4JI0O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji0O00
2E5LO 5LMNO 3J81N 4DR6O 4JI0O 1J5EO 1N34O 4DUYO 4LF6O 4JI8O 4JYAO 2Z0AA 4OPHA 5FLXN 4B3RO 4LFCO 3F5TA 1XNRO 4LF8O 5BXZA 2N74A 4JI7O 1HNZO 4LFBO 1FYJA 1FKAO 2FKXA 4AQYO 5A2QN 2UUAO 2VQEO 5IT9N 4X65O 4DV2O 1DK1A 4JV5O 1HR0O 1D2DA 1R1BA 4B3MO 1N33O 4LF9O 4K0KO 4OPAA 1XMOO 4NXNO 2UUCO 4JI6O 4X64O 2LW7A 1IBLO 2AGAA 4LF4O 2UUBO 1KUQA 4DR2O 1XEQA 4KHPO 4YY3O 3OTOO 2UU9O 1IBMO 3JAMN 4GKKO 4X66O 4DR1O 4JI3O 4DR7O 4DV5O 1I94O 3T1HO 4X62O 3O65A 1NS1A 2JRIA 5BY1A 1HNWO 1FJGO 1IBKO 5LMUO 1A32A 2DOSA 3SDLA 1AILA 4B3SO 3J7AU 4DR3O 4DV0O 1AB3A 4B3TO 4LF7O 4DV1O 2DJVA 2UXBO 4JI5O 5BR8O 3R66A 4DUZO 4OX9O 1YZBA 5H5NA 3T1YO 1HNXO 4GKJO 4JI2O 4DV7O 2F4VO 3RT3C 2ZM6O 2UXDO 3M8AA 3J80N 2HHHO 1X59A 2UXCO 4YHHO 1R6TA 4LFAO 4JI1O 4DR5O 4DV6O 4DR4O 2VQFO 1F7YA 1N36O 4LF5O 1N32O 4NXMO 5IWAO 2ZKOA 4DV3O 4JI4O 1G1XB 5LL6Y 4A5UB 4DV4O 1XNQO 1XMQO
chains in the Genus database with same CATH superfamily
1OCCB 5KAFZ 4LR3A 5B1AB 4DR6O 3CC7V 2IU0A 1OCRB 4RUEA 4QE7A 1XL4A 1Q90D 1BQ0A 3C3TA 1VQKV 3SJCC 3UO3A 4UB8Z 3TETA 1AP5A 1MZEA 5GONB 4KXRA 1AJNA 3W7WA 1NVPD 3DTUB 4UCTA 3JASB 4Z1MG 3W7XA 2UXDB 3RYIB 2FKXA 4XDLA 3AG3B 1LR1A 2QKCA 5EBWC 3TCUA 2JVDA 1Z5VA 3K58A 1H2LA 1DGSA 1GK9A 4LCUC 4X1KB 2LW1A 3K5NA 1KP2A 1DK1A 4PELA 1D2DA 1EZVH 4ZIBA 4FFBB 3THOA 2EILB 3U11A 3NXSA 2CGOA 5K1XA 2EIKB 4LF6B 3K79A 1KUQA 3JCZA 4FMTA 2Y4UA 3R65A 4JI8B 1SETA 1K4CC 2RNBA 2VWJA 5GTHZ 2DYRB 1EM1A 4PD4F 3DGEA 2VRZA 1I94O 4X62O 1AI6A 2JGUA 4B3RB 2JRIA 1JQ0A 5LOVA 1PL4A 3BA8A 3CXCU 2XHBA 2KG7A 1AILA 1NJIW 3OMNB 1MG1A 3N2GA 4FLWA 3JALA 1YZBA 1R3LC 1KB9F 1URFA 1GM7A 4TUYA 1S5HC 4G27B 3I56V 1O9HA 4FZ1A 1AJPA 4PDRA 3LDEA 4DRXB 3SPJA 2PYLA 2A0LA 4B3MB 4X20B 2QJ1A 1V54C 3ABMB 5JJJB 2F43G 1G4YB 5CA0B 2EINC 5LL6Y 5EK0A 1P7BA 2Q4PA 1M90W 3A8TA 2K9PA 3OGCC 2P4KA 1ZAUA 4JI0O 2B9ZA 1L1FA 2DQ3A 3ABLB 1R73A 2QTOA 1VEWA 3UO2A 1GAXA 2NNUA 4OPHA 3MHSC 4IHJA 5GTIZ 2IJHA 3JD1A 2OCHA 3C3SA 4XDJA 3U10A 3QVNA 4Q6GA 5KX5A 2DE0X 4TWKA 1XILA 1Y76A 5KA5A 1N32B 3RYHA 1P4RA 1JPXA 2P6JA 4GX1A 1AJQA 1N8RW 4FVMA 1JR9A 1OHHG 1FFTB 1H8HG 2GDSA 4JGSA 3CMAV 1VF6A 4DUYB 4G2KA 1KQSU 1QLEB 2XTAA 2BTQA 2DWEC 3N2GB 4P9PA 3JALB 1GMGA 5JJNB 5KHKA 4U3FH 5EYPA 1VQ8V 2OTLV 1WPBA 3O65A 1NS1A 5E1AC 2QKAA 3J7AU 2GUZB 1SKVA 1AI7A 5JCOC 5JVDA 2CDYA 5L3DA 2PI4A 1HNXO 2Q0OC 1K5SA 3ZHTA 4RUFA 5KHIA 2UXDO 2A7WA 5LP6A 1I0HA 4JV5B 1SQQH 3DSQA 4HNAA 2AZ2A 4R50A 4I9QA 4R7CA 4NXNB 4JASA 3FB5C 1XL6A 2N04A 1W2BU 1KKCA 2UUBB 1J95A 3DC5A 1IURA 3SYCA 3GVMA 5KX5B 5IJ9A 3H9VA 3TJTA 4FZ0A 4LF6O 1KD1W 1HP8A 1FXKA 4JI8O 4J10A 1UFIA 4WFFA 1HDJA 4CBCA 3ASOB 4B3RO 3OM3B 4LC1A 4J7ZA 4LWSB 2DMXA 1ZX3A 5H6RA 3SPCA 1DLBA 2WSSG 1W0KG 2DYSC 2IJIA 3SJAC 3HPLC 4I55A 2YEVB 3U0ZA 2JK5C 3CCJV 2BTQB 4YJ3A 1NQTA 4JTDB 4LF5B 1R3IC 2EZPA 5EYPB 2ADQB 2KQXA 3LNNA 1XNQB 3E89A 1FD9A 4B3MO 1M9NA 2YIDA 3HKCA 2EIMC 4DW0A 1Z5WA 3CE2A 3SJQC 1E1QG 1OCOB 1OV9A 3JAMN 1N0JA 3OR7C 4PA9A 4UCOA 4FLXA 3K9SA 5JH7A 3B2EE 3D3QA 4JAAA 1A32A 2N05A 1EN5A 4HNAB 1M4UA 3HR0A 3TXQA 4LF7O 1JJOA 3K0GA 4R6ZA 4RAIA 5JWPA 4EB6A 4RQFA 1H2GA 3ICXA 4J9ZB 1Q6UA 3JD4A 3WG7C 2EZOA 3B4SA 3C90A 1M57C 4IGGA 4BAYA 3CRCA 4W4LA 4YHHO 4UVAA 2LGWA 2Q8VA 2EJ7A 4Q20A 1OCZC 1FXKB 1NR1A 2XAFA 1VQMV 1F7YA 3E35A 4WCEV 1MZFA 1N32O 1WP7A 2ZKOA 1SF9A 4GLXA 3K59A 2KB1A 5H9CA 4DUYO 2YIBD 1HWYA 1GN6A 2QEXV 4MTFA 1OCCC 3FAVA 3EHBB 2QWQB 4DW1A 4DV2B 4O4JA 5CB4B 2W0XA 2UXBB 4FM1A 1NKDA 3F5TA 3T1YB 2N74A 4QE9A 1V55B 1H2SB 3E22B 4JYCA 2F95B 2EX3A 3EVKA 3ETEA 3QF7A 4JI1B 1TUBA 1KKDA 4DR5B 2DWDC 3L75H 3WB2A 1KYOF 5FL7G 5LHHA 3VOUA 3ZMSA 2P90A 1XMQB 1RFYA 5JH7B 1BS3A 4JV5O 2AZ0A 5LMNB 3K04A 2L6LA 4NXNO 1J5EB 4EFBA 3W7TA 4TV8B 4GKJB 5BZBA 2UUBO 3E86A 4PV1B 1GTOA 4EB6B 2Q0AA 2XASA 1GRJA 4TQFA 2WLMA 1EZJA 1SZTA 3HKDB 4HZ3A 2GHYA 3AG1B 2DYRC 3ZMUA 1K5QA 3G6EV 2Y48A 1BHAA 4LFBB 5KLVH 4WFBV 3B40A 1PPJH 4BR6A 5C8YA 1GN3A 3EXAA 1RPOA 2ZT9B 3K57A 1R3KC 4O2AB 4RO2A 3FAVB 3TXSA 4DXWA 1KBHA 4LF5O 1LUWA 2KSDA 3FX7A 2PF4E 1I5YA 2JS5A 1XNQO 1BZKA 3OUFA 4DR1B 2P67A 5EZYA 4ABMA 1KU9A 1VF7A 2HG5C 5LMUB 3WB1A 4B3TB 3CXHF 1BSMA 4U3JA 4BW9A 3H1HH 2Q69A 5IYZB 4MSWC 1YJ9V 2CTWA 4BW5A 5IYDO 3ZN0A 4UCRA 3B77A 