1YIJV

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yijV00
3CMEV 3CXCU 1VQMV 1YI2V 1KQSU 3CCMV 3CCSV 3CC7V 3CCRV 1KC8W 1M1KW 2QEXV 3G6EV 3CCQV 3CCJV 1K73W 3CC2V 1VQ7V 1VQ6V 2OTJV 1Q81W 1K8AW 3CD6V 4WFAV 3CMAV 1VQ4V 1NJIW 1VQKV 1Q82W 3CCLV 4WCEV 1YJ9V 1S72V 1VQOV 1Q86W 3CCUV 2QA4V 1YITV 3I55V 1YJWV 1M90W 1VQ5V 4WF9V 1N8RW 3I56V 1K9MW 3CPWU 1W2BU 3CC4V 3G71V 1VQLV 1JJ2U 4WFBV 1VQ8V 1VQ9V 2OTLV 1VQNV 1YIJV 1YHQV 3OW2U 1KD1W 3G4SV 3CCEV 5DM6V 1VQPV 1R73A 1QVGU 1YJNV 3CCVV 2D3OW 1Q7YW 1QVFU
chains in the Genus database with same CATH superfamily
3R65A 4PA3A 3U11A 2P7TC 2IJIA 3RYCB 3L71H 4ZI7A 1DF4A 4G27B 3K9SA 4O4JB 5KUKA 2P6JA 4DV5O 3FAVB 4QIWF 2Q68A 4O4LB 2WLMA 2BTQB 2Y4TA 1ORQC 2EBOA 3LSSA 4DV6B 4H44B 3OR6C 1HNZB 1JJOA 1Y6XA 5F2VO 2Q67A 3FB6C 1OCRB 3ASOB 1XNRO 4IIJA 2IU0A 5LXTB 1M1KW 2R70A 4UUJC 1UFIA 3E89A 2M6YA 2HEPA 4FIPC 3DC5A 1GM9A 3STZC 1NH2D 1GM7A 2OT5A 4JI1O 4B3TB 1S5LZ 4I4TA 1HNWO 5KHKA 1K9MW 3ABTA 5JCOC 4W4LA 4K0KO 2XOKG 5LA6A 4XDJA 3FB5C 2YXLA 4YJ3A 1R3LC 4JV5O 2UXBB 1WP8A 3JSNA 1L0NH 3LDCA 3CRCA 2PI5A 5C8YB 4IHJA 2HJFC 1F4MA 5CBHA 2W6JG 3APOA 2KB1A 4PDLA 3P32A 2QWNB 1X59A 1VARA 1AROP 4KL1A 4EB6A 4DV6O 4JZGA 3CE2A 1HNZO 1CP9A 2XT9A 1HWYA 4DRXB 1K34A 1G8MA 3E8FA 3M8AA 4H0LB 3N2KB 3K03A 4B3RB 3QNEA 3P3PA 4O4HB 2H94A 1SQVH 4B3TO 3HKBB 3RVZA 2Y48A 5J2UA 4EFEA 3JAKB 5LBQA 1FXKB 2HHHB 2QJ1A 1K4CC 3WFVA 1WA8A 2UXBO 3QO7A 3CCVV 1JOYA 1FD9A 3OEEG 5BMVA 4LF5O 4B08A 3SPCA 2UXXA 3OUSA 5B5EZ 4MVUA 1XHZA 3D36C 3OTOB 2VS0A 4J7ZA 1GN6A 2YICA 2EINC 4TUYB 4KXRA 3QO5A 1B06A 1SRYA 3GVMA 5EC2C 3O9OA 5BR8B 3OFNG 2X6CA 2NNUA 4KHPO 2AGAA 4DV7B 5KLVH 4UCRA 2ZXWC 1BZKA 2OYQA 4B3RO 5C93A 1H2LA 1LUWA 4NTWA 4JF3A 4X1KB 4X1IA 2DYSB 2BTOA 2XTAA 4U3FH 4CC6A 1V55B 4UB8Z 1SQQH 5A9GA 4DXWA 4DR5B 3HKEA 5A2QN 1D5NA 2HHHO 5KHHA 3L75H 5H5NA 1IBLO 3ZMTA 2QWQB 3HKCB 2RMKB 4F6RB 4TOIA 2PY5A 2ILMA 1KYOF 3ZS8C 4QGPA 4PDVA 3ASNB 3ABLC 2F4VB 5BR8O 2H3OA 1JPXA 3VQVA 1PM9A 1Q8IA 4I55B 4UVAA 4LF9B 1AI5A 1AVMA 2YXYA 1BL8A 1KBHA 3A0RA 4I0XB 5CBFA 4LF4B 2F43G 3ZBHA 4U7OA 5B3SB 3BPZA 3P3NA 4JAUA 1VQNV 3VQYA 1NH2B 1XUQA 4JI3B 4FLUA 4J42A 3AK3A 3CMAV 1SQFA 5K1XA 1E1RG 5EYPA 2ZDIC 1ZUQA 2Y0PA 2F4VO 1YXBA 1VF5B 1YIJV 3JASB 1CXZB 1GM8A 1AILA 2YEVA 4X20A 5KX5A 3ICXA 3WG7B 1RPRA 4FLTA 3FB8C 4AI8A 1COWG 4DR4B 1KC8W 3K59A 4LF4O 1DGSA 4LC1A 3SGIA 5JCOA 1TVKB 1YJ9V 4W4KA 3W7TA 4R50A 5GW7A 2HR3A 3BA8A 2E5LB 5EBMC 4ZOLB 4JI3O 4J80A 4B7KA 3C90A 2QKSA 4OX9O 1SETA 2JJ2G 3UM7A 4PDRA 1WN7A 4UVBA 3K5NA 4FFBA 2QM4A 4RQFA 2YXHA 4WFFA 2QM7A 5ITZA 2F95B 1VQLV 3K08A 4MW3A 3SDLA 4C7UA 4MW8A 1G6UA 4FM1A 4MS2A 2OIEA 3H1HH 4RO2A 4PV1B 2OCHA 5B1AB 4DR4O 1HR0B 4CS3A 2Q4PA 3RGBA 3ABMB 4OPHA 5CB4A 1NTZH 5KA6A 3CPWU 3A2FA 2EIJB 2EIKB 1KKCA 4JV5B 3SYOA 2E5LO 3D36A 1XQ8A 2VWKA 3LDEA 1PD3A 3HPLC 4X1YA 2Z3YA 1Q81W 3CXHF 2ZE5A 4JPRA 1E79G 2FKXA 2LW7A 1H8HG 2M7WA 2K9PA 2P67A 4TV8B 1BGYH 3I5DA 3T1HB 1TAEA 1VF6C 3DGEA 4YY3B 1V54C 3ETDA 2QWPB 5H6RA 1QLEC 3D3QA 1BMFG 3ZHRA 1HR0O 1K4DC 2Q7HA 1RM1B 3OMIB 4I50B 1S77D 2ZINA 2PYJA 4ZHQB 2B5UA 4WCEV 3RYHB 1WP7A 2GDSA 2FTKA 1H2MA 1SQPH 5LP6A 1AJPA 2UUBB 1GK9A 2YC0A 3F5WC 1VQ9V 4R8CA 4D7SA 1EN5A 1I94O 2UXCO 1R6TA 2AZ2A 2F66C 1UJWB 5KAIZ 1M57B 1MOFA 3SPHA 3N27A 1MSWD 4GCZA 1EFRG 2Q6AA 3AK1A 3SYQA 3T1HO 1EZJA 4YY3O 3MHSC 2ZCEA 4X65B 2CK3G 3CB2A 1KMIZ 1R3IC 2CH7A 4QNHB 1HP8A 3ZEDA 5LOVA 3K58A 1IZ3A 1ZL8A 3TCUA 3IC7A 4LH7A 2UUBO 1BHAA 1GRJA 4QE9A 5D5PA 2WPDG 4U3JB 5LMNB 2JRIA 4IT5A 3FYIB 1IX9A 4WFHA 5IJ0A 3SYPA 4J9YB 4JAVA 3BY6A 4EB6B 1MNGA 4LNUB 4YJ2B 4DV0B 1RSOA 2XAJA 2WWWA 3CX5F 3K57A 3CRAA 1TGOA 4NB5A 2YIBA 3TETA 3EVKA 1TUBB 1M4UA 2UXDB 3ZRWB 3OW2U 3PJSK 2A9HA 1DK1A 3CJHB 1FFXB 1R3JC 2XASA 2X6AA 2GBOA 2Q5ZA 4GKKO 5J2UB 4TQDA 3JCUZ 3RVYA 3K9AA 4FMTA 3HKDA 3QO8A 2MW2B 2MK3A 3JARA 5CN0A 1D5AA 1Q6IA 1Y76A 3NR7A 5LMNO 1JCHA 5GTIZ 2AXTZ 1QVFU 2Q9LA 4NXMB 4YIOA 4MTGA 1BT8A 1XL4A 2QKAA 4JASA 3J7AU 4L8JA 2WLIB 3KCXA 4RUFA 4RWUA 4BIOA 1RFYA 3TJTA 4EEQA 4ABMA 2ZD9A 5CA1A 1XL6A 3EXAA 2B9ZA 2UXDO 4OXSA 1K5SA 3CCSV 2UUCB 3RYIA 5TISZ 3HKEB 5DEDA 3ZHUA 4O2AB 4P2ZA 1G4YB 4O4IB 1M93A 1R6NA 2HKOA 2CAZC 3JD3A 2P4KA 3ZRSA 4DUYB 4NTYA 1KD1W 2RJZA 1N0NA 4CS2A 3M7MX 3WB0A 4Z1VA 3BA9A 5EC1C 5FNVB 3VBBA 3JYCA 3ZHTA 2IU3A 5LL6Y 3MDSA 2V1DA 3AG3B 2WSSG 1VF6A 5KHGA 3APQA 5IYCO 1S0VA 5B1NA 4X88A 3W7XA 4DW0A 1NKDA 4GX0A 3LSQA 4A5UB 1P49A 3JD1A 4XDKA 1US6A 1NJIW 2IJJA 1R6KA 1SZXA 3AG4C 4O2BB 2UUCO 3GWKC 3ABKC 4JTCB 2WLJA 3FYEB 1CEZA 5FL7G 2Q73A 2AHZA 1Q6UA 3OEHG 3E2EA 1EZVH 2KSDA 1X4TA 2WLHA 3NXSA 4DUYO 1BQZA 1NR7A 2JGDA 3RBZA 4QJFB 5IY5C 4I7ZB 1VQMV 1Y74A 5EYPB 5EK0A 3K06A 1QU7A 1MMMA 3E8GA 3FB7C 1XDCA 5EIBC 3E22A 4X20B 5KX5B 4WF9V 1GTOA 2A79B 2CGOA 1SA0A 3VOUA 3CC4V 1NQTA 3JD2A 2EIMC 2IBZH 3CRRA 4NR1A 2JEUA 3K04A 3DXRB 1NVPD 4IL6Z 4CC5A 2LP7A 2JK5C 5EBLC 4YHHB 1OHHG 3D8CA 3RT3C 1S3JA 1YVWA 2E74B 3JAWB 2PTMA 3JCZA 4NVPA 5LHIA 4HAMA 4UCTA 2WLNA 2YIBD 4X8AA 4LFCB 2GUZA 2ZE8A 1SF9A 2UU9B 1SQXH 3A0HZ 5IT9N 4KP4A 1I0HA 1Q3EA 4TSFG 3MD0A 2WLKA 3ZMUA 1NI8A 1AI4A 2IH3C 1PL4A 1MG1A 2RCVA 3C3SA 1M90W 4F4LA 2Z5UA 3UCSC 1LR1A 4DR2B 2CTWA 4DUZB 4DO2A 2EJRA 1BSMA 1H2NA 3KZIZ 3W7WA 1Y4MA 4YHHO 1Y66A 2V7QG 2PYLA 3D3IA 1Y67A 1JFFA 5EBWC 3WB1A 4BWAA 1S5JA 1TUEB 1HDJA 2P4VA 1YTFD 2JVDA 3UT5B 2CTRA 3ZX6A 1OCOC 