4JI0O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji0O00
4YY3O 2FKXA 2N74A 5LMUO 1IBMO 4JI7O 2E5LO 1FYJA 1YZBA 4LF4O 4NXNO 5IT9N 4LF6O 4LFAO 1XNQO 1D2DA 1X59A 3OTOO 4JI6O 2VQEO 4LF9O 4NXMO 3RT3C 4JI3O 2DOSA 4DV5O 2LW7A 4DV3O 1R1BA 4DR2O 1FJGO 4DV0O 3SDLA 1IBKO 1HR0O 1A32A 4OPHA 1F7YA 1XMOO 4B3TO 3F5TA 3JAMN 1DK1A 1KUQA 5IWAO 4AQYO 3J81N 2ZKOA 4X62O 4JI8O 4DV1O 4X65O 3R66A 4LFCO 3M8AA 4DV4O 4JYAO 2UXBO 4A5UB 3T1HO 4JI2O 1J5EO 2F4VO 1N36O 4JI4O 4OPAA 4LF7O 4K0KO 4GKJO 1N34O 4DV7O 2AGAA 4DR5O 2Z0AA 4DR1O 4X66O 5A2QN 1N33O 2JRIA 1G1XB 1AILA 2UUCO 1XNRO 5LL6Y 1IBLO 2VQFO 1HNWO 4JI1O 4LFBO 4JI5O 4X64O 4LF8O 2DJVA 4B3MO 4JV5O 2UXCO 3T1YO 1FKAO 4DUYO 4YHHO 1HNZO 1XMQO 1NS1A 4GKKO 5H5NA 1XEQA 4DV2O 1N32O 4DR6O 1AB3A 3J80N 4B3SO 2ZM6O 2UXDO 1HNXO 2UUAO 4KHPO 2UUBO 4JI0O 4DR3O 5FLXN 4DV6O 2HHHO 4B3RO 1R6TA 4DR4O 4DUZO 2UU9O 5BXZA 3O65A 5BR8O 5LMNO 4DR7O 5BY1A 3J7AU 1I94O 4OX9O 4LF5O
chains in the Genus database with same CATH superfamily
1M93A 3VOUA 1RFYA 1LUWA 1K92A 2OCHA 3ZRWA 2EZPA 5JQGB 4LFAO 3E8FA 3KG2A 1JR9A 4GX5A 2QA4V 4NXMO 1WN7A 4I9WA 4JI3B 2CTPA 2ATKC 1R1BA 1WB7A 2AZ2A 2IBZH 3B09A 4X66B 2ZDIC 1DK1A 3J81N 2ZKOA 3CSXA 3TK1A 3R66A 1VQ9V 4JI8B 1VQPV 4EKWA 4R7CA 5GONB 5EK0A 3KKYA 5A9GA 2F4VO 2FTKA 4QE7A 4JPRA 3AEIA 1FXKB 4FM1A 4O2AB 4X66O 4DV7B 3ZRXA 1R3KC 3RYHB 1TUEB 3SYPA 3AG3B 4ZHQA 2JEXA 4TV8B 3ZMVA 2Q9LA 1GTOA 1NR1A 5IY5B 4JI1B 1SZXA 1JOYA 1NH2B 4PJ0Z 3K79A 1D5NA 2OT5A 2ZE6A 4OXSA 3RYFB 1JPXA 4CBCA 3MHSC 3ZHVA 1RM1B 1RPOA 4BWAA 3ZHQA 1M56C 5EIBC 4MTFA 5B5EZ 4J9ZB 2QM7A 2JS3A 2Q6AA 2Y4UA 1BT8A 2R9RB 4B3RO 3JATA 5BMVB 2JGUA 2QWPB 3IFXA 1ZX3A 4UVCA 2QEXV 3W7TA 4LF5O 1OCZC 3ASNB 2H94A 1PP9H 1K8AW 4PA3A 1G8MA 5C8YB 1GAXA 5IT9N 2B9ZA 1AI7A 1KP2A 1X59A 3U10A 3ZMUA 5IJ9A 3OM3B 3G4SV 4DW1A 3L72H 2VQEB 4GYCB 1OV9A 4DV5B 3E8HA 4FLTA 5IYDO 2EX3A 4JTAB 3SDLA 5GW7A 3RN4A 3SJAC 2JEUA 4NVPA 3F5TA 1XNRB 3H01A 1AI4A 2Q8VA 4X65O 4LR3A 4YIPA 5L3CA 1YSCA 3ZRWB 1JVMA 4CC6A 5JVDA 2IW5A 4IIJA 3BRCA 5KA6A 1N32B 2YXHA 3VQWA 1AJPA 3CWBH 1XQ8A 4UB8Z 2YXYA 1XNRO 2YEVA 4WFHA 1Z5VA 3AK1A 2QSAA 3CRMA 4D6TH 3CHXA 2LGQA 4FIPC 1TA8A 4ZOLA 5J2UA 1NH2D 3KCYA 3CE2A 1Q5OA 2RCVA 4B08A 5H5NA 5EBLC 3VQXA 3JASA 3TGUH 4NB5A 1N32O 1IVSA 1NU1H 2UXDO 1WA8A 3CC2V 2X7RB 2N05A 2XAJA 3W7XA 2DYSC 4JF3A 4JI0O 4DR3O 2ITDC 4OGQB 4UB6Z 2QM8A 2BOCC 3QO5A 1R3LC 3FB6C 3L71H 5BR8B 3ABLC 3K58A 4ZHQB 1Y76A 3SPGA 1MZFA 1GRJA 2DN9A 1IBMB 1OCOB 1YZBA 4UUJC 3K04A 3AG4C 4IHJA 1QLNA 3E2EA 1H8HG 1QNMA 5KAFZ 2GUZA 2MW2B 3CP1A 2ZIMA 2LW7A 1EN4A 4X1IA 3UO2A 2FYUH 2JJ1G 5B1BB 4DR2B 1IXBA 2CTQA 1U96A 4PELA 1XMOO 3JATB 1AI5A 2ADQB 2HP8A 3CCSV 4G2KA 4PDLA 3E35A 4PDMA 5E1AC 4X62B 4KP4A 4DV1B 1WJZA 1M57B 5EZYA 3ZMTA 3T1HO 4JYAB 1S5LZ 4MVQA 3ZHTA 3CCLV 5DM6V 2BTOA 3M99B 3U0ZA 3EVKA 4UVBA 5IJ9B 5LL6Y 2UUCB 1NZ6A 4KHPB 4MVZA 2HLDG 1MMMA 1SKVA 2K9PA 2DJVA 5LXTA 1XL6A 4MVRA 3CS5A 1HNZB 1V9PA 4R6ZA 2HFEC 3CB2A 1SZTA 3X2QC 1QR9A 3FKSG 2UXNA 1HNXO 2ZDIA 4KHPO 4LH7A 4MT8A 1KKCA 2Y0PA 3F7VC 5JVDB 4GX0A 3G67A 3OTOB 1VQLV 3FAVA 4IIJB 1K9MW 2EBOA 4DR4B 3MDSA 4ZBMA 2XT9A 2YEVB 1P7BA 4ZOLB 5J2UB 4MVUA 1CEZA 2QJ1A 1WAZA 1Q6HA 5JJJB 3JAWA 3OTOO 3JASB 1BGYH 2DOSA 1TVKA 1Q43A 2IU3A 1E79G 3RFRA 2GHYA 1AR5A 2Q7GA 3OUSA 1WA8B 5CA1A 3BAAA 5KX5A 4DR5B 2ZR2A 3T4ZA 1YHQV 3L9DA 1PV0A 4YJ3A 3OGIB 4HAMA 4LWSA 1Y76B 3M8AA 2D2CB 1GM9A 1JA8A 3ABMB 1R6NA 1JMKC 5F2VO 2PF4E 2EIKB 1WB8A 4GKJB 4X1YA 3OW2U 5EBMC 4DR5O 1EFRG 2F23A 2WLLA 4JZ2A 4W4KA 1ZL8A 4I4TA 2M7WA 4IHJB 2V1DA 5K1PA 1G1XB 4P2ZA 1IBLO 2GUZB 4UCRA 1WPXA 4U7OA 4KFMA 4LCUC 4P9PA 4X1IB 3ZS8C 4JI5O 4HNAA 4X64B 3RWRD 2XAFA 2NNUA 3ZHRA 5C93A 3T1YO 4JV5B 2UXCB 4JGSA 2WLHA 5J9PC 4QE9A 3JARA 1H2GA 1SQBH 2CTWA 3GB7C 4PDVA 5FNVA 3J80N 2EIMC 3P30A 3STLC 2ZXWC 5EZYB 3APQA 3THOA 4J10A 4LF4B 2X0LA 3E83A 1PNLA 4X89A 2UUBB 1KKDA 1GN4A 3G71V 1ORQC 2ZD9A 1W0KG 3BA9A 5LMNB 4OX9O 1QLEC 1MZEA 2JS5A 2HJDA 1COWG 2BCCH 3DC6A 3TXSA 4UV9A 2HG5C 3CC7V 1LNQA 3E89A 4J9YB 4LF4O 2YSUB 3I5DA 1JFFA 5LXTB 3ZMSA 3ZRSA 1XNQB 1D2DA 3UKMA 1XL4A 1KP3A 4FLUA 4PA9A 1V54C 2Q69A 3Q4HA 1H2LA 2GTAA 1ZAUA 3OR7C 5CA0A 3ABKC 1FJGO 4DV3B 4TV9A 3HKCA 1N33B 1HR0B 3FAVB 1K4CC 2WAMA 5JWPA 4AI8A 3TJTA 5IWAB 1PD3A 3U11A 4LFCO 5IYBO 