4FZ1A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high ph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
410
structure length
406
Chain Sequence
SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
molecule keywords Acid-sensing ion channel 1
total genus 94
structure length 406
sequence length 410
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz1A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz1A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz1A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz1A02
4FZ1A 4NTXA 3S3WA 4NTYA 4NTWA 2L35A 2FB5A 2QTSA 4NYKA 4FZ0A 3S3XA 3N27A 1WP7A 3IJ4A 1WP8A
chains in the Genus database with same CATH superfamily
3SJCC 2UXNA 1YITV 3BA9A 2VWJA 2IJIA 5CA0A 3E22A 2QTSA 4AQYB 1B04A 4NTWA 4QE9A 1AJPA 3N2KB 2Z5UA 4RQFA 3OUFA 2VQEO 1N34O 1Q81W 3S3WA 3X2QC 4GT1A 1XBLA 2W0XA 4DYLA 4IIJB 3IGAC 2OCHA 3F7VC 2WLHA 2QWOB 2AHZA 2P67A 5J2TA 4QPKA 1Z5VA 4RAIA 1OJHA 3OW2U 4AILC 1H8HG 4O4HB 4LR3A 3B8NA 4I9QA 1FFXB 3CRCA 4PI2A 3KG2A 2Y48A 1FD9A 5J9PC 3EFFK 3CCQV 1YCIA 3K0DA 2E76B 2X7RB 3M99B 2HKOA 1Y67A 1BMFG 5C93A 1ENVA 1FFTB 1VEWA 4J10A 4FM1A 2D3OW 3BY6A 3ZMTA 2UXBB 2F1MA 3E89A 3HR0A 4H37A 4JYBA 4UCRA 1OCRC 4TV8A 1XL4A 3ETQA 2JGDB 4LF9B 5JJEB 1M9NA 3H9VA 5CMUA 2CTWA 2YXLA 1HNXO 2HHHO 2UUBB 3STZC 2PY5A 1VIBA 4GKKB 1H2NA 1R6KA 2ZQMA 2CH7A 3B40A 4J41A 2X6CA 3K5NA 3FB7C 3CMAV 2JRIA 4X64O 3RYHB 2Q69A 3D8CA 2UUAB 4JAAA 1BL8A 3NXSA 4I0XA 5IT9N 1NTZH 5LP6B 2EIKC 3JARB 2HVJC 2GUZA 5JCOA 3F5WC 2K9PA 1XNRB 5KLVH 5EZYA 2GUZB 3GB7C 5IDJA 3CRRA 1SRYA 4DK1A 3FYEB 2ZE7A 2EJRA 4XDLA 1L0NH 1Q6UA 3ASNC 4Q20A 4HBNA 4IYIA 1K5SA 5CBHA 2EINC 4JI4O 3CPWU 1YIJV 4O4LB 3WFVA 1HR0O 2H3OA 3RYFB 5KHIA 3CB2A 2DW4A 1X59A 1MA1A 4JTAB 4R6ZA 4X20B 4ZOLB 5IYZB 2R9AA 1EM1A 2EIJC 4H33A 1D5AA 3STLC 5LHIA 2A06H 3I55V 2XASA 1B06A 4R7CA 4B7EA 1HW7A 4GLXA 2YXHA 3FAVA 4PI0A 1OCOC 3TXSA 1M5IA 5C8YA 3SYAA 2EIJB 4UVAA 3J80N 1PD3A 2ZXWC 2JGDA 3F5TA 3JARA 3JD3A 3EVKA 4NR1A 3K57A 5CA3A 2JVDA 4JYAO 3ZHUA 1GM7A 2YXYA 5JVDB 5KHJA 2JS5A 2CGNA 4DUYB 2XAFA 3CCMV 4J7JA 2ITCC 4IIJA 4I0XB 5KUKA 3CRQA 1QU7A 3DXRA 1Q5OA 1G4YB 4MTOA 2UXBO 1AI5A 1MSWD 3T2MA 1J95A 2ZR3A 3KKYA 4FIPC 4G28B 1KKDA 5EC2C 3BFRA 1R73A 5K1PA 2RQ6A 4LF5B 3Q4HB 4Q6GA 3QVNA 4K0KO 3KCXA 2XAQA 3JD2A 2LFRA 2Z3YA 4X20A 4ZOLA 5GTIZ 1NH2B 2YC0A 1Q6HA 2Q9LA 2IH3C 4KHPB 1GTOA 1M57B 4JI5B 3ZRXA 2Y69C 1I5XA 3R66A 5ITZB 2WLJA 4MVUA 5LGUA 3P3PA 1NBMG 3ZRWA 4IL6Z 1Q3EA 2GTSA 1EN5A 4B08A 5B1BC 3SJAC 2VQEB 1SQFA 1KMIZ 1XILA 2EBOA 4I55A 2AHYA 5IJ9B 1SQPH 1IX9A 2R9IA 2B1GA 1BT8A 2VQFB 4LFAO 4OXSA 3ABMB 3ZRVA 4G2KA 2O57A 2PTMA 2BOBC 4AHCA 2B1IA 4WFGA 1PP9H 1R3LC 1AR1B 4PDRA 4ZIBA 4R50A 5CA0B 4B7KA 1KYOF 2QKSA 1F7YA 4CH6A 1SA0B 1RPOA 4I7ZB 1HP8A 4PA4A 2YIBD 4JI3B 3EHBB 3SPJA 4EB6A 3ABUA 3RBZA 3MD0A 3JALB 3CS5A 4FFKA 3UO2A 3QNEA 3G80A 1Q82W 5HFMA 1MZFA 3W7UA 3F7YC 3ABKB 2UXDB 5KHGA 2M7WA 2QM4A 3RT3C 2Q7HA 3N2GA 3CCUV 4AQYO 2VQFO 4FLYA 3D3QA 4JI1B 5EBLC 2D2CB 3CJHB 3JCZA 2BTOA 1GN2A 2XOKG 1NU1H 3C3SA 2BSKB 5IYBO 5KHKA 1MSDA 3DGEA 3ZHVA 1KECA 4O4IA 4ZI7B 1IBLB 2L6LA 2Q5ZA 4DRXA 5JWPA 1TVKB 3MHSC 1COWG 2OCCB 4FFBA 1FAFA 1FXVA 4UCSA 4JI5O 4LFCB 5BMVB 1H38A 2A0LA 2AZ0A 4JYAB 1SKVA 2JEXA 1GO3F 1Y4MA 2WLMA 3VQYA 1TA8A 1XMOB 4JI0O 1N32O 4X66B 3TCUA 3T1YB 2GDSA 1XMQO 2ADQB 3E8BA 4CS3A 3CP1A 2OIGA 1KB9F 2Q0OC 3FD9A 3TGUH 2PUSA 2ODMA 4GZRB 4WFAV 4JAVA 3JD1A 4JYCA 1K3EA 2QE7G 4E4EA 3JASB 2OWOA 4K3AA 5IWAO 2OT5A 2W6IG 3B09A 5J2TB 1N33O 5H9CA 2B5UA 2DWDC 2P06A 2P22C 2WAMA 2P6JA 4JTCB 3TETA 1KP2A 1GN6A 4NXNB 5J2UA 4TSFG 4LF4B 4DUYO 3H1JH 1OCRB 1Y74B 1P7BA 1FXKB 1Y76B 4BW9A 5H5NA 3WB2A 2M6YA 2Y0IA 2JGUA 4TQFA 4UB6Z 1US6A 2X6AA 1T5EA 4JI8O 1LUVA 3W7XA 2IW5A 2OTLV 5LGNA 2NR5A 5L3GA 4LF4O 2Q7EA 1BQ0A 1AP5A 1FXKC 1S5JA 3UT5A 