1YIJV

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yijV00
4WFBV 3CCVV 1W2BU 3CMAV 1R73A 1VQ6V 3CCMV 4WCEV 3G71V 1NJIW 1KQSU 2OTLV 1N8RW 3CCJV 2OTJV 3CC2V 1KD1W 3CCUV 1S72V 3CD6V 1M1KW 1YJWV 1KC8W 1Q7YW 3I56V 1YI2V 1YIJV 1QVGU 3OW2U 1YJNV 3CCSV 1YJ9V 3CCRV 1Q86W 3CMEV 1JJ2U 1YHQV 4WFAV 3CCLV 1VQ7V 4WF9V 1YITV 1VQOV 3CCQV 1VQPV 1Q81W 1VQ5V 3CXCU 1VQKV 1VQ4V 3G4SV 1VQLV 3I55V 1K9MW 2QA4V 3G6EV 1M90W 1K8AW 1VQ8V 3CC4V 2QEXV 1Q82W 1QVFU 3CPWU 1VQ9V 1VQNV 1VQMV 3CCEV 2D3OW 5DM6V 3CC7V 1K73W
chains in the Genus database with same CATH superfamily
4K35A 4GKKB 4P2ZA 4KUMA 3STZC 4J9YB 4Z1VA 4CBCA 3S3XA 3JAWA 2YXYA 1S72V 2JVDA 2WLMA 1D2DA 3JARA 1AB3A 4PV1B 4FLVA 3AG3B 4G28B 5IYCO 4Q20A 3P3NA 3OTOO 3FB8C 3OTOB 5IY5B 3SJBC 4FLTA 1OCZB 4LF5O 4LF5B 2EULA 2E75B 3UT5B 4P9OA 4X20A 2OTJV 3SR2C 5DN6G 4LWSA 4MVOA 1H2KA 3C90A 4JI7O 4JI7B 5H9CA 2HP8A 3KCXA 2R72A 1NH2B 1TUEB 3ABMB 3JD2A 2DOSA 2XTAA 3QVNA 1VQ6V 1IBMB 1ZL8B 4U7NA 1ZUQA 5KA5A 3T4ZA 2KKWA 2Q9LA 4OX9O 4OX9B 2BTQB 3RN4A 1I5YA 3U0ZA 3RVYA 2PI5A 4R8CA 4JF3A 1Y74B 1QBZA 4FFKA 1ZAUA 4O4LB 1XMQO 1XMQB 2Z0AA 5B66Z 2LFRA 3DSQA 5EBMC 5B1AC 4JTCB 1A32A 3ZRWA 1NTZH 3JALB 2JRIA 1L0NH 4X1KB 4RO2A 2E76B 4UB8Z 2XAQA 5BY1A 3W7UA 4CH3A 1RPOA 5JJJB 1KB9F 1MOFA 4MSWC 3ZMUA 2UUBO 1LUWA 2FL4A 3IC9A 2W0XA 4ZIBA 2DJVA 2QR4A 3BA8A 1MA1A 5CBGA 2AHYA 3QO5A 1RSOB 1HW7A 3ETDA 2YIDA 2OYQA 4Z2WA 5LOVB 2GDSA 1K5QA 1IBKB 1IBKO 2P06A 1FXVA 1FS0G 1GM9A 5IE9A 1E1RG 5LMNO 5LMNB 3FB6C 3EVKA 2CK3G 3FYIB 3K5OA 4BR6A 1VQLV 2VRZA 1GH6A 3JAWB 4I9QA 4MVSA 2AZ2A 3CRRA 1OV9A 4J80A 2B9ZA 3JARB 3MDSA 4BIZA 4DUZO 4DUZB 2DE0X 4UV8A 1F7YA 5EYPA 2B1IA 2RNBA 1PKXA 3E8HA 4MVQA 2QM8A 3A8TA 1VQPV 2DQ3A 2QJ1A 4X20B 3LSUA 1XNQO 1XNQB 1I08A 4LWSB 5KMGA 2Q4PA 2R9AA 5BXZA 1VF6C 5L3DA 4ZHQA 4YY3O 1Q7YW 2JEXA 3CRMA 4E4EA 1OZ0A 4O2BA 1MZEA 3OEHG 4LBEC 1K9MW 4B3MB 4B3MO 1N36O 1N36B 1MG1A 1G6UA 3AG3C 3ZS8C 3G71V 1WNSA 2ADPA 2IJKA 4UCRA 5DEDA 5LL6Y 1RM1B 4DV5O 4DV5B 4DR2O 5H6QA 1EN5A 3CCUV 5IY5C 4L87A 2B1GA 3D36C 3ETGA 4TSFG 4ZI7A 5B1BB 1AJPA 2A3QA 4WF9V 1H38A 3ZRWB 4KP4A 4DV3O 4DV3B 4JI4O 4JI4B 1SERA 1P49A 4R50A 1VQ9V 3HR0A 2KQXA 3IAYA 3J7AU 2UXCO 2UXCB 5KHJA 4GX0A 4HAMA 3ABMC 1SC5B 1AR5A 2GSMB 5IWAO 5IWAB 2IBZH 1YF2A 3ZIAG 2EBOA 2YDEA 3NXSA 4IHJA 1NKDA 2YI8A 3SPGA 2N74A 1V54B 2EILC 4DR1B 4O4JA 1BCCH 5EIBC 1WB7A 2ZIMA 2PYJA 2WLIA 2F95B 3T2MA 2IW5A 4JASA 1P84F 3OE7G 1VQOV 4FLWA 5KA6A 3GWKC 1R6NA 4RWUA 1EZJA 2VWKA 5LGTA 4YIPA 3AK1A 2YIAA 4IGGA 1WA8A 1GN2A 1FYJA 3T1YO 3HKEA 5EYPB 4LCUC 4FLUA 2ZE6A 4UCVA 3WFVA 5IT9N 2WPDG 3ZBHA 1XMOO 1XMOB 3ABLB 1PV0A 3DC5A 1YJNV 3GB7C 2QGNA 3IC7A 4XDKA 5KMGB 4MTFA 2QM4A 2VQFO 2VQFB 4J41A 1BS3A 4ZHQB 1SESA 4RQFA 2B5UA 4ZOLA 5A9GA 1CEZA 4O2BB 3F5TA 4AQYB 1LUVA 4QGPA 5F2VO 4GKJB 4GKJO 2ZINA 5KHHA 4UFZA 3K04A 4K8XA 1H2NA 4MVUA 4WFAV 5BZBA 2YIBA 3JATA 4DK0A 2WAMA 5J2TA 4LF6O 3SYPA 2GTSA 3CC7V 1YDXA 4JZ2A 4ZI7B 3LNMB 3CX5F 2W0FC 1GK9A 4QPKA 2DYRC 1F4MA 3U11A 3H9VA 2DYSC 1SZXA 2ILMA 1F23A 4B7KA 2WLHA 2QKCA 3ZHVA 3G6BA 4FM0A 4OGQB 2NN4A 1K4DC 1R6KA 3CP1A 2YC0A 4LFCO 4LFCB 2QEXV 1SQQH 1S0VA 1CXZB 1VEWA 2L6LA 2P90A 2RCVA 3CC2V 1M1KW 4IHJB 5L3FA 5CB4A 2UUAB 4N21A 5LYJA 3WG7B 5EK0A 4O4JB 1K4CC 1G8MA 2ZE5A 3T4DA 2D2CB 4LF8O 4LF8B 1AI5A 5B1BC 3OR7C 3K9SA 2P67A 3B40A 2WLIB 2Q73A 4QJFB 1SZTA 2Q67A 3CRCA 4TWKA 2QWQB 4B3SO 2P22C 3P32A 2E74B 2QWPB 4PDMA 1WA8B 2LP7A 1VQ4V 3K59A 3HKEB 2QA4V 3QO7A 2ZE7A 3VBBA 2ZR3A 2Q0AA 1DF5A 1S5HC 1R73A 3P30A 2HKOA 3W7XA 1BQZA 1GTOA 4JTAB 1V54C 1AJNA 3SJQC 1SA0A 3CCLV 4ZOLB 1ZWIC 4DR4O 