1BE3H 4JI2O 4FM0A 1J5EO 4JASA 1GO3F 1NTZH 1SETA 3JD2A 3CC4V 5ITZA 4DR1O 4MVSA 1EM1A 5B1AC 1N33O 5DEDA 3JAWB 2BSKA 4MS2A 4CS3A 4E2LA 4AHCA 1SERA 1FXHA 1TVKB 3K08A 2F66C 1HNWB 3RVYA 4I50A 3I55V 4FMTA 1Y66A 5H6RA 3CRCA 5CA1B 3OUFA 5KX5B 5HFMA 1VQNV 1S5HC 4GX1A 2OYQA 1KBHA 1AJNA 3DTUB 2FMLA 2IH1C 3BY6A 1XMQB 1M56B 5JCOC 4YJ3B 4BR6A 4LNUA 4LWSB 3F5WC 2UUAO 1IURA 1SA0A 3JAKA 4DV6O 1K34A 3ZEDA 2ZCEA 2ZE7A 4X1YB 1XI1A 2YDEA 4BW9A 2WLLB 1ZL8B 1OCZB 4I4TB 3J7AU 2LP7A 2IM9A 2GBOA 3E8GA 3W7UA 4DV0B 4O4LA 1UPGA 2GSMB 3OEEG 3TCUA 2V4DA 1Q6UA 1VF6C 2OTLV 4HNAB 5JH7A 5FPRA 4UCTA 1L0NH 2PUSA 4LFAB 4Z1MG 1K3EA 1XHXA 4JZGA 3JARB 3AG7A 3VQVA 4D7TA 1X4TA 1SQXH 1Q3EA 4NXMB 1THZA 5FNVB 2ZNJA 4E4EA 2YXLA 2KB1A 4X88A 2O57A 2WA3A 3HPLC 4DV0O 1IBKO 3LSSA 1W0JG 4XDLA 4IT5A 3E22A 4XDJA 1H2MA 4LFBB 1V55C 1NTMH 2JIZG 1VARA 4JI4O 5LYJA 4AILC 2F4VB 3B8NA 2Z0AA 4I7ZB 1JFFB 4D7SA 3P3NA 4PI2A 3FB8C 3G6EV 4MVOA 2W6JG 3A8TA 3Q4HB 3C3SA 4Z1VA 2Y48A 1SQQH 2UXXA 4LFBO 1ZUQA 4PV1B 2OCCC 5CA0B 1O9GA 4JAUA 1Z2GA 4TV9B 3HKCB 1Y67A 4PDRA 2CK3G 4FLZA 2QWRB 2WLKA 3A0RA 4DRXA 2DYSB 1L0LH 2QGNA 2Q7HA 4UV8A 4MW8A 3CXHF 4CC5A 2B1GA 1SC5B 2B1IA 3ABLB 4U3FH 4B3RB 5ITZB 5IDJA 1QVGU 5BY1A 1I94O 4W4LA 1YJ9V 2FB5A 2BSKB 3D3QA 1QU7A 1K73W 3UCSC 4YXWG 4YY3O 2KG7A 3BCCH 4LF5B 5L3BA 4I50B 4DK0A 1FYJA 2L35A 3AG4B 2XAQA 4KUMA 4TOIA 4AQYB 3R65A 5HFLA 4X1KA 2R72A 2QKAA 2EIJB 1HDJA 4GX2A 3OGCC 1GH6A 4LNUB 3CCEV 2ZINA 2D3OW 4K0KB 4EFBA 3K9SA 2WWWA 2WLNA 4GLXA 4CH6A 3WU2Z 1SA0B 3JAKB 3ZJZA 4JAVA 3OTFA 3JALA 4AQYO 1GN6A 1S5JA 4JYCA 1XUQA 4X65B 5E79Z 2EILC 3LNMB 3D36C 4O4LB 1SQVH 3FYIB 5KHGA 1N36O 4K0KO 2Y0IA 3JYCA 5JH7B 1Y6XA 3FB7C 2JRIA 4Z2WA 4PA7A 3KCXA 2Q73A 2VQFO 4RWUA 5L3FA 1IZ3A 1OCRB 3RYCA 3JCZA 1YI2V 1FKAO 3DSQA 4JTDB 2YICA 3K57A 1L8DA 4GKKO 2Q0OC 3X2QB 3BHPA 1KMIZ 2ETNA 2JK5C 4DV2O 3IC9A 3E22B 1AB3A 1KQSU 3BEHA 4MVMA 4EB6A 4U3JA 4O2BA 2UXDB 4FPPA 2RDCA 4RO2A 2HR3A 2XUMA 5FL7G 2BE3A 5LYJB 4JI0B 4DR3B 1YEWA 4DUZO 2UU9O 4X9QA 4PA4A 4ZI7A 1Q86W 1MABG 3ZRVA 1QBZA 1NT2B 3M7MX 2N74A 5LMUO 5LGNA 4JI7O 2XHBA 5KAIZ 1XBLA 5CMUA 4FK5C 3D8CA 3OAAG 3CJHA 3S3XA 4QPJA 4R8CA 3IJ4A 4JI6O 1D5AA 2WLMA 4LF9O 1NI8A 1PL0A 2AHZA 2W0FC 4I9QA 4DRXB 1BMFG 1R6KA 1J95A 5B1OA 2JGDA 5JCOA 2EINC 5JJEB 3JAMN 1XMOB 4CS4A 3IAYA 3CXCU 2VS0A 2NLJC 2C2AA 2F93B 3HR0A 2KG7B 3B8MA 1S0VA 4MTGA 4GCZA 3ETDA 4QGPA 4UCUA 1PL4A 3T1HB 2DQ3A 1GKFA 1YJWV 3HKDA 3K0DA 2N04A 5A2QN 4X1KB 2VWKA 3SYQA 1L1FA 2P90A 1VF6A 3K0GA 1IX9A 1FD9A 1NBMG 3A2FA 1RSOA 4F4LA 3OMNB 4O4JA 4B3MO 5B66Z 3DXRA 3LSUA 2HKOA 2EIMB 3JALB 4K8ZA 3ICXA 2ZXWB 3ASNC 2P4VA 1HNXB 5CBFA 4FM2A 4P9OA 2A3QA 3JD3A 2ZE8A 3K5MA 1FXVA 1QLEB 2DMXA 2CUGA 4MW3A 4QIWF 3S3WA 3PJSK 2KKWA 2YI9A 4PD4F 3EHBB 5CBGA 3SPHA 3RYCB 4B3TB 2RN9A 1MOFA 4TWKA 4LF6O 2ZR3A 2AZ0A 2R70A 3F7YC 3GWKC 1V54B 4J80A 2DQ0A 4ASUG 4EFEA 2Y69C 4MSWC 1VQ4V 3NXSA 2Q7EA 1SESA 3ABKB 2CGNA 3ETGA 4EB6B 4U3JB 5KHJA 4O2BB 1XREA 1K7DA 3FFQA 1Y4MA 4B3TO 3BVOA 1K5SA 3ZIAG 5KHHA 2PYLA 4JAAA 4ZI7B 4TUYA 1LUVA 5L3DA 1WLEA 2P22C 2UXBO 2A9HA 3I56V 5B3SC 1M5IA 5B1AB 5FPOA 1N8RW 3C90A 5KHKA 4LC1A 3CJHB 1S3JA 4J11A 1JX9A 1IBLB 4H0LB 1XOUA 4CZZA 1Q8IA 1SF9A 3AG2C 2E75B 4JI5B 4WFFA 2AHYA 2ZNIA 2JGDB 4YHHO 1KYOF 4K35A 3T1YB 4P30A 3AK2A 1PNMA 2P5OA 1OZ0A 4N21A 4FZ0A 4DR6O 1VQ6V 3H1HH 3LDCA 2IH3C 2NN4A 2P06A 3JD4A 2E3CA 4K8XA 1GN3A 3HKDB 3P32A 1B3QA 5BXZA 3OMAB 4YJ2A 4FZ1A 4DR7O 3D36A 2ARHA 4NTYA 4OX9B 2P67A 1SRYA 1WPBA 3QO8A 1SQFA 4UCVA 1RSOB 5KUMA 4NXNO 4O4JB 1WP7A 3DXRB 1SQPH 1Z5WA 1DGSA 5DN6G 4BAYA 2Q0AA 3AK3A 1G4YB 3RT3C 3B4SA 3W7SA 1MNGA 3OR6C 4O4HA 3P3PA 1U97A 3CRQA 4H33A 2QM4A 1FJGB 4F6RA 1KD1W 4TQFA 1JJ2U 3T1CA 4DO2A 4WFBV 2V7QG 1FFXA 1TUBA 3FB5C 2CAZC 3CRAA 1AI6A 2WSSG 4LFCB 4DV4O 1M1KW 4GZRB 4LF8B 1AVMA 3QTCA 2Y4TA 1YTFB 4JI2B 1J5EB 4WFAV 3B77A 1EZVH 3CMEV 4DR1B 4G28B 3APOA 2LGWA 3K03A 2HJFC 1S72V 1OCCC 2OCCB 4GT1A 4J7KA 3N2GA 2GTSA 3LNNA 4LF8O 1URFA 2X6CA 2XAGA 3OFNG 1AJQA 1NS1A 4PA6A 2PGGA 1QQCA 1FS0G 5IE9A 4RQEA 3RBZA 4TUYB 1KC8W 4B3SO 3EXAA 2ZM6O 2W6IG 4NKGB 2UUAB 4DV6B 1PNKA 1M9NA 2ADPA 1VMGA 3IGAC 5DECA 2HVKC 4UFZA 3WG7C 1TGOA 1YXBA 2QE7G 1OJHA 1XILA 3SGIA 2WLIA 2OIGA 3WB0A 1RPRA 4CH4A 3H1KH 1Q82W 4ICGA 3L73H 1AR1B 4EEQA 1HP8A 2JDIG 