4FZ1A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high ph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
410
structure length
406
Chain Sequence
SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
molecule keywords Acid-sensing ion channel 1
total genus 94
structure length 406
sequence length 410
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz1A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz1A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz1A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz1A02
3S3WA 4NTYA 2FB5A 4FZ0A 3IJ4A 2L35A 4NYKA 3S3XA 1WP8A 4NTWA 4FZ1A 4NTXA 1WP7A 3N27A 2QTSA
chains in the Genus database with same CATH superfamily
1IBMB 1SQXH 3TXQA 4DR5B 3P3PA 2CTQA 4X9QA 2LP7A 5AG2A 1S5JA 1XMOB 2EILB 3W7UA 3CCQV 3HR0A 3CCVV 3L73H 2QDOA 1UPGA 4LNUA 4X20B 2O57A 3ETDA 4YXWG 3X2QC 2EIMB 1FXVA 1M57C 1TGOA 1K33A 3ASNB 5LOVB 1BL8A 4LH7A 3Q4HA 2YIDA 3OFNG 3A8TA 1K34A 3CE2A 2JEXA 2JEUA 5CN0A 1KP2A 1B06A 1IBKO 1JOYA 2QM7A 1Q8IA 3JAKB 1MZFA 5BMVA 2BTQB 5B1BB 3ZRSA 3SPGA 5LGNA 2YS8A 2BE3A 3K5MA 1HNWB 1CXZB 4JPRA 3CC4V 2A0LA 3WG7C 3UQ8A 4PI0A 4FFBA 4LFCO 1AVMA 4DR5O 2HVJC 4UCRA 2ZD9A 4PI2A 4HBNA 4O4HA 2N74A 1HDJA 2CGNA 3OMIB 1XMQO 5FLXN 5KUKA 3J80N 4NXMO 3W7WA 3JD4A 2LW7A 2M6YA 5EZYB 3MDSA 2EINB 4FVMA 4GCZA 2OCCB 1PPJH 1WP7A 5CBFA 2DYRC 1H2NA 2Q69A 1IURA 3BVOA 3E35A 4O2BA 4XDLA 2QWRB 4JAVA 1AP5A 4J41A 3B8NA 4X8AA 4B3SO 4DR6B 3OEHG 1L0NH 1QLEB 4TQFA 1SESA 1VEWA 2GTAA 5KX5A 2UU9O 1CEZA 5KX5B 2HHHO 3LDDA 4X62O 1EN6A 5DM6V 3R66A 1W0JG 1D2DA 5LA6A 3JAWA 1Q3EA 3JARA 5LXTA 3ZN0A 4ZOLB 4X62B 1B3QA 4QPKA 5IYDO 3WB0A 1E79G 1Q90D 1JA8A 2UXDB 3IC9A 2CAZC 1BQZA 3AG2B 4KUMA 2UUBO 4O4JA 1RSOB 4FLVA 4CC5A 2A06H 1QCEA 2D2CB 2LGQA 4MVQA 4GT1A 3K5NA 3VBBA 3K03A 2UXBB 1OCZB 3OD4A 5CBGA 1GKFA 2XOKG 1IBLO 3I56V 1G6UA 2E5LO 1PL0A 3OM3B 1FFXB 3E22B 3TK1A 2JJ1G 3JATA 2UXBO 2XHBA 2NR5A 4K8ZA 1SKVA 1S0VA 1F4MA 3B09A 1PKXA 3DXRB 3K5LA 1ZX3A 5EYPB 1WN7A 3BA8A 2L6LA 2FMLA 4RQEA 3AG2C 3JATB 4WBNB 1XNRO 3L71H 3SYAA 3ETEA 2XAQA 1YSCA 1VQKV 1GN2A 2KG7A 4FK5C 1I94O 2ZXWC 4KHPO 3ICXA 1J95A 3OEEG 2PTMA 2PI5A 1EZJA 3RYIB 3SJAC 1S5LZ 1AI6A 4J80A 1XBLA 4LNUB 1NH2D 1HNZO 2RJZA 3THOA 3SJCC 3APOA 4J7KA 2N04A 2CTPA 3OR6C 2QSAA 3ZMVA 2FYUH 4FZ0A 1K7DA 4DO2A 5B66Z 1M90W 3H1HH 1SF9A 1XILA 4I50B 3JARB 5LA6B 2DQ0A 4MVZA 3BHPA 2VWJA 5HFLA 4CBCA 1GH6A 4EB6A 3FB5C 3H1KH 5L3GA 3LSUA 4GX0A 1N4CA 1R3LC 1R3IC 2F66C 1H8HG 5CA1B 2X6CA 1JJ2U 3RYCB 4U7NA 4LH6A 4UCTA 1M9NA 2QWOB 3ABKC 3C3TA 1N33O 3QNEA 1AI4A 1IXBA 2UXNA 5C93A 1ZLZA 4UCOA 1BGYH 1PNMA 3HPLC 1WAZA 4JI2O 3ABMC 4DRXA 4JI8O 5KMGA 1IDSA 1WJZA 5LHIA 4JI5B 3RYFA 5B1AC 4UCUA 4LFCB 1VQ4V 1I0HA 1GN4A 2P22C 3ML0A 4YJ2A 2JRIA 2Y0IA 4NKGB 2EBOA 1KD1W 1YJNV 1S3JA 1XDCA 1DLBA 4CH5A 2JK5C 4PA6A 1U96A 5LP6A 2CGOA 5JQGB 3FYIB 2IM9A 4FM1A 4JI6B 4DR2O 4RWUA 3ABLB 4DR4B 1ZWIC 2XAJA 1LR1A 2E76B 2MK3A 5IJ9B 1AJPA 2KSDA 4IGGA 2PYJA 1QVFU 1VARA 2P6JA 1UFIA 4K0KO 1H8EG 1RM1B 4FLXA 3ZHUA 4Q20A 2Q68A 1OHHG 3CX5F 5JWPA 4DR7O 4WCEV 4JI5O 3T1CA 4KHPB 2KG7B 1IBMO 2F93B 2V7QG 2EJ7A 4TV9A 1EZVH 4ZI7B 1K92A 3QG5A 4L87A 5IWAO 5B1OA 2QKSA 2Q7GA 3WB1A 1IZ3A 2GUZA 1GTOA 3T1HO 1XI1A 2HLDG 2ARHA 1S76D 1PP9H 1PNKA 3CXCU 3CC2V 2DQ3A 5KA5A 1PV0A 3ABKB 1RM1C 2JS5A 2W6JG 1ORQC 5L3CA 4LF8O 4H37A 4WFFA 2NN4A 5ITZB 1TVKB 4U3JB 4PA4A 2HFEC 3H1IH 3JAWB 2LFSA 2OCHA 2ADPA 3LSQA 4MSWC 3HKEB 2UUCO 5J9PC 1R6KA 3F7VC 5IY5C 4IYIA 4A5UB 3DGEA 3ETQA 2PUSA 1FKAO 1VP7A 4DV6O 3I5DA 2F43G 3RT3C 1GN6A 1FYJA 4QE7A 3HKBB 4WFEA 4LF7O 4NTXA 3WB2A 2F4VB 2Y69B 1QU7A 2IH3C 5KUMA 5KHGA 5KHIA 2KKWA 2Y4UA 5L3EA 4UXNA 5KAIZ 2Q7HA 2CH7A 2R9AA 1SZTA 3AG4C 1BT8A 1COWG 1XNQB 2BSKB 5IWAB 1HNZB 5LHHA 4KFMA 4K3AA 1YI2V 3MHSC 3E8HA 1GM8A 4GZRB 1SS3A 2ITDC 3CSXA 2RCVA 5B5EZ 3K04A 1HP8A 