4FZ1A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high ph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
410
structure length
406
Chain Sequence
SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 94
structure length 406
sequence length 410
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz1A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz1A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz1A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz1A02
4NTWA 3S3WA 2FB5A 2QTSA 4FZ0A 3IJ4A 4FZ1A 2L35A 4NTXA 4NYKA 3N27A 3S3XA 1WP7A 1WP8A 4NTYA
chains in the Genus database with same CATH superfamily
3BHPA 2AHYA 1IBKO 1SF9A 1AILA 1V54C 4NXMB 5KHIA 4K3AA 3K5MA 1V55C 3B8NA 4IGGA 5J2TB 2H94A 5JCOA 3SGIA 1THZA 2DMXA 4JI3O 1WP7A 4LFBB 3AK3A 3T1HB 5JJNB 5J2UA 1UPGA 2ITCC 4X1IB 2HKOA 2PI5A 3D8CA 2UXCO 3IC7A 4XDLA 3DXRB 4JTDB 5EYPA 3BCCH 3DSQA 2PYJA 5LGUA 5L3BA 1F51A 1MA1A 2EZPA 3ETDA 4MVUA 5KHGA 4YY3O 4UB6Z 5CA1B 3J7AU 3HKDA 2BTOA 2QKCA 5LHIA 3TETA 2DYRC 2QWNB 4LF5B 4KHPO 1QVGU 3LUTB 2YIDA 3STZC 2A3QA 4PHZA 2GDSA 4DR6O 2FYUH 1VQPV 4E4EA 3BEHA 1N0JA 1R6NA 3BPZA 4FZ0A 4O4HB 4FLTA 1SQQH 3QO5A 3QO8A 4DV2B 2FKXA 3WG7B 3ZRWA 4WBNB 3OTOB 2BTQA 3C90A 2WLIA 4WFBV 4LF6O 4FLUA 1NBMG 4X65B 1Z5WA 1DK1A 2JGUA 5GTHZ 2WPDG 2Q9LA 2ZQMA 4X1KB 4KFMA 2MW2B 1HWYA 2HHHO 4TUYA 5EK0A 2WA3A 4TOIA 1HDJA 2AZ0A 4LFAO 2ZM6O 1FXVA 1IXMA 4NVPA 1R6KA 5D5QA 4J9YB 2EIMC 3ZRVA 2YUAA 4LWSA 5L3DA 4G2KA 5CMUA 4NR1A 5H6RA 5ITZB 5H9CA 4DR1B 3SYQA 5L3EA 4LF9O 4IL6Z 3OTFA 4LF7B 1PP9H 2V1DA 3KCXA 1BCCH 1QLEB 3APOA 3JASA 4U3JB 1FJGO 1N34B 1GMGA 2ARHA 2IW5A 5HFLA 4FPPA 3L74H 2JGDB 2PUSA 2ZXWC 3JALA 4LF8B 4LH6A 2R72A 4DR7O 3HKEA 2XAGA 2K9PA 5E79Z 3M7MX 2Q67A 1WA8A 3T1CA 5H6QA 1I5YA 2R9IA 4MS2A 1VQ8V 4JGSA 5C8YB 2LFRA 2QKSA 4QE7A 1I7FA 4EB6A 1GH6A 1SETA 1XI1A 5KHJA 1N32B 1GRJA 2PY5A 4FFBB 5CBFA 1H8HG 3OFNG 3S3XA 4O2AA 4J80A 1IX9A 4O4LA 3OUSA 5C93A 3CRAA 4GCZA 1N36O 5JH7B 2EIKC 4F6EA 1JJ2U 1XNQO 3L70H 5EBMC 3E8BA 4DV1O 1TVKA 3JAWA 5LOVB 4CC5A 4TQFA 1M90W 5AG2A 4PDRA 1IBKB 1ZLZA 4DK1A 3NXSA 2Y69C 5KA5A 3A8TA 4UCOA 3SYOA 4CS4A 4QNHB 2E3CA 2ZD9A 2ILMA 2YXLA 4JI3B 1XBLA 2UXDB 5H5NA 5B1NA 1YITV 4H13B 1YTFD 4OXSA 4I4TB 2UXCB 2OCHA 4JI6O 5KHKA 3K03A 4UFZA 1GK9A 3ZHSA 5LA6A 1TUBB 3QNEA 3BFRA 1E1RG 5LYJA 4K0KO 4YY3B 3ASNB 1COWG 3O9OA 4LNUA 2GV9A 4H37A 2CTPA 4DV5O 3B2EE 4X20A 4KHPB 2QWPB 3CD6V 3ZMZA 3WB0A 1R3IC 5EBWC 3LDCA 4BW5A 4DR6B 3LDDA 2QKAA 3JCZA 5BR8O 1N0NA 2JJ1G 5L3GA 2E76B 1QQCA 1Y74A 4GX1A 1J95A 3JATA 5L3CA 2WLNA 3KG2A 1V9PA 1SA0A 2QWOB 5IJ0B 4B3TO 1R73A 1Q7YW 2F66C 1NTMH 3EFFK 3JSLA 1U96A 3CC7V 4YJ2A 3I55V 1BMFG 2IM9A 5CA0B 4D7SA 2Q7EA 4X66O 1AJPA 4I0XB 4MVZA 4XDKA 1AI5A 4R50A 2HVKC 2DWDC 4CBCA 1NR7A 1D5NA 3P3PA 1BS3A 3C3TA 4LF9B 2YXHA 1VQMV 5IYDO 3AG3B 4J41A 1CEZA 5ITZA 3SDLA 2HR3A 2Q73A 2JIZG 3AK1A 1FJGB 3DTUB 3B77A 2JS5A 4JI8O 2HVJC 3WG7C 4DR7B 2EIJB 4PA7A 3FB5C 1BGYH 1SQFA 4AI8A 3RWRD 2JGDA 2FTKA 4PJ0Z 2O57A 3ASOB 5E1AC 3RGBA 1KC8W 1SQGA 2NNUA 3CCMV 4TQDA 2JDIG 2ZDIA 4K8XA 3JD4A 3WU2Z 5FL7G 1XILA 3DGEA 1B3QA 2YIAA 5C8YA 5BXZA 5EC2C 3GB7C 2PYLA 3P3NA 1HNWO 4NXNO 1WP8A 2DJVA 3U11A 5KAFZ 2R9RB 1HNZO 2EX3A 4L8JA 4OPAA 4J10A 4YJ3A 2PF4E 3SYAA 2XASA 4X1YB 1AP5A 1SERA 3CC2V 1Q82W 5EIBD 1YTFB 5BZBA 1NU1H 3SYCA 1N36B 1QLEC 2QJ1A 1DTOA 1DF4A 2IJIA 3ZMVA 1B06A 1XNQB 1KMIZ 2PGGA 3SPJA 1CPYA 2F23A 1MMMA 4FLVA 4DV1B 1CP9A 4MVQA 1SQVH 3ZCCA 4NXMO 1SQPH 5J2UB 3ZMUA 4NTWA 4A5UB 5LP6A 4BR6A 1MSWD 2YSUB 1OCRB 3M8AA 4FZ1A 5EYPB 3CX5F 3CEIA 5LOVA 1CXZB 1F4NA 3M99B 3BRCA 5KUMA 1K9MW 1AB3A 1B6QA 1Q5OA 5FPRA 5F2VO 3K08A 4JI6B 3HKCB 2EILB 3L73H 4I9QA 2BOCC 1RFYA 4J7ZA 1BHAA 4U7OA 1AROP 1URFA 4K0KB 4JYBA 4LF5O 1LNQA 4CH4A 4ZI7A 2HG5C 4DV5B 1P7BA 3ZRWB 2BTQB 1R3JC 1ZWIC 4JTCB 3RN4A 3W7TA 