4FZ1A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high ph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
410
structure length
406
Chain Sequence
SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 94
structure length 406
sequence length 410
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz1A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz1A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz1A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz1A02
4FZ1A 1WP7A 4NTWA 2L35A 4NTXA 3S3WA 1WP8A 2FB5A 3N27A 4FZ0A 3S3XA 4NTYA 4NYKA 2QTSA 3IJ4A
chains in the Genus database with same CATH superfamily
3RYHA 3VQXA 4K0KB 4K8XA 4NB5A 3HR0A 2JGDA 1YJNV 4JYAB 1WA8B 2JGUA 2X6CA 1N8RW 2Q6AA 3CP1A 4KHPO 4O4IB 1I7FA 1LUWA 1R6NA 4JI1B 3SPHA 3OR7C 4GCZA 3OUFA 4CS2A 3T1CA 1M57C 4MW3A 1NTZH 2P22C 4DK1A 3WG7B 2V4DA 3IGAC 2GUZA 1P84F 2YI8A 1ZTEA 2UXDO 3W7WA 1TVKB 3B8MA 4GX1A 4DV4B 1VQ9V 4DR2O 3EHBB 2QM7A 1N32O 2ADQB 4H44B 4X20B 2UUBB 1BZKA 1RPOA 5H6RA 1IBKB 1HR0O 5B1AC 4DV1O 3SPIA 1R3KC 2A3QA 3ASOC 1SRYA 2RCVA 4FLZA 1XOUA 2F66C 1GAXA 1K33A 1CP9A 3CRMA 1Q6UA 1LNQA 4MVQA 2P5OA 3APQA 3ZRWB 2LW7A 5JH7B 2HHHO 2WA4A 2Q69A 4JTDB 3F7YC 4NXMO 5EBMC 5GTIZ 4JI6B 4MVOA 1JJ2U 3BABA 4LFCO 1HP8A 4LF6B 2HFEC 1UFIA 1NR1A 3QO5A 1QBZA 2DW4A 3ZRSA 2DYRB 2P4VA 5B1NA 2EZOA 5IY5B 1GN2A 3WU2Z 2V1DA 3AK2A 4UCVA 2YEVA 1T5EA 4CH4A 1TUEB 2EJ7A 3UCSC 2N74A 3P32A 3HKDB 1N33B 3U0ZA 1GO3F 1J5EB 3UO2A 2AZ0A 4R8CA 4WBNB 4FFKA 2R9IA 4QIWF 4DV2B 3K58A 5LBQA 1RSOB 4UCOA 3I56V 5B3SB 4I4TA 4O4HA 4IIJA 5FL7G 4QNHB 5B5EZ 4B7EA 3M99B 4HZ3A 3AK3A 3J7AU 3JCZA 4UB8Z 3CXHF 1SA0A 2PUSA 3ZHTA 2Z3YA 3JD2A 3BHPA 4B3SO 4KP4A 1NVPD 1EBOA 3K5LA 4YY3B 2YDEA 5D5PA 5B1AB 1Q43A 2C2AA 5EYPB 1W2BU 5CA0A 3ASOB 4UVAA 1HNZO 3S3XA 4P2ZA 3K5OA 2KB1A 3CD6V 2RNBA 4B3TB 3OM3B 5CB4B 4B3RO 4NTXA 3CEIA 3HKBA 1S0VA 2ZDIA 1R3JC 3OTFA 3QNEA 4ZI7B 5E1AC 4DK0A 1MSDA 5JQGA 1O9GA 4P9OA 4GX5A 2YXLA 4DRXA 1K34A 2OWOA 5FLXN 3SJBC 4HYOA 2Q9LA 4G28B 4WFEA 1M9NA 4LR3A 1PNKA 1YEWA 4LF4B 4UB6Z 1VQOV 5LGNA 4DR7O 5J2UA 1VQKV 2H3OA 1YSCA 4DO2A 3LUTB 3ABUA 3W7UA 4X66B 1YF2A 1B06A 3B09A 3STLC 2Q5ZA 5H9CA 4EFBA 2OCHA 3STZC 3E89A 5LHGA 4D6TH 2L35A 4X1KB 4JI2O 4NTYA 1OV9A 2AW9A 2Y69B 1NZ6A 5C8YB 4JI5O 3RYFA 3T1HO 3OT7A 1FAFA 4RUEA 4JYBA 3G67A 2QWNB 4LF9B 1XMQB 2RJZA 3FAVA 2N04A 4CH5A 3G6EV 2HKOA 3RWRD 3FB6C 3A0HZ 4X89A 1KMIZ 5LXTB 3RYIB 5IYDO 4MSWC 3T4DA 1SC5B 3E86A 4BW5A 2KG7B 1FKAO 3BRCA 3NR7A 5KX5B 2QA4V 3B4SA 1KKCA 2XT9A 2XNDG 4FK5C 1TGOA 1G8MA 3JATB 1AR4A 4AQYB 2E75B 2QWOB 1S3JA 4J7ZA 2W0XA 4GZRB 1MOFA 2QTOA 1VQMV 2OT5A 1EN6A 4QPJA 3VQVA 1NKDA 2BSKA 4CS4A 1VF5B 1MG1A 3DSQA 3BAAA 5KUKA 2Q7EA 3BA8A 2WLKA 4L87A 4NKGB 4MVMA 1PL4A 3VQWA 3ZJZA 4C7UA 5ITZB 1IBKO 1K4DC 1D2DA 3RBZA 2IJIA 4JZ2A 4U3FH 1X59A 4X65O 5J2TA 1BGYH 5JJNB 2XAHA 4GKKO 1TAEA 1B3QA 2BTOA 2EZPA 3CRAA 1AI6A 4ZOLA 4MS2A 1V55C 1QQCA 1XREA 2A0LA 3JYCA 3KCXA 1AROP 1NS1A 1P7GA 1V9PA 4QPKA 2UXDB 2Q0AA 2KKWA 3IAYA 3GB7C 4OPAA 4ZHQB 4DR2B 3L71H 5IYZA 3JASA 1N32B 3CMAV 3E8HA 4FLTA 2X0LA 1HR0B 1EN4A 2BTQA 3R65A 4LH7A 4U3JB 2YIAA 2W6JG 1P49A 1Y6XA 3K9SA 2DOSA 1N33O 3KCYA 4LWSB 1YZBA 1WPBA 2BCCH 1VQ4V 3DXRA 4DV2O 3ZMZA 3ZMUA 5DM6V 3RVZA 3Q4HB 4MW8A 1FS0G 2Q7HA 4HNAB 3AG2C 1K73W 5FNVA 5BMVB 4LP8A 1HNXB 4L8JA 1Q6HA 5BZBA 3B40A 5EBLC 1AI4A 3E83A 2IJKA 3NXSA 1Q7YW 3JAWA 4DW1A 4MTXA 1AP6A 1JVMA 3F5WC 5EZYB 2ZE6A 4BWAA 4GX0A 2BOCC 3QTCA 5D5QA 3CCSV 5LHIA 2JEXA 3CRRA 1JJOA 1SQGA 2NNUA 5EK0A 5LHHA 4YJ3A 3CCVV 2QE7G 3HKCB 3W7SA 1V55B 2ZE7A 4JASA 2DJVA 3CHXA 2ZM6O 3CC2V 3RYHB 3SYOA 3J80N 1YTFB 1D5NA 4UV9A 4LH6A 5JVDA 2JGDB 1NH2B 5CBGA 4LF4O 1XBLA 1L8DA 1QR8A 4KFMA 4YHHO 2OIEA 1ROPA 4FM2A 5DEDA 4X66O 2P67A 3BEHA 1GKFA 4JTCB 4UVCA 1HNZB 3JD0A 1H8HG 2Q0OC 4FVMA 4GT1A 2JJ2G 4OGQB 