4DR4B 3RYIA 1BHBA 4GYCB 2BE3A 1K97A 1Q82W 4DV1O 4DV1B 4FMTA 3AG1B 2UXDO 2UXDB 1TA8A 3ETQA 3W7WA 4DV7O 4DV7B 3KG2A 2ZDIA 2XOKG 1AI6A 1GO3F 1NTKH 1RP3B 1RFYA 1PL0A 3JATB 1BMFG 4UVBA 5J2TB 5H5NA 1YJ9V 4H44B 1KMIZ 2E3CA 1J5EO 1J5EB 3ABLC 2K1EA 4LFBO 4LFBB 2A0LA 3STLC 5KHKA 3W7TA 1WP7A 1XHZA 3H1HH 3K79A 1JCHA 1UFIA 4J7KA 3TGUH 1LR1A 4J7ZA 3M99B 5JH7A 1ZLZA 3HPLC 1Q86W 2ZNIA 5B1AB 4PELA 3SYOA 4I4TA 1I94O 2IJIA 3BEHA 1I94B 1DK1A 4YJ2A 4G2KA 4I9WA 3CXHF 2WLLA 3AG4C 1D5AA 5BR8B 2IJHA 4EFBA 5FLXN 1JX9A 4X8AA 3K03A 5CB4B 5LYJB 1AR4A 5LHHA 5BMVA 1L1FA 1W0JG 4Z1MG 1QVGU 4FIPC 3JSLA 4DW1A 5L3BA 4EFEA 1IXMA 3IFXA 1VQNV 3QNEA 4B08A 4D7TA 1BGYH 3CMAV 4H13B 2X6BA 3O9OA 1ZSPA 3K0GA 3BFRA 4NTXA 2IM9A 3B8NA 3VQXA 3B77A 2UUCO 2UUCB 2JJ2G 2CTWA 3CSXA 3FKSG 4JI6B 4JI6O 1US6A 4X65O 4X65B 4QPJA 1Q81W 2K9PA 3CWBH 4HZ3A 1WLEA 2GHYA 1LNQA 2Q5ZA 2EIJB 1Y4MA 3WG7C 4EB6A 1M4UA 1CPYA 4X1IA 1SA0B 1Z2GA 4WBNA 4IYIA 2Y4UA 3UO3A 1DF4A 1OCCC 3CB2A 3RYIB 3VQVA 1DLBA 2A06H 4LC1A 1XL6A 1Z5WA 5LOVA 2H3OA 4DR5B 4R7CA 5CN0A 2E5LO 2E5LB 1M93A 3K08A 2VWJA 4JGSA 2DMXA 3CYOA 4DRXA 4GKKO 3OTFA 4PDLA 3QG5A 1AP5A 1X59A 5EC2C 5CA3A 1WPXA 4OXSA 2CH7A 3L75H 3LSSA 5B5EZ 2OCHA 3ZCCA 2P7TC 5EC1C 2YUAA 4IL6Z 2A79B 3HKCA 1ZX3A 4H37A 3A0HZ 3CCVV 1R3KC 2OIEA 5JH7B 4LF7B 3GVMA 2UXXA 2GUZA 3RFRA 1NR1A 4I4TB 4YJ2B 5FL7G 1KC8W 2WLLB 3KKYA 3AG1C 3WB1A 1GKFA 2DN9A 1CP9A 2XT9A 1S76D 5KHIA 5KUKA 1VQ5V 4A5UB 3BHPA 3K06A 5BMVB 2BOBC 2KG7A 2V1DA 1H2SB 2PTMA 4MT8A 4PA4A 1Z5VA 1IBMO 1VIBA 2ADQB 3ZMVA 3N27A 3T1CA 3I56V 3ASOB 2RN9A 1BL8A 1XOUA 3ETEA 5GONA 4TV9A 2EILB 3UQ8A 4TT3G 1MMMA 1FFTB 4XDLA 3F7YC 3RWRD 4NXNB 1E1QG 4IIJA 1QR8A 4DXWA 1PL4A 3KZIZ 5AG2A 3ZN1A 1MNGA 2R9RB 1YHQV 1Q3EA 5J9PC 2QWNB 4EB6B 1FKAO 4X1IB 1M57B 4WBNB 3F7VC 1VQMV 4UXNA 4PA9A 3LDDA 1PNMA 4PD4F 1NJIW 2BTOA 1XEQA 1M5IA 5FPRA 3C3TA 4U3JA 4DRXB 1AJQA 4JTDB 2R70A 4JI5O 4JI5B 2CTRA 2CH7B 1NH2D 1IBLO 1IBLB 1BZKA 3D3QA 4K8ZA 1M9NA 1E79G 2EIJC 1F4NA 4ZBMA 3HKCB 4MTXA 4E2LA 2DQ0A 4N23A 4PA7A 1R3JC 1V9PA 2PF4E 2GUZB 2QWOB 3VOUA 1HP8A 1R1BA 5EZYA 4KFMA 2DYRB 2OIGA 2DYSB 2ZDIC 1XILA 5EIBD 1XDCA 2JK5C 4IT5A 2KG7B 2HHHO 2HHHB 3RW0A 4FM2A 3E2EA 5LXTA 3JASA 2QDOA 2YXLA 4F6RA 1GN4A 4CS4A 1M56B 4GX2A 1K33A 3ML0A 2OTLV 2EX3A 4CH4A 4NTYA 1K7DA 2ARHA 5GONB 4TV9B 4JPRA 4NB5A 1ORQC 3BAAA 4MTOA 1RPRA 3CRQA 2AZ0A 1FD9A 1QQCA 4RAIA 1S5JA 2P5OA 4JAUA 4OPHA 1PPJH 3ZHQA 2X6AA 3L71H 4IIJB 4I5SA 4I55A 3ZX6A 1BT8A 4Q6GA 2WLJA 4I0XA 5H6RA 1QNMA 4WFEA 3J81N 4TQFA 3L72H 3K58A 1K3EA 3K9AA 4YIOA 3OMNB 3SJCC 3TXSA 4JI1O 1W0KG 3ASOC 4JI1B 3MD0A 1K8AW 4W4LA 4X62O 4X62B 4QE7A 4DR1O 1WAZA 3OMIB 3G67A 3G80A 4DUYB 4BAYA 4U3JB 1FXHA 5E79Z 1KD1W 1NVPB 4FZ0A 4MVRA 3K5LA 3B09A 4CC5A 1JVMA 2JGDA 4KL1A 5KLVH 2Q0OC 1IDSA 2XNDG 3BA9A 3JD3A 3SPJA 4FFBA 2IH3C 4GUNA 1SQPH 2R9IA 3ZEDA 1SRYA 2IU0A 2WLNA 1SQVH 1M57C 1UJWB 3OGIB 1KYOF 4YHHO 4YHHB 1AI7A 1KP2A 3K5MA 5KAFZ 3R66A 5EZYB 1KKCA 4RQEA 3FD9A 2ZIOA 1SQFA 3CEIA 3T1HO 3T1HB 2M6YA 2H8PC 3B2EE 1TUBA 4QIWF 1XUQA 1XHXA 2UXBB 1N8RW 5C93A 1AP6A 3VQWA 4BW5A 1H2LA 2ATKC 4AQYO 5LXTB 3JASB 3TCUA 2F43G 4F6RB 4X66O 4X66B 2OT5A 4CH6A 1J95A 1HNWB 3AG4B 4PA6A 1HWYA 3RGBA 1N34B 1N34O 3WB0A 1PP9H 1YSCA 4LH6A 1SETA 1JQ0A 1OCRB 2YXHA 4DV2B 1KBHA 1U97A 2FMLA 4YXWG 2GTAA 1QHTA 3ABKC 4UUJC 3ZRXA 1URFA 3WU2Z 1WN7A 3DXRA 4P30A 5K1XA 4PHZA 4I55B 4D6TH 1YEWA 5B1NA 2PI4A 5LA6A 4DR6O 1NVPD 1VARA 4DR6B 4I0XB 1BQ0A 1L8DA 3ASNB 3RVZA 1GN6A 3AEIA 3FB5C 2XAHA 1EM1A 3FYEB 2F23A 1OCOC 4LF9O 4LF9B 4L8JA 3CCJV 1YXBA 1M56C 2EZOA 3H1KH 5IYZA 1KECA 3CJHA 4JAAA 