2QSAA 3IJ4A 4HBNA 3RYIA 1RP3B 2LJ2A 2ZR3A 3D3QA 4DUZB 1YDXA 3E8GA 1D5AA 4OGQB 4I5SA 5BR8B 4PV1B 4UCRA 4CC6A 1US6A 2GSMB 4TUYB 3K9AA 3WB2A 1EFRG 3LSSA 2CH7A 3LSQA 4PD4F 4JI1O 1XREA 2IU3A 4B3RB 1EZVH 1EN6A 2XAQA 4O4JA 5IYBO 4LWSB 2P7TC 5BY1A 2EJRA 1Y4MA 4B3TB 3J80N 4ZHQA 4YIOA 3CWBH 1DLBA 1Q81W 2ZE7A 4MTFA 2Y0PA 3HPLC 2VQFB 1KYOF 3OGIB 3FB7C 4DUYB 2KB1A 3ASNC 3MDSA 1HR0O 4UCUA 3JASB 1G6UA 3LNNA 4LP8A 2DW4A 1P7GA 3HKEB 1EBOA 1XL4A 4Z1VA 4LF7O 1WA8B 4LF8O 2Q8VA 2IU0A 3E22A 1VQ4V 3JYCA 4LC1A 4JYAO 4OX9O 2M6YA 4W4KA 4EB6B 2DQ3A 2L35A 1Q86W 4YHHO 1PV0A 2W0FC 2LP7A 2RNBA 1Q6IA 2FL4A 5IYCO 2GUZA 2X6BA 1Q8IA 3KZIZ 4O2AB 2ADPA 3R66A 2B1IA 1H2KA 1EM1A 3U10A 4O4LB 2BSKA 4NXNB 2BE3A 3ETGA 1H2SB 1GN4A 3SPCA 1HNZB 1FS0G 3LNMB 4R6ZA 2H8PC 5D5PA 1GO3F 2K1EA 3T2MA 5EZYA 3E83A 1KB9F 3AG3C 1IBLB 1TVKB 2JS3A 3JAWB 3EVKA 4X1YA 3MHSC 1OJHA 1H2NA 3ZHUA 2EIJC 3N2GA 1PKXA 3K3WA 3JD0A 4JYCA 5A9GA 2WLJA 5EC1C 2UXBO 3LSUA 4H33A 1IURA 3ASOC 3G67A 3IC9A 5CB4A 3THOA 3ZRSA 2UXDO 4DO2A 3K06A 3A2FA 3CCQV 1PD3A 2WLLA 5LA6B 1VQKV 1JCHA 5LYJB 4X62B 2P90A 3FD9A 2CUGA 4LNUB 3AG2B 4X20B 1JFFA 1SRYA 4UUJC 3G71V 3FX7A 2VS0A 1M57B 1XUQA 3ZN1A 4E2LA 4JZ2A 1XOUA 2QM4A 1XL6A 2HJFC 4TV8B 3OMNB 3HKCA 5IJ9B 1H38A 3D36A 3JAMN 4JI2O 1HW7A 5L3FA 1Y74B 3GWKC 4D6TH 3OR7C 3JATB 5JCOC 3CXCU 3ETEA 5H2FZ 1KUQA 4MT8A 4JZGA 4PDVA 2AZ2A 4WFHA 5DECA 1JA8A 2XOKG 3SJBC 2JK5C 3MD0A 5IT9N 1SA0B 1AR4A 1K4CC 1OCRC 3K0DA 2AW9A 4JI1B 1Q3EA 1DF5A 4YJ2B 4DV3O 2Q69A 2Q6AA 1FYJA 2QGNA 2B1GA 5IYZA 1K3EA 3OMIB 4WF9V 1L0NH 2EILC 4UV8A 4HZ3A 2R9AA 5CBGA 4DV6O 1WN7A 3AK2A 3QF7A 4B08A 3SYPA 3N27A 1OCZB 2N05A 1BT8A 1FFTB 1ORQC 1HR0B 3OT7A 2LFSA 3E8FA 5KX5A 5B3SB 3T1YB 3AG1B 4IHJA 3I56V 1K5QA 4HAMA 3TXSA 4CH6A 4I7ZB 1DGSA 4FM1A 1P49A 4OPHA 4JYAB 1SQXH 4OX9B 4BIZA 5B1AB 2LW7A 5KLVH 4YIPA 3RBZA 4DW0A 4YHHB 3N2KB 3ABMB 4PA3A 3ZIAG 1MZFA 5GONA 4LCUC 1Z5VA 4KXRA 2F93B 1M56B 4YJ3B 2MK3A 5EBLC 1XDCA 1SZXA 1G4YB 2ZT9B 5IY5C 4DR3O 2N04A 2W0XA 2M7WA 4EKWA 1VF7A 4JPRA 2A7WA 3AEIA 1B04A 2PZSA 1BHBA 4J7JA 3JAKA 3W7SA 4G28B 5GTIZ 4MTXA 4LFCB 1VF6A 3IFXA 1ZSPA 1PL0A 2Q5ZA 4N21A 1QNMA 5LP6B 5B1BB 1Z2GA 3OMAB 1YCIA 3W7XA 4G27B 1PM9A 5B1OA 3Q4HA 2UXBB 1ZL8B 1FFXA 1VEWA 4UVCA 1JOYA 1NT2B 2CAZC 2E5LB 3UO3A 1XHZA 1QCEA 3CCVV 2WWWA 5IDJA 5KHHA 2ZNJA 1VP7A 3SPIA 1R3LC 3HR0A 1H2LA 3ZHRA 4ZI7B 5IWAO 3BABA 1VQLV 3RYHA 3RYIB 2D2CB 3OAAG 4AILC 4GX5A 1HNXO 1H8EG 3TXQA 1FPOA 2Q4PA 4UB8Z 2P4VA 4CZZA 1K92A 2ZIOA 4JI2B 4I55B 2B5UA 2QTSA 4DUZO 2CH7B 2Y0IA 4TV8A 5JJEB 4DR5O 5IJ9A 2JJ2G 5FNVA 3ZRXA 4X89A 1SS3A 3H1JH 1VIBA 4O4JB 2X6AA 4U7NA 1IXBA 5GW7A 1JVMA 1FAFA 1OHHG 1RPRA 2ODMA 2XUMA 3DC5A 2LW1A 4ZHQB 4B3RO 4DV3B 3RYCB 3BVOA 3B8MA 3ZJZA 1GAXA 1AR1B 1XNRB 2LQTA 2Z5UA 3RYFA 5KUKA 2QEXV 3I5DA 2VQFO 2Q7HA 4NB5A 3AG2C 4DUYO 4DV6B 4JASA 2W6IG 1M57C 4QPJA 3JSNA 2HJDA 4DR2O 2F4VO 3E22B 3ZHQA 1GM7A 2CGNA 4FLZA 1K33A 3RFRA 2LO1A 2QWQB 2JEUA 4TWKA 3L72H 4X88A 5HFMA 3H1IH 2D3OW 4AQYO 2LGQA 2OCCB 1YJWV 3CMEV 1G1XB 1AI6A 5KAIZ 1HP8A 2Q68A 2GUZB 3CCEV 2NR5A 2ITDC 1E1QG 2DWEC 3CRMA 4DK0A 4TV9A 5CA3A 1O9GA 2L6LA 3K5NA 4PA4A 1NTKH 1Q6UA 2BSKB 3F5TA 4MW3A 4QIWF 1QVFU 2QTOA 4R7CA 2ZKOA 3H9VA 3K0GA 1MNGA 5EZYB 3K5OA 3N2KA 2PI4A 2E74B 2EJ7A 4DR3B 1G8MA 4MTGA 4TT3G 1OCZC 1UJWB 5JWPA 2XT9A 2DE0X 1RSOA 3UQ8A 1JX9A 3E35A 1IBLO 2E75B 5B3SC 3AG1C 1R6TA 3E8HA 2JVDA 3N2GB 1S5JA 2R70A 3R65A 4RAIA 3SPGA 2YEVA 3BA8A 3ABLB 4GX2A 3VBBA 4RUFA 3VQWA 5CB4B 3JCUZ 1PNKA 2ZE6A 3ABKB 2GBOA 3CCRV 5B1AC 1FXKA 2ZDIC 2YIBA 4K8ZA 1KKDA 2WLLB 2N74A 1H2MA 2X7RB 3ABMC 5JQGA 5JVDA 1M56C 4HNAA 4LR3A 1NKDA 1ZL8A 1JFFB 2X6CA 4X62O 3L9DA 1S72V 1S5HC 1W59A 1YHQV 4X8AA 3CS5A 1T5EA 4TSFG 4DV0O 2QR4A 3EXAA 3B4SA 5LMNO 3B40A 4FLXA 5IWAB 4P30A 2P06A 3FFQA 1TGOA 2JEXA 1QR8A 4P9OA 2C2AA 1WPXA 5LL6Y 1PL4A 4B3SO 1HNXB 