3L70H 4FLWA 2QWQB 1H2NA 1W2BU 2ZT9B 4IGGA 3OE7G 5B1NA 2YIBA 2OWOA 1A32A 4OPHA 1IBKB 3CCMV 4YJ2B 1IXMA 1XDCA 2EILB 4KL1A 4U7NA 2DYRC 5EC1C 1KB9F 3OD4A 5EBWC 5IYZA 3AG1C 2P7TC 2P4KA 4H44B 4J7ZA 1I5YA 4N23A 5CN0A 1IDSA 1OHHG 2ODMA 4LF7O 5LGUA 4UVAA 4JI4B 2AW9A 4BW5A 2EJ7A 4G27B 3HB3B 3K3WA 4LBEC 1VF5B 4O4HB 3A0BZ 2PYJA 2GDSA 1NR7A 1ZWIC 4F6RB 1S77D 1BHBA 1PPJH 2XTAA 1FFXB 1BSMA 1TUBB 1VQ8V 3QVNA 5LP6C 2FL4A 3GVMA 2IJHA 1M90W 2ZQMA 4RUFA 5CB4A 4CH5A 1B06A 5CA3A 3MAQA 4DXWA 1DF5A 2A79B 3STZC 1VP7A 1T5EA 5FLXN 2HHHO 1R6TA 1H2SB 3ASOC 3H1JH 5J2TA 3H9VA 4XBFA 4UCOA 1I94B 1EN5A 1GM8A 3W7WA 4X8AA 1GM7A 3OT7A 5EIBD 4YY3B 3N2GB 4BIOA 1NVPB 3B2EE 5H6QA 4FFBA 4FVMA 3ABTA 1RP3B 3E86A 1H38A 3DGEA 1N4CA 4JI3O 4HZ3A 3LDEA 3FD9A 1UFIA 2A0LA 2WLJA 1O9HA 4TSFG 3IC7A 4I55A 1ZTEA 2EINB 4J41A 5EYPA 3ZHSA 1YIJV 4FLYA 3SYOA 1GK9A 2CH7A 3RVZA 1CP9A 3ETEA 4JI8O 3BABA 2PTMA 1P7GA 1CXZB 4DW0A 4NTWA 5LA6B 4BIUA 1PM9A 1HWYA 4L8JA 2WLIB 3ABUA 3K06A 1N36B 4DV7O 4RUEA 2HVJC 4CH3A 2M6YA 3ZCCA 2OTJV 1AP6A 1QR8A 5K1XA 3ZX6A 4JI1O 1NTKH 3QF7A 2VQFB 3QG5A 2R9AA 5CBHA 2HEPA 2CGOA 2KSDA 1FPOA 2Q67A 1R3IC 1SS3A 3E8BA 1TAEA 1JQ0A 4O4IA 4GKKB 3CCJV 4DV2B 1CPYA 2LJ2A 5IYZB 2IJJA 1N0JA 4H37A 2Q68A 3CRRA 3O9OA 4TQDA 2QR4A 1DLBA 1MSDA 4FFKA 3G80A 4DUZB 2UU9B 3RYIA 3CPWU 3SJCC 4UCSA 2BTQA 3RGBA 5LBQA 4UXNA 2FKXA 1YITV 1VQKV 1Y74A 2QKSA 3WFVA 1H2KA 4MTXA 3A0HZ 5LMUB 4JI7B 1NVPD 1N0NA 2EULA 3ETQA 4XDKA 4PHZA 3C3TA 1BQZA 3WB2A 1KECA 2LFRA 4WCEV 1VIBA 2Y69B 4LP8A 4JI6B 4B7EA 2VQEO 2Q4PA 2RQ6A 3N27A 5D5QA 3OMIB 1AR4A 4DV5O 3ZN1A 4LF9B 3QNEA 5CB4B 3CCUV 3NR7A 2QWNB 2MK3A 4NR1A 2KQXA 4F6EA 5LHIA 1KUQA 5J2TB 1EZJA 5EC2C 5B3SB 2G38A 2AXTZ 3BFRA 3UT5A 3CEIA 4I0XA 3K5LA 1BHAA 4FFBB 2LO1A 3CX5F 4KXRA 1FXKC 3EFFK 3G6BA 1AILA 2W0XA 3K9AA 2B5UA 3AG2B 3AG3C 2RNBA 4K3AA 3MD0A 1K97A 4WF9V 1B04A 1QCEA 4I5SA 1ZLZA 1YF2A 4I55B 2YIBD 5IY5C 2YC0A 4B3MB 5EYPB 2QDOA 1WP8A 3JSNA 1VQ7V 2LQTA 2CDYA 2CH7B 4J42A 4JYBA 1K4DC 5D5PA 1PKXA 4ABMA 2E5LB 1RM1C 2R9IA 3PN1A 5H9CA 1MSWD 1F4NA 3CCVV 2VWJA 4HYOA 1I08A 3CYOA 4C7UA 3H1LH 3UM7A 5BR8O 4TT3G 2EIJC 2ZE5A 1W59A 4IYIA 5LOVA 2L6LA 1GN2A 3D3IA 1B6QA 1ROPA 4WBNA 3K5OA 3JD1A 1IBMO 2EJRA 3UQ8A 1H8EG 2E5LO 1K33A 3JSLA 3T2MA 4LF6B 2OIEA 1XHZA 2Q5ZA 3SPIA 4O4IB 3CCQV 2F95B 1FFTB 2QTSA 1BL8A 3ZMZA 5IJ0A 2XASA 5KMGA 1US6A 2YI8A 4DR2O 3DC5A 1EN6A 4JTCB 5LP6A 4WFEA 3SJBC 1AROP 3RYIB 4X62O 3CD6V 2XAHA 4DV1O 4DYLA 2BTQB 2K1EA 4DK1A 1ZSPA 1OCRC 4JYAO 2XOKG 1E1QG 1Y74B 1NKDA 2UXBB 2BOBC 1JCHA 5TISZ 2YIAA 3H1IH 1VF7A 2X6AA 2H8PC 4LH6A 1OCCB 1BZKA 1EBOA 2UUCO 2F43G 5KA5A 1AP5A 1Q6IA 3KZIZ 3LUTB 2VRZA 3ZBHA 5KUKA 2EZOA 3SR2C 1HNZO 1I0HA 4YHHB 1VQMV 1VQ5V 2LFSA 1DTOA 2E74B 4DR6B 3TXQA 3UT5B 3HKEA 3CCRV 1BS3A 1F4MA 4IYHA 3UO3A 1S76D 4I0XB 2IU0A 4CS2A 4DR4O 3O65A 1SQGA 3SJQC 4DR7B 3CMAV 3WG7B 4NYKA 2Z3YA 2Z5UA 3K59A 1BCCH 5LGTA 5H2FZ 2PY5A 4Q20A 5BZBA 1WNSA 3HKBA 5KHIA 4NXNB 2RJZA 1KU9A 2DE0X 1OCOC 5LHHA 4H13B 3L75H 1E1RG 2PI5A 4J7JA 1R73A 1MG1A 2P6JA 2YS8A 1Q81W 4X20A 4QJFB 1LR1A 4GUNA 2CTRA 3ML0A 1F7YA 5B1BC 4PI0A 2DYRB 3T4DA 1FAFA 3AG1B 1P84F 2F1MA 1BQ0A 4QNHB 3MHHC 3N2KA 5LOVB 4WFGA 3FYEB 4WBNB 3ZHUA 4A5UB 4DV4B 1Q90D 3K5NA 1YJNV 1M57C 1QHTA 3LSQA 4DUYB 1I7FA 5JJNB 4GKJO 4QPKA 2AGAA 1R3JC 2NR5A 1G6UA 2QWOB 1VQOV 3RW0A 1JJOA 2QTOA 1NQTA 5IYCO 3BPZA 5IJ0B 1V55B 2H3OA 5KMGB 4X64O 5L3GA 1VEWA 2XNDG 5JQGA 4JV5O 2UXCO 1M4UA 4DUYO 2JVDA 5LP6B 1YDXA 1GMGA 3WB1A 4ZIBA 3VBBA 2A7WA 2JJ2G 2RMKB 4B3SB 2ZM6B 3LDDA 2UUBO 3ASOB 3SYCA 2PI4A 5GTHZ 4FJCC 3FX7A 5LMNO 4HBNA 4ZKIA 3L74H 2E76B 1F23A 5GONA 1P49A 3GWOA 2YUAA 3VQYA 1DF4A 2ILMA 4RAIA 2IJKA 4NTXA 1FXKA 3QO7A 2PZSA 4O2AA 1K5QA 1XNQO 3RYHA 4BIZA 3SYAA 4TV8A 1MA1A 1ENVA 2ITCC 4L87A 2QKCA 3BA8A 4B7KA 2A06H 1Q7YW 1N34B 4DV3O 3TETA 2YIDA 2CE4A 3HKEB 5L3EA 1HR0O 5LA6A 3ZN0A 3RYFA 5KLVH 1I5XA 4IL6Z 5IWAO 1P4RA 4MTOA 2WA4A 5GTIZ 1UJWB 2X6BA 2ZIOA 3SPCA 4OPAA 4RQFA 5AG2A 1N34O 4LF7B 4JYYA 3HKBB 3SPJA 5BMVA 3ABMC 1F51A 1NJIW 2EIKC 2DW4A 1HNWO 5C8YA 3OEHG 4X20B 4YIOA 3B40A 1YVWA 1YTFD 1XMQO 4R50A 2DWDC 4FLXA 1XEQA 2IJIA 3JD0A 1HW7A 3N2KB 5LHGA 1QVFU 3JCUZ 4Q6GA 2LW1A 2HHHB 1YCIA 4FLVA 2DWEC 2GV9A 2WPDG
chains in the Genus database with same CATH topology