1BZKA 4AQYO 2P67A 5LMUO 3C3SA 3SYOA 2LO1A 4X65O 1JFFA 1OCZC 3ZN1A 5BMVB 3FAVB 4UVBA 3ZX6A 3SPHA 3VOUA 1N34O 4BW5A 4AHCA 3P32A 4LFBO 1HNXO 4J9ZB 3AK2A 4DYLA 4X1IB 5H6QA 2W0FC 1QR9A 3FD9A 4EKWA 1E1RG 3OTOB 4EFBA 3OW2U 3CCEV 4GX2A 1BCCH 3KG2A 4DV6B 4PD4F 3ZHRA 2QEXV 4YY3B 2EX3A 3E89A 3RGBA 3J81N 1XMQB 1M56B 2AZ2A 5B1NA 1N36O 4TSFG 2JGDA 4JI1B 3OUFA 1MSDA 4PA3A 1G4YB 4B7KA 3CD6V 4UUJC 2BCCH 2QJ1A 1SETA 5GONA 3STZC 2YXHA 5BY1A 4GYCB 2HKOA 2BTOA 3M8AA 3P30A 4LF8B 3CPWU 2B1GA 4YJ3B 3UO3A 4D7SA 2EILC 4BAYA 2V4DA 3N2GA 2WWWA 3D8CA 3EXAA 2M7WA 3UT5A 4WFAV 5A9GA 4HZ3A 4H33A 3QTCA 3UT5B 5IYBO 2QWQB 3AG3C 2P4VA 4W4LA 1FAFA 1Y74A 5LP6C 5IJ0B 4MVRA 4NXNO 5DEDA 1KYOF 5LYJB 2Y0PA 3BEHA 1G8MA 1OJHA 3KZIZ 1YDXA 2UUAB 4GLXA 3GVMA 4YHHB 2RNBA 2WA3A 1MOFA 5GONB 1H38A 1H2MA 1S5HC 3N2GB 2X6BA 3D36A 1X4TA 1MABG 2XASA 3JSLA 3NXSA 3L9DA 4UV9A 4MTGA 4LWSA 1NTKH 5JCOA 3CP1A 3RYHB 1Z5WA 3ZIAG 1Y66A 3VQWA 1N0JA 1K97A 1OCCB 3K08A 3FB6C 4ZHQA 2ODMA 2YXYA 1BMFG 3ASOC 1NU1H 3FX7A 3M99B 2R72A 2H3OA 4KP4A 2CDYA 1WP8A 3U0ZA 4J10A 2FTKA 3QF7A 1Q86W 3QVNA 4N21A 4JYYA 4MS2A 3RBZA 1VQOV 1AI7A 1XMOO 4FLWA 3RVZA 2ETNA 3JAMN 3ZJZA 2UXXA 4JV5O 2PGGA 5JJEB 2ZINA 1JX9A 4I55A 2LQTA 4UB6Z 3ZHSA 4AI8A 1NR7A 1N33B 3CXHF 2D3OW 1XHZA 4R8CA 2K9PA 5F2VO 2ATKC 3MHHC 3AG7A 1TUEB 2GHYA 3L70H 1OCCC 3OTOO 4DUZB 3BAAA 2ZR3A 3OGIB 3RYHA 1GMGA 2DMXA 4LWSB 2QWPB 4JYCA 3MAQA 1U97A 2ZNIA 2QM8A 4FFKA 1QR8A 2AW9A 2W6IG 2Q6AA 3SYCA 1KUQA 3J7AU 5A2QN 1KP3A 2HEPA 4IT5A 4JI7O 3JALA 2UUBB 3BCCH 4D7TA 3K58A 4I9QA 4CH4A 3FFQA 2K1EA 3SJQC 1OCOC 4ABMA 2QGNA 5C8YA 3SPCA 3G4SV 2EINC 4OPHA 4UB8Z 2ZDIC 5JCOC 1P49A 4LFAO 1M56C 3G80A 1RPRA 2YEVA 2HHHB 1J5EO 4F4LA 2ZNJA 3N27A 3ZRWA 1P7GA 3ABMB 3AK1A 3N2KA 2VQFO 3CRQA 4YJ3A 4CS4A 2UXCB 3OGCC 1K5SA 4JYBA 4U3JA 3BY6A 1AP6A 5LGTA 2QTOA 2WLMA 4RQFA 4BWAA 3CRMA 4CC6A 1K4DC 1URFA 2EIMC 2XTAA 1PM9A 2OIGA 2GTSA 1SERA 2ZIMA 3QO5A 2AZ0A 5J2UA 4X66O 3L72H 2WLIA 4P30A 2H94A 3BFRA 1B04A 3OMNB 4UVCA 4TOIA 3DTUB 4LF5B 3D3QA 4DK0A 3F5TA 4BIZA 5CA0B 2B1IA 5KHKA 2IJHA 1KC8W 1Y76A 2V1DA 3RFRA 3HKDA 3DC5A 4GKKO 2EIJC 2DE0X 4LP8A 3B77A 1Y67A 2ZE6A 1QHTA 3S3WA 3B4SA 1KECA 1L1FA 2Q8VA 4DR6O 1AILA 3BABA 5J2TB 3ZMTA 1L0LH 1YTFB 4DV0B 4HNAA 4AILC 1WA8A 3ASNC 1K3EA 1YF2A 4X88A 4ZI7A 1QVGU 4TV9B 4HYOA 2HJDA 4IIJA 4WFBV 5JQGA 4FZ1A 4PDMA 4LF9B 3CMEV 4DV7B 5IDJA 4NXMB 1AR1B 4JI8B 4DR3O 1SC5B 1US6A 5KA6A 4YHHO 3SGIA 4PA9A 5IJ9A 1I5YA 1M5IA 1SQGA 1DF4A 1VQMV 1IXMA 2QTSA 2EIKC 1V54C 4DR7B 1KKDA 4GX5A 2HVKC 3PJSK 4F6RB 1MG1A 2DWEC 3ZBHA 2VQEO 4EEQA 2YUAA 4J9YB 1EN5A 3ZRVA 4CH6A 4GX1A 4X1YB 2Q0OC 2Q0AA 1SQQH 3A0RA 2YI9A 4DR4O 4BIUA 4OXSA 2L35A 2QM4A 1MSWD 2P06A 1GRJA 3RYFB 3IGAC 1WB8A 3HB3B 4TQDA 4PJ0Z 4LF4B 2ZR2A 2LGWA 1VQ7V 2PY5A 4XBFA 4I0XB 2LFRA 4KL1A 4LBEC 5LMNO 3K0DA 3OR7C 4WFGA 2DW4A 2IJJA 4P9OA 4R50A 4F6RA 1DF5A 5FL7G 2OIEA 5LMUB 4J11A 4B7EA 3E83A 1TVKA 2ZIOA 3CJHA 1GM9A 1WNSA 4B3MB 4H44B 1P84F 4JZ2A 2WA4A 5B1AB 3G71V 2G38A 1V54B 3PN1A 4JYAO 5JVDA 1FJGO 3BPZA 5L3BA 1M57B 2B5UA 2HR3A 2WLNA 2X7RB 1YCIA 3X2QB 2WLLB 5CBHA 1HR0O 3ABLC 1V55B 1GM7A 3HKCA 4WBNA 2B9ZA 2PF4E 1NI8A 5LBQA 2E3CA 1DGSA 2E5LB 3FYEB 4HNAB 4PV1B 3B8MA 3ETGA 1CPYA 2YDEA 5BZBA 1HNXB 3JAKA 1VIBA 4DUZO 2UXCO 3VQXA 4LF7B 1R1BA 1N0NA 2ITCC 3GB7C 4X65B 2UXDO 2WLHA 2F1MA 3Q4HB 2Z5UA 2Q9LA 3OUSA 5EYPA 2Q73A 2ZM6O 2CTWA 4X20A 1Q81W 1K73W 4O4IA 3CEIA 3EHBB 3HKDB 3LNNA 1Y76B 4X64B 1NVPD 2KQXA 4FM0A 5CA0A 1YEWA 2IU0A 1HW7A 4DK1A 2QKAA 4IL6Z 3ZMUA 4Q6GA 4ZIBA 1FXHA 3W7SA 4Z2WA 4J42A 1JQ0A 1AJNA 4DV2B 4MVUA 4Z1MG 1W2BU 3FB7C 5EBLC 1YHQV 5H2FZ 4DV3O 4TV8B 4DR1O 1FD9A 2OWOA 3STLC 1BSMA 4DV1B 1A32A 3CB2A 1I7FA 3CJHB 1QNMA 3A0HZ 3I55V 3TCUA 3T2MA 3SDLA 3T1HB 1AI5A 1N34B 1OZ0A 4JZGA 1AJQA 1EFRG 2YICA 3ZRWB 1Q6UA 5LL6Y 1BHBA 5D5PA 1BE3H 4QNHB 1XL4A 1FJGB 1S77D 