4Q20A 3CRCA 4H44B 4HYOA 4WFGA 3FYIB 4JAVA 3K79A 2RCVA 1LUWA 5B1BC 5LP6C 4UCTA 2QDOA 1AI7A 4DR5B 5DM6V 3K59A 3K5LA 2G38A 3CPWU 4I55A 4UV9A 3JD3A 5IYZB 5LXTB 4MVSA 2YC0A 4J7KA 1L8DA 1K34A 1KQSU 2YICA 2ZNIA 1S0VA 4QPKA 3WFVA 1L0LH 1MOFA 1KD1W 2CTWA 4JI7B 2YDEA 3RYCA 1GN3A 5KX5B 3BAAA 1XEQA 4FIPC 4IHJB 3LDEA 3QVNA 2EZOA 3MAQA 4DR2B 2F4VB 1OCOB 3T1YO 1IVSA 1TA8A 1VQ6V 2ZE8A 4EFBA 3CJHA 2V4DA 4AHCA 4MVMA 3SR2C 3VQYA 1QU7A 2XTAA 4AQYB 3C3SA 1NTZH 3RW0A 1MABG 3OEHG 2KSDA 5GONB 4FLYA 3FAVA 1BQ0A 4P9PA 4QJFB 3MHHC 1WLEA 2IH3C 3HB3B 3RVYA 3G80A 4EEQA 4C7UA 2KQXA 1MG1A 4JAUA 3OGCC 4NKGB 1YJNV 1VMGA 2AXTZ 2DYSB 1N33B 4CH5A 3JAKB 4PI0A 1R3KC 2A79B 1YXBA 1NVPD 3SJCC 2EINB 2UUCO 3ZHVA 1BSMA 1NI8A 2FMLA 4FVMA 3QG5A 3L71H 1GN2A 3HKBA 3JARA 5DN6G 2HP8A 2VWJA 1SC5B 1M4UA 4LFCO 1KP2A 1ZAUA 1NR1A 3QTCA 2OYQA 3Q4HB 2OCCC 3E89A 5JJJB 2H3OA 2VQEO 3UM7A 1YZBA 4JF3A 3CYOA 1FFXB 1GM8A 2OWOA 4ZOLA 4X64B 1D2DA 1S76D 2IH1C 1JMKC 2Y4UA 1AP6A 2ZIMA 2WA4A 2QWRB 3W7UA 3OW2U 1I5XA 1S3JA 1Y76A 2E5LO 3K04A 1VQOV 4FLWA 3ZMTA 3P32A 2BCCH 1JJOA 1TUEB 3CCLV 1KKCA 1MZEA 3DC6A 1NJIW 3RYHB 2UU9O 1M5IA 1VQNV 3PN1A 2CGOA 2YIBD 1OV9A 2P4KA 4DV0B 1SQBH 4RUEA 4JV5B 4DRXA 5IE9A 3WB1A 3OUFA 5LMNB 4KUMA 4CH3A 3UCSC 5J9PC 4O2BA 1PNMA 1JPXA 4GLXA 5FNVB 4B3SB 4DR4B 1VQ5V 1P84F 3ABLC 2QM7A 4PA6A 1Y66A 2FB5A 2RDCA 2RMKB 3ZHTA 4PDLA 4NTYA 3ABKC 5DEDA 3E86A 4FMTA 1AJNA 5LBQA 1AR5A 1XMQB 2F1MA 2EBOA 2WLKA 1IZ3A 2JRIA 4FM2A 3RYFB 4B3MB 4JTAB 1XNRO 2OIGA 2WSSG 3CRQA 4RWUA 5LXTA 1MSDA 4XDJA 5KA6A 4JI0B 1NH2D 2QE7G 3CRRA 3D36C 2ADQB 5BMVA 1EN4A 3OM3B 5FPOA 1OZ0A 3G6EV 1Q6HA 3IGAC 4QGPA 4N23A 3H1HH 1XHXA 4IYHA 1FXHA 1WB7A 2F43G 3BA9A 5KMGA 3UT5A 4GUNA 1AJQA 2UXNA 1YVWA 1NVPB 1OCCB 1LUVA 2Y4TA 4TV9B 3TGUH 1RPOA 1WAZA 4XBFA 2OIEA 1P4RA 1WPBA 1F4MA 3CCUV 4UXNA 4Q6GA 3GVMA 4DXWA 1RM1B 2UUAO 1J5EB 4P2ZA 2OTLV 4MTOA 2CDYA 4JI5O 1ZX3A 1UFIA 2KG7A 1BE3H 4UCSA 1RSOB 4O4IA 4ABMA 1GN6A 5CBHA 3A0HZ 2UUCB 3CCSV 5B5EZ 2YEVB 1I94B 2QA4V 3AG4B 4WFEA 3J81N 1KP3A 1QBZA 1OCOC 2XAHA 1GM9A 1NQTA 3ZS8C 5FLXN 1FXKB 4RO2A 3A0RA 4WFFA 2VQEB 1FKAO 5CN0A 4B7EA 1KBHA 2P22C 1VARA 1FD9A 1GTOA 1VF5B 3G6BA 5EIBC 1IBMO 5JQGB 1L1FA 5JVDB 4EFEA 4IIJB 4HNAB 4ICGA 4B7KA 4MVOA 3K9SA 2RN9A 2OT5A 3TK1A 3CCJV 1F23A 3OE7G 4F6RA 1I0HA 1R1BA 4I50A 3ABTA 3W7WA 2DYSC 2CK3G 4PELA 3NR7A 2HEPA 3T4ZA 2UU9B 1K7DA 2EINC 3CSXA 3X2QB 3K58A 1VF6C 3ML0A 4MW8A 2F95B 1PPJH 3GWOA 1K97A 3A0BZ 5J2TA 4BAYA 4CS3A 1X4TA 1NH2B 4X1IA 2UUBO 3ZMSA 1YEWA 4K35A 3RVZA 2YS8A 1PNLA 4BWAA 3PJSK 1S5LZ 2Q0OC 3DXRA 3O65A 3E2EA 1W0KG 3B09A 3CB2A 3L75H 1QLNA 1F7YA 4ASUG 5LGNA 3SJAC 5CA1A 3CP1A 2YXYA 3VOUA 5A2QN 3TJTA 3JD2A 1VQ9V 1Y67A 4JI7O 3UKMA 1YF2A 4LF6B 2ZR2A 2V7QG 2PTMA 4O4HA 2ZCEA 4JI4O 3H01A 4WBNA 3CJHB 1H2GA 1N8RW 3RT3C 3FYEB 1QR9A 4LH7A 4MVRA 2HHHB 4J9ZB 1WNSA 3FB6C 1QHTA 4LFAB 4ZIBA 4X1KA 2ZM6B 1AVMA 3S3WA 3FKSG 4GKJO 4WCEV 1EN5A 2XAJA 2ETNA 3FAVB 2AHZA 3KKYA 3VQVA 3IAYA 4GKKO 4J42A 2IJJA 5TISZ 4DV7O 4IT5A 4UVBA 1ENVA 1Q43A 4LF4O 4W4LA 3ETQA 4H0LB 2KKWA 2W6JG 3G4SV 4BW9A 2UUAB 1VQ7V 2UXXA 2IJKA 2ZE5A 4JI5B 2WAMA 4D7TA 1N33O 4U3JA 1V54B 1ZUQA 3HKBB 1WJZA 3JARB 1V55B 3CC4V 4BIUA 1YSCA 1BQZA 4GX0A 3CHXA 3T4DA 3H1LH 4BIOA 3ZX6A 1U97A 1O9HA 5LMUO 1NS1A 1M93A 4L87A 4ZOLB 4PDMA 1XMOO 2XNDG 3KCYA 2LGWA 1OCCC 3APQA 2CTQA 1Q90D 1Y76B 4X64O 5LHGA 1WB8A 2IJHA 4DV4O 1SZTA 1IBMB 4FFBA 2IBZH 2DYRB 2A06H 1K8AW 3UO2A 2XAFA 3F7YC 1RM1C 4QE9A 1M1KW 2AGAA 4Z2WA 4IIJA 2YI8A 1IDSA 4DRXB 4ZKIA 3SJQC 2DN9A 5JH7A 3F5WC 4RQFA 4O2BB 1ROPA 3QO7A 3CMAV 4JV5O 3D3IA 5K1PA 2OTJV 2Z0AA 4LFBO 4YXWG 3T1HO 2BOBC 3AG4C 1I08A 1W2BU 1N4CA 5LGTA 4PA9A 3OD4A 2A9HA 4GT1A 1YIJV 1ZTEA 4GZRB 4DR4O 3ABUA 3HKDB 2P67A 1FXKC 2RQ6A 4UVAA 4X9QA 2EIMB 1AI4A 2EULA 2CTRA 4MSWC 2UUBB 1BL8A 2NN4A 2XHBA 4I4TA 3F7VC 1Y6XA 