4FZ1A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high ph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
410
structure length
406
Chain Sequence
b'SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 94
structure length 406
sequence length 410
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz1A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz1A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz1A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz1A02
4NTXA 1WP8A 2L35A 4FZ1A 4FZ0A 4NTYA 3S3XA 3IJ4A 4NYKA 2QTSA 3S3WA 3N27A 2FB5A 1WP7A 4NTWA
chains in the Genus database with same CATH superfamily
4L8JA 1NJIW 4J80A 2F43G 4PA6A 4UXNA 3L70H 4ZI7B 4Z2WA 2XAQA 2MK3A 2OTLV 3P30A 2HP8A 1H2MA 4X8AA 1NQTA 4MVUA 3RW0A 1QQCA 3F7YC 5BMVB 2OYQA 2BOBC 1VP7A 4X20A 4HZ3A 3BVOA 3H1HH 2PGGA 2BTQA 2HJFC 3UT5B 1QCEA 3CP1A 1US6A 5EZYA 1W59A 3SYAA 1LR1A 5IE9A 1K5SA 3SDLA 2JIZG 1V54B 4DR3B 1R3JC 4DV3B 2Q69A 1IXMA 1BGYH 2EIMC 5GTHZ 1S5HC 4E4EA 1K92A 2IH1C 1JFFB 3S3WA 5EBMC 4A5UB 3HKCB 4G28B 2EBOA 5H5NA 2K1EA 1YJ9V 3QG5A 1F7YA 1Z2GA 2VRZA 4BIOA 3O9OA 3ZCCA 2Q7GA 1M56B 2WLIA 4RQEA 2NR5A 3ZHVA 4JZ2A 3D36A 4DR7O 3K03A 2AZ0A 1QLEB 5AG2A 1ZTEA 5JCOA 2A9HA 1P7BA 1K97A 3K59A 1Q6IA 1KD1W 4I4TB 1VQ8V 5EC1C 3JARB 5LMNB 2QM4A 1BS3A 3M99B 2HLDG 4QE9A 3HKEA 3HKBB 4GX5A 5LGNA 1PPJH 4YJ2B 2EILB 3BCCH 2DYSB 2PUSA 2ZXWB 3Q4HB 4UV8A 2YIAA 1K7DA 3ZRSA 3CRAA 3AG1B 3ZMTA 2OCCB 4LF8O 5FNVA 1Q5OA 2AXTZ 2Y48A 5LBQA 4WBNB 4F6RB 4NVPA 4IL6Z 1NVPB 4BW9A 5KUMA 4TUYB 4I50B 4FLZA 3P3PA 2VQEO 1KECA 1MG1A 4JYAB 1K3EA 1V55C 2RN9A 2B1GA 4QJFB 4X9QA 4X64O 3RYCB 3ZMZA 1TVKB 3J80N 2UUBO 5EYPA 3VQWA 2ZDIC 1NU1H 1R1BA 5GONA 3WFVA 5IYZA 5CBFA 4JI8O 2Q8VA 5IYCO 1OCRB 1L8DA 4WFAV 1SERA 2HHHO 3E8HA 1Y4MA 1VIBA 5B1NA 4UCUA 4GZRB 3SGIA 1RPRA 4L87A 1WA8A 2FB5A 3CRRA 2FL4A 4PDVA 1Q90D 2WA4A 3OAAG 1YI2V 1I7FA 1RSOA 1FPOA 2HVJC 2P06A 4B3MO 2E3CA 3AG3C 3A0BZ 4CS4A 1K73W 1BQZA 5EC2C 1NH2D 2P90A 2VWKA 5DEDA 2WA3A 3OUFA 2QJ1A 4RUEA 4FZ1A 3VBBA 3SPJA 3JALB 2FYUH 4FLVA 1YJNV 3WU2Z 4UB8Z 4JI1O 3SYQA 1M93A 3WB1A 3OR7C 4LF9O 5LXTA 2RMKB 2Y0PA 1NTZH 2P67A 5C8YB 1XREA 2F4VO 3KCXA 1VF6A 4NXNB 1HNWB 2X6BA 2UUCB 2KB1A 4UCSA 2KKWA 2ZD9A 5DN6G 4X66O 5JH7B 1EFRG 4YIOA 3ZBHA 2WAMA 3SR2C 4R8CA 3STZC 1N36B 1IBLB 3OGCC 1VF7A 1SQQH 2O57A 3M7MX 1AI6A 3E83A 3FAVB 1TAEA 5CA1B 2ZKOA 1DGSA 2HEPA 1T5EA 1AJQA 4KHPO 4DR1O 3UKMA 5LGTA 2QSAA 3BEHA 5B66Z 3K0DA 2ETNA 4K35A 3K79A 5H2FZ 4FFBA 1R3IC 2QDOA 3G4SV 3DXRB 3CCSV 4ZOLB 1KP2A 1VQ5V 4J42A 2IJHA 2YXYA 5FL7G 3CMAV 2RJZA 4I5SA 1GM7A 4WFGA 2P7TC 4ABMA 4EFEA 1K4CC 5JWPA 2IM9A 2UXDO 3ZX6A 1I94O 2PI4A 1Y6XA 3BHPA 4O4IB 1N8RW 3U11A 2RQ6A 4XDJA 2ZCEA 2BOCC 1XILA 1XMOB 3RYHA 2VS0A 4HNAB 5H6QA 5EK0A 4JTAB 2HR3A 2HVKC 4Z1MG 2H3OA 1YVWA 4WFHA 4JASA 5B1OA 1Q82W 4I9WA 4BR6A 4DV1O 1SQXH 5CBHA 3IJ4A 1EZJA 2JS5A 4DR7B 2AHYA 4X1YB 1EN4A 1COWG 2ZE7A 1WJZA 1AJPA 3OMAB 1WN7A 1OCCB 1SC5B 2DWDC 3D8CA 2XUMA 3LNNA 5IYDO 2Y4UA 4TOIA 1S77D 2X0LA 3EXAA 1R6KA 4K8ZA 5CA3A 1LNQA 4LF4O 4DO2A 2LGQA 5JQGA 2ZE6A 5J2UB 2AW9A 5B1BC 3BAAA 3WB0A 4DR4B 3L74H 3AG2C 2XHBA 2QKCA 1WB8A 1FS0G 4Q20A 2A0LA 1Z5WA 3K3WA 5B3SB 2FTKA 1YCIA 3E22B 4DV3O 4DYLA 1KB9F 1OCOC 2CTQA 4LNUA 2JS3A 2R9RB 4I9QA 4DV0O 1H2SB 3IC7A 5KHJA 2VQEB 1Q3EA 4MVSA 1VQPV 2P4VA 3BABA 4LWSB 2EINC 4J9ZB 1MSDA 5FLXN 2WLJA 2Q67A 3H9VA 1L0NH 3APQA 4X64B 2ADQB 5DECA 3T4DA 1OCZC 3ABLB 2E75B 2UUBB 4DV5O 3JATA 1XNQO 4JYYA 3D36C 1KC8W 4PA4A 4DR2B 3A2FA 3I56V 3CHXA 3GVMA 1FD9A 4JI8B 5JCOC 2A3QA 5JJNB 3QTCA 1BSMA 3F5TA 2BSKA 4HYOA 2HHHB 4NTYA 1X59A 3CCUV 1ZL8A 1KBHA 4P9PA 2OTJV 4JTCB 5CN0A 2XNDG 3JD2A 1FXKA 4FMTA 5DM6V 3QO8A 2IU0A 3CCJV 4R6ZA 4DRXB 1N34O 1VMGA 5GW7A 4K0KO 1A32A 2AHZA 3UM7A 1HNZO 2XASA 3K04A 2JDIG 4RUFA 2GTAA 4LH6A 4RQFA 4Q6GA 1IZ3A 