2UU9O 4FK5C 1KQSU 5H2FZ 5L3GA 3K5MA 2Q0OC 3Q4HB 4DV2B 1K8AW 1NR1A 1AJQA 5JVDB 5CA0B 4MTFA 1HNXB 1E1QG 3JATA 3ZJZA 1OCZB 2ZXWB 3JAMN 4WBNB 2W0XA 1O9GA 2BOCC 3ETGA 3JALA 4FFKA 5KMGA 2ZE6A 3ZHQA 3F7YC 4DUZO 4FLWA 5LP6C 5E1AC 2YI8A 2DYSC 3AG2C 4GZRB 2WA3A 3OTOO 1WPBA 1XBLA 3U0ZA 4JI7B 5IYZB 3WB2A 3S3XA 4JAAA 1AI6A 4ZIBA 4XDLA 3W7SA 3BCCH 3STLC 3ABLB 5BXZA 3N2GB 5IWAB 4DV7O 3X2QB 2G38A 1HNXO 3K0DA 2OWOA 5GONA 4JI0B 3T2MA 4TV9A 2P22C 3TXQA 5H9CA 3RW0A 3J80N 3SR2C 2VRZA 4DR5O 1M9NA 1JMKC 2CUGA 1R73A 1I7FA 3RYFA 2GSMB 3QF7A 2DN9A 4LWSB 3OMNB 4GUNA 1QHTA 3BFRA 1Z5WA 2BSKB 1QBZA 5JH7A 1NVPB 4YXWG 5LYJB 3RYCA 2DYRC 5LGTA 5IJ0B 4O4JA 4UCOA 4X62B 2LW1A 3FAVA 2QGNA 2BTQA 5L3FA 2FMLA 5IWAO 4N21A 4WFGA 4LF9O 4LR3A 2EZOA 3CCQV 3SJAC 5IJ9B 3G67A 1XILA 4RUEA 3OGIB 2L6LA 3K3WA 1PNKA 1GKFA 1VQOV 5KHJA 2E3CA 5LXTA 3WG7C 4CH5A 2PGGA 4DV1B 4L87A 3IFXA 3AG1B 2OCCB 1MSDA 1UPGA 4JI5B 3T4DA 1F4NA 5IE9A 1WB8A 3MAQA 1U97A 5C8YA 1L1FA 5J2TB 1LUVA 3LNMB 4E2LA 4UFZA 1WLEA 4IYIA 3H9VA 1JJ2U 5CMUA 4X62O 2OTLV 2QM8A 1OCCC 4JYBA 3OM3B 3QTCA 1DTOA 3H1KH 4PHZA 3CCRV 1N33B 4ASUG 2F93B 3FFQA 2DQ3A 5JJJB 2OTJV 4MSWC 3UO3A 4DRXA 3U10A 4X89A 2NLJC 3H01A 3L72H 2EX3A 5BY1A 3N2KA 1FXHA 3TK1A 1FAFA 4DV1O 4KUMA 4JI2B 4U7NA 1F51A 4O4HA 1G1XB 5JQGB 4PDMA 4B3MB 3ABMC 4JI5O 4H13B 4KFMA 2FB5A 3JAKA 3T1CA 1FXKA 2KQXA 1BQ0A 2ZE7A 3JSLA 2EIKC 4IYHA 2JGUA 3A0BZ 1H38A 4R6ZA 3ZCCA 1QCEA 2QWRB 1N36B 3I56V 4F6EA 3IJ4A 4GX5A 4TUYA 2QDOA 1RPOA 1D2DA 2WLLB 1MZFA 2QWOB 4FM2A 1N33O 1V54B 2R9IA 1VQ7V 1QLEB 5B66Z 4LCUC 2D2CB 1PV0A 1FYJA 1K92A 1AR4A 2A7WA 2W6IG 2O57A 4CH6A 2GV9A 3ML0A 3THOA 3TXSA 4JI2O 4X1KA 4ZI7B 2B1IA 4B3MO 4MVMA 4CH3A 4LF8B 1K7DA 1BHBA 1XMOB 1GAXA 4OGQB 4FLVA 2CTQA 4Q20A 1R3KC 3CCJV 2E75B 4AHCA 2PF4E 4J11A 2YIDA 1MA1A 2EJ7A 1N36O 1B3QA 3ETEA 5D5QA 2CTPA 4IIJB 4J41A 4DK0A 5B1BC 1O9HA 3F7VC 3E35A 4RAIA 2JS3A 3G6EV 4I4TB 2DOSA 2JS5A 1GN2A 1SA0B 2IW5A 1LNQA 1SC5B 2YS8A 4I55A 5LA6B 3CEIA 4YJ3B 1AJNA 4LF6B 1NS1A 4GX1A 1JQ0A 5IDJA 4CH4A 4I0XA 3JD4A 2VQEB 2EILC 3OE7G 4IHJB 3P30A 4JYAB 3UO2A 5K1PA 4K35A 1QVGU 4LF8O 4NKGB 3E8HA 3CMEV 1RP3B 5EIBD 4FLYA 2RNBA 1XMOO 4JZ2A 2Y4UA 3E83A 4ICGA 1AB3A 3BABA 3UQ8A 3CP1A 2R9AA 2A3QA 2ZNIA 4TT3G 1Q7YW 4X65O 1KKDA 1XHXA 3ETQA 2XHBA 1M56B 2QE7G 3JASA 2ZM6B 5L3DA 3KKYA 2ADPA 3T4ZA 1PP9H 3T1YB 3C3TA 1P84F 1OZ0A 4Q6GA 4LF6O 1WA8B 4MVQA 5BMVB 2L35A 1TVKA 4NTXA 2XAHA 4LFAB 2ODMA 3MHHC 2ZR3A 4NYKA 4JI8B 2JIZG 4UCSA 2ATKC 3CD6V 2NN4A 3K79A 4DV0O 2ZT9B 4ZOLA 3OAAG 2PZSA 3O65A 1QNMA 3DC6A 3AG7A 3SJQC 4B3SB 3OR7C 1N0JA 2QSAA 5L3BA 1WAZA 2PI4A 1NTMH 2Y69C 5DM6V 4E4EA 1NU1H 4X1IB 4CZZA 3TGUH 2ZM6O 1JX9A 4P30A 4WFAV 3T1YO 1J5EB 3BVOA 2RN9A 1EN6A 2H8PC 2LFSA 1GN4A 3SJBC 3SYCA 2JDIG 2DE0X 2WAMA 2VQFB 2HFEC 4JYYA 4LFAO 3UKMA 3ZMSA 3IC9A 4TWKA 2DWEC 4NXMO 2ARHA 3AK2A 4FLXA 2QTSA 4B3SO 4I9QA 1ZAUA 1Q5OA 5BZBA 4J7KA 2KG7A 1FS0G 2N04A 1MZEA 4TV8A 3ZN1A 2A06H 3B4SA 2F23A 4BR6A 1P7GA 4UVCA 3AG4B 1Q6HA 2JJ1G 4FZ1A 5FLXN 4JI1B 3ABKB 3CCUV 5KHIA 4BIUA 2VQFO 3CYOA 3QVNA 4I50A 4ZHQA 1FJGB 3RYHA 3OGCC 4X64B 1KB9F 2ZR2A 1H2GA 4UB6Z 4FJCC 5IY5B 1NTKH 1W59A 2ADQB 1AR1B 4NXNB 2YEVB 4UXNA 4DW1A 1FKAO 1IBKB 1OCRC 3ASOC 3DTUB 3OTFA 3M99B 1PNMA 4JTDB 3CRQA 4PA6A 2EIMB 2HJDA 4BIZA 3SYAA 4EFBA 2Q69A 2ZNJA 1GN3A 1IVSA 3HB3B 3FD9A 2Z0AA 1K3EA 5GTHZ 2Q7EA 4PD4F 2UUAB 3B09A 4PELA 1ZLZA 5LGNA 1FJGO 1WNSA 4X64O 2AW9A 4FFBB 3ZRXA 4LF5B 2ZKOA 2GTAA 2IJHA 4BW9A 4U3JA 5EZYA 3VQXA 2A0LA 5ITZB 5DECA 1YEWA 2FL4A 4NXNO 1VF7A 1ZTEA 1VQ5V 4G28B 1SKVA 2PUSA 3FX7A 4LNUA 4YJ2A 1IBKO 2X7RB 1W2BU 4GX2A 2AZ0A 2V4DA 1I5YA 1W0JG 1YHQV 3RN4A 4JGSA 5CB4B 4KHPB 3L9DA 3OD4A 4DV4B 1QQCA 1TUBA 2QEXV 1VQ6V 3ZRWA 4HNAA 1Q90D 3J81N 3CJHA 1FFXA 1FXKC 4B7EA 3B40A 3DSQA 2UUAO 4QE7A 4X1YB 2EINB 4HBNA 4MVOA 4X66B 2IM9A 4LFCO 2W0FC 4RQEA 1IBLB 1BCCH 1OCOB 1OJHA 1K73W 5JWPA 2OIGA 1WB7A 3CS5A 5KAFZ 3ABUA 3I55V 1BS3A 2WLIA 5IYBO 3SPJA 3HR0A 2P06A 3RWRD 4DR2O 1K5QA 5L3CA 1VQPV 3CC2V 5JJNB 4DV4O 3IAYA 4XBFA 2IH1C 1IXMA 5DN6G 3GB7C 1OCZC 1V55C 5LP6B 1OV9A 2ETNA 2HVKC 2N05A 3AG2B 1S72V 3SJCC 3AEIA 2LQTA 3WU2Z 4H33A 2HG5C 4MVZA 4O2AA 4X66O 4G2KA 4O4IA 1BE3H 5HFLA 1WPXA 2NR5A 3QG5A 4YIPA 4DV3B 1PL0A 4LF7B 1I08A 2YIAA 5H6QA 4MTXA 3ASNC 4IGGA 4DV2O 1J95A 1XNQB 2EZPA 3K0GA 2ZQMA 1XI1A 4OPAA 1YJWV 1VEWA 4R7CA 5FNVA 2DQ0A 3X2QC 2DJVA 2CH7B 2RQ6A 3FKSG 3ZIAG 2VWJA 4GT1A 5LOVB 1XMQB 1ZL8B 4FPPA 1F7YA 5HFMA 2Q7GA 1VMGA 3BEHA 2XAGA 5B3SC 3LSUA 4UV8A 1AR5A 4PA7A 4J9ZB 4O2BA 5KUMA 2CDYA 4JI7O 1EN4A 1M5IA 1KUQA 3L73H 2DYRB 1RSOB 3GWOA 5CA3A 2KKWA 4O4LA 3H1LH 3K5LA 2C2AA 4DV3O 4OX9B 4LF7O 3B8NA 1IDSA 1KP3A 1V9PA 4LP8A 4AQYB 1VQ4V 4FM0A 4GKJB 4DYLA 1XNQO 3ZMZA 4JI0O 3R66A 4ZKIA 5FPOA 2IJKA 3G80A 4WFBV 1AP6A 1L8DA 5AG2A 1XMQO 1N4CA 1QLNA 3HKDB 4D7TA 2BOBC 3DXRA 3JARB 1U96A 3ZMVA 3CCLV 1YCIA 1Y76B 3AG1C 2OCCC 1SERA 2GTSA 1N34B 1N8RW 1XOUA 4UCUA 3H1IH 2X6BA 4PA9A 5LGUA 3JAWA 5CBGA 3KG2A 3CXCU 1VIBA 3E8BA 1OCCB 2ITDC 4FVMA 2FYUH 1YTFB 4AQYO 4PI0A 4GKJO 1PNLA 5CA1B 4BW5A 4GYCB 1Z2GA 4MT8A 4LBEC 2HP8A 3H1JH 5B1AC 4K3AA 3RYIB 4FLZA 1FFTB 3KCYA 4PJ0Z 3G4SV 3HKBA 1A32A 3B8MA 3W7UA 1YF2A 1YZBA 1ZSPA 3ZHSA 3VQWA 2BCCH 2R72A 2DMXA 1ENVA 2EIJC 3LDDA 5KA5A 1N34O 2LGWA 4TQFA 1VQ8V 3JD0A 1I94B 2UXCB 5LMUB 2YDEA 1N32B 4K8ZA 1P4RA 1GMGA 1H8EG 1HW7A 3UT5A 3RFRA 