2WWWA 2G38A 2W0FC 3OR6C 1N0JA 2GUZB 1ZX3A 1H2SB 4GUNA 1MMMA 1W59A 2QGNA 2HG5C 1OJHA 1K97A 2YC0A 4YJ2A 3AG2B 3ML0A 4WF9V 2AGAA 4MVZA 2EIKC 2VQFO 4WFBV 1K92A 4DR7B 3E8FA 4DR1B 1OCRC 3UO3A 3F7VC 3M8AA 1WPXA 1XMQO 2RDCA 2IH3C 3SYCA 3U10A 2QR4A 2QJ1A 2QM8A 2ZDIC 3SYQA 1KECA 4IL6Z 1M5IA 3HKEA 1WB8A 1PL0A 2Y4TA 1GMGA 3K79A 4KXRA 3CWBH 1Y66A 3VQYA 4JI2B 3A2FA 3M7MX 1H8EG 1YJ9V 3UT5A 2H94A 1RM1C 4RQFA 4YIOA 1E1RG 2X6BA 2B9ZA 3ABLC 1M93A 2XOKG 2YEVB 1XMOO 2IH1C 2XUMA 4FPPA 2DYSC 4F6RA 2JS5A 2VWKA 4JF3A 2IBZH 2B1IA 3ETQA 3ETDA 1FXKA 1FJGO 1KKDA 3ASNC 2E76B 2DQ0A 2EX3A 1PNLA 2ZKOA 5TISZ 4LNUA 2F95B 4TOIA 4I4TB 2XAQA 4O4HB 4IIJB 4TQDA 5GW7A 1NTKH 2FYUH 4BIOA 4CS3A 1QHTA 1ZWIC 5LL6Y 4EB6A 1R6TA 1HNWB 4WCEV 1K5QA 1OZ0A 1SA0B 1S76D 2K1EA 3BCCH 2E5LB 1H2LA 2VWJA 1HDJA 1BL8A 1PV0A 4DXWA 4RAIA 4JAAA 3K5NA 3AEIA 4CBCA 2EIKB 1K4CC 4J7KA 4OX9B 5KA6A 4X64B 3G71V 3N27A 1OCRB 3F5TA 4FZ0A 5CA1A 2YIBA 5CA0B 2CE4A 4X1YA 3IFXA 1OCCC 3S3WA 4LF8B 3OTOB 4X65B 3HKBB 4IHJA 2VQEO 1AJPA 2ODMA 4GKKB 5JQGB 1NJIW 4LCUC 4MTFA 4R7CA 1VQNV 1YHQV 4DRXB 1ENVA 2JVDA 1BQZA 1WP8A 4Z1MG 1R3LC 4FFBA 1NQTA 5H5NA 3ZCCA 1Q3EA 1Z2GA 3CCRV 4A5UB 2DE0X 5J2UB 1RM1B 4BIUA 3CXCU 3ABLB 1O9HA 4I55A 1RFYA 3TETA 1HNXO 1W0KG 5KAFZ 1AI5A 4QE7A 1CPYA 2DYSB 4DV3O 1YTFD 3RVYA 3CCQV 2Q68A 1NH2D 3CRCA 3OGCC 1YXBA 2CGNA 3ASNB 3N2GA 2CAZC 4DYLA 3CCJV 2XAJA 4O2AB 2N05A 3FKSG 2DMXA 2GBOA 3K9AA 2ZT9B 3CE2A 2Z5UA 2NLJC 1TUBA 1A32A 2R9RB 4UV8A 4O4JA 3E35A 3LSQA 1LUVA 3CC7V 2YUAA 1N4CA 1F51A 1KB9F 1SQFA 5KMGA 1IXMA 1SQPH 2CTRA 4FM1A 3FAVB 2YICA 4PELA 3ABMC 1NBMG 4WFAV 1Q5OA 5EIBC 1Q86W 1M57B 1NU1H 4N21A 5KHHA 4PDLA 1KU9A 4UFZA 1D5AA 1IX9A 4DR5B 2P7TC 1WA8A 5IT9N 1WNSA 3K08A 1Q81W 1OCCB 1XILA 1JQ0A 1KC8W 3JALA 2OTJV 4DW0A 4PJ0Z 4J11A 4IT5A 5HFLA 3CYOA 5KA5A 4JI0B 3W7TA 4DUZO 2QKCA 2LQTA 5LA6B 4I9WA 2HEPA 2CH7A 4QGPA 4JGSA 2D2CB 4IYHA 2ZM6B 3FB5C 4G27B 2BE3A 2JRIA 2EJRA 5L3GA 4NXNO 1MSWD 4TV9A 4DR1O 4BR6A 1H38A 5J2TB 2A79B 2WLIA 1V54C 4YHHB 2WLLA 2ITDC 4DV7B 1S5JA 2F1MA 3MAQA 3JARA 3CRQA 4ZOLB 3CS5A 3OFNG 2IJHA 5AG2A 5IDJA 4HAMA 1IXBA 1HW7A 1R3IC 1GM9A 2AHZA 2OTLV 5JJJB 4JV5O 4MTGA 5CA3A 4GKJB 3P30A 3A0BZ 3EFFK 1KD1W 1S77D 2Y0PA 4CC5A 1NR7A 5IYZB 1R73A 3JASB 2JJ1G 3P3NA 3U11A 1EFRG 4MVUA 3ABMB 3D8CA 3SJAC 2LFRA 1VF6A 2VQFB 4NYKA 2BTQB 1QNMA 1YIJV 2OYQA 3H1JH 1AVMA 4J9ZB 2QTSA 3DGEA 1FYJA 5LMUO 2AHYA 4DR3B 1M1KW 4DV0B 3EXAA 2P6JA 3JSNA 2KSDA 1AR5A 3ABTA 3CX5F 3L73H 3DXRB 4RWUA 3UKMA 1BS3A 1BHBA 5CMUA 2WLMA 4DV5O 2GDSA 4FIPC 2FKXA 1AP5A 1BMFG 1Q90D 1N36B 3G6BA 1HNWO 1XHZA 5KHKA 3FB8C 1FFXB 1W0JG 3OMNB 4EKWA 2E5LO 4OPHA 1XMOB 3ZBHA 5GONA 3B8NA 2EIMC 5KUMA 3JAWB 1VQ6V 5EBWC 2A9HA 4WFFA 5LYJA 1FJGB 1U96A 3TGUH 1IBLO 4OX9O 5EYPA 1SERA 4X64O 2QSAA 2CUGA 4U7OA 2GV9A 1V54B 4MTOA 1CXZB 2GHYA 3FYEB 5CB4A 4HBNA 4LF8O 4YJ3B 3OTOO 2R72A 3ZHQA 2ITCC 4G2KA 2FTKA 1BQ0A 3L75H 4JI3B 2E74B 2WPDG 2EINC 1MZFA 2MK3A 3JAKA 2EILC 1WP7A 2JEUA 2DWEC 4PV1B 4LF5B 3ZHRA 5JVDB 1K8AW 4TT3G 1NI8A 3D3IA 4ASUG 4JTAB 3T1YO 5KHGA 1PD3A 2FB5A 3QVNA 5BXZA 4R6ZA 2Y0IA 1MA1A 3K03A 4KL1A 2VQEB 2CK3G 3AG3C 1Q82W 3MDSA 3OGIB 2ARHA 2HLDG 3FFQA 4UUJC 1GN6A 2YIDA 1G4YB 4YJ2B 3LSSA 3RT3C 4H33A 3ZMSA 1WAZA 1IVSA 1XDCA 4I0XA 4NR1A 3UQ8A 2HP8A 4LC1A 1RP3B 2ZIOA 3SPJA 1IDSA 1R1BA 1ZL8A 1I0HA 1QCEA 2EIMB 2Y4UA 1P7BA 3JD4A 3MHHC 4DV3B 2JIZG 5JJEB 4PDVA 3HKEB 2DQ3A 3BPZA 2ZNIA 4DR5O 4MVSA 5L3DA 2PZSA 3ZN1A 1L1FA 3JATA 5B66Z 2L6LA 1BCCH 1URFA 4IGGA 2GSMB 3SPGA 3UT5B 3B2EE 4J41A 1OCOC 5H6QA 2VRZA 4CC6A 2PY5A 4JI0O 3TXSA 2DN9A 3C3SA 2EINB 5EC2C 1QLEC 2QKSA 4BW9A 4X88A 2EILB 1FFTB 5F2VO 1ZSPA 1JOYA 3HPLC 1SQBH 2ZNJA 5C93A 3QO7A 3QF7A 3C3TA 1VF7A 4UCRA 5EIBD 4LNUB 2AXTZ 2XASA 1SZXA 3SJCC 2EIJC 4WFGA 4JAVA 4EB6B 1AI7A 2ZE8A 4DV7O 4JI8B 2F4VB 3W7XA 5LMNO 1XHXA 4JYCA 3LNNA 2ADPA 