1JMKC 4JI7O 3BEHA 1IVSA 4E2LA 1I5YA 2IJKA 4WBNA 1GKFA 1K9MW 1AILA 1RM1B 4JI7B 3ZS8C 4BW5A 4LH6A 5IWAB 1AI6A 3D3IA 5JH7B 2QWQB 2KB1A 3E2EA 1YJ9V 3AEIA 4KL1A 2X6BA 1QVFU 3UKMA 2YICA 1M4UA 4CBCA 4QPJA 2F43G 1WP7A 3W7WA 2Q4PA 2HJFC 1TVKA 3K5MA 4K35A 4G27B 4KHPO 3K04A 4I5SA 4DR4B 1EFRG 2IM9A 1SERA 4UV9A 2IJJA 1RSOB 4FZ1A 4DR7O 3HKEA 2XT9A 2JS3A 1JFFB 2EIMC 4BWAA 2DQ3A 1GN4A 5FNVA 5GW7A 4DV6O 3ASOC 4DV4O 3ZN0A 4DXWA 4DR5O 3L74H 2E74B 2WA4A 2FYUH 2GTAA 4OX9O 4UCOA 3E86A 1G6UA 1VF7A 4HAMA 1N0NA 4PV1B 2BCCH 3GWKC 4I4TA 2R70A 3JCUZ 1W0JG 3A0BZ 2WLNA 1O9HA 1IXMA 2QDOA 2QM7A 3GVMA 4CC5A 3LSSA 2DQ0A 2Y0PA 1HR0B 4Z1MG 2MW2B 1KKCA 1KUQA 1IXBA 3A0HZ 1SA0A 3JATB 4IHJB 3HPLC 2X0LA 3OAAG 3H1LH 4FLXA 5BMVA 5J2UB 1K92A 3U10A 4U7OA 4DW1A 4YJ2A 4DV1O 4TUYB 3CWBH 4UB8Z 4A5UB 5KMGA 2V4DA 4BAYA 3SYQA 3K06A 5LBQA 2E3CA 2VS0A 5LYJB 1YEWA 4JPRA 3C90A 1FJGO 4KXRA 2QTOA 4JI1O 3ETDA 2ZKOA 3THOA 5BZBA 5LMNB 4YHHB 1RP3B 5LMUO 3CC4V 3OD4A 3T4DA 1SQGA 1XUQA 5EIBD 2QWNB 1P49A 4JZGA 1BS3A 4X62O 5LMUB 1N32B 4N21A 1GMGA 4DR6B 4FZ0A 5LA6A 1ZLZA 2YEVA 1XNQB 2Y69B 1YI2V 1AROP 3HB3B 3HKDA 1SC5B 4GKJB 3N27A 1E79G 1PNLA 1HNWB 2FMLA 2KG7A 1V55C 2P5OA 2ZE5A 2JIZG 1VARA 3GWOA 5LYJA 4X1IA 3PN1A 1FXKA 4D6TH 2E5LB 1RSOA 1H2KA 4O2AA 3X2QB 1M56C 3RYCA 3CE2A 5TISZ 4Z2WA 3JSNA 4F6EA 2GBOA 1NTKH 1P7GA 4RUFA 3J7AU 1JVMA 4UFZA 5JQGA 5H2FZ 3VQVA 2E5LO 1K33A 1DF5A 4TV9A 1EN6A 5JH7A 3E8HA 4O2AB 1ZTEA 2QJ1A 4PDLA 3K5LA 1NVPD 1ZWIC 2JDIG 3BCCH 4KUMA 2NLJC 3C3TA 5EBMC 1JJOA 2BE3A 4FM2A 2EILB 2QWPB 4HNAB 3K9SA 2A3QA 1Y66A 2UXCB 1Q7YW 2PF4E 4LNUA 3OTOO 1PL4A 4IT5A 5CA1A 2IJHA 1R3KC 4MVMA 2WLIB 2UXXA 2YI8A 3ML0A 4WFFA 4P9PA 3RVZA 4PDMA 2W0FC 5L3CA 2ADPA 1I7FA 2NNUA 2WLKA 1K5QA 1SQQH 3AG1C 1XEQA 2CE4A 4EB6B 1XHXA 5D5QA 3AG3C 3AK2A 3OMAB 1YJWV 4UXNA 4FLUA 5KMGB 3CJHA 4UCVA 3K03A 2Q68A 2CTRA 5CB4A 2ZIOA 2F93B 3K9AA 4LFAB 4NXMO 4I55B 3LSQA 2KQXA 2WLIA 3AG3B 5IYDO 1XI1A 4UCUA 3ASNB 4EFEA 1TAEA 3SJQC 1S3JA 1NR7A 1Z2GA 2F4VO 1U96A 3LDEA 2EINB 3WG7B 3ZIAG 3HKBB 4QJFB 4HNAA 5JVDA 3BPZA 3ABLC 1P4RA 4FPPA 4BIZA 4MTFA 4CS2A 1MZEA 4BIUA 4YJ3B 2ZNIA 2LGWA 4LF7B 1SZXA 2LGQA 2CTPA 4ZKIA 4B3TB 3ZMZA 2LQTA 3B8MA 2HP8A 4DV2O 1D2DA 4DV4B 1K8AW 2JK5C 1N36O 1SZTA 5L3BA 5KHHA 3H01A 1HNWO 4DV3B 4J9ZB 2VWKA 2V7QG 4ZHQB 2ETNA 4J11A 4FJCC 3H1KH 4AI8A 1IURA 4ZBMA 1VQ8V 3CC2V 1O9GA 1OCZB 3DXRB 1NZ6A 5FPOA 4Z1VA 1GM8A 1KD1W 5LXTB 1R3JC 2W6JG 1GK9A 2YI9A 1WNSA 4GCZA 4U3JB 3ETGA 4X8AA 3CXCU 5LMNO 1S5HC 1VQOV 1OCZC 4B3SO 5LP6C 4GKKO 3G67A 3IC9A 2ZDIA 3OE7G 3OEEG 5FPRA 5LA6B 5L3DA 3L73H 3G6BA 1M93A 4J7ZA 3SPIA 3NR7A 2ZIMA 1VQLV 3K59A 4OX9B 1NS1A 3IC7A 5EYPB 5KUMA 2PI5A 1K97A 5IJ9A 3CYOA 3CCJV 5GTHZ 3SPHA 2RDCA 1XNRO 5DECA 3MDSA 1TUEB 1L0LH 4K0KB 1QBZA 1YVWA 3L75H 3SYCA 2ITDC 4LF7O 4N23A 1JX9A 3ZHSA 4X1KA 4B3TO 4FLTA 1QLEC 1Q43A 1VQ7V 2CH7B 1UJWB 2BTQA 1OZ0A 3JASA 3QTCA 5FL7G 4NXNO 3BA8A 2V1DA 1OCOB 1Z5WA 4B3SB 4F6RA 3T1CA 1M57C 4X88A 1EBOA 1WB7A 1XQ8A 3CMEV 3BRCA 4JGSA 3G71V 3TXQA 1U97A 4LWSB 4QNHB 4DV6B 3K79A 1BCCH 3JAWA 3LDCA 4TT3G 1NH2D 1N8RW 2UU9B 4CH5A 5LHGA 3WB0A 1N0JA 2Y4TA 4JYYA 3T4ZA 1HWYA 2WLLB 1DF4A 5IJ0B 3ZX6A 5BR8B 4DR2O 5H6RA 5L3EA 1IBKB 3DSQA 2QKAA 2DWEC 4LF6O 3FX7A 4X65B 1CPYA 3LSUA 5D5PA 1HNXB 1JR9A 1AI7A 3L70H 3OTFA 3BVOA 1KC8W 1WPXA 1Q86W 1H2SB 4UVCA 5E79Z 1AB3A 1VQNV 3E22B 2BSKA 4X89A 3L71H 3T1HB 3H1HH 3RGBA 2GV9A 2MK3A 4NXMB 4DV0B 1EZJA 1AVMA 3LNMB 4YHHO 1VQMV 4X65O 2ZM6O 1YSCA 4GX5A 4L8JA 1H2LA 3ETEA 1BZKA 1JOYA 1XREA 5IYZA 5L3FA 5ITZA 4PA6A 4F4LA 2HEPA 5K1XA 2A7WA 2ZR2A 3RYFA 3EXAA 3DC5A 4W4LA 1IBLO 5FLXN 1TGOA 4DRXB 4MTXA 4X1YA 3OFNG 3ABMC 3RYHA 4JASA 2LO1A 1DTOA 1J5EO 3PJSK 2XAHA 2DOSA 3JAWB 3VQWA 1R6NA 1V55B 2OCCC 3JAKB 2N05A 3W7TA 2RN9A 3QG5A 1HDJA 1URFA 2ARHA 3WU2Z 4I9WA 3QF7A 3OUSA 1XHZA 1NR1A 1QHTA 1OV9A 2JEUA 