1ZX3A 2R9RB 4P9PA 3OT7A 1JVMA 1P7BA 4JI4B 1NBMG 1SZTA 1AI7A 3G6BA 1VQKV 1L0LH 3CRMA 2KG7B 4X9QA 1YSCA 2QA4V 1NZ6A 2LFRA 3Q4HA 2Q8VA 5L3EA 1B04A 5JVDA 5CA0A 1JA8A 1IURA 2E76B 4H37A 1URFA 1TA8A 1RM1C 1Z5VA 1PKXA 3CCEV 4WBNA 1K97A 1KP2A 4HYOA 2X0LA 4DR3B 1KU9A 2UXNA 1EM1A 2JGDB 4UCVA 3HKCA 1QR8A 1R1BA 4J10A 1GH6A 4JI6B 4F6RA 2JEXA 1S5HC 1DF5A 1Y74B 5B1OA 3EHBB 3B2EE 1M57C 3BHPA 5LMUO 5LHGA 1SESA 1N32O 5IYZA 5IYDO 1YJNV 3L70H 4EKWA 5LHHA 2YI9A 3E22B 2YUAA 4K8XA 2Q0AA 5B1BB 2AHYA 1SQBH 2QKCA 4JI4O 1PPJH 3N2GA 2RDCA 1JR9A 4MVRA 4D6TH 4LH6A 4QPJA 4DK1A 4DR6B 4DR1B 2LJ2A 2EILB 1F23A 2XAQA 1W0KG 3SPIA 2DW4A 4GKKB 1NT2B 1YDXA 4DR3O 3ZHVA 1H2SB 1GO3F 5FPRA 4JI6O 2GUZB 4LWSA 2LO1A 1MABG 2LGQA 2GHYA 4AILC 5EZYB 2BSKA 4N23A 1B6QA 5LYJA 3S3WA 1SS3A 3CSXA 1FXVA 2ZDIA 2Y0IA 3BRCA 2P5OA 5J9PC 3LNNA 1DLBA 5IJ9A 1Q43A 4I9WA 4I5SA 4UV9A 3SPGA 2VQEO 4DR7B 2WA4A 1ROPA 1M56C 4DR6O 4JYAO 4HNAB 1IBMB 3F5TA 3K5OA 4DR1O 2BE3A 3ZN0A 2QR4A 1JFFB 1ZWIC 1THZA 4QPKA 2YSUB 4P9OA 1T5EA 3LUTB 2K1EA 4ZBMA 5J2TA 2XNDG 1CPYA 4MVSA 3JATB 1I5XA 4CS4A 3CCMV 3IGAC 2ZIOA 1VP7A 2B1GA 2Y69B 3BAAA 4LFBB 1FPOA 1XREA 3JALB 1WJZA 4PA4A 5KMGB 4PI2A 1Q86W 1S76D 3B77A 1KECA 3EFFK 1AP5A 3OMAB 4DR7O 3G71V 1K33A 1IBMO 4Z2WA 2DWDC 2XUMA 3PN1A 2XAFA 4JTAB 3L74H 1YI2V 4JI8O 2HVJC 1EBOA 2F1MA 2CGNA 2ITCC 4CBCA 5JQGA 1Q82W 3CWBH 4DV5B 3A8TA 1YITV 2P90A 3OUFA 2N74A 1SQGA 2HLDG 2D3OW 4FZ0A 5GONB 4TV9B 1XNRB 3CC7V 2ZIMA 3ZRVA 3AG3C 2EULA 4LFBO 2CE4A 1QR9A 4JYCA 4Z1MG 1H2KA 2WLLA 4GLXA 1J5EO 4HZ3A 1IXBA 4BAYA 3CHXA 2QTOA 4J7JA 3RYFB 5JJEB 1HNWB 5E79Z 4K0KB 4WFEA 3E86A 4MTOA 1XEQA 5JH7B
chains in the Genus database with same CATH topology
3R65A 4WFHA 4XBFA 4PA3A 2IH1C 1IXMA 5DN6G 3SYPA 4J9YB 4JAVA 3GB7C 1DTOA 3CCRV 1OCZC 2P7TC 2IJIA 3BY6A 4ASUG 1V55C 1DF4A 2DQ3A 4G27B 2OTJV 4MSWC 5KUKA 2HVKC 2XAJA 2P6JA 4X89A 3AG2B 2WWWA 1S72V 2NLJC 3H01A 4QIWF 3AEIA 2Q68A 2WLMA 1FXHA 1ORQC 2EBOA 4H33A 3TK1A 2HG5C 3LSSA 4KUMA 4MVZA 3TETA 4G2KA 4U7NA 1F51A 3OR6C 3ZRWB 5HFLA 3OW2U 3PJSK 2A9HA 1WPXA 4PDMA 3ABMC 4KFMA 1R3JC 2XASA 2X6AA 2Q67A 3FB6C 1OCRB 3ASOB 3T1CA 2IU0A 1FXKA 1M1KW 4UUJC 1PL0A 5H6QA 3E89A 3ASNC 4MTXA 3RVYA 1J95A 2EIKC 4FIPC 3K9AA 1GM9A 2EZPA 3STZC 3K0GA 1GM7A 2OT5A 2ZQMA 4R6ZA 1NH2D 1H38A 1YJWV 4FMTA 1QCEA 3ZCCA 4R7CA 3QO8A 3I56V 1K9MW 3ABTA 2DQ0A 2MK3A 3X2QC 2XOKG 4GX5A 5CN0A 4XDJA 3FB5C 3FKSG 1R3LC 1JCHA 1RPOA 3ZIAG 4GT1A 3LDCA 2WLLB 1QVFU 2PI5A 2HJFC 1F4MA 1V54B 4FPPA 5HFMA 5CBHA 2R9IA 2XAGA 3BEHA 5B3SC 1VQ7V 2W6JG 4MTGA 1QLEB 2KB1A 4LCUC 1XL4A 4UV8A 4JASA 2WLIB 4PDLA 4PA7A 4J9ZB 4RUFA 3P32A 5KUMA 1K92A 1AROP 2W6IG 2ZD9A 3ML0A 1XL6A 2B1IA 1CP9A 2DYRB 1HWYA 3GWOA 4OXSA 4MVMA 5CA3A 1K34A 1G8MA 3E8FA 1K5SA 1K7DA 1BHBA 2C2AA 3CCSV 4Q20A 1R3KC 3B8NA 3CCJV 1KP3A 3K03A 4LP8A 1VQ4V 4P2ZA 3QNEA 3ZMZA 2H94A 1G4YB 1R6NA 4ZKIA 3RVZA 2HKOA 3ETEA 2Y48A 3JD3A 2IJKA 5LBQA 3ZRSA 1FXKB 4WFBV 1K4CC 3WFVA 1KD1W 1JOYA 3QO7A 5B1BC 3CCVV 3OEEG 1QLNA 3F7VC 3SPCA 2UXXA 3E35A 3OUSA 4MVUA 4RAIA 5EC1C 3G6EV 2BOBC 2IW5A 3VBBA 1LNQA 3JYCA 2EINC 3ZMVA 3QO5A 3CCLV 2IU3A 3AG1C 1AJNA 2OCCC 1SERA 2V1DA 1SRYA 3AG3B 1JQ0A 2WSSG 4GX1A 5IDJA 5IYCO 1S0VA 1N8RW 5B1NA 3JD4A 4X88A 3W7XA 2X6BA 1NKDA 4GX0A 3LSQA 4PA9A 2EILC 3OE7G 5EC2C 3OFNG 3P30A 3JD1A 2X6CA 4XDKA 2NNUA 5LGUA 1QVGU 5CBGA 1NJIW 2IJJA 3KG2A 3E8HA 1R6KA 3CMEV 3CXCU 3AG4C 3E8BA 1OCCB 3ABKC 2ITDC 2ZXWC 4JTCB 2WLJA 3E83A 1YTFB 3FYEB 1PNLA 1CEZA 5FL7G 5C93A 4JF3A 2AHZA 4BW5A 2DYSB 3OEHG 3E2EA 3CP1A 1V55B 2WLHA 4MT8A 4DXWA 4LBEC 3NXSA 1NR7A 5B1AC 4TT3G 3RBZA 1FFTB 4QJFB 5IY5C 3G4SV 3ZMTA 1Q7YW 1KKDA 1VQMV 3B8MA 3W7UA 5EK0A 3K06A 1M56B 2QE7G 3E8GA 3FB7C 5L3DA 3T4ZA 1ENVA 2EIJC 3LDDA 1OZ0A 5KA5A 4MVQA 4PDVA 3ASNB 4WF9V 1GTOA 2A79B 3ABLC 3VOUA 3CC4V 1VQ8V 1NQTA 3JD2A 2EIMC 3JD0A 1JPXA 2XAHA 2JEUA 3K04A 1NVPD 3MHHC 4UVAA 2ZR3A 1P4RA 1AI5A 1GMGA 2LP7A 2JIZG 2JK5C 1BL8A 2ATKC 1H8EG 3A0RA 5EBLC 2R9RB 1OHHG 4P9PA 5CBFA 3CD6V 1JVMA 3K79A 1P7BA 1S3JA 1NBMG 1SZTA 1AI7A 3OAAG 1VQKV 2F43G 4U7OA 1YSCA 2QA4V 2LFRA 5B3SB 3JCZA 5LHIA 4HAMA 5L3EA 3SJQC 2WLNA 3OR7C 5L3BA 4JAUA 1VQNV 2PI4A 4X8AA 4H37A 1RM1C 1PKXA 3CCEV 5DM6V 2Y69C 1NH2B 1K97A 1KP2A 4KP4A 4HYOA 4CZZA 4TSFG 2X0LA 1JX9A 3MD0A 4P30A 2UXNA 2WLKA 3ZMUA 4WFAV 3CMAV 1QR8A 2H8PC 2JEXA 1S5HC 2LFSA 1AI4A 2IH3C 3SYCA 1E1RG 1MG1A 2JDIG 1DF5A 2ZDIC 1M90W 2WAMA 4F4LA 5B1OA 3EHBB 2HFEC 2Z5UA 1M57C 1YIJV 3UKMA 5LHGA 1GM8A 3ZMSA 1SESA 2YEVA 5IYDO 3WG7B 1YJNV 1RPRA 4DO2A 2EJRA 3FB8C 4EKWA 5LHHA 4TWKA 3W7WA 2DWEC 1COWG 1Y4MA 1KC8W 1Y66A 2V7QG 5B1BB 2AHYA 4LC1A 3D3IA 1YJ9V 5EBWC 3W7TA 1TUEB 4R50A 5GW7A 2HR3A 1YTFD 4MVRA 4QPJA 5BZBA 1OCOC 4FK5C 1FS0G 5EBMC 2EILB 1F23A 1KQSU 3ZN1A 2XAQA 1W0KG 5L3GA 3SPIA 2DW4A 2QKSA 1SETA 2JJ2G 3UM7A 4PDRA 1K8AW 1NR1A 4UVCA 1AJQA 4MTFA 4UVBA 1GO3F 1E1QG 3AG4B 4RQFA 2JJ1G 3ZJZA 3ABKB 4WFFA 3CCUV 1OCZB 2ZXWB 1MABG 4BIUA 2GHYA 2QM7A 3CYOA 2BOCC 3ETGA 1VQLV 3K08A 4MW3A 4N23A 3OGCC 3F7YC 4MW8A 1B6QA 4MS2A 4RO2A 5E1AC 2ZR2A 2DYSC 5B1AB 1H2GA 3AG2C 4FJCC 1FXVA 5IY5B 2ZDIA 3ABMB 1AR1B 2YEVB 5J9PC 1DLBA 5KA6A 4UXNA 3CPWU 4UV9A 4I9WA 4I5SA 3SPGA 1AI6A 1OCRC 2EIJB 2EIKB 3ASOC 3DTUB 1ROPA 1M56C 4XDLA 3W7SA 3SYOA 3STLC 3D36A 3ABLB 3M99B 3ZN0A 1PNMA 4JTDB 3LDEA 4PA6A 1PD3A 3HPLC 2EIMB 3X2QB 2Z3YA 4BIZA 3SYAA 2Q69A 1Q81W 4JPRA 