1M90W 4FJCC 1VQLV 2NLJC 1XMQO 2RNBA 1AVMA 2C2AA 4J10A 4JI1B 4LF6O 1QU7A 1H2LA 1SQPH 4GX2A 1N4CA 4NYKA 3UCSC 4X1IB 3ASOB 3F7VC 3OT7A 1HNXO 1K5QA 1LUVA 3K57A 4JPRA 4YY3O 3UQ8A 4B3TB 4FM0A 2Q7HA 1Q7YW 5BY1A 4LF7B 1B3QA 1MMMA 4X66B 3SYPA 5LHIA 1NS1A 1IDSA 3BPZA 2VWJA 1BQ0A 2N04A 2CH7A 4YHHB 3CSXA 4KHPB 2QWNB 4CH6A 1DF5A 3AG7A 3GB7C 4ASUG 1B06A 3ABUA 2ITCC 2P22C 4GX1A 3EFFK 5IJ0B 3AK3A 1PKXA 3LSQA 3LDDA 4IHJA 5CBGA 4JI7O 1QVFU 1KKCA 1AB3A 3X2QB 5IY5B 4PDLA 3APOA 3G71V 4MVOA 4H44B 4O2BA 1AP6A 2A7WA 1I94B 3AK2A 3B40A 1TUEB 3KCYA 4EB6A 3ZRWA 4J7ZA 3JYCA 1CPYA 4I0XB 3SPHA 4PDRA 3TXSA 2JGDB 3QVNA 1D5NA 4GCZA 2LFRA 4NXNO 2CGOA 1VF6C 4JAVA 2FMLA 1S0VA 1I0HA 3OW2U 2EJRA 2ODMA 4ZHQA 3NR7A 4MTFA 1YEWA 3CRCA 4PI0A 3E8FA 1EN5A 1N36O 1B04A 1GH6A 2DE0X 1IBLO 1G4YB 4ZKIA 2W6IG 5IWAB 4DW1A 3CX5F 2EIJB 2LO1A 2YS8A 5LP6B 1NT2B 1BHAA 4Z1VA 1PD3A 1MZFA 1JJOA 1NH2B 5D5PA 2YIDA 1GK9A 4JYCA 5JVDA 3HKDA 3ETGA 2Y0IA 3AG4C 1CEZA 3DSQA 1PNKA 2UUAO 3THOA 1U97A 4LCUC 4FM1A 3FX7A 3ETDA 4O2AB 4DW0A 1AP5A 3AK1A 1I08A 4MW3A 3JASA 5K1PA 4MTOA 4PA9A 2ZM6O 3U10A 1TUBB 4LF4B 1FJGO 5LMUB 4TV8A 2DYRC 4IIJB 1QR9A 5EYPB 4CC5A 1FFXA 3WG7C 3B8NA 1PL0A 1Y76A 2ZIOA 1YDXA 3ASNC 4UCTA 3KKYA 5KX5B 2IH3C 2A06H 1XI1A 2BE3A 2Q0AA 2X7RB 4LH7A 5CA0A 3QO5A 1XMOO 3CXCU 2DOSA 4DV0B 2ATKC 4PHZA 5KMGA 2IBZH 3M8AA 1OZ0A 4CS2A 2UXXA 1BT8A 1VQ9V 1YIJV 4DV2O 4OX9O 1GTOA 4TV9B 4G2KA 1H38A 1GAXA 5LOVA 5L3DA 4DV5B 3JD0A 1XNQB 1Y74B 3L9DA 1YTFB 1GM9A 1Y66A 2R9IA 3ZHUA 2CGNA 3KG2A 4AQYO 2E76B 3B2EE 4PELA 4GKJB 2G38A 4LC1A 1SA0B 2Q9LA 4P9OA 5B1AC 1N32O 1PL4A 3GWKC 1EM1A 3H1IH 1N34B 4DR4O 4K0KB 2ADPA 1HNZB 2AZ2A 3CJHB 1QR8A 1BMFG 3N2KB 1M57C 3IFXA 2GDSA 2KG7A 3W7WA 2UXBO 2LP7A 1XMQB 1GN6A 2IJKA 3JAWA 2Q7EA 1R3KC 2E74B 3IAYA 3ZJZA 4LF6B 5CB4B 2QTOA 3HB3B 4ZI7A 1GN2A 1H2GA 2QM7A 4MVRA 1XL6A 4CS3A 3DC6A 1EZVH 2ZE5A 3OEEG 4DV4O 2QA4V 4DR2O 4PV1B 4PDMA 5BMVA 1HNXB 3KZIZ 3D3QA 4YY3B 4OPHA 1R6TA 4QGPA 3CPWU 4W4LA 5EIBC 5L3CA 3UT5A 3U0ZA 3RBZA 3E89A 1WAZA 4JI5O 3CCEV 1FXKC 4JI3B 3W7TA 4KL1A 4KXRA 3TK1A 1ZAUA 1R73A 3QO7A 2JRIA 1JFFA 2EIMB 3HKCA 2WLMA 3IGAC 1WNSA 4LF5O 3K5MA 1GN3A 3N2GB 4JI7B 3CS5A 1E1RG 1MA1A 5IJ9B 1NTKH 4GUNA 4MT8A 4FLXA 1GN4A 2YDEA 3OE7G 2HJDA 2B5UA 3OMNB 3ZS8C 4O4JB 1P84F 4I4TA 4MS2A 2LW7A 3SJAC 1N33B 3JARA 2D3OW 4B3TO 2ARHA 3ETQA 3ABMB 4PA3A 5KUKA 2YIBA 3E35A 2EULA 2Y69C 4LF7O 2HFEC 2XTAA 3HKBA 3CRQA 4YJ2A 1F4MA 4CBCA 3Q4HA 2NNUA 2OT5A 3MDSA 4YHHO 1QHTA 2ZINA 4J9YB 2FKXA 3TETA 5B3SC 1VF5B 1YZBA 1VQ6V 4U3JB 3RYIB 4F6RA 4WBNA 1D5AA 2P4KA 4TUYA 4I50A 4B3SB 2UUAB 3G67A 4UVCA 1I5YA 1YTFD 3CD6V 4GKKO 2QR4A 3RVZA 1V55B 4H33A 3E8GA 2ZM6B 4X89A 3RYCA 1FYJA 1TVKA 4H37A 2PF4E 1FJGB 5J2TB 1FKAO 4HAMA 2YSUB 4UV9A 1VQOV 3P32A 1Q6HA 3RWRD 3BY6A 5LYJB 5BZBA 3L72H 4DV7B 3K5NA 2GUZB 1ZSPA 4GT1A 3CC2V 2YEVB 1NBMG 4EKWA 1AR5A 1VEWA 1URFA 3PN1A 3CCRV 3OFNG 3JAKB 4NR1A 3BA9A 5IWAO 4JGSA 4DV2B 4OX9B 1OHHG 3AG3B 1MABG 5ITZB 5KA5A 2GSMB 1YF2A 5D5QA 4O4LB 1PNLA 4YJ3B 3RYFB 2Z0AA 4AI8A 3JSNA 4LR3A 3JALA 4X1KB 4CH3A 4AQYB 2PYJA 3L71H 3FYIB 1Q86W 3L75H 2ZR2A 2WLLB 1H8EG 3OEHG 5LMUO 1HW7A 1JR9A 1N32B 3A0HZ 5C8YA 4RAIA 1Q6UA 2LQTA 4F6EA 3MAQA 2K9PA 5JH7A 2YC0A 4NKGB 3T1HO 2UXBB 2CAZC 2OIGA 4U7OA 2H8PC 3FAVA 5CA1A 4XDLA 2PY5A 1AILA 4X65O 2EZOA 2CTRA 4DK1A 3SYOA 3SJBC 3CYOA 3LDCA 4TQDA 2UXCO 4ICGA 4K8XA 4DV4B 1G6UA 4DR6B 2V4DA 3DXRA 3FB8C 4ZOLA 3MD0A 1SS3A 3W7XA 3K9SA 4I55B 3FKSG 3LUTB 4O4HB 1W0KG 1IVSA 3B4SA 4CH4A 4U7NA 2W0FC 3ZHTA 4H13B 4AILC 3ZMUA 4GKJO 1SKVA 3JD4A 1G1XB 1M9NA 4JI5B 1K33A 4O4IA 5LA6B 2Q5ZA 2DJVA 1NR1A 1IBMO 1SF9A 2WPDG 1O9GA 1YHQV 3H01A 4HNAA 1IURA 2V1DA 2JJ1G 3CWBH 4H0LB 2Y4TA 5A2QN 4LF5B 2EIJC 2WLHA 5LP6C 1UJWB 1AROP 2AGAA 4XDKA 1BE3H 1KP3A 2XAJA 2GTSA 1FAFA 4DR5O 3C90A 3TJTA 4X1YA 4AHCA 1WP8A 3W7UA 2N74A 