1YCIA 5A2QN 3OFNG 2VQFB 2RMKB 2ZNIA 3KZIZ 3MHHC 1RPRA 1U96A 2M6YA 3QO8A 4JTAB 4FLTA 2WLLB 3H1JH 2JIZG 5B5EZ 2F23A 2FMLA 4GKKO 1TGOA 1AP6A 2BOCC 5IY5B 4K8XA 4CC5A 3OD4A 1QLEC 3OUSA 1VMGA 4MW3A 1BL8A 3JD2A 2ZINA 3KCYA 5C93A 2ZR3A 4B3SO 3VQYA 3BY6A 2UXBO 3R66A 3RYIA 1NU1H 1O9GA 4JI0B 3JCUZ 1MNGA 1G6UA 1FS0G 3T1YO 3X2QC 4ZOLA 2X6CA 3RYCA 3ETGA 4X1KA 2Y0PA 4JI1O 4DR5O 2OT5A 4IYIA 3ZN1A 4FFBA 1L8DA 2PUSA 5KUKA 2JDIG 2H8PC 2UXXA 3LUTB 4FLYA 4U3JB 1R3JC 4KHPB 1RM1B 4MVRA 3CS5A 3LSUA 1XMQO 5LMNO 2ZE8A 1D5NA 4UVBA 1NH2B 1J5EO 4UCVA 2BTOA 2CTQA 2R72A 3RYFA 1VQNV 2W0FC 3T1CA 2YC0A 3RBZA 2Z0AA 4DV0B 4DR3B 1NTZH 1Q8IA 1F23A 2QKSA 1H2KA 4JI2B 5GW7A 3LSSA 4DV7B 1M5IA 4LFBO 4F6RA 1FKAO 1VP7A 4UVCA 2EIJC 3DC6A 1BCCH 5IJ0B 2GTAA 4DRXA 4DR4B 5IT9N 4X20A 4QNHB 3RVYA 3ZRSA 1YF2A 5CA0A 3VQXA 5CBHA 1IX9A 3CC2V 3FKSG 1FPOA 1YDXA 1H8EG 1HNXB 1QQCA 1QU7A 4PA6A 2JGDA 4JAVA 4DR1O 3JARA 2WA3A 2FYUH 3STLC 3CWBH 2DN9A 2AHZA 4ZOLB 2FTKA 2Y69B 4PI2A 3BCCH 4QPJA 3RYCB 1OCOC 4YIPA 1NI8A 5LA6A 1XNRB 2YIBA 5LMUO 1EN4A 1Z2GA 2HR3A 1QBZA 3CD6V 3WU2Z 4FFKA 1AB3A 4B3TO 5LP6C 2A06H 4AQYB 2UUAB 4O4HA 5CA1A 1QVFU 3E8GA 3SPIA 1IZ3A 3UM7A 2WAMA 4ASUG 3CCRV 1EN6A 2DQ0A 4MS2A 4X1IA 3RYFB 2UUCB 2VQFO 1Q5OA 3KG2A 4X1YB 3D3IA 1TAEA 3P3NA 4AHCA 5L3CA 5J2UB 4DV5B 3AG4C 5H6QA 1SQGA 4H13B 1SQFA 4PA4A 4F6RB 1L0LH 3SGIA 1L0NH 1P7GA 2Q68A 2GUZA 5KAIZ 2GSMB 4UV8A 1K33A 2ZM6B 1P49A 2ATKC 2HVKC 2LGQA 3ETQA 2IW5A 3AK1A 4GUNA 4JYBA 4UCSA 3AG7A 1Y66A 2JGDB 4D7SA 3JARB 2WLIA 4JI4B 2Q67A 4LF7B 3E2EA 1R1BA 5LA6B 3P32A 1DF4A 1YITV 1EFRG 4FLZA 2F93B 2QWNB 1MA1A 4U7OA 4KHPO 3STZC 1PP9H 4YHHB 2WLHA 1EBOA 4DR7O 4O4HB 4W4KA 3K03A 4DYLA 5CA1B 2L35A 3OEEG 3CJHA 2QDOA 4NR1A 4XDKA 5JQGB 3L9DA 1KP3A 3ABKB 4LWSA 2V4DA 2WLJA 3E83A 2E76B 1AR1B 4X1IB 3OAAG 2VS0A 4DR3O 4DV0O 2Z3YA 3SYPA 1SA0A 2X7RB 5L3FA 2G38A 2HKOA 4HYOA 2YEVA 1BE3H 3ZHVA 4I0XA 2HFEC 3BFRA 4H0LB 4JI2O 3PJSK 3DXRA 4DV7O 3CX5F 2LJ2A 4MT8A 1P84F 4HAMA 4DR4O 1NH2D 4LF4B 1AROP 2ZCEA 4UV9A 3ZMVA 2ZXWB 2H3OA 1K3EA 3CSXA 1PNLA 1BT8A 3CHXA 4J7KA 1VQ5V 4MVZA 3NR7A 1XHXA 3AG2C 5B3SC 3GWOA 1THZA 1E79G 1CPYA 2WLIB 3ASNB 4WFHA 4DUZB 1W0JG 1XNRO 2P4VA 4GX5A 4QGPA 1I7FA 2F4VB 4K8ZA 2A9HA 4LBEC 4GYCB 5BMVB 4AQYO 1COWG 4O4LB 3T4DA 2UUAO 2LFRA 2E75B 1RP3B 2X0LA 3JSLA 2X6BA 4WBNA 4DV3B 5B66Z 2KKWA 3RN4A 3CJHB 5CMUA 3FD9A 4OPAA 1QVGU 2R70A 2UUCO 4C7UA 2Q7GA 1SA0B 4DK0A 1SQPH 1XUQA 4I0XB 4MVSA 4DV5O 5CB4A 3DXRB 2Z5UA 1SRYA 1Q6HA 3CMEV 2IBZH 4D7TA 1VQPV 2XNDG 2QSAA 1K73W 4E2LA 1BHBA 3E22A 1JFFA 2ETNA 3M99B 1B6QA 3H1KH 3L71H 2ZM6O 1DF5A 1VARA 1NT2B 2BE3A 5EBLC 4PI0A 4I9WA 5B1BC 4TV8A 4JI4O 3TGUH 5IYBO 3JAWA 3CCLV 3G67A 4X66B 1ZL8A 3J81N 3T1HB 2B5UA 2CH7A 3H1LH 3K06A 2ZR2A 1FJGB 1KC8W 1IBKB 3HKDA 1YEWA 1KMIZ 4BIOA 4JI5B 4WBNB 1YHQV 5KUMA 2Q5ZA 3OMIB 1Y4MA 5JJEB 4EFEA 2A79B 2QR4A 3FB8C 4FJCC 4GKKB 2AW9A 3K08A 4IYHA 3RGBA 4O2AA 2OCCB 4TQDA 3CRAA 3VQWA 1OZ0A 4KUMA 1PNKA 4LP8A 3QO7A 5B1AC 4DO2A 2HP8A 4B3SB 2RQ6A 1OCRC 4D6TH 1S0VA 4NKGB 1CXZB 3GB7C 3F7VC 4F6EA 5KMGB 1Y74A 4MW8A 1XHZA 4LF4O 1IVSA 1V9PA 5EIBD 1JFFB 3MAQA 3CRMA 2V7QG 4JYAB 1M56B 1V54B 5JCOA 3ZMZA 3CEIA 3K5LA 4TSFG 2EINB 1Q82W 5CN0A 1WB8A 1NTKH 3ZS8C 1B04A 1R6NA 1SQBH 1FXHA 3AG3C 5IYZA 3HKEA 1QR9A 1GN2A 1RSOB 3OR6C 3IC7A 3KKYA 5FPRA 1GO3F 5KHGA 2HLDG 2IM9A 4DUZO 3ZRXA 3JAWB 3CP1A 4IIJA 5KA6A 3RWRD 2F4VO 1N0NA 1ZL8B 2EILC 2MW2B 3VQVA 1E1RG 2EBOA 2EIKC 1R6TA 2CH7B 1N33B 2VWKA 4I50A 5ITZA 2QM7A 4FLUA 4FK5C 2ZIMA 2WLLA 3ZRWA 2XAHA 1IXBA 1IBLB 1IDSA 4DV3O 4YY3B 4MTGA 1QCEA 3A2FA 1ORQC 4IL6Z 4ZI7B 1HNWB 3AK2A 4B7KA 1S3JA 2EULA 3D36A 3WFVA 3LNMB 3ABUA 5BXZA 2HEPA 2IU3A 1H2NA 3ABMC 1AVMA 2HHHB 1Y74B 2RN9A 5EC2C 1YIJV 3SYQA 4DV6B 5IDJA 5A9GA 2VQEO 2CE4A 1SZXA 5LYJA 1YJWV 1MSWD 5EBMC 4FIPC 2XAJA 2RCVA 1NBMG 1X4TA 5HFLA 4FM0A 4CS3A 3OT7A 3ABLC 2R9RB 4PHZA 2D2CB 3HKEB 1F4MA 3HKBA 3ZBHA 2AGAA 2P5OA 3G4SV 1QLNA 4CH4A 1ROPA 2XAGA 4NYKA 2Q73A 4X66O 1YVWA 5TISZ 1UJWB 3L70H 4O2BB 4IIJB 3T1HO 5D5QA 4X88A 1YJNV 1FJGO 4GX0A 4LF8B 1IBKO 4YXWG 2OWOA 4I50B 5ITZB 2AXTZ 3SYAA 3ZRWB 2Y0IA 1NR7A 4JI5O 3OE7G 1AR4A 3BPZA 1QHTA 5IJ0A 1Q86W 2F66C 3J80N 2B1IA 1JX9A 2QWOB 4UXNA 1FAFA 3CCEV 1CEZA 2OIEA 3ZJZA 2F1MA 2DW4A 4A5UB 4AI8A 4FM2A 1DTOA 2YSUB 1GKFA 