3K0DA 1E79G 1ZWIC 3T2MA 1THZA 1H8HG 4QPKA 3HB3B 2YSUB 2M7WA 2P67A 1K3EA 4P9OA 5H9CA 3RW0A 3LUTB 2K1EA 4PELA 3DGEA 1M9NA 5LGNA 1V54C 3ETDA 4ZBMA 2XNDG 5H6RA 1CPYA 1R73A 1QLEC 4MVSA 3ZRXA 1BMFG 1I5XA 2GSMB 2IJHA 3CCMV 1K4DC 3IGAC 1RM1B 2B1GA 2Y69B 3OMNB 2A0LA 3OMIB 4PA4A 1S77D 1QBZA 1NVPB 2B5UA 4YXWG 4WCEV 1Q86W 1S76D 3B77A 1VQ5V 1KECA 4G28B 2DYRC 2FTKA 5LGTA 1AJPA 3EFFK 2X7RB 3OMAB 1W2BU 1GK9A 3F5WC 3G71V 1VQ9V 4GX2A 1K33A 4R8CA 1I5YA 1W0JG 1YHQV 2DWDC 4JGSA 5L3FA 2XAFA 4JTAB 1YI2V 4N21A 4WFGA 1UJWB 1M57B 2HVJC 1EBOA 1MOFA 2EZOA 2QEXV 3CCQV 3SPHA 1VQ6V 2ITCC 3ZRWA 4RUEA 4CBCA 3K3WA 1MSWD 1PNKA 4GCZA 1Q82W 1EFRG 1FXKC 2Q6AA 1GKFA 1VQOV 1YITV 2P90A 3WG7C 3OUFA 3SYQA 4QE7A 1EZJA 2EINB 4L87A 3IFXA 4MVOA 3MHSC 3AG1B 2OCCB 2W0FC 2HLDG 4RQEA 2D3OW 2CK3G 1R3IC 3T4DA 3CC7V 3ZRVA 1OCOB 3AG3C 4QNHB 1F4NA 1K73W 1QR9A 4JYCA 4Z1MG 2WLLA 1L1FA 4HZ3A 3TCUA 4BAYA 2QTOA 3LNMB 3IC7A 3ABUA 4E2LA 3I55V 1WLEA 1BHAA 4QE9A 1JJ2U 4WFEA 5CMUA 2OTLV 2QM8A 2WLIA 1OCCC 2WPDG 3E86A 3SPJA 5IYBO 4MTOA 1K5QA 4JYBA 5L3CA 1VQPV 3CC2V 3FYIB 3OM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME V;  3CXC U;  1VQM V;  1YI2 V;  1KQS U;  3CCM V;  3CCS V;  3CC7 V;  3CCR V;  1KC8 W;  1M1K W;  2QEX V;  3G6E V;  3CCQ V;  3CCJ V;  1K73 W;  3CC2 V;  1VQ7 V;  1VQ6 V;  2OTJ V;  1Q81 W;  1K8A W;  3CD6 V;  4WFA V;  3CMA V;  1VQ4 V;  1NJI W;  1VQK V;  1Q82 W;  3CCL V;  4WCE V;  1YJ9 V;  1S72 V;  1VQO V;  1Q86 W;  3CCU V;  2QA4 V;  1YIT V;  3I55 V;  1YJW V;  1M90 W;  1VQ5 V;  4WF9 V;  1N8R W;  3I56 V;  1K9M W;  3CPW U;  1W2B U;  3CC4 V;  3G71 V;  1VQL V;  1JJ2 U;  4WFB V;  1VQ8 V;  1VQ9 V;  2OTL V;  1VQN V;  1YIJ V;  1YHQ V;  3OW2 U;  1KD1 W;  3G4S V;  3CCE V;  5DM6 V;  1VQP V;  1R73 A;  1QVG U;  1YJN V;  3CCV V;  2D3O W;  1Q7Y W;  1QVF U; 
#chains in the Genus database with same CATH topology
 3R65 A;  4PA3 A;  3U11 A;  2P7T C;  2IJI A;  3RYC B;  3L71 H;  4ZI7 A;  1DF4 A;  4G27 B;  3K9S A;  4O4J B;  5KUK A;  2P6J A;  4DV5 O;  3FAV B;  4QIW F;  2Q68 A;  4O4L B;  2WLM A;  2BTQ B;  2Y4T A;  1ORQ C;  2EBO A;  3LSS A;  4DV6 B;  4H44 B;  3OR6 C;  1HNZ B;  1JJO A;  1Y6X A;  5F2V O;  2Q67 A;  3FB6 C;  1OCR B;  3ASO B;  1XNR O;  4IIJ A;  2IU0 A;  5LXT B;  1M1K W;  2R70 A;  4UUJ C;  1UFI A;  3E89 A;  2M6Y A;  2HEP A;  4FIP C;  3DC5 A;  1GM9 A;  3STZ C;  1NH2 D;  1GM7 A;  2OT5 A;  4JI1 O;  4B3T B;  1S5L Z;  4I4T A;  1HNW O;  5KHK A;  1K9M W;  3ABT A;  5JCO C;  4W4L A;  4K0K O;  2XOK G;  5LA6 A;  4XDJ A;  3FB5 C;  2YXL A;  4YJ3 A;  1R3L C;  4JV5 O;  2UXB B;  1WP8 A;  3JSN A;  1L0N H;  3LDC A;  3CRC A;  2PI5 A;  5C8Y B;  4IHJ A;  2HJF C;  1F4M A;  5CBH A;  2W6J G;  3APO A;  2KB1 A;  4PDL A;  3P32 A;  2QWN B;  1X59 A;  1VAR A;  1ARO P;  4KL1 A;  4EB6 A;  4DV6 O;  4JZG A;  3CE2 A;  1HNZ O;  1CP9 A;  2XT9 A;  1HWY A;  4DRX B;  1K34 A;  1G8M A;  3E8F A;  3M8A A;  4H0L B;  3N2K B;  3K03 A;  4B3R B;  3QNE A;  3P3P A;  4O4H B;  2H94 A;  1SQV H;  4B3T O;  3HKB B;  3RVZ A;  2Y48 A;  5J2U A;  4EFE A;  3JAK B;  5LBQ A;  1FXK B;  2HHH B;  2QJ1 A;  1K4C C;  3WFV A;  1WA8 A;  2UXB O;  3QO7 A;  3CCV V;  1JOY A;  1FD9 A;  3OEE G;  5BMV A;  4LF5 O;  4B08 A;  3SPC A;  2UXX A;  3OUS A;  5B5E Z;  4MVU A;  1XHZ A;  3D36 C;  3OTO B;  2VS0 A;  4J7Z A;  1GN6 A;  2YIC A;  2EIN C;  4TUY B;  4KXR A;  3QO5 A;  1B06 A;  1SRY A;  3GVM A;  5EC2 C;  3O9O A;  5BR8 B;  3OFN G;  2X6C A;  2NNU A;  4KHP O;  2AGA A;  4DV7 B;  5KLV H;  4UCR A;  2ZXW C;  1BZK A;  2OYQ A;  4B3R O;  5C93 A;  1H2L A;  1LUW A;  4NTW A;  4JF3 A;  4X1K B;  4X1I A;  2DYS B;  2BTO A;  2XTA A;  4U3F H;  4CC6 A;  1V55 B;  4UB8 Z;  1SQQ H;  5A9G A;  4DXW A;  4DR5 B;  3HKE A;  5A2Q N;  1D5N A;  2HHH O;  5KHH A;  3L75 H;  5H5N A;  1IBL O;  3ZMT A;  2QWQ B;  3HKC B;  2RMK B;  4F6R B;  4TOI A;  2PY5 A;  2ILM A;  1KYO F;  3ZS8 C;  4QGP A;  4PDV A;  3ASN B;  3ABL C;  2F4V B;  5BR8 O;  2H3O A;  1JPX A;  3VQV A;  1PM9 A;  1Q8I A;  4I55 B;  4UVA A;  4LF9 B;  1AI5 A;  1AVM A;  2YXY A;  1BL8 A;  1KBH A;  3A0R A;  4I0X B;  5CBF A;  4LF4 B;  2F43 G;  3ZBH A;  4U7O A;  5B3S B;  3BPZ A;  3P3N A;  4JAU A;  1VQN V;  3VQY A;  1NH2 B;  1XUQ A;  4JI3 B;  4FLU A;  4J42 A;  3AK3 A;  3CMA V;  1SQF A;  5K1X A;  1E1R G;  5EYP A;  2ZDI C;  1ZUQ A;  2Y0P A;  2F4V O;  1YXB A;  1VF5 B;  1YIJ V;  3JAS B;  1CXZ B;  1GM8 A;  1AIL A;  2YEV A;  4X20 A;  5KX5 A;  3ICX A;  3WG7 B;  1RPR A;  4FLT A;  3FB8 C;  4AI8 A;  1COW G;  4DR4 B;  1KC8 W;  3K59 A;  4LF4 O;  1DGS A;  4LC1 A;  3SGI A;  5JCO A;  1TVK B;  1YJ9 V;  4W4K A;  3W7T A;  4R50 A;  5GW7 A;  2HR3 A;  3BA8 A;  2E5L B;  5EBM C;  4ZOL B;  4JI3 O;  4J80 A;  4B7K A;  3C90 A;  2QKS A;  4OX9 O;  1SET A;  2JJ2 G;  3UM7 A;  4PDR A;  1WN7 A;  4UVB A;  3K5N A;  4FFB A;  2QM4 A;  4RQF A;  2YXH A;  4WFF A;  2QM7 A;  5ITZ A;  2F95 B;  1VQL V;  3K08 A;  4MW3 A;  3SDL A;  4C7U A;  4MW8 A;  1G6U A;  4FM1 A;  4MS2 A;  2OIE A;  3H1H H;  4RO2 A;  4PV1 B;  2OCH A;  5B1A B;  4DR4 O;  1HR0 B;  4CS3 A;  2Q4P A;  3RGB A;  3ABM B;  4OPH A;  5CB4 A;  1NTZ H;  5KA6 A;  3CPW U;  3A2F A;  2EIJ B;  2EIK B;  1KKC A;  4JV5 B;  3SYO A;  2E5L O;  3D36 A;  1XQ8 A;  2VWK A;  3LDE A;  1PD3 A;  3HPL C;  4X1Y A;  2Z3Y A;  1Q81 W;  3CXH F;  2ZE5 A;  4JPR A;  1E79 G;  