4N23A 1Q8IA 4RO2A 3VOUA 1NI8A 1GO3F 2CK3G 3OMIB 2P5OA 2Z3YA 3A8TA 3B8MA 4D6TH 3RN4A 1YSCA 4J7KA 1V9PA 1AR4A 3OTOO 2H94A 2L6LA 5J2UA 4X20B 1JCHA 1THZA 3VQXA 1JA8A 2Z5UA 2BTQB 5B1BB 1XQ8A 4FLWA 3EHBB 4NTWA 4JI3O 3IC9A 1QLNA 5EZYB 1K9MW 3E22A 1V54C 1XHXA 3GWOA 4UUJC 5BR8O 1OCOB 1G8MA 4CC6A 1WP7A 1XHZA 1S3JA 1S5JA 3P3NA 2PTMA 1KUQA 3CCLV 4LWSA 5TISZ 2QM8A 2OIEA 4FK5C 2X6CA 4GKKB 2F95B 2EINB 2ZT9B 1M56C 2XT9A 1ZX3A 3HPLC 1NZ6A 4X88A 2HG5C 3ZHQA 2WLIB 3JD3A 1QLEC 4G27B 1MSWD 4JI6B 4F4LA 2M6YA 4OPAA 3H1KH 5F2VO 4D7TA 3T1YO 3FB6C 4C7UA 4QIWF 3ZRVA 1N33O 3FB7C 1M1KW 4CH5A 1QVGU 4DXWA 4FLYA 1IX9A 4LBEC 1FXVA 3ZHRA 2XAGA 3JCZA 4YXWG 5KHHA 2DN9A 4B08A 1JPXA 1IBKO 3HKEB 4DRXA 2KQXA 3BA8A 2EILC 2DYSC 2ZXWC 4BAYA 1UFIA 1NTMH 3TXQA 1BHBA 1WPXA 4B3RO 3K5LA 2ZIMA 1TA8A 3AG1C 4PI2A 2OCCC 3CB2A 3H1JH 1GKFA 3RFRA 5K1XA 2P6JA 1GM8A 1BCCH 5FNVB 3J81N 4B3SO 2QKAA 4YIPA 2KSDA 5IDJA 1JMKC 3CCVV 4MTXA 5H6RA 2WLKA 4FVMA 3SPIA 1AJNA 2ZQMA 3STLC 1P7GA 4QE7A 2F1MA 2F23A 2WWWA 3ABKB 2EIKB 1VQ4V 5JJEB 3OUSA 1ZUQA 1NR7A 4TWKA 4X1IA 5GONB 3CE2A 5IYZB 1SETA 1EN6A 4JZGA 1OCRC 1AI4A 4UB6Z 4J7JA 4DV7O 2ZE8A 4DV6O 3T1HB 1LUWA 2WSSG 3TCUA 1JJ2U 2JEXA 3LSSA 3B09A 1OJHA 3ML0A 3OM3B 1WA8B 3MHSC 3SYCA 4X65B 3SPGA 1I5XA 2MW2B 2WLNA 3LSUA 1RSOB 2ILMA 3SJQC 5GTIZ 1SQBH 4X62O 2UXCB 1J5EB 1D2DA 5KA6A 5LHGA 4QNHB 1SRYA 3OD4A 1RFYA 1E79G 5IJ0A 1XOUA 5A9GA 5KAFZ 5LGUA 1HR0O 1XUQA 1ENVA 2JEUA 3I55V 2CTPA 2E5LO 1XNRB 4FIPC 3CEIA 1P49A 3CC7V 5LXTB 4I0XA 3ZHSA 4UCOA 2PI5A 1IBMB 2JGDA 2CE4A 1VQNV 4MW8A 2QWRB 4IGGA 4DUZO 1CP9A 3G6EV 4LFCO 2QE7G 2W6JG 3ABMC 1PNMA 1WLEA 4JI4O 1F4NA 1W0JG 2IW5A 4BW5A 5LP6A 1K8AW 4QPJA 1RM1B 3FYEB 2V7QG 3CC4V 5LL6Y 1MZEA 4JI0B 2NN4A 4DR5B 3C3SA 4LFBO 2GV9A 2Q68A 3UO3A 4KP4A 3AG4B 2VQFB 4B7EA 5B5EZ 4FFBB 4DR6O 1JVMA 5FPOA 4O2AA 3T4ZA 1VQKV 1N0NA 3K0GA 1M4UA 3ZIAG 5KHIA 3O65A 1TUBA 1BZKA 1XL4A 3K08A 1R3LC 3OTOB 1X4TA 4PJ0Z 1J95A 2W0XA 4IIJA 2DYRB 2YXHA 2BTOA 2IJJA 3WG7B 5KX5A 3ZEDA 4TQFA 3ASNB 2ITDC 2LGWA 3CRMA 3K58A 2QWOB 5BR8B 3RYHB 2UU9O 3VQYA 2YICA 1HP8A 4MVQA 4LP8A 4UCRA 2DQ0A 1WB7A 2A79B 4TV9A 4LFAO 3NXSA 3JAMN 1F51A 4D7SA 4WCEV 3I5DA 2EX3A 1L0LH 3JSLA 1JQ0A 1RP3B 1Y74A 3H1LH 2XAFA 5H9CA 4JAAA 4GYCB 1OCCC 4GLXA 3T1YB 2X6AA 1NKDA 1Q81W 1XDCA 3K06A 2ZNJA 4NTXA 3VQVA 3FB5C 5IT9N 1DTOA 1SA0A 3K9AA 2IU3A 2PZSA 1IBKB 1HDJA 2JJ2G 5B1AB 5EBWC 5JQGB 4WFEA 2OCHA 3ETEA 4ZBMA 2QWPB 4B3RB 1L1FA 4PA7A 4JV5B 3CJHA 3N2KA 1EBOA 1QBZA 4JI2O 3CMEV 2XAHA 1UPGA 5FPRA 1M57B 1VQ7V 5L3FA 2CUGA 4LNUB 2EZPA 4KUMA 1E1QG 3ICXA 1CXZB 3WB2A 1F23A 3G6BA 1H2NA 2IJIA 1VARA 3OTFA 5CB4A 3JCUZ 2GHYA 4WF9V 3MHHC 4EFBA 3ABLC 3OR6C 4EEQA 2DWEC 4U3FH 4OXSA 3JATB 1AI5A 4JI6O 4J41A 1N0JA 4FZ0A 4DV6B 3E8BA 2BSKB 2M7WA 4NXMO 1S76D 1ZL8B 4B7KA 4JTDB 2BCCH 2RCVA 2YIBD 1K4DC 1R6NA 1FXKB 3QF7A 3TGUH 1SESA 3T2MA 1Y67A 4BIZA 4MVZA 4IYHA 3FFQA 4TSFG 3CCQV 4X62B 1Q43A 4OGQB 3S3XA 1XBLA 1KKDA 4FLUA 3N2GA 1Z5VA 3SJCC 1XEQA 1NVPD 3RVYA 4MTGA 1SQFA 4UVBA 1HR0B 1B6QA 2UXNA 5IJ9A 4XBFA 1MNGA 5CMUA 2E5LB 3A0RA 4DUYO 1IXBA 3PJSK 2PYLA 3W7SA 2Q4PA 2YI9A 3ASOC 3CXHF 4O4JA 4RWUA 1FXHA 4DUZB 4W4KA 4LFCB 2EJ7A 2F66C 4FFKA 1ORQC 2QKSA 3R65A 3QNEA 2GBOA 2YUAA 2Y69B 4JI4B 4NB5A 1YJWV 3DGEA 3SPCA 1SQGA 5L3BA 2CH7B 3E86A 2L35A 1PM9A 2JK5C 4DR3O 4LF8B 2DMXA 4U3JA 3RYIA 4LFBB 2QEXV 3G80A 2YI8A 1J5EO 1JOYA 4FLTA 4MSWC 4K3AA 2XOKG 3BFRA 5IYBO 2DQ3A 1MOFA 2D2CB 1AR1B 3L73H 1PP9H 5J2TA 5KLVH 2DW4A 3X2QC 5IY5C 4IHJB 1OV9A 2N05A 2ZDIA 5KHKA 1XNRO 3N27A 4FM2A 1DK1A 4O2BB 3OGIB 5LYJA 3LDEA 1S5LZ 2LJ2A 4EB6B 3ZRWB 3ZN0A 2QGNA 3HR0A 1ZLZA 2GUZA 2YEVA 3RGBA 3RT3C 1SZXA 2UU9B 3ZMVA 1H2KA 3FD9A 5LMNO 1DF4A 5LHHA 4ZHQB 1GMGA 3D3IA 3JAKA 2B9ZA 2QWQB 2Q6AA 2RDCA 1M5IA 4B3MB 4ZIBA 4LFAB 5ITZA 4IT5A 3C3TA 4JI0O 5C93A 1PV0A 4O4LA 5KAIZ 2ZNIA 4QPKA 1WPBA 