3AG3B 4FMTA 4K35A 1H2GA 2P4KA 4UCTA 2Z0AA 2P90A 4AILC 3SJQC 1KUQA 4DUZB 2PF4E 4WFHA 4GKJO 4I7ZB 4I50A 2QEXV 4DR4B 1LR1A 2AZ2A 5JCOA 1BT8A 1AB3A 5CA1B 4NVPA 4X1YB 5BR8O 4PA6A 5DECA 4XDJA 4FLXA 4NXNB 1JA8A 4P9PA 3GWKC 2ZINA 4IHJB 4TUYA 4DR3O 4DV0O 4EEQA 3CSXA 1AJNA 3OMIB 4FFBB 2E3CA 4ABMA 1EM1A 4JV5B 1Y76A 3CJHA 1H2NA 2WSSG 1YCIA 2XAGA 3ZIAG 1JFFA 1GM7A 5IWAB 4J7JA 2IW5A 1OCOB 4I55B 1N36O 1AJQA 1SESA 3IJ4A 1KBHA 3E22A 3CC4V 4J10A 1XQ8A 4X9QA 1N0NA 4O2BA 1PKXA 3H1HH 2H8PC 1XNRB 4U7NA 1VQ8V 5KAIZ 1VQPV 1VP7A 3UM7A 2FMLA 2M7WA 3N2GB 5LMUB 3CPWU 1GRJA 4UVBA 3CCUV 4X62B 1KQSU 4PA7A 5KLVH 4TV8A 3G4SV 1TUBB 1M4UA 1J95A 2EIJB 4O4JB 3T2MA 3E8GA 1IURA 1GH6A 4DV5B 1SQQH 4TSFG 5KMGB 3C90A 1YVWA 4GYCB 3K0GA 4JI4B 1VF6C 2QKAA 2R70A 5LGTA 3O65A 4FM0A 4IYIA 4JI3O 4D7TA 4UCUA 4B3MO 3GWOA 4FZ1A 5J9PC 5L3FA 3ICXA 3I55V 1XI1A 4LF5O 4JI7B 4DUYO 3AG7A 2QWPB 3K3WA 5IE9A 2K9PA 3N2KA 4RO2A 5IJ0A 4ICGA 2Q4PA 5B3SC 2WAMA 1IBLB 1XL4A 1HWYA 3JALB 2HVJC 1AR1B 3WB1A 5IJ9A 2RMKB 1XNQB 1UPGA 4LF7B 2WLJA 4PI0A 3RN4A 1EZVH 3ETEA 1QU7A 5A9GA 4I5SA 4UCSA 2CH7B 5LP6A 3TJTA 4X1IA 1WJZA 1YDXA 2W6IG 1L0NH 2VS0A 4PDRA 2IM9A 2YXHA 4GX2A 1WLEA 3E2EA 1THZA 2F23A 1SETA 4PDMA 1FXVA 4TV9B 4N23A 4O4LA 2WLIB 4K8ZA 2WLLB 5EC1C 5LGUA 3T1YB 2X6AA 4PD4F 3JARB 5B1OA 2A7WA 1L0LH 1EZJA 4DR6O 3JD1A 1F4NA 1VQ5V 1VARA 2LO1A 1GN4A 3D3QA 3B77A 3A0RA 3CMEV 2F93B 1MABG 1F4MA 2JS3A 1QLNA 1K9MW 2CTQA 2ETNA 4E2LA 1WB7A 5L3EA 1EN5A 1QVFU 3TXQA 3SYAA 3ZRXA 3L74H 4RQEA 4I9QA 3RYFB 4Z2WA 3RYCA 3ZN0A 4CZZA 1ZAUA 1OHHG 3LDEA 1Y74A 3QO8A 1NT2B 2IJJA 3D36A 4LFAO 2CTPA 1Q6IA 1I08A 1DK1A 1DTOA 1K3EA 3AG4C 3JD3A 4H37A 3VOUA 5JWPA 5LOVA 5FPOA 1ZLZA 4PA9A 2YIBD 1N34O 5BY1A 4RUFA 2CTWA 1VQLV 3APOA 5FPRA 2Y69C 5H2FZ 3I5DA 3BY6A 4F4LA 1M90W 2CGOA 4H13B 2UUCB 2ZE5A 3ZS8C 1VEWA 4JZGA 4O4IA 4NTWA 1VIBA 1DF4A 4JI8O 4EFEA 5IYBO 2F4VO 2XHBA 2WLHA 3KZIZ 4Z1VA 2HR3A 2UU9B 5GONB 4AHCA 2YSUB 2BSKB 2MW2B 1YJWV 2GTAA 2LW1A 1US6A 1TVKA 1H2MA 5LYJB 4DR4O 2LP7A 1NTMH 4LFBB 1K7DA 4X20A 4PHZA 4CH6A 5GTHZ 3OEHG 5KHIA 4YIPA 5KHJA 3PN1A 1JPXA 3SDLA 4FLWA 2ATKC 1M56C 5LMNB 2HJDA 1Y67A 2HVKC 3JAKB 2UUAO 3ZRWA 1CEZA 5JH7A 2ZR2A 1IBMO 3FD9A 1F23A 2JK5C 1H2KA 1GK9A 4FJCC 3DTUB 5IYCO 2BOBC 5IWAO 3RFRA 4AI8A 3OE7G 3VBBA 1I5YA 3DC5A 5BR8B 2Q67A 4E4EA 5CBHA 3AG4B 1DGSA 2RQ6A 1XNRO 4B08A 4QJFB 2ZQMA 3LSUA 2ZR3A 2OCCC 3HKDA 4O2AA 1I94O 2UXCB 4X62O 1PPJH 5K1PA 4J80A 2UXBB 1BE3H 4BAYA 4WBNA 5K1XA 3OUSA 4Q20A 1RSOA 2QWRB 4JAUA 4I0XB 5JCOC 2Q7GA 3FB7C 3PJSK 1FD9A 2YS8A 3OD4A 4W4KA 4DV6O 5FNVB 4JI4O 1S5LZ 1ZUQA 1ZL8B 3A8TA 3ZHSA 1KYOF 2XTAA 2F43G 2ZD9A 3L72H 1YI2V 4PA3A 2V7QG 3ETGA 1KP3A 4K0KO 3P3PA 1G1XB 2IU3A 3K57A 3MHSC 3RGBA 4JI7O 1DF5A 4JYAO 3AG1C 4R50A 1XUQA 1Z5VA 3BFRA 2P06A 4B7KA 4JI1O 1GM8A 2PYJA 1U97A 4PI2A 1XNQO 2LJ2A 1M56B 4LF7O 4JYYA 2B1GA 4BIZA 4ZI7A 5LA6A 2PTMA 2HJFC 2YXYA 4DV4O 3H1LH 4OXSA 2LFSA 1Y4MA 2QM4A 2EBOA 3H1KH 1WN7A 4B3MB 3EVKA 5CN0A 2EULA 3IC7A 3WB2A 2PI5A 3O9OA 4PA4A 2UXXA 2UUBO 1XL6A 4ZKIA 2ZIMA 1FXKC 4DUYB 1GTOA 4ZIBA 3FYIB 3X2QC 4KHPB 4ZBMA 1SKVA 3JAMN 2PI4A 4D7SA 1JR9A 1P4RA 4UXNA 2OIGA 3CCEV 2ZXWC 2OCCB 2X7RB 4W4LA 3ZMTA 3J81N 4JI6O 3E8BA 3WB0A 2A06H 4X8AA 4I50B 4X1KA 1JCHA 4LF6O 2Q73A 5L3BA 5C8YA 3KG2A 4K3AA 2WA3A 1YITV 2UXNA 2YI9A 4TUYB 4DV1B 3ABKC 2D3OW 3BVOA 4JPRA 4GLXA 1MZEA 1R6KA 3HB3B 1PNMA 2NR5A 3ZHVA 1J5EO 5LXTA 3RYIA 2XAFA 4DR6B 1FXHA 3AG1B 2HHHB 2KG7A 5LP6C 5B1BC 3MD0A 4NXMB 1Z5WA 4XBFA 5KX5A 1Y76B 3CJHB 4MVRA 2O57A 4FLVA 2UUCO 1JFFB 3IC9A 4LFCB 1G6UA 1I5XA 3THOA 3E22B 1FFXA 3TK1A 3K06A 3CCLV 3K0DA 3GVMA 2ZCEA 5E79Z 2QDOA 4O2BB 1JX9A 3AK1A 2UU9O 3LDDA 4LFAB 3JSLA 4F6RB 4YY3O 4J9YB 2ILMA 3OMAB 1S5HC 3ZRVA 1FXKB 4LFBO 4TV8B 2RN9A 4KUMA 1N34B 3X2QB 4CH3A 4J42A 4XDLA 5L3CA 5ITZA 4B3TO 1B6QA 1S72V 5HFMA 4MT8A 2ZXWB 