1JR9A 1KECA 2ATKC 1K4DC 1TAEA 4ZBMA 4KL1A 1XMQO 3OR6C 2CE4A 3ZN0A 1TUBA 2WLIB 2DQ0A 4B3MO 4RQEA 1YI2V 3K57A 4J11A 2ZXWB 4DV2O 1K73W 3OTOO 5BMVB 1A32A 4X65O 1GKFA 3BY6A 3STLC 3ICXA 4JI0O 3X2QC 1SKVA 2VWKA 4F4LA 4KP4A 4CS2A 1EZJA 4JI4B 5KMGB 3AG7A 3UT5B 2P6JA 2Z3YA 2Q7GA 4FM0A 2HLDG 2NLJC 4DYLA 2VRZA 4FK5C 3JD1A 3OEEG 1XQ8A 2GHYA 2RJZA 5IY5B 2X0LA 2YI9A 4GKJB 1KU9A 4R8CA 5IJ0A 3SPHA 4X66B 4DR1O 4GKKB 3CXHF 5K1XA 4JYYA 1X59A 3JALB 5CA0A 4DV7B 4WFAV 2DOSA 3U0ZA 2KG7B 4Z1MG 3EHBB 1N34O 4LF4B 4I0XA 4LBEC 2EIKB 4DW1A 4O4IB 1J5EO 4UCVA 4I9WA 1SESA 1BZKA 4JI8B 4IYIA 2WLHA 1LR1A 5LHHA 2ZINA 3H1KH 3VQXA 2Y69B 1YJ9V 1I94O 2P5OA 1E79G 1NZ6A 4NYKA 3CE2A 3ZBHA 2Q0AA 5LMUB 4GYCB 1K5SA 1N32O 1XMOB 4NTXA 3ZEDA 1HNWB 2GTSA 1JQ0A 2Y48A 3P30A 2B9ZA 2HFEC 4PI2A 3TCUA 1S77D 1W0JG 2WLMA 4F6RB 4DV4B 4I50B 4U3FH 4FFKA 2A0LA 1M9NA 4JAAA 2GTAA 5B66Z 3FB8C 2QM8A 4FJCC
chains in the Genus database with same CATH topology
4NTWA 3S3WA 2FB5A 2QTSA 4FZ0A 3IJ4A 4FZ1A 2L35A 4NTXA 4NYKA 3N27A 3S3XA 1WP7A 1WP8A 4NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTW A;  3S3W A;  2FB5 A;  2QTS A;  4FZ0 A;  3IJ4 A;  4FZ1 A;  2L35 A;  4NTX A;  4NYK A;  3N27 A;  3S3X A;  1WP7 A;  1WP8 A;  4NTY A; 
#chains in the Genus database with same CATH topology
 3BHP A;  2AHY A;  1IBK O;  1SF9 A;  1AIL A;  1V54 C;  4NXM B;  5KHI A;  4K3A A;  3K5M A;  1V55 C;  3B8N A;  4IGG A;  5J2T B;  2H94 A;  5JCO A;  3SGI A;  1THZ A;  2DMX A;  4JI3 O;  1WP7 A;  4LFB B;  3AK3 A;  3T1H B;  5JJN B;  5J2U A;  1UPG A;  2ITC C;  4X1I B;  2HKO A;  2PI5 A;  3D8C A;  2UXC O;  3IC7 A;  4XDL A;  3DXR B;  4JTD B;  5EYP A;  3BCC H;  3DSQ A;  2PYJ A;  5LGU A;  5L3B A;  1F51 A;  1MA1 A;  2EZP A;  3ETD A;  4MVU A;  5KHG A;  4YY3 O;  4UB6 Z;  5CA1 B;  3J7A U;  3HKD A;  2BTO A;  2QKC A;  5LHI A;  3TET A;  2DYR C;  2QWN B;  4LF5 B;  4KHP O;  1QVG U;  3LUT B;  2YID A;  3STZ C;  2A3Q A;  4PHZ A;  2GDS A;  4DR6 O;  2FYU H;  1VQP V;  4E4E A;  3BEH A;  1N0J A;  1R6N A;  3BPZ A;  4FZ0 A;  4O4H B;  4FLT A;  1SQQ H;  3QO5 A;  3QO8 A;  4DV2 B;  2FKX A;  3WG7 B;  3ZRW A;  4WBN B;  3OTO B;  2BTQ A;  3C90 A;  2WLI A;  4WFB V;  4LF6 O;  4FLU A;  1NBM G;  4X65 B;  1Z5W A;  1DK1 A;  2JGU A;  5GTH Z;  2WPD G;  2Q9L A;  2ZQM A;  4X1K B;  4KFM A;  2MW2 B;  1HWY A;  2HHH O;  4TUY A;  5EK0 A;  2WA3 A;  4TOI A;  1HDJ A;  2AZ0 A;  4LFA O;  2ZM6 O;  1FXV A;  1IXM A;  4NVP A;  1R6K A;  5D5Q A;  4J9Y B;  2EIM C;  3ZRV A;  2YUA A;  4LWS A;  5L3D A;  4G2K A;  5CMU A;  4NR1 A;  5H6R A;  5ITZ B;  5H9C A;  4DR1 B;  3SYQ A;  5L3E A;  4LF9 O;  4IL6 Z;  3OTF A;  4LF7 B;  1PP9 H;  2V1D A;  3KCX A;  1BCC H;  1QLE B;  3APO A;  3JAS A;  4U3J B;  1FJG O;  1N34 B;  1GMG A;  2ARH A;  2IW5 A;  5HFL A;  4FPP A;  3L74 H;  2JGD B;  2PUS A;  2ZXW C;  3JAL A;  4LF8 B;  4LH6 A;  2R72 A;  4DR7 O;  3HKE A;  2XAG A;  2K9P A;  5E79 Z;  3M7M X;  2Q67 A;  1WA8 A;  3T1C A;  5H6Q A;  1I5Y A;  2R9I A;  4MS2 A;  1VQ8 V;  4JGS A;  5C8Y B;  2LFR A;  2QKS A;  4QE7 A;  1I7F A;  4EB6 A;  1GH6 A;  1SET A;  1XI1 A;  5KHJ A;  1N32 B;  1GRJ A;  2PY5 A;  4FFB B;  5CBF A;  1H8H G;  3OFN G;  3S3X A;  4O2A A;  4J80 A;  1IX9 A;  4O4L A;  3OUS A;  5C93 A;  3CRA A;  4GCZ A;  1N36 O;  5JH7 B;  2EIK C;  4F6E A;  1JJ2 U;  1XNQ O;  3L70 H;  5EBM C;  3E8B A;  4DV1 O;  1TVK A;  3JAW A;  5LOV B;  4CC5 A;  4TQF A;  1M90 W;  5AG2 A;  4PDR A;  1IBK B;  1ZLZ A;  4DK1 A;  3NXS A;  2Y69 C;  5KA5 A;  3A8T A;  4UCO A;  3SYO A;  4CS4 A;  4QNH B;  2E3C A;  2ZD9 A;  2ILM A;  2YXL A;  4JI3 B;  1XBL A;  2UXD B;  5H5N A;  5B1N A;  1YIT V;  4H13 B;  1YTF D;  4OXS A;  4I4T B;  2UXC B;  2OCH A;  4JI6 O;  5KHK A;  3K03 A;  4UFZ A;  1GK9 A;  3ZHS A;  5LA6 A;  1TUB B;  3QNE A;  3BFR A;  1E1R G;  5LYJ A;  4K0K O;  4YY3 