1Q8IA 4WCEV 4X66O 3T1YO 4X1YB 4KP4A 1D5NA 1QQCA 3E8GA 1VQKV 4DV7B 2LW1A 1HNZO 1L8DA 1ROPA 2Q8VA 2QWRB 1XDCA 4LFCO 2DJVA 4RO2A 3BAAA 3MAQA 1LUWA 2P4KA 3ZCCA 1RFYA 1A32A 4IYHA 4DR3O 3AG7A 5EZYB 4TWKA 2ZE8A 3AK1A 1NQTA 1HNZB 4U7NA 2ZDIC 3SJBC 1W59A 4FLVA 1V54C 1NJIW 4CH3A 4RUEA 2XAJA 2DYSC 1DGSA 2LW7A 1AI4A 2ZINA 4DV5O 1AJQA 5LOVB 3FYIB 3Q4HA 4FMTA 3ZBHA 2Q0AA 1I94B 1VQ4V 4O4HA 1P84F 2XTAA 3CD6V 3O65A 4NTYA 3B77A 2KSDA 1YZBA 3RWRD 1JCHA 1PNMA 2G38A 5IJ0A 1FKAO 5LOVA 3QO5A 3I5DA 4MVQA 4LC1A 4RQEA 4JI2O 4JI3O 1S0VA 5HFLA 2YIAA 3UCSC 2HJDA 1NVPB 2BTQB 1QVGU 1BHAA 1WB8A 4PHZA 4QE7A 1IDSA 1ZAUA 3CRAA 1L1FA 4TQDA 2EIKB 1RPRA 2YSUB 1V9PA 1YDXA 1BGYH 4NKGB 1Y6XA 5DN6G 1JPXA 2XNDG 1MOFA 3UQ8A 1MNGA 2R9RB 1CXZB 2RJZA 3P3NA 3K3WA 5LP6A 2Q67A 1SETA 4MVSA 3HKCB 2UUCB 4BR6A 1QCEA 3RFRA 4DUZO 4MVZA 1R6TA 4NTXA 2YIBA 4UV8A 2WLLA 3FB5C 4DR5B 5EBWC 3A0RA 2ILMA 2DYRB 2IU3A 4CC6A 4LP8A 3RVYA 4LFBO 3BHPA 1VQPV 2CK3G 3UO3A 4J7KA 3TK1A 1H2MA 5EYPA 1XMQB 1K4DC 2JJ2G 4RWUA 1N36B 1QNMA 4FK5C 5EK0A 1BHBA 1R3IC 4YY3B 2QA4V 1ZX3A 2QEXV 3B4SA 3MHHC 4X9QA 3FFQA 2DN9A 3A8TA 1PNKA 2Q73A 2VRZA 1EZVH 2DMXA 4O4JA 2XUMA 1VMGA 4FLZA 1WP8A 1N33B 1MMMA 2ZE6A 1LR1A 2DE0X 3I56V 2EJ7A 3CCLV 4K8ZA 3A2FA 1SESA 2EIMB 2OYQA 4DV5B 1AJNA 1YF2A 2A9HA 4DR7B 1G1XB 3SDLA 5KAIZ 4UVBA 3N2KA 2QSAA 4NVPA 1G8MA 4CS4A 1F51A 5BY1A 2QR4A 5CBFA 1WPBA 4ZHQA 3FKSG 3OMIB 4D7SA 4DR1O 4MTGA 2OTJV 4MT8A 2LJ2A 4MSWC 4LFBB 3CHXA 5CB4B 5A9GA 2A79B 3ZHTA 1KQSU 1K34A 4JI2B 4PA7A 4X1IB 3L9DA 1FS0G 4UCTA 3CSXA 2WWWA 1JJ2U 2UXCO 1F23A 4F6RB 3OEHG 4DV7O 3S3XA 1M56B 1I94O 4B3RO 3LDDA 4EEQA 2PYJA 4YXWG 4JV5O 5B1BB 3K58A 4UUJC 4PA9A 3RN4A 2RCVA 4JTDB 2ATKC 3U11A 4JI0B 2F66C 1XMOO 4GYCB 3SPGA 3SR2C 4TV8B 1VP7A 4H0LB 3OM3B 2FTKA 4DV3O 3JAKA 4XDJA 1QR8A 4FVMA 2EILC 1OHHG 2F23A 1YTFB 5IE9A 3OTOB 1W2BU 1NI8A 4DV1B 4X1KB 3M7MX 4QGPA 3CCVV 4LNUB 5GONB 1CEZA 3ABTA 1VQ6V 4B3MB 1FFXA 3ZJZA 3OR6C 3AG4C 2YIDA 4C7UA 4O2BA 1K73W 1K7DA 4X64B 1XOUA 3ZHQA 2UUCO 1BSMA 1E1QG 1B6QA 2F4VB 3CCSV 1XL6A 1VF6C 4LF9O 5DEDA 1TUBA 2OIEA 1WA8B 1FYJA 2RMKB 4GX2A 5FNVB 2PZSA 3HKDB 3RYIB 1M90W 1YJNV 2QKCA 4J80A 4ABMA 2B9ZA 4B3MO 5LGTA 4PJ0Z 2XHBA 4XDKA 2F95B 4TOIA 3ABKC 4IGGA 1AR5A 3CRMA 5AG2A 2ZCEA 3RYCB 3VQXA 1MG1A 4MVOA 4P9OA 4EKWA 4MW3A 1ZL8B 4CZZA 2KG7B 3KZIZ 1ZL8A 3N2GB 2ZM6B 3BABA 4ASUG 2ZNJA 5A2QN 4XBFA 2E75B 4O4JB 2UXDO 2ZT9B 1WAZA 1VF6A 4B3RB 2KKWA 1R1BA 3RW0A 4GKJO 1H2GA 1BQZA 2HG5C 2CGOA 1XNQO 5CA1B 1VQ9V 3M8AA 4LWSA 3T1HO 4J42A 4W4KA 3K0GA 5H6QA 1J5EB 4U3JA 2C2AA 4DO2A 3AG1B 3QO7A 4WFHA 3H1IH 1PM9A 1GH6A 5LHHA 1WLEA 1JQ0A 4JAUA 3J81N 5E1AC 2R72A 3QO8A 4I4TB 1IBKO 3CEIA 4MVRA 5B5EZ 4I50B 1KBHA 4LF5O 1KU9A 1YHQV 1NT2B 1F4NA 2P90A 2YUAA 4H13B 4PELA 4IHJA 1FXHA 4DR4O 5IY5B 5CBGA 2YDEA 2FKXA 3SYPA 1M1KW 3IAYA 1OCCC 3AG2B 5B1AC 5JJNB 4JV5B 2XAGA 4WF9V 1MABG 3WG7C 3E35A 1JFFA 5B3SC 3P30A 4OPHA 3E8FA 3JD0A 3HKBA 3ABLB 4LBEC 4X62B 3IJ4A 5IY5C 1SQXH 1WN7A 1NKDA 4WBNB 1OCCB 3AG2C 3R65A 5B1AB 3ZMVA 2BOCC 1SF9A 4I50A 2P4VA 2Y4UA 4YIOA 2N04A 4GX0A 1QLEB 5JQGB 5B3SB 2IBZH 2QGNA 3OMNB 5JJJB 1VF5B 1RM1C 4DR1B 1GN3A 2GHYA 3OR7C 3LUTB 1S76D 3LNNA 4MS2A 3CX5F 4GUNA 5BR8O 4DR2B 1AR4A 3JATA 2H8PC 5IYCO 2AW9A 2HVKC 4LH7A 4QIWF 5EC1C 2IU0A 3SGIA 5LXTA 3O9OA 5B1OA 4NYKA 5BXZA 5F2VO 2CTQA 2L35A 4JI6O 3JSLA 1GRJA 5KX5A 1W0KG 1Q6IA 4FFBB 2YEVB 4H44B 5CN0A 2WSSG 1IBMB 4J9YB 1N4CA 2DYRC 2Q6AA 4P30A 2FB5A 3G6EV 2PYLA 1B3QA 2ZXWB 1WA8A 1TUBB 3D36C 3K5OA 4BIOA 2CDYA 1Y74A 4YJ3A 2GSMB 3ASOB 3JALA 4D7TA 3U0ZA 1ORQC 3W7SA 4JI8B 1FJGB 2NN4A 1S77D 4JI4B 2K1EA 3P32A 1H8EG 2EZOA 4OGQB 2IH1C 2ZD9A 2WA3A 3ZMSA 4JZ2A 1IBMO 4LF8O 1QLNA 4PA3A 4GX1A 2PGGA 4TV9B 4FLWA 3B2EE 1SS3A 3APQA 3APOA 3E83A 3ZMUA 5C8YB 4K8XA 4LCUC 5KA5A 3ICXA 3FAVB 2EULA 1UPGA 5GONA 3ZRSA 4DV2B 2HLDG 2WPDG 4JI6B 2FL4A 