1BSMA 3CB2A 2LGQA 1FPOA 2WLNA 1Q8IA 2QWQB 2FL4A 4FLYA 3LNMB 5DN6G 3D36C 2Q8VA 1B04A 3H01A 3OAAG 3RW0A 4B3SB 2PYLA 5CBFA 2R9AA 1OCZC 1QR9A 3KKYA 3JCUZ 1E79G 2KQXA 4Q6GA 3N2KB 5IJ0B 2LGWA 4ZHQA 4TWKA 4P30A 1K5SA 3H1IH 3ABKB 1KP2A 3K5MA 1F7YA 3ZHUA 5IJ9B 4TQFA 1MNGA 4B3RB 3DC6A 2NN4A 5A2QN 1ORQC 4U3JA 4F6EA 5LP6B 5B1BB 1X4TA 3SGIA 4X1IB 3OW2U 4YXWG 2UXCO 4LWSA 2DWDC 3WG7C 2UUAB 1VMGA 1SZTA 1IBMB 2UXBO 3LDCA 1SQXH 1IZ3A 1NVPB 3SR2C 3ZMVA 2PGGA 4LF9O 2CDYA 3Q4HA 3ZX6A 3SYPA 4O4LB 4HNAA 1DLBA 2B5UA 1RPRA 5BMVA 1COWG 3R66A 2GTSA 1E1QG 1AILA 3TCUA 3CCMV 4H0LB 1SF9A 3L9DA 4XDKA 1XEQA 1QLEB 3BA9A 3OEEG 4FLUA 2Y48A 1QVGU 1PM9A 1SQVH 1TA8A 4AQYO 3WFVA 3K59A 1I94B 3T4ZA 1UJWB 5EZYA 4LBEC 4JI5B 3T1HB 3G80A 1PP9H 2M6YA 3K04A 3RYCB 1Y74B 2DYRC 4DV6B 5IY5C 3HKCA 4QE9A 3ZEDA 1VQ7V 2IU0A 1OCZB 3L70H 3FX7A 3H9VA 5LOVB 3SPCA 1BHAA 1JMKC 1GN3A 2JDIG 1SS3A 3QG5A
chains in the Genus database with same CATH topology
4FZ1A 1WP7A 4NTWA 2L35A 4NTXA 3S3WA 1WP8A 2FB5A 3N27A 4FZ0A 3S3XA 4NTYA 4NYKA 2QTSA 3IJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ1 A;  1WP7 A;  4NTW A;  2L35 A;  4NTX A;  3S3W A;  1WP8 A;  2FB5 A;  3N27 A;  4FZ0 A;  3S3X A;  4NTY A;  4NYK A;  2QTS A;  3IJ4 A; 
#chains in the Genus database with same CATH topology
 3RYH A;  3VQX A;  4K0K B;  4K8X A;  4NB5 A;  3HR0 A;  2JGD A;  1YJN V;  4JYA B;  1WA8 B;  2JGU A;  2X6C A;  1N8R W;  2Q6A A;  3CP1 A;  4KHP O;  4O4I B;  1I7F A;  1LUW A;  1R6N A;  4JI1 B;  3SPH A;  3OR7 C;  4GCZ A;  3OUF A;  4CS2 A;  3T1C A;  1M57 C;  4MW3 A;  1NTZ H;  2P22 C;  4DK1 A;  3WG7 B;  2V4D A;  3IGA C;  2GUZ A;  1P84 F;  2YI8 A;  1ZTE A;  2UXD O;  3W7W A;  1TVK B;  3B8M A;  4GX1 A;  4DV4 B;  1VQ9 V;  4DR2 O;  3EHB B;  2QM7 A;  1N32 O;  2ADQ B;  4H44 B;  4X20 B;  2UUB B;  1BZK A;  1RPO A;  5H6R A;  1IBK B;  1HR0 O;  5B1A C;  4DV1 O;  3SPI A;  1R3K C;  2A3Q A;  3ASO C;  1SRY A;  2RCV A;  4FLZ A;  1XOU A;  2F66 C;  1GAX A;  1K33 A;  1CP9 A;  3CRM A;  1Q6U A;  1LNQ A;  4MVQ A;  2P5O A;  3APQ A;  3ZRW B;  2LW7 A;  5JH7 B;  2HHH O;  2WA4 A;  2Q69 A;  4JTD B;  3F7Y C;  4NXM O;  5EBM C;  5GTI Z;  4JI6 B;  4MVO A;  1JJ2 U;  3BAB A;  4LFC O;  1HP8 A;  4LF6 B;  2HFE C;  1UFI A;  1NR1 A;  3QO5 A;  1QBZ A;  2DW4 A;  3ZRS A;  2DYR B;  2P4V A;  5B1N A;  2EZO A;  5IY5 B;  1GN2 A;  3WU2 Z;  2V1D A;  3AK2 A;  4UCV A;  2YEV A;  1T5E A;  4CH4 A;  1TUE B;  2EJ7 A;  3UCS C;  2N74 A;  3P32 A;  3HKD B;  1N33 B;  3U0Z A;  1GO3 F;  1J5E B;  3UO2 A;  2AZ0 A;  4R8C A;  4WBN B;  4FFK A;  2R9I A;  4QIW F;  4DV2 B;  3K58 A;  5LBQ A;  1RSO B;  4UCO A;  3I56 V;  5B3S B;  4I4T A;  4O4H A;  4IIJ A;  5FL7 G;  4QNH B;  5B5E Z;  4B7E A;  3M99 B;  4HZ3 A;  3AK3 A;  3J7A U;  3JCZ A;  4UB8 Z;  3CXH F;  1SA0 A;  2PUS A;  3ZHT A;  2Z3Y A;  3JD2 A;  3BHP A;  4B3S O;  4KP4 A;  1NVP D;  1EBO A;  3K5L A;  4YY3 B;  2YDE A;  5D5P A;  5B1A B;  1Q43 A;  2C2A A;  5EYP B;  1W2B U;  5CA0 A;  3ASO B;  4UVA A;  1HNZ O;  3S3X A;  4P2Z A;  3K5O A;  2KB1 A;  3CD6 V;  2RNB A;  4B3T B;  3OM3 B;  5CB4 B;  4B3R O;  4NTX A;  3CEI A;  3HKB A;  1S0V A;  2ZDI A;  1R3J C;  3OTF A;  3QNE A;  4ZI7 B;  5E1A C;  4DK0 A;  1MSD A;  5JQG A;  1O9G A;  4P9O A;  4GX5 A;  2YXL A;  4DRX A;  1K34 A;  2OWO A;  5FLX N;  3SJB C;  4HYO A;  2Q9L A;  4G28 B;  4WFE A;  1M9N A;  4LR3 A;  1PNK A;  1YEW A;  4LF4 B;  4UB6 Z;  1VQO V;  5LGN A;  4DR7 O;  5J2U A;  1VQK V;  2H3O A;  1YSC A;  4DO2 A;  3LUT B;  3ABU A;  3W7U A;  4X66 B;  1YF2 A;  1B06 A;  3B09 A;  3STL C;  2Q5Z A;  5H9C A;  4EFB A;  2OCH A;  3STZ C;  3E89 A;  5LHG A;  4D6T H;  2L35 A;  4X1K B;  4JI2 O;  4NTY A;  1OV9 A;  2AW9 A;  2Y69 B;  1NZ6 A;  5C8Y B;  4JI5 O;  3RYF A;  3T1H O;  3OT7 A;  1FAF A;  4RUE A;  4JYB A;  3G67 A;  2QWN B;  4LF9 B;  1XMQ B;  2RJZ A;  3FAV A;  2N04 A;  4CH5 A;  3G6E V;  2HKO A;  3RWR D;  3FB6 C;  3A0H Z;  4X89 A;  1KMI Z;  5LXT B;  3RYI B;  5IYD O;  4MSW C;  3T4D A;  1SC5 B;  3E86 A;  4BW5 A;  2KG7 B;  1FKA O;  3BRC A;  3NR7 A;  5KX5 B;  2QA4 V;  3B4S A;  1KKC A;  2XT9 A;  2XND G;  4FK5 C;  1TGO A;  1G8M A;  3JAT B;  1AR4 A;  4AQY B;  2E75 B;  2QWO B;  1S3J A;  4J7Z A;  2W0X A;  4GZR B;  1MOF A;  2QTO A;  1VQM V;  2OT5 A;  1EN6 A;  4QPJ A;  3VQV A;  1NKD A;  2BSK A;  4CS4 A;  1VF5 B;  1MG1 A;  3DSQ A;  3BAA A;  5KUK A;  2Q7E A;  3BA8 A;  2WLK A;  4L87 A;  4NKG B;  4MVM A;  1PL4 A;  3VQW A;  3ZJZ A;  4C7U A;  5ITZ B;  1IBK O;  1K4D C;  1D2D A;  3RBZ A;  2IJI A;  4JZ2 A;  4U3F H;  1X59 A;  4X65 O;  5J2T A;  1BGY H;  5JJN B;  2XAH A;  4GKK O;  1TAE A;  1B3Q A;  2BTO A;  2EZP A;  3CRA A;  1AI6 A;  4ZOL A;  4MS2 A;  1V55 C;  1QQC A;  1XRE A;  2A0L A;  3JYC A;  3KCX A;  1ARO P;  1NS1 A;  1P7G A;  1V9P A;  4QPK A;  2UXD B;  2Q0A A;  2KKW A;  3IAY A;  3GB7 C;  4OPA A;  4ZHQ B;  4DR2 B;  3L71 H;  5IYZ A;  3JAS A;  1N32 B;  3CMA V;  3E8H A;  4FLT A;  2X0L A;  1HR0 B;  1EN4 A;  2BTQ A;  3R65 A;  4LH7 A;  4U3J B;  2YIA A;  2W6J G;  1P49 A;  1Y6X A;  3K9S A;  2DOS A;  1N33 O;  3KCY A;  4LWS B;  1YZB A;  1WPB A;  2BCC H;  1VQ4 V;  3DXR A;  4DV2 O;  3ZMZ A;  3ZMU A;  5DM6 V;  3RVZ A;  3Q4H B;  4MW8 A;  1FS0 G;  2Q7H A;  4HNA B;  3AG2 C;  1K73 W;  5FNV A;  5BMV B;  4LP8 A;  1HNX B;  4L8J A;  1Q6H A;  5BZB A;  3B40 A;  5EBL C;  1AI4 A;  3E83 A;  2IJK A;  3NXS A;  1Q7Y W;  3JAW A;  4DW1 A;  4MTX A;  1AP6 A;  1JVM A;  3F5W C;  5EZY B;  2ZE6 A;  4BWA A;  4GX0 A;  2BOC C;  3QTC A;  5D5Q A;  3CCS V;  5LHI A;  2JEX A;  3CRR A;  1JJO A;  1SQG A;  2NNU A;  5EK0 A;  5LHH A;  4YJ3 A;  3CCV V;  2QE7 G;  3HKC B;  3W7S A;  1V55 B;  2ZE7 A;  4JAS A;  2DJV A;  3CHX A;  2ZM6 O;  3CC2 V;  3RYH B;  3SYO A;  3J80 N;  1YTF B;  1D5N A;  4UV9 A;  4LH6 A;  5JVD A;  2JGD B;  1NH2 B;  5CBG A;  4LF4 O;  1XBL A;  1L8D A;  1QR8 A;  4KFM A;  4YHH O;  2OIE A;  1ROP A;  4FM2 A;  5DED A;  4X66 O;  2P67 A;  3BEH A;  1GKF A;  4JTC B;  4UVC A;  1HNZ B;  3JD0 A;  1H8H G;  2Q0O C;  4FVM A;  4GT1 A;  2JJ2 G;  4OGQ B;  2WWW A;  2G38 A;  2W0F C;  3OR6 C;  1N0J A;  2GUZ B;  1ZX3 A;  1H2S B;  4GUN A;  1MMM A;  1W59 A;  2QGN A;  2HG5 C;  1OJH A;  1K97 A;  2YC0 A;  4YJ2 A;  3AG2 B;  3ML0 A;  4WF9 V;  2AGA A;  4MVZ A;  2EIK C;  2VQF O;  4WFB V;  1K92 A;  4DR7 B;  3E8F A;  4DR1 B;  1OCR C;  3UO3 A;  3F7V C;  3M8A A;  1WPX A;  1XMQ O;  2RDC A;  2IH3 C;  3SYC A;  3U10 A;  2QR4 A;  2QJ1 A;  2QM8 A;  2ZDI C;  3SYQ A;  1KEC A;  4IL6 Z;  1M5I A;  3HKE A;  1WB8 A;  1PL0 A;  2Y4T A;  1GMG A;  3K79 A;  4KXR A;  3CWB H;  1Y66 A;  3VQY A;  4JI2 B;  3A2F A;  3M7M X;  1H8E G;  1YJ9 V;  3UT5 A;  2H94 A;  1RM1 C;  4RQF A;  4YIO A;  1E1R G;  2X6B A;  2B9Z A;  3ABL C;  1M93 A;  2XOK G;  2YEV B;  1XMO O;  2IH1 C;  2XUM A;  4FPP A;  2DYS C;  4F6R A;  2JS5 A;  2VWK A;  4JF3 A;  2IBZ H;  2B1I A;  3ETQ A;  3ETD A;  1FXK A;  1FJG O;  1KKD A;  3ASN C;  2E76 B;  2DQ0 A;  2EX3 A;  1PNL A;  2ZKO A;  5TIS Z;  4LNU A;  2F95 B;  4TOI A;  4I4T B;  2XAQ A;  4O4H B;  4IIJ B;  4TQD A;  5GW7 A;  1NTK H;  2FYU H;  4BIO A;  4CS3 A;  1QHT A;  1ZWI C;  5LL6 Y;  4EB6 A;  1R6T A;  1HNW B;  4WCE V;  1K5Q A;  1OZ0 A;  1SA0 B;  1S76 D;  2K1E A;  3BCC H;  2E5L B;  1H2L A;  2VWJ A;  1HDJ A;  1BL8 A;  1PV0 A;  4DXW A;  4RAI A;  4JAA A;  3K5N A;  3AEI A;  4CBC A;  2EIK B;  1K4C C;  4J7K A;  4OX9 B;  5KA6 A;  4X64 B;  3G71 V;  3N27 A;  1OCR B;  3F5T A;  4FZ0 A;  5CA1 A;  2YIB A;  5CA0 B;  2CE4 A;  4X1Y A;  3IFX A;  1OCC C;  3S3W A;  4LF8 B;  3OTO B;  4X65 B;  3HKB B;  4IHJ A;  2VQE O;  1AJP A;  2ODM A;  4GKK B;  5JQG B;  1NJI W;  4LCU C;  4MTF A;  4R7C A;  1VQN V;  