4YY3O 2FKXA 2N74A 5LMUO 1IBMO 4JI7O 2E5LO 1FYJA 1YZBA 4LF4O 4NXNO 5IT9N 4LF6O 4LFAO 1XNQO 1D2DA 1X59A 3OTOO 4JI6O 2VQEO 4LF9O 4NXMO 3RT3C 4JI3O 2DOSA 4DV5O 2LW7A 4DV3O 1R1BA 4DR2O 1FJGO 4DV0O 3SDLA 1IBKO 1HR0O 1A32A 4OPHA 1F7YA 1XMOO 4B3TO 3F5TA 3JAMN 1DK1A 1KUQA 5IWAO 4AQYO 3J81N 2ZKOA 4X62O 4JI8O 4DV1O 4X65O 3R66A 4LFCO 3M8AA 4DV4O 4JYAO 2UXBO 4A5UB 3T1HO 4JI2O 1J5EO 2F4VO 1N36O 4JI4O 4OPAA 4LF7O 4K0KO 4GKJO 1N34O 4DV7O 2AGAA 4DR5O 2Z0AA 4DR1O 4X66O 5A2QN 1N33O 2JRIA 1G1XB 1AILA 2UUCO 1XNRO 5LL6Y 1IBLO 2VQFO 1HNWO 4JI1O 4LFBO 4JI5O 4X64O 4LF8O 2DJVA 4B3MO 4JV5O 2UXCO 3T1YO 1FKAO 4DUYO 4YHHO 1HNZO 1XMQO 1NS1A 4GKKO 5H5NA 1XEQA 4DV2O 1N32O 4DR6O 1AB3A 3J80N 4B3SO 2ZM6O 2UXDO 1HNXO 2UUAO 4KHPO 2UUBO 4JI0O 4DR3O 5FLXN 4DV6O 2HHHO 4B3RO 1R6TA 4DR4O 4DUZO 2UU9O 5BXZA 3O65A 5BR8O 5LMNO 4DR7O 5BY1A 3J7AU 1I94O 4OX9O 4LF5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 O;  2FKX A;  2N74 A;  5LMU O;  1IBM O;  4JI7 O;  2E5L O;  1FYJ A;  1YZB A;  4LF4 O;  4NXN O;  5IT9 N;  4LF6 O;  4LFA O;  1XNQ O;  1D2D A;  1X59 A;  3OTO O;  4JI6 O;  2VQE O;  4LF9 O;  4NXM O;  3RT3 C;  4JI3 O;  2DOS A;  4DV5 O;  2LW7 A;  4DV3 O;  1R1B A;  4DR2 O;  1FJG O;  4DV0 O;  3SDL A;  1IBK O;  1HR0 O;  1A32 A;  4OPH A;  1F7Y A;  1XMO O;  4B3T O;  3F5T A;  3JAM N;  1DK1 A;  1KUQ A;  5IWA O;  4AQY O;  3J81 N;  2ZKO A;  4X62 O;  4JI8 O;  4DV1 O;  4X65 O;  3R66 A;  4LFC O;  3M8A A;  4DV4 O;  4JYA O;  2UXB O;  4A5U B;  3T1H O;  4JI2 O;  1J5E O;  2F4V O;  1N36 O;  4JI4 O;  4OPA A;  4LF7 O;  4K0K O;  4GKJ O;  1N34 O;  4DV7 O;  2AGA A;  4DR5 O;  2Z0A A;  4DR1 O;  4X66 O;  5A2Q N;  1N33 O;  2JRI A;  1G1X B;  1AIL A;  2UUC O;  1XNR O;  5LL6 Y;  1IBL O;  2VQF O;  1HNW O;  4JI1 O;  4LFB O;  4JI5 O;  4X64 O;  4LF8 O;  2DJV A;  4B3M O;  4JV5 O;  2UXC O;  3T1Y O;  1FKA O;  4DUY O;  4YHH O;  1HNZ O;  1XMQ O;  1NS1 A;  4GKK O;  5H5N A;  1XEQ A;  4DV2 O;  1N32 O;  4DR6 O;  1AB3 A;  3J80 N;  4B3S O;  2ZM6 O;  2UXD O;  1HNX O;  2UUA O;  4KHP O;  2UUB O;  4JI0 O;  4DR3 O;  5FLX N;  4DV6 O;  2HHH O;  4B3R O;  1R6T A;  4DR4 O;  4DUZ O;  2UU9 O;  5BXZ A;  3O65 A;  5BR8 O;  5LMN O;  4DR7 O;  5BY1 A;  3J7A U;  1I94 O;  4OX9 O;  4LF5 O; 
#chains in the Genus database with same CATH topology
 1M93 A;  3VOU A;  1RFY A;  1LUW A;  1K92 A;  2OCH A;  3ZRW A;  2EZP A;  5JQG B;  4LFA O;  3E8F A;  3KG2 A;  1JR9 A;  4GX5 A;  2QA4 V;  4NXM O;  1WN7 A;  4I9W A;  4JI3 B;  2CTP A;  2ATK C;  1R1B A;  1WB7 A;  2AZ2 A;  2IBZ H;  3B09 A;  4X66 B;  2ZDI C;  1DK1 A;  3J81 N;  2ZKO A;  3CSX A;  3TK1 A;  3R66 A;  1VQ9 V;  4JI8 B;  1VQP V;  4EKW A;  4R7C A;  5GON B;  5EK0 A;  3KKY A;  5A9G A;  2F4V O;  2FTK A;  4QE7 A;  4JPR A;  3AEI A;  1FXK B;  4FM1 A;  4O2A B;  4X66 O;  4DV7 B;  3ZRX A;  1R3K C;  3RYH B;  1TUE B;  3SYP A;  3AG3 B;  4ZHQ A;  2JEX A;  4TV8 B;  3ZMV A;  2Q9L A;  1GTO A;  1NR1 A;  5IY5 B;  4JI1 B;  1SZX A;  1JOY A;  1NH2 B;  4PJ0 Z;  3K79 A;  1D5N A;  2OT5 A;  2ZE6 A;  4OXS A;  3RYF B;  1JPX A;  4CBC A;  3MHS C;  3ZHV A;  1RM1 B;  1RPO A;  4BWA A;  3ZHQ A;  1M56 C;  5EIB C;  4MTF A;  5B5E Z;  4J9Z B;  2QM7 A;  2JS3 A;  2Q6A A;  2Y4U A;  1BT8 A;  2R9R B;  4B3R O;  3JAT A;  5BMV B;  2JGU A;  2QWP B;  3IFX A;  1ZX3 A;  4UVC A;  2QEX V;  3W7T A;  4LF5 O;  1OCZ C;  3ASN B;  2H94 A;  1PP9 H;  1K8A W;  4PA3 A;  1G8M A;  5C8Y B;  1GAX A;  5IT9 N;  2B9Z A;  1AI7 A;  1KP2 A;  1X59 A;  3U10 A;  3ZMU A;  5IJ9 A;  3OM3 B;  3G4S V;  4DW1 A;  3L72 H;  2VQE B;  4GYC B;  1OV9 A;  4DV5 B;  3E8H A;  4FLT A;  5IYD O;  2EX3 A;  4JTA B;  3SDL A;  5GW7 A;  3RN4 A;  3SJA C;  2JEU A;  4NVP A;  3F5T A;  1XNR B;  3H01 A;  1AI4 A;  2Q8V A;  4X65 O;  4LR3 A;  4YIP A;  5L3C A;  1YSC A;  3ZRW B;  1JVM A;  4CC6 A;  5JVD A;  2IW5 A;  4IIJ A;  3BRC A;  5KA6 A;  1N32 B;  2YXH A;  3VQW A;  1AJP A;  3CWB H;  1XQ8 A;  4UB8 Z;  2YXY A;  1XNR O;  2YEV A;  4WFH A;  1Z5V A;  3AK1 A;  2QSA A;  3CRM A;  4D6T H;  3CHX A;  2LGQ A;  4FIP C;  1TA8 A;  4ZOL A;  5J2U A;  1NH2 D;  3KCY A;  3CE2 A;  1Q5O A;  2RCV A;  4B08 A;  5H5N A;  5EBL C;  3VQX A;  3JAS A;  3TGU H;  4NB5 A;  1N32 O;  1IVS A;  1NU1 H;  2UXD O;  1WA8 A;  3CC2 V;  2X7R B;  2N05 A;  2XAJ A;  