  3AG1 B;  1V54 C;  4XBF A;  2GTS A;  1OCR B;  1ZL8 B;  3O9O A;  1JX9 A;  4XDL A;  3K5O A;  4Z1V A;  1S77 D;  1JQ0 A;  3MAQ A;  1KKC A;  5IJ9 B;  2OCC C;  4EB6 B;  3SPI A;  2QE7 G;  3JAL A;  5IE9 A;  2O57 A;  1W0J G;  3ZX6 A;  2YSU B;  1BGY H;  5H2F Z;  4GX0 A;  1SKV A;  2LJ2 A;  3ZS8 C;  5IYZ A;  2XAG A;  3BAB A;  4UUJ C;  3JAT A;  2R9I A;  3LNN A;  1VAR A;  1SF9 A;  1SRY A;  1FXK B;  2KB1 A;  4OGQ B;  3QVN A;  4RQE A;  4DUZ B;  5K1P A;  3B4S A;  3CCL V;  2Y69 C;  2EIL B;  1DLB A;  1QBZ A;  1NI8 A;  1Q8I A;  2M6Y A;  4X1I B;  3B2E E;  1GK9 A;  2UXD B;  2EZO A;  1VF5 B;  1XHX A;  3DC5 A;  4KFM A;  2AGA A;  4I50 A;  5IY5 C;  3MDS A;  4KHP O;  2CH7 A;  4DV3 B;  1RFY A;  3OT7 A;  3CC4 V;  2YEV B;  4FPP A;  3UCS C;  3DTU B;  1KB9 F;  1QLN A;  4PHZ A;  3SPC A;  3RYF B;  1GRJ A;  2Y4U A;  3X2Q C;  1QR8 A;  3KKY A;  1M93 A;  1MSD A;  2DYS C;  3VQY A;  4LFB B;  3A0B Z;  4FMT A;  2WLL B;  1H2L A;  1O9G A;  3B8N A;  1BL8 A;  1N36 B;  4TQF A;  1H2N A;  4LF9 B;  4OPA A;  1GN2 A;  3ML0 A;  2P67 A;  4O4L A;  2Q8V A;  4LR3 A;  1FFX B;  2QWN B;  4GX2 A;  4MTO A;  3RYC A;  2QTS A;  3VQV A;  1G4Y B;  3IJ4 A;  2F43 G;  4X1Y B;  4UCV A;  4TV9 A;  1Q82 W;  2XUM A;  1IVS A;  4MTX A;  5EYP B;  2GV9 A;  1R6N A;  4LF4 B;  3N2K A;  2Y0P A;  4J9Z B;  4FLT A;  4DR3 O;  4O2A B;  2F23 A;  3BA9 A;  3M8A A;  4DW1 A;  1VQM V;  1Z5W A;  2WLM A;  5EZY B;  2N74 A;  3RVZ A;  4MVZ A;  4FLX A;  1HNW O;  3RGB A;  1TAE A;  2GDS A;  4ZI7 A;  3CSX A;  2YIB A;  3L70 H;  2G38 A;  5CA0 B;  1GMG A;  2H3O A;  3CC2 V;  3OTF A;  1MOF A;  3CCU V;  3LDC A;  2P7T C;  5L3E A;  5CA3 A;  2KG7 B;  1FJG B;  3FB6 C;  1QLE C;  4IGG A;  4O2B A;  1HR0 B;  3J7A U;  3MD0 A;  1Y6X A;  2WSS G;  1Q3E A;  4FIP C;  3H1I H;  1JCH A;  1TGO A;  4I9Q A;  1GO3 F;  4UVB A;  2YIB D;  2BOC C;  2QJ1 A;  4PDV A;  5LMN B;  1GAX A;  3BAA A;  5B5E Z;  2UU9 B;  1I5Y A;  1SQV H;  2JRI A;  4HNA B;  5J2T B;  1ROP A;  3TCU A;  3PJS K;  2A79 B;  4JI8 O;  3AG1 C;  1PP9 H;  2PUS A;  3CWB H;  4NXM O;  5KX5 A;  2KSD A;  4FLV A;  3ZN1 A;  3ABL B;  2QEX V;  4J7Z A;  1V55 C;  2A9H A;  4LC1 A;  1M57 C;  2VQF O;  4TUY B;  1XNR O;  2QWQ B;  1D5N A;  2BTO A;  1B6Q A;  1N32 B;  3AK1 A;  5IWA O;  4HYO A;  1KP3 A;  1VIB A;  1P49 A;  3ASO C;  4I55 B;  2JDI G;  4CH5 A;  3ZRX A;  2JS5 A;  4FZ0 A;  4DR7 B;  3RW0 A;  4FJC C;  2FML A;  3CRC A;  4LNU A;  4UCS A;  4MVU A;  3JAR A;  2DW4 A;  5A9G A;  1NH2 D;  4JAV A;  1R3L C;  4F6R A;  3L9D A;  1IX9 A;  4K3A A;  1FXK C;  2EUL A;  4GCZ A;  3T1C A;  3RYH B;  4X1K A;  2A3Q A;  3A0R A;  3OE7 G;  2VWK A;  2EIL C;  4G27 B;  4J9Y B;  5JQG A;  4X88 A;  4DRX B;  1SQG A;  2CE4 A;  1NJI W;  4JGS A;  3QF7 A;  4BAY A;  5JVD B;  4BW9 A;  3L75 H;  3ZED A;  4UCR A;  2OYQ A;  2Q7G A;  4YJ3 A;  4B08 A;  4J42 A;  2LW1 A;  4X20 B;  4AHC A;  1BQZ A;  5JJJ B;  3W7X A;  5LHI A;  5LA6 B;  3ZMU A;  3A8T A;  1PL4 A;  3RFR A;  4U7N A;  4AI8 A;  1OCC C;  1K8A W;  1K4D C;  2XAQ A;  4AIL C;  2JIZ G;  4JI7 B;  1IBM O;  1TVK A;  5L3B A;  