2XAQA 4E4EA 2PGGA 2ZXWC 3SJBC 1T5EA 1TUEB 4JYAO 4CS4A 2R9AA 2EIMB 5LYJB 1B06A 1B3QA 3B09A 3IC9A 2JS3A 3QO5A 3FYIB 4OX9B 2CUGA 2JEXA 3IFXA 5LGTA 5IYCO 4JYYA 1VQ9V 2P7TC 3ASNC 4DR7B 3FYEB 3HKBB 4N23A 3BEHA 2UXCB 5AG2A 2LFSA 1Q3EA 1VIBA 2Q7HA 4P9OA 4RWUA 5LGUA 4X1YA 2QWPB 4DV4B 1JVMA 1N33O 4NTXA 4B08A 5HFMA 5J2UA 5LGNA 1M57B 3LSQA 1IBLO 4BIUA 1W59A 3WB0A 1XEQA 2YXLA 2GV9A 3ASOC 4YY3O 3CCVV 2RDCA 5H2FZ 1OCZB 1PKXA 2CK3G 3CCSV 3JAKA 4PDVA 2OTJV 2CGNA 1VF6C 1HNWO 4LH7A 1HNZB 3QG5A 1YXBA 1K8AW 1I08A 2YS8A 5L3BA 1NTMH 2YXHA 4X65B 1LNQA 2H94A 3RW0A 2HHHO 3APQA 1HR0B 3UKMA 2PI5A 1TVKA 2GBOA 2QM8A 2P22C 4DV6O 1YI2V 1S5LZ 2FB5A 4NVPA 1OJHA 3ZIAG 1ZSPA 3S3WA 1WJZA 4J7JA 4UFZA 2X6AA 1MOFA 1WP8A 2C2AA 2ADPA 4WFAV 5CBFA 3OW2U 5F2VO 4QJFB 5JQGA 3I55V 4MVQA 4WFEA 3BVOA 5LXTA 3SPGA 3BAAA 5FPOA 3N27A 4J80A 4ZHQB 2LP7A 2BCCH 4X89A 2QE7G 4LF8O 2WPDG 1ZTEA 2IJKA 1FXKC 1VQLV 1GN4A 4H37A 3CRRA 5FNVA 4UB6Z 1N36B 4KFMA 4NXMB 3I5DA 1SQVH 3JAKB 2OCCC 3CCUV 1GM8A 2E5LB 2GTSA 3IAYA 2ZQMA 2ZDIA 3S3XA 4OGQB 2PTMA 3UCSC 4MVMA 3SYOA 2YDEA 1CP9A 3IGAC 4P2ZA 3IJ4A 4U7NA 2QGNA 1H2MA 1JJ2U 1V55C 3OGIB 3F7YC 3ZMTA 1XQ8A 1M56C 4PDLA 1WN7A 2IJJA 1TVKB 3A0HZ 4JI7B 1BQZA 4BIZA 2ZE6A 3B8MA 3G80A 5BMVA 4OX9O 2ARHA 1VQ7V 4O4LA 1GH6A 4I4TA 3W7SA 1S5JA 4WFGA 4FPPA 2UXCO 4Z1VA 3CRQA 3AEIA 4JI6B 2XOKG 3H1IH 2QWRB 4UUJC 5LXTB 4CS2A 5KHJA 1G1XB 4YJ2A 4JTCB 4DV4O 3AG1C 1VQ4V 4HBNA 2YXYA 4RQEA 2YIAA 2OIGA 1AR5A 2WWWA 3ZHSA 5FNVB 2LQTA 3JSNA 1N4CA 1NZ6A 2QTSA 3K3WA 4DV1B 2ZIOA 1K34A 5BR8B 5LOVB 4L87A 4CZZA 1LUVA 2Q6AA 3L74H 1HW7A 2KG7B 3CPWU 2BSKA 5L3GA 1WA8A 1HNZO 2Q9LA 1FYJA 1SERA 1SC5B 4LFAB 2E74B 3F5WC 3CCQV 4QIWF 2HJFC 3L72H 1VQ6V 3A0BZ 4TUYB 4X65O 2WLKA 5IWAB 4N21A 1HR0O 2ITCC 5B1NA 3X2QB 1ZLZA 3OEHG 1N34B 2NN4A 5EC1C 4AILC 1TA8A 5LHIA 3VBBA 2NR5A 1K4DC 4I4TB 4JPRA 5DN6G 3LDCA 3OTFA 4WF9V 1Q6IA 1XOUA 2JEUA 4MVOA 4OXSA 4TV9A 4IHJB 2PZSA 4YJ2B 5DECA 3JATA 3N2KA 2D3OW 1XBLA 2ZNJA 1Y76B 1BMFG 5B1OA 4LF9B 4K0KB 3RYHB 5KHHA 1XMOB 4JZ2A 1N36O 3EFFK 1M1KW 4X64B 2ZD9A 4NXMO 5KMGA 1Y6XA 2EIJB 5IY5C 1I5XA 4CH6A 2W6JG 2CAZC 2UU9B 3QTCA 3ZHQA 1IBMB 2E5LO 3JYCA 4MTXA 1Q81W 2CTRA 3BRCA 3D36C 2YI9A 2BSKB 2VQEB 3ZEDA 1WA8B 3ZCCA 1PM9A 3E8FA 3Q4HA 1YTFB 3K9AA 4CH5A 1K9MW 1RSOA 5FLXN 4CH3A 2QM4A 1S72V 1XDCA 3ETDA 1IXMA 5JVDB 4JI7O 2PY5A 4JZGA 2ZE5A 1JA8A 2HJDA 2OYQA 3KCXA 1WLEA 2FL4A 4KP4A 1RM1C 1ENVA 1FXVA 3MDSA 3JD0A 5LP6B 4X9QA 1XREA 5DEDA 3BA9A 4UCUA 4JI6O 4O4IA 2LW7A 4TV9B 4TOIA 1R6KA 1BGYH 1Y67A 1G8MA 3BHPA 4I5SA 4PA7A 4ZI7A 2P06A 4F4LA 2QA4V 1AI4A 2R9IA 5IJ9B 1U97A 2M7WA 3JATB 3N2KB 3SPHA 4B7EA 4LFCB 4J42A 2B1GA 3FB6C 3A0RA 3AG4B 2ITDC 2DOSA 4JAUA 4GCZA 2ILMA 4DV1O 2DJVA 2JJ1G 5BR8O 4EKWA 3RFRA 4CC6A 2IH1C 2W6IG 3G71V 3AK3A 2CTPA 4PA3A 4NTWA 5H5NA 4I55B 3LDDA 1WB7A 4BWAA 1QR8A 3O9OA 4G28B 4YJ3B 4LFAO 4R8CA 5LHGA 5L3EA 1PL0A 3Q4HB 5IWAO 4DR2B 3OTOB 2Y69C 4K35A 3ABTA 3HKCB 4GZRB 5IE9A 4JI3B 4H33A 3CC4V 3T4ZA 1D5AA 1N34O 4O2BA 5DM6V 3QNEA 1VQOV 3D8CA 1UPGA 2YI8A 2ODMA 3UQ8A 3CCMV 2NLJC 2YUAA 2WA4A 4MVUA 1Q7YW 3MD0A 4ZKIA 2Y4TA 1JMKC 4O4IB 4TT3G 3T2MA 1WNSA 4KL1A 5K1PA 2V1DA 1NVPB 1MMMA 3SR2C 2Q7EA 4LNUA 1M93A 5J2TA 3E8HA 3W7UA 1S77D 1SS3A 3TK1A 4LF9O 4K0KO 1XMOO 3L73H 4DR6B 4X64O 3BABA 1AI5A 4ICGA 2YICA 4Z2WA 2UU9O 3JD3A 2WLNA 3ML0A 1IBMO 3FFQA 1MABG 1ZWIC 3K5OA 4JF3A 4X8AA 1WPXA 3H01A 2O57A 3ZHUA 4DK1A 1YSCA 4O4JB 2AHYA 1F4NA 2HVJC 1K92A 3UT5A 1KECA 1VF5B 1SQXH 3AG2B 5B3SB 3RT3C 3P30A 3CB2A 3ZX6A 1K97A 4NB5A 4I7ZB 1TUBB 1MSDA 4NTYA 3ZHRA 4H44B 5CA3A 1FFXA 1YTFD 4QPKA 5EIBC 2K1EA 5E79Z 3K0DA 3ABKC 1I94B 4X62B 3GWKC 4PJ0Z 1WAZA 5J9PC 1ZUQA 4ZBMA 2MK3A 3HB3B 2DYSB 1K7DA 2IH3C 4LFCO 4J41A 4LNUB 4IT5A 5J2TB 4LH6A 1H38A 2LO1A 4MTOA 1Q43A 1PD3A 2PYJA 1S76D 2EJRA 5D5PA 1PV0A 1F51A 3PN1A 3K5MA 5C8YB 4P30A 2A3QA 2ZDIC 4PDMA 5GONA 4EEQA 3ZRVA 4L8JA 4DV2O 3RVZA 3JASA 4J11A 2JJ2G 2XT9A 3UT5B 3P3PA 3E8BA 4DR2O 1JCHA 5LBQA 2UXNA 3OTOO 1PNMA 4JI3O 5EZYB 1JOYA 5B1BB 4GT1A 1XI1A 1GM9A 5BY1A 3OMAB 3G6BA 5CBGA 4ZHQA 2RJZA 3SDLA 3WG7B 2E3CA 1FFXB 4YIOA 3CYOA 2BOBC 4GKJO 4K3AA 1SESA 3FB7C 4FLVA 4J9YB 4GX2A 3M8AA 1X59A 3B8NA 3M7MX 1US6A 2XUMA 4XBFA 2ZE7A 3APOA 1QNMA
chains in the Genus database with same CATH topology