2UUAO 2QSAA 1EZVH 2CE4A 2NLJC 2AXTZ 3ZJZA 2V4DA 5JVDA 1OCCB 4JYCA 1N32O 3ZN0A 1N32B 3ZMTA 2JGDB 3DTUB 5E1AC 2FTKA 3P3PA 2WA3A 3APQA 4FFBB 1XI1A 2X6CA 4RUEA 4AILC 2LW7A 3M8AA 4LFAO 4LFAB 3L9DA 3ZHRA 1IZ3A 3OGCC 4HNAA 2D3OW 3UKMA 1YCIA 1OJHA 3HKBA 2BCCH 2ZCEA 1W59A 4C7UA 2DW4A 2W6JG 3CMEV 3NR7A 2ZE8A 4MTGA 2HLDG 4BW9A 1TUBB 5HFLA 3OUSA 2XAGA 4X64B 5K1PA 3G4SV 1QCEA 2QTSA 1YTFB 1TAEA 5DECA 1IVSA 4GCZA 3A2FA 4DV0O 4DV0B 1YJWV 1L0LH 4PA3A 1SKVA 1HNXO 1HNXB 2QE7G 5B1OA 1SQGA 2FKXA 1PNKA 5FNVA 3ZHSA 4EEQA 5LGNA 3A0BZ 1AILA 1QLEC 5LP6A 3QO8A 4CS2A 3DXRB 3JD0A 4B3TO 4B3TB 2DWDC 5IJ9A 1SQBH 4X9QA 3RYFA 3J80N 2RMKB 1EN4A 1F51A 5LA6B 2HEPA 4NKGB 4LNUA 4LF4O 4LF4B 2JS5A 2UU9O 2UU9B 4LR3A 5B3SB 1N0NA 2Z5UA 2Y0IA 5IYZB 5BR8O 3LSQA 2RQ6A 4DV6B 1EFRG 3CJHB 3AK3A 1Q6IA 1OCRC 3GWOA 3L70H 2X7RB 3TETA 4X88A 1WP8A 1KUQA 2QTOA 1VF5B 5JVDB 1WB8A 4DYLA 3JAKA 4K3AA 3N2KA 3CC4V 2AHZA 2ZNJA 3DC6A 4FZ1A 1B6QA 2IU3A 4PDVA 2MW2B 3ASNC 5D5QA 2ZXWB 1YTFD 1QU7A 4KHPB 1GN3A 3W7SA 1HR0O 1HR0B 1GM7A 4HNAB 4J7JA 1NBMG 2YIBD 1M90W 1H8EG 4FM1A 2JIZG 1VMGA 1NR7A 1HNZO 3HKBB 2HR3A 4F6EA 1HNZB 3ABUA 4WFBV 3MHHC 1P7BA 4GX5A 3CHXA 3AG7A 3R65A 3EFFK 4DR5O 3FB7C 4FLZA 3UO2A 3B4SA 1NZ6A 4MW3A 4UB6Z 5CA1A 1SS3A 4CS3A 2L35A 2XASA 3TK1A 3AG2B 3APOA 4P9PA 5KAIZ 2PUSA 2WLKA 1P7GA 5FNVB 4GT1A 2OCCB 5LP6B 4R6ZA 5IJ9B 2EIMC 4B3RO 4B3RB 3RYFB 1MSDA 2JDIG 3OR6C 3D8CA 3B8MA 4CH5A 4WFHA 3MHSC 1N0JA 2N05A 4LNUB 5IDJA 3E35A 4UCTA 4LF7O 1G4YB 4DW0A 1G1XB 3ZMZA 5LHIA 1VF7A 2YI9A 3K5NA 3ZMSA 3OM3B 5EBLC 3FFQA 2O57A 1WPBA 2JGUA 2V7QG 1KQSU 5IYDO 2BOCC 4IYHA 5CA0A 1ZTEA 3AK2A 3SPCA 3JAKB 1BE3H 3N2KB 4J9ZB 3RYHA 4H0LB 2QM7A 1JJ2U 5A2QN 2GBOA 1XL4A 4F4LA 3CXCU 1UPGA 1I5XA 1KKDA 2WWWA 3OD4A 1AI4A 3Q4HA 2LQTA 4RUFA 3ZHUA 5B3SC 4LP8A 4NXNO 3BVOA 5GW7A 2EJ7A 1GAXA 2A9HA 3LUTB 4O4HA 2ZR2A 4HBNA 3CD6V 3OT7A 4QE9A 2Y48A 4LH7A 1MZFA 4X1YA 3ABTA 2AW9A 4JAVA 4WFGA 1Y67A 4I7ZB 5JWPA 3X2QB 2Z3YA 4GZRB 4I50A 2ZT9B 4AI8A 1FFXA 1X4TA 2XUMA 1QLNA 2ETNA 3A0RA 5KUMA 2EZPA 2UUBB 2ZXWC 1XREA 1TVKA 4GX1A 1SF9A 5CA1B 3E83A 3JYCA 2HFEC 2Q6AA 4JYYA 5L3EA 2Q7HA 1MABG 4JV5B 4JV5O 4FLYA 4MVZA 2ZQMA 1B06A 3ABKB 1WJZA 3BRCA 3JD4A 4DK1A 4X89A 3LDEA 3CCEV 2OWOA 2AGAA 1O9GA 3S3WA 4U7OA 2UXNA 2XAJA 4FPPA 3ZRVA 2PZSA 4J10A 1JOYA 4W4KA 4UCUA 3OEEG 3AG2C 3VQYA 3RT3C 1OCOB 1AVMA 5CA0B 2EIKB 2OCCC 1FJGO 1FJGB 5LP6C 2CAZC 3RYCA 5LGUA 2QKAA 3RYHB 3E8FA 3RBZA 3H1IH 1R3LC 5JQGA 2CUGA 4YY3B 1N4CA 5JCOA 2N04A 1AROP 3C3SA 2LGWA 4CZZA 4O2AA 3Q4HB 1V55B 1KU9A 4JZGA 4O4HB 5JJNB 3CS5A 2Y4TA 5DM6V 1Q43A 2WA4A 2G38A 1HDJA 4X1YB 2QWRB 4DR2B 3PJSK 5GTIZ 1OCZC 2HVKC 3BPZA 2ITCC 4HYOA 2PYLA 4NVPA 4JI2O 4JI2B 2GV9A 3F5WC 4I50B 3JAMN 2JJ1G 3QTCA 1H8HG 4JI3O 4JI3B 1FFXB 1GMGA 3ZRSA 3WB2A 4XBFA 4JYBA 1Q6HA 1K92A 2ITDC 4ICGA 4DUYO 3D3IA 4CC6A 1TVKB 1MSWD 4TQDA 1JMKC 2LO1A 2YS8A 4YJ3A 3N2GA 3MAQA 4UVCA 1T5EA 5CMUA 1K5SA 2BSKA 3KCYA 3TXQA 4J11A 1D5NA 2ODMA 2RDCA 4FJCC 1S5LZ 3H1LH 3X2QC 3JSNA 2HVJC 2W6IG 3FAVA 4MW8A 2P4VA 4J42A 5FPOA 3LNNA 1FXKA 1PM9A 3E86A 1QLEB 1FPOA 2Q7GA 2QKSA 5IJ0A 4DV4O 4DV4B 4PI2A 4DR3O 4DR3B 3HKDA 3T1YB 4WCEV 3U10A 4TUYA 2Y69B 2UXBO 5KX5A 2P4KA 1JPXA 2PY5A 4B7EA 1NU1H 2YEVA 2KB1A 3CE2A 3JCUZ 4DO2A 2HG5C 1HNWO 3RYCB 3L73H 5J2UA 1YITV 3DGEA 4TOIA 5CBFA 1COWG 3OMAB 3G6EV 2JEUA 4DV2O 5JQGB 1GM8A 1PD3A 4JI0O 1P4RA 4JI0B 4FVMA 1EBOA 4O2AB 3ICXA 2EINB 2Q8VA 2M7WA 1I0HA 2WSSG 1GRJA 2LFSA 2FB5A 1ROPA 1AR1B 4JI8O 4JI8B 1Q8IA 4U3FH 2H94A 2JS3A 1O9HA 4XDJA 2XHBA 4LF6B 1ENVA 4KXRA 3IGAC 1YZBA 2F1MA 1R6TA 2EIKC 4NR1A 1BHAA 3E22A 