3B2EE 1JVMA 5IY5B 1RFYA 3ZRXA 4OGQB 3AEIA 3W7XA 1N8RW 3D3IA 1QLNA 1DK1A 5EIBD 5EZYA 3WFVA 2HJFC 5JJJB 1FS0G 1YXBA 4DUYO 2OTJV 5LMNB 1WPBA 4UCSA 4QIWF 5JH7B 2DJVA 2XAHA 1GN3A 4LF4O 4JI7B 1KU9A 2ZT9B 2R9RB 1IBKB 2IW5A 2P7TC 1R6TA 4JI6O 3K59A 5EBMC 2P5OA 2AGAA 1QQCA 4JI4B 1YVWA 3AG4B 2IBZH 1HWYA 2RMKB 4PDVA 1IVSA 2DOSA 4DV4O 4HAMA 5H6RA 1F23A 2CUGA 2PI4A 3M7MX 1KQSU 5IYCO 1N32O 3C90A 4CH3A 5EBWC 2R9IA 4O4LB 1XOUA 4LCUC 1QBZA 2EJRA 5J2TA 5BR8B 4OX9B 4KXRA 4DR3B 2GSMB 3TETA 3OTFA 1UJWB 2EULA 4B3RB 2Q7EA 2QR4A 3ZCCA 4DW0A 1TAEA 1RPOA 1NH2B 3HKCB 1VF6A 1FFXA 3E22A 1SRYA 1F7YA 1W59A 5B3SC 5LOVA 2GDSA 2WPDG 4OPAA 4UV8A 2A9HA 4JI3O 3CRRA 1O9HA 2IJIA 1XL6A 3E2EA 3D36C 3K0GA 2OTLV 2OCCC 2C2AA 4LFBB 1V55C 2JGUA 4DW1A 4J7ZA 1AR5A 4ZOLA 5LXTB 5JH7A 4NR1A 5L3FA 4RO2A 5KHJA 3K9AA 2YI8A 3K79A 4CS3A 3E8BA 1NT2B 4NYKA 4DUYB 3ABUA 4I0XA 3LSSA 1WB7A 3CHXA 3TJTA 2DYSB 3JD2A 4JTDB 4LR3A 4FM2A 3JASA 2Q67A 4B3RO 2PYLA 4I4TA 2Y48A 1N36B 3WU2Z 5BR8O 4OX9O 2EIKB 5K1PA 4ZKIA 1OCRC 2UUAO 4YY3O 1GAXA 1DTOA 4FLUA 1GK9A 5B3SB 4I9WA 2WAMA 4LF9O 4MTOA 2AHZA 4X1YA 1FXKB 1JCHA 1VQLV 3SJBC 1EM1A 2Z0AA 4O2BB 5IJ0A 1Y74B 2YEVB 2ZE8A 2IU3A 3CCSV 3F5WC 3ZHTA 1SA0A 4N23A 3U10A 5C8YB 3ZEDA 2DYSC 5HFMA 1BHAA 1Y6XA 4MW8A 1VQ6V 3AG1B 1LNQA 5FPOA 4JI3B 1VQ9V 3EFFK 4DV2O 4JTCB 3MD0A 4H13B 3QO7A 1VMGA 1S72V 3BRCA 3CC7V 1K5QA 4WF9V 2E75B 1ZL8B 4J7JA 4LFAB 4FFBB 2XAGA 2QA4V 3ZHVA 3OAAG 5E1AC 2YXLA 5E79Z 1BS3A 2E74B 1WA8B 4IYHA 4NTYA 2BOBC 4XDKA 3OT7A 4O4IB 1KKCA 2JGDB 1JJOA 1XNRB 4JI2B 2BTQA 3LDEA 3ZMZA 2P4KA 1K8AW 1B6QA 4X89A 3L74H 4BW9A 1VF5B 4X1KA 2A79B 2FL4A 2LJ2A 1N32B 1EBOA 2IJKA 1LUVA 2EZPA 1YTFD 1XEQA 2MW2B 3JD0A 3ASOB 3FB8C 3K5OA 5IYZB 2EIJB 1ZAUA 3A0BZ 4I55B 1FPOA 4LF6B 4BR6A 1QLEC 3EVKA 4X1IA 1TUBA 1JR9A 1VQPV 3KKYA 3T1YO 3UCSC 2JJ2G 2WLLA 4G28B 3KCYA 1Q43A 1R73A 1K9MW 3FAVA 1JFFB 1T5EA 3LUTB 5EC1C 4NTWA 2RN9A 3G6BA 4E4EA 2OT5A 4TUYB 3ZHQA 3K06A 5JVDB 3CCRV 5IT9N 1NQTA 1Q7YW 1PD3A 5LGUA 3SPIA 4FJCC 4G2KA 4JI0O 2UUCB 3NR7A 2F23A 4CS2A 1VQ5V 1NJIW 3SPJA 4JV5B 2DYRB 2N05A 5CB4B 4DXWA 1KMIZ 2IH1C 4MVMA 2JS3A 1IX9A 1R3KC 1JMKC 4U3FH 4IHJA 1O9GA 1SQPH 3E86A 3S3XA 4FLTA 3AG1C 1XNQO 2WLJA 2CE4A 3BA9A 2KB1A 1VF6C 3T1YB 2XAFA 3U11A 2RDCA 2CH7B 3E8GA 1Z2GA 4R6ZA 2PZSA 2ZCEA 2H8PC 1IBLB 5LYJA 1NKDA 1OCOB 3G67A 4PDRA 3RVYA 1Z5VA 2AXTZ 1THZA 2DWDC 1CP9A 3B40A 2VQEB 4MVSA 3T4DA 3H1LH 3GWKC 3FKSG 2A7WA 1YIJV 2QE7G 4MTFA 2WLKA 3JYCA 1NTZH 5FPRA 4JYAB 4IHJB 3SYPA 1L8DA 4NB5A 5DECA 5GTHZ 3JCUZ 3VQVA 1KB9F 1X59A 2VRZA 4P9PA 4B3MO 2JDIG 2ZE7A 4I5SA 5KHHA 1SZXA 4WFHA 3L75H 2YIAA 4QJFB 4FMTA 1M4UA 4DV5B 1ZSPA 4IIJB 3F7YC 2P90A 3O65A 1HNWO 1F4NA 4MVOA 1SQVH 5D5QA 3IFXA 4TT3G 1FXKC 1P7BA 1I08A 3UM7A 4QPJA 4UFZA 3JCZA 3TGUH 4O2AB 1MZEA 2QKCA 5EC2C 1AROP 5IE9A 2X6AA 1M93A 2ADQB 2YIBD 3IJ4A 1PNLA 2ZKOA 1XQ8A 4GKJO 5BXZA 3VQYA 5EK0A 4DV5O 1EN4A 5GW7A 5FNVB 2GV9A 1E1QG 4O2AA 4GKKB 5FNVA 2ZE5A 5IYZA 1D5AA 1AR4A 3H9VA 4MW3A 3CS5A 2GBOA 1H2GA 5CMUA 4CZZA 4D6TH 1NBMG 4XDJA 4ZHQB 2AHYA 1R3JC 4YIOA 3A2FA 4PELA 1XREA 1K4CC 1OV9A 5CA3A 2Z3YA 2WLIB 1OCRB 5J2UB 4X66B 4YIPA 1D5NA 1SQFA 3T4ZA 1AB3A 2YSUB 4GKJB 4EFEA 4DV4B 3GWOA 3SYQA 4JGSA 4PHZA 5L3DA 3ZS8C 3OMAB 2VWKA 4DV1O 4JI4O 2ZQMA 4DV0O 2EZOA 4K8XA 4NVPA 4UVAA 3W7TA 4DV3B 4UCVA 3AG3B 1M1KW 2ILMA 3G6EV 5DN6G 2XNDG 1G1XB 2X0LA 4K35A 5LHGA 3IC7A 3N2KB 3R65A 2R70A 2JIZG 2WSSG 4YJ2B 2QWNB 1J5EB 1H2KA 2W0XA 1RP3B 3OE7G 5H9CA 1SA0B 3AK3A 3DC6A 3ABTA 2NLJC 5EIBC 5GTIZ 2ZM6B 3E8FA 4DRXB 1ENVA 1FXKA 1BQ0A 4MTXA 4C7UA 3IAYA 2Q5ZA 2Y4TA 3RN4A 5CB4A 4B3TO 3JALB 2OYQA 3CCUV 1ZTEA 3KCXA 3RYCA 1MMMA 4I4TB 4FPPA 3JASB 4RAIA 2VS0A 4R7CA 4L8JA 2HG5C 4EB6B 3JD3A 4FLYA 4PA7A 3HKEA 1TA8A 1XUQA 4GUNA 2Y69C 3P3NA 1Q6IA 4PDLA 4I50A 4W4KA 1MA1A 1GO3F 1P4RA 4ASUG 2DN9A 5ITZA 1NS1A 1MNGA 1R6NA 