4I9W A;  4JF3 A;  3W7T A;  1R73 A;  1Y76 B;  1VMG A;  3HKB A;  1N8R W;  3CX5 F;  2JS3 A;  3M7M X;  5J2U A;  3KCY A;  2QR4 A;  2ATK C;  2YDE A;  3FB5 C;  4JYY A;  3ABM B;  2EJR A;  5H6R A;  4Z2W A;  1K5Q A;  1PPJ H;  5B3S B;  3OEH G;  3KCX A;  2PI4 A;  4JTD B;  1N34 B;  4LFC O;  3D36 C;  1X4T A;  3OM3 B;  1FAF A;  3WB2 A;  5LP6 C;  1NTZ H;  1XDC A;  2ZE7 A;  4PA3 A;  5BY1 A;  3JAL B;  1J5E B;  1QQC A;  4CS4 A;  2AXT Z;  2D3O W;  1GTO A;  2VQE B;  1FD9 A;  2EIK C;  5CBG A;  5IYZ B;  4TOI A;  2OTL V;  4JZ2 A;  4WFF A;  2WAM A;  5KUM A;  2UXD O;  3F5W C;  3D36 A;  1IBL O;  2WLN A;  2NR5 A;  3JAT B;  2JEU A;  3D8C A;  5LP6 A;  3OEE G;  2HR3 A;  4DV3 O;  2UXX A;  1QNM A;  1XI1 A;  3CME V;  1XNQ B;  2Q6A A;  1URF A;  5KUK A;  3APO A;  4DR1 B;  4LFB O;  2QM8 A;  2F93 B;  1OCZ C;  4JI3 O;  4W4K A;  2GBO A;  1JMK C;  3B77 A;  1N36 O;  2YXL A;  3CCS V;  2YC0 A;  3VOU A;  1ENV A;  4I50 B;  2F4V B;  3EXA A;  2CH7 B;  4Q20 A;  1K34 A;  1IXB A;  1W59 A;  1OHH G;  1VEW A;  4DR3 B;  2ZIM A;  2L6L A;  2Y69 B;  2H94 A;  1RM1 B;  5KHG A;  1XMO O;  4NTW A;  3F7V C;  1RPR A;  2YUA A;  2QWP B;  3W7U A;  1HNW B;  1YSC A;  1DF5 A;  5IYB O;  4QPJ A;  2Z5U A;  2P90 A;  2BOB C;  4ZIB A;  3W7S A;  5IY5 B;  1PNM A;  2QGN A;  3SPJ A;  2LW7 A;  4LP8 A;  4ASU G;  4O4L B;  3A0H Z;  4UFZ A;  2BSK A;  4QGP A;  4H44 B;  3RYC B;  5EC2 C;  1YCI A;  3HKC A;  3JSL A;  5JJE B;  2LP7 A;  3N2G A;  5C8Y A;  2DYS B;  5L3D A;  4TV9 B;  2X6B A;  3TET A;  5GON A;  2WWW A;  2ILM A;  1NKD A;  4JAU A;  4H33 A;  3N2K B;  4NKG B;  1XIL A;  2P06 A;  3TK1 A;  1Q7Y W;  1X59 A;  2W0X A;  3E8G A;  3THO A;  2UXB O;  1HR0 O;  5L3F A;  3ETE A;  4ZI7 B;  1MA1 A;  1YI2 V;  4JI8 B;  4IIJ A;  2JGD A;  1H8H G;  2B1G A;  4PV1 B;  2ADQ B;  4LH7 A;  4GUN A;  1S5H C;  3B8M A;  2VQF B;  1XNR B;  1EBO A;  3G67 A;  3CYO A;  2UU9 O;  2P22 C;  1W2B U;  1M56 C;  2M7W A;  3OUS A;  4O2B B;  4QNH B;  1SS3 A;  3SYP A;  4JAS A;  1BZK A;  3DC6 A;  3AK2 A;  1K33 A;  3ZHR A;  1CP9 A;  1WA8 A;  3NXS A;  3CXH F;  4TT3 G;  3D3I A;  1NBM G;  1M9N A;  4I7Z B;  3G71 V;  5D5P A;  5D5Q A;  1HDJ A;  1WPB A;  4DXW A;  3EVK A;  1QCE A;  4PD4 F;  5KMG A;  1BHB A;  1QLE B;  1AR5 A;  4L87 A;  1NH2 B;  1BQ0 A;  1BS3 A;  4NXN B;  2ZNI A;  1NR7 A;  2HJD A;  4DR7 O;  4ZKI A;  3SJC C;  5B3S C;  5KX5 B;  2XOK G;  5LGT A;  1L1F A;  1Q6U A;  3LSU A;  4MVS A;  4CS2 A;  1VQP V;  2IM9 A;  1S76 D;  2Q7E A;  3TGU H;  2JJ2 G;  1B04 A;  1M90 W;  1JOY A;  4DV4 O;  5KHK A;  2Q73 A;  3BCC H;  3KZI Z;  2RN9 A;  2ZIN A;  3E22 A;  4U3J A;  2PYL A;  4YXW G;  2N05 A;  5DED A;  4B3R B;  4LNU B;  1IBM B;  1Y67 A;  3JAR B;  2ZDI A;  3N27 A;  5BZB A;  4DV0 B;  2PYJ A;  2Q67 A;  2ZKO A;  1V55 B;  3JAW A;  5LOV A;  1M57 B;  4X62 B;  5LHG A;  4F6R B;  1K97 A;  1KU9 A;  4DV2 O;  2VWJ A;  5E1A C;  3HKE A;  2XTA A;  4J7K A;  4X1K B;  2EBO A;  4O4H A;  2JVD A;  2OWO A;  5LGN A;  3ASO B;  3ZHU A;  4P9O A;  2H8P C;  5JQG B;  2OTJ V;  3PN1 A;  3WFV A;  1K7D A;  1R1B A;  2MW2 B;  4JI7 