2E5LO 5LMNO 3J81N 4DR6O 4JI0O 1J5EO 1N34O 4DUYO 4LF6O 4JI8O 4JYAO 2Z0AA 4OPHA 5FLXN 4B3RO 4LFCO 3F5TA 1XNRO 4LF8O 5BXZA 2N74A 4JI7O 1HNZO 4LFBO 1FYJA 1FKAO 2FKXA 4AQYO 5A2QN 2UUAO 2VQEO 5IT9N 4X65O 4DV2O 1DK1A 4JV5O 1HR0O 1D2DA 1R1BA 4B3MO 1N33O 4LF9O 4K0KO 4OPAA 1XMOO 4NXNO 2UUCO 4JI6O 4X64O 2LW7A 1IBLO 2AGAA 4LF4O 2UUBO 1KUQA 4DR2O 1XEQA 4KHPO 4YY3O 3OTOO 2UU9O 1IBMO 3JAMN 4GKKO 4X66O 4DR1O 4JI3O 4DR7O 4DV5O 1I94O 3T1HO 4X62O 3O65A 1NS1A 2JRIA 5BY1A 1HNWO 1FJGO 1IBKO 5LMUO 1A32A 2DOSA 3SDLA 1AILA 4B3SO 3J7AU 4DR3O 4DV0O 1AB3A 4B3TO 4LF7O 4DV1O 2DJVA 2UXBO 4JI5O 5BR8O 3R66A 4DUZO 4OX9O 1YZBA 5H5NA 3T1YO 1HNXO 4GKJO 4JI2O 4DV7O 2F4VO 3RT3C 2ZM6O 2UXDO 3M8AA 3J80N 2HHHO 1X59A 2UXCO 4YHHO 1R6TA 4LFAO 4JI1O 4DR5O 4DV6O 4DR4O 2VQFO 1F7YA 1N36O 4LF5O 1N32O 4NXMO 5IWAO 2ZKOA 4DV3O 4JI4O 1G1XB 5LL6Y 4A5UB 4DV4O 1XNQO 1XMQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L O;  5LMN O;  3J81 N;  4DR6 O;  4JI0 O;  1J5E O;  1N34 O;  4DUY O;  4LF6 O;  4JI8 O;  4JYA O;  2Z0A A;  4OPH A;  5FLX N;  4B3R O;  4LFC O;  3F5T A;  1XNR O;  4LF8 O;  5BXZ A;  2N74 A;  4JI7 O;  1HNZ O;  4LFB O;  1FYJ A;  1FKA O;  2FKX A;  4AQY O;  5A2Q N;  2UUA O;  2VQE O;  5IT9 N;  4X65 O;  4DV2 O;  1DK1 A;  4JV5 O;  1HR0 O;  1D2D A;  1R1B A;  4B3M O;  1N33 O;  4LF9 O;  4K0K O;  4OPA A;  1XMO O;  4NXN O;  2UUC O;  4JI6 O;  4X64 O;  2LW7 A;  1IBL O;  2AGA A;  4LF4 O;  2UUB O;  1KUQ A;  4DR2 O;  1XEQ A;  4KHP O;  4YY3 O;  3OTO O;  2UU9 O;  1IBM O;  3JAM N;  4GKK O;  4X66 O;  4DR1 O;  4JI3 O;  4DR7 O;  4DV5 O;  1I94 O;  3T1H O;  4X62 O;  3O65 A;  1NS1 A;  2JRI A;  5BY1 A;  1HNW O;  1FJG O;  1IBK O;  5LMU O;  1A32 A;  2DOS A;  3SDL A;  1AIL A;  4B3S O;  3J7A U;  4DR3 O;  4DV0 O;  1AB3 A;  4B3T O;  4LF7 O;  4DV1 O;  2DJV A;  2UXB O;  4JI5 O;  5BR8 O;  3R66 A;  4DUZ O;  4OX9 O;  1YZB A;  5H5N A;  3T1Y O;  1HNX O;  4GKJ O;  4JI2 O;  4DV7 O;  2F4V O;  3RT3 C;  2ZM6 O;  2UXD O;  3M8A A;  3J80 N;  2HHH O;  1X59 A;  2UXC O;  4YHH O;  1R6T A;  4LFA O;  4JI1 O;  4DR5 O;  4DV6 O;  4DR4 O;  2VQF O;  1F7Y A;  1N36 O;  4LF5 O;  1N32 O;  4NXM O;  5IWA O;  2ZKO A;  4DV3 O;  4JI4 O;  1G1X B;  5LL6 Y;  4A5U B;  4DV4 O;  1XNQ O;  1XMQ O; 
#chains in the Genus database with same CATH topology
 1OCC B;  5KAF Z;  4LR3 A;  5B1A B;  4DR6 O;  3CC7 V;  2IU0 A;  1OCR B;  4RUE A;  4QE7 A;  1XL4 A;  1Q90 D;  1BQ0 A;  3C3T A;  1VQK V;  3SJC C;  3UO3 A;  4UB8 Z;  3TET A;  1AP5 A;  1MZE A;  5GON B;  4KXR A;  1AJN A;  3W7W A;  1NVP D;  3DTU B;  4UCT A;  3JAS B;  4Z1M G;  3W7X A;  2UXD B;  3RYI B;  2FKX A;  4XDL A;  3AG3 B;  1LR1 A;  2QKC A;  5EBW C;  3TCU A;  2JVD A;  1Z5V A;  3K58 A;  1H2L A;  1DGS A;  1GK9 A;  4LCU C;  4X1K B;  2LW1 A;  3K5N A;  1KP2 A;  1DK1 A;  4PEL A;  1D2D A;  1EZV H;  4ZIB A;  4FFB B;  3THO A;  2EIL B;  3U11 A;  3NXS A;  2CGO A;  5K1X A;  2EIK B;  4LF6 B;  3K79 A;  1KUQ A;  3JCZ A;  4FMT A;  2Y4U A;  3R65 A;  4JI8 B;  1SET A;  1K4C C;  2RNB A;  2VWJ A;  5GTH Z;  2DYR B;  1EM1 A;  4PD4 F;  3DGE A;  2VRZ A;  1I94 O;  4X62 O;  1AI6 A;  2JGU A;  4B3R B;  2JRI A;  1JQ0 A;  5LOV A;  1PL4 A;  3BA8 A;  3CXC U;  2XHB A;  2KG7 A;  1AIL A;  1NJI W;  3OMN B;  1MG1 A;  3N2G A;  4FLW A;  3JAL A;  1YZB A;  1R3L C;  1KB9 F;  1URF A;  1GM7 A;  4TUY A;  1S5H C;  4G27 B;  3I56 V;  1O9H A;  4FZ1 A;  1AJP A;  4PDR A;  3LDE A;  4DRX B;  3SPJ A;  2PYL A;  2A0L A;  4B3M B;  4X20 B;  2QJ1 A;  1V54 C;  3ABM B;  5JJJ B;  2F43 G;  1G4Y B;  5CA0 B;  2EIN C;  5LL6 Y;  5EK0 A;  1P7B A;  2Q4P A;  1M90 W;  3A8T A;  2K9P A;  3OGC C;  2P4K A;  1ZAU A;  4JI0 O;  2B9Z A;  1L1F A;  2DQ3 A;  3ABL B;  1R73 A;  2QTO A;  1VEW A;  3UO2 A;  1GAX A;  2NNU A;  4OPH A;  3MHS C;  4IHJ A;  5GTI Z;  2IJH A;  3JD1 A;  2OCH A;  3C3S A;  4XDJ A;  3U10 A;  3QVN A;  4Q6G A;  5KX5 A;  2DE0 X;  4TWK A;  1XIL A;  1Y76 A;  5KA5 A;  1N32 B;  3RYH A;  1P4R A;  1JPX A;  2P6J A;  4GX1 A;  1AJQ A;  1N8R W;  4FVM A;  1JR9 A;  1OHH G;  1FFT B;  1H8H G;  2GDS A;  4JGS A;  3CMA V;  1VF6 A;  4DUY B;  4G2K A;  1KQS U;  1QLE B;  2XTA A;  2BTQ A;  2DWE C;  3N2G B;  4P9P A;  3JAL B;  1GMG A;  5JJN B;  5KHK A;  4U3F H;  5EYP A;  1VQ8 V;  2OTL V;  1WPB A;  3O65 A;  