4B3TB 4TUYA 3O9OA 2Q4PA 3RWRD 2JVDA 1JPXA 4MT8A 3RYIA 4AQYB 2YIBA 1NR1A 1I94B 2XUMA 4JI0B 4ZBMA 1PL4A 3TXSA 4FIPC 5TISZ 4JASA 4X1KB 4B08A 1TUBB 1YZBA 5H5NA 3LNMB 2GUZB 4LF5O 4BIOA 1YITV 4RUFA 3CCMV 2F95B 4QE9A 3DXRA 2UU9B 1ROPA 3CYOA 4LC1A 4O4LA 3SR2C 3K9SA 2FKXA 4U7OA 4JTAB 4ICGA 3CCJV 1KBHA 4E2LA 4LF6O 3DSQA 2BOCC 4DR1B 1ZUQA 2F4VO 5K1XA 2NNUA 1XHXA 1Q82W 2VQFB 2RQ6A 4TWKA 1Q5OA 1RSOA 2BSKA 4O4JB 1LUWA 1NTMH 3UKMA 1ZL8A 3CMAV 1F51A 4H0LB 5B1BC 1V9PA 4X64O 1SQBH 2YC0A 4F6EA 5LP6B 1I5XA 1VF7A 3RW0A 3APQA 4DV7O 3QO8A 3K3WA 3WG7B 3CRAA 3ZMSA 4Z1VA 1VQNV 3K57A 3CRCA 3HKBA 4JF3A 4RUEA 4NXNB 1FFTB 4K0KB 4P2ZA 1VQ8V 4FLZA 5KAFZ 2HP8A 3JSNA 3LDCA 2ZDIA 1Q6HA 2FB5A 4B3SB 2CTRA 5KMGB 4JAUA 4DR2B 3CWBH 3JD1A 2XT9A 5KLVH 3UO2A 4G27B 1NVPB 4QGPA 2A3QA 1NZ6A 5JJNB 1W0KG 5CA1A 1Y4MA 2ZXWB 3H1JH 1H2SB 1HR0B 4TV8A 1WLEA 1WPXA 2CK3G 2LW1A 4JI1O 4JAAA 3CCLV 1YJWV 1H2LA 3H01A 1YJ9V 4O4HB 4I7ZB
chains in the Genus database with same CATH topology
3S3WA 4NTYA 2FB5A 4FZ0A 3IJ4A 2L35A 4NYKA 3S3XA 1WP8A 4NTWA 4FZ1A 4NTXA 1WP7A 3N27A 2QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3W A;  4NTY A;  2FB5 A;  4FZ0 A;  3IJ4 A;  2L35 A;  4NYK A;  3S3X A;  1WP8 A;  4NTW A;  4FZ1 A;  4NTX A;  1WP7 A;  3N27 A;  2QTS A; 
#chains in the Genus database with same CATH topology
 1IBM B;  1SQX H;  3TXQ A;  4DR5 B;  3P3P A;  2CTQ A;  4X9Q A;  2LP7 A;  5AG2 A;  1S5J A;  1XMO B;  2EIL B;  3W7U A;  3CCQ V;  3HR0 A;  3CCV V;  3L73 H;  2QDO A;  1UPG A;  4LNU A;  4X20 B;  2O57 A;  3ETD A;  4YXW G;  3X2Q C;  2EIM B;  1FXV A;  1M57 C;  1TGO A;  1K33 A;  3ASN B;  5LOV B;  1BL8 A;  4LH7 A;  3Q4H A;  2YID A;  3OFN G;  3A8T A;  1K34 A;  3CE2 A;  2JEX A;  2JEU A;  5CN0 A;  1KP2 A;  1B06 A;  1IBK O;  1JOY A;  2QM7 A;  1Q8I A;  3JAK B;  1MZF A;  5BMV A;  2BTQ B;  5B1B B;  3ZRS A;  3SPG A;  5LGN A;  2YS8 A;  2BE3 A;  3K5M A;  1HNW B;  1CXZ B;  4JPR A;  3CC4 V;  2A0L A;  3WG7 C;  3UQ8 A;  4PI0 A;  4FFB A;  4LFC O;  1AVM A;  4DR5 O;  2HVJ C;  4UCR A;  2ZD9 A;  4PI2 A;  4HBN A;  4O4H A;  2N74 A;  1HDJ A;  2CGN A;  3OMI B;  1XMQ O;  5FLX N;  5KUK A;  3J80 N;  4NXM O;  3W7W A;  3JD4 A;  2LW7 A;  2M6Y A;  5EZY B;  3MDS A;  2EIN B;  4FVM A;  4GCZ A;  2OCC B;  1PPJ H;  1WP7 A;  5CBF A;  2DYR C;  1H2N A;  2Q69 A;  1IUR A;  3BVO A;  3E35 A;  4O2B A;  4XDL A;  2QWR B;  4JAV A;  1AP5 A;  4J41 A;  3B8N A;  4X8A A;  4B3S O;  4DR6 B;  3OEH G;  1L0N H;  1QLE B;  4TQF A;  1SES A;  1VEW A;  2GTA A;  5KX5 A;  2UU9 O;  1CEZ A;  5KX5 B;  2HHH O;  3LDD A;  4X62 O;  1EN6 A;  5DM6 V;  3R66 A;  1W0J G;  1D2D A;  5LA6 A;  3JAW A;  1Q3E A;  3JAR A;  5LXT A;  3ZN0 A;  4ZOL B;  4X62 B;  1B3Q A;  4QPK A;  5IYD O;  3WB0 A;  1E79 G;  1Q90 D;  1JA8 A;  2UXD B;  3IC9 A;  2CAZ C;  1BQZ A;  3AG2 B;  4KUM A;  2UUB O;  4O4J A;  1RSO B;  4FLV A;  4CC5 A;  2A06 H;  1QCE A;  2D2C B;  2LGQ A;  4MVQ A;  4GT1 A;  3K5N A;  3VBB A;  3K03 A;  2UXB B;  1OCZ B;  3OD4 A;  5CBG A;  1GKF A;  2XOK G;  1IBL O;  3I56 V;  1G6U A;  2E5L O;  1PL0 A;  3OM3 B;  1FFX B;  3E22 B;  3TK1 A;  2JJ1 G;  3JAT A;  2UXB O;  2XHB A;  2NR5 A;  4K8Z A;  1SKV A;  1S0V A;  1F4M A;  3B09 A;  1PKX A;  3DXR B;  3K5L A;  1ZX3 A;  5EYP B;  1WN7 A;  3BA8 A;  2L6L A;  2FML A;  4RQE A;  3AG2 C;  3JAT B;  4WBN B;  1XNR O;  3L71 H;  3SYA A;  3ETE A;  2XAQ A;  1YSC A;  1VQK V;  1GN2 A;  2KG7 A;  4FK5 C;  1I94 O;  2ZXW C;  4KHP O;  3ICX A;  1J95 A;  3OEE G;  2PTM A;  2PI5 A;  1EZJ A;  3RYI B;  3SJA C;  1S5L Z;  1AI6 A;  4J80 A;  1XBL A;  4LNU B;  1NH2 D;  1HNZ O;  2RJZ A;  3THO A;  3SJC C;  3APO A;  4J7K A;  2N04 A;  2CTP A;  3OR6 C;  2QSA A;  3ZMV A;  2FYU H;  4FZ0 A;  1K7D A;  4DO2 A;  5B66 Z;  1M90 W;  3H1H H;  1SF9 A;  1XIL A;  4I50 B;  3JAR B;  5LA6 B;  2DQ0 A;  4MVZ A;  