1YHQ V;  4DRX B;  1ENV A;  2JVD A;  1BQZ A;  1WP8 A;  4Z1M G;  1R3L C;  4FFB A;  1NQT A;  5H5N A;  3ZCC A;  1Q3E A;  1Z2G A;  3CCR V;  4A5U B;  2DE0 X;  5J2U B;  1RM1 B;  4BIU A;  3CXC U;  3ABL B;  1O9H A;  4I55 A;  1RFY A;  3TET A;  1HNX O;  1W0K G;  5KAF Z;  1AI5 A;  4QE7 A;  1CPY A;  2DYS B;  4DV3 O;  1YTF D;  3RVY A;  3CCQ V;  2Q68 A;  1NH2 D;  3CRC A;  3OGC C;  1YXB A;  2CGN A;  3ASN B;  3N2G A;  2CAZ C;  4DYL A;  3CCJ V;  2XAJ A;  4O2A B;  2N05 A;  3FKS G;  2DMX A;  2GBO A;  3K9A A;  2ZT9 B;  3CE2 A;  2Z5U A;  2NLJ C;  1TUB A;  1A32 A;  2R9R B;  4UV8 A;  4O4J A;  3E35 A;  3LSQ A;  1LUV A;  3CC7 V;  2YUA A;  1N4C A;  1F51 A;  1KB9 F;  1SQF A;  5KMG A;  1IXM A;  1SQP H;  2CTR A;  4FM1 A;  3FAV B;  2YIC A;  4PEL A;  3ABM C;  1NBM G;  4WFA V;  1Q5O A;  5EIB C;  1Q86 W;  1M57 B;  1NU1 H;  4N21 A;  5KHH A;  4PDL A;  1KU9 A;  4UFZ A;  1D5A A;  1IX9 A;  4DR5 B;  2P7T C;  1WA8 A;  5IT9 N;  1WNS A;  3K08 A;  1Q81 W;  1OCC B;  1XIL A;  1JQ0 A;  1KC8 W;  3JAL A;  2OTJ V;  4DW0 A;  4PJ0 Z;  4J11 A;  4IT5 A;  5HFL A;  3CYO A;  5KA5 A;  4JI0 B;  3W7T A;  4DUZ O;  2QKC A;  2LQT A;  5LA6 B;  4I9W A;  2HEP A;  2CH7 A;  4QGP A;  4JGS A;  2D2C B;  4IYH A;  2ZM6 B;  3FB5 C;  4G27 B;  2BE3 A;  2JRI A;  2EJR A;  5L3G A;  4NXN O;  1MSW D;  4TV9 A;  4DR1 O;  4BR6 A;  1H38 A;  5J2T B;  2A79 B;  2WLI A;  1V54 C;  4YHH B;  2WLL A;  2ITD C;  4DV7 B;  1S5J A;  2F1M A;  3MAQ A;  3JAR A;  3CRQ A;  4ZOL B;  3CS5 A;  3OFN G;  2IJH A;  5AG2 A;  5IDJ A;  4HAM A;  1IXB A;  1HW7 A;  1R3I C;  1GM9 A;  2AHZ A;  2OTL V;  5JJJ B;  4JV5 O;  4MTG A;  5CA3 A;  4GKJ B;  3P30 A;  3A0B Z;  3EFF K;  1KD1 W;  1S77 D;  2Y0P A;  4CC5 A;  1NR7 A;  5IYZ B;  1R73 A;  3JAS B;  2JJ1 G;  3P3N A;  3U11 A;  1EFR G;  4MVU A;  3ABM B;  3D8C A;  3SJA C;  2LFR A;  1VF6 A;  2VQF B;  4NYK A;  2BTQ B;  1QNM A;  1YIJ V;  2OYQ A;  3H1J H;  1AVM A;  4J9Z B;  2QTS A;  3DGE A;  1FYJ A;  5LMU O;  2AHY A;  4DR3 B;  1M1K W;  4DV0 B;  3EXA A;  2P6J A;  3JSN A;  2KSD A;  1AR5 A;  3ABT A;  3CX5 F;  3L73 H;  3DXR B;  4RWU A;  3UKM A;  1BS3 A;  1BHB A;  5CMU A;  2WLM A;  4DV5 O;  2GDS A;  4FIP C;  2FKX A;  1AP5 A;  1BMF G;  1Q90 D;  1N36 B;  3G6B A;  1HNW O;  1XHZ A;  5KHK A;  3FB8 C;  1FFX B;  1W0J G;  3OMN B;  4EKW A;  2E5L O;  4OPH A;  1XMO B;  3ZBH A;  5GON A;  3B8N A;  2EIM C;  5KUM A;  3JAW B;  1VQ6 V;  5EBW C;  2A9H A;  4WFF A;  5LYJ A;  1FJG B;  1U96 A;  3TGU H;  1IBL O;  4OX9 O;  5EYP A;  1SER A;  4X64 O;  2QSA A;  2CUG A;  4U7O A;  2GV9 A;  1V54 B;  4MTO A;  1CXZ B;  2GHY A;  3FYE B;  5CB4 A;  4HBN A;  4LF8 O;  4YJ3 B;  3OTO O;  2R72 A;  3ZHQ A;  2ITC C;  4G2K A;  2FTK A;  1BQ0 A;  3L75 H;  4JI3 B;  2E74 B;  2WPD G;  2EIN C;  1MZF A;  2MK3 A;  3JAK A;  2EIL C;  1WP7 A;  2JEU A;  2DWE C;  4PV1 B;  4LF5 B;  3ZHR A;  5JVD B;  1K8A W;  4TT3 G;  1NI8 A;  3D3I A;  4ASU G;  4JTA B;  3T1Y O;  5KHG A;  1PD3 A;  2FB5 A;  3QVN A;  5BXZ A;  4R6Z A;  2Y0I A;  1MA1 A;  3K03 A;  4KL1 A;  2VQE B;  2CK3 G;  3AG3 C;  1Q82 W;  3MDS A;  3OGI B;  2ARH A;  2HLD G;  3FFQ A;  4UUJ C;  1GN6 A;  2YID A;  1G4Y B;  4YJ2 B;  3LSS A;  3RT3 C;  4H33 A;  3ZMS A;  1WAZ A;  1IVS A;  1XDC A;  4I0X A;  4NR1 A;  3UQ8 A;  2HP8 A;  4LC1 A;  1RP3 B;  2ZIO A;  3SPJ A;  1IDS A;  1R1B A;  1ZL8 A;  1I0H A;  1QCE A;  2EIM B;  2Y4U A;  1P7B A;  3JD4 A;  3MHH C;  4DV3 B;  2JIZ G;  5JJE B;  4PDV A;  3HKE B;  2DQ3 A;  3BPZ A;  2ZNI A;  4DR5 O;  4MVS A;  5L3D A;  2PZS A;  3ZN1 A;  1L1F A;  3JAT A;  5B66 Z;  2L6L A;  1BCC H;  1URF A;  4IGG A;  2GSM B;  3SPG A;  3UT5 B;  3B2E E;  4J41 A;  1OCO C;  5H6Q A;  2VRZ A;  4CC6 A;  2PY5 A;  4JI0 O;  3TXS A;  2DN9 A;  3C3S A;  2EIN B;  5EC2 C;  1QLE C;  2QKS A;  4BW9 A;  4X88 A;  2EIL B;  1FFT B;  5F2V O;  