2ZR3A 4YJ3A 4DK0A 5HFLA 5JVDB 3RYFA 3HKDB 2VQFO 2LW1A 4X1KA 5JJJB 5L3EA 3F5WC 5EBLC 1SQVH 4JYAO 2WLLA 3AEIA 4JYBA 1YXBA 1W2BU 2QTSA 1U96A 3DC5A 1JX9A 3ABKC 3JASB 2EIKC 4J11A 4LF9B 2JGUA 4PD4F 3ABTA 1K34A 5EIBD 4HBNA 3J7AU 4GX0A 3B77A 4TV8B 4I7ZB 2HKOA 4IYIA 2F4VB 3AG2B 1FFXB 5J9PC 1Y76B 1P4RA 3JD1A 3E2EA 4JI2B 5CA0B 1KMIZ 1QNMA 3ZMSA 5L3GA 3K5OA 5KMGB 1ZWIC 1DLBA 1KQSU 1SZTA 2CDYA 2R9AA 3LNMB 4DR1B 5E79Z 2R72A 1RPOA 4N21A 5BXZA 5HFMA 1S72V 1KYOF 1OCZB 2Q73A 5LOVB 1GRJA 2Q0OC 1ROPA 1HWYA 3ZN1A 4UVAA 4WFFA 4I55A 3T1CA 5KHGA 4O4HA 4BIUA 1VQMV 2YXLA 1TGOA 2JVDA 3DTUB 4E2LA 4UCVA 4R7CA 2LFSA 4NXMB 3EVKA 4TT3G 2UXDB 2F93B 5LA6A 3CCMV 1H8HG 4R50A 4JAUA 4UFZA 1HNWO 1O9HA 4CZZA 1KU9A 4JV5O 2UUCO 3ZRXA 4BWAA 4JF3A 5E1AC 3R66A 4WFBV 4P30A 1YITV 1AI7A 2R70A 2KG7B 3UO2A 1FFTB 4FPPA 2CTWA 3BRCA 2B1IA 2OWOA 1RM1C 4MVMA 4P2ZA 4KFMA 4DV1B 3JAWB 1BL8A 4DUYB
chains in the Genus database with same CATH topology
4NTXA 1WP8A 2L35A 4FZ1A 4FZ0A 4NTYA 3S3XA 3IJ4A 4NYKA 2QTSA 3S3WA 3N27A 2FB5A 1WP7A 4NTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTX A;  1WP8 A;  2L35 A;  4FZ1 A;  4FZ0 A;  4NTY A;  3S3X A;  3IJ4 A;  4NYK A;  2QTS A;  3S3W A;  3N27 A;  2FB5 A;  1WP7 A;  4NTW A; 
#chains in the Genus database with same CATH topology
 4L8J A;  1NJI W;  4J80 A;  2F43 G;  4PA6 A;  4UXN A;  3L70 H;  4ZI7 B;  4Z2W A;  2XAQ A;  2MK3 A;  2OTL V;  3P30 A;  2HP8 A;  1H2M A;  4X8A A;  1NQT A;  4MVU A;  3RW0 A;  1QQC A;  3F7Y C;  5BMV B;  2OYQ A;  2BOB C;  1VP7 A;  4X20 A;  4HZ3 A;  3BVO A;  3H1H H;  2PGG A;  2BTQ A;  2HJF C;  3UT5 B;  1QCE A;  3CP1 A;  1US6 A;  5EZY A;  1W59 A;  3SYA A;  1LR1 A;  5IE9 A;  1K5S A;  3SDL A;  2JIZ G;  1V54 B;  4DR3 B;  1R3J C;  4DV3 B;  2Q69 A;  1IXM A;  1BGY H;  2EIM C;  5GTH Z;  1S5H C;  4E4E A;  1K92 A;  2IH1 C;  1JFF B;  3S3W A;  5EBM C;  4A5U B;  3HKC B;  4G28 B;  2EBO A;  5H5N A;  2K1E A;  1YJ9 V;  3QG5 A;  1F7Y A;  1Z2G A;  2VRZ A;  4BIO A;  3O9O A;  3ZCC A;  2Q7G A;  1M56 B;  2WLI A;  4RQE A;  2NR5 A;  3ZHV A;  4JZ2 A;  3D36 A;  4DR7 O;  3K03 A;  2AZ0 A;  1QLE B;  5AG2 A;  1ZTE A;  5JCO A;  2A9H A;  1P7B A;  1K97 A;  3K59 A;  1Q6I A;  1KD1 W;  4I4T B;  1VQ8 V;  5EC1 C;  3JAR B;  5LMN B;  2QM4 A;  1BS3 A;  3M99 B;  2HLD G;  4QE9 A;  3HKE A;  3HKB B;  4GX5 A;  5LGN A;  1PPJ H;  4YJ2 B;  2EIL B;  3BCC H;  2DYS B;  2PUS A;  2ZXW B;  3Q4H B;  4UV8 A;  2YIA A;  1K7D A;  3ZRS A;  3CRA A;  3AG1 B;  3ZMT A;  2OCC B;  4LF8 O;  5FNV A;  1Q5O A;  2AXT Z;  2Y48 A;  5LBQ A;  4WBN B;  4F6R B;  4NVP A;  4IL6 Z;  1NVP B;  4BW9 A;  5KUM A;  4TUY B;  4I50 B;  4FLZ A;  3P3P A;  2VQE O;  1KEC A;  1MG1 A;  4JYA B;  1K3E A;  1V55 C;  2RN9 A;  2B1G A;  4QJF B;  4X9Q A;  4X64 O;  3RYC B;  3ZMZ A;  1TVK B;  3J80 N;  2UUB O;  5EYP A;  3VQW A;  2ZDI C;  1NU1 H;  1R1B A;  5GON A;  3WFV A;  5IYZ A;  5CBF A;  4JI8 O;  2Q8V A;  5IYC O;  1OCR B;  1L8D A;  4WFA V;  1SER A;  2HHH O;  3E8H A;  1Y4M A;  1VIB A;  5B1N A;  4UCU A;  4GZR B;  3SGI A;  1RPR A;  4L87 A;  1WA8 A;  2FB5 A;  3CRR A;  2FL4 A;  4PDV A;  1Q90 D;  2WA4 A;  3OAA G;  1YI2 V;  1I7F A;  1RSO A;  1FPO A;  2HVJ C;  2P06 A;  4B3M O;  2E3C A;  3AG3 C;  3A0B Z;  4CS4 A;  1K73 W;  1BQZ A;  5EC2 C;  1NH2 D;  2P90 A;  2VWK A;  5DED A;  2WA3 A;  3OUF A;  2QJ1 A;  4RUE A;  4FZ1 A;  3VBB A;  3SPJ A;  3JAL B;  2FYU H;  4FLV A;  1YJN V;  3WU2 Z;  4UB8 Z;  4JI1 O;  3SYQ A;  1M93 A;  3WB1 A;  3OR7 C;  4LF9 O;  5LXT A;  2RMK B;  2Y0P A;  1NTZ H;  2P67 A;  5C8Y B;  1XRE A;  2F4V O;  3KCX A;  1VF6 A;  4NXN B;  1HNW B;  2X6B A;  2UUC B;  2KB1 A;  4UCS A;  2KKW A;  2ZD9 A;  5DN6 G;  4X66 O;  5JH7 B;  1EFR G;  4YIO A;  3ZBH A;  2WAM A;  3SR2 C;  4R8C A;  3STZ C;  1N36 B;  1IBL B;  3OGC C;  1VF7 A;  1SQQ H;  2O57 A;  3M7M