3I5DA 2F66C 3OAAG 1R3IC 5TISZ 2ZD9A 3H01A 3SPIA 1JR9A 3H1JH 4G27B 4NYKA 4PJ0Z 4NTWA 1V55C 1IURA 3SPHA 4YJ3B 1Y6XA 1H2MA 3N2GB 5GTHZ 1JJOA 1S77D 4OPAA 1Y76A 2KSDA 4H33A 5L3GA 3CCRV 2BSKB 1RM1C 3BY6A 1S3JA 4ABMA 3BABA 1DGSA 3QF7A 3I55V 4UVAA 3FAVB 3SYAA 5LBQA 1Q5OA 2CGNA 1K73W 2Y0PA 1NS1A 1FXKB 1XQ8A 2CTQA 5C8YA 4PI0A 5IJ0B 2YSUB 4O4IA 4B3SB 1EN6A 1NQTA 1YI2V 4FK5C 2EIMB 1NT2B 2ZKOA 3HKDB 1JFFA 5ITZA 4FLXA 4MS2A 5LMUO 5LMUB 4EKWA 4TUYB 4X64O 5KX5B 3M7MX 3JD1A 3CPWU 2YEVB 2NR5A 2CDYA 2CGOA 1KP3A 4BIOA 4GLXA 2IH1C 4NXMO 4NXMB 5J2UB 3PN1A 3K57A 1QR9A 4TV8A 5D5PA 1N33O 1N33B 4UCOA 5EBWC 1VQKV 1H2GA 1TGOA 3UM7A 2Q69A 1XNRO 1XNRB 5JJEB 2X0LA 4UV9A 1VF6A 2Q68A 1NI8A 3SYQA 2Y69C 1SQXH 3K0DA 3JCZA 2NNUA 3UCSC 1Q90D 3EHBB 1I7FA 3E22B 3IJ4A 3ZHTA 2DWEC 2VQEO 2VQEB 3FX7A 4DV6O 1VP7A 2F93B 1XBLA 5L3CA 1IX9A 3O65A 1PNLA 2Q7EA 2LGQA 3D36A 5JCOC 3CCSV 2EINC 3UT5A 1K34A 2HJFC 4MVMA 3BCCH 1JA8A 3SDLA 5KHGA 2C2AA 3L74H 1QVFU 2VS0A 2LJ2A 3K3WA 4WFFA 1W2BU 1NTMH 1Y76B 4DR7O 3SJAC 4DR7B 4KHPO 3HB3B 5HFMA 1ZL8A 2CTPA 3EXAA 1B3QA 3THOA 1BSMA 5H2FZ 1VQ7V 2ZM6O 2ZM6B 2BTQA 2HJDA 5C8YB 1YVWA 2MK3A 4O4IB 1Y74A 1B04A 4ZKIA 3CCMV 5IYBO 2FYUH 4O4LA 1FAFA 2F4VO 2F4VB 1OHHG 1JFFB 5ITZB 4BIUA 1U96A 3E8GA 3JALA 4ASUG 4X1KA 3SGIA 3OUFA 1Q6UA 1THZA 2LW1A 4JYAO 4JYAB 3OFNG 2IJJA 4PDRA 5LHGA 4K0KO 4K0KB 4TV8B 4UCSA 1Y66A 4QNHB 3TJTA 4BWAA 3SYCA 3CRAA 1RSOA 3LDCA 3E89A 1YIJV 1FXKC 3OW2U 4AHCA 2EJRA 1IXBA 2YICA 2PGGA 4D7SA 2A7WA 3E8BA 2RJZA 3CCQV 5CBHA 1DTOA 2P6JA 1VQ8V 2XAFA
chains in the Genus database with same CATH topology
2H8PC 3AG1B 4QIWF 3W7WA 4P2ZA 4KUMA 4U7OA 3KG2A 3STZC 2ZDIA 1N8RW 2XOKG 4J9YB 5C93A 4CBCA 2UXNA 1AI6A 1GO3F 2XAJA 2ATKC 4FPPA 3ZRVA 4BW5A 1S72V 1PL0A 3TCUA 1BMFG 2F43G 2WLMA 4UVBA 2OT5A 1JOYA 1J95A 1YJ9V 3AG4B 4PA6A 1HWYA 3AG3B 3OEEG 3AG2C 4G28B 5IYCO 1YSCA 4Q20A 3ABLC 1SETA 1JQ0A 1OCRB 1OCOB 2K1EA 3FB8C 2EIKB 2OCCC 4YXWG 2A0LA 3STLC 5IY5B 5LGUA 1OCZB 3W7TA 3ABKC 3E8FA 3K79A 3RBZA 4UUJC 3ZRXA 1JCHA 4P9OA 1R3LC 2OTJV 5DN6G 4P30A 3M99B 4MVOA 1AROP 3HPLC 4CZZA 1Q86W 5H9CA 5B1NA 5B1AB 2PI4A 4PELA 3SYOA 2IJIA 3BEHA 1NVPD 1NH2B 4G2KA 1V55B 4I9WA 2WLLA 3ASNB 3RVZA 3FB5C 3AEIA 1TUEB 3ABMB 3AG4C 3JD2A 2XAHA 2IJHA 5DM6V 3FYEB 1JX9A 4X8AA 3K03A 1VQ6V 1OCOC 4U7NA 5KA5A 5LHHA 3T4ZA 3PJSK 3CCJV 1M56C 2EZOA 1L1FA 1OCZC 2HVKC 1W0JG 2ITCC 1KECA 4HYOA 4Z1MG 1QVGU 1I5YA 3RVYA 4FIPC 2PI5A 4R8CA 4JF3A 3F5WC 1QBZA 5L3BA 1IXMA 2JJ1G 2NLJC 3IFXA 2LFRA 5B1AC 1H8HG 5EBMC 3ZJZA 1VQNV 4JTCB 3QNEA 1OCCB 4JYCA 1GMGA 3ZN0A 3ZRSA 4XBFA 3ZMTA 4JYBA 3CMAV 3ZRWA 2X6BA 1K92A 2ITDC 3K0GA 4RO2A 3DTUB 3D3IA 5E1AC 2FTKA 2XAQA 1MSWD 3W7UA 3B8NA 3B77A 1RPOA 2JJ2G 1MOFA 4MSWC 3FKSG 3ZMUA 2X6CA 4QPJA 1Q81W 4RUEA 4UVCA 4HZ3A 1WLEA 5CMUA 1K5SA 2GHYA 1LNQA 2D3OW 3OGCC 5CBGA 2EIJB 3UKMA 1Y4MA 2AHYA 3WG7C 3QO5A 4FJCC 3ETDA 1CPYA 3X2QC 2HVJC 2W6IG 1DF4A 1OCCC 4MW8A 1K5QA 1FXVA 1DLBA 4LC1A 1FXKA 2DW4A 2W6JG 3CMEV 1FS0G 1XL6A 1GM9A 3E86A 4MTGA 1E1RG 1QLEB 2QKSA 2HLDG 3FB6C 4R7CA 2CK3G 5HFLA 3FYIB 3OUSA 2XAGA 3G4SV 5CN0A 1VQLV 1QCEA 1YTFB 3K08A 4MVSA 4JGSA 3CYOA 4WCEV 2Y69B 4GCZA 4BIZA 4PDLA 1JPXA 1YJWV 5EC2C 2YEVA 2KB1A 4UV8A 1WPXA 4OXSA 4PA3A 4DO2A 2HG5C 5CA3A 2QE7G 3LSSA 2B1IA 5B1OA 3E8HA 1PKXA 3ZCCA 2P7TC 5EC1C 1YITV 4MVQA 2QM8A 3DGEA 1VQPV 5CBFA 1COWG 3OMAB 1PNKA 3G6EV 2DQ3A 2JEUA 5LGNA 2A79B 1GM8A 1QLEC 3QO8A 4H37A 1PD3A 1P4RA 3JD0A 3CCVV 2DWDC 1R3KC 1EBOA 2UXXA 2EINB 1NR1A 1F51A 5L3DA 2M7WA 5FL7G 1KC8W 1Q7YW 2WLLB 3AG1C 1GKFA 2WSSG 1CP9A 2JEXA 2LFSA 1S76D 1ROPA 1AR1B 1OZ0A 5KUKA 