3W7X A;  2DYS C;  4JF3 A;  4JI0 O;  4DR3 O;  2ITD C;  4OGQ B;  4UB6 Z;  2QM8 A;  2BOC C;  3QO5 A;  1R3L C;  3FB6 C;  3L71 H;  5BR8 B;  3ABL C;  3K58 A;  4ZHQ B;  1Y76 A;  3SPG A;  1MZF A;  1GRJ A;  2DN9 A;  1IBM B;  1OCO B;  1YZB A;  4UUJ C;  3K04 A;  3AG4 C;  4IHJ A;  1QLN A;  3E2E A;  1H8H G;  1QNM A;  5KAF Z;  2GUZ A;  2MW2 B;  3CP1 A;  2ZIM A;  2LW7 A;  1EN4 A;  4X1I A;  3UO2 A;  2FYU H;  2JJ1 G;  5B1B B;  4DR2 B;  1IXB A;  2CTQ A;  1U96 A;  4PEL A;  1XMO O;  3JAT B;  1AI5 A;  2ADQ B;  2HP8 A;  3CCS V;  4G2K A;  4PDL A;  3E35 A;  4PDM A;  5E1A C;  4X62 B;  4KP4 A;  4DV1 B;  1WJZ A;  1M57 B;  5EZY A;  3ZMT A;  3T1H O;  4JYA B;  1S5L Z;  4MVQ A;  3ZHT A;  3CCL V;  5DM6 V;  2BTO A;  3M99 B;  3U0Z A;  3EVK A;  4UVB A;  5IJ9 B;  5LL6 Y;  2UUC B;  1NZ6 A;  4KHP B;  4MVZ A;  2HLD G;  1MMM A;  1SKV A;  2K9P A;  2DJV A;  5LXT A;  1XL6 A;  4MVR A;  3CS5 A;  1HNZ B;  1V9P A;  4R6Z A;  2HFE C;  3CB2 A;  1SZT A;  3X2Q C;  1QR9 A;  3FKS G;  2UXN A;  1HNX O;  2ZDI A;  4KHP O;  4LH7 A;  4MT8 A;  1KKC A;  2Y0P A;  3F7V C;  5JVD B;  4GX0 A;  3G67 A;  3OTO B;  1VQL V;  3FAV A;  4IIJ B;  1K9M W;  2EBO A;  4DR4 B;  3MDS A;  4ZBM A;  2XT9 A;  2YEV B;  1P7B A;  4ZOL B;  5J2U B;  4MVU A;  1CEZ A;  2QJ1 A;  1WAZ A;  1Q6H A;  5JJJ B;  3JAW A;  3OTO O;  3JAS B;  1BGY H;  2DOS A;  1TVK A;  1Q43 A;  2IU3 A;  1E79 G;  3RFR A;  2GHY A;  1AR5 A;  2Q7G A;  3OUS A;  1WA8 B;  5CA1 A;  3BAA A;  5KX5 A;  4DR5 B;  2ZR2 A;  3T4Z A;  1YHQ V;  3L9D A;  1PV0 A;  4YJ3 A;  3OGI B;  4HAM A;  4LWS A;  1Y76 B;  3M8A A;  2D2C B;  1GM9 A;  1JA8 A;  3ABM B;  1R6N A;  1JMK C;  5F2V O;  2PF4 E;  2EIK B;  1WB8 A;  4GKJ B;  4X1Y A;  3OW2 U;  5EBM C;  4DR5 O;  1EFR G;  2F23 A;  2WLL A;  4JZ2 A;  4W4K A;  1ZL8 A;  4I4T A;  2M7W A;  4IHJ B;  2V1D A;  5K1P A;  1G1X B;  4P2Z A;  1IBL O;  2GUZ B;  4UCR A;  1WPX A;  4U7O A;  4KFM A;  4LCU C;  4P9P A;  4X1I B;  3ZS8 C;  4JI5 O;  4HNA A;  4X64 B;  3RWR D;  2XAF A;  2NNU A;  3ZHR A;  5C93 A;  3T1Y O;  4JV5 B;  2UXC B;  4JGS A;  2WLH A;  5J9P C;  4QE9 A;  3JAR A;  1H2G A;  1SQB H;  2CTW A;  3GB7 C;  4PDV A;  5FNV A;  3J80 N;  2EIM C;  3P30 A;  3STL C;  2ZXW C;  5EZY B;  3APQ A;  3THO A;  4J10 A;  4LF4 B;  2X0L A;  3E83 A;  1PNL A;  4X89 A;  2UUB B;  1KKD A;  1GN4 A;  3G71 V;  1ORQ C;  2ZD9 A;  1W0K G;  3BA9 A;  5LMN B;  4OX9 O;  1QLE C;  1MZE A;  2JS5 A;  2HJD A;  1COW G;  2BCC H;  3DC6 A;  3TXS A;  4UV9 A;  2HG5 C;  3CC7 V;  1LNQ A;  3E89 A;  4J9Y B;  4LF4 O;  2YSU B;  3I5D A;  1JFF A;  5LXT B;  3ZMS A;  3ZRS A;  1XNQ B;  1D2D A;  3UKM A;  1XL4 A;  1KP3 A;  4FLU A;  4PA9 A;  1V54 C;  2Q69 A;  3Q4H A;  1H2L A;  2GTA A;  1ZAU A;  3OR7 C;  5CA0 A;  3ABK C;  1FJG O;  4DV3 B;  4TV9 A;  3HKC A;  1N33 B;  1HR0 B;  3FAV B;  1K4C C;  2WAM A;  5JWP A;  4AI8 A;  3TJT A;  5IWA B;  1PD3 A;  3U11 A;  4LFC O;  5IYB O;  1BE3 H;  4JI2 O;  4FM0 A;  1J5E O;  4JAS A;  1GO3 F;  1NTZ H;  1SET A;  3JD2 A;  3CC4 V;  5ITZ A;  4DR1 O;  4MVS A;  1EM1 A;  5B1A C;  1N33 O;  5DED A;  3JAW B;  2BSK A;  4MS2 A;  4CS3 A;  4E2L A;  4AHC A;  1SER A;  1FXH A;  1TVK B;  3K08 A;  2F66 C;  1HNW B;  3RVY A;  4I50 A;  3I55 V;  4FMT A;  1Y66 A;  5H6R A;  3CRC A;  5CA1 B;  3OUF A;  5KX5 B;  5HFM A;  1VQN V;  1S5H C;  4GX1 A;  2OYQ A;  1KBH A;  1AJN A;  3DTU B;  2FML A;  2IH1 C;  3BY6 A;  1XMQ B;  1M56 B;  5JCO C;  4YJ3 B;  4BR6 A;  4LNU A;  4LWS B;  3F5W C;  2UUA O;  1IUR A;  1SA0 A;  3JAK A;  4DV6 O;  1K34 A;  3ZED A;  2ZCE A;  2ZE7 A;  4X1Y B;  1XI1 A;  2YDE A;  4BW9 A;  2WLL B;  1ZL8 B;  1OCZ B;  4I4T B;  3J7A U;  2LP7 A;  2IM9 A;  2GBO A;  3E8G A;  3W7U A;  4DV0 B;  4O4L A;  1UPG A;  2GSM B;  3OEE G;  3TCU A;  2V4D A;  1Q6U A;  1VF6 C;  2OTL V;  4HNA B;  5JH7 A;  5FPR A;  4UCT A;  1L0N H;  2PUS A;  4LFA B;  4Z1M G;  1K3E A;  1XHX A;  4JZG A;  3JAR B;  3AG7 A;  3VQV A;  4D7T A;  1X4T A;  1SQX H;  1Q3E A;  4NXM B;  1THZ A;  5FNV B;  2ZNJ A;  4E4E A;  2YXL A;  2KB1 A;  4X88 A;  2O57 A;  2WA3 A;  3HPL C;  4DV0 O;  1IBK O;  3LSS A;  1W0J G;  4XDL A;  4IT5 A;  3E22 A;  4XDJ A;  1H2M A;  4LFB B;  1V55 C;  1NTM H;  2JIZ G;  1VAR A;  4JI4 O;  5LYJ A;  4AIL C;  2F4V B;  3B8N A;  2Z0A A;  4I7Z