O;  3L71 H;  5LMU B;  1K73 W;  3CCM V;  4LFC B;  3EHB B;  2GTA A;  4YJ3 B;  3OMI B;  1MNG A;  3G6E V;  2HP8 A;  5IDJ A;  4YJ2 A;  2YI8 A;  4YHH O;  4N21 A;  1RM1 C;  4TQD A;  4K8Z A;  2JEX A;  2Y48 A;  1YTF D;  1UFI A;  4JYB A;  2P5O A;  1SZX A;  1TVK B;  1N34 O;  3HKB B;  1IBL B;  2AW9 A;  3DSQ A;  4BWA A;  2W0F C;  2WA4 A;  1J5E O;  4PEL A;  4FFB A;  5J2U B;  1Z5V A;  2VQE O;  2IJI A;  3K3W A;  2JK5 C;  4E2L A;  2PZS A;  3IC7 A;  3LDD A;  4GYC B;  4LCU C;  1OCC B;  4DUY B;  1EN6 A;  3SJB C;  3ZHQ A;  3P3P A;  5H5N A;  2HG5 C;  1RSO A;  4GKK O;  5C93 A;  1Q43 A;  4JI3 B;  2ETN A;  4J7J A;  3HB3 B;  3H9V A;  4DV1 O;  1G6U A;  3OR6 C;  1HW7 A;  3T2M A;  2AHY A;  2CUG A;  4I0X A;  4PA7 A;  1HNZ O;  3ZHT A;  3BRC A;  5GTI Z;  1AI4 A;  5CMU A;  3T1Y O;  4JI4 B;  1Q81 W;  2IBZ H;  1XNQ O;  1JA8 A;  2P6J A;  1XMO B;  2PI5 A;  4DR1 O;  2LO1 A;  4X66 O;  1M5I A;  1Z2G A;  1ZX3 A;  1VQ6 V;  2F4V O;  5LP6 B;  2ZR3 A;  4TV8 A;  3IGA C;  3UM7 A;  1VQ7 V;  2PTM A;  4WFG A;  5FPO A;  1XMQ O;  4BIZ A;  3ETD A;  4DO2 A;  2RMK B;  4EKW A;  2EIK B;  2UUA B;  1AB3 A;  3UT5 A;  1WP7 A;  1SQF A;  4LH6 A;  3K5L A;  4FM2 A;  2OCH A;  1K9M W;  3AG2 C;  4JPR A;  1NZ6 A;  4U7O A;  5EBM C;  4RUE A;  1YIJ V;  1F51 A;  5LXT A;  2BE3 A;  2E75 B;  2F66 C;  1IXM A;  2ZE5 A;  3BEH A;  2Y4T A;  1U96 A;  4CZZ A;  2QTO A;  5L3C A;  4E4E A;  1SES A;  1E1Q G;  5BXZ A;  2UUB O;  1K4C C;  4JV5 B;  3AG7 A;  1D5A A;  1BCC H;  2UXB B;  1OCZ B;  1YEW A;  5JJN B;  2CAZ C;  1EN4 A;  2EIN B;  2R9A A;  3OUF A;  2BSK B;  1K3E A;  4JI2 O;  3RN4 A;  2CGO A;  5ITZ A;  5B1A C;  3SPH A;  3HKC B;  3CHX A;  3ZBH A;  3U11 A;  4DYL A;  2UUC O;  3N2G B;  4W4L A;  5C8Y B;  1ARO P;  2DOS A;  1F23 A;  4J10 A;  3FD9 A;  3JYC A;  5GON B;  1BMF G;  2K9P A;  4L8J A;  4JI0 O;  2N04 A;  3CEI A;  2QDO A;  2IJH A;  1H2K A;  2DYR C;  1TUB A;  1TA8 A;  2WLJ A;  3FAV A;  5LHH A;  4GX1 A;  4D6T H;  2W6J G;  4Z1M G;  4YY3 O;  4JI5 B;  4DV6 B;  1FPO A;  2R70 A;  1H2M A;  4DR5 B;  5IT9 N;  4IIJ B;  2JGD B;  2HLD G;  4MW8 A;  5AG2 A;  4JI6 B;  2CTW A;  3VQW A;  3CB2 A;  3LSQ A;  2QA4 V;  4GLX A;  3K0G A;  4UV8 A;  3UO2 A;  1WB7 A;  2C2A A;  3F5T A;  3BY6 A;  4OX9 B;  3K59 A;  4DV4 B;  2ITD C;  4NXN O;  1AIL A;  4LF8 O;  1WNS A;  1N4C A;  2ZCE A;  3K58 A;  1WA8 B;  1S3J A;  1NU1 H;  2ZE6 A;  3HKD A;  1GH6 A;  2ZR2 A;  2XND G;  2DMX A;  4DV2 B;  3QG5 A;  3ZCC A;  1M56 B;  3I5D A;  5KMG B;  3ABK B;  3WG7 C;  1W0K G;  4PA6 A;  4K35 A;  5A2Q N;  4GX5 A;  3K5N A;  4LBE C;  2Q69 A;  3RYI A;  1EN5 A;  4B3R O;  1JFF A;  4IYI A;  2MK3 A;  4DV0 O;  5EIB C;  3ZRW A;  3JAS A;  4X62 O;  2ODM A;  3CCJ V;  4HBN A;  2A0L A;  1H38 A;  2RJZ A;  2Y0I A;  3E86 A;  5KAF Z;  4YHH B;  3E22 B;  4U3J B;  3LSS A;  2E5L B;  3VQX A;  4LF7 B;  4DR4 O;  1AP6 A;  5B66 Z;  2UXC B;  4R6Z A;  4MT8 A;  5TIS Z;  2A7W A;  3CJH A;  4WFH A;  3S3W A;  2V7Q G;  5IJ0 A;  5LMU O;  3BVO A;  3JAW B;  5LOV B;  5KHJ A;  1G1X B;  3KG2 A;  1EZJ A;  4NR1 A;  1YTF B;  5JWP A;  