5B3SB 2H94A 1VQ5V 4XDJA 3OEHG 4LBEC 1K9MW 2Z5UA 3K06A 1MG1A 2BOBC 1ENVA 2V1DA 3AG3C 3LSQA 3IGAC 1EFRG 4MT8A 4PA4A 3G71V 1OCRC 3GWOA 2EIKC 2IJKA 1RM1B 2X7RB 3TETA 5H6QA 1BHAA 3ZMVA 3CCUV 5IY5C 4X88A 4L87A 3T1CA 2B1GA 3I56V 3OAAG 3ASOB 3ETGA 4TSFG 2QTOA 1R3IC 1AJPA 1BL8A 5B1BB 3ETEA 4WF9V 2ZD9A 1H38A 3H01A 3SPIA 3ZRWB 2EILB 4KP4A 1SERA 4TT3G 3CC4V 1FFTB 4XDLA 4R50A 1VQ9V 3F7YC 4G27B 2AHZA 1B6QA 1E1QG 1V55C 2IU3A 4PDVA 3SPHA 3ASNC 4GX0A 4HAMA 3ABMC 1QR8A 4DXWA 2ZXWB 1YTFD 2GSMB 1S77D 3W7SA 5L3GA 4H33A 3CCRV 1RM1C 3ZN1A 3ZIAG 1GM7A 3BY6A 2R9RB 1S3JA 2EBOA 1YHQV 5J9PC 1NBMG 3NXSA 3I55V 1M90W 1M57B 4UVAA 1NKDA 1H8EG 3F7VC 2JIZG 3SPGA 1NR7A 3SYAA 1V54B 4UXNA 2HR3A 4PA9A 5LBQA 1VQMV 3LDDA 2EILC 3ABUA 4WFBV 1K73W 1PNMA 1FXKB 1NJIW 3MHHC 1P7BA 4GX5A 2YSUB 1NQTA 1YI2V 4FK5C 2WLIA 2EIMB 3T2MA 2IW5A 3R65A 4JASA 3EFFK 3OE7G 1VQOV 4MS2A 5KA6A 3FB7C 4EKWA 1R6NA 1AJQA 4JTDB 1EZJA 3JD1A 3CPWU 5LGTA 4MW3A 2YEVB 1NH2D 1KP3A 4LCUC 1M9NA 1E79G 2IH1C 2XASA 3TK1A 3AG2B 3WFVA 2EIJC 4P9PA 2WPDG 1F4NA 3ABLB 1QR9A 2WLKA 1YJNV 4GT1A 3GB7C 2OCCB 4ZBMA 4MTXA 5EBWC 4E2LA 3IC7A 4XDKA 2DQ0A 4R6ZA 2EIMC 4N23A 4PA7A 1R3JC 4MTFA 1VQKV 1H2GA 3VOUA 2JDIG 3OR6C 1SESA 4KFMA 3B8MA 4RQFA 2B5UA 4WFHA 3MHSC 2DYRB 3UM7A 2Q69A 1CEZA 5IDJA 3E35A 2DYSB 2ZDIC 2X0LA 4UV9A 1G4YB 2JK5C 2Q68A 3ZMZA 3K04A 5LHIA 3SYQA 2Y69C 3RW0A 3ZMSA 3E2EA 4MVUA 4WFAV 3K0DA 3OM3B 3JCZA 2NNUA 5EBLC 5BZBA 3EHBB 2WAMA 1M56B 3SYPA 3CC7V 2V7QG 2DWEC 4GX2A 1K33A 1KQSU 5IYDO 2BOCC 3ML0A 2OTLV 3LNMB 5L3CA 1K7DA 2W0FC 1GK9A 4QPKA 1PNLA 4JPRA 2DYRC 1F4MA 1ORQC 3SPCA 4MTOA 1RPRA 3D36A 4J9ZB 2DYSC 1F23A 3CCSV 4RAIA 2EINC 2QM7A 1K34A 2WLHA 4JAUA 1JJ2U 2HJFC 4MVMA 2X6AA 1XL4A 4F4LA 3CXCU 1K4DC 1I5XA 1R6KA 2C2AA 2WWWA 3CP1A 4I5SA 1KKDA 2QEXV 1QVFU 1AI4A 4RUFA 3K3WA 5B3SC 2WLJA 4WFFA 4LP8A 1W2BU 1S0VA 5H6RA 5GW7A 2A9HA 3LUTB 4WFEA 2P90A 3CC2V 2ZR2A 3CD6V 4QE9A 1M1KW 1K3EA 3K9AA 2Y48A 3HB3B 5L3FA 5HFMA 3ABTA 4N21A 4JAVA 4WFGA 1VQ7V 3WG7B 5EK0A 3OMNB 3X2QB 1K4CC 1W0KG 3ASOC 3MD0A 1G8MA 1K8AW 2Z3YA 3T4DA 1AI5A 5B1BC 3OR7C 2MK3A 2P67A 4ZKIA 2WLIB 4QE7A 3CCMV 5IYBO 3OMIB 1OHHG 4QJFB 4BAYA 1SZTA 1FXHA 1KD1W 1NVPB 2Q67A 4MVRA 4BIUA 4TWKA 1QLNA 3A0RA 5KUMA 3E8GA 2EZPA 3P32A 1JVMA 4ASUG 2ZXWC 3OUFA 2LP7A 2XNDG 4PDMA 4GX1A 3JD3A 3SPJA 1VQ4V 1THZA 2IH3C 2QA4V 3QO7A 2R9IA 3E83A 3JYCA 3OFNG 3VBBA 2ZR3A 1SRYA 2IJJA 4PDRA 1DF5A 5LHGA 1S5HC 1R73A 1Y66A 2IU0A 2WLNA 2HFEC 2HKOA 2Q6AA 3P30A 1M57C 4QNHB 1UJWB 3W7XA 1GTOA 4JTAB 5L3EA 1V54C 1MABG 1AI7A 1KP2A 3SYCA 1AJNA 3LDCA 3E89A 3SJQC 1YIJV 1FXKC 3OW2U 2EJRA 4MVZA 3CCLV 1ZWIC 3E8BA 3CCQV 5CBHA 2ZQMA 1BHBA 4RQEA 3ABKB 3JD4A 1DTOA 2P6JA 1VQ8V 1K97A 4X89A 1Q82W 3LDEA 3CCEV 2XAFA 4FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  3CCV V;  1W2B U;  3CMA V;  1R73 A;  1VQ6 V;  3CCM V;  4WCE V;  3G71 V;  1NJI W;  1KQS U;  2OTL V;  1N8R W;  3CCJ V;  2OTJ V;  3CC2 V;  1KD1 W;  3CCU V;  1S72 V;  3CD6 V;  1M1K W;  1YJW V;  1KC8 W;  1Q7Y W;  3I56 V;  1YI2 V;  1YIJ V;  1QVG U;  3OW2 U;  1YJN V;  3CCS V;  1YJ9 V;  3CCR V;  1Q86 W;  3CME V;  1JJ2 U;  1YHQ V;  4WFA V;  3CCL V;  1VQ7 V;  4WF9 V;  1YIT V;  1VQO V;  3CCQ V;  1VQP V;  1Q81 W;  1VQ5 V;  3CXC U;  1VQK V;  1VQ4 V;  3G4S V;  1VQL V;  3I55 V;  1K9M W;  2QA4 V;  3G6E V;  1M90 W;  1K8A W;  1VQ8 V;  3CC4 V;  2QEX V;  1Q82 W;  1QVF U;  3CPW U;  1VQ9 V;  1VQN V;  1VQM V;  3CCE V;  2D3O W;  5DM6 V;  3CC7 V;  1K73 W; 
#chains in the Genus database with same CATH topology