3G4SV 1GM9A 2LFSA 3FB6C 2UUAO 4OPAA 3UM7A 4DK0A 3AK3A 5KA6A 4LF8B 3ZHRA 1YTFD 4DW0A 3VBBA 2N74A 1QR9A 1GAXA 3WB1A 5DM6V 1ZUQA 3JD4A 4EFBA 2YS8A 4ICGA 3VOUA 4MW8A 4O4LA 3CCRV 1K4CC 2HR3A 1N34B 2PI4A 1THZA 4CH4A 4PDVA 5B1NA 4FM0A 1VQ5V 4JF3A 3FB8C 4P2ZA 2QM8A 1S72V 4DR3B 2P7TC 3UT5B 2AGAA 1I0HA 3D36A 3OGCC 5JCOC 4O2BB 1AP6A 4YY3O 3SYOA 3JYCA 5LL6Y 1S5LZ 4R8CA 1YXBA 1X4TA 2LP7A 2CAZC 1SQBH 2HFEC 5KX5B 3HKCA 1LNQA 3L72H 1WJZA 1PV0A 3RYIA 2EX3A 1Q90D 3IFXA 1DK1A 5EIBC 4WFBV 2HHHB 2UUBO 1EN4A 3OGIB 4HZ3A 2JJ1G 1PKXA 4DUZB 4DV0O 2RNBA 3ZEDA 4PD4F 2AXTZ 3CXHF 1F4MA 1E1RG 1KP3A 4DR6O 3TJTA 3SPCA 1V54B 5B66Z 2EZPA 5KAFZ 4KFMA 3ZRWB 3ZN1A 3K08A 1ZSPA 2DYSB 3AG4B 1SQVH 1I08A 2CUGA 2AZ2A 4WFEA 4O4IB 4ZI7A 3JAMN 4L87A 4LF6B 1UFIA 1CP9A 1DLBA 1BE3H 4U3FH 1IZ3A 1FPOA 2Q7GA 3HKEB 3OT7A 4NB5A 2H94A 1JA8A 3CC7V 4HYOA 3KCYA 4YIPA 3CCEV 3DC6A 3DTUB 1NTMH 1PL0A 2Z0AA 4TUYA 1Y76A 2UU9O 4YJ2B 1PPJH
chains in the Genus database with same CATH topology
4FZ1A 4NTXA 3S3WA 4NTYA 4NTWA 2L35A 2FB5A 2QTSA 4NYKA 4FZ0A 3S3XA 3N27A 1WP7A 3IJ4A 1WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ1 A;  4NTX A;  3S3W A;  4NTY A;  4NTW A;  2L35 A;  2FB5 A;  2QTS A;  4NYK A;  4FZ0 A;  3S3X A;  3N27 A;  1WP7 A;  3IJ4 A;  1WP8 A; 
#chains in the Genus database with same CATH topology
 3SJC C;  2UXN A;  1YIT V;  3BA9 A;  2VWJ A;  2IJI A;  5CA0 A;  3E22 A;  2QTS A;  4AQY B;  1B04 A;  4NTW A;  4QE9 A;  1AJP A;  3N2K B;  2Z5U A;  4RQF A;  3OUF A;  2VQE O;  1N34 O;  1Q81 W;  3S3W A;  3X2Q C;  4GT1 A;  1XBL A;  2W0X A;  4DYL A;  4IIJ B;  3IGA C;  2OCH A;  3F7V C;  2WLH A;  2QWO B;  2AHZ A;  2P67 A;  5J2T A;  4QPK A;  1Z5V A;  4RAI A;  1OJH A;  3OW2 U;  4AIL C;  1H8H G;  4O4H B;  4LR3 A;  3B8N A;  4I9Q A;  1FFX B;  3CRC A;  4PI2 A;  3KG2 A;  2Y48 A;  1FD9 A;  5J9P C;  3EFF K;  3CCQ V;  1YCI A;  3K0D A;  2E76 B;  2X7R B;  3M99 B;  2HKO A;  1Y67 A;  1BMF G;  5C93 A;  1ENV A;  1FFT B;  1VEW A;  4J10 A;  4FM1 A;  2D3O W;  3BY6 A;  3ZMT A;  2UXB B;  2F1M A;  3E89 A;  3HR0 A;  4H37 A;  4JYB A;  4UCR A;  1OCR C;  4TV8 A;  1XL4 A;  3ETQ A;  2JGD B;  4LF9 B;  5JJE B;  1M9N A;  3H9V A;  5CMU A;  2CTW A;  2YXL A;  1HNX O;  2HHH O;  2UUB B;  3STZ C;  2PY5 A;  1VIB A;  4GKK B;  1H2N A;  1R6K A;  2ZQM A;  2CH7 A;  3B40 A;  4J41 A;  2X6C A;  3K5N A;  3FB7 C;  3CMA V;  2JRI A;  4X64 O;  3RYH B;  2Q69 A;  3D8C A;  2UUA B;  4JAA A;  1BL8 A;  3NXS A;  4I0X A;  5IT9 N;  1NTZ H;  5LP6 B;  2EIK C;  3JAR B;  2HVJ C;  2GUZ A;  5JCO A;  3F5W C;  2K9P A;  1XNR B;  5KLV H;  5EZY A;  2GUZ B;  3GB7 C;  5IDJ A;  3CRR A;  1SRY A;  4DK1 A;  3FYE B;  2ZE7 A;  2EJR A;  4XDL A;  1L0N H;  1Q6U A;  3ASN C;  4Q20 A;  4HBN A;  4IYI A;  1K5S A;  5CBH A;  2EIN C;  4JI4 O;  3CPW U;  1YIJ V;  4O4L B;  3WFV A;  1HR0 O;  2H3O A;  3RYF B;  5KHI A;  3CB2 A;  2DW4 A;  1X59 A;  1MA1 A;  4JTA B;  4R6Z A;  4X20 B;  4ZOL B;  5IYZ B;  2R9A A;  1EM1 A;  2EIJ C;  4H33 A;  1D5A A;  3STL C;  5LHI A;  2A06 H;  3I55 V;  2XAS A;  1B06 A;  4R7C A;  4B7E A;  1HW7 A;  4GLX A;  2YXH A;  3FAV A;  4PI0 A;  1OCO C;  3TXS A;  1M5I A;  5C8Y A;  3SYA A;  2EIJ B;  4UVA A;  3J80 N;  1PD3 A;  2ZXW C;  2JGD A;  3F5T A;  3JAR A;  3JD3 A;  3EVK A;  4NR1 A;  3K57 A;  5CA3 A;  2JVD A;  4JYA O;  3ZHU A;  1GM7 A;  2YXY A;  5JVD B;  5KHJ A;  2JS5 A;  2CGN A;  4DUY B;  2XAF A;  3CCM V;  4J7J A;  2ITC C;  4IIJ A;  4I0X B;  5KUK A;  3CRQ A;  1QU7 A;  3DXR A;  1Q5O A;  1G4Y B;  4MTO A;  2UXB O;  1AI5 A;  1MSW D;  3T2M A;  1J95 A;  2ZR3 A;  3KKY A;  4FIP C;  4G28 B;  1KKD A;  5EC2 C;  3BFR A;  1R73 A;  5K1P A;  2RQ6 A;  4LF5 B;  3Q4H B;  4Q6G A;  3QVN A;  4K0K O;  3KCX A;  2XAQ A;  3JD2 A;  2LFR A;  2Z3Y A;  4X20 A;  4ZOL A;  5GTI Z;  1NH2 B;  2YC0 A;  1Q6H A;  2Q9L A;  2IH3 C;  4KHP B;  1GTO A;  1M57 B;  4JI5 B;  3ZRX A;  2Y69 C;  1I5X A;  3R66 A;  5ITZ B;  2WLJ A;  4MVU A;  5LGU A;  3P3P A;  1NBM G;  3ZRW A;  4IL6 Z;  1Q3E A;  2GTS A;  1EN5 A;  4B08 A;  5B1B C;  3SJA C;  2VQE B;  1SQF A;  1KMI Z;  1XIL A;  2EBO A;  4I55 A;  2AHY A;  5IJ9 B;  1SQP H;  1IX9 A;  2R9I A;  2B1G A;  1BT8 A;  2VQF B;  4LFA O;  4OXS A;  3ABM B;  3ZRV A;  4G2K A;  2O57 A;  2PTM A;  2BOB C;  4AHC A;  2B1I A;  4WFG A;  1PP9 H;  1R3L C;  1AR1 B;  4PDR A;  4ZIB A;  4R50 A;  5CA0 B;  4B7K A;  1KYO F;  2QKS A;  1F7Y A;  4CH6 A;  1SA0 B;  1RPO A;  4I7Z B;  1HP8 A;  4PA4 A;  2YIB D;  4JI3 B;  3EHB B;  3SPJ A;  4EB6 A;  3ABU A;  3RBZ A;  3MD0 A;  3JAL B;  3CS5 A;  4FFK A;  3UO2 A;  3QNE A;  3G80 A;  1Q82 W;  5HFM A;  1MZF A;  3W7U A;  3F7Y C;  3ABK B;  2UXD B;  5KHG A;  2M7W A;  2QM4 A;  3RT3 C;  2Q7H A;  3N2G A;  3CCU V;  4AQY O;  2VQF O;  4FLY A;  3D3Q A;  4JI1 B;  5EBL C;  2D2C B;  3CJH B;  3JCZ A;  2BTO A;  1GN2 A;  2XOK G;  1NU1 H;  3C3S A;  2BSK B;  5IYB O;  5KHK A;  1MSD A;  3DGE A;  3ZHV A;  1KEC A;  4O4I A;  4ZI7 B;  1IBL B;  2L6L A;  2Q5Z A;  4DRX A;  5JWP A;  1TVK B;  3MHS C;  1COW G;  2OCC B;  4FFB A;  1FAF A;  1FXV A;  4UCS A;  4JI5 O;  4LFC B;  5BMV B;  1H38 A;  2A0L A;  2AZ0 A;  4JYA B;  1SKV A;  2JEX A;  1GO3 F;  1Y4M A;  2WLM A;  3VQY A;  1TA8 A;  1XMO B;  4JI0 O;  1N32 O;  4X66 B;  3TCU A;  3T1Y B;  2GDS A;  1XMQ O;  2ADQ B;  3E8B A;  4CS3 A;  3CP1 A;  2OIG A;  1KB9 F;  2Q0O C;  3FD9 A;  3TGU H;  2PUS A;  2ODM A;  4GZR B;  4WFA V;  4JAV A;  3JD1 A;  4JYC A;  1K3E A;  2QE7 G;  4E4E A;  3JAS B;  2OWO A;  4K3A A;  5IWA O;  2OT5 A;  2W6I G;  3B09 A;  5J2T B;  1N33 O;  5H9C A;  2B5U A;  2DWD C;  2P06 A;  2P22 C;  2WAM A;  2P6J A;  4JTC B;  3TET A;  1KP2 A;  1GN6 A;  4NXN B;  5J2U A;  4TSF G;  4LF4 B;  4DUY O;  3H1J H;  1OCR B;  1Y74 B;  1P7B A;  1FXK B;  1Y76 B;  4BW9 A;  5H5N A;  3WB2 A;  2M6Y A;  2Y0I A;  2JGU A;  4TQF A;  4UB6 Z;  1US6 A;  2X6A A;  1T5E A;  4JI8 O;  1LUV A;  3W7X A;  2IW5 A;  2OTL V;  5LGN A;  2NR5 A;  5L3G A;  4LF4 O;  2Q7E A;  1BQ0 A;  1AP5 A;  1FXK C;  1S5J A;  3UT5 A;  1JMK C;  4JI7 O;  3BEH A;  1IVS A;  4E2L A;  1I5Y A;  2IJK A;  4WBN A;  1GKF A;  1K9M W;  1AIL A;  1RM1 B;  4JI7 B;  3ZS8 C;  4BW5 A;  4LH6 A;  5IWA B;  1AI6 A;  3D3I A;  5JH7 B;  2QWQ B;  2KB1 A;  3E2E A;  1YJ9 V;  3AEI A;  4KL1 A;  2X6B A;  1QVF U;  3UKM A;  2YIC A;  1M4U A;  4CBC A;  4QPJ A;  2F43 G;  1WP7 A;  3W7W A;  2Q4P A;  2HJF C;  1TVK A;  3K5M A;  4K35 A;  4G27 B;  4KHP O;  3K04 A;  4I5S A;  4DR4 B;  1EFR G;  2IM9 A;  1SER A;  4UV9 A;  2IJJ A;  1RSO B;  4FZ1 A;  4DR7 O;  3HKE A;  2XT9 A;  2JS3 A;  1JFF B;  2EIM C;  4BWA A;  2DQ3 A;  1GN4 A;  5FNV A;  5GW7 A;  4DV6 O;  3ASO C;  4DV4 O;  3ZN0 A;  4DXW A;  4DR5 O;  3L74 H;  2E74 B;  2WA4 A;  2FYU H;  2GTA A;  4OX9 O;  4UCO A;  3E86 A;  1G6U A;  1VF7 A;  4HAM A;  1N0N A;  4PV1 B;  2BCC H;  3GWK C;  4I4T A;  2R70 A;  3JCU Z;  1W0J G;  3A0B Z;  2WLN A;  1O9H A;  1IXM A;  2QDO A;  2QM7 A;  3GVM A;  4CC5 A;  3LSS A;  2DQ0 A;  2Y0P A;  1HR0 B;  4Z1M G;  2MW2 B;  1KKC A;  1KUQ A;  1IXB A;  3A0H Z;  1SA0 A;  3JAT B;  4IHJ B;  3HPL C;  2X0L A;  3OAA G;  3H1L H;  4FLX A;  5BMV A;  5J2U B;  1K92 A;  3U10 A;  4U7O A;  4DW1 A;  4YJ2 A;  4DV1 O;  4TUY B;  3CWB H;  4UB8 Z;  4A5U B;  5KMG A;  2V4D A;  4BAY A;  3SYQ A;  3K06 A;  5LBQ A;  2E3C A;  2VS0 A;  5LYJ B;  1YEW A;  4JPR A;  3C90 A;  1FJG O;  4KXR A;  2QTO A;  4JI1 O;  3ETD A;  2ZKO A;  3THO A;  5BZB A;  5LMN B;  4YHH B;  1RP3 B;  5LMU O;  3CC4 V;  3OD4 A;  3T4D A;  1SQG A;  1XUQ A;  5EIB D;  2QWN B;  1P49 A;  4JZG A;  1BS3 A;  4X62 O;  5LMU B;  1N32 B;  4N21 A;  1GMG A;  4DR6 B;  4FZ0 A;  5LA6 A;  1ZLZ A;  2YEV A;  1XNQ B;  2Y69 B;  1YI2 V;  1ARO