B;  1JFF B;  4D7S A;  3P3N A;  4PI2 A;  3FB8 C;  3G6E V;  4MVO A;  2W6J G;  3A8T A;  3Q4H B;  3C3S A;  4Z1V A;  2Y48 A;  1SQQ H;  2UXX A;  4LFB O;  1ZUQ A;  4PV1 B;  2OCC C;  5CA0 B;  1O9G A;  4JAU A;  1Z2G A;  4TV9 B;  3HKC B;  1Y67 A;  4PDR A;  2CK3 G;  4FLZ A;  2QWR B;  2WLK A;  3A0R A;  4DRX A;  2DYS B;  1L0L H;  2QGN A;  2Q7H A;  4UV8 A;  4MW8 A;  3CXH F;  4CC5 A;  2B1G A;  1SC5 B;  2B1I A;  3ABL B;  4U3F H;  4B3R B;  5ITZ B;  5IDJ A;  1QVG U;  5BY1 A;  1I94 O;  4W4L A;  1YJ9 V;  2FB5 A;  2BSK B;  3D3Q A;  1QU7 A;  1K73 W;  3UCS C;  4YXW G;  4YY3 O;  2KG7 A;  3BCC H;  4LF5 B;  5L3B A;  4I50 B;  4DK0 A;  1FYJ A;  2L35 A;  3AG4 B;  2XAQ A;  4KUM A;  4TOI A;  4AQY B;  3R65 A;  5HFL A;  4X1K A;  2R72 A;  2QKA A;  2EIJ B;  1HDJ A;  4GX2 A;  3OGC C;  1GH6 A;  4LNU B;  3CCE V;  2ZIN A;  2D3O W;  4K0K B;  4EFB A;  3K9S A;  2WWW A;  2WLN A;  4GLX A;  4CH6 A;  3WU2 Z;  1SA0 B;  3JAK B;  3ZJZ A;  4JAV A;  3OTF A;  3JAL A;  4AQY O;  1GN6 A;  1S5J A;  4JYC A;  1XUQ A;  4X65 B;  5E79 Z;  2EIL C;  3LNM B;  3D36 C;  4O4L B;  1SQV H;  3FYI B;  5KHG A;  1N36 O;  4K0K O;  2Y0I A;  3JYC A;  5JH7 B;  1Y6X A;  3FB7 C;  2JRI A;  4Z2W A;  4PA7 A;  3KCX A;  2Q73 A;  2VQF O;  4RWU A;  5L3F A;  1IZ3 A;  1OCR B;  3RYC A;  3JCZ A;  1YI2 V;  1FKA O;  3DSQ A;  4JTD B;  2YIC A;  3K57 A;  1L8D A;  4GKK O;  2Q0O C;  3X2Q B;  3BHP A;  1KMI Z;  2ETN A;  2JK5 C;  4DV2 O;  3IC9 A;  3E22 B;  1AB3 A;  1KQS U;  3BEH A;  4MVM A;  4EB6 A;  4U3J A;  4O2B A;  2UXD B;  4FPP A;  2RDC A;  4RO2 A;  2HR3 A;  2XUM A;  5FL7 G;  2BE3 A;  5LYJ B;  4JI0 B;  4DR3 B;  1YEW A;  4DUZ O;  2UU9 O;  4X9Q A;  4PA4 A;  4ZI7 A;  1Q86 W;  1MAB G;  3ZRV A;  1QBZ A;  1NT2 B;  3M7M X;  2N74 A;  5LMU O;  5LGN A;  4JI7 O;  2XHB A;  5KAI Z;  1XBL A;  5CMU A;  4FK5 C;  3D8C A;  3OAA G;  3CJH A;  3S3X A;  4QPJ A;  4R8C A;  3IJ4 A;  4JI6 O;  1D5A A;  2WLM A;  4LF9 O;  1NI8 A;  1PL0 A;  2AHZ A;  2W0F C;  4I9Q A;  4DRX B;  1BMF G;  1R6K A;  1J95 A;  5B1O A;  2JGD A;  5JCO A;  2EIN C;  5JJE B;  3JAM N;  1XMO B;  4CS4 A;  3IAY A;  3CXC U;  2VS0 A;  2NLJ C;  2C2A A;  2F93 B;  3HR0 A;  2KG7 B;  3B8M A;  1S0V A;  4MTG A;  4GCZ A;  3ETD A;  4QGP A;  4UCU A;  1PL4 A;  3T1H B;  2DQ3 A;  1GKF A;  1YJW V;  3HKD A;  3K0D A;  2N04 A;  5A2Q N;  4X1K B;  2VWK A;  3SYQ A;  1L1F A;  2P90 A;  1VF6 A;  3K0G A;  1IX9 A;  1FD9 A;  1NBM G;  3A2F A;  1RSO A;  4F4L A;  3OMN B;  4O4J A;  4B3M O;  5B66 Z;  3DXR A;  3LSU A;  2HKO A;  2EIM B;  3JAL B;  4K8Z A;  3ICX A;  2ZXW B;  3ASN C;  2P4V A;  1HNX B;  5CBF A;  4FM2 A;  4P9O A;  2A3Q A;  3JD3 A;  2ZE8 A;  3K5M A;  1FXV A;  1QLE B;  2DMX A;  2CUG A;  4MW3 A;  4QIW F;  3S3W A;  3PJS K;  2KKW A;  2YI9 A;  4PD4 F;  3EHB B;  5CBG A;  3SPH A;  3RYC B;  4B3T B;  2RN9 A;  1MOF A;  4TWK A;  4LF6 O;  2ZR3 A;  2AZ0 A;  2R70 A;  3F7Y C;  3GWK C;  1V54 B;  4J80 A;  2DQ0 A;  4ASU G;  4EFE A;  2Y69 C;  4MSW C;  1VQ4 V;  3NXS A;  2Q7E A;  1SES A;  3ABK B;  2CGN A;  3ETG A;  4EB6 B;  4U3J B;  5KHJ A;  4O2B B;  1XRE A;  1K7D A;  3FFQ A;  1Y4M A;  4B3T O;  3BVO A;  1K5S A;  3ZIA G;  5KHH A;  2PYL A;  4JAA A;  4ZI7 B;  4TUY A;  1LUV A;  5L3D A;  1WLE A;  2P22 C;  2UXB O;  2A9H A;  3I56 V;  5B3S C;  1M5I A;  5B1A B;  5FPO A;  1N8R W;  3C90 A;  5KHK A;  4LC1 A;  3CJH B;  1S3J A;  4J11 A;  1JX9 A;  1IBL B;  4H0L B;  1XOU A;  4CZZ A;  1Q8I A;  1SF9 A;  3AG2 C;  2E75 B;  4JI5 B;  4WFF A;  2AHY A;  2ZNI A;  2JGD B;  4YHH O;  1KYO F;  4K35 A;  3T1Y B;  4P30 A;  3AK2 A;  1PNM A;  2P5O A;  1OZ0 A;  4N21 A;  4FZ0 A;  4DR6 O;  1VQ6 V;  3H1H H;  3LDC A;  2IH3 C;  2NN4 A;  2P06 A;  3JD4 A;  2E3C A;  4K8X A;  1GN3 A;  3HKD B;  3P32 A;  1B3Q A;  5BXZ A;  3OMA B;  4YJ2 A;  4FZ1 A;  4DR7 O;  3D36 A;  2ARH A;  4NTY A;  4OX9 B;  2P67 A;  1SRY A;  1WPB A;  3QO8 A;  1SQF A;  4UCV A;  1RSO B;  5KUM A;  4NXN O;  4O4J B;  1WP7 A;  3DXR B;  1SQP H;  1Z5W A;  1DGS A;  5DN6 G;  4BAY A;  2Q0A A;  3AK3 A;  1G4Y B;  3RT3 C;  3B4S A;  3W7S A;  1MNG A;  3OR6 C;  4O4H A;  3P3P A;  1U97 A;  3CRQ A;  4H33 A;  2QM4 A;  1FJG B;  4F6R A;  1KD1 W;  4TQF A;  1JJ2 U;  3T1C A;  4DO2 A;  4WFB V;  2V7Q G;  1FFX A;  1TUB A;  3FB5 C;  2CAZ C;  3CRA