 4K35 A;  4GKK B;  4P2Z A;  4KUM A;  3STZ C;  4J9Y B;  4Z1V A;  4CBC A;  3S3X A;  3JAW A;  2YXY A;  1S72 V;  2JVD A;  2WLM A;  1D2D A;  3JAR A;  1AB3 A;  4PV1 B;  4FLV A;  3AG3 B;  4G28 B;  5IYC O;  4Q20 A;  3P3N A;  3OTO O;  3FB8 C;  3OTO B;  5IY5 B;  3SJB C;  4FLT A;  1OCZ B;  4LF5 O;  4LF5 B;  2EUL A;  2E75 B;  3UT5 B;  4P9O A;  4X20 A;  2OTJ V;  3SR2 C;  5DN6 G;  4LWS A;  4MVO A;  1H2K A;  3C90 A;  4JI7 O;  4JI7 B;  5H9C A;  2HP8 A;  3KCX A;  2R72 A;  1NH2 B;  1TUE B;  3ABM B;  3JD2 A;  2DOS A;  2XTA A;  3QVN A;  1VQ6 V;  1IBM B;  1ZL8 B;  4U7N A;  1ZUQ A;  5KA5 A;  3T4Z A;  2KKW A;  2Q9L A;  4OX9 O;  4OX9 B;  2BTQ B;  3RN4 A;  1I5Y A;  3U0Z A;  3RVY A;  2PI5 A;  4R8C A;  4JF3 A;  1Y74 B;  1QBZ A;  4FFK A;  1ZAU A;  4O4L B;  1XMQ O;  1XMQ B;  2Z0A A;  5B66 Z;  2LFR A;  3DSQ A;  5EBM C;  5B1A C;  4JTC B;  1A32 A;  3ZRW A;  1NTZ H;  3JAL B;  2JRI A;  1L0N H;  4X1K B;  4RO2 A;  2E76 B;  4UB8 Z;  2XAQ A;  5BY1 A;  3W7U A;  4CH3 A;  1RPO A;  5JJJ B;  1KB9 F;  1MOF A;  4MSW C;  3ZMU A;  2UUB O;  1LUW A;  2FL4 A;  3IC9 A;  2W0X A;  4ZIB A;  2DJV A;  2QR4 A;  3BA8 A;  1MA1 A;  5CBG A;  2AHY A;  3QO5 A;  1RSO B;  1HW7 A;  3ETD A;  2YID A;  2OYQ A;  4Z2W A;  5LOV B;  2GDS A;  1K5Q A;  1IBK B;  1IBK O;  2P06 A;  1FXV A;  1FS0 G;  1GM9 A;  5IE9 A;  1E1R G;  5LMN O;  5LMN B;  3FB6 C;  3EVK A;  2CK3 G;  3FYI B;  3K5O A;  4BR6 A;  1VQL V;  2VRZ A;  1GH6 A;  3JAW B;  4I9Q A;  4MVS A;  2AZ2 A;  3CRR A;  1OV9 A;  4J80 A;  2B9Z A;  3JAR B;  3MDS A;  4BIZ A;  4DUZ O;  4DUZ B;  2DE0 X;  4UV8 A;  1F7Y A;  5EYP A;  2B1I A;  2RNB A;  1PKX A;  3E8H A;  4MVQ A;  2QM8 A;  3A8T A;  1VQP V;  2DQ3 A;  2QJ1 A;  4X20 B;  3LSU A;  1XNQ O;  1XNQ B;  1I08 A;  4LWS B;  5KMG A;  2Q4P A;  2R9A A;  5BXZ A;  1VF6 C;  5L3D A;  4ZHQ A;  4YY3 O;  1Q7Y W;  2JEX A;  3CRM A;  4E4E A;  1OZ0 A;  4O2B A;  1MZE A;  3OEH G;  4LBE C;  1K9M W;  4B3M B;  4B3M O;  1N36 O;  1N36 B;  1MG1 A;  1G6U A;  3AG3 C;  3ZS8 C;  3G71 V;  1WNS A;  2ADP A;  2IJK A;  4UCR A;  5DED A;  5LL6 Y;  1RM1 B;  4DV5 O;  4DV5 B;  4DR2 O;  5H6Q A;  1EN5 A;  3CCU V;  5IY5 C;  4L87 A;  2B1G A;  3D36 C;  3ETG A;  4TSF G;  4ZI7 A;  5B1B B;  1AJP A;  2A3Q A;  4WF9 V;  1H38 A;  3ZRW B;  4KP4 A;  4DV3 O;  4DV3 B;  4JI4 O;  4JI4 B;  1SER A;  1P49 A;  4R50 A;  1VQ9 V;  3HR0 A;  2KQX A;  3IAY A;  3J7A U;  2UXC O;  2UXC B;  5KHJ A;  4GX0 A;  4HAM A;  3ABM C;  1SC5 B;  1AR5 A;  2GSM B;  5IWA O;  5IWA B;  2IBZ H;  1YF2 A;  3ZIA G;  2EBO A;  2YDE A;  3NXS A;  4IHJ A;  1NKD A;  2YI8 A;  3SPG A;  2N74 A;  1V54 B;  2EIL C;  4DR1 B;  4O4J A;  1BCC H;  5EIB C;  1WB7 A;  2ZIM A;  2PYJ A;  2WLI A;  2F95 B;  3T2M A;  2IW5 A;  4JAS A;  1P84 F;  3OE7 G;  1VQO V;  4FLW A;  5KA6 A;  3GWK C;  1R6N A;  4RWU A;  1EZJ A;  2VWK A;  5LGT A;  4YIP A;  3AK1 A;  2YIA A;  4IGG A;  1WA8 A;  1GN2 A;  1FYJ A;  3T1Y O;  3HKE A;  5EYP B;  4LCU C;  4FLU A;  2ZE6 A;  4UCV A;  3WFV A;  5IT9 N;  2WPD G;  3ZBH A;  1XMO O;  1XMO B;  3ABL B;  1PV0 A;  3DC5 A;  1YJN V;  3GB7 C;  2QGN A;  3IC7 A;  4XDK A;  5KMG B;  4MTF A;  2QM4 A;  2VQF O;  2VQF B;  4J41 A;  1BS3 A;  4ZHQ B;  1SES A;  4RQF A;  2B5U A;  4ZOL A;  5A9G A;  1CEZ A;  4O2B B;  3F5T A;  4AQY B;  1LUV A;  4QGP A;  5F2V O;  4GKJ B;  4GKJ O;  2ZIN A;  5KHH A;  4UFZ A;  3K04 A;  4K8X A;  1H2N A;  4MVU A;  4WFA V;  5BZB A;  2YIB A;  3JAT A;  4DK0 A;  2WAM A;  5J2T A;  4LF6 O;  3SYP A;  2GTS A;  3CC7 V;  1YDX A;  4JZ2 A;  4ZI7 B;  3LNM B;  3CX5 F;  2W0F C;  1GK9 A;  4QPK A;  2DYR C;  1F4M A;  3U11 A;  3H9V A;  2DYS C;  1SZX A;  2ILM A;  