P;  3HB3 B;  3HKD A;  1SC5 B;  4GKJ B;  3N27 A;  1E79 G;  1PNL A;  1HNW B;  2FML A;  2KG7 A;  1V55 C;  2P5O A;  2ZE5 A;  2JIZ G;  1VAR A;  3GWO A;  5LYJ A;  4X1I A;  3PN1 A;  1FXK A;  4D6T H;  2E5L B;  1RSO A;  1H2K A;  4O2A A;  3X2Q B;  1M56 C;  3RYC A;  3CE2 A;  5TIS Z;  4Z2W A;  3JSN A;  4F6E A;  2GBO A;  1NTK H;  1P7G A;  4RUF A;  3J7A U;  1JVM A;  4UFZ A;  5JQG A;  5H2F Z;  3VQV A;  2E5L O;  1K33 A;  1DF5 A;  4TV9 A;  1EN6 A;  5JH7 A;  3E8H A;  4O2A B;  1ZTE A;  2QJ1 A;  4PDL A;  3K5L A;  1NVP D;  1ZWI C;  2JDI G;  3BCC H;  4KUM A;  2NLJ C;  3C3T A;  5EBM C;  1JJO A;  2BE3 A;  4FM2 A;  2EIL B;  2QWP B;  4HNA B;  3K9S A;  2A3Q A;  1Y66 A;  2UXC B;  1Q7Y W;  2PF4 E;  4LNU A;  3OTO O;  1PL4 A;  4IT5 A;  5CA1 A;  2IJH A;  1R3K C;  4MVM A;  2WLI B;  2UXX A;  2YI8 A;  3ML0 A;  4WFF A;  4P9P A;  3RVZ A;  4PDM A;  2W0F C;  5L3C A;  2ADP A;  1I7F A;  2NNU A;  2WLK A;  1K5Q A;  1SQQ H;  3AG1 C;  1XEQ A;  2CE4 A;  4EB6 B;  1XHX A;  5D5Q A;  3AG3 C;  3AK2 A;  3OMA B;  1YJW V;  4UXN A;  4FLU A;  5KMG B;  3CJH A;  4UCV A;  3K03 A;  2Q68 A;  2CTR A;  5CB4 A;  2ZIO A;  2F93 B;  3K9A A;  4LFA B;  4NXM O;  4I55 B;  3LSQ A;  2KQX A;  2WLI A;  3AG3 B;  5IYD O;  1XI1 A;  4UCU A;  3ASN B;  4EFE A;  1TAE A;  3SJQ C;  1S3J A;  1NR7 A;  1Z2G A;  2F4V O;  1U96 A;  3LDE A;  2EIN B;  3WG7 B;  3ZIA G;  3HKB B;  4QJF B;  4HNA A;  5JVD A;  3BPZ A;  3ABL C;  1P4R A;  4FPP A;  4BIZ A;  4MTF A;  4CS2 A;  1MZE A;  4BIU A;  4YJ3 B;  2ZNI A;  2LGW A;  4LF7 B;  1SZX A;  2LGQ A;  2CTP A;  4ZKI A;  4B3T B;  3ZMZ A;  2LQT A;  3B8M A;  2HP8 A;  4DV2 O;  1D2D A;  4DV4 B;  1K8A W;  2JK5 C;  1N36 O;  1SZT A;  5L3B A;  5KHH A;  3H01 A;  1HNW O;  4DV3 B;  4J9Z B;  2VWK A;  2V7Q G;  4ZHQ B;  2ETN A;  4J11 A;  4FJC C;  3H1K H;  4AI8 A;  1IUR A;  4ZBM A;  1VQ8 V;  3CC2 V;  1O9G A;  1OCZ B;  3DXR B;  1NZ6 A;  5FPO A;  4Z1V A;  1GM8 A;  1KD1 W;  5LXT B;  1R3J C;  2W6J G;  1GK9 A;  2YI9 A;  1WNS A;  4GCZ A;  4U3J B;  3ETG A;  4X8A A;  3CXC U;  5LMN O;  1S5H C;  1VQO V;  1OCZ C;  4B3S O;  5LP6 C;  4GKK O;  3G67 A;  3IC9 A;  2ZDI A;  3OE7 G;  3OEE G;  5FPR A;  5LA6 B;  5L3D A;  3L73 H;  3G6B A;  1M93 A;  4J7Z A;  3SPI A;  3NR7 A;  2ZIM A;  1VQL V;  3K59 A;  4OX9 B;  1NS1 A;  3IC7 A;  5EYP B;  5KUM A;  2PI5 A;  1K97 A;  5IJ9 A;  3CYO A;  3CCJ V;  5GTH Z;  3SPH A;  2RDC A;  1XNR O;  5DEC A;  3MDS A;  1TUE B;  1L0L H;  4K0K B;  1QBZ A;  1YVW A;  3L75 H;  3SYC A;  2ITD C;  4LF7 O;  4N23 A;  1JX9 A;  3ZHS A;  4X1K A;  4B3T O;  4FLT A;  1QLE C;  1Q43 A;  1VQ7 V;  2CH7 B;  1UJW B;  2BTQ A;  1OZ0 A;  3JAS A;  3QTC A;  5FL7 G;  4NXN O;  3BA8 A;  2V1D A;  1OCO B;  1Z5W A;  4B3S B;  4F6R A;  3T1C A;  1M57 C;  4X88 A;  1EBO A;  1WB7 A;  1XQ8 A;  3CME V;  3BRC A;  4JGS A;  3G71 V;  3TXQ A;  1U97 A;  4LWS B;  4QNH B;  4DV6 B;  3K79 A;  1BCC H;  3JAW A;  3LDC A;  4TT3 G;  1NH2 D;  1N8R W;  2UU9 B;  4CH5 A;  5LHG A;  3WB0 A;  1N0J A;  2Y4T A;  4JYY A;  3T4Z A;  1HWY A;  2WLL B;  1DF4 A;  5IJ0 B;  3ZX6 A;  5BR8 B;  4DR2 O;  5H6R A;  5L3E A;  1IBK B;  3DSQ A;  2QKA A;  2DWE C;  4LF6 O;  3FX7 A;  4X65 B;  1CPY A;  3LSU A;  5D5P A;  1HNX B;  1JR9 A;  1AI7 A;  3L70 H;  3OTF A;  3BVO A;  1KC8 W;  1WPX A;  1Q86 W;  1H2S B;  4UVC A;  5E79 Z;  1AB3 A;  1VQN V;  3E22 B;  2BSK A;  4X89 A;  3L71 H;  3T1H B;  3H1H H;  3RGB A;  2GV9 A;  2MK3 A;  4NXM B;  4DV0 B;  1EZJ A;  1AVM A;  3LNM B;  4YHH O;  1VQM V;  4X65 O;  2ZM6 O;  1YSC A;  4GX5 A;  4L8J A;  1H2L A;  3ETE A;  1BZK A;  1JOY A;  1XRE A;  5IYZ A;  5L3F A;  5ITZ A;  4PA6 A;  4F4L A;  2HEP A;  5K1X A;  2A7W A;  2ZR2 A;  3RYF A;  3EXA A;  3DC5 A;  4W4L A;  1IBL O;  5FLX N;  1TGO A;  4DRX B;  4MTX A;  4X1Y A;  3OFN G;  3ABM C;  3RYH A;  4JAS A;  2LO1 A;  1DTO A;  1J5E