A;  1AI6 A;  2WSS G;  4LFC B;  4DV4 O;  1M1K W;  4GZR B;  4LF8 B;  1AVM A;  3QTC A;  2Y4T A;  1YTF B;  4JI2 B;  1J5E B;  4WFA V;  3B77 A;  1EZV H;  3CME V;  4DR1 B;  4G28 B;  3APO A;  2LGW A;  3K03 A;  2HJF C;  1S72 V;  1OCC C;  2OCC B;  4GT1 A;  4J7K A;  3N2G A;  2GTS A;  3LNN A;  4LF8 O;  1URF A;  2X6C A;  2XAG A;  3OFN G;  1AJQ A;  1NS1 A;  4PA6 A;  2PGG A;  1QQC A;  1FS0 G;  5IE9 A;  4RQE A;  3RBZ A;  4TUY B;  1KC8 W;  4B3S O;  3EXA A;  2ZM6 O;  2W6I G;  4NKG B;  2UUA B;  4DV6 B;  1PNK A;  1M9N A;  2ADP A;  1VMG A;  3IGA C;  5DEC A;  2HVK C;  4UFZ A;  3WG7 C;  1TGO A;  1YXB A;  2QE7 G;  1OJH A;  1XIL A;  3SGI A;  2WLI A;  2OIG A;  3WB0 A;  1RPR A;  4CH4 A;  3H1K H;  1Q82 W;  4ICG A;  3L73 H;  1AR1 B;  4EEQ A;  1HP8 A;  2JDI G;  3L70 H;  4FLW A;  2QWQ B;  1H2N A;  1W2B U;  2ZT9 B;  4IGG A;  3OE7 G;  5B1N A;  2YIB A;  2OWO A;  1A32 A;  4OPH A;  1IBK B;  3CCM V;  4YJ2 B;  1IXM A;  1XDC A;  2EIL B;  4KL1 A;  4U7N A;  2DYR C;  5EC1 C;  1KB9 F;  3OD4 A;  5EBW C;  5IYZ A;  3AG1 C;  2P7T C;  2P4K A;  4H44 B;  4J7Z A;  1I5Y A;  4N23 A;  5CN0 A;  1IDS A;  1OHH G;  2ODM A;  4LF7 O;  5LGU A;  4UVA A;  4JI4 B;  2AW9 A;  4BW5 A;  2EJ7 A;  4G27 B;  3HB3 B;  3K3W A;  4LBE C;  1VF5 B;  4O4H B;  3A0B Z;  2PYJ A;  2GDS A;  1NR7 A;  1ZWI C;  4F6R B;  1S77 D;  1BHB A;  1PPJ H;  2XTA A;  1FFX B;  1BSM A;  1TUB B;  1VQ8 V;  3QVN A;  5LP6 C;  2FL4 A;  3GVM A;  2IJH A;  1M90 W;  2ZQM A;  4RUF A;  5CB4 A;  4CH5 A;  1B06 A;  5CA3 A;  3MAQ A;  4DXW A;  1DF5 A;  2A79 B;  3STZ C;  1VP7 A;  1T5E A;  5FLX N;  2HHH O;  1R6T A;  1H2S B;  3ASO C;  3H1J H;  5J2T A;  3H9V A;  4XBF A;  4UCO A;  1I94 B;  1EN5 A;  1GM8 A;  3W7W A;  4X8A A;  1GM7 A;  3OT7 A;  5EIB D;  4YY3 B;  3N2G B;  4BIO A;  1NVP B;  3B2E E;  5H6Q A;  4FFB A;  4FVM A;  3ABT A;  1RP3 B;  3E86 A;  1H38 A;  3DGE A;  1N4C A;  4JI3 O;  4HZ3 A;  3LDE A;  3FD9 A;  1UFI A;  2A0L A;  2WLJ A;  1O9H A;  4TSF G;  3IC7 A;  4I55 A;  1ZTE A;  2EIN B;  4J41 A;  5EYP A;  3ZHS A;  1YIJ V;  4FLY A;  3SYO A;  1GK9 A;  2CH7 A;  3RVZ A;  1CP9 A;  3ETE A;  4JI8 O;  3BAB A;  2PTM A;  1P7G A;  1CXZ B;  4DW0 A;  4NTW A;  5LA6 B;  4BIU A;  1PM9 A;  1HWY A;  4L8J A;  2WLI B;  3ABU A;  3K06 A;  1N36 B;  4DV7 O;  4RUE A;  2HVJ C;  4CH3 A;  2M6Y A;  3ZCC A;  2OTJ V;  1AP6 A;  1QR8 A;  5K1X A;  3ZX6 A;  4JI1 O;  1NTK H;  3QF7 A;  2VQF B;  3QG5 A;  2R9A A;  5CBH A;  2HEP A;  2CGO A;  2KSD A;  1FPO A;  2Q67 A;  1R3I C;  1SS3 A;  3E8B A;  1TAE A;  1JQ0 A;  4O4I A;  4GKK B;  3CCJ V;  4DV2 B;  1CPY A;  2LJ2 A;  5IYZ B;  2IJJ A;  1N0J A;  4H37 A;  2Q68 A;  3CRR A;  3O9O A;  4TQD A;  2QR4 A;  1DLB A;  1MSD A;  4FFK A;  3G80 A;  4DUZ B;  2UU9 B;  3RYI A;  3CPW U;  3SJC C;  4UCS A;  2BTQ A;  3RGB A;  5LBQ A;  4UXN A;  2FKX A;  1YIT V;  1VQK V;  1Y74 A;  2QKS A;  3WFV A;  1H2K A;  4MTX A;  3A0H Z;  5LMU B;  4JI7 B;  1NVP D;  1N0N A;  2EUL A;  3ETQ A;  4XDK A;  4PHZ A;  3C3T A;  1BQZ A;  3WB2 A;  1KEC A;  2LFR A;  4WCE V;  1VIB A;  2Y69 B;  4LP8 A;  4JI6 B;  4B7E A;  2VQE O;  2Q4P A;  2RQ6 A;  3N27 A;  5D5Q A;  3OMI B;  1AR4 A;  4DV5 O;  3ZN1 A;  4LF9 B;  3QNE A;  5CB4 B;  3CCU V;  3NR7 A;  2QWN B;  2MK3 A;  4NR1 A;  2KQX A;  4F6E A;  5LHI A;  1KUQ A;  5J2T B;  1EZJ A;  5EC2 C;  5B3S B;  2G38 A;  2AXT Z;  3BFR A;  3UT5 A;  3CEI A;  4I0X A;  3K5L A;  1BHA A;  4FFB B;  2LO1 A;  3CX5 F;  4KXR A;  1FXK C;  3EFF K;  3G6B A;  1AIL A;  2W0X A;  3K9A A;  2B5U A;  3AG2 B;  3AG3 C;  2RNB A;  4K3A A;  3MD0 A;  1K97 A;  4WF9 V;  1B04 A;  1QCE A;  4I5S A;  1ZLZ A;  1YF2 A;  4I55 B;  2YIB D;  5IY5 C;  2YC0 A;  4B3M B;  5EYP B;  2QDO A;  1WP8 A;  3JSN A;  1VQ7 V;  2LQT A;  2CDY A;  2CH7 B;  4J42 A;  4JYB A;  1K4D C;  5D5P A;  1PKX A;  4ABM A;  2E5L B;  1RM1 C;  2R9I A;  3PN1 A;  5H9C A;  1MSW D;  1F4N A;  3CCV V;  2VWJ A;  4HYO A;  1I08 A;  3CYO A;  4C7U A;  3H1L H;  3UM7 A;  5BR8 O;  4TT3 G;  2EIJ C;  2ZE5 A;  1W59 A;  4IYI A;  5LOV A;  2L6L A;  1GN2 A;  3D3I A;  1B6Q A;  1ROP A;  4WBN A;  3K5O A;  3JD1 A;  1IBM O;  2EJR A;  3UQ8 A;  1H8E G;  2E5L O;  1K33 A;  3JSL A;  3T2M A;  4LF6 B;  2OIE A;  1XHZ A;  2Q5Z A;  3SPI A;  4O4I B;  3CCQ V;  2F95 B;  1FFT B;  