1F23 A;  4B7K A;  2WLH A;  2QKC A;  3ZHV A;  3G6B A;  4FM0 A;  4OGQ B;  2NN4 A;  1K4D C;  1R6K A;  3CP1 A;  2YC0 A;  4LFC O;  4LFC B;  2QEX V;  1SQQ H;  1S0V A;  1CXZ B;  1VEW A;  2L6L A;  2P90 A;  2RCV A;  3CC2 V;  1M1K W;  4IHJ B;  5L3F A;  5CB4 A;  2UUA B;  4N21 A;  5LYJ A;  3WG7 B;  5EK0 A;  4O4J B;  1K4C C;  1G8M A;  2ZE5 A;  3T4D A;  2D2C B;  4LF8 O;  4LF8 B;  1AI5 A;  5B1B C;  3OR7 C;  3K9S A;  2P67 A;  3B40 A;  2WLI B;  2Q73 A;  4QJF B;  1SZT A;  2Q67 A;  3CRC A;  4TWK A;  2QWQ B;  4B3S O;  2P22 C;  3P32 A;  2E74 B;  2QWP B;  4PDM A;  1WA8 B;  2LP7 A;  1VQ4 V;  3K59 A;  3HKE B;  2QA4 V;  3QO7 A;  2ZE7 A;  3VBB A;  2ZR3 A;  2Q0A A;  1DF5 A;  1S5H C;  1R73 A;  3P30 A;  2HKO A;  3W7X A;  1BQZ A;  1GTO A;  4JTA B;  1V54 C;  1AJN A;  3SJQ C;  1SA0 A;  3CCL V;  4ZOL B;  1ZWI C;  4DR4 O;  4DR4 B;  3RYI A;  1BHB A;  4GYC B;  2BE3 A;  1K97 A;  1Q82 W;  4DV1 O;  4DV1 B;  4FMT A;  3AG1 B;  2UXD O;  2UXD B;  1TA8 A;  3ETQ A;  3W7W A;  4DV7 O;  4DV7 B;  3KG2 A;  2ZDI A;  2XOK G;  1AI6 A;  1GO3 F;  1NTK H;  1RP3 B;  1RFY A;  1PL0 A;  3JAT B;  1BMF G;  4UVB A;  5J2T B;  5H5N A;  1YJ9 V;  4H44 B;  1KMI Z;  2E3C A;  1J5E O;  1J5E B;  3ABL C;  2K1E A;  4LFB O;  4LFB B;  2A0L A;  3STL C;  5KHK A;  3W7T A;  1WP7 A;  1XHZ A;  3H1H H;  3K79 A;  1JCH A;  1UFI A;  4J7K A;  3TGU H;  1LR1 A;  4J7Z A;  3M99 B;  5JH7 A;  1ZLZ A;  3HPL C;  1Q86 W;  2ZNI A;  5B1A B;  4PEL A;  3SYO A;  4I4T A;  1I94 O;  2IJI A;  3BEH A;  1I94 B;  1DK1 A;  4YJ2 A;  4G2K A;  4I9W A;  3CXH F;  2WLL A;  3AG4 C;  1D5A A;  5BR8 B;  2IJH A;  4EFB A;  5FLX N;  1JX9 A;  4X8A A;  3K03 A;  5CB4 B;  5LYJ B;  1AR4 A;  5LHH A;  5BMV A;  1L1F A;  1W0J G;  4Z1M G;  1QVG U;  4FIP C;  3JSL A;  4DW1 A;  5L3B A;  4EFE A;  1IXM A;  3IFX A;  1VQN V;  3QNE A;  4B08 A;  4D7T A;  1BGY H;  3CMA V;  4H13 B;  2X6B A;  3O9O A;  1ZSP A;  3K0G A;  3BFR A;  4NTX A;  2IM9 A;  3B8N A;  3VQX A;  3B77 A;  2UUC O;  2UUC B;  2JJ2 G;  2CTW A;  3CSX A;  3FKS G;  4JI6 B;  4JI6 O;  1US6 A;  4X65 O;  4X65 B;  4QPJ A;  1Q81 W;  2K9P A;  3CWB H;  4HZ3 A;  1WLE A;  2GHY A;  1LNQ A;  2Q5Z A;  2EIJ B;  1Y4M A;  3WG7 C;  4EB6 A;  1M4U A;  1CPY A;  4X1I A;  1SA0 B;  1Z2G A;  4WBN A;  4IYI A;  2Y4U A;  3UO3 A;  1DF4 A;  1OCC C;  3CB2 A;  3RYI B;  3VQV A;  1DLB A;  2A06 H;  4LC1 A;  1XL6 A;  1Z5W A;  5LOV A;  2H3O A;  4DR5 B;  4R7C A;  5CN0 A;  2E5L O;  2E5L B;  1M93 A;  3K08 A;  2VWJ A;  4JGS A;  2DMX A;  3CYO A;  4DRX A;  4GKK O;  3OTF A;  4PDL A;  3QG5 A;  1AP5 A;  1X59 A;  5EC2 C;  5CA3 A;  1WPX A;  4OXS A;  2CH7 A;  3L75 H;  3LSS A;  5B5E Z;  2OCH A;  3ZCC A;  2P7T C;  5EC1 C;  2YUA A;  4IL6 Z;  2A79 B;  3HKC A;  1ZX3 A;  4H37 A;  3A0H Z;  3CCV V;  1R3K C;  2OIE A;  5JH7 B;  4LF7 B;  3GVM A;  2UXX A;  2GUZ A;  3RFR A;  1NR1 A;  4I4T B;  4YJ2 B;  5FL7 G;  1KC8 W;  2WLL B;  3KKY A;  3AG1 C;  3WB1 A;  1GKF A;  2DN9 A;  1CP9 A;  2XT9 A;  1S76 D;  5KHI A;  5KUK A;  1VQ5 V;  4A5U B;  3BHP A;  3K06 A;  5BMV B;  2BOB C;  2KG7 A;  2V1D A;  1H2S B;  2PTM A;  4MT8 A;  4PA4 A;  1Z5V A;  1IBM O;  1VIB A;  2ADQ B;  3ZMV A;  3N27 A;  3T1C A;  3I56 V;  3ASO B;  2RN9 A;  1BL8 A;  1XOU A;  3ETE A;  5GON A;  4TV9 A;  2EIL B;  3UQ8 A;  4TT3 G;  1MMM A;  1FFT B;  4XDL A;  3F7Y C;  3RWR D;  4NXN B;  1E1Q G;  4IIJ A;  1QR8 A;  4DXW A;  1PL4 A;  3KZI Z;  5AG2 A;  3ZN1 A;  1MNG A;  2R9R B;  1YHQ V;  1Q3E A;  5J9P C;  2QWN B;  4EB6 B;  1FKA O;  4X1I B;  1M57 B;  4WBN B;  3F7V C;  1VQM V;  4UXN A;  4PA9 A;  3LDD A;  1PNM A;  4PD4 