2FKX A;  2LW7 A;  1H8H G;  2M7W A;  2K9P A;  2P67 A;  4TV8 B;  1BGY H;  3I5D A;  3T1H B;  1TAE A;  1VF6 C;  3DGE A;  4YY3 B;  1V54 C;  3ETD A;  2QWP B;  5H6R A;  1QLE C;  3D3Q A;  1BMF G;  3ZHR A;  1HR0 O;  1K4D C;  2Q7H A;  1RM1 B;  3OMI B;  4I50 B;  1S77 D;  2ZIN A;  2PYJ A;  4ZHQ B;  2B5U A;  4WCE V;  3RYH B;  1WP7 A;  2GDS A;  2FTK A;  1H2M A;  1SQP H;  5LP6 A;  1AJP A;  2UUB B;  1GK9 A;  2YC0 A;  3F5W C;  1VQ9 V;  4R8C A;  4D7S A;  1EN5 A;  1I94 O;  2UXC O;  1R6T A;  2AZ2 A;  2F66 C;  1UJW B;  5KAI Z;  1M57 B;  1MOF A;  3SPH A;  3N27 A;  1MSW D;  4GCZ A;  1EFR G;  2Q6A A;  3AK1 A;  3SYQ A;  3T1H O;  1EZJ A;  4YY3 O;  3MHS C;  2ZCE A;  4X65 B;  2CK3 G;  3CB2 A;  1KMI Z;  1R3I C;  2CH7 A;  4QNH B;  1HP8 A;  3ZED A;  5LOV A;  3K58 A;  1IZ3 A;  1ZL8 A;  3TCU A;  3IC7 A;  4LH7 A;  2UUB O;  1BHA A;  1GRJ A;  4QE9 A;  5D5P A;  2WPD G;  4U3J B;  5LMN B;  2JRI A;  4IT5 A;  3FYI B;  1IX9 A;  4WFH A;  5IJ0 A;  3SYP A;  4J9Y B;  4JAV A;  3BY6 A;  4EB6 B;  1MNG A;  4LNU B;  4YJ2 B;  4DV0 B;  1RSO A;  2XAJ A;  2WWW A;  3CX5 F;  3K57 A;  3CRA A;  1TGO A;  4NB5 A;  2YIB A;  3TET A;  3EVK A;  1TUB B;  1M4U A;  2UXD B;  3ZRW B;  3OW2 U;  3PJS K;  2A9H A;  1DK1 A;  3CJH B;  1FFX B;  1R3J C;  2XAS A;  2X6A A;  2GBO A;  2Q5Z A;  4GKK O;  5J2U B;  4TQD A;  3JCU Z;  3RVY A;  3K9A A;  4FMT A;  3HKD A;  3QO8 A;  2MW2 B;  2MK3 A;  3JAR A;  5CN0 A;  1D5A A;  1Q6I A;  1Y76 A;  3NR7 A;  5LMN O;  1JCH A;  5GTI Z;  2AXT Z;  1QVF U;  2Q9L A;  4NXM B;  4YIO A;  4MTG A;  1BT8 A;  1XL4 A;  2QKA A;  4JAS A;  3J7A U;  4L8J A;  2WLI B;  3KCX A;  4RUF A;  4RWU A;  4BIO A;  1RFY A;  3TJT A;  4EEQ A;  4ABM A;  2ZD9 A;  5CA1 A;  1XL6 A;  3EXA A;  2B9Z A;  2UXD O;  4OXS A;  1K5S A;  3CCS V;  2UUC B;  3RYI A;  5TIS Z;  3HKE B;  5DED A;  3ZHU A;  4O2A B;  4P2Z A;  1G4Y B;  4O4I B;  1M93 A;  1R6N A;  2HKO A;  2CAZ C;  3JD3 A;  2P4K A;  3ZRS A;  4DUY B;  4NTY A;  1KD1 W;  2RJZ A;  1N0N A;  4CS2 A;  3M7M X;  3WB0 A;  4Z1V A;  3BA9 A;  5EC1 C;  5FNV B;  3VBB A;  3JYC A;  3ZHT A;  2IU3 A;  5LL6 Y;  3MDS A;  2V1D A;  3AG3 B;  2WSS G;  1VF6 A;  5KHG A;  3APQ A;  5IYC O;  1S0V A;  5B1N A;  4X88 A;  3W7X A;  4DW0 A;  1NKD A;  4GX0 A;  3LSQ A;  4A5U B;  1P49 A;  3JD1 A;  4XDK A;  1US6 A;  1NJI W;  2IJJ A;  1R6K A;  1SZX A;  3AG4 C;  4O2B B;  2UUC O;  3GWK C;  3ABK C;  4JTC B;  2WLJ A;  3FYE B;  1CEZ A;  5FL7 G;  2Q73 A;  2AHZ A;  1Q6U A;  3OEH G;  3E2E A;  1EZV H;  2KSD A;  1X4T A;  2WLH A;  3NXS A;  4DUY O;  1BQZ A;  1NR7 A;  2JGD A;  3RBZ A;  4QJF B;  5IY5 C;  4I7Z B;  1VQM V;  1Y74 A;  5EYP B;  5EK0 A;  3K06 A;  1QU7 A;  1MMM A;  3E8G A;  3FB7 C;  1XDC A;  5EIB C;  3E22 A;  4X20 B;  5KX5 B;  4WF9 V;  1GTO A;  2A79 B;  2CGO A;  1SA0 A;  3VOU A;  3CC4 V;  1NQT A;  3JD2 A;  2EIM C;  2IBZ H;  3CRR A;  4NR1 A;  2JEU A;  3K04 A;  3DXR B;  1NVP D;  4IL6 Z;  4CC5 A;  2LP7 A;  2JK5 C;  5EBL C;  4YHH B;  1OHH G;  3D8C A;  3RT3 C;  1S3J A;  1YVW A;  2E74 B;  3JAW B;  2PTM A;  3JCZ A;  4NVP A;  5LHI A;  4HAM A;  4UCT A;  2WLN A;  2YIB D;  4X8A A;  4LFC B;  2GUZ A;  2ZE8 A;  1SF9 A;  2UU9 B;  1SQX H;  3A0H Z;  5IT9 N;  4KP4 A;  1I0H A;  1Q3E A;  4TSF G;  3MD0 A;  2WLK A;  3ZMU A;  1NI8 A;  1AI4 A;  2IH3 C;  1PL4 A;  1MG1 A;  2RCV A;  3C3S A;  1M90 W;  4F4L A;  2Z5U A;  3UCS C;  1LR1 A;  4DR2 B;  2CTW A;  4DUZ B;  4DO2 A;  2EJR A;  1BSM A;  1H2N A;  3KZI Z;  3W7W A;  1Y4M A;  4YHH O;  1Y66 A;  2V7Q G;  2PYL A;  3D3I A;  1Y67 A;  1JFF A;  5EBW C;  3WB1 A;  4BWA A;  1S5J A;  1TUE B;  1HDJ A;  2P4V A;  1YTF D;  2JVD A;  3UT5 B;  2CTR A;  3ZX6 A;  1OCO C;  2UU9 O;  4FK5 C;  1KQS U;  5H2F Z;  5L3G A;  3K5M A;  2Q0O C;  3Q4H B;  4DV2 B;  1K8A W;  1NR1 A;  1AJQ A;  5JVD B;  5CA0 B;  4MTF A;  1HNX B;  1E1Q G;  3JAT A;  3ZJZ A;  1OCZ B;  2ZXW B;  3JAM N;  4WBN B;  2W0X A;  1O9G A;  2BOC C;  3ETG A;  3JAL A;  4FFK A;  5KMG A;  2ZE6 A;  3ZHQ A;  3F7Y C;  4DUZ O;  4FLW A;  5LP6 C;  5E1A C;  2YI8 A;  2DYS C;  3AG2 C;  4GZR B;  2WA3 A;  3OTO O;  1WPB A;  1XBL A;  3U0Z A;  4JI7 B;  5IYZ B;  3WB2 A;  3S3X A;  4JAA A;  1AI6 A;  4ZIB A;  4XDL A;  3W7S A;  3BCC H;  3STL C;  3ABL B;  5BXZ A;  3N2G B;  5IWA B;  4DV7 O;  3X2Q B;  2G38 A;  1HNX O;  3K0D A;  2OWO A;  5GON A;  4JI0 B;  3T2M A;  4TV9 A;  2P22 C;  3TXQ A;  5H9C A;  3RW0 A;  3J80 N;  3SR2 C;  2VRZ A;  4DR5 O;  1M9N A;  1JMK C;  2CUG A;  1R73 A;  1I7F A;  3RYF A;  2GSM B;  3QF7 A;  2DN9 A;  4LWS B;  3OMN B;  4GUN A;  1QHT A;  3BFR A;  1Z5W A;  2BSK B;  1QBZ A;  5JH7 A;  1NVP B;  4YXW G;  5LYJ B;  3RYC A;  2DYR C;  5LGT A;  5IJ0 B;  4O4J A;  4UCO A;  4X62 B;  2LW1 A;  3FAV A;  2QGN A;  2BTQ A;  5L3F A;  2FML A;  5IWA O;  4N21 A;  4WFG A;  4LF9 O;  4LR3 A;  2EZO A;  3CCQ V;  3SJA C;  5IJ9 B;  3G67 A;  1XIL A;  4RUE A;  3OGI B;  2L6L A;  3K3W A;  1PNK A;  1GKF A;  1VQO V;  5KHJ A;  2E3C A;  5LXT A;  3WG7 C;  4CH5 A;  2PGG A;  4DV1 B;  4L87 A;  3IFX A;  3AG1 B;  2OCC B;  1MSD A;  1UPG A;  4JI5 B;  3T4D A;  1F4N A;  5IE9 A;  1WB8 A;  3MAQ A;  1U97 A;  5C8Y A;  1L1F A;  5J2T B;  1LUV A;  3LNM B;  4E2L A;  4UFZ A;  1WLE A;  4IYI A;  3H9V A;  1JJ2 U;  5CMU A;  4X62 O;  2OTL V;  2QM8 A;  1OCC C;  4JYB A;  3OM3 B;  3QTC A;  1DTO A;  3H1K H;  4PHZ A;  3CCR