1NS1 A;  5E1A C;  2QKA A;  3J7A U;  2GUZ B;  1SKV A;  1AI7 A;  5JCO C;  5JVD A;  2CDY A;  5L3D A;  2PI4 A;  1HNX O;  2Q0O C;  1K5S A;  3ZHT A;  4RUF A;  5KHI A;  2UXD O;  2A7W A;  5LP6 A;  1I0H A;  4JV5 B;  1SQQ H;  3DSQ A;  4HNA A;  2AZ2 A;  4R50 A;  4I9Q A;  4R7C A;  4NXN B;  4JAS A;  3FB5 C;  1XL6 A;  2N04 A;  1W2B U;  1KKC A;  2UUB B;  1J95 A;  3DC5 A;  1IUR A;  3SYC A;  3GVM A;  5KX5 B;  5IJ9 A;  3H9V A;  3TJT A;  4FZ0 A;  4LF6 O;  1KD1 W;  1HP8 A;  1FXK A;  4JI8 O;  4J10 A;  1UFI A;  4WFF A;  1HDJ A;  4CBC A;  3ASO B;  4B3R O;  3OM3 B;  4LC1 A;  4J7Z A;  4LWS B;  2DMX A;  1ZX3 A;  5H6R A;  3SPC A;  1DLB A;  2WSS G;  1W0K G;  2DYS C;  2IJI A;  3SJA C;  3HPL C;  4I55 A;  2YEV B;  3U0Z A;  2JK5 C;  3CCJ V;  2BTQ B;  4YJ3 A;  1NQT A;  4JTD B;  4LF5 B;  1R3I C;  2EZP A;  5EYP B;  2ADQ B;  2KQX A;  3LNN A;  1XNQ B;  3E89 A;  1FD9 A;  4B3M O;  1M9N A;  2YID A;  3HKC A;  2EIM C;  4DW0 A;  1Z5W A;  3CE2 A;  3SJQ C;  1E1Q G;  1OCO B;  1OV9 A;  3JAM N;  1N0J A;  3OR7 C;  4PA9 A;  4UCO A;  4FLX A;  3K9S A;  5JH7 A;  3B2E E;  3D3Q A;  4JAA A;  1A32 A;  2N05 A;  1EN5 A;  4HNA B;  1M4U A;  3HR0 A;  3TXQ A;  4LF7 O;  1JJO A;  3K0G A;  4R6Z A;  4RAI A;  5JWP A;  4EB6 A;  4RQF A;  1H2G A;  3ICX A;  4J9Z B;  1Q6U A;  3JD4 A;  3WG7 C;  2EZO A;  3B4S A;  3C90 A;  1M57 C;  4IGG A;  4BAY A;  3CRC A;  4W4L A;  4YHH O;  4UVA A;  2LGW A;  2Q8V A;  2EJ7 A;  4Q20 A;  1OCZ C;  1FXK B;  1NR1 A;  2XAF A;  1VQM V;  1F7Y A;  3E35 A;  4WCE V;  1MZF A;  1N32 O;  1WP7 A;  2ZKO A;  1SF9 A;  4GLX A;  3K59 A;  2KB1 A;  5H9C A;  4DUY O;  2YIB D;  1HWY A;  1GN6 A;  2QEX V;  4MTF A;  1OCC C;  3FAV A;  3EHB B;  2QWQ B;  4DW1 A;  4DV2 B;  4O4J A;  5CB4 B;  2W0X A;  2UXB B;  4FM1 A;  1NKD A;  3F5T A;  3T1Y B;  2N74 A;  4QE9 A;  1V55 B;  1H2S B;  3E22 B;  4JYC A;  2F95 B;  2EX3 A;  3EVK A;  3ETE A;  3QF7 A;  4JI1 B;  1TUB A;  1KKD A;  4DR5 B;  2DWD C;  3L75 H;  3WB2 A;  1KYO F;  5FL7 G;  5LHH A;  3VOU A;  3ZMS A;  2P90 A;  1XMQ B;  1RFY A;  5JH7 B;  1BS3 A;  4JV5 O;  2AZ0 A;  5LMN B;  3K04 A;  2L6L A;  4NXN O;  1J5E B;  4EFB A;  3W7T A;  4TV8 B;  4GKJ B;  5BZB A;  2UUB O;  3E86 A;  4PV1 B;  1GTO A;  4EB6 B;  2Q0A A;  2XAS A;  1GRJ A;  4TQF A;  2WLM A;  1EZJ A;  1SZT A;  3HKD B;  4HZ3 A;  2GHY A;  3AG1 B;  2DYR C;  3ZMU A;  1K5Q A;  3G6E V;  2Y48 A;  1BHA A;  4LFB B;  5KLV H;  4WFB V;  3B40 A;  1PPJ H;  4BR6 A;  5C8Y A;  1GN3 A;  3EXA A;  1RPO A;  2ZT9 B;  3K57 A;  1R3K C;  4O2A B;  4RO2 A;  3FAV B;  3TXS A;  4DXW A;  1KBH A;  4LF5 O;  1LUW A;  2KSD A;  3FX7 A;  2PF4 E;  1I5Y A;  2JS5 A;  1XNQ O;  1BZK A;  3OUF A;  4DR1 B;  2P67 A;  5EZY A;  4ABM A;  1KU9 A;  1VF7 A;  2HG5 C;  5LMU B;  3WB1 A;  4B3T B;  3CXH F;  1BSM A;  4U3J A;  4BW9 A;  3H1H H;  2Q69 A;  5IYZ B;  4MSW C;  1YJ9 V;  2CTW A;  4BW5 A;  5IYD O;  3ZN0 A;  4UCR A;  3B77 A;  1YCI A;  5A2Q N;  3OFN G;  2VQF B;  2RMK B;  2ZNI A;  3KZI Z;  3MHH C;  1RPR A;  1U96 A;  2M6Y A;  3QO8 A;  4JTA B;  4FLT A;  2WLL B;  3H1J H;  2JIZ G;  5B5E Z;  2F23 A;  2FML A;  4GKK O;  1TGO A;  1AP6 A;  2BOC C;  5IY5 B;  4K8X A;  4CC5 A;  3OD4 A;  1QLE C;  3OUS A;  1VMG A;  4MW3 A;  1BL8 A;  3JD2 A;  2ZIN A;  3KCY A;  5C93 A;  2ZR3 A;  4B3S O;  3VQY A;  3BY6 A;  2UXB O;  3R66 A;  3RYI A;  1NU1 H;  1O9G A;  4JI0 B;  3JCU Z;  1MNG A;  1G6U A;  1FS0 G;  3T1Y O;  3X2Q C;  4ZOL A;  2X6C A;  3RYC A;  3ETG A;  4X1K A;  2Y0P A;  4JI1 O;  4DR5 O;  2OT5 A;  4IYI A;  3ZN1 A;  4FFB A;  1L8D A;  2PUS A;  5KUK A;  2JDI G;  2H8P C;  2UXX A;  3LUT B;  4FLY A;  4U3J B;  1R3J C;  4KHP B;  1RM1 B;  4MVR A;  3CS5 A;  3LSU A;  1XMQ O;  5LMN O;  2ZE8 A;  1D5N A;  4UVB A;  1NH2 B;  1J5E O;  4UCV A;  2BTO A;  2CTQ A;  2R72 A;  3RYF A;  1VQN V;  2W0F C;  3T1C A;  2YC0 A;  3RBZ A;  2Z0A A;  4DV0 B;  4DR3 B;  1NTZ H;  1Q8I A;  1F23 A;  2QKS A;  1H2K A;  4JI2 B;  5GW7 A;  3LSS A;  4DV7 B;  1M5I A;  4LFB O;  4F6R A;  1FKA O;  1VP7 A;  4UVC A;  2EIJ C;  3DC6 A;  1BCC H;  5IJ0 B;  2GTA A;  4DRX A;  4DR4 B;  5IT9 N;  4X20 A;  4QNH B;  3RVY A;  3ZRS A;  1YF2 A;  5CA0 A;  3VQX A;  5CBH A;  1IX9 A;  3CC2 V;  3FKS G;  1FPO A;  1YDX A;  1H8E G;  1HNX B;  1QQC A;  1QU7 A;  4PA6 