3BHP A;  2VWJ A;  5HFL A;  4CBC A;  1GH6 A;  4EB6 A;  3FB5 C;  3H1K H;  5L3G A;  3LSU A;  4GX0 A;  1N4C A;  1R3L C;  1R3I C;  2F66 C;  1H8H G;  5CA1 B;  2X6C A;  1JJ2 U;  3RYC B;  4U7N A;  4LH6 A;  4UCT A;  1M9N A;  2QWO B;  3ABK C;  3C3T A;  1N33 O;  3QNE A;  1AI4 A;  1IXB A;  2UXN A;  5C93 A;  1ZLZ A;  4UCO A;  1BGY H;  1PNM A;  3HPL C;  1WAZ A;  4JI2 O;  3ABM C;  4DRX A;  4JI8 O;  5KMG A;  1IDS A;  1WJZ A;  5LHI A;  4JI5 B;  3RYF A;  5B1A C;  4UCU A;  4LFC B;  1VQ4 V;  1I0H A;  1GN4 A;  2P22 C;  3ML0 A;  4YJ2 A;  2JRI A;  2Y0I A;  4NKG B;  2EBO A;  1KD1 W;  1YJN V;  1S3J A;  1XDC A;  1DLB A;  4CH5 A;  2JK5 C;  4PA6 A;  1U96 A;  5LP6 A;  2CGO A;  5JQG B;  3FYI B;  2IM9 A;  4FM1 A;  4JI6 B;  4DR2 O;  4RWU A;  3ABL B;  4DR4 B;  1ZWI C;  2XAJ A;  1LR1 A;  2E76 B;  2MK3 A;  5IJ9 B;  1AJP A;  2KSD A;  4IGG A;  2PYJ A;  1QVF U;  1VAR A;  2P6J A;  1UFI A;  4K0K O;  1H8E G;  1RM1 B;  4FLX A;  3ZHU A;  4Q20 A;  2Q68 A;  1OHH G;  3CX5 F;  5JWP A;  4DR7 O;  4WCE V;  4JI5 O;  3T1C A;  4KHP B;  2KG7 B;  1IBM O;  2F93 B;  2V7Q G;  2EJ7 A;  4TV9 A;  1EZV H;  4ZI7 B;  1K92 A;  3QG5 A;  4L87 A;  5IWA O;  5B1O A;  2QKS A;  2Q7G A;  3WB1 A;  1IZ3 A;  2GUZ A;  1GTO A;  3T1H O;  1XI1 A;  2HLD G;  2ARH A;  1S76 D;  1PP9 H;  1PNK A;  3CXC U;  3CC2 V;  2DQ3 A;  5KA5 A;  1PV0 A;  3ABK B;  1RM1 C;  2JS5 A;  2W6J G;  1ORQ C;  5L3C A;  4LF8 O;  4H37 A;  4WFF A;  2NN4 A;  5ITZ B;  1TVK B;  4U3J B;  4PA4 A;  2HFE C;  3H1I H;  3JAW B;  2LFS A;  2OCH A;  2ADP A;  3LSQ A;  4MSW C;  3HKE B;  2UUC O;  5J9P C;  1R6K A;  3F7V C;  5IY5 C;  4IYI A;  4A5U B;  3DGE A;  3ETQ A;  2PUS A;  1FKA O;  1VP7 A;  4DV6 O;  3I5D A;  2F43 G;  3RT3 C;  1GN6 A;  1FYJ A;  4QE7 A;  3HKB B;  4WFE A;  4LF7 O;  4NTX A;  3WB2 A;  2F4V B;  2Y69 B;  1QU7 A;  2IH3 C;  5KUM A;  5KHG A;  5KHI A;  2KKW A;  2Y4U A;  5L3E A;  4UXN A;  5KAI Z;  2Q7H A;  2CH7 A;  2R9A A;  1SZT A;  3AG4 C;  1BT8 A;  1COW G;  1XNQ B;  2BSK B;  5IWA B;  1HNZ B;  5LHH A;  4KFM A;  4K3A A;  1YI2 V;  3MHS C;  3E8H A;  1GM8 A;  4GZR B;  1SS3 A;  2ITD C;  3CSX A;  2RCV A;  5B5E Z;  3K04 A;  1HP8 A;  1BZK A;  4AQY O;  2P67 A;  5LMU O;  3C3S A;  3SYO A;  2LO1 A;  4X65 O;  1JFF A;  1OCZ C;  3ZN1 A;  5BMV B;  3FAV B;  4UVB A;  3ZX6 A;  3SPH A;  3VOU A;  1N34 O;  4BW5 A;  4AHC A;  3P32 A;  4LFB O;  1HNX O;  4J9Z B;  3AK2 A;  4DYL A;  4X1I B;  5H6Q A;  2W0F C;  1QR9 A;  3FD9 A;  4EKW A;  1E1R G;  3OTO B;  4EFB A;  3OW2 U;  3CCE V;  4GX2 A;  1BCC H;  3KG2 A;  4DV6 B;  4PD4 F;  3ZHR A;  2QEX V;  4YY3 B;  2EX3 A;  3E89 A;  3RGB A;  3J81 N;  1XMQ B;  1M56 B;  2AZ2 A;  5B1N A;  1N36 O;  4TSF G;  2JGD A;  4JI1 B;  3OUF A;  1MSD A;  4PA3 A;  1G4Y B;  4B7K A;  3CD6 V;  4UUJ C;  2BCC H;  2QJ1 A;  1SET A;  5GON A;  3STZ C;  2YXH A;  5BY1 A;  4GYC B;  2HKO A;  2BTO A;  3M8A A;  3P30 A;  4LF8 B;  3CPW U;  2B1G A;  4YJ3 B;  3UO3 A;  4D7S A;  2EIL C;  4BAY A;  2V4D A;  3N2G A;  2WWW A;  3D8C A;  3EXA A;  2M7W A;  3UT5 A;  4WFA V;  5A9G A;  4HZ3 A;  4H33 A;  3QTC A;  3UT5 B;  5IYB O;  2QWQ B;  3AG3 C;  2P4V A;  4W4L A;  1FAF A;  1Y74 A;  5LP6 C;  5IJ0 B;  4MVR A;  4NXN O;  5DED A;  1KYO F;  5LYJ B;  2Y0P A;  3BEH A;  1G8M A;  1OJH A;  3KZI Z;  1YDX A;  2UUA B;  4GLX A;  3GVM A;  4YHH B;  2RNB A;  2WA3 A;  1MOF A;  5GON B;  1H38 A;  1H2M A;  1S5H C;  3N2G B;  2X6B A;  3D36 A;  1X4T A;  1MAB G;  2XAS A;  3JSL A;  3NXS A;  3L9D A;  4UV9 A;  4MTG A;  4LWS A;  1NTK H;  5JCO A;  3CP1 A;  3RYH B;  1Z5W A;  3ZIA G;  1Y66 A;  3VQW A;  1N0J A;  1K97 A;  1OCC B;  3K08 A;  3FB6 C;  4ZHQ A;  2ODM A;  2YXY A;  1BMF G;  3ASO C;  1NU1 H;  3FX7 A;  3M99 B;  2R72 A;  2H3O A;  4KP4 A;  2CDY A;  1WP8 A;  3U0Z A;  4J10 A;  2FTK A;  3QF7 A;  1Q86 W;  3QVN A;  4N21 A;  4JYY A;  4MS2 