B;  3ASN B;  1COW G;  3O9O A;  4LNU A;  2GV9 A;  4H37 A;  2CTP A;  4DV5 O;  3B2E E;  4X20 A;  4KHP B;  2QWP B;  3CD6 V;  3ZMZ A;  3WB0 A;  1R3I C;  5EBW C;  3LDC A;  4BW5 A;  4DR6 B;  3LDD A;  2QKA A;  3JCZ A;  5BR8 O;  1N0N A;  2JJ1 G;  5L3G A;  2E76 B;  1QQC A;  1Y74 A;  4GX1 A;  1J95 A;  3JAT A;  5L3C A;  2WLN A;  3KG2 A;  1V9P A;  1SA0 A;  2QWO B;  5IJ0 B;  4B3T O;  1R73 A;  1Q7Y W;  2F66 C;  1NTM H;  3EFF K;  3JSL A;  1U96 A;  3CC7 V;  4YJ2 A;  3I55 V;  1BMF G;  2IM9 A;  5CA0 B;  4D7S A;  2Q7E A;  4X66 O;  1AJP A;  4I0X B;  4MVZ A;  4XDK A;  1AI5 A;  4R50 A;  2HVK C;  2DWD C;  4CBC A;  1NR7 A;  1D5N A;  3P3P A;  1BS3 A;  3C3T A;  4LF9 B;  2YXH A;  1VQM V;  5IYD O;  3AG3 B;  4J41 A;  1CEZ A;  5ITZ A;  3SDL A;  2HR3 A;  2Q73 A;  2JIZ G;  3AK1 A;  1FJG B;  3DTU B;  3B77 A;  2JS5 A;  4JI8 O;  2HVJ C;  3WG7 C;  4DR7 B;  2EIJ B;  4PA7 A;  3FB5 C;  1BGY H;  1SQF A;  4AI8 A;  3RWR D;  2JGD A;  2FTK A;  4PJ0 Z;  2O57 A;  3ASO B;  5E1A C;  3RGB A;  1KC8 W;  1SQG A;  2NNU A;  3CCM V;  4TQD A;  2JDI G;  2ZDI A;  4K8X A;  3JD4 A;  3WU2 Z;  5FL7 G;  1XIL A;  3DGE A;  1B3Q A;  2YIA A;  5C8Y A;  5BXZ A;  5EC2 C;  3GB7 C;  2PYL A;  3P3N A;  1HNW O;  4NXN O;  1WP8 A;  2DJV A;  3U11 A;  5KAF Z;  2R9R B;  1HNZ O;  2EX3 A;  4L8J A;  4OPA A;  4J10 A;  4YJ3 A;  2PF4 E;  3SYA A;  2XAS A;  4X1Y B;  1AP5 A;  1SER A;  3CC2 V;  1Q82 W;  5EIB D;  1YTF B;  5BZB A;  1NU1 H;  3SYC A;  1N36 B;  1QLE C;  2QJ1 A;  1DTO A;  1DF4 A;  2IJI A;  3ZMV A;  1B06 A;  1XNQ B;  1KMI Z;  2PGG A;  3SPJ A;  1CPY A;  2F23 A;  1MMM A;  4FLV A;  4DV1 B;  1CP9 A;  4MVQ A;  1SQV H;  3ZCC A;  4NXM O;  1SQP H;  5J2U B;  3ZMU A;  4NTW A;  4A5U B;  5LP6 A;  4BR6 A;  1MSW D;  2YSU B;  1OCR B;  3M8A A;  4FZ1 A;  5EYP B;  3CX5 F;  3CEI A;  5LOV A;  1CXZ B;  1F4N A;  3M99 B;  3BRC A;  5KUM A;  1K9M W;  1AB3 A;  1B6Q A;  1Q5O A;  5FPR A;  5F2V O;  3K08 A;  4JI6 B;  3HKC B;  2EIL B;  3L73 H;  4I9Q A;  2BOC C;  1RFY A;  4J7Z A;  1BHA A;  4U7O A;  1ARO P;  1URF A;  4K0K B;  4JYB A;  4LF5 O;  1LNQ A;  4CH4 A;  4ZI7 A;  2HG5 C;  4DV5 B;  1P7B A;  3ZRW B;  2BTQ B;  1R3J C;  1ZWI C;  4JTC B;  3RN4 A;  3W7T A;  2QSA A;  3IJ4 A;  4HBN A;  3RYI A;  1RP3 B;  2LJ2 A;  2ZR3 A;  3D3Q A;  4DUZ B;  1YDX A;  3E8G A;  1D5A A;  4OGQ B;  4I5S A;  5BR8 B;  4PV1 B;  4UCR A;  4CC6 A;  1US6 A;  2GSM B;  4TUY B;  3K9A A;  3WB2 A;  1EFR G;  3LSS A;  2CH7 A;  3LSQ A;  4PD4 F;  4JI1 O;  1XRE A;  2IU3 A;  4B3R B;  1EZV H;  1EN6 A;  2XAQ A;  4O4J A;  5IYB O;  4LWS B;  2P7T C;  5BY1 A;  2EJR A;  1Y4M A;  4B3T B;  3J80 N;  4ZHQ A;  4YIO A;  3CWB H;  1DLB A;  1Q81 W;  2ZE7 A;  4MTF A;  2Y0P A;  3HPL C;  2VQF B;  1KYO F;  3OGI B;  3FB7 C;  4DUY B;  2KB1 A;  3ASN C;  3MDS A;  1HR0 O;  4UCU A;  3JAS B;  1G6U A;  3LNN A;  4LP8 A;  2DW4 A;  1P7G A;  3HKE B;  1EBO A;  1XL4 A;  4Z1V A;  4LF7 O;  1WA8 B;  4LF8 O;  2Q8V A;  2IU0 A;  3E22 A;  1VQ4 V;  3JYC A;  4LC1 A;  4JYA O;  4OX9 O;  2M6Y A;  4W4K A;  4EB6 B;  2DQ3 A;  2L35 A;  1Q86 W;  4YHH O;  1PV0 A;  2W0F C;  2LP7 A;  2RNB A;  1Q6I A;  2FL4 A;  5IYC O;  2GUZ A;  2X6B A;  1Q8I A;  3KZI Z;  4O2A B;  2ADP A;  3R66 A;  2B1I A;  1H2K A;  1EM1 A;  3U10 A;  4O4L B;  2BSK A;  4NXN B;  2BE3 A;  3ETG A;  1H2S B;  1GN4 A;  3SPC A;  1HNZ B;  1FS0 G;  3LNM B;  4R6Z A;  2H8P C;  5D5P A;  1GO3 F;  2K1E A;  3T2M A;  5EZY A;  3E83 A;  1KB9 F;  3AG3 C;  1IBL B;  1TVK B;  2JS3 A;  3JAW B;  3EVK A;  4X1Y A;  3MHS C;  1OJH A;  1H2N A;  3ZHU A;  2EIJ C;  3N2G A;  1PKX A;  3K3W A;  3JD0 A;  4JYC A;  5A9G A;  2WLJ A;  5EC1 C;  2UXB O;  3LSU A;  4H33 A;  1IUR A;  3ASO C;  3G67 A;  3IC9 A;  5CB4 A;  3THO A;  3ZRS A;  2UXD O;  4DO2 A;  3K06 A;  3A2F A;  3CCQ V;  1PD3 A;  2WLL A;  5LA6 B;  1VQK V;  1JCH