V;  1N33 B;  4ASU G;  2F93 B;  3FFQ A;  2DQ3 A;  5JJJ B;  2OTJ V;  4MSW C;  3UO3 A;  4DRX A;  3U10 A;  4X89 A;  2NLJ C;  3H01 A;  3L72 H;  2EX3 A;  5BY1 A;  3N2K A;  1FXH A;  3TK1 A;  1FAF A;  4DV1 O;  4KUM A;  4JI2 B;  4U7N A;  1F51 A;  4O4H A;  1G1X B;  5JQG B;  4PDM A;  4B3M B;  3ABM C;  4JI5 O;  4H13 B;  4KFM A;  2FB5 A;  3JAK A;  3T1C A;  1FXK A;  2KQX A;  1BQ0 A;  2ZE7 A;  3JSL A;  2EIK C;  4IYH A;  2JGU A;  3A0B Z;  1H38 A;  4R6Z A;  3ZCC A;  1QCE A;  2QWR B;  1N36 B;  3I56 V;  4F6E A;  3IJ4 A;  4GX5 A;  4TUY A;  2QDO A;  1RPO A;  1D2D A;  2WLL B;  1MZF A;  2QWO B;  4FM2 A;  1N33 O;  1V54 B;  2R9I A;  1VQ7 V;  1QLE B;  5B66 Z;  4LCU C;  2D2C B;  1PV0 A;  1FYJ A;  1K92 A;  1AR4 A;  2A7W A;  2W6I G;  2O57 A;  4CH6 A;  2GV9 A;  3ML0 A;  3THO A;  3TXS A;  4JI2 O;  4X1K A;  4ZI7 B;  2B1I A;  4B3M O;  4MVM A;  4CH3 A;  4LF8 B;  1K7D A;  1BHB A;  1XMO B;  1GAX A;  4OGQ B;  4FLV A;  2CTQ A;  4Q20 A;  1R3K C;  3CCJ V;  2E75 B;  4AHC A;  2PF4 E;  4J11 A;  2YID A;  1MA1 A;  2EJ7 A;  1N36 O;  1B3Q A;  3ETE A;  5D5Q A;  2CTP A;  4IIJ B;  4J41 A;  4DK0 A;  5B1B C;  1O9H A;  3F7V C;  3E35 A;  4RAI A;  2JS3 A;  3G6E V;  4I4T B;  2DOS A;  2JS5 A;  1GN2 A;  1SA0 B;  2IW5 A;  1LNQ A;  1SC5 B;  2YS8 A;  4I55 A;  5LA6 B;  3CEI A;  4YJ3 B;  1AJN A;  4LF6 B;  1NS1 A;  4GX1 A;  1JQ0 A;  5IDJ A;  4CH4 A;  4I0X A;  3JD4 A;  2VQE B;  2EIL C;  3OE7 G;  4IHJ B;  3P30 A;  4JYA B;  3UO2 A;  5K1P A;  4K35 A;  1QVG U;  4LF8 O;  4NKG B;  3E8H A;  3CME V;  1RP3 B;  5EIB D;  4FLY A;  2RNB A;  1XMO O;  4JZ2 A;  2Y4U A;  3E83 A;  4ICG A;  1AB3 A;  3BAB A;  3UQ8 A;  3CP1 A;  2R9A A;  2A3Q A;  2ZNI A;  4TT3 G;  1Q7Y W;  4X65 O;  1KKD A;  1XHX A;  3ETQ A;  2XHB A;  1M56 B;  2QE7 G;  3JAS A;  2ZM6 B;  5L3D A;  3KKY A;  2ADP A;  3T4Z A;  1PP9 H;  3T1Y B;  3C3T A;  1P84 F;  1OZ0 A;  4Q6G A;  4LF6 O;  1WA8 B;  4MVQ A;  5BMV B;  2L35 A;  1TVK A;  4NTX A;  2XAH A;  4LFA B;  2ODM A;  3MHH C;  2ZR3 A;  4NYK A;  4JI8 B;  2JIZ G;  4UCS A;  2ATK C;  3CD6 V;  2NN4 A;  3K79 A;  4DV0 O;  2ZT9 B;  4ZOL A;  3OAA G;  2PZS A;  3O65 A;  1QNM A;  3DC6 A;  3AG7 A;  3SJQ C;  4B3S B;  3OR7 C;  1N0J A;  2QSA A;  5L3B A;  1WAZ A;  2PI4 A;  1NTM H;  2Y69 C;  5DM6 V;  4E4E A;  1NU1 H;  4X1I B;  4CZZ A;  3TGU H;  2ZM6 O;  1JX9 A;  4P30 A;  4WFA V;  3T1Y O;  1J5E B;  3BVO A;  2RN9 A;  1EN6 A;  2H8P C;  2LFS A;  1GN4 A;  3SJB C;  3SYC A;  2JDI G;  2DE0 X;  2WAM A;  2VQF B;  2HFE C;  4JYY A;  4LFA O;  3UKM A;  3ZMS A;  3IC9 A;  4TWK A;  2DWE C;  4NXM O;  2ARH A;  3AK2 A;  4FLX A;  2QTS A;  4B3S O;  4I9Q A;  1ZAU A;  1Q5O A;  5BZB A;  4J7K A;  2KG7 A;  1FS0 G;  2N04 A;  1MZE A;  4TV8 A;  3ZN1 A;  2A06 H;  3B4S A;  2F23 A;  4BR6 A;  1P7G A;  4UVC A;  3AG4 B;  1Q6H A;  2JJ1 G;  4FZ1 A;  5FLX N;  4JI1 B;  3ABK B;  3CCU V;  5KHI A;  4BIU A;  2VQF O;  3CYO A;  3QVN A;  4I50 A;  4ZHQ A;  1FJG B;  3RYH A;  3OGC C;  4X64 B;  1KB9 F;  2ZR2 A;  1H2G A;  4UB6 Z;  4FJC C;  5IY5 B;  1NTK H;  1W59 A;  2ADQ B;  1AR1 B;  4NXN B;  2YEV B;  4UXN A;  4DW1 A;  1FKA O;  1IBK B;  1OCR C;  3ASO C;  3DTU B;  3OTF A;  3M99 B;  1PNM A;  4JTD B;  3CRQ A;  4PA6 A;  2EIM B;  2HJD A;  4BIZ A;  3SYA A;  4EFB A;  2Q69 A;  2ZNJ A;  1GN3 A;  1IVS A;  3HB3 B;  3FD9 A;  2Z0A A;  1K3E A;  5GTH Z;  2Q7E A;  4PD4 F;  2UUA B;  3B09 A;  4PEL A;  1ZLZ A;  5LGN A;  1FJG O;  1WNS A;  4X64 O;  2AW9 A;  4FFB B;  3ZRX A;  4LF5 B;  2ZKO A;  2GTA A;  2IJH A;  4BW9 A;  4U3J A;  5EZY A;  3VQX A;  2A0L A;  5ITZ B;  5DEC A;  1YEW A;  2FL4 A;  4NXN O;  1VF7 A;  1ZTE A;  1VQ5 V;  4G28 B;  1SKV A;  2PUS A;  3FX7 A;  4LNU A;  4YJ2 A;  1IBK O;  2X7R B;  1W2B U;  4GX2 A;  2AZ0 A;  2V4D A;  1I5Y A;  1W0J G;  1YHQ V;  3RN4 A;  4JGS A;  5CB4 B;  4KHP B;  3L9D A;  3OD4 A;  4DV4 B;  1QQC A;  1TUB A;  2QEX V;  1VQ6 V;  3ZRW A;  4HNA A;  1Q90 D;  3J81 N;  3CJH A;  1FFX A;  1FXK C;  4B7E A;  3B40 A;  3DSQ A;  2UUA O;  4QE7 A;  4X1Y B;  2EIN B;  4HBN A;  4MVO A;  4X66 B;  2IM9 A;  4LFC O;  2W0F C;  4RQE A;  1IBL B;  1BCC H;  1OCO B;  1OJH A;  1K73 W;  5JWP A;  2OIG A;  1WB7 A;  3CS5 A;  5KAF Z;  3ABU A;  3I55 V;  1BS3 A;  2WLI A;  5IYB O;  3SPJ A;  3HR0 A;  2P06 A;  3RWR D;  4DR2 O;  1K5Q A;  5L3C A;  1VQP V;  3CC2 V;  5JJN B;  4DV4 O;  3IAY A;  4XBF A;  2IH1 C;  1IXM A;  5DN6 G;  3GB7 C;  1OCZ C;  1V55 C;  5LP6 B;  1OV9 A;  2ETN A;  2HVK C;  2N05 A;  3AG2 B;  1S72 V;  3SJC C;  3AEI A;  2LQT A;  3WU2 Z;  4H33 A;  2HG5 C;  4MVZ A;  4O2A A;  4X66 O;  4G2K A;  4O4I A;  1BE3 H;  5HFL A;  1WPX A;  2NR5 A;  3QG5 A;  4YIP A;  4DV3 B;  1PL0 A;  4LF7 B;  1I08 A;  2YIA A;  5H6Q A;  4MTX A;  3ASN C;  4IGG A;  4DV2 O;  1J95 A;  1XNQ B;  2EZP A;  3K0G A;  2ZQM A;  1XI1 A;  4OPA A;  1YJW V;  1VEW A;  4R7C A;  5FNV A;  2DQ0 A;  3X2Q C;  2DJV A;  2CH7 B;  2RQ6 A;  3FKS G;  3ZIA G;  2VWJ A;  4GT1 A;  5LOV B;  1XMQ B;  1ZL8 B;  4FPP A;  1F7Y A;  5HFM A;  2Q7G A;  1VMG A;  3BEH A;  2XAG A;  5B3S C;  3LSU A;  4UV8 A;  1AR5 A;  4PA7 A;  4J9Z B;  4O2B A;  5KUM A;  2CDY A;  4JI7 O;  1EN4 A;  1M5I A;  1KUQ A;  3L73 H;  2DYR B;  1RSO B;  3GWO A;  5CA3 A;  2KKW A;  4O4L A;  3H1L H;  3K5L A;  2C2A A;  4DV3 O;  4OX9 B;  4LF7 O;  3B8N A;  1IDS A;  1KP3 A;  1V9P A;  4LP8 A;  4AQY B;  