A;  3RBZ A;  1VQO V;  1AI7 A;  1XMO O;  4FLW A;  3RVZ A;  2ETN A;  3JAM N;  3ZJZ A;  2UXX A;  4JV5 O;  2PGG A;  5JJE B;  2ZIN A;  1JX9 A;  4I55 A;  2LQT A;  4UB6 Z;  3ZHS A;  4AI8 A;  1NR7 A;  1N33 B;  3CXH F;  2D3O W;  1XHZ A;  4R8C A;  2K9P A;  5F2V O;  2ATK C;  3MHH C;  3AG7 A;  1TUE B;  2GHY A;  3L70 H;  1OCC C;  3OTO O;  4DUZ B;  3BAA A;  2ZR3 A;  3OGI B;  3RYH A;  1GMG A;  2DMX A;  4LWS B;  2QWP B;  4JYC A;  3MAQ A;  1U97 A;  2ZNI A;  2QM8 A;  4FFK A;  1QR8 A;  2AW9 A;  2W6I G;  2Q6A A;  3SYC A;  1KUQ A;  3J7A U;  5A2Q N;  1KP3 A;  2HEP A;  4IT5 A;  4JI7 O;  3JAL A;  2UUB B;  3BCC H;  4D7T A;  3K58 A;  4I9Q A;  4CH4 A;  3FFQ A;  2K1E A;  3SJQ C;  1OCO C;  4ABM A;  2QGN A;  5C8Y A;  3SPC A;  3G4S V;  2EIN C;  4OPH A;  4UB8 Z;  2ZDI C;  5JCO C;  1P49 A;  4LFA O;  1M56 C;  3G80 A;  1RPR A;  2YEV A;  2HHH B;  1J5E O;  4F4L A;  2ZNJ A;  3N27 A;  3ZRW A;  1P7G A;  3ABM B;  3AK1 A;  3N2K A;  2VQF O;  3CRQ A;  4YJ3 A;  4CS4 A;  2UXC B;  3OGC C;  1K5S A;  4JYB A;  4U3J A;  3BY6 A;  1AP6 A;  5LGT A;  2QTO A;  2WLM A;  4RQF A;  4BWA A;  3CRM A;  4CC6 A;  1K4D C;  1URF A;  2EIM C;  2XTA A;  1PM9 A;  2OIG A;  2GTS A;  1SER A;  2ZIM A;  3QO5 A;  2AZ0 A;  5J2U A;  4X66 O;  3L72 H;  2WLI A;  4P30 A;  2H94 A;  3BFR A;  1B04 A;  3OMN B;  4UVC A;  4TOI A;  3DTU B;  4LF5 B;  3D3Q A;  4DK0 A;  3F5T A;  4BIZ A;  5CA0 B;  2B1I A;  5KHK A;  2IJH A;  1KC8 W;  1Y76 A;  2V1D A;  3RFR A;  3HKD A;  3DC5 A;  4GKK O;  2EIJ C;  2DE0 X;  4LP8 A;  3B77 A;  1Y67 A;  2ZE6 A;  1QHT A;  3S3W A;  3B4S A;  1KEC A;  1L1F A;  2Q8V A;  4DR6 O;  1AIL A;  3BAB A;  5J2T B;  3ZMT A;  1L0L H;  1YTF B;  4DV0 B;  4HNA A;  4AIL C;  1WA8 A;  3ASN C;  1K3E A;  1YF2 A;  4X88 A;  4ZI7 A;  1QVG U;  4TV9 B;  4HYO A;  2HJD A;  4IIJ A;  4WFB V;  5JQG A;  4FZ1 A;  4PDM A;  4LF9 B;  3CME V;  4DV7 B;  5IDJ A;  4NXM B;  1AR1 B;  4JI8 B;  4DR3 O;  1SC5 B;  1US6 A;  5KA6 A;  4YHH O;  3SGI A;  4PA9 A;  5IJ9 A;  1I5Y A;  1M5I A;  1SQG A;  1DF4 A;  1VQM V;  1IXM A;  2QTS A;  2EIK C;  1V54 C;  4DR7 B;  1KKD A;  4GX5 A;  2HVK C;  3PJS K;  4F6R B;  1MG1 A;  2DWE C;  3ZBH A;  2VQE O;  4EEQ A;  2YUA A;  4J9Y B;  1EN5 A;  3ZRV A;  4CH6 A;  4GX1 A;  4X1Y B;  2Q0O C;  2Q0A A;  1SQQ H;  3A0R A;  2YI9 A;  4DR4 O;  4BIU A;  4OXS A;  2L35 A;  2QM4 A;  1MSW D;  2P06 A;  1GRJ A;  3RYF B;  3IGA C;  1WB8 A;  3HB3 B;  4TQD A;  4PJ0 Z;  4LF4 B;  2ZR2 A;  2LGW A;  1VQ7 V;  2PY5 A;  4XBF A;  4I0X B;  2LFR A;  4KL1 A;  4LBE C;  5LMN O;  3K0D A;  3OR7 C;  4WFG A;  2DW4 A;  2IJJ A;  4P9O A;  4R50 A;  4F6R A;  1DF5 A;  5FL7 G;  2OIE A;  5LMU B;  4J11 A;  4B7E A;  3E83 A;  1TVK A;  2ZIO A;  3CJH A;  1GM9 A;  1WNS A;  4B3M B;  4H44 B;  1P84 F;  4JZ2 A;  2WA4 A;  5B1A B;  3G71 V;  2G38 A;  1V54 B;  3PN1 A;  4JYA O;  5JVD A;  1FJG O;  3BPZ A;  5L3B A;  1M57 B;  2B5U A;  2HR3 A;  2WLN A;  2X7R B;  1YCI A;  3X2Q B;  2WLL B;  5CBH A;  1HR0 O;  3ABL C;  1V55 B;  1GM7 A;  3HKC A;  4WBN A;  2B9Z A;  2PF4 E;  1NI8 A;  5LBQ A;  2E3C A;  1DGS A;  2E5L B;  3FYE B;  4HNA B;  4PV1 B;  3B8M A;  3ETG A;  1CPY A;  2YDE A;  5BZB A;  1HNX B;  3JAK A;  1VIB A;  4DUZ O;  2UXC O;  3VQX A;  4LF7 B;  1R1B A;  1N0N A;  2ITC C;  3GB7 C;  4X65 B;  2UXD O;  2WLH A;  2F1M A;  3Q4H B;  2Z5U A;  2Q9L A;  3OUS A;  5EYP A;  2Q73 A;  2ZM6 O;  2CTW A;  4X20 A;  1Q81 W;  1K73 W;  4O4I A;  3CEI A;  3EHB B;  3HKD B;  3LNN A;  1Y76 B;  4X64 B;  1NVP D;  2KQX A;  4FM0 A;  5CA0 A;  1YEW A;  2IU0 A;  1HW7 A;  4DK1 A;  2QKA A;  4IL6 Z;  3ZMU A;  4Q6G A;  4ZIB A;  1FXH A;  3W7S A;  4Z2W A;  4J42 A;  1JQ0 A;  1AJN A;  4DV2 B;  4MVU A;  4Z1M G;  1W2B U;  3FB7 C;  5EBL C;  1YHQ V;  5H2F Z;  4DV3 O;  4TV8 B;  4DR1 O;  1FD9 A;  2OWO A;  3STL C;  1BSM A;  4DV1 B;  1A32 A;  3CB2 