X;  1AI6 A;  3E83 A;  3FAV B;  1TAE A;  5CA1 B;  2ZKO A;  1DGS A;  2HEP A;  1T5E A;  1AJQ A;  4KHP O;  4DR1 O;  3UKM A;  5LGT A;  2QSA A;  3BEH A;  5B66 Z;  3K0D A;  2ETN A;  4K35 A;  3K79 A;  5H2F Z;  4FFB A;  1R3I C;  2QDO A;  3G4S V;  3DXR B;  3CCS V;  4ZOL B;  1KP2 A;  1VQ5 V;  4J42 A;  2IJH A;  2YXY A;  5FL7 G;  3CMA V;  2RJZ A;  4I5S A;  1GM7 A;  4WFG A;  2P7T C;  4ABM A;  4EFE A;  1K4C C;  5JWP A;  2IM9 A;  2UXD O;  3ZX6 A;  1I94 O;  2PI4 A;  1Y6X A;  3BHP A;  4O4I B;  1N8R W;  3U11 A;  2RQ6 A;  4XDJ A;  2ZCE A;  2BOC C;  1XIL A;  1XMO B;  3RYH A;  2VS0 A;  4HNA B;  5H6Q A;  5EK0 A;  4JTA B;  2HR3 A;  2HVK C;  4Z1M G;  2H3O A;  1YVW A;  4WFH A;  4JAS A;  5B1O A;  1Q82 W;  4I9W A;  4BR6 A;  4DV1 O;  1SQX H;  5CBH A;  3IJ4 A;  1EZJ A;  2JS5 A;  4DR7 B;  2AHY A;  4X1Y B;  1EN4 A;  1COW G;  2ZE7 A;  1WJZ A;  1AJP A;  3OMA B;  1WN7 A;  1OCC B;  1SC5 B;  2DWD C;  3D8C A;  2XUM A;  3LNN A;  5IYD O;  2Y4U A;  4TOI A;  1S77 D;  2X0L A;  3EXA A;  1R6K A;  4K8Z A;  5CA3 A;  1LNQ A;  4LF4 O;  4DO2 A;  2LGQ A;  5JQG A;  2ZE6 A;  5J2U B;  2AW9 A;  5B1B C;  3BAA A;  3WB0 A;  4DR4 B;  3L74 H;  3AG2 C;  2XHB A;  2QKC A;  1WB8 A;  1FS0 G;  4Q20 A;  2A0L A;  1Z5W A;  3K3W A;  5B3S B;  2FTK A;  1YCI A;  3E22 B;  4DV3 O;  4DYL A;  1KB9 F;  1OCO C;  2CTQ A;  4LNU A;  2JS3 A;  2R9R B;  4I9Q A;  4DV0 O;  1H2S B;  3IC7 A;  5KHJ A;  2VQE B;  1Q3E A;  4MVS A;  1VQP V;  2P4V A;  3BAB A;  4LWS B;  2EIN C;  4J9Z B;  1MSD A;  5FLX N;  2WLJ A;  2Q67 A;  3H9V A;  1L0N H;  3APQ A;  4X64 B;  2ADQ B;  5DEC A;  3T4D A;  1OCZ C;  3ABL B;  2E75 B;  2UUB B;  4DV5 O;  3JAT A;  1XNQ O;  4JYY A;  3D36 C;  1KC8 W;  4PA4 A;  4DR2 B;  3A2F A;  3I56 V;  3CHX A;  3GVM A;  1FD9 A;  4JI8 B;  5JCO C;  2A3Q A;  5JJN B;  3QTC A;  1BSM A;  3F5T A;  2BSK A;  4HYO A;  2HHH B;  4NTY A;  1X59 A;  3CCU V;  1ZL8 A;  1KBH A;  4P9P A;  2OTJ V;  4JTC B;  5CN0 A;  2XND G;  3JD2 A;  1FXK A;  4FMT A;  5DM6 V;  3QO8 A;  2IU0 A;  3CCJ V;  4R6Z A;  4DRX B;  1N34 O;  1VMG A;  5GW7 A;  4K0K O;  1A32 A;  2AHZ A;  3UM7 A;  1HNZ O;  2XAS A;  3K04 A;  2JDI G;  4RUF A;  2GTA A;  4LH6 A;  4RQF A;  4Q6G A;  1IZ3 A;  1M90 W;  4FJC C;  1VQL V;  2NLJ C;  1XMQ O;  2RNB A;  1AVM A;  2C2A A;  4J10 A;  4JI1 B;  4LF6 O;  1QU7 A;  1H2L A;  1SQP H;  4GX2 A;  1N4C A;  4NYK A;  3UCS C;  4X1I B;  3ASO B;  3F7V C;  3OT7 A;  1HNX O;  1K5Q A;  1LUV A;  3K57 A;  4JPR A;  4YY3 O;  3UQ8 A;  4B3T B;  4FM0 A;  2Q7H A;  1Q7Y W;  5BY1 A;  4LF7 B;  1B3Q A;  1MMM A;  4X66 B;  3SYP A;  5LHI A;  1NS1 A;  1IDS A;  3BPZ A;  2VWJ A;  1BQ0 A;  2N04 A;  2CH7 A;  4YHH B;  3CSX A;  4KHP B;  2QWN B;  4CH6 A;  1DF5 A;  3AG7 A;  3GB7 C;  4ASU G;  1B06 A;  3ABU A;  2ITC C;  2P22 C;  4GX1 A;  3EFF K;  5IJ0 B;  3AK3 A;  1PKX A;  3LSQ A;  3LDD A;  4IHJ A;  5CBG A;  4JI7 O;  1QVF U;  1KKC A;  1AB3 A;  3X2Q B;  5IY5 B;  4PDL A;  3APO A;  3G71 V;  4MVO A;  4H44 B;  4O2B A;  1AP6 A;  2A7W A;  1I94 B;  3AK2 A;  3B40 A;  1TUE B;  3KCY A;  4EB6 A;  3ZRW A;  4J7Z A;  3JYC A;  1CPY A;  4I0X B;  3SPH A;  4PDR A;  3TXS A;  2JGD B;  3QVN A;  1D5N A;  4GCZ A;  2LFR A;  4NXN O;  2CGO A;  1VF6 C;  4JAV A;  2FML A;  1S0V A;  1I0H A;  3OW2 U;  2EJR A;  2ODM A;  4ZHQ A;  3NR7 A;  4MTF A;  1YEW A;  3CRC A;  4PI0 A;  3E8F A;  1EN5 A;  1N36 O;  1B04 A;  1GH6 A;  2DE0 X;  1IBL O;  1G4Y B;  4ZKI A;  2W6I G;  5IWA B;  4DW1 A;  3CX5 F;  2EIJ B;  2LO1 A;  2YS8 A;  5LP6 B;  1NT2 B;  1BHA A;  4Z1V A;  1PD3 A;  1MZF A;  1JJO A;  1NH2 B;  5D5P A;  2YID A;  1GK9 A;  4JYC A;  5JVD A;  3HKD A;  3ETG A;  2Y0I A;  3AG4 C;  1CEZ A;  3DSQ A;  1PNK A;  2UUA O;  3THO A;  1U97 A;  4LCU C;  4FM1 A;  3FX7 A;  3ETD A;  4O2A B;  4DW0 A;  1AP5 A;  3AK1 A;  1I08 A;  4MW3 A;  3JAS A;  5K1P