3HKE B;  4O4H B;  1Q86 W;  4FLZ A;  3K79 A;  1L8D A;  2ZQM A;  3RBZ A;  4R7C A;  3SYO A;  4GKK B;  2DQ3 A;  2YXH A;  5FNV A;  2IH1 C;  2OT5 A;  1KC8 W;  4DV1 B;  1VQ8 V;  1JR9 A;  5LL6 Y;  4YJ2 B;  2ZXW C;  1HNZ B;  2JJ1 G;  5EIB D;  1AI7 A;  2RCV A;  3I56 V;  2IU0 A;  3T1Y B;  3P30 A;  4DUY O;  3AG3 C;  4O4I A;  2E3C A;  4JYA B;  3JD2 A;  4X66 B;  2X0L A;  3OGI B;  1PNK A;  5GW7 A;  4C7U A;  4B3T O;  1MG1 A;  2Z3Y A;  5BMV A;  1OV9 A;  2EIN C;  3CC7 V;  2KKW A;  2XAH A;  4FFB B;  3R65 A;  1R3K C;  4LF6 O;  5BR8 O;  3LDE A;  4DR2 B;  5E79 Z;  1XMQ B;  1AI6 A;  2X6C A;  2WLI A;  4JZG A;  4BR6 A;  3R66 A;  4JI4 O;  3E8B A;  5H9C A;  4UVC A;  3L72 H;  4DW0 A;  2CGN A;  4LFA O;  3T4Z A;  2HVJ C;  1IDS A;  1U97 A;  1Y74 A;  1HNX O;  1RSO B;  2WLK A;  3ZN0 A;  1ORQ C;  1K5S A;  2YIC A;  1FS0 G;  4X89 A;  1MZF A;  1OJH A;  3RVY A;  5CA1 A;  1E1R G;  1K92 A;  1SQX H;  2NLJ C;  4I0X B;  5GTH Z;  2YS8 A;  3W7W A;  2UUA O;  2CTR A;  1ZLZ A;  2VS0 A;  2UUB B;  1I5X A;  3DGE A;  3A2F A;  1AR1 B;  1YF2 A;  1MSW D;  4PA4 A;  4GKJ B;  5B1O A;  5J9P C;  1UJW B;  1BSM A;  3H1J H;  4TV8 B;  4ICG A;  2DN9 A;  3B40 A;  4ZHQ A;  4TWK A;  1Y4M A;  4JI2 B;  1Q6H A;  2FL4 A;  5JCO A;  4JV5 O;  3UT5 B;  1Y66 A;  2UUC B;  5CB4 A;  1OZ0 A;  4X9Q A;  5JH7 A;  2V1D A;  5IYC O;  4X8A A;  1PNL A;  2LFR A;  4NVP A;  4JI0 B;  1N0N A;  1NR1 A;  4UCO A;  4K0K B;  3E35 A;  3IFX A;  5LXT B;  1XOU A;  5L3G A;  1B3Q A;  2LFS A;  3T1H O;  2IJK A;  1XEQ A;  1DF4 A;  4JTC B;  1SQQ H;  4CS3 A;  1S72 V;  1ZAU A;  4F4L A;  1PKX A;  3ABK C;  4YY3 B;  1KKD A;  1F4M A;  3CCE V;  3AG2 B;  3CRM A;  3JAK A;  1I0H A;  3CRR A;  1IBK B;  4UV9 A;  2HVK C;  5CBF A;  2OIG A;  2YI9 A;  1QR9 A;  3OR7 C;  1S5L Z;  1RP3 B;  3CRQ A;  5KHH A;  2LGW A;  2Q4P A;  4UB8 Z;  5ITZ B;  4UB6 Z;  4NB5 A;  4FK5 C;  1J95 A;  2W6I G;  4RQF A;  4JI5 O;  4DV6 O;  4CBC A;  4DR5 O;  1NTK H;  1JJO A;  4TSF G;  2V4D A;  4LF5 B;  4QIW F;  3LNM B;  4JI6 O;  2GHY A;  4LF8 B;  1QU7 A;  5LBQ A;  1GKF A;  2ARH A;  2Q0A A;  2QKC A;  4CH4 A;  3QO7 A;  2ZDI C;  1SA0 A;  1AI5 A;  3H1H H;  1VQL V;  2KQX A;  1TUB B;  5B1A B;  4MVQ A;  4PDM A;  3FAV B;  1VP7 A;  3T4D A;  3K03 A;  4IYH A;  1KQS U;  4OX9 O;  2PY5 A;  4HZ3 A;  2B1I A;  4K8X A;  2ZE8 A;  2EX3 A;  3E83 A;  4X65 O;  1P84 F;  2QKA A;  2HHH O;  1AR4 A;  1R3J C;  3JCU Z;  3H1L H;  1FFT B;  4ZOL A;  4QE7 A;  1NVP B;  1GM9 A;  1XL4 A;  2DQ0 A;  1NT2 B;  2QKS A;  5K1X A;  1VF6 C;  2DYR B;  3OFN G;  1JJ2 U;  5CBH A;  1N33 O;  3JD4 A;  3SJA C;  4LWS A;  5KLV H;  1Q6I A;  3U0Z A;  2P4V A;  2QSA A;  4PDL A;  1KEC A;  4AQY B;  1YIT V;  3I55 V;  2R9R B;  4DR4 B;  1SC5 B;  3WB1 A;  1PD3 A;  1SQP H;  3E8F A;  4DK0 A;  4H13 B;  4G28 B;  1Q5O A;  3HKD B;  1SET A;  1CEZ A;  1VF6 A;  1KYO F;  3JAM N;  1ZTE A;  2XAF A;  3E2E A;  3BFR A;  1H8E G;  2E5L O;  3TXQ A;  4LF7 O;  3BA8 A;  2UXC O;  1XUQ A;  3G80 A;  2VRZ A;  3UKM A;  3RYI B;  3JD1 A;  3C3S A;  3H01 A;  1JFF B;  2IW5 A;  4WF9 V;  1ZSP A;  2L35 