A;  2JGD A;  4JAV A;  4DR1 O;  3JAR A;  2WA3 A;  2FYU H;  3STL C;  3CWB H;  2DN9 A;  2AHZ A;  4ZOL B;  2FTK A;  2Y69 B;  4PI2 A;  3BCC H;  4QPJ A;  3RYC B;  1OCO C;  4YIP A;  1NI8 A;  5LA6 A;  1XNR B;  2YIB A;  5LMU O;  1EN4 A;  1Z2G A;  2HR3 A;  1QBZ A;  3CD6 V;  3WU2 Z;  4FFK A;  1AB3 A;  4B3T O;  5LP6 C;  2A06 H;  4AQY B;  2UUA B;  4O4H A;  5CA1 A;  1QVF U;  3E8G A;  3SPI A;  1IZ3 A;  3UM7 A;  2WAM A;  4ASU G;  3CCR V;  1EN6 A;  2DQ0 A;  4MS2 A;  4X1I A;  3RYF B;  2UUC B;  2VQF O;  1Q5O A;  3KG2 A;  4X1Y B;  3D3I A;  1TAE A;  3P3N A;  4AHC A;  5L3C A;  5J2U B;  4DV5 B;  3AG4 C;  5H6Q A;  1SQG A;  4H13 B;  1SQF A;  4PA4 A;  4F6R B;  1L0L H;  3SGI A;  1L0N H;  1P7G A;  2Q68 A;  2GUZ A;  5KAI Z;  2GSM B;  4UV8 A;  1K33 A;  2ZM6 B;  1P49 A;  2ATK C;  2HVK C;  2LGQ A;  3ETQ A;  2IW5 A;  3AK1 A;  4GUN A;  4JYB A;  4UCS A;  3AG7 A;  1Y66 A;  2JGD B;  4D7S A;  3JAR B;  2WLI A;  4JI4 B;  2Q67 A;  4LF7 B;  3E2E A;  1R1B A;  5LA6 B;  3P32 A;  1DF4 A;  1YIT V;  1EFR G;  4FLZ A;  2F93 B;  2QWN B;  1MA1 A;  4U7O A;  4KHP O;  3STZ C;  1PP9 H;  4YHH B;  2WLH A;  1EBO A;  4DR7 O;  4O4H B;  4W4K A;  3K03 A;  4DYL A;  5CA1 B;  2L35 A;  3OEE G;  3CJH A;  2QDO A;  4NR1 A;  4XDK A;  5JQG B;  3L9D A;  1KP3 A;  3ABK B;  4LWS A;  2V4D A;  2WLJ A;  3E83 A;  2E76 B;  1AR1 B;  4X1I B;  3OAA G;  2VS0 A;  4DR3 O;  4DV0 O;  2Z3Y A;  3SYP A;  1SA0 A;  2X7R B;  5L3F A;  2G38 A;  2HKO A;  4HYO A;  2YEV A;  1BE3 H;  3ZHV A;  4I0X A;  2HFE C;  3BFR A;  4H0L B;  4JI2 O;  3PJS K;  3DXR A;  4DV7 O;  3CX5 F;  2LJ2 A;  4MT8 A;  1P84 F;  4HAM A;  4DR4 O;  1NH2 D;  4LF4 B;  1ARO P;  2ZCE A;  4UV9 A;  3ZMV A;  2ZXW B;  2H3O A;  1K3E A;  3CSX A;  1PNL A;  1BT8 A;  3CHX A;  4J7K A;  1VQ5 V;  4MVZ A;  3NR7 A;  1XHX A;  3AG2 C;  5B3S C;  3GWO A;  1THZ A;  1E79 G;  1CPY A;  2WLI B;  3ASN B;  4WFH A;  4DUZ B;  1W0J G;  1XNR O;  2P4V A;  4GX5 A;  4QGP A;  1I7F A;  2F4V B;  4K8Z A;  2A9H A;  4LBE C;  4GYC B;  5BMV B;  4AQY O;  1COW G;  4O4L B;  3T4D A;  2UUA O;  2LFR A;  2E75 B;  1RP3 B;  2X0L A;  3JSL A;  2X6B A;  4WBN A;  4DV3 B;  5B66 Z;  2KKW A;  3RN4 A;  3CJH B;  5CMU A;  3FD9 A;  4OPA A;  1QVG U;  2R70 A;  2UUC O;  4C7U A;  2Q7G A;  1SA0 B;  4DK0 A;  1SQP H;  1XUQ A;  4I0X B;  4MVS A;  4DV5 O;  5CB4 A;  3DXR B;  2Z5U A;  1SRY A;  1Q6H A;  3CME V;  2IBZ H;  4D7T A;  1VQP V;  2XND G;  2QSA A;  1K73 W;  4E2L A;  1BHB A;  3E22 A;  1JFF A;  2ETN A;  3M99 B;  1B6Q A;  3H1K H;  3L71 H;  2ZM6 O;  1DF5 A;  1VAR A;  1NT2 B;  2BE3 A;  5EBL C;  4PI0 A;  4I9W A;  5B1B C;  4TV8 A;  4JI4 O;  3TGU H;  5IYB O;  3JAW A;  3CCL V;  3G67 A;  4X66 B;  1ZL8 A;  3J81 N;  3T1H B;  2B5U A;  2CH7 A;  3H1L H;  3K06 A;  2ZR2 A;  1FJG B;  1KC8 W;  1IBK B;  3HKD A;  1YEW A;  1KMI Z;  4BIO A;  4JI5 B;  4WBN B;  1YHQ V;  5KUM A;  2Q5Z A;  3OMI B;  1Y4M A;  5JJE B;  4EFE A;  2A79 B;  2QR4 A;  3FB8 C;  4FJC C;  4GKK B;  2AW9 A;  3K08 A;  4IYH A;  3RGB A;  4O2A A;  2OCC B;  4TQD A;  3CRA A;  3VQW A;  1OZ0 A;  4KUM A;  1PNK A;  4LP8 A;  3QO7 A;  5B1A C;  4DO2 A;  2HP8 A;  4B3S B;  2RQ6 A;  1OCR C;  4D6T H;  1S0V A;  4NKG B;  1CXZ B;  3GB7 C;  3F7V C;  4F6E A;  5KMG B;  1Y74 A;  4MW8 A;  1XHZ A;  4LF4 O;  1IVS A;  1V9P A;  5EIB D;  1JFF B;  3MAQ A;  3CRM A;  2V7Q G;  4JYA B;  1M56 B;  1V54 B;  5JCO A;  3ZMZ A;  3CEI A;  3K5L A;  4TSF G;  2EIN B;  1Q82 W;  5CN0 A;  1WB8 A;  1NTK H;  3ZS8 C;  1B04 A;  1R6N A;  1SQB H;  1FXH A;  3AG3 C;  5IYZ A;  3HKE A;  1QR9 A;  1GN2 A;  1RSO B;  3OR6 C;  3IC7 A;  3KKY A;  5FPR A;  1GO3 F;  5KHG A;  2HLD G;  2IM9 A;  4DUZ O;  3ZRX A;  3JAW B;  3CP1 A;  4IIJ A;  5KA6 A;  3RWR D;  2F4V O;  1N0N A;  1ZL8 B;  2EIL C;  2MW2 B;  3VQV A;  1E1R G;  2EBO A;  2EIK C;  1R6T A;  2CH7 B;  1N33 B;  2VWK A;  4I50 A;  5ITZ A;  2QM7 A;  4FLU A;  4FK5 C;  2ZIM A;  2WLL A;  3ZRW A;  2XAH A;  1IXB A;  1IBL B;  1IDS A;  4DV3 O;  4YY3 B;  4MTG A;  1QCE A;  3A2F A;  1ORQ C;  4IL6 Z;  4ZI7 B;  1HNW B;  3AK2 A;  4B7K A;  1S3J A;  2EUL A;  3D36 A;  3WFV A;  3LNM B;  3ABU A;  5BXZ A;  2HEP A;  2IU3 A;  1H2N A;  3ABM C;  1AVM A;  2HHH B;  1Y74 B;  2RN9 A;  5EC2 C;  1YIJ V;  3SYQ A;  4DV6 B;  5IDJ A;  5A9G A;  2VQE