A;  5LYJ B;  4X62 B;  2P90 A;  3FD9 A;  2CUG A;  4LNU B;  3AG2 B;  4X20 B;  1JFF A;  1SRY A;  4UUJ C;  3G71 V;  3FX7 A;  2VS0 A;  1M57 B;  1XUQ A;  3ZN1 A;  4E2L A;  4JZ2 A;  1XOU A;  2QM4 A;  1XL6 A;  2HJF C;  4TV8 B;  3OMN B;  3HKC A;  5IJ9 B;  1H38 A;  3D36 A;  3JAM N;  4JI2 O;  1HW7 A;  5L3F A;  1Y74 B;  3GWK C;  4D6T H;  3OR7 C;  3JAT B;  5JCO C;  3CXC U;  3ETE A;  5H2F Z;  1KUQ A;  4MT8 A;  4JZG A;  4PDV A;  2AZ2 A;  4WFH A;  5DEC A;  1JA8 A;  2XOK G;  3SJB C;  2JK5 C;  3MD0 A;  5IT9 N;  1SA0 B;  1AR4 A;  1K4C C;  1OCR C;  3K0D A;  2AW9 A;  4JI1 B;  1Q3E A;  1DF5 A;  4YJ2 B;  4DV3 O;  2Q69 A;  2Q6A A;  1FYJ A;  2QGN A;  2B1G A;  5IYZ A;  1K3E A;  3OMI B;  4WF9 V;  1L0N H;  2EIL C;  4UV8 A;  4HZ3 A;  2R9A A;  5CBG A;  4DV6 O;  1WN7 A;  3AK2 A;  3QF7 A;  4B08 A;  3SYP A;  3N27 A;  1OCZ B;  2N05 A;  1BT8 A;  1FFT B;  1ORQ C;  1HR0 B;  3OT7 A;  2LFS A;  3E8F A;  5KX5 A;  5B3S B;  3T1Y B;  3AG1 B;  4IHJ A;  3I56 V;  1K5Q A;  4HAM A;  3TXS A;  4CH6 A;  4I7Z B;  1DGS A;  4FM1 A;  1P49 A;  4OPH A;  4JYA B;  1SQX H;  4OX9 B;  4BIZ A;  5B1A B;  2LW7 A;  5KLV H;  4YIP A;  3RBZ A;  4DW0 A;  4YHH B;  3N2K B;  3ABM B;  4PA3 A;  3ZIA G;  1MZF A;  5GON A;  4LCU C;  1Z5V A;  4KXR A;  2F93 B;  1M56 B;  4YJ3 B;  2MK3 A;  5EBL C;  1XDC A;  1SZX A;  1G4Y B;  2ZT9 B;  5IY5 C;  4DR3 O;  2N04 A;  2W0X A;  2M7W A;  4EKW A;  1VF7 A;  4JPR A;  2A7W A;  3AEI A;  1B04 A;  2PZS A;  1BHB A;  4J7J A;  3JAK A;  3W7S A;  4G28 B;  5GTI Z;  4MTX A;  4LFC B;  1VF6 A;  3IFX A;  1ZSP A;  1PL0 A;  2Q5Z A;  4N21 A;  1QNM A;  5LP6 B;  5B1B B;  1Z2G A;  3OMA B;  1YCI A;  3W7X A;  4G27 B;  1PM9 A;  5B1O A;  3Q4H A;  2UXB B;  1ZL8 B;  1FFX A;  1VEW A;  4UVC A;  1JOY A;  1NT2 B;  2CAZ C;  2E5L B;  3UO3 A;  1XHZ A;  1QCE A;  3CCV V;  2WWW A;  5IDJ A;  5KHH A;  2ZNJ A;  1VP7 A;  3SPI A;  1R3L C;  3HR0 A;  1H2L A;  3ZHR A;  4ZI7 B;  5IWA O;  3BAB A;  1VQL V;  3RYH A;  3RYI B;  2D2C B;  3OAA G;  4AIL C;  4GX5 A;  1HNX O;  1H8E G;  3TXQ A;  1FPO A;  2Q4P A;  4UB8 Z;  2P4V A;  4CZZ A;  1K92 A;  2ZIO A;  4JI2 B;  4I55 B;  2B5U A;  2QTS A;  4DUZ O;  2CH7 B;  2Y0I A;  4TV8 A;  5JJE B;  4DR5 O;  5IJ9 A;  2JJ2 G;  5FNV A;  3ZRX A;  4X89 A;  1SS3 A;  3H1J H;  1VIB A;  4O4J B;  2X6A A;  4U7N A;  1IXB A;  5GW7 A;  1JVM A;  1FAF A;  1OHH G;  1RPR A;  2ODM A;  2XUM A;  3DC5 A;  2LW1 A;  4ZHQ B;  4B3R O;  4DV3 B;  3RYC B;  3BVO A;  3B8M A;  3ZJZ A;  1GAX A;  1AR1 B;  1XNR B;  2LQT A;  2Z5U A;  3RYF A;  5KUK A;  2QEX V;  3I5D A;  2VQF O;  2Q7H A;  4NB5 A;  3AG2 C;  4DUY O;  4DV6 B;  4JAS A;  2W6I G;  1M57 C;  4QPJ A;  3JSN A;  2HJD A;  4DR2 O;  2F4V O;  3E22 B;  3ZHQ A;  1GM7 A;  2CGN A;  4FLZ A;  1K33 A;  3RFR A;  2LO1 A;  2QWQ B;  2JEU A;  4TWK A;  3L72 H;  4X88 A;  5HFM A;  3H1I H;  2D3O W;  4AQY O;  2LGQ A;  2OCC B;  1YJW V;  3CME V;  1G1X B;  1AI6 A;  5KAI Z;  1HP8 A;  2Q68 A;  2GUZ B;  3CCE V;  2NR5 A;  2ITD C;  1E1Q G;  2DWE C;  3CRM A;  4DK0 A;  4TV9 A;  5CA3 A;  1O9G A;  2L6L A;  3K5N A;  4PA4 A;  1NTK H;  1Q6U A;  2BSK B;  3F5T A;  4MW3 A;  4QIW F;  1QVF U;  2QTO A;  4R7C A;  2ZKO A;  3H9V A;  3K0G A;  1MNG A;  5EZY B;  3K5O A;  3N2K A;  2PI4 A;  2E74 B;  2EJ7 A;  4DR3 B;  1G8M A;  4MTG A;  4TT3 G;  1OCZ C;  1UJW B;  5JWP A;  2XT9 A;  2DE0 X;  1RSO A;  3UQ8 A;  1JX9 A;  3E35 A;  1IBL O;  2E75 B;  5B3S C;  3AG1 C;  1R6T A;  3E8H A;  2JVD A;  3N2G B;  1S5J A;  2R70 A;  3R65 A;  4RAI A;  3SPG A;  2YEV A;  3BA8 A;  3ABL B;  4GX2 A;  3VBB A;  4RUF A;  3VQW A;  5CB4 B;  3JCU Z;  1PNK A;  2ZE6 A;  3ABK B;  2GBO A;  3CCR V;  5B1A C;  1FXK A;  2ZDI C;  2YIB A;  4K8Z A;  1KKD A;  2WLL B;  2N74 A;  1H2M A;  2X7R B;  3ABM C;  5JQG A;  5JVD A;  1M56 C;  4HNA A;  4LR3 A;  1NKD A;  1ZL8 A;  1JFF B;  