A;  3ZMS A;  1OCO B;  3ZRW B;  3CE2 A;  3JAS B;  2NNU A;  1HP8 A;  3K04 A;  4P9P A;  1UPG A;  1F4N A;  3AG4 C;  4IHJ A;  1P4R A;  2B5U A;  1GN3 A;  3OAA G;  3ICX A;  3GB7 C;  4PA9 A;  3WG7 B;  1MAB G;  5CN0 A;  2ADP A;  3S3X A;  4Q6G A;  4DV5 B;  3CJH B;  5EBW C;  2WPD G;  5IJ0 B;  2WA3 A;  4EFE A;  3DXR A;  1A32 A;  4UCU A;  4B3T B;  3ZJZ A;  4R8C A;  1S5J A;  2DJV A;  5EC1 C;  1VQ9 V;  3K5M A;  2X7R B;  4IT5 A;  1DTO A;  5BR8 B;  4LF6 B;  4RWU A;  2BTQ A;  2B9Z A;  4XDK A;  4EEQ A;  5IYD O;  2E76 B;  1QVG U;  3UQ8 A;  3MHH C;  5DM6 V;  1COW G;  1R3I C;  4LFA B;  3SJQ C;  3SDL A;  4JYA O;  1HNX B;  4MTF A;  3QO5 A;  5HFL A;  2HKO A;  4CH6 A;  5FNV B;  4B3S O;  4PI0 A;  1RPO A;  4QE9 A;  2X6A A;  4DR2 O;  4H37 A;  1FXH A;  2CTQ A;  2R72 A;  3AEI A;  4BIO A;  3L73 H;  4DK1 A;  3EFF K;  3CMA V;  1MZE A;  1XL6 A;  2QWO B;  4O4I B;  3SGI A;  2EIM B;  3ZMT A;  5HFM A;  1YZB A;  1JVM A;  3ABU A;  5BMV B;  1WP8 A;  1NTM H;  2Z0A A;  1BE3 H;  1E79 G;  1P7B A;  2ZXW B;  2LQT A;  3RWR D;  5FPR A;  2WLI B;  4ZBM A;  4WFE A;  2WLH A;  4BW5 A;  1WJZ A;  3AG3 B;  3Q4H A;  4GZR B;  4ABM A;  1Y74 B;  2FB5 A;  3ETG A;  3SYA A;  1PV0 A;  2FYU H;  2RNB A;  3ABT A;  3K9A A;  1WAZ A;  2F95 B;  3O65 A;  4GKJ O;  2RQ6 A;  1LR1 A;  5CA1 B;  5KA5 A;  4X64 O;  1EM1 A;  3QNE A;  4JI1 B;  1GM7 A;  3OGC C;  5LYJ A;  3FB7 C;  1LUV A;  1I94 O;  2HEP A;  1N0J A;  1ZUQ A;  3T1H B;  4B3M O;  4FLW A;  4NYK A;  3IAY A;  3GWO A;  4I4T A;  4RAI A;  4FZ1 A;  2DWD C;  1M1K W;  1FYJ A;  2P4K A;  4MVM A;  3HPL C;  3GVM A;  2EJ7 A;  1WLE A;  5DN6 G;  2K1E A;  4K0K O;  2GUZ A;  5B1B B;  2F1M A;  4FLY A;  1YVW A;  4FLU A;  3RT3 C;  2D2C B;  1YJW V;  1R6T A;  3P32 A;  4ZHQ B;  3QTC A;  3UO3 A;  3K9S A;  4DV7 O;  1SQB H;  1EZV H;  5CB4 B;  4J80 A;  2PGG A;  5JH7 B;  4WCE V;  3FB8 C;  1OCR C;  3IC9 A;  4YIP A;  1IBK O;  4B7K A;  1AJN A;  3SPG A;  1FXV A;  4WBN A;  3G4S V;  1CXZ B;  3OTO B;  3CPW U;  3ZMV A;  3FX7 A;  3SR2 C;  2XT9 A;  3ZHS A;  3L74 H;  3CS5 A;  1KUQ A;  1LNQ A;  4U3F H;  4O4J A;  4OPH A;  1LUW A;  2Q0O C;  3WB0 A;  3STL C;  1O9H A;  2AZ0 A;  3JAK B;  4LF5 O;  3AK3 A;  4X65 B;  1ZL8 A;  2HHH B;  1IUR A;  2ZM6 B;  3WU2 Z;  5IJ9 A;  2EZP A;  4EB6 A;  2OIE A;  1OCO C;  1QHT A;  3E89 A;  1GN6 A;  2YID A;  1NVP D;  1N33 B;  2QM7 A;  3K06 A;  3CCV V;  1KP2 A;  3JSN A;  4JYC A;  5FL7 G;  4H0L B;  3TXS A;  5LGU A;  2XAJ A;  1SA0 B;  3CXC U;  1DK1 A;  3SYC A;  5H6Q A;  1FXK A;  2ZD9 A;  4NTY A;  1SZT A;  2DE0 X;  3VBB A;  1TUE B;  3ZRV A;  3BHP A;  1YDX A;  4DR6 O;  1VQO V;  2QWR B;  1MMM A;  2ZT9 B;  4X1I A;  4AQY O;  3QO8 A;  4NTX A;  3K08 A;  3M99 B;  2E74 B;  1BHA A;  4ZOL B;  2NN4 A;  1YJ9 V;  2XAS A;  3P3N A;  4FM0 A;  1US6 A;  2IJJ A;  4R50 A;  1AP5 A;  5EBL C;  4J41 A;  2UXN A;  2YEV A;  4RUF A;  1ZWI C;  2ZIO A;  3RYF A;  1EFR G;  4LWS B;  2A06 H;  4FVM A;  1L0N H;  2EIJ B;  3J81 N;  1NQT A;  1XBL A;  4N23 A;  5EK0 A;  2EIM C;  1THZ A;  2WLL A;  2FTK A;  1NS1 A;  3BPZ A;  3ASN B;  