O;  2CE4 A;  1SZX A;  5LYJ A;  1YJW V;  1MSW D;  5EBM C;  4FIP C;  2XAJ A;  2RCV A;  1NBM G;  1X4T A;  5HFL A;  4FM0 A;  4CS3 A;  3OT7 A;  3ABL C;  2R9R B;  4PHZ A;  2D2C B;  3HKE B;  1F4M A;  3HKB A;  3ZBH A;  2AGA A;  2P5O A;  3G4S V;  1QLN A;  4CH4 A;  1ROP A;  2XAG A;  4NYK A;  2Q73 A;  4X66 O;  1YVW A;  5TIS Z;  1UJW B;  3L70 H;  4O2B B;  4IIJ B;  3T1H O;  5D5Q A;  4X88 A;  1YJN V;  1FJG O;  4GX0 A;  4LF8 B;  1IBK O;  4YXW G;  2OWO A;  4I50 B;  5ITZ B;  2AXT Z;  3SYA A;  3ZRW B;  2Y0I A;  1NR7 A;  4JI5 O;  3OE7 G;  1AR4 A;  3BPZ A;  1QHT A;  5IJ0 A;  1Q86 W;  2F66 C;  3J80 N;  2B1I A;  1JX9 A;  2QWO B;  4UXN A;  1FAF A;  3CCE V;  1CEZ A;  2OIE A;  3ZJZ A;  2F1M A;  2DW4 A;  4A5U B;  4AI8 A;  4FM2 A;  1DTO A;  2YSU B;  1GKF A;  2XAQ A;  4E4E A;  2PGG A;  2ZXW C;  3SJB C;  1T5E A;  1TUE B;  4JYA O;  4CS4 A;  2R9A A;  2EIM B;  5LYJ B;  1B06 A;  1B3Q A;  3B09 A;  3IC9 A;  2JS3 A;  3QO5 A;  3FYI B;  4OX9 B;  2CUG A;  2JEX A;  3IFX A;  5LGT A;  5IYC O;  4JYY A;  1VQ9 V;  2P7T C;  3ASN C;  4DR7 B;  3FYE B;  3HKB B;  4N23 A;  3BEH A;  2UXC B;  5AG2 A;  2LFS A;  1Q3E A;  1VIB A;  2Q7H A;  4P9O A;  4RWU A;  5LGU A;  4X1Y A;  2QWP B;  4DV4 B;  1JVM A;  1N33 O;  4NTX A;  4B08 A;  5HFM A;  5J2U A;  5LGN A;  1M57 B;  3LSQ A;  1IBL O;  4BIU A;  1W59 A;  3WB0 A;  1XEQ A;  2YXL A;  2GV9 A;  3ASO C;  4YY3 O;  3CCV V;  2RDC A;  5H2F Z;  1OCZ B;  1PKX A;  2CK3 G;  3CCS V;  3JAK A;  4PDV A;  2OTJ V;  2CGN A;  1VF6 C;  1HNW O;  4LH7 A;  1HNZ B;  3QG5 A;  1YXB A;  1K8A W;  1I08 A;  2YS8 A;  5L3B A;  1NTM H;  2YXH A;  4X65 B;  1LNQ A;  2H94 A;  3RW0 A;  2HHH O;  3APQ A;  1HR0 B;  3UKM A;  2PI5 A;  1TVK A;  2GBO A;  2QM8 A;  2P22 C;  4DV6 O;  1YI2 V;  1S5L Z;  2FB5 A;  4NVP A;  1OJH A;  3ZIA G;  1ZSP A;  3S3W A;  1WJZ A;  4J7J A;  4UFZ A;  2X6A A;  1MOF A;  1WP8 A;  2C2A A;  2ADP A;  4WFA V;  5CBF A;  3OW2 U;  5F2V O;  4QJF B;  5JQG A;  3I55 V;  4MVQ A;  4WFE A;  3BVO A;  5LXT A;  3SPG A;  3BAA A;  5FPO A;  3N27 A;  4J80 A;  4ZHQ B;  2LP7 A;  2BCC H;  4X89 A;  2QE7 G;  4LF8 O;  2WPD G;  1ZTE A;  2IJK A;  1FXK C;  1VQL V;  1GN4 A;  4H37 A;  3CRR A;  5FNV A;  4UB6 Z;  1N36 B;  4KFM A;  4NXM B;  3I5D A;  1SQV H;  3JAK B;  2OCC C;  3CCU V;  1GM8 A;  2E5L B;  2GTS A;  3IAY A;  2ZQM A;  2ZDI A;  3S3X A;  4OGQ B;  2PTM A;  3UCS C;  4MVM A;  3SYO A;  2YDE A;  1CP9 A;  3IGA C;  4P2Z A;  3IJ4 A;  4U7N A;  2QGN A;  1H2M A;  1JJ2 U;  1V55 C;  3OGI B;  3F7Y C;  3ZMT A;  1XQ8 A;  1M56 C;  4PDL A;  1WN7 A;  2IJJ A;  1TVK B;  3A0H Z;  4JI7 B;  1BQZ A;  4BIZ A;  2ZE6 A;  3B8M A;  3G80 A;  5BMV A;  4OX9 O;  2ARH A;  1VQ7 V;  4O4L A;  1GH6 A;  4I4T A;  3W7S A;  1S5J A;  4WFG A;  4FPP A;  2UXC O;  4Z1V A;  3CRQ A;  3AEI A;  4JI6 B;  2XOK G;  3H1I H;  2QWR B;  4UUJ C;  5LXT B;  4CS2 A;  5KHJ A;  1G1X B;  4YJ2 A;  4JTC B;  4DV4 O;  3AG1 C;  1VQ4 V;  4HBN A;  2YXY A;  4RQE A;  2YIA A;  2OIG A;  1AR5 A;  2WWW A;  3ZHS A;  5FNV B;  2LQT A;  3JSN A;  1N4C A;  1NZ6 A;  2QTS A;  3K3W A;  4DV1 B;  2ZIO A;  1K34 A;  5BR8 B;  5LOV B;  4L87 A;  4CZZ A;  1LUV A;  2Q6A A;  3L74 H;  1HW7 A;  2KG7 B;  3CPW U;  2BSK A;  5L3G A;  1WA8 A;  1HNZ O;  2Q9L A;  1FYJ A;  1SER A;  1SC5 B;  4LFA B;  2E74 B;  3F5W C;  3CCQ V;  4QIW F;  2HJF C;  3L72 H;  1VQ6 V;  3A0B Z;  4TUY B;  4X65 O;  2WLK A;  5IWA B;  4N21 A;  1HR0 O;  2ITC C;  5B1N A;  3X2Q B;  1ZLZ A;  3OEH G;  1N34 B;  2NN4 A;  5EC1 C;  4AIL C;  1TA8 A;  5LHI A;  3VBB A;  2NR5 A;  1K4D C;  4I4T B;  4JPR A;  5DN6 G;  3LDC A;  3OTF A;  4WF9 V;  1Q6I A;  1XOU A;  2JEU A;  4MVO A;  4OXS A;  4TV9 A;  4IHJ B;  2PZS A;  4YJ2 B;  5DEC A;  3JAT A;  3N2K A;  2D3O W;  1XBL A;  2ZNJ A;  1Y76 B;  1BMF G;  5B1O A;  4LF9 B;  4K0K B;  3RYH B;  5KHH A;  1XMO B;  4JZ2 A;  1N36 O;  3EFF K;  1M1K W;  4X64 B;  2ZD9 A;  4NXM O;  5KMG A;  1Y6X A;  2EIJ B;  5IY5 C;  1I5X A;  4CH6 A;  2W6J G;  2CAZ C;  2UU9 B;  3QTC A;  3ZHQ A;  1IBM B;  2E5L O;  3JYC A;  4MTX A;  1Q81 W;  2CTR A;  3BRC A;  3D36 C;  2YI9 A;  2BSK B;  2VQE B;  3ZED A;  1WA8 B;  3ZCC A;  1PM9 A;  3E8F A;  3Q4H A;  1YTF B;  3K9A A;  4CH5 A;  1K9M W;  1RSO A;  5FLX N;  4CH3 A;  2QM4 A;  1S72 V;  1XDC A;  