2QTS A;  1BL8 A;  3ZMZ A;  5IJ0 A;  2XAS A;  5KMG A;  1US6 A;  2YI8 A;  4DR2 O;  3DC5 A;  1EN6 A;  4JTC B;  5LP6 A;  4WFE A;  3SJB C;  1ARO P;  3RYI B;  4X62 O;  3CD6 V;  2XAH A;  4DV1 O;  4DYL A;  2BTQ B;  2K1E A;  4DK1 A;  1ZSP A;  1OCR C;  4JYA O;  2XOK G;  1E1Q G;  1Y74 B;  1NKD A;  2UXB B;  2BOB C;  1JCH A;  5TIS Z;  2YIA A;  3H1I H;  1VF7 A;  2X6A A;  2H8P C;  4LH6 A;  1OCC B;  1BZK A;  1EBO A;  2UUC O;  2F43 G;  5KA5 A;  1AP5 A;  1Q6I A;  3KZI Z;  3LUT B;  2VRZ A;  3ZBH A;  5KUK A;  2EZO A;  3SR2 C;  1HNZ O;  1I0H A;  4YHH B;  1VQM V;  1VQ5 V;  2LFS A;  1DTO A;  2E74 B;  4DR6 B;  3TXQ A;  3UT5 B;  3HKE A;  3CCR V;  1BS3 A;  1F4M A;  4IYH A;  3UO3 A;  1S76 D;  4I0X B;  2IU0 A;  4CS2 A;  4DR4 O;  3O65 A;  1SQG A;  3SJQ C;  4DR7 B;  3CMA V;  3WG7 B;  4NYK A;  2Z3Y A;  2Z5U A;  3K59 A;  1BCC H;  5LGT A;  5H2F Z;  2PY5 A;  4Q20 A;  5BZB A;  1WNS A;  3HKB A;  5KHI A;  4NXN B;  2RJZ A;  1KU9 A;  2DE0 X;  1OCO C;  5LHH A;  4H13 B;  3L75 H;  1E1R G;  2PI5 A;  4J7J A;  1R73 A;  1MG1 A;  2P6J A;  2YS8 A;  1Q81 W;  4X20 A;  4QJF B;  1LR1 A;  4GUN A;  2CTR A;  3ML0 A;  1F7Y A;  5B1B C;  4PI0 A;  2DYR B;  3T4D A;  1FAF A;  3AG1 B;  1P84 F;  2F1M A;  1BQ0 A;  4QNH B;  3MHH C;  3N2K A;  5LOV B;  4WFG A;  3FYE B;  4WBN B;  3ZHU A;  4A5U B;  4DV4 B;  1Q90 D;  3K5N A;  1YJN V;  1M57 C;  1QHT A;  3LSQ A;  4DUY B;  1I7F A;  5JJN B;  4GKJ O;  4QPK A;  2AGA A;  1R3J C;  2NR5 A;  1G6U A;  2QWO B;  1VQO V;  3RW0 A;  1JJO A;  2QTO A;  1NQT A;  5IYC O;  3BPZ A;  5IJ0 B;  1V55 B;  2H3O A;  5KMG B;  4X64 O;  5L3G A;  1VEW A;  2XND G;  5JQG A;  4JV5 O;  2UXC O;  1M4U A;  4DUY O;  2JVD A;  5LP6 B;  1YDX A;  1GMG A;  3WB1 A;  4ZIB A;  3VBB A;  2A7W A;  2JJ2 G;  2RMK B;  4B3S B;  2ZM6 B;  3LDD A;  2UUB O;  3ASO B;  3SYC A;  2PI4 A;  5GTH Z;  4FJC C;  3FX7 A;  5LMN O;  4HBN A;  4ZKI A;  3L74 H;  2E76 B;  1F23 A;  5GON A;  1P49 A;  3GWO A;  2YUA A;  3VQY A;  1DF4 A;  2ILM A;  4RAI A;  2IJK A;  4NTX A;  1FXK A;  3QO7 A;  2PZS A;  4O2A A;  1K5Q A;  1XNQ O;  3RYH A;  4BIZ A;  3SYA A;  4TV8 A;  1MA1 A;  1ENV A;  2ITC C;  4L87 A;  2QKC A;  3BA8 A;  4B7K A;  2A06 H;  1Q7Y W;  1N34 B;  4DV3 O;  3TET A;  2YID A;  2CE4 A;  3HKE B;  5L3E A;  1HR0 O;  5LA6 A;  3ZN0 A;  3RYF A;  5KLV H;  1I5X A;  4IL6 Z;  5IWA O;  1P4R A;  4MTO A;  2WA4 A;  5GTI Z;  1UJW B;  2X6B A;  2ZIO A;  3SPC A;  4OPA A;  4RQF A;  5AG2 A;  1N34 O;  4LF7 B;  4JYY A;  3HKB B;  3SPJ A;  5BMV A;  3ABM C;  1F51 A;  1NJI W;  2EIK C;  2DW4 A;  1HNW O;  5C8Y A;  3OEH G;  4X20 B;  4YIO A;  3B40 A;  1YVW A;  1YTF D;  1XMQ O;  4R50 A;  2DWD C;  4FLX A;  1XEQ A;  2IJI A;  3JD0 A;  1HW7 A;  3N2K B;  5LHG A;  1QVF U;  3JCU Z;  4Q6G A;  2LW1 A;  2HHH B;  1YCI A;  4FLV A;  2DWE C;  2GV9 A;  2WPD G; 
#chains in the Genus database with same CATH homology
 4YY3 O;  2FKX A;  2N74 A;  5LMU O;  1IBM O;  4JI7 O;  2E5L O;  1FYJ A;  1YZB A;  4LF4 O;  4NXN O;  5IT9 N;  4LF6 O;  4LFA O;  1XNQ O;  1D2D A;  1X59 A;  3OTO O;  4JI6 O;  2VQE O;  4LF9 O;  4NXM O;  3RT3 C;  4JI3 O;  2DOS A;  4DV5 O;  2LW7 A;  4DV3 O;  1R1B A;  4DR2 O;  1FJG O;  4DV0 O;  3SDL A;  1IBK O;  1HR0 O;  1A32 A;  4OPH A;  1F7Y A;  1XMO O;  4B3T O;  3F5T A;  3JAM N;  1DK1 A;  1KUQ A;  5IWA O;  4AQY O;  3J81 N;  2ZKO A;  4X62 O;  4JI8 O;  4DV1 O;  4X65 O;  3R66 A;  4LFC O;  3M8A A;  4DV4 O;  4JYA O;  2UXB O;  4A5U B;  3T1H O;  4JI2 O;  1J5E O;  2F4V O;  1N36 O;  4JI4 O;  4OPA A;  4LF7 O;  4K0K O;  4GKJ O;  1N34 O;  4DV7 O;  2AGA A;  4DR5 O;  2Z0A A;  4DR1 O;  4X66 O;  5A2Q N;  1N33 O;  2JRI A;  1G1X B;  1AIL A;  2UUC O;  1XNR O;  5LL6 Y;  1IBL O;  2VQF O;  1HNW O;  4JI1 O;  4LFB O;  4JI5 O;  4X64 O;  4LF8 O;  2DJV A;  4B3M O;  4JV5 O;  2UXC O;  3T1Y O;  1FKA O;  4DUY O;  4YHH O;  1HNZ O;  1XMQ O;  1NS1 A;  4GKK O;  5H5N A;  1XEQ A;  4DV2 O;  1N32 O;  4DR6 O;  1AB3 A;  3J80 N;  4B3S O;  2ZM6 O;  2UXD O;  1HNX O;  2UUA O;  4KHP O;  2UUB O;  4JI0 O;  4DR3 O;  5FLX N;  4DV6 O;  2HHH O;  4B3R O;  1R6T A;  4DR4 O;  4DUZ O;  2UU9 O;  5BXZ A;  3O65 A;  5BR8 O;  5LMN O;  4DR7 O;  5BY1 A;  3J7A U;  1I94 O;  4OX9 O;  4LF5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...