5KAI Z;  3STZ C;  4KHP B;  3ZMZ A;  1FFX A;  3F7Y C;  1YHQ V;  4IL6 Z;  4DUZ O;  3NR7 A;  1L0L H;  1DGS A;  2QM4 A;  4UXN A;  4EFB A;  2Q9L A;  1D2D A;  1V54 B;  4X1Y A;  2BCC H;  4JTA B;  3CRA A;  4DV5 O;  1F7Y A;  5EYP A;  1VQK V;  4KP4 A;  2OCC B;  2YIA A;  1VQ5 V;  1YXB A;  4O2A A;  4B3S B;  3FFQ A;  5EZY A;  1KMI Z;  2RDC A;  4IHJ B;  3FKS G;  3K57 A;  3E8H A;  4B7E A;  4BIU A;  1M4U A;  1SER A;  3J80 N;  4A5U B;  1KBH A;  2YXY A;  3C3T A;  5KA6 A;  2IU3 A;  1GM8 A;  2XHB A;  4LF9 O;  2HJF C;  3DXR B;  1V9P A;  4CC6 A;  4WFB V;  5CA0 A;  1VQN V;  5B1B C;  3H1K H;  2CDY A;  3AG4 B;  1Q90 D;  3OD4 A;  2BTQ B;  4D7S A;  5JCO C;  2KG7 A;  1GN4 A;  4MW3 A;  1FKA O;  4QJF B;  4MVR A;  1AVM A;  3GWK C;  3SYQ A;  4LF4 O;  1VF7 A;  3ZHV A;  3ABL C;  2ITC C;  4P2Z A;  2LGQ A;  4X64 B;  4I5S A;  4FM1 A;  2FKX A;  4G2K A;  1I94 B;  3X2Q B;  4HNA A;  5J2T A;  4B3M B;  3FYE B;  3MHS C;  1VQ4 V;  4P30 A;  3G6B A;  5KHI A;  4YIO A;  4WFA V;  5FLX N;  2CTP A;  4JI1 O;  1WN7 A;  4TUY A;  2JGU A;  5F2V O;  3ETQ A;  1AJP A;  1FJG O;  4MVO A;  1KD1 W;  4XDJ A;  4DV7 B;  3Q4H B;  4CC5 A;  4MS2 A;  4I55 A;  1WB8 A;  4PI2 A;  4NXM B;  4UCT A;  3APQ A;  1XHZ A;  1XQ8 A;  3TJT A;  1P7G A;  2PF4 E;  4GT1 A;  5LMN O;  2HFE C;  2GSM B;  4RO2 A;  5DEC A;  5LYJ B;  2CK3 G;  1PL0 A;  4FFK A;  3OW2 U;  1S0V A;  3C90 A;  3RYH A;  4KUM A;  1I08 A;  1CPY A;  5IWA B;  4I4T B;  3HR0 A;  4HAM A;  3CP1 A;  4DRX A;  1T5E A;  1I7F A;  4F6E A;  4KXR A;  4UVA A;  5JVD A;  2AHZ A;  3OTO O;  3FYI B;  2GUZ B;  3K0D A;  3B09 A;  4MTG A;  1YJN V;  4CH3 A;  4X20 A;  2AZ2 A;  3JD3 A;  3U10 A;  4PDR A;  1AJQ A;  4JAA A;  5LA6 A;  4J11 A;  1N32 O;  1HWY A;  1XRE A;  1IZ3 A;  1H2S B;  1JPX A;  3CD6 V;  3ABM C;  1WPX A;  3JD0 A;  3JCZ A;  2IH3 C;  4QPK A;  2EIJ C;  4PJ0 Z;  1R6K A;  2Q7H A;  1QVF U;  2Q5Z A;  1B06 A;  2ZM6 O;  3ZRS A;  1Y76 A;  1PM9 A;  4WBN B;  1G8M A;  2DWE C;  3CCR V;  5B1N A;  3D3Q A;  3LUT B;  3ASN C;  3ZIA G;  3OMN B;  4MSW C;  4OXS A; 
#chains in the Genus database with same CATH homology
 1JVM A;  1YSC A;  3ZCC A;  1DF5 A;  3ABU A;  3OMA B;  3CCQ V;  5IYB O;  1M56 B;  2Q68 A;  4QPJ A;  2Z5U A;  2P90 A;  3ABK B;  2BOB C;  1H2G A;  3W7S A;  5IY5 B;  1PNM A;  3SPJ A;  4ASU G;  4LP8 A;  3WG7 C;  3AG1 B;  1W0K G;  1E79 G;  4PA6 A;  1V54 C;  4GX5 A;  4XBF A;  1P7B A;  1OCR B;  5EC2 C;  2ZXW B;  4LBE C;  2Q69 A;  1JX9 A;  4XDL A;  1S77 D;  2WLI B;  1JQ0 A;  4ZBM A;  2MK3 A;  4WFE A;  2LP7 A;  2WLH A;  4BW5 A;  2OCC C;  2DYS B;  3AG3 B;  5L3D A;  3SPI A;  3ZRW A;  3CCJ V;  2QE7 G;  2X6B A;  3ETG A;  3SYA A;  3TET A;  1W0J G;  2WWW A;  2A0L A;  2YSU B;  3ABT A;  3K9A A;  1H38 A;  3E86 A;  1NKD A;  4GX0 A;  4JAU A;  4H33 A;  5KA5 A;  3LSS A;  3QNE A;  3TK1 A;  1GM7 A;  1Q7Y W;  3OGC C;  4R6Z A;  3FB7 C;  4MT8 A;  2XAG A;  4WFH A;  2V7Q G;  4UUJ C;  3E8G A;  2R9I A;  3GWO A;  1SRY A;  4RAI A;  2DWD C;  5L3F A;  1FXK B;  2KB1 A;  3ETE A;  1M1K W;  4MVM A;  3HPL C;  1EZJ A;  3KG2 A;  1YI2 