3ETD A;  1IXM A;  5JVD B;  4JI7 O;  2PY5 A;  4JZG A;  2ZE5 A;  1JA8 A;  2HJD A;  2OYQ A;  3KCX A;  1WLE A;  2FL4 A;  4KP4 A;  1RM1 C;  1ENV A;  1FXV A;  3MDS A;  3JD0 A;  5LP6 B;  4X9Q A;  1XRE A;  5DED A;  3BA9 A;  4UCU A;  4JI6 O;  4O4I A;  2LW7 A;  4TV9 B;  4TOI A;  1R6K A;  1BGY H;  1Y67 A;  1G8M A;  3BHP A;  4I5S A;  4PA7 A;  4ZI7 A;  2P06 A;  4F4L A;  2QA4 V;  1AI4 A;  2R9I A;  5IJ9 B;  1U97 A;  2M7W A;  3JAT B;  3N2K B;  3SPH A;  4B7E A;  4LFC B;  4J42 A;  2B1G A;  3FB6 C;  3A0R A;  3AG4 B;  2ITD C;  2DOS A;  4JAU A;  4GCZ A;  2ILM A;  4DV1 O;  2DJV A;  2JJ1 G;  5BR8 O;  4EKW A;  3RFR A;  4CC6 A;  2IH1 C;  2W6I G;  3G71 V;  3AK3 A;  2CTP A;  4PA3 A;  4NTW A;  5H5N A;  4I55 B;  3LDD A;  1WB7 A;  4BWA A;  1QR8 A;  3O9O A;  4G28 B;  4YJ3 B;  4LFA O;  4R8C A;  5LHG A;  5L3E A;  1PL0 A;  3Q4H B;  5IWA O;  4DR2 B;  3OTO B;  2Y69 C;  4K35 A;  3ABT A;  3HKC B;  4GZR B;  5IE9 A;  4JI3 B;  4H33 A;  3CC4 V;  3T4Z A;  1D5A A;  1N34 O;  4O2B A;  5DM6 V;  3QNE A;  1VQO V;  3D8C A;  1UPG A;  2YI8 A;  2ODM A;  3UQ8 A;  3CCM V;  2NLJ C;  2YUA A;  2WA4 A;  4MVU A;  1Q7Y W;  3MD0 A;  4ZKI A;  2Y4T A;  1JMK C;  4O4I B;  4TT3 G;  3T2M A;  1WNS A;  4KL1 A;  5K1P A;  2V1D A;  1NVP B;  1MMM A;  3SR2 C;  2Q7E A;  4LNU A;  1M93 A;  5J2T A;  3E8H A;  3W7U A;  1S77 D;  1SS3 A;  3TK1 A;  4LF9 O;  4K0K O;  1XMO O;  3L73 H;  4DR6 B;  4X64 O;  3BAB A;  1AI5 A;  4ICG A;  2YIC A;  4Z2W A;  2UU9 O;  3JD3 A;  2WLN A;  3ML0 A;  1IBM O;  3FFQ A;  1MAB G;  1ZWI C;  3K5O A;  4JF3 A;  4X8A A;  1WPX A;  3H01 A;  2O57 A;  3ZHU A;  4DK1 A;  1YSC A;  4O4J B;  2AHY A;  1F4N A;  2HVJ C;  1K92 A;  3UT5 A;  1KEC A;  1VF5 B;  1SQX H;  3AG2 B;  5B3S B;  3RT3 C;  3P30 A;  3CB2 A;  3ZX6 A;  1K97 A;  4NB5 A;  4I7Z B;  1TUB B;  1MSD A;  4NTY A;  3ZHR A;  4H44 B;  5CA3 A;  1FFX A;  1YTF D;  4QPK A;  5EIB C;  2K1E A;  5E79 Z;  3K0D A;  3ABK C;  1I94 B;  4X62 B;  3GWK C;  4PJ0 Z;  1WAZ A;  5J9P C;  1ZUQ A;  4ZBM A;  2MK3 A;  3HB3 B;  2DYS B;  1K7D A;  2IH3 C;  4LFC O;  4J41 A;  4LNU B;  4IT5 A;  5J2T B;  4LH6 A;  1H38 A;  2LO1 A;  4MTO A;  1Q43 A;  1PD3 A;  2PYJ A;  1S76 D;  2EJR A;  5D5P A;  1PV0 A;  1F51 A;  3PN1 A;  3K5M A;  5C8Y B;  4P30 A;  2A3Q A;  2ZDI C;  4PDM A;  5GON A;  4EEQ A;  3ZRV A;  4L8J A;  4DV2 O;  3RVZ A;  3JAS A;  4J11 A;  2JJ2 G;  2XT9 A;  3UT5 B;  3P3P A;  3E8B A;  4DR2 O;  1JCH A;  5LBQ A;  2UXN A;  3OTO O;  1PNM A;  4JI3 O;  5EZY B;  1JOY A;  5B1B B;  4GT1 A;  1XI1 A;  1GM9 A;  5BY1 A;  3OMA B;  3G6B A;  5CBG A;  4ZHQ A;  2RJZ A;  3SDL A;  3WG7 B;  2E3C A;  1FFX B;  4YIO A;  3CYO A;  2BOB C;  4GKJ O;  4K3A A;  1SES A;  3FB7 C;  4FLV A;  4J9Y B;  4GX2 A;  3M8A A;  1X59 A;  3B8N A;  3M7M X;  1US6 A;  2XUM A;  4XBF A;  2ZE7 A;  3APO A;  1QNM A; 
#chains in the Genus database with same CATH homology
 2E5L O;  5LMN O;  3J81 N;  4DR6 O;  4JI0 O;  1J5E O;  1N34 O;  4DUY O;  4LF6 O;  4JI8 O;  4JYA O;  2Z0A A;  4OPH A;  5FLX N;  4B3R O;  4LFC O;  3F5T A;  1XNR O;  4LF8 O;  5BXZ A;  2N74 A;  4JI7 O;  1HNZ O;  4LFB O;  1FYJ A;  1FKA O;  2FKX A;  4AQY O;  5A2Q N;  2UUA O;  2VQE O;  5IT9 N;  4X65 O;  4DV2 O;  1DK1 A;  4JV5 O;  1HR0 O;  1D2D A;  1R1B A;  4B3M O;  1N33 O;  4LF9 O;  4K0K O;  4OPA A;  1XMO O;  4NXN O;  2UUC O;  4JI6 O;  4X64 O;  2LW7 A;  1IBL O;  2AGA A;  4LF4 O;  2UUB O;  1KUQ A;  4DR2 O;  1XEQ A;  4KHP O;  4YY3 O;  3OTO O;  2UU9 O;  1IBM O;  3JAM N;  4GKK O;  4X66 O;  4DR1 O;  4JI3 O;  4DR7 O;  4DV5 O;  1I94 O;  3T1H O;  4X62 O;  3O65 A;  1NS1 A;  2JRI A;  5BY1 A;  1HNW O;  1FJG O;  1IBK O;  5LMU O;  1A32 A;  2DOS A;  3SDL A;  1AIL A;  4B3S O;  3J7A U;  4DR3 O;  4DV0 O;  1AB3 A;  4B3T O;  4LF7 O;  4DV1 O;  2DJV A;  2UXB O;  4JI5 O;  5BR8 O;  3R66 A;  4DUZ O;  4OX9 O;  1YZB A;  5H5N A;  3T1Y O;  1HNX O;  4GKJ O;  4JI2 O;  4DV7 O;  2F4V O;  3RT3 C;  2ZM6 O;  2UXD O;  3M8A A;  3J80 N;  2HHH O;  1X59 A;  2UXC O;  4YHH O;  1R6T A;  4LFA O;  4JI1 O;  4DR5 O;  4DV6 O;  4DR4 O;  2VQF O;  1F7Y A;  1N36 O;  4LF5 O;  1N32 O;  4NXM O;  5IWA O;  2ZKO A;  4DV3 O;  4JI4 O;  1G1X B;  5LL6 Y;  4A5U B;  4DV4 O;  1XNQ O;  1XMQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...