O;  3PJS K;  2XAH A;  2DOS A;  3JAW B;  3VQW A;  1R6N A;  1V55 B;  2OCC C;  3JAK B;  2N05 A;  3W7T A;  2RN9 A;  3QG5 A;  1HDJ A;  1URF A;  2ARH A;  3WU2 Z;  4I9W A;  3QF7 A;  3OUS A;  1XHZ A;  1NR1 A;  1QHT A;  1OV9 A;  2JEU A;  1Q8I A;  4WCE V;  4X66 O;  3T1Y O;  4X1Y B;  4KP4 A;  1D5N A;  1QQC A;  3E8G A;  1VQK V;  4DV7 B;  2LW1 A;  1HNZ O;  1L8D A;  1ROP A;  2Q8V A;  2QWR B;  1XDC A;  4LFC O;  2DJV A;  4RO2 A;  3BAA A;  3MAQ A;  1LUW A;  2P4K A;  3ZCC A;  1RFY A;  1A32 A;  4IYH A;  4DR3 O;  3AG7 A;  5EZY B;  4TWK A;  2ZE8 A;  3AK1 A;  1NQT A;  1HNZ B;  4U7N A;  2ZDI C;  3SJB C;  1W59 A;  4FLV A;  1V54 C;  1NJI W;  4CH3 A;  4RUE A;  2XAJ A;  2DYS C;  1DGS A;  2LW7 A;  1AI4 A;  2ZIN A;  4DV5 O;  1AJQ A;  5LOV B;  3FYI B;  3Q4H A;  4FMT A;  3ZBH A;  2Q0A A;  1I94 B;  1VQ4 V;  4O4H A;  1P84 F;  2XTA A;  3CD6 V;  3O65 A;  4NTY A;  3B77 A;  2KSD A;  1YZB A;  3RWR D;  1JCH A;  1PNM A;  2G38 A;  5IJ0 A;  1FKA O;  5LOV A;  3QO5 A;  3I5D A;  4MVQ A;  4LC1 A;  4RQE A;  4JI2 O;  4JI3 O;  1S0V A;  5HFL A;  2YIA A;  3UCS C;  2HJD A;  1NVP B;  2BTQ B;  1QVG U;  1BHA A;  1WB8 A;  4PHZ A;  4QE7 A;  1IDS A;  1ZAU A;  3CRA A;  1L1F A;  4TQD A;  2EIK B;  1RPR A;  2YSU B;  1V9P A;  1YDX A;  1BGY H;  4NKG B;  1Y6X A;  5DN6 G;  1JPX A;  2XND G;  1MOF A;  3UQ8 A;  1MNG A;  2R9R B;  1CXZ B;  2RJZ A;  3P3N A;  3K3W A;  5LP6 A;  2Q67 A;  1SET A;  4MVS A;  3HKC B;  2UUC B;  4BR6 A;  1QCE A;  3RFR A;  4DUZ O;  4MVZ A;  1R6T A;  4NTX A;  2YIB A;  4UV8 A;  2WLL A;  3FB5 C;  4DR5 B;  5EBW C;  3A0R A;  2ILM A;  2DYR B;  2IU3 A;  4CC6 A;  4LP8 A;  3RVY A;  4LFB O;  3BHP A;  1VQP V;  2CK3 G;  3UO3 A;  4J7K A;  3TK1 A;  1H2M A;  5EYP A;  1XMQ B;  1K4D C;  2JJ2 G;  4RWU A;  1N36 B;  1QNM A;  4FK5 C;  5EK0 A;  1BHB A;  1R3I C;  4YY3 B;  2QA4 V;  1ZX3 A;  2QEX V;  3B4S A;  3MHH C;  4X9Q A;  3FFQ A;  2DN9 A;  3A8T A;  1PNK A;  2Q73 A;  2VRZ A;  1EZV H;  2DMX A;  4O4J A;  2XUM A;  1VMG A;  4FLZ A;  1WP8 A;  1N33 B;  1MMM A;  2ZE6 A;  1LR1 A;  2DE0 X;  3I56 V;  2EJ7 A;  3CCL V;  4K8Z A;  3A2F A;  1SES A;  2EIM B;  2OYQ A;  4DV5 B;  1AJN A;  1YF2 A;  2A9H A;  4DR7 B;  1G1X B;  3SDL A;  5KAI Z;  4UVB A;  3N2K A;  2QSA A;  4NVP A;  1G8M A;  4CS4 A;  1F51 A;  5BY1 A;  2QR4 A;  5CBF A;  1WPB A;  4ZHQ A;  3FKS G;  3OMI B;  4D7S A;  4DR1 O;  4MTG A;  2OTJ V;  4MT8 A;  2LJ2 A;  4MSW C;  4LFB B;  3CHX A;  5CB4 B;  5A9G A;  2A79 B;  3ZHT A;  1KQS U;  1K34 A;  4JI2 B;  4PA7 A;  4X1I B;  3L9D A;  1FS0 G;  4UCT A;  3CSX A;  2WWW A;  1JJ2 U;  2UXC O;  1F23 A;  4F6R B;  3OEH G;  4DV7 O;  3S3X A;  1M56 B;  1I94 O;  4B3R O;  3LDD A;  4EEQ A;  2PYJ A;  4YXW G;  4JV5 O;  5B1B B;  3K58 A;  4UUJ C;  4PA9 A;  3RN4 A;  2RCV A;  4JTD B;  2ATK C;  3U11 A;  4JI0 B;  2F66 C;  1XMO O;  4GYC B;  3SPG A;  3SR2 C;  4TV8 B;  1VP7 A;  4H0L B;  3OM3 B;  2FTK A;  4DV3 O;  3JAK A;  4XDJ A;  1QR8 A;  4FVM A;  2EIL C;  1OHH G;  2F23 A;  1YTF B;  5IE9 A;  3OTO B;  1W2B U;  1NI8 A;  4DV1 B;  4X1K B;  3M7M X;  4QGP A;  3CCV V;  4LNU B;  5GON B;  1CEZ A;  3ABT A;  1VQ6 V;  4B3M B;  1FFX A;  3ZJZ A;  3OR6 C;  3AG4 C;  2YID A;  4C7U A;  4O2B A;  1K73 W;  1K7D A;  4X64 B;  1XOU A;  3ZHQ A;  2UUC O;  1BSM A;  1E1Q G;  1B6Q A;  2F4V B;  3CCS V;  1XL6 A;  1VF6 C;  4LF9 O;  5DED A;  1TUB A;  2OIE A;  1WA8 B;  1FYJ A;  2RMK B;  4GX2 A;  5FNV B;  2PZS A;  3HKD B;  3RYI B;  1M90 W;  1YJN V;  2QKC A;  4J80 A;  4ABM A;  2B9Z A;  4B3M O;  5LGT A;  4PJ0 Z;  2XHB A;  4XDK A;  2F95 B;  4TOI A;  3ABK C;  4IGG A;  1AR5 A;  3CRM A;  5AG2 A;  2ZCE A;  3RYC B;  3VQX A;  1MG1 A;  4MVO A;  4P9O A;  4EKW A;  4MW3 A;  1ZL8 B;  4CZZ A;  2KG7 B;  3KZI Z;  1ZL8 A;  3N2G B;  2ZM6 B;  3BAB A;  4ASU G;  2ZNJ A;  5A2Q N;  4XBF A;  2E75 B;  4O4J B;  2UXD