V;  4RQE A;  1YTF B;  1H8H G;  1WLE A;  3CCL V;  5DN6 G;  2Y69 C;  2EIL B;  2B1G A;  1Q86 W;  1DLB A;  2K1E A;  1QBZ A;  3K79 A;  2ZQM A;  5B1B B;  3RBZ A;  1YJW V;  1S5H C;  3P32 A;  3B8M A;  1EBO A;  1GK9 A;  4R7C A;  3CYO A;  3SYO A;  2EZO A;  1W2B U;  1M56 C;  4KFM A;  2DQ3 A;  5IY5 C;  2M7W A;  2IH1 C;  3OUS A;  4QNH B;  2OT5 A;  3SYP A;  1KC8 W;  4JAS A;  1VQ8 V;  4WCE V;  3CC4 V;  2YEV B;  3FB8 C;  1OCR C;  1K33 A;  4FPP A;  3DTU B;  2ZXW C;  1QLN A;  2JJ1 G;  1AJN A;  3SPC A;  3SPG A;  1AI7 A;  1CP9 A;  1FXV A;  3NXS A;  3I56 V;  3G4S V;  2IU0 A;  3CPW U;  3X2Q C;  3ZMV A;  1QR8 A;  3P30 A;  4TT3 G;  3D3I A;  2DYS C;  3AG3 C;  1NBM G;  1M9N A;  3G71 V;  1LNQ A;  4FMT A;  2WLL B;  3JD2 A;  2X0L A;  1PNK A;  3B8N A;  1BL8 A;  4DXW A;  1QCE A;  5GW7 A;  1MG1 A;  2Z3Y A;  1BHB A;  1QLE B;  3STL C;  2EIN C;  3ML0 A;  2P67 A;  3CC7 V;  4L87 A;  1NH2 B;  2XAH A;  4GX2 A;  3R65 A;  4MTO A;  1R3K C;  1NR7 A;  3LDE A;  4ZKI A;  1AI6 A;  5B3S C;  2X6C A;  2WLI A;  2XOK G;  5LGT A;  3E8B A;  1L1F A;  5H9C A;  4UVC A;  4MVS A;  2EZP A;  1VQP V;  1G4Y B;  3T4Z A;  2F43 G;  1OCO C;  2HVJ C;  1S76 D;  1Q82 W;  3E89 A;  2WLK A;  3ZN0 A;  4MTX A;  1ORQ C;  2JJ2 G;  1K5S A;  1FS0 G;  4X89 A;  1M90 W;  1NVP D;  1R6N A;  2QM7 A;  3RVY A;  1JOY A;  3K06 A;  3CCV V;  1KP2 A;  1E1R G;  1K92 A;  4J9Z B;  4JYC A;  5FL7 G;  2NLJ C;  4YXW G;  1VQM V;  2WLM A;  3W7W A;  5LGU A;  2ZDI A;  2XAJ A;  5BZB A;  3RVZ A;  2Q67 A;  1V55 B;  4MVZ A;  3CXC U;  3SYC A;  1M57 B;  1I5X A;  5H6Q A;  5LHG A;  1K97 A;  1FXK A;  3DGE A;  2ZD9 A;  3VBB A;  1SZT A;  1TUE B;  5E1A C;  3ZRV A;  1AR1 B;  1MSW D;  1VQO V;  2EBO A;  4PA4 A;  5B1O A;  5LGN A;  5J9P C;  1UJW B;  3ASO B;  4P9O A;  2H8P C;  1GMG A;  2OTJ V;  3CC2 V;  3QO8 A;  3K08 A;  3WFV A;  3M99 B;  1MOF A;  1K7D A;  4TWK A;  3CCU V;  3LDC A;  1Y4M A;  2P7T C;  1BHA A;  5L3E A;  5CA3 A;  1K73 W;  1YJ9 V;  3CCM V;  3FB6 C;  2XAS A;  1Y66 A;  3EHB B;  1QLE C;  1OZ0 A;  2IJJ A;  4R50 A;  3OMI B;  3MD0 A;  5EBL C;  2V1D A;  5IYC O;  2WSS G;  3G6E V;  2UXN A;  2YEV A;  4RUF A;  4X8A A;  1PNL A;  5IDJ A;  2LFR A;  4FIP C;  1ZWI C;  1NR1 A;  1EFR G;  4N21 A;  1RM1 C;  1JCH A;  3E35 A;  2JEX A;  3IFX A;  2EIJ B;  1GO3 F;  2Y48 A;  4UVB A;  5L3G A;  1YTF D;  1NQT A;  4N23 A;  2BOC C;  4PDV A;  4JYB A;  2LFS A;  5EK0 A;  2EIM C;  1THZ A;  2WLL A;  2IJK A;  2FTK A;  1I5Y A;  1DF4 A;  4JTC B;  3ASN B;  1ROP A;  3STZ C;  3TCU A;  1S72 V;  3PJS K;  4F4L A;  1PKX A;  2W0F C;  3ABK C;  3ZMZ A;  1KKD A;  2A79 B;  1F4M A;  3CCE V;  4PEL A;  3F7Y C;  1YHQ V;  3AG2 B;  3AG1 C;  2IJI A;  3K3W A;  2JK5 C;  4E2L A;  3IC7 A;  3LDD A;  4UV9 A;  2HVK C;  3ZN1 A;  5CBF A;  4LCU C;  4UXN A;  3ABL B;  2QEX V;  1OCC B;  1QR9 A;  1V55 C;  1V54 B;  3OR7 C;  2A9H A;  4LC1 A;  1M57 C;  4JTA B;  2HG5 C;  5C93 A;  1B6Q A;  4FK5 C;  1J95 A;  2W6I G;  4KP4 A;  4RQF A;  1VQK V;  2OCC B;  3HB3 B;  4HYO A;  1KP3 A;  1VQ5 V;  3ASO C;  3OR6 C;  4CBC A;  2JDI G;  3T2M A;  