A;  1I7F A;  3CJH B;  1QNM A;  3A0H Z;  3I55 V;  3TCU A;  3T2M A;  3SDL A;  3T1H B;  1AI5 A;  1N34 B;  1OZ0 A;  4JZG A;  1AJQ A;  1EFR G;  2YIC A;  3ZRW B;  1Q6U A;  5LL6 Y;  1BHB A;  5D5P A;  1BE3 H;  4QNH B;  1XL4 A;  1FJG B;  1S77 D;  3B2E E;  1JVM A;  5IY5 B;  1RFY A;  3ZRX A;  4OGQ B;  3AEI A;  3W7X A;  1N8R W;  3D3I A;  1QLN A;  1DK1 A;  5EIB D;  5EZY A;  3WFV A;  2HJF C;  5JJJ B;  1FS0 G;  1YXB A;  4DUY O;  2OTJ V;  5LMN B;  1WPB A;  4UCS A;  4QIW F;  5JH7 B;  2DJV A;  2XAH A;  1GN3 A;  4LF4 O;  4JI7 B;  1KU9 A;  2ZT9 B;  2R9R B;  1IBK B;  2IW5 A;  2P7T C;  1R6T A;  4JI6 O;  3K59 A;  5EBM C;  2P5O A;  2AGA A;  1QQC A;  4JI4 B;  1YVW A;  3AG4 B;  2IBZ H;  1HWY A;  2RMK B;  4PDV A;  1IVS A;  2DOS A;  4DV4 O;  4HAM A;  5H6R A;  1F23 A;  2CUG A;  2PI4 A;  3M7M X;  1KQS U;  5IYC O;  1N32 O;  3C90 A;  4CH3 A;  5EBW C;  2R9I A;  4O4L B;  1XOU A;  4LCU C;  1QBZ A;  2EJR A;  5J2T A;  5BR8 B;  4OX9 B;  4KXR A;  4DR3 B;  2GSM B;  3TET A;  3OTF A;  1UJW B;  2EUL A;  4B3R B;  2Q7E A;  2QR4 A;  3ZCC A;  4DW0 A;  1TAE A;  1RPO A;  1NH2 B;  3HKC B;  1VF6 A;  1FFX A;  3E22 A;  1SRY A;  1F7Y A;  1W59 A;  5B3S C;  5LOV A;  2GDS A;  2WPD G;  4OPA A;  4UV8 A;  2A9H A;  4JI3 O;  3CRR A;  1O9H A;  2IJI A;  1XL6 A;  3E2E A;  3D36 C;  3K0G A;  2OTL V;  2OCC C;  2C2A A;  4LFB B;  1V55 C;  2JGU A;  4DW1 A;  4J7Z A;  1AR5 A;  4ZOL A;  5LXT B;  5JH7 A;  4NR1 A;  5L3F A;  4RO2 A;  5KHJ A;  3K9A A;  2YI8 A;  3K79 A;  4CS3 A;  3E8B A;  1NT2 B;  4NYK A;  4DUY B;  3ABU A;  4I0X A;  3LSS A;  1WB7 A;  3CHX A;  3TJT A;  2DYS B;  3JD2 A;  4JTD B;  4LR3 A;  4FM2 A;  3JAS A;  2Q67 A;  4B3R O;  2PYL A;  4I4T A;  2Y48 A;  1N36 B;  3WU2 Z;  5BR8 O;  4OX9 O;  2EIK B;  5K1P A;  4ZKI A;  1OCR C;  2UUA O;  4YY3 O;  1GAX A;  1DTO A;  4FLU A;  1GK9 A;  5B3S B;  4I9W A;  2WAM A;  4LF9 O;  4MTO A;  2AHZ A;  4X1Y A;  1FXK B;  1JCH A;  1VQL V;  3SJB C;  1EM1 A;  2Z0A A;  4O2B B;  5IJ0 A;  1Y74 B;  2YEV B;  2ZE8 A;  2IU3 A;  3CCS V;  3F5W C;  3ZHT A;  1SA0 A;  4N23 A;  3U10 A;  5C8Y B;  3ZED A;  2DYS C;  5HFM A;  1BHA A;  1Y6X A;  4MW8 A;  1VQ6 V;  3AG1 B;  1LNQ A;  5FPO A;  4JI3 B;  1VQ9 V;  3EFF K;  4DV2 O;  4JTC B;  3MD0 A;  4H13 B;  3QO7 A;  1VMG A;  1S72 V;  3BRC A;  3CC7 V;  1K5Q A;  4WF9 V;  2E75 B;  1ZL8 B;  4J7J A;  4LFA B;  4FFB B;  2XAG A;  2QA4 V;  3ZHV A;  3OAA G;  5E1A C;  2YXL A;  5E79 Z;  1BS3 A;  2E74 B;  1WA8 B;  4IYH A;  4NTY A;  2BOB C;  4XDK A;  3OT7 A;  4O4I B;  1KKC A;  2JGD B;  1JJO A;  1XNR B;  4JI2 B;  2BTQ A;  3LDE A;  3ZMZ A;  2P4K A;  1K8A W;  1B6Q A;  4X89 A;  3L74 H;  4BW9 A;  1VF5 B;  4X1K A;  2A79 B;  2FL4 A;  2LJ2 A;  1N32 B;  1EBO A;  2IJK A;  1LUV A;  2EZP A;  1YTF D;  1XEQ A;  2MW2 B;  3JD0 A;  3ASO B;  3FB8 C;  3K5O A;  5IYZ B;  2EIJ B;  1ZAU A;  3A0B Z;  4I55 B;  1FPO A;  4LF6 B;  4BR6 A;  1QLE C;  3EVK A;  4X1I A;  1TUB A;  1JR9 A;  1VQP V;  3KKY A;  3T1Y O;  3UCS C;  2JJ2 G;  2WLL A;  4G28 B;  3KCY A;  1Q43 A;  1R73 A;  1K9M W;  3FAV A;  1JFF B;  1T5E A;  3LUT B;  5EC1 C;  4NTW A;  2RN9 A;  3G6B A;  4E4E A;  2OT5 A;  4TUY B;  3ZHQ A;  3K06 A;  5JVD B;  3CCR V;  5IT9 N;  1NQT A;  1Q7Y W;  1PD3 A;  5LGU A;  3SPI A;  4FJC C;  4G2K A;  4JI0 O;  2UUC B;  3NR7 A;  2F23 A;  4CS2 A;  1VQ5 V;  1NJI W;  3SPJ A;  4JV5 B;  2DYR B;  2N05 A;  5CB4 B;  4DXW A;  1KMI Z;  2IH1 C;  4MVM A;  2JS3 A;  1IX9 A;  1R3K C;  1JMK C;  4U3F H;  4IHJ A;  1O9G A;  1SQP H;  3E86 A;  3S3X A;  4FLT A;  3AG1 C;  1XNQ O;  2WLJ A;  2CE4 A;  3BA9 A;  2KB1 A;  1VF6 C;  3T1Y B;  2XAF A;  3U11 A;  2RDC A;  2CH7 B;  3E8G A;  1Z2G A;  4R6Z A;  2PZS A;  2ZCE A;  2H8P C;  1IBL B;  5LYJ A;  1NKD A;  1OCO B;  3G67 A;  4PDR A;  3RVY A;  1Z5V A;  2AXT Z;  1THZ A;  2DWD C;  1CP9 A;  3B40 A;  2VQE