A;  4MTO A;  4PA9 A;  2ZM6 O;  3U10 A;  1TUB B;  4LF4 B;  1FJG O;  5LMU B;  4TV8 A;  2DYR C;  4IIJ B;  1QR9 A;  5EYP B;  4CC5 A;  1FFX A;  3WG7 C;  3B8N A;  1PL0 A;  1Y76 A;  2ZIO A;  1YDX A;  3ASN C;  4UCT A;  3KKY A;  5KX5 B;  2IH3 C;  2A06 H;  1XI1 A;  2BE3 A;  2Q0A A;  2X7R B;  4LH7 A;  5CA0 A;  3QO5 A;  1XMO O;  3CXC U;  2DOS A;  4DV0 B;  2ATK C;  4PHZ A;  5KMG A;  2IBZ H;  3M8A A;  1OZ0 A;  4CS2 A;  2UXX A;  1BT8 A;  1VQ9 V;  1YIJ V;  4DV2 O;  4OX9 O;  1GTO A;  4TV9 B;  4G2K A;  1H38 A;  1GAX A;  5LOV A;  5L3D A;  4DV5 B;  3JD0 A;  1XNQ B;  1Y74 B;  3L9D A;  1YTF B;  1GM9 A;  1Y66 A;  2R9I A;  3ZHU A;  2CGN A;  3KG2 A;  4AQY O;  2E76 B;  3B2E E;  4PEL A;  4GKJ B;  2G38 A;  4LC1 A;  1SA0 B;  2Q9L A;  4P9O A;  5B1A C;  1N32 O;  1PL4 A;  3GWK C;  1EM1 A;  3H1I H;  1N34 B;  4DR4 O;  4K0K B;  2ADP A;  1HNZ B;  2AZ2 A;  3CJH B;  1QR8 A;  1BMF G;  3N2K B;  1M57 C;  3IFX A;  2GDS A;  2KG7 A;  3W7W A;  2UXB O;  2LP7 A;  1XMQ B;  1GN6 A;  2IJK A;  3JAW A;  2Q7E A;  1R3K C;  2E74 B;  3IAY A;  3ZJZ A;  4LF6 B;  5CB4 B;  2QTO A;  3HB3 B;  4ZI7 A;  1GN2 A;  1H2G A;  2QM7 A;  4MVR A;  1XL6 A;  4CS3 A;  3DC6 A;  1EZV H;  2ZE5 A;  3OEE G;  4DV4 O;  2QA4 V;  4DR2 O;  4PV1 B;  4PDM A;  5BMV A;  1HNX B;  3KZI Z;  3D3Q A;  4YY3 B;  4OPH A;  1R6T A;  4QGP A;  3CPW U;  4W4L A;  5EIB C;  5L3C A;  3UT5 A;  3U0Z A;  3RBZ A;  3E89 A;  1WAZ A;  4JI5 O;  3CCE V;  1FXK C;  4JI3 B;  3W7T A;  4KL1 A;  4KXR A;  3TK1 A;  1ZAU A;  1R73 A;  3QO7 A;  2JRI A;  1JFF A;  2EIM B;  3HKC A;  2WLM A;  3IGA C;  1WNS A;  4LF5 O;  3K5M A;  1GN3 A;  3N2G B;  4JI7 B;  3CS5 A;  1E1R G;  1MA1 A;  5IJ9 B;  1NTK H;  4GUN A;  4MT8 A;  4FLX A;  1GN4 A;  2YDE A;  3OE7 G;  2HJD A;  2B5U A;  3OMN B;  3ZS8 C;  4O4J B;  1P84 F;  4I4T A;  4MS2 A;  2LW7 A;  3SJA C;  1N33 B;  3JAR A;  2D3O W;  4B3T O;  2ARH A;  3ETQ A;  3ABM B;  4PA3 A;  5KUK A;  2YIB A;  3E35 A;  2EUL A;  2Y69 C;  4LF7 O;  2HFE C;  2XTA A;  3HKB A;  3CRQ A;  4YJ2 A;  1F4M A;  4CBC A;  3Q4H A;  2NNU A;  2OT5 A;  3MDS A;  4YHH O;  1QHT A;  2ZIN A;  4J9Y B;  2FKX A;  3TET A;  5B3S C;  1VF5 B;  1YZB A;  1VQ6 V;  4U3J B;  3RYI B;  4F6R A;  4WBN A;  1D5A A;  2P4K A;  4TUY A;  4I50 A;  4B3S B;  2UUA B;  3G67 A;  4UVC A;  1I5Y A;  1YTF D;  3CD6 V;  4GKK O;  2QR4 A;  3RVZ A;  1V55 B;  4H33 A;  3E8G A;  2ZM6 B;  4X89 A;  3RYC A;  1FYJ A;  1TVK A;  4H37 A;  2PF4 E;  1FJG B;  5J2T B;  1FKA O;  4HAM A;  2YSU B;  4UV9 A;  1VQO V;  3P32 A;  1Q6H A;  3RWR D;  3BY6 A;  5LYJ B;  5BZB A;  3L72 H;  4DV7 B;  3K5N A;  2GUZ B;  1ZSP A;  4GT1 A;  3CC2 V;  2YEV B;  1NBM G;  4EKW A;  1AR5 A;  1VEW A;  1URF A;  3PN1 A;  3CCR V;  3OFN G;  3JAK B;  4NR1 A;  3BA9 A;  5IWA O;  4JGS A;  4DV2 B;  4OX9 B;  1OHH G;  3AG3 B;  1MAB G;  5ITZ B;  5KA5 A;  2GSM B;  1YF2 A;  5D5Q A;  4O4L B;  1PNL A;  4YJ3 B;  3RYF B;  2Z0A A;  4AI8 A;  3JSN A;  4LR3 A;  3JAL A;  4X1K B;  4CH3 A;  4AQY B;  2PYJ A;  3L71 H;  3FYI B;  1Q86 W;  3L75 H;  2ZR2 A;  2WLL B;  1H8E G;  3OEH G;  5LMU O;  1HW7 A;  1JR9 A;  1N32 B;  3A0H Z;  5C8Y A;  4RAI A;  1Q6U A;  2LQT A;  4F6E A;  3MAQ A;  2K9P A;  5JH7 A;  2YC0 A;  4NKG B;  3T1H O;  2UXB B;  2CAZ C;  2OIG A;  4U7O A;  2H8P C;  3FAV A;  5CA1 A;  4XDL A;  2PY5 A;  1AIL A;  4X65 O;  2EZO A;  2CTR A;  4DK1 A;  3SYO A;  3SJB C;  3CYO A;  3LDC A;  4TQD A;  2UXC O;  4ICG A;  4K8X A;  4DV4 B;  1G6U A;  4DR6 B;  2V4D A;  3DXR A;  3FB8 C;  4ZOL A;  3MD0 A;  1SS3 A;  3W7X A;  3K9S A;  4I55 B;  3FKS G;  3LUT B;  4O4H B;  1W0K G;  1IVS A;  3B4S A;  4CH4 A;  4U7N A;  2W0F C;  3ZHT A;  4H13 B;  4AIL C;  3ZMU A;  4GKJ O;  1SKV A;  3JD4 A;  1G1X B;  1M9N A;  4JI5 B;  1K33 A;  4O4I A;  5LA6 B;  2Q5Z A;  2DJV A;  1NR1 A;  1IBM O;  1SF9 A;  2WPD G;  1O9G A;  