4TSF G;  2AHY A;  4PA7 A;  3ZRX A;  4QIW F;  3LNM B;  3RW0 A;  2GHY A;  4FJC C;  5LBQ A;  1AI4 A;  4MVU A;  5CMU A;  1GKF A;  3FKS G;  1Q81 W;  3E8H A;  2DW4 A;  4BIU A;  1NH2 D;  4JAV A;  1R3L C;  3QO7 A;  2ZDI C;  2P6J A;  1SER A;  2PI5 A;  1AI5 A;  1VQL V;  5B1A B;  1FXK C;  4MVQ A;  5KA6 A;  2IU3 A;  4GCZ A;  1GM8 A;  4PDM A;  3T1C A;  3T4D A;  1VQ6 V;  3A0R A;  3K03 A;  2HJF C;  3OE7 G;  1KQS U;  2EIL C;  4G27 B;  4HZ3 A;  2B1I A;  2ZR3 A;  4WFB V;  1VQN V;  4J9Y B;  5B1B C;  3IGA C;  3E83 A;  4X88 A;  3UM7 A;  1VQ7 V;  4WFG A;  4BIZ A;  3ETD A;  1R3J C;  4DO2 A;  3AG4 B;  4JGS A;  4EKW A;  2EIK B;  1NJI W;  4BAY A;  1FFT B;  4QE7 A;  1NVP B;  1GM9 A;  1XL4 A;  2DQ0 A;  2QKS A;  4MW3 A;  4QJF B;  4MVR A;  2DYR B;  1K9M W;  3OFN G;  3W7X A;  3AG2 C;  5LHI A;  1JJ2 U;  3SYQ A;  4JPR A;  5CBH A;  4U7O A;  3ZMU A;  5EBM C;  3JD4 A;  4RUE A;  1YIJ V;  4U7N A;  1F51 A;  3ABL C;  2ITC C;  1OCC C;  4P2Z A;  4PDL A;  1K8A W;  1KEC A;  1YIT V;  1K4D C;  2XAQ A;  1IXM A;  2JIZ G;  3BEH A;  4I5S A;  3I55 V;  2R9R B;  4CZZ A;  2QTO A;  5L3C A;  4G2K A;  1SES A;  1PD3 A;  4I9W A;  4JF3 A;  1E1Q G;  3X2Q B;  3E8F A;  1R73 A;  5L3B A;  3W7T A;  1K4C C;  3FYE B;  4G28 B;  1N8R W;  3MHS C;  1SET A;  1CEZ A;  1VQ4 V;  4P30 A;  1OCZ B;  2ATK C;  3FB5 C;  4WFA V;  2EIN B;  2XAF A;  3ABM B;  2EJR A;  5H6R A;  3E2E A;  3OUF A;  1K5Q A;  1H8E G;  1K3E A;  5B3S B;  3OEH G;  5B1A C;  3UKM A;  3SPH A;  2PI4 A;  4JTD B;  3JD1 A;  3H01 A;  1AJP A;  2IW5 A;  4WF9 V;  4MVO A;  1KD1 W;  4XDJ A;  3OM3 B;  3ZMS A;  1OCO B;  3ZRW B;  1ARO P;  4PA3 A;  1F23 A;  2NNU A;  4MS2 A;  3K04 A;  2D3O W;  3JYC A;  1GTO A;  4P9P A;  1BMF G;  1F4N A;  3AG4 C;  2EIK C;  1P4R A;  5CBG A;  2B5U A;  3OAA G;  3GB7 C;  4PA9 A;  3WG7 B;  1MAB G;  4GT1 A;  2IJH A;  5CN0 A;  2HFE C;  2GSM B;  2OTL V;  4RO2 A;  2DYR C;  4WFF A;  2CK3 G;  2WAM A;  1PL0 A;  2WLJ A;  5KUM A;  3F5W C;  5EBW C;  3OW2 U;  2WPD G;  1S0V A;  5LHH A;  3D36 A;  4GX1 A;  2WLN A;  4KUM A;  1CPY A;  2JEU A;  2W6J G;  4Z1M G;  3ZJZ A;  4HAM A;  3OEE G;  2HR3 A;  4R8C A;  3CP1 A;  5EC1 C;  1VQ9 V;  2X7R B;  2UXX A;  2HLD G;  4MW8 A;  1DTO A;  3CME V;  4UVA A;  4XDK A;  2AHZ A;  3LSQ A;  5IYD O;  2Q6A A;  3FYI B;  3K0D A;  1QVG U;  2QA4 V;  3MHH C;  4MTG A;  3K0G A;  5KUK A;  1YJN V;  5DM6 V;  4UV8 A;  1COW G;  1R3I C;  2QM8 A;  3SJQ C;  3JD3 A;  1OCZ C;  4PDR A;  1AJQ A;  2C2A A;  4MTF A;  3QO5 A;  1HWY A;  3BY6 A;  5HFL A;  3B77 A;  2HKO A;  3CCS V;  1JPX A;  3CD6 V;  3ABM C;  3VOU A;  1ENV A;  1WPX A;  3JD0 A;  3JCZ A;  2ITD C;  4Q20 A;  2IH3 C;  1K34 A;  4QPK A;  1OHH G;  2EIJ C;  1RPO A;  4QE9 A;  1R6K A;  2X6A A;  4H37 A;  1QVF U;  1FXH A;  2Y69 B;  2H94 A;  1RM1 B;  3AEI A;  3ZRS A;  1G8M A;  1S3J A;  2DWE C;  3EFF K;  3CCR V;  5B1N A;  3F7V C;  1RPR A;  3CMA V;  3LUT B;  1XL6 A;  3ASN C;  3ZIA G;  3W7U A;  2EIM B;  3ZMT A;  2ZR2 A;  3OMN B;  4MSW C;  5HFM A;  2XND G;  4OXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...