1ZSP A;  1JOY A;  3HPL C;  1SQB H;  2ZNJ A;  5C93 A;  3QO7 A;  3QF7 A;  3C3T A;  1VF7 A;  4UCR A;  5EIB D;  4LNU B;  2AXT Z;  2XAS A;  1SZX A;  3SJC C;  2EIJ C;  4WFG A;  4JAV A;  4EB6 B;  1AI7 A;  2ZE8 A;  4DV7 O;  4JI8 B;  2F4V B;  3W7X A;  5LMN O;  1XHX A;  4JYC A;  3LNN A;  2ADP A;  3AG3 B;  4FMT A;  4K35 A;  1H2G A;  2P4K A;  4UCT A;  2Z0A A;  2P90 A;  4AIL C;  3SJQ C;  1KUQ A;  4DUZ B;  2PF4 E;  4WFH A;  4GKJ O;  4I7Z B;  4I50 A;  2QEX V;  4DR4 B;  1LR1 A;  2AZ2 A;  5JCO A;  1BT8 A;  1AB3 A;  5CA1 B;  4NVP A;  4X1Y B;  5BR8 O;  4PA6 A;  5DEC A;  4XDJ A;  4FLX A;  4NXN B;  1JA8 A;  4P9P A;  3GWK C;  2ZIN A;  4IHJ B;  4TUY A;  4DR3 O;  4DV0 O;  4EEQ A;  3CSX A;  1AJN A;  3OMI B;  4FFB B;  2E3C A;  4ABM A;  1EM1 A;  4JV5 B;  1Y76 A;  3CJH A;  1H2N A;  2WSS G;  1YCI A;  2XAG A;  3ZIA G;  1JFF A;  1GM7 A;  5IWA B;  4J7J A;  2IW5 A;  1OCO B;  4I55 B;  1N36 O;  1AJQ A;  1SES A;  3IJ4 A;  1KBH A;  3E22 A;  3CC4 V;  4J10 A;  1XQ8 A;  4X9Q A;  1N0N A;  4O2B A;  1PKX A;  3H1H H;  2H8P C;  1XNR B;  4U7N A;  1VQ8 V;  5KAI Z;  1VQP V;  1VP7 A;  3UM7 A;  2FML A;  2M7W A;  3N2G B;  5LMU B;  3CPW U;  1GRJ A;  4UVB A;  3CCU V;  4X62 B;  1KQS U;  4PA7 A;  5KLV H;  4TV8 A;  3G4S V;  1TUB B;  1M4U A;  1J95 A;  2EIJ B;  4O4J B;  3T2M A;  3E8G A;  1IUR A;  1GH6 A;  4DV5 B;  1SQQ H;  4TSF G;  5KMG B;  3C90 A;  1YVW A;  4GYC B;  3K0G A;  4JI4 B;  1VF6 C;  2QKA A;  2R70 A;  5LGT A;  3O65 A;  4FM0 A;  4IYI A;  4JI3 O;  4D7T A;  4UCU A;  4B3M O;  3GWO A;  4FZ1 A;  5J9P C;  5L3F A;  3ICX A;  3I55 V;  1XI1 A;  4LF5 O;  4JI7 B;  4DUY O;  3AG7 A;  2QWP B;  3K3W A;  5IE9 A;  2K9P A;  3N2K A;  4RO2 A;  5IJ0 A;  4ICG A;  2Q4P A;  5B3S C;  2WAM A;  1IBL B;  1XL4 A;  1HWY A;  3JAL B;  2HVJ C;  1AR1 B;  3WB1 A;  5IJ9 A;  2RMK B;  1XNQ B;  1UPG A;  4LF7 B;  2WLJ A;  4PI0 A;  3RN4 A;  1EZV H;  3ETE A;  1QU7 A;  5A9G A;  4I5S A;  4UCS A;  2CH7 B;  5LP6 A;  3TJT A;  4X1I A;  1WJZ A;  1YDX A;  2W6I G;  1L0N H;  2VS0 A;  4PDR A;  2IM9 A;  2YXH A;  4GX2 A;  1WLE A;  3E2E A;  1THZ A;  2F23 A;  1SET A;  4PDM A;  1FXV A;  4TV9 B;  4N23 A;  4O4L A;  2WLI B;  4K8Z A;  2WLL B;  5EC1 C;  5LGU A;  3T1Y B;  2X6A A;  4PD4 F;  3JAR B;  5B1O A;  2A7W A;  1L0L H;  1EZJ A;  4DR6 O;  3JD1 A;  1F4N A;  1VQ5 V;  1VAR A;  2LO1 A;  1GN4 A;  3D3Q A;  3B77 A;  3A0R A;  3CME V;  2F93 B;  1MAB G;  1F4M A;  2JS3 A;  1QLN A;  1K9M W;  2CTQ A;  2ETN A;  4E2L A;  1WB7 A;  5L3E A;  1EN5 A;  1QVF U;  3TXQ A;  3SYA A;  3ZRX A;  3L74 H;  4RQE A;  4I9Q A;  3RYF B;  4Z2W A;  3RYC A;  3ZN0 A;  4CZZ A;  1ZAU A;  1OHH G;  3LDE A;  1Y74 A;  3QO8 A;  1NT2 B;  2IJJ A;  3D36 A;  4LFA O;  2CTP A;  1Q6I A;  1I08 A;  1DK1 A;  1DTO A;  1K3E A;  3AG4 C;  3JD3 A;  4H37 A;  3VOU A;  5JWP A;  5LOV A;  5FPO A;  1ZLZ A;  4PA9 A;  2YIB D;  1N34 O;  5BY1 A;  4RUF A;  2CTW A;  1VQL V;  3APO A;  5FPR A;  2Y69 C;  5H2F Z;  3I5D A;  3BY6 A;  4F4L A;  1M90 W;  2CGO A;  4H13 B;  2UUC B;  2ZE5 A;  3ZS8 C;  1VEW A;  4JZG A;  4O4I A;  4NTW A;  1VIB A;  1DF4 A;  4JI8 O;  4EFE A;  5IYB O;  2F4V O;  2XHB A;  2WLH A;  3KZI Z;  4Z1V A;  2HR3 A;  2UU9 B;  5GON B;  4AHC A;  2YSU B;  2BSK B;  2MW2 B;  1YJW V;  2GTA A;  2LW1 A;  1US6 A;  1TVK A;  1H2M A;  5LYJ B;  4DR4 O;  2LP7 A;  1NTM H;  4LFB B;  1K7D A;  4X20 A;  4PHZ A;  4CH6 A;  5GTH Z;  3OEH G;  5KHI A;  4YIP A;  5KHJ A;  3PN1 A;  1JPX A;  3SDL A;  4FLW A;  2ATK C;  1M56 C;  5LMN B;  2HJD A;  1Y67 A;  2HVK C;  3JAK B;  2UUA O;  3ZRW A;  1CEZ A;  5JH7 A;  2ZR2 A;  1IBM O;  3FD9 A;  1F23 A;  2JK5 C;  1H2K A;  1GK9 A;  4FJC C;  3DTU B;  5IYC O;  2BOB C;  5IWA O;  3RFR A;  4AI8 A;  3OE7 G;  3VBB A;  1I5Y A;  3DC5 A;  5BR8 B;  2Q67 A;  4E4E A;  5CBH A;  3AG4 B;  1DGS A;  2RQ6 A;  1XNR O;  4B08 