1YHQ V;  3H01 A;  4HNA A;  1IUR A;  2V1D A;  2JJ1 G;  3CWB H;  4H0L B;  2Y4T A;  5A2Q N;  4LF5 B;  2EIJ C;  2WLH A;  5LP6 C;  1UJW B;  1ARO P;  2AGA A;  4XDK A;  1BE3 H;  1KP3 A;  2XAJ A;  2GTS A;  1FAF A;  4DR5 O;  3C90 A;  3TJT A;  4X1Y A;  4AHC A;  1WP8 A;  3W7U A;  2N74 A;  4N23 A;  1Q8I A;  4RO2 A;  3VOU A;  1NI8 A;  1GO3 F;  2CK3 G;  3OMI B;  2P5O A;  2Z3Y A;  3A8T A;  3B8M A;  4D6T H;  3RN4 A;  1YSC A;  4J7K A;  1V9P A;  1AR4 A;  3OTO O;  2H94 A;  2L6L A;  5J2U A;  4X20 B;  1JCH A;  1THZ A;  3VQX A;  1JA8 A;  2Z5U A;  2BTQ B;  5B1B B;  1XQ8 A;  4FLW A;  3EHB B;  4NTW A;  4JI3 O;  3IC9 A;  1QLN A;  5EZY B;  1K9M W;  3E22 A;  1V54 C;  1XHX A;  3GWO A;  4UUJ C;  5BR8 O;  1OCO B;  1G8M A;  4CC6 A;  1WP7 A;  1XHZ A;  1S3J A;  1S5J A;  3P3N A;  2PTM A;  1KUQ A;  3CCL V;  4LWS A;  5TIS Z;  2QM8 A;  2OIE A;  4FK5 C;  2X6C A;  4GKK B;  2F95 B;  2EIN B;  2ZT9 B;  1M56 C;  2XT9 A;  1ZX3 A;  3HPL C;  1NZ6 A;  4X88 A;  2HG5 C;  3ZHQ A;  2WLI B;  3JD3 A;  1QLE C;  4G27 B;  1MSW D;  4JI6 B;  4F4L A;  2M6Y A;  4OPA A;  3H1K H;  5F2V O;  4D7T A;  3T1Y O;  3FB6 C;  4C7U A;  4QIW F;  3ZRV A;  1N33 O;  3FB7 C;  1M1K W;  4CH5 A;  1QVG U;  4DXW A;  4FLY A;  1IX9 A;  4LBE C;  1FXV A;  3ZHR A;  2XAG A;  3JCZ A;  4YXW G;  5KHH A;  2DN9 A;  4B08 A;  1JPX A;  1IBK O;  3HKE B;  4DRX A;  2KQX A;  3BA8 A;  2EIL C;  2DYS C;  2ZXW C;  4BAY A;  1UFI A;  1NTM H;  3TXQ A;  1BHB A;  1WPX A;  4B3R O;  3K5L A;  2ZIM A;  1TA8 A;  3AG1 C;  4PI2 A;  2OCC C;  3CB2 A;  3H1J H;  1GKF A;  3RFR A;  5K1X A;  2P6J A;  1GM8 A;  1BCC H;  5FNV B;  3J81 N;  4B3S O;  2QKA A;  4YIP A;  2KSD A;  5IDJ A;  1JMK C;  3CCV V;  4MTX A;  5H6R A;  2WLK A;  4FVM A;  3SPI A;  1AJN A;  2ZQM A;  3STL C;  1P7G A;  4QE7 A;  2F1M A;  2F23 A;  2WWW A;  3ABK B;  2EIK B;  1VQ4 V;  5JJE B;  3OUS A;  1ZUQ A;  1NR7 A;  4TWK A;  4X1I A;  5GON B;  3CE2 A;  5IYZ B;  1SET A;  1EN6 A;  4JZG A;  1OCR C;  1AI4 A;  4UB6 Z;  4J7J A;  4DV7 O;  2ZE8 A;  4DV6 O;  3T1H B;  1LUW A;  2WSS G;  3TCU A;  1JJ2 U;  2JEX A;  3LSS A;  3B09 A;  1OJH A;  3ML0 A;  3OM3 B;  1WA8 B;  3MHS C;  3SYC A;  4X65 B;  3SPG A;  1I5X A;  2MW2 B;  2WLN A;  3LSU A;  1RSO B;  2ILM A;  3SJQ C;  5GTI Z;  1SQB H;  4X62 O;  2UXC B;  1J5E B;  1D2D A;  5KA6 A;  5LHG A;  4QNH B;  1SRY A;  3OD4 A;  1RFY A;  1E79 G;  5IJ0 A;  1XOU A;  5A9G A;  5KAF Z;  5LGU A;  1HR0 O;  1XUQ A;  1ENV A;  2JEU A;  3I55 V;  2CTP A;  2E5L O;  1XNR B;  4FIP C;  3CEI A;  1P49 A;  3CC7 V;  5LXT B;  4I0X A;  3ZHS A;  4UCO A;  2PI5 A;  1IBM B;  2JGD A;  2CE4 A;  1VQN V;  4MW8 A;  2QWR B;  4IGG A;  4DUZ O;  1CP9 A;  3G6E V;  4LFC O;  2QE7 G;  2W6J G;  3ABM C;  1PNM A;  1WLE A;  4JI4 O;  1F4N A;  1W0J G;  2IW5 A;  4BW5 A;  5LP6 A;  1K8A W;  4QPJ A;  1RM1 B;  3FYE B;  2V7Q G;  3CC4 V;  5LL6 Y;  1MZE A;  4JI0 B;  2NN4 A;  4DR5 B;  3C3S A;  4LFB O;  2GV9 A;  2Q68 A;  3UO3 A;  4KP4 A;  3AG4 B;  2VQF B;  4B7E A;  5B5E Z;  4FFB B;  4DR6 O;  1JVM A;  5FPO A;  4O2A A;  3T4Z A;  1VQK V;  1N0N A;  3K0G A;  1M4U A;  3ZIA G;  5KHI A;  3O65 A;  1TUB A;  1BZK A;  1XL4 A;  3K08 A;  1R3L C;  3OTO B;  1X4T A;  4PJ0 Z;  1J95 A;  2W0X A;  4IIJ A;  2DYR B;  2YXH A;  2BTO A;  2IJJ A;  3WG7 B;  5KX5 A;  3ZED A;  4TQF A;  3ASN B;  2ITD C;  2LGW A;  3CRM A;  3K58 A;  2QWO B;  5BR8 B;  3RYH B;  2UU9 O;  3VQY A;  2YIC A;  1HP8 A;  4MVQ A;  4LP8 A;  4UCR A;  2DQ0 A;  1WB7 A;  2A79 B;  4TV9 A;  4LFA O;  3NXS A;  3JAM N;  1F51 A;  4D7S A;  4WCE V;  3I5D A;  2EX3 A;  1L0L H;  3JSL A;  1JQ0 A;  1RP3 B;  1Y74 A;  3H1L H;  2XAF A;  5H9C A;  4JAA A;  4GYC B;  1OCC C;  4GLX A;  3T1Y B;  2X6A A;  1NKD A;  1Q81 W;  1XDC A;  3K06 A;  2ZNJ A;  4NTX A;  3VQV A;  3FB5 C;  5IT9 N;  1DTO A;  1SA0 A;  3K9A A;  2IU3 A;  2PZS