1VQ4 V;  4FM0 A;  4GKJ B;  4DYL A;  1XNQ O;  3ZMZ A;  4JI0 O;  3R66 A;  4ZKI A;  5FPO A;  2IJK A;  3G80 A;  4WFB V;  1AP6 A;  1L8D A;  5AG2 A;  1XMQ O;  1N4C A;  1QLN A;  3HKD B;  4D7T A;  2BOB C;  3DXR A;  3JAR B;  1U96 A;  3ZMV A;  3CCL V;  1YCI A;  1Y76 B;  3AG1 C;  2OCC C;  1SER A;  2GTS A;  1N34 B;  1N8R W;  1XOU A;  4UCU A;  3H1I H;  2X6B A;  4PA9 A;  5LGU A;  3JAW A;  5CBG A;  3KG2 A;  3CXC U;  1VIB A;  3E8B A;  1OCC B;  2ITD C;  4FVM A;  2FYU H;  1YTF B;  4AQY O;  4PI0 A;  4GKJ O;  1PNL A;  5CA1 B;  4BW5 A;  4GYC B;  1Z2G A;  4MT8 A;  4LBE C;  2HP8 A;  3H1J H;  5B1A C;  4K3A A;  3RYI B;  4FLZ A;  1FFT B;  3KCY A;  4PJ0 Z;  3G4S V;  3HKB A;  1A32 A;  3B8M A;  3W7U A;  1YF2 A;  1YZB A;  1ZSP A;  3ZHS A;  3VQW A;  2BCC H;  2R72 A;  2DMX A;  1ENV A;  2EIJ C;  3LDD A;  5KA5 A;  1N34 O;  2LGW A;  4TQF A;  1VQ8 V;  3JD0 A;  1I94 B;  2UXC B;  5LMU B;  2YDE A;  1N32 B;  4K8Z A;  1P4R A;  1GMG A;  1H8E G;  1HW7 A;  3UT5 A;  3RFR A;  1ZX3 A;  2R9R B;  4P9P A;  3OT7 A;  1JVM A;  1P7B A;  4JI4 B;  1NBM G;  1SZT A;  1AI7 A;  3G6B A;  1VQK V;  1L0L H;  3CRM A;  2KG7 B;  4X9Q A;  1YSC A;  2QA4 V;  1NZ6 A;  2LFR A;  3Q4H A;  2Q8V A;  5L3E A;  1B04 A;  5JVD A;  5CA0 A;  1JA8 A;  1IUR A;  2E76 B;  4H37 A;  1URF A;  1TA8 A;  1RM1 C;  1Z5V A;  1PKX A;  3CCE V;  4WBN A;  1K97 A;  1KP2 A;  4HYO A;  2X0L A;  4DR3 B;  1KU9 A;  2UXN A;  1EM1 A;  2JGD B;  4UCV A;  3HKC A;  1QR8 A;  1R1B A;  4J10 A;  1GH6 A;  4JI6 B;  4F6R A;  2JEX A;  1S5H C;  1DF5 A;  1Y74 B;  5B1O A;  3EHB B;  3B2E E;  1M57 C;  3BHP A;  5LMU O;  5LHG A;  1SES A;  1N32 O;  5IYZ A;  5IYD O;  1YJN V;  3L70 H;  4EKW A;  5LHH A;  2YI9 A;  3E22 B;  2YUA A;  4K8X A;  2Q0A A;  5B1B B;  2AHY A;  1SQB H;  2QKC A;  4JI4 O;  1PPJ H;  3N2G A;  2RDC A;  1JR9 A;  4MVR A;  4D6T H;  4LH6 A;  4QPJ A;  4DK1 A;  4DR6 B;  4DR1 B;  2LJ2 A;  2EIL B;  1F23 A;  2XAQ A;  1W0K G;  3SPI A;  2DW4 A;  4GKK B;  1NT2 B;  1YDX A;  4DR3 O;  3ZHV A;  1H2S B;  1GO3 F;  5FPR A;  4JI6 O;  2GUZ B;  4LWS A;  2LO1 A;  1MAB G;  2LGQ A;  2GHY A;  4AIL C;  5EZY B;  2BSK A;  4N23 A;  1B6Q A;  5LYJ A;  3S3W A;  1SS3 A;  3CSX A;  1FXV A;  2ZDI A;  2Y0I A;  3BRC A;  2P5O A;  5J9P C;  3LNN A;  1DLB A;  5IJ9 A;  1Q43 A;  4I9W A;  4I5S A;  4UV9 A;  3SPG A;  2VQE O;  4DR7 B;  2WA4 A;  1ROP A;  1M56 C;  4DR6 O;  4JYA O;  4HNA B;  1IBM B;  3F5T A;  3K5O A;  4DR1 O;  2BE3 A;  3ZN0 A;  2QR4 A;  1JFF B;  1ZWI C;  1THZ A;  4QPK A;  2YSU B;  4P9O A;  1T5E A;  3LUT B;  2K1E A;  4ZBM A;  5J2T A;  2XND G;  1CPY A;  4MVS A;  3JAT B;  1I5X A;  4CS4 A;  3CCM V;  3IGA C;  2ZIO A;  1VP7 A;  2B1G A;  2Y69 B;  3BAA A;  4LFB B;  1FPO A;  1XRE A;  3JAL B;  1WJZ A;  4PA4 A;  5KMG B;  4PI2 A;  1Q86 W;  1S76 D;  3B77 A;  1KEC A;  3EFF K;  1AP5 A;  3OMA B;  4DR7 O;  3G71 V;  1K33 A;  1IBM O;  4Z2W A;  2DWD C;  2XUM A;  3PN1 A;  2XAF A;  4JTA B;  3L74 H;  1YI2 V;  4JI8 O;  2HVJ C;  1EBO A;  2F1M A;  2CGN A;  2ITC C;  4CBC A;  5JQG A;  1Q82 W;  3CWB H;  4DV5 B;  3A8T A;  1YIT V;  2P90 A;  3OUF A;  2N74 A;  1SQG A;  2HLD G;  2D3O W;  4FZ0 A;  5GON B;  4TV9 B;  1XNR B;  3CC7 V;  2ZIM A;  3ZRV A;  3AG3 C;  2EUL A;  4LFB O;  2CE4 A;  1QR9 A;  4JYC A;  4Z1M G;  1H2K A;  2WLL A;  4GLX A;  1J5E O;  4HZ3 A;  1IXB A;  4BAY A;  3CHX A;  2QTO A;  4J7J A;  3RYF B;  5JJE B;  1HNW B;  5E79 Z;  4K0K B;  4WFE A;  3E86 A;  4MTO A;  1XEQ A;  5JH7 B; 
#chains in the Genus database with same CATH homology
 3R65 A;  4WFH A;  4XBF A;  4PA3 A;  2IH1 C;  1IXM A;  5DN6 G;  3SYP A;  4J9Y B;  4JAV A;  3GB7 C;  1DTO A;  3CCR V;  1OCZ C;  2P7T C;  2IJI A;  3BY6 A;  4ASU G;  1V55 C;  1DF4 A;  2DQ3 A;  4G27 B;  2OTJ V;  4MSW C;  5KUK A;  2HVK C;  2XAJ A;  2P6J A;  4X89 A;  3AG2 B;  2WWW A;  1S72 V;  2NLJ C;  3H01 A;  4QIW F;  3AEI A;  2Q68 A;  2WLM A;  1FXH A;  1ORQ C;  2EBO A;  4H33 A;  3TK1 A;  2HG5 C;  3LSS A;  4KUM A;  4MVZ A;  3TET A;  4G2K A;  4U7N A;  1F51 A;  3OR6 C;  3ZRW B;  5HFL A;  3OW2 U;  3PJS K;  2A9H A;  1WPX A;  4PDM A;  3ABM C;  4KFM A;  1R3J C;  2XAS A;  2X6A A;  2Q67 A;  3FB6 C;  1OCR B;  3ASO B;  3T1C A;  2IU0 A;  1FXK A;  1M1K W;  4UUJ C;  1PL0 A;  5H6Q A;  3E89 A;  3ASN C;  4MTX A;  3RVY A;  1J95 A;  2EIK C;  4FIP C;  3K9A A;  1GM9 A;  2EZP A;  3STZ C;  3K0G A;  1GM7 A;  2OT5 A;  2ZQM A;  4R6Z A;  1NH2 D;  1H38 A;  1YJW V;  4FMT A;  1QCE A;  3ZCC A;  4R7C A;  3QO8 A;  3I56 V;  1K9M W;  3ABT A;  2DQ0 A;  2MK3 A;  3X2Q C;  2XOK G;  4GX5 A;  5CN0 A;  4XDJ A;  3FB5 C;  3FKS G;  1R3L C;  1JCH A;  1RPO A;  3ZIA G;  4GT1 A;  3LDC A;  2WLL B;  1QVF U;  2PI5 A;  2HJF C;  1F4M A;  1V54 B;  4FPP A;  5HFM A;  5CBH A;  2R9I A;  2XAG A;  3BEH A;  5B3S C;  1VQ7 V;  2W6J G;  4MTG A;  1QLE B;  2KB1 A;  4LCU C;  1XL4 A;  4UV8 A;  4JAS A;  2WLI B;  4PDL A;  4PA7 A;  4J9Z B;  4RUF A;  3P32 A;  5KUM A;  1K92 A;  1ARO P;  2W6I G;  2ZD9 A;  3ML0 A;  1XL6 A;  2B1I A;  1CP9 A;  2DYR B;  1HWY A;  3GWO A;  4OXS A;  4MVM A;  5CA3 A;  1K34 A;  1G8M A;  3E8F A;  1K5S A;  1K7D A;  1BHB A;  2C2A A;  3CCS V;  4Q20 A;  1R3K C;  3B8N A;  3CCJ V;  1KP3 A;  3K03 A;  4LP8 A;  1VQ4 V;  4P2Z A;  3QNE A;  3ZMZ A;  2H94 A;  1G4Y B;  1R6N A;  4ZKI A;  3RVZ A;  2HKO A;  3ETE A;  2Y48 A;  3JD3 A;  