O;  2ZT9 B;  1WAZ A;  1VF6 A;  4B3R B;  2KKW A;  1R1B A;  3RW0 A;  4GKJ O;  1H2G A;  1BQZ A;  2HG5 C;  2CGO A;  1XNQ O;  5CA1 B;  1VQ9 V;  3M8A A;  4LWS A;  3T1H O;  4J42 A;  4W4K A;  3K0G A;  5H6Q A;  1J5E B;  4U3J A;  2C2A A;  4DO2 A;  3AG1 B;  3QO7 A;  4WFH A;  3H1I H;  1PM9 A;  1GH6 A;  5LHH A;  1WLE A;  1JQ0 A;  4JAU A;  3J81 N;  5E1A C;  2R72 A;  3QO8 A;  4I4T B;  1IBK O;  3CEI A;  4MVR A;  5B5E Z;  4I50 B;  1KBH A;  4LF5 O;  1KU9 A;  1YHQ V;  1NT2 B;  1F4N A;  2P90 A;  2YUA A;  4H13 B;  4PEL A;  4IHJ A;  1FXH A;  4DR4 O;  5IY5 B;  5CBG A;  2YDE A;  2FKX A;  3SYP A;  1M1K W;  3IAY A;  1OCC C;  3AG2 B;  5B1A C;  5JJN B;  4JV5 B;  2XAG A;  4WF9 V;  1MAB G;  3WG7 C;  3E35 A;  1JFF A;  5B3S C;  3P30 A;  4OPH A;  3E8F A;  3JD0 A;  3HKB A;  3ABL B;  4LBE C;  4X62 B;  3IJ4 A;  5IY5 C;  1SQX H;  1WN7 A;  1NKD A;  4WBN B;  1OCC B;  3AG2 C;  3R65 A;  5B1A B;  3ZMV A;  2BOC C;  1SF9 A;  4I50 A;  2P4V A;  2Y4U A;  4YIO A;  2N04 A;  4GX0 A;  1QLE B;  5JQG B;  5B3S B;  2IBZ H;  2QGN A;  3OMN B;  5JJJ B;  1VF5 B;  1RM1 C;  4DR1 B;  1GN3 A;  2GHY A;  3OR7 C;  3LUT B;  1S76 D;  3LNN A;  4MS2 A;  3CX5 F;  4GUN A;  5BR8 O;  4DR2 B;  1AR4 A;  3JAT A;  2H8P C;  5IYC O;  2AW9 A;  2HVK C;  4LH7 A;  4QIW F;  5EC1 C;  2IU0 A;  3SGI A;  5LXT A;  3O9O A;  5B1O A;  4NYK A;  5BXZ A;  5F2V O;  2CTQ A;  2L35 A;  4JI6 O;  3JSL A;  1GRJ A;  5KX5 A;  1W0K G;  1Q6I A;  4FFB B;  2YEV B;  4H44 B;  5CN0 A;  2WSS G;  1IBM B;  4J9Y B;  1N4C A;  2DYR C;  2Q6A A;  4P30 A;  2FB5 A;  3G6E V;  2PYL A;  1B3Q A;  2ZXW B;  1WA8 A;  1TUB B;  3D36 C;  3K5O A;  4BIO A;  2CDY A;  1Y74 A;  4YJ3 A;  2GSM B;  3ASO B;  3JAL A;  4D7T A;  3U0Z A;  1ORQ C;  3W7S A;  4JI8 B;  1FJG B;  2NN4 A;  1S77 D;  4JI4 B;  2K1E A;  3P32 A;  1H8E G;  2EZO A;  4OGQ B;  2IH1 C;  2ZD9 A;  2WA3 A;  3ZMS A;  4JZ2 A;  1IBM O;  4LF8 O;  1QLN A;  4PA3 A;  4GX1 A;  2PGG A;  4TV9 B;  4FLW A;  3B2E E;  1SS3 A;  3APQ A;  3APO A;  3E83 A;  3ZMU A;  5C8Y B;  4K8X A;  4LCU C;  5KA5 A;  3ICX A;  3FAV B;  2EUL A;  1UPG A;  5GON A;  3ZRS A;  4DV2 B;  2HLD G;  2WPD G;  4JI6 B;  2FL4 A;  3G4S V;  1GM9 A;  2LFS A;  3FB6 C;  2UUA O;  4OPA A;  3UM7 A;  4DK0 A;  3AK3 A;  5KA6 A;  4LF8 B;  3ZHR A;  1YTF D;  4DW0 A;  3VBB A;  2N74 A;  1QR9 A;  1GAX A;  3WB1 A;  5DM6 V;  1ZUQ A;  3JD4 A;  4EFB A;  2YS8 A;  4ICG A;  3VOU A;  4MW8 A;  4O4L A;  3CCR V;  1K4C C;  2HR3 A;  1N34 B;  2PI4 A;  1THZ A;  4CH4 A;  4PDV A;  5B1N A;  4FM0 A;  1VQ5 V;  4JF3 A;  3FB8 C;  4P2Z A;  2QM8 A;  1S72 V;  4DR3 B;  2P7T C;  3UT5 B;  2AGA A;  1I0H A;  3D36 A;  3OGC C;  5JCO C;  4O2B B;  1AP6 A;  4YY3 O;  3SYO A;  3JYC A;  5LL6 Y;  1S5L Z;  4R8C A;  1YXB A;  1X4T A;  2LP7 A;  2CAZ C;  1SQB H;  2HFE C;  5KX5 B;  3HKC A;  1LNQ A;  3L72 H;  1WJZ A;  1PV0 A;  3RYI A;  2EX3 A;  1Q90 D;  3IFX A;  1DK1 A;  5EIB C;  4WFB V;  2HHH B;  2UUB O;  1EN4 A;  3OGI B;  4HZ3 A;  2JJ1 G;  1PKX A;  4DUZ B;  4DV0 O;  2RNB A;  3ZED A;  4PD4 F;  2AXT Z;  3CXH F;  1F4M A;  1E1R G;  1KP3 A;  4DR6 O;  3TJT A;  3SPC A;  1V54 B;  5B66 Z;  2EZP A;  5KAF Z;  4KFM A;  3ZRW B;  3ZN1 A;  3K08 A;  1ZSP A;  2DYS B;  3AG4 B;  1SQV H;  1I08 A;  2CUG A;  2AZ2 A;  4WFE A;  4O4I B;  4ZI7 A;  3JAM N;  4L87 A;  4LF6 B;  1UFI A;  1CP9 A;  1DLB A;  1BE3 H;  4U3F H;  1IZ3 A;  1FPO A;  2Q7G A;  3HKE B;  3OT7 A;  4NB5 A;  2H94 A;  1JA8 A;  3CC7 V;  4HYO A;  3KCY A;  4YIP A;  3CCE V;  3DC6 A;  3DTU B;  1NTM H;  1PL0 A;  2Z0A A;  4TUY A;  1Y76 A;  2UU9 O;  4YJ2 B;  1PPJ H; 
#chains in the Genus database with same CATH homology
 4FZ1 A;  4NTX A;  3S3W A;  4NTY A;  4NTW A;  2L35 A;  2FB5 A;  2QTS A;  4NYK A;  4FZ0 A;  3S3X A;  3N27 A;  1WP7 A;  3IJ4 A;  1WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...