A;  1IBK B;  1HDJ A;  2JJ2 G;  5B1A B;  5EBW C;  5JQG B;  4WFE A;  2OCH A;  3ETE A;  4ZBM A;  2QWP B;  4B3R B;  1L1F A;  4PA7 A;  4JV5 B;  3CJH A;  3N2K A;  1EBO A;  1QBZ A;  4JI2 O;  3CME V;  2XAH A;  1UPG A;  5FPR A;  1M57 B;  1VQ7 V;  5L3F A;  2CUG A;  4LNU B;  2EZP A;  4KUM A;  1E1Q G;  3ICX A;  1CXZ B;  3WB2 A;  1F23 A;  3G6B A;  1H2N A;  2IJI A;  1VAR A;  3OTF A;  5CB4 A;  3JCU Z;  2GHY A;  4WF9 V;  3MHH C;  4EFB A;  3ABL C;  3OR6 C;  4EEQ A;  2DWE C;  4U3F H;  4OXS A;  3JAT B;  1AI5 A;  4JI6 O;  4J41 A;  1N0J A;  4FZ0 A;  4DV6 B;  3E8B A;  2BSK B;  2M7W A;  4NXM O;  1S76 D;  1ZL8 B;  4B7K A;  4JTD B;  2BCC H;  2RCV A;  2YIB D;  1K4D C;  1R6N A;  1FXK B;  3QF7 A;  3TGU H;  1SES A;  3T2M A;  1Y67 A;  4BIZ A;  4MVZ A;  4IYH A;  3FFQ A;  4TSF G;  3CCQ V;  4X62 B;  1Q43 A;  4OGQ B;  3S3X A;  1XBL A;  1KKD A;  4FLU A;  3N2G A;  1Z5V A;  3SJC C;  1XEQ A;  1NVP D;  3RVY A;  4MTG A;  1SQF A;  4UVB A;  1HR0 B;  1B6Q A;  2UXN A;  5IJ9 A;  4XBF A;  1MNG A;  5CMU A;  2E5L B;  3A0R A;  4DUY O;  1IXB A;  3PJS K;  2PYL A;  3W7S A;  2Q4P A;  2YI9 A;  3ASO C;  3CXH F;  4O4J A;  4RWU A;  1FXH A;  4DUZ B;  4W4K A;  4LFC B;  2EJ7 A;  2F66 C;  4FFK A;  1ORQ C;  2QKS A;  3R65 A;  3QNE A;  2GBO A;  2YUA A;  2Y69 B;  4JI4 B;  4NB5 A;  1YJW V;  3DGE A;  3SPC A;  1SQG A;  5L3B A;  2CH7 B;  3E86 A;  2L35 A;  1PM9 A;  2JK5 C;  4DR3 O;  4LF8 B;  2DMX A;  4U3J A;  3RYI A;  4LFB B;  2QEX V;  3G80 A;  2YI8 A;  1J5E O;  1JOY A;  4FLT A;  4MSW C;  4K3A A;  2XOK G;  3BFR A;  5IYB O;  2DQ3 A;  1MOF A;  2D2C B;  1AR1 B;  3L73 H;  1PP9 H;  5J2T A;  5KLV H;  2DW4 A;  3X2Q C;  5IY5 C;  4IHJ B;  1OV9 A;  2N05 A;  2ZDI A;  5KHK A;  1XNR O;  3N27 A;  4FM2 A;  1DK1 A;  4O2B B;  3OGI B;  5LYJ A;  3LDE A;  1S5L Z;  2LJ2 A;  4EB6 B;  3ZRW B;  3ZN0 A;  2QGN A;  3HR0 A;  1ZLZ A;  2GUZ A;  2YEV A;  3RGB A;  3RT3 C;  1SZX A;  2UU9 B;  3ZMV A;  1H2K A;  3FD9 A;  5LMN O;  1DF4 A;  5LHH A;  4ZHQ B;  1GMG A;  3D3I A;  3JAK A;  2B9Z A;  2QWQ B;  2Q6A A;  2RDC A;  1M5I A;  4B3M B;  4ZIB A;  4LFA B;  5ITZ A;  4IT5 A;  3C3T A;  4JI0 O;  5C93 A;  1PV0 A;  4O4L A;  5KAI Z;  2ZNI A;  4QPK A;  1WPB A;  2ZR3 A;  4YJ3 A;  4DK0 A;  5HFL A;  5JVD B;  3RYF A;  3HKD B;  2VQF O;  2LW1 A;  4X1K A;  5JJJ B;  5L3E A;  3F5W C;  5EBL C;  1SQV H;  4JYA O;  2WLL A;  3AEI A;  4JYB A;  1YXB A;  1W2B U;  2QTS A;  1U96 A;  3DC5 A;  1JX9 A;  3ABK C;  3JAS B;  2EIK C;  4J11 A;  4LF9 B;  2JGU A;  4PD4 F;  3ABT A;  1K34 A;  5EIB D;  4HBN A;  3J7A U;  4GX0 A;  3B77 A;  4TV8 B;  4I7Z B;  2HKO A;  4IYI A;  2F4V B;  3AG2 B;  1FFX B;  5J9P C;  1Y76 B;  1P4R A;  3JD1 A;  3E2E A;  4JI2 B;  5CA0 B;  1KMI Z;  1QNM A;  3ZMS A;  5L3G A;  3K5O A;  5KMG B;  1ZWI C;  1DLB A;  1KQS U;  1SZT A;  2CDY A;  2R9A A;  3LNM B;  4DR1 B;  5E79 Z;  2R72 A;  1RPO A;  4N21 A;  5BXZ A;  5HFM A;  1S72 V;  1KYO F;  1OCZ B;  2Q73 A;  5LOV B;  1GRJ A;  2Q0O C;  1ROP A;  1HWY A;  3ZN1 A;  4UVA A;  4WFF A;  4I55 A;  3T1C A;  5KHG A;  4O4H A;  4BIU A;  1VQM V;  2YXL A;  1TGO A;  2JVD A;  3DTU B;  4E2L A;  4UCV A;  4R7C A;  2LFS A;  4NXM B;  3EVK A;  4TT3 G;  2UXD B;  2F93 B;  5LA6 A;  3CCM V;  1H8H G;  4R50 A;  4JAU A;  4UFZ A;  1HNW O;  1O9H A;  4CZZ A;  1KU9 A;  4JV5 O;  2UUC O;  3ZRX A;  4BWA A;  4JF3 A;  5E1A C;  3R66 A;  4WFB V;  4P30 A;  1YIT V;  1AI7 A;  2R70 A;  2KG7 B;  3UO2 A;  1FFT B;  4FPP A;  2CTW A;  3BRC A;  2B1I A;  2OWO A;  1RM1 C;  4MVM A;  4P2Z A;  4KFM A;  4DV1 B;  3JAW B;  1BL8 A;  4DUY B; 
#chains in the Genus database with same CATH homology
 4NTX A;  1WP8 A;  2L35 A;  4FZ1 A;  4FZ0 A;  4NTY A;  3S3X A;  3IJ4 A;  4NYK A;  2QTS A;  3S3W A;  3N27 A;  2FB5 A;  1WP7 A;  4NTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...