2X6C A;  4X62 O;  3L9D A;  1S72 V;  1S5H C;  1W59 A;  1YHQ V;  4X8A A;  3CS5 A;  1T5E A;  4TSF G;  4DV0 O;  2QR4 A;  3EXA A;  3B4S A;  5LMN O;  3B40 A;  4FLX A;  5IWA B;  4P30 A;  2P06 A;  3FFQ A;  1TGO A;  2JEX A;  1QR8 A;  4P9O A;  2C2A A;  1WPX A;  5LL6 Y;  1PL4 A;  4B3S O;  1HNX B;  4Q20 A;  3CRC A;  4H44 B;  4HYO A;  4WFG A;  3FYI B;  4JAV A;  3K79 A;  2RCV A;  1LUW A;  5B1B C;  5LP6 C;  4UCT A;  2QDO A;  1AI7 A;  4DR5 B;  5DM6 V;  3K59 A;  3K5L A;  2G38 A;  3CPW U;  4I55 A;  4UV9 A;  3JD3 A;  5IYZ B;  5LXT B;  4MVS A;  2YC0 A;  4J7K A;  1L8D A;  1K34 A;  1KQS U;  2YIC A;  2ZNI A;  1S0V A;  4QPK A;  3WFV A;  1L0L H;  1MOF A;  1KD1 W;  2CTW A;  4JI7 B;  2YDE A;  3RYC A;  1GN3 A;  5KX5 B;  3BAA A;  1XEQ A;  4FIP C;  4IHJ B;  3LDE A;  3QVN A;  2EZO A;  3MAQ A;  4DR2 B;  2F4V B;  1OCO B;  3T1Y O;  1IVS A;  1TA8 A;  1VQ6 V;  2ZE8 A;  4EFB A;  3CJH A;  2V4D A;  4AHC A;  4MVM A;  3SR2 C;  3VQY A;  1QU7 A;  2XTA A;  4AQY B;  3C3S A;  1NTZ H;  3RW0 A;  1MAB G;  3OEH G;  2KSD A;  5GON B;  4FLY A;  3FAV A;  1BQ0 A;  4P9P A;  4QJF B;  3MHH C;  1WLE A;  2IH3 C;  3HB3 B;  3RVY A;  3G80 A;  4EEQ A;  4C7U A;  2KQX A;  1MG1 A;  4JAU A;  3OGC C;  4NKG B;  1YJN V;  1VMG A;  2AXT Z;  2DYS B;  1N33 B;  4CH5 A;  3JAK B;  4PI0 A;  1R3K C;  2A79 B;  1YXB A;  1NVP D;  3SJC C;  2EIN B;  2UUC O;  3ZHV A;  1BSM A;  1NI8 A;  2FML A;  4FVM A;  3QG5 A;  3L71 H;  1GN2 A;  3HKB A;  3JAR A;  5DN6 G;  2HP8 A;  2VWJ A;  1SC5 B;  1M4U A;  4LFC O;  1KP2 A;  1ZAU A;  1NR1 A;  3QTC A;  2OYQ A;  3Q4H B;  2OCC C;  3E89 A;  5JJJ B;  2H3O A;  2VQE O;  3UM7 A;  1YZB A;  4JF3 A;  3CYO A;  1FFX B;  1GM8 A;  2OWO A;  4ZOL A;  4X64 B;  1D2D A;  1S76 D;  2IH1 C;  1JMK C;  2Y4U A;  1AP6 A;  2ZIM A;  2WA4 A;  2QWR B;  3W7U A;  3OW2 U;  1I5X A;  1S3J A;  1Y76 A;  2E5L O;  3K04 A;  1VQO V;  4FLW A;  3ZMT A;  3P32 A;  2BCC H;  1JJO A;  1TUE B;  3CCL V;  1KKC A;  1MZE A;  3DC6 A;  1NJI W;  3RYH B;  2UU9 O;  1M5I A;  1VQN V;  3PN1 A;  2CGO A;  2YIB D;  1OV9 A;  2P4K A;  4DV0 B;  1SQB H;  4RUE A;  4JV5 B;  4DRX A;  5IE9 A;  3WB1 A;  3OUF A;  5LMN B;  4KUM A;  4CH3 A;  3UCS C;  5J9P C;  4O2B A;  1PNM A;  1JPX A;  4GLX A;  5FNV B;  4B3S B;  4DR4 B;  1VQ5 V;  1P84 F;  3ABL C;  2QM7 A;  4PA6 A;  1Y66 A;  2FB5 A;  2RDC A;  2RMK B;  3ZHT A;  4PDL A;  4NTY A;  3ABK C;  5DED A;  3E86 A;  4FMT A;  1AJN A;  5LBQ A;  1AR5 A;  1XMQ B;  2F1M A;  2EBO A;  2WLK A;  1IZ3 A;  2JRI A;  4FM2 A;  3RYF B;  4B3M B;  4JTA B;  1XNR O;  2OIG A;  2WSS G;  3CRQ A;  4RWU A;  5LXT A;  1MSD A;  4XDJ A;  5KA6 A;  4JI0 B;  1NH2 D;  2QE7 G;  3CRR A;  3D36 C;  2ADQ B;  5BMV A;  1EN4 A;  3OM3 B;  5FPO A;  1OZ0 A;  3G6E V;  1Q6H A;  3IGA C;  4QGP A;  4N23 A;  3H1H H;  1XHX A;  4IYH A;  1FXH A;  1WB7 A;  2F43 G;  3BA9 A;  5KMG A;  3UT5 A;  4GUN A;  1AJQ A;  2UXN A;  1YVW A;  1NVP B;  1OCC B;  1LUV A;  2Y4T A;  4TV9 B;  3TGU H;  1RPO A;  1WAZ A;  4XBF A;  2OIE A;  1P4R A;  1WPB A;  1F4M A;  3CCU V;  4UXN A;  4Q6G A;  3GVM A;  4DXW A;  1RM1 B;  2UUA O;  1J5E B;  4P2Z A;  2OTL V;  4MTO A;  2CDY A;  4JI5 O;  1ZX3 A;  1UFI A;  2KG7 A;  1BE3 H;  4UCS A;  1RSO B;  4O4I A;  4ABM A;  1GN6 A;  5CBH A;  3A0H Z;  2UUC B;  3CCS V;  5B5E Z;  2YEV B;  1I94 B;  2QA4 V;  3AG4 B;  4WFE A;  3J81 N;  1KP3 A;  1QBZ A;  1OCO C;  2XAH A;  1GM9 A;  1NQT A;  3ZS8 C;  5FLX N;  1FXK B;  4RO2 A;  3A0R A;  4WFF A;  2VQE B;  1FKA O;  5CN0 A;  4B7E A;  1KBH A;  2P22 C;  1VAR A;  1FD9 A;  1GTO A;  1VF5 B;  3G6B A;  5EIB C;  1IBM O;  5JQG B;  1L1F A;  5JVD B;  4EFE A;  4IIJ B;  4HNA B;  4ICG A;  4B7K A;  4MVO A;  3K9S A;  2RN9 A;  2OT5 A;  3TK1 A;  3CCJ V;  1F23 A;  3OE7 G;  4F6R A;  1I0H A;  1R1B A;  4I50 A;  3ABT A;  3W7W A;  2DYS C;  2CK3 G;  4PEL A;  