2IJK A;  5LBQ A;  3ZRS A;  1FXK B;  4WFB V;  1K4C C;  3WFV A;  1KD1 W;  1JOY A;  3QO7 A;  5B1B C;  3CCV V;  3OEE G;  1QLN A;  3F7V C;  3SPC A;  2UXX A;  3E35 A;  3OUS A;  4MVU A;  4RAI A;  5EC1 C;  3G6E V;  2BOB C;  2IW5 A;  3VBB A;  1LNQ A;  3JYC A;  2EIN C;  3ZMV A;  3QO5 A;  3CCL V;  2IU3 A;  3AG1 C;  1AJN A;  2OCC C;  1SER A;  2V1D A;  1SRY A;  3AG3 B;  1JQ0 A;  2WSS G;  4GX1 A;  5IDJ A;  5IYC O;  1S0V A;  1N8R W;  5B1N A;  3JD4 A;  4X88 A;  3W7X A;  2X6B A;  1NKD A;  4GX0 A;  3LSQ A;  4PA9 A;  2EIL C;  3OE7 G;  5EC2 C;  3OFN G;  3P30 A;  3JD1 A;  2X6C A;  4XDK A;  2NNU A;  5LGU A;  1QVG U;  5CBG A;  1NJI W;  2IJJ A;  3KG2 A;  3E8H A;  1R6K A;  3CME V;  3CXC U;  3AG4 C;  3E8B A;  1OCC B;  3ABK C;  2ITD C;  2ZXW C;  4JTC B;  2WLJ A;  3E83 A;  1YTF B;  3FYE B;  1PNL A;  1CEZ A;  5FL7 G;  5C93 A;  4JF3 A;  2AHZ A;  4BW5 A;  2DYS B;  3OEH G;  3E2E A;  3CP1 A;  1V55 B;  2WLH A;  4MT8 A;  4DXW A;  4LBE C;  3NXS A;  1NR7 A;  5B1A C;  4TT3 G;  3RBZ A;  1FFT B;  4QJF B;  5IY5 C;  3G4S V;  3ZMT A;  1Q7Y W;  1KKD A;  1VQM V;  3B8M A;  3W7U A;  5EK0 A;  3K06 A;  1M56 B;  2QE7 G;  3E8G A;  3FB7 C;  5L3D A;  3T4Z A;  1ENV A;  2EIJ C;  3LDD A;  1OZ0 A;  5KA5 A;  4MVQ A;  4PDV A;  3ASN B;  4WF9 V;  1GTO A;  2A79 B;  3ABL C;  3VOU A;  3CC4 V;  1VQ8 V;  1NQT A;  3JD2 A;  2EIM C;  3JD0 A;  1JPX A;  2XAH A;  2JEU A;  3K04 A;  1NVP D;  3MHH C;  4UVA A;  2ZR3 A;  1P4R A;  1AI5 A;  1GMG A;  2LP7 A;  2JIZ G;  2JK5 C;  1BL8 A;  2ATK C;  1H8E G;  3A0R A;  5EBL C;  2R9R B;  1OHH G;  4P9P A;  5CBF A;  3CD6 V;  1JVM A;  3K79 A;  1P7B A;  1S3J A;  1NBM G;  1SZT A;  1AI7 A;  3OAA G;  1VQK V;  2F43 G;  4U7O A;  1YSC A;  2QA4 V;  2LFR A;  5B3S B;  3JCZ A;  5LHI A;  4HAM A;  5L3E A;  3SJQ C;  2WLN A;  3OR7 C;  5L3B A;  4JAU A;  1VQN V;  2PI4 A;  4X8A A;  4H37 A;  1RM1 C;  1PKX A;  3CCE V;  5DM6 V;  2Y69 C;  1NH2 B;  1K97 A;  1KP2 A;  4KP4 A;  4HYO A;  4CZZ A;  4TSF G;  2X0L A;  1JX9 A;  3MD0 A;  4P30 A;  2UXN A;  2WLK A;  3ZMU A;  4WFA V;  3CMA V;  1QR8 A;  2H8P C;  2JEX A;  1S5H C;  2LFS A;  1AI4 A;  2IH3 C;  3SYC A;  1E1R G;  1MG1 A;  2JDI G;  1DF5 A;  2ZDI C;  1M90 W;  2WAM A;  4F4L A;  5B1O A;  3EHB B;  2HFE C;  2Z5U A;  1M57 C;  1YIJ V;  3UKM A;  5LHG A;  1GM8 A;  3ZMS A;  1SES A;  2YEV A;  5IYD O;  3WG7 B;  1YJN V;  1RPR A;  4DO2 A;  2EJR A;  3FB8 C;  4EKW A;  5LHH A;  4TWK A;  3W7W A;  2DWE C;  1COW G;  1Y4M A;  1KC8 W;  1Y66 A;  2V7Q G;  5B1B B;  2AHY A;  4LC1 A;  3D3I A;  1YJ9 V;  5EBW C;  3W7T A;  1TUE B;  4R50 A;  5GW7 A;  2HR3 A;  1YTF D;  4MVR A;  4QPJ A;  5BZB A;  1OCO C;  4FK5 C;  1FS0 G;  5EBM C;  2EIL B;  1F23 A;  1KQS U;  3ZN1 A;  2XAQ A;  1W0K G;  5L3G A;  3SPI A;  2DW4 A;  2QKS A;  1SET A;  2JJ2 G;  3UM7 A;  4PDR A;  1K8A W;  1NR1 A;  4UVC A;  1AJQ A;  4MTF A;  4UVB A;  1GO3 F;  1E1Q G;  3AG4 B;  4RQF A;  2JJ1 G;  3ZJZ A;  3ABK B;  4WFF A;  3CCU V;  1OCZ B;  2ZXW B;  1MAB G;  4BIU A;  2GHY A;  2QM7 A;  3CYO A;  2BOC C;  3ETG A;  1VQL V;  3K08 A;  4MW3 A;  4N23 A;  3OGC C;  3F7Y C;  4MW8 A;  1B6Q A;  4MS2 A;  4RO2 A;  5E1A C;  2ZR2 A;  2DYS C;  5B1A B;  1H2G A;  3AG2 C;  4FJC C;  1FXV A;  5IY5 B;  2ZDI A;  3ABM B;  1AR1 B;  2YEV B;  5J9P C;  1DLB A;  5KA6 A;  4UXN A;  3CPW U;  4UV9 A;  4I9W A;  4I5S A;  3SPG A;  1AI6 A;  1OCR C;  2EIJ B;  2EIK B;  3ASO C;  3DTU B;  1ROP A;  1M56 C;  4XDL A;  3W7S A;  3SYO A;  3STL C;  3D36 A;  3ABL B;  3M99 B;  3ZN0 A;  1PNM A;  4JTD B;  3LDE A;  4PA6 A;  1PD3 A;  3HPL C;  2EIM B;  3X2Q B;  2Z3Y A;  4BIZ A;  3SYA A;  2Q69 A;  1Q81 W;  4JPR A;  3K0D A;  1E79 G;  1ZWI C;  3T2M A;  1THZ A;  1H8H G;  4QPK A;  3HB3 B;  2YSU B;  2M7W A;  2P67 A;  1K3E A;  4P9O A;  5H9C A;  3RW0 A;  3LUT B;  2K1E A;  4PEL A;  3DGE A;  1M9N A;  5LGN A;  1V54 C;  3ETD A;  4ZBM A;  2XND G;  5H6R A;  1CPY A;  1R73 A;  1QLE C;  4MVS A;  3ZRX A;  1BMF G;  1I5X A;  2GSM B;  2IJH A;  3CCM V;  1K4D C;  3IGA C;  1RM1 B;  2B1G A;  2Y69 B;  3OMN B;  2A0L A;  3OMI B;  4PA4 A;  1S77 D;  1QBZ A;  1NVP B;  2B5U A;  4YXW G;  4WCE V;  1Q86 W;  1S76 D;  3B77 A;  1VQ5 V;  1KEC A;  4G28 B;  2DYR C;  2FTK A;  5LGT A;  1AJP A;  3EFF K;  2X7R B;  3OMA B;  1W2B U;  1GK9 A;  3F5W C;  3G71 V;  1VQ9 V;  4GX2 A;  1K33 A;  4R8C A;  1I5Y A;  1W0J G;  1YHQ V;  2DWD C;  4JGS A;  5L3F A;  2XAF A;  4JTA B;  1YI2 V;  4N21 A;  4WFG A;  1UJW B;  1M57 B;  2HVJ C;  1EBO A;  1MOF A;  2EZO A;  2QEX V;  3CCQ V;  3SPH A;  1VQ6 V;  2ITC C;  3ZRW A;  4RUE A;  4CBC A;  3K3W A;  1MSW D;  1PNK A;  4GCZ A;  1Q82 W;  1EFR G;  1FXK C;  2Q6A A;  1GKF A;  1VQO V;  1YIT V;  2P90 A;  3WG7 C;  3OUF A;  3SYQ A;  4QE7 A;  1EZJ A;  2EIN B;  4L87 A;  3IFX A;  4MVO A;  3MHS C;  3AG1 B;  2OCC B;  2W0F C;  2HLD G;  4RQE A;  2D3O W;  2CK3 G;  1R3I C;  3T4D A;  3CC7 V;  3ZRV A;  1OCO B;  3AG3 C;  4QNH B;  1F4N A;  1K73 W;  1QR9 A;  4JYC A;  4Z1M G;  2WLL A;  1L1F A;  4HZ3 A;  3TCU A;  4BAY A;  2QTO A;  3LNM B;  3IC7 A;  3ABU A;  4E2L A;  3I55 V;  1WLE A;  1BHA A;  4QE9 A;  1JJ2 U;  4WFE A;  5CMU A;  2OTL V;  2QM8 A;  2WLI A;  1OCC C;  2WPD G;  3E86 A;  3SPJ A;  5IYB O;  4MTO A;  1K5Q A;  4JYB A;  5L3C A;  1VQP V;  3CC2 V;  3FYI B;  3OM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...