A;  4QJF B;  2ZQM A;  3LSU A;  2ZR3 A;  2OCC C;  3HKD A;  4O2A A;  1I94 O;  2UXC B;  4X62 O;  1PPJ H;  5K1P A;  4J80 A;  2UXB B;  1BE3 H;  4BAY A;  4WBN A;  5K1X A;  3OUS A;  4Q20 A;  1RSO A;  2QWR B;  4JAU A;  4I0X B;  5JCO C;  2Q7G A;  3FB7 C;  3PJS K;  1FD9 A;  2YS8 A;  3OD4 A;  4W4K A;  4DV6 O;  5FNV B;  4JI4 O;  1S5L Z;  1ZUQ A;  1ZL8 B;  3A8T A;  3ZHS A;  1KYO F;  2XTA A;  2F43 G;  2ZD9 A;  3L72 H;  1YI2 V;  4PA3 A;  2V7Q G;  3ETG A;  1KP3 A;  4K0K O;  3P3P A;  1G1X B;  2IU3 A;  3K57 A;  3MHS C;  3RGB A;  4JI7 O;  1DF5 A;  4JYA O;  3AG1 C;  4R50 A;  1XUQ A;  1Z5V A;  3BFR A;  2P06 A;  4B7K A;  4JI1 O;  1GM8 A;  2PYJ A;  1U97 A;  4PI2 A;  1XNQ O;  2LJ2 A;  1M56 B;  4LF7 O;  4JYY A;  2B1G A;  4BIZ A;  4ZI7 A;  5LA6 A;  2PTM A;  2HJF C;  2YXY A;  4DV4 O;  3H1L H;  4OXS A;  2LFS A;  1Y4M A;  2QM4 A;  2EBO A;  3H1K H;  1WN7 A;  4B3M B;  3EVK A;  5CN0 A;  2EUL A;  3IC7 A;  3WB2 A;  2PI5 A;  3O9O A;  4PA4 A;  2UXX A;  2UUB O;  1XL6 A;  4ZKI A;  2ZIM A;  1FXK C;  4DUY B;  1GTO A;  4ZIB A;  3FYI B;  3X2Q C;  4KHP B;  4ZBM A;  1SKV A;  3JAM N;  2PI4 A;  4D7S A;  1JR9 A;  1P4R A;  4UXN A;  2OIG A;  3CCE V;  2ZXW C;  2OCC B;  2X7R B;  4W4L A;  3ZMT A;  3J81 N;  4JI6 O;  3E8B A;  3WB0 A;  2A06 H;  4X8A A;  4I50 B;  4X1K A;  1JCH A;  4LF6 O;  2Q73 A;  5L3B A;  5C8Y A;  3KG2 A;  4K3A A;  2WA3 A;  1YIT V;  2UXN A;  2YI9 A;  4TUY B;  4DV1 B;  3ABK C;  2D3O W;  3BVO A;  4JPR A;  4GLX A;  1MZE A;  1R6K A;  3HB3 B;  1PNM A;  2NR5 A;  3ZHV A;  1J5E O;  5LXT A;  3RYI A;  2XAF A;  4DR6 B;  1FXH A;  3AG1 B;  2HHH B;  2KG7 A;  5LP6 C;  5B1B C;  3MD0 A;  4NXM B;  1Z5W A;  4XBF A;  5KX5 A;  1Y76 B;  3CJH B;  4MVR A;  2O57 A;  4FLV A;  2UUC O;  1JFF B;  3IC9 A;  4LFC B;  1G6U A;  1I5X A;  3THO A;  3E22 B;  1FFX A;  3TK1 A;  3K06 A;  3CCL V;  3K0D A;  3GVM A;  2ZCE A;  5E79 Z;  2QDO A;  4O2B B;  1JX9 A;  3AK1 A;  2UU9 O;  3LDD A;  4LFA B;  3JSL A;  4F6R B;  4YY3 O;  4J9Y B;  2ILM A;  3OMA B;  1S5H C;  3ZRV A;  1FXK B;  4LFB O;  4TV8 B;  2RN9 A;  4KUM A;  1N34 B;  3X2Q B;  4CH3 A;  4J42 A;  4XDL A;  5L3C A;  5ITZ A;  4B3T O;  1B6Q A;  1S72 V;  5HFM A;  4MT8 A;  2ZXW B;  1BSM A;  3CB2 A;  2LGQ A;  1FPO A;  2WLN A;  1Q8I A;  2QWQ B;  2FL4 A;  4FLY A;  3LNM B;  5DN6 G;  3D36 C;  2Q8V A;  1B04 A;  3H01 A;  3OAA G;  3RW0 A;  4B3S B;  2PYL A;  5CBF A;  2R9A A;  1OCZ C;  1QR9 A;  3KKY A;  3JCU Z;  1E79 G;  2KQX A;  4Q6G A;  3N2K B;  5IJ0 B;  2LGW A;  4ZHQ A;  4TWK A;  4P30 A;  1K5S A;  3H1I H;  3ABK B;  1KP2 A;  3K5M A;  1F7Y A;  3ZHU A;  5IJ9 B;  4TQF A;  1MNG A;  4B3R B;  3DC6 A;  2NN4 A;  5A2Q N;  1ORQ C;  4U3J A;  4F6E A;  5LP6 B;  5B1B B;  1X4T A;  3SGI A;  4X1I B;  3OW2 U;  4YXW G;  2UXC O;  4LWS A;  2DWD C;  3WG7 C;  2UUA B;  1VMG A;  1SZT A;  1IBM B;  2UXB O;  3LDC A;  1SQX H;  1IZ3 A;  1NVP B;  3SR2 C;  3ZMV A;  2PGG A;  4LF9 O;  2CDY A;  3Q4H A;  3ZX6 A;  3SYP A;  4O4L B;  4HNA A;  1DLB A;  2B5U A;  1RPR A;  5BMV A;  1COW G;  3R66 A;  2GTS A;  1E1Q G;  1AIL A;  3TCU A;  3CCM V;  4H0L B;  1SF9 A;  3L9D A;  4XDK A;  1XEQ A;  1QLE B;  3BA9 A;  3OEE G;  4FLU A;  2Y48 A;  1QVG U;  1PM9 A;  1SQV H;  1TA8 A;  4AQY O;  3WFV A;  3K59 A;  1I94 B;  3T4Z A;  1UJW B;  5EZY A;  4LBE C;  4JI5 B;  3T1H B;  3G80 A;  1PP9 H;  2M6Y A;  3K04 A;  3RYC B;  1Y74 B;  2DYR C;  4DV6 B;  5IY5 C;  3HKC A;  4QE9 A;  3ZED A;  1VQ7 V;  2IU0 A;  1OCZ B;  3L70 H;  3FX7 A;  3H9V A;  5LOV B;  3SPC A;  1BHA A;  1JMK C;  1GN3 A;  2JDI G;  1SS3 A;  3QG5 A; 
#chains in the Genus database with same CATH homology
 4FZ1 A;  1WP7 A;  4NTW A;  2L35 A;  4NTX A;  3S3W A;  1WP8 A;  2FB5 A;  3N27 A;  4FZ0 A;  3S3X A;  4NTY A;  4NYK A;  2QTS A;  3IJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...