3NR7 A;  2HEP A;  3T4Z A;  2UU9 B;  1K7D A;  2EIN C;  3CSX A;  3X2Q B;  3K58 A;  1VF6 C;  3ML0 A;  4MW8 A;  2F95 B;  1PPJ H;  3GWO A;  1K97 A;  3A0B Z;  5J2T A;  4BAY A;  4CS3 A;  1X4T A;  1NH2 B;  4X1I A;  2UUB O;  3ZMS A;  1YEW A;  4K35 A;  3RVZ A;  2YS8 A;  1PNL A;  4BWA A;  3PJS K;  1S5L Z;  2Q0O C;  3DXR A;  3O65 A;  3E2E A;  1W0K G;  3B09 A;  3CB2 A;  3L75 H;  1QLN A;  1F7Y A;  4ASU G;  5LGN A;  3SJA C;  5CA1 A;  3CP1 A;  2YXY A;  3VOU A;  5A2Q N;  3TJT A;  3JD2 A;  1VQ9 V;  1Y67 A;  4JI7 O;  3UKM A;  1YF2 A;  4LF6 B;  2ZR2 A;  2V7Q G;  2PTM A;  4O4H A;  2ZCE A;  4JI4 O;  3H01 A;  4WBN A;  3CJH B;  1H2G A;  1N8R W;  3RT3 C;  3FYE B;  1QR9 A;  4LH7 A;  4MVR A;  2HHH B;  4J9Z B;  1WNS A;  3FB6 C;  1QHT A;  4LFA B;  4ZIB A;  4X1K A;  2ZM6 B;  1AVM A;  3S3W A;  3FKS G;  4GKJ O;  4WCE V;  1EN5 A;  2XAJ A;  2ETN A;  3FAV B;  2AHZ A;  3KKY A;  3VQV A;  3IAY A;  4GKK O;  4J42 A;  2IJJ A;  5TIS Z;  4DV7 O;  4IT5 A;  4UVB A;  1ENV A;  1Q43 A;  4LF4 O;  4W4L A;  3ETQ A;  4H0L B;  2KKW A;  2W6J G;  3G4S V;  4BW9 A;  2UUA B;  1VQ7 V;  2UXX A;  2IJK A;  2ZE5 A;  4JI5 B;  2WAM A;  4D7T A;  1N33 O;  4U3J A;  1V54 B;  1ZUQ A;  3HKB B;  1WJZ A;  3JAR B;  1V55 B;  3CC4 V;  4BIU A;  1YSC A;  1BQZ A;  4GX0 A;  3CHX A;  3T4D A;  3H1L H;  4BIO A;  3ZX6 A;  1U97 A;  1O9H A;  5LMU O;  1NS1 A;  1M93 A;  4L87 A;  4ZOL B;  4PDM A;  1XMO O;  2XND G;  3KCY A;  2LGW A;  1OCC C;  3APQ A;  2CTQ A;  1Q90 D;  1Y76 B;  4X64 O;  5LHG A;  1WB8 A;  2IJH A;  4DV4 O;  1SZT A;  1IBM B;  4FFB A;  2IBZ H;  2DYR B;  2A06 H;  1K8A W;  3UO2 A;  2XAF A;  3F7Y C;  1RM1 C;  4QE9 A;  1M1K W;  2AGA A;  4Z2W A;  4IIJ A;  2YI8 A;  1IDS A;  4DRX B;  4ZKI A;  3SJQ C;  2DN9 A;  5JH7 A;  3F5W C;  4RQF A;  4O2B B;  1ROP A;  3QO7 A;  3CMA V;  4JV5 O;  3D3I A;  5K1P A;  2OTJ V;  2Z0A A;  4LFB O;  4YXW G;  3T1H O;  2BOB C;  3AG4 C;  1I08 A;  1W2B U;  1N4C A;  5LGT A;  4PA9 A;  3OD4 A;  2A9H A;  4GT1 A;  1YIJ V;  1ZTE A;  4GZR B;  4DR4 O;  3ABU A;  3HKD B;  2P67 A;  1FXK C;  2RQ6 A;  4UVA A;  4X9Q A;  2EIM B;  1AI4 A;  2EUL A;  2CTR A;  4MSW C;  2UUB B;  1BL8 A;  2NN4 A;  2XHB A;  4I4T A;  3F7V C;  1Y6X A;  1JR9 A;  1KEC A;  2ATK C;  1K4D C;  1TAE A;  4ZBM A;  4KL1 A;  1XMQ O;  3OR6 C;  2CE4 A;  3ZN0 A;  1TUB A;  2WLI B;  2DQ0 A;  4B3M O;  4RQE A;  1YI2 V;  3K57 A;  4J11 A;  2ZXW B;  4DV2 O;  1K73 W;  3OTO O;  5BMV B;  1A32 A;  4X65 O;  1GKF A;  3BY6 A;  3STL C;  3ICX A;  4JI0 O;  3X2Q C;  1SKV A;  2VWK A;  4F4L A;  4KP4 A;  4CS2 A;  1EZJ A;  4JI4 B;  5KMG B;  3AG7 A;  3UT5 B;  2P6J A;  2Z3Y A;  2Q7G A;  4FM0 A;  2HLD G;  2NLJ C;  4DYL A;  2VRZ A;  4FK5 C;  3JD1 A;  3OEE G;  1XQ8 A;  2GHY A;  2RJZ A;  5IY5 B;  2X0L A;  2YI9 A;  4GKJ B;  1KU9 A;  4R8C A;  5IJ0 A;  3SPH A;  4X66 B;  4DR1 O;  4GKK B;  3CXH F;  5K1X A;  4JYY A;  1X59 A;  3JAL B;  5CA0 A;  4DV7 B;  4WFA V;  2DOS A;  3U0Z A;  2KG7 B;  4Z1M G;  3EHB B;  1N34 O;  4LF4 B;  4I0X A;  4LBE C;  2EIK B;  4DW1 A;  4O4I B;  1J5E O;  4UCV A;  4I9W A;  1SES A;  1BZK A;  4JI8 B;  4IYI A;  2WLH A;  1LR1 A;  5LHH A;  2ZIN A;  3H1K H;  3VQX A;  2Y69 B;  1YJ9 V;  1I94 O;  2P5O A;  1E79 G;  1NZ6 A;  4NYK A;  3CE2 A;  3ZBH A;  2Q0A A;  5LMU B;  4GYC B;  1K5S A;  1N32 O;  1XMO B;  4NTX A;  3ZED A;  1HNW B;  2GTS A;  1JQ0 A;  2Y48 A;  3P30 A;  2B9Z A;  2HFE C;  4PI2 A;  3TCU A;  1S77 D;  1W0J G;  2WLM A;  4F6R B;  4DV4 B;  4I50 B;  4U3F H;  4FFK A;  2A0L A;  1M9N A;  4JAA A;  2GTA A;  5B66 Z;  3FB8 C;  2QM8 A;  4FJC C; 
#chains in the Genus database with same CATH homology
 4NTW A;  3S3W A;  2FB5 A;  2QTS A;  4FZ0 A;  3IJ4 A;  4FZ1 A;  2L35 A;  4NTX A;  4NYK A;  3N27 A;  3S3X A;  1WP7 A;  1WP8 A;  4NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...