B;  4MVS A;  3T4D A;  3H1L H;  3GWK C;  3FKS G;  2A7W A;  1YIJ V;  2QE7 G;  4MTF A;  2WLK A;  3JYC A;  1NTZ H;  5FPR A;  4JYA B;  4IHJ B;  3SYP A;  1L8D A;  4NB5 A;  5DEC A;  5GTH Z;  3JCU Z;  3VQV A;  1KB9 F;  1X59 A;  2VRZ A;  4P9P A;  4B3M O;  2JDI G;  2ZE7 A;  4I5S A;  5KHH A;  1SZX A;  4WFH A;  3L75 H;  2YIA A;  4QJF B;  4FMT A;  1M4U A;  4DV5 B;  1ZSP A;  4IIJ B;  3F7Y C;  2P90 A;  3O65 A;  1HNW O;  1F4N A;  4MVO A;  1SQV H;  5D5Q A;  3IFX A;  4TT3 G;  1FXK C;  1P7B A;  1I08 A;  3UM7 A;  4QPJ A;  4UFZ A;  3JCZ A;  3TGU H;  4O2A B;  1MZE A;  2QKC A;  5EC2 C;  1ARO P;  5IE9 A;  2X6A A;  1M93 A;  2ADQ B;  2YIB D;  3IJ4 A;  1PNL A;  2ZKO A;  1XQ8 A;  4GKJ O;  5BXZ A;  3VQY A;  5EK0 A;  4DV5 O;  1EN4 A;  5GW7 A;  5FNV B;  2GV9 A;  1E1Q G;  4O2A A;  4GKK B;  5FNV A;  2ZE5 A;  5IYZ A;  1D5A A;  1AR4 A;  3H9V A;  4MW3 A;  3CS5 A;  2GBO A;  1H2G A;  5CMU A;  4CZZ A;  4D6T H;  1NBM G;  4XDJ A;  4ZHQ B;  2AHY A;  1R3J C;  4YIO A;  3A2F A;  4PEL A;  1XRE A;  1K4C C;  1OV9 A;  5CA3 A;  2Z3Y A;  2WLI B;  1OCR B;  5J2U B;  4X66 B;  4YIP A;  1D5N A;  1SQF A;  3T4Z A;  1AB3 A;  2YSU B;  4GKJ B;  4EFE A;  4DV4 B;  3GWO A;  3SYQ A;  4JGS A;  4PHZ A;  5L3D A;  3ZS8 C;  3OMA B;  2VWK A;  4DV1 O;  4JI4 O;  2ZQM A;  4DV0 O;  2EZO A;  4K8X A;  4NVP A;  4UVA A;  3W7T A;  4DV3 B;  4UCV A;  3AG3 B;  1M1K W;  2ILM A;  3G6E V;  5DN6 G;  2XND G;  1G1X B;  2X0L A;  4K35 A;  5LHG A;  3IC7 A;  3N2K B;  3R65 A;  2R70 A;  2JIZ G;  2WSS G;  4YJ2 B;  2QWN B;  1J5E B;  1H2K A;  2W0X A;  1RP3 B;  3OE7 G;  5H9C A;  1SA0 B;  3AK3 A;  3DC6 A;  3ABT A;  2NLJ C;  5EIB C;  5GTI Z;  2ZM6 B;  3E8F A;  4DRX B;  1ENV A;  1FXK A;  1BQ0 A;  4MTX A;  4C7U A;  3IAY A;  2Q5Z A;  2Y4T A;  3RN4 A;  5CB4 A;  4B3T O;  3JAL B;  2OYQ A;  3CCU V;  1ZTE A;  3KCX A;  3RYC A;  1MMM A;  4I4T B;  4FPP A;  3JAS B;  4RAI A;  2VS0 A;  4R7C A;  4L8J A;  2HG5 C;  4EB6 B;  3JD3 A;  4FLY A;  4PA7 A;  3HKE A;  1TA8 A;  1XUQ A;  4GUN A;  2Y69 C;  3P3N A;  1Q6I A;  4PDL A;  4I50 A;  4W4K A;  1MA1 A;  1GO3 F;  1P4R A;  4ASU G;  2DN9 A;  5ITZ A;  1NS1 A;  1MNG A;  1R6N A;  4B3T B;  4TUY A;  3O9O A;  2Q4P A;  3RWR D;  2JVD A;  1JPX A;  4MT8 A;  3RYI A;  4AQY B;  2YIB A;  1NR1 A;  1I94 B;  2XUM A;  4JI0 B;  4ZBM A;  1PL4 A;  3TXS A;  4FIP C;  5TIS Z;  4JAS A;  4X1K B;  4B08 A;  1TUB B;  1YZB A;  5H5N A;  3LNM B;  2GUZ B;  4LF5 O;  4BIO A;  1YIT V;  4RUF A;  3CCM V;  2F95 B;  4QE9 A;  3DXR A;  2UU9 B;  1ROP A;  3CYO A;  4LC1 A;  4O4L A;  3SR2 C;  3K9S A;  2FKX A;  4U7O A;  4JTA B;  4ICG A;  3CCJ V;  1KBH A;  4E2L A;  4LF6 O;  3DSQ A;  2BOC C;  4DR1 B;  1ZUQ A;  2F4V O;  5K1X A;  2NNU A;  1XHX A;  1Q82 W;  2VQF B;  2RQ6 A;  4TWK A;  1Q5O A;  1RSO A;  2BSK A;  4O4J B;  1LUW A;  1NTM H;  3UKM A;  1ZL8 A;  3CMA V;  1F51 A;  4H0L B;  5B1B C;  1V9P A;  4X64 O;  1SQB H;  2YC0 A;  4F6E A;  5LP6 B;  1I5X A;  1VF7 A;  3RW0 A;  3APQ A;  4DV7 O;  3QO8 A;  3K3W A;  3WG7 B;  3CRA A;  3ZMS A;  4Z1V A;  1VQN V;  3K57 A;  3CRC A;  3HKB A;  4JF3 A;  4RUE A;  4NXN B;  1FFT B;  4K0K B;  4P2Z A;  1VQ8 V;  4FLZ A;  5KAF Z;  2HP8 A;  3JSN A;  3LDC A;  2ZDI A;  1Q6H A;  2FB5 A;  4B3S B;  2CTR A;  5KMG B;  4JAU A;  4DR2 B;  3CWB H;  3JD1 A;  2XT9 A;  5KLV H;  3UO2 A;  4G27 B;  1NVP B;  4QGP A;  2A3Q A;  1NZ6 A;  5JJN B;  1W0K G;  5CA1 A;  1Y4M A;  2ZXW B;  3H1J H;  1H2S B;  1HR0 B;  4TV8 A;  1WLE A;  1WPX A;  2CK3 G;  2LW1 A;  4JI1 O;  4JAA A;  3CCL V;  1YJW V;  1H2L A;  3H01 A;  1YJ9 V;  4O4H B;  4I7Z B; 
#chains in the Genus database with same CATH homology
 3S3W A;  4NTY A;  2FB5 A;  4FZ0 A;  3IJ4 A;  2L35 A;  4NYK A;  3S3X A;  1WP8 A;  4NTW A;  4FZ1 A;  4NTX A;  1WP7 A;  3N27 A;  2QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...