F;  1NJI W;  2BTO A;  1XEQ A;  1M5I A;  5FPR A;  3C3T A;  4U3J A;  4DRX B;  1AJQ A;  4JTD B;  2R70 A;  4JI5 O;  4JI5 B;  2CTR A;  2CH7 B;  1NH2 D;  1IBL O;  1IBL B;  1BZK A;  3D3Q A;  4K8Z A;  1M9N A;  1E79 G;  2EIJ C;  1F4N A;  4ZBM A;  3HKC B;  4MTX A;  4E2L A;  2DQ0 A;  4N23 A;  4PA7 A;  1R3J C;  1V9P A;  2PF4 E;  2GUZ B;  2QWO B;  3VOU A;  1HP8 A;  1R1B A;  5EZY A;  4KFM A;  2DYR B;  2OIG A;  2DYS B;  2ZDI C;  1XIL A;  5EIB D;  1XDC A;  2JK5 C;  4IT5 A;  2KG7 B;  2HHH O;  2HHH B;  3RW0 A;  4FM2 A;  3E2E A;  5LXT A;  3JAS A;  2QDO A;  2YXL A;  4F6R A;  1GN4 A;  4CS4 A;  1M56 B;  4GX2 A;  1K33 A;  3ML0 A;  2OTL V;  2EX3 A;  4CH4 A;  4NTY A;  1K7D A;  2ARH A;  5GON B;  4TV9 B;  4JPR A;  4NB5 A;  1ORQ C;  3BAA A;  4MTO A;  1RPR A;  3CRQ A;  2AZ0 A;  1FD9 A;  1QQC A;  4RAI A;  1S5J A;  2P5O A;  4JAU A;  4OPH A;  1PPJ H;  3ZHQ A;  2X6A A;  3L71 H;  4IIJ B;  4I5S A;  4I55 A;  3ZX6 A;  1BT8 A;  4Q6G A;  2WLJ A;  4I0X A;  5H6R A;  1QNM A;  4WFE A;  3J81 N;  4TQF A;  3L72 H;  3K58 A;  1K3E A;  3K9A A;  4YIO A;  3OMN B;  3SJC C;  3TXS A;  4JI1 O;  1W0K G;  3ASO C;  4JI1 B;  3MD0 A;  1K8A W;  4W4L A;  4X62 O;  4X62 B;  4QE7 A;  4DR1 O;  1WAZ A;  3OMI B;  3G67 A;  3G80 A;  4DUY B;  4BAY A;  4U3J B;  1FXH A;  5E79 Z;  1KD1 W;  1NVP B;  4FZ0 A;  4MVR A;  3K5L A;  3B09 A;  4CC5 A;  1JVM A;  2JGD A;  4KL1 A;  5KLV H;  2Q0O C;  1IDS A;  2XND G;  3BA9 A;  3JD3 A;  3SPJ A;  4FFB A;  2IH3 C;  4GUN A;  1SQP H;  2R9I A;  3ZED A;  1SRY A;  2IU0 A;  2WLN A;  1SQV H;  1M57 C;  1UJW B;  3OGI B;  1KYO F;  4YHH O;  4YHH B;  1AI7 A;  1KP2 A;  3K5M A;  5KAF Z;  3R66 A;  5EZY B;  1KKC A;  4RQE A;  3FD9 A;  2ZIO A;  1SQF A;  3CEI A;  3T1H O;  3T1H B;  2M6Y A;  2H8P C;  3B2E E;  1TUB A;  4QIW F;  1XUQ A;  1XHX A;  2UXB B;  1N8R W;  5C93 A;  1AP6 A;  3VQW A;  4BW5 A;  1H2L A;  2ATK C;  4AQY O;  5LXT B;  3JAS B;  3TCU A;  2F43 G;  4F6R B;  4X66 O;  4X66 B;  2OT5 A;  4CH6 A;  1J95 A;  1HNW B;  3AG4 B;  4PA6 A;  1HWY A;  3RGB A;  1N34 B;  1N34 O;  3WB0 A;  1PP9 H;  1YSC A;  4LH6 A;  1SET A;  1JQ0 A;  1OCR B;  2YXH A;  4DV2 B;  1KBH A;  1U97 A;  2FML A;  4YXW G;  2GTA A;  1QHT A;  3ABK C;  4UUJ C;  3ZRX A;  1URF A;  3WU2 Z;  1WN7 A;  3DXR A;  4P30 A;  5K1X A;  4PHZ A;  4I55 B;  4D6T H;  1YEW A;  5B1N A;  2PI4 A;  5LA6 A;  4DR6 O;  1NVP D;  1VAR A;  4DR6 B;  4I0X B;  1BQ0 A;  1L8D A;  3ASN B;  3RVZ A;  1GN6 A;  3AEI A;  3FB5 C;  2XAH A;  1EM1 A;  3FYE B;  2F23 A;  1OCO C;  4LF9 O;  4LF9 B;  4L8J A;  3CCJ V;  1YXB A;  1M56 C;  2EZO A;  3H1K H;  5IYZ A;  1KEC A;  3CJH A;  4JAA A;  2UUA O;  2QSA A;  1EZV H;  2CE4 A;  2NLJ C;  2AXT Z;  3ZJZ A;  2V4D A;  5JVD A;  1OCC B;  4JYC A;  1N32 O;  3ZN0 A;  1N32 B;  3ZMT A;  2JGD B;  3DTU B;  5E1A C;  2FTK A;  3P3P A;  2WA3 A;  3APQ A;  4FFB B;  1XI1 A;  2X6C A;  4RUE A;  4AIL C;  2LW7 A;  3M8A A;  4LFA O;  4LFA B;  3L9D A;  3ZHR A;  1IZ3 A;  3OGC C;  4HNA A;  2D3O W;  3UKM A;  1YCI A;  1OJH A;  3HKB A;  2BCC H;  2ZCE A;  1W59 A;  4C7U A;  2DW4 A;  2W6J G;  3CME V;  3NR7 A;  2ZE8 A;  4MTG A;  2HLD G;  4BW9 A;  1TUB B;  5HFL A;  3OUS A;  2XAG A;  4X64 B;  5K1P A;  3G4S V;  1QCE A;  2QTS A;  1YTF B;  1TAE A;  5DEC A;  1IVS A;  4GCZ A;  3A2F A;  4DV0 O;  4DV0 B;  1YJW V;  1L0L H;  4PA3 A;  1SKV A;  1HNX O;  1HNX B;  2QE7 G;  5B1O A;  1SQG A;  2FKX A;  1PNK A;  5FNV A;  3ZHS A;  4EEQ A;  5LGN A;  3A0B Z;  1AIL A;  1QLE C;  5LP6 A;  3QO8 A;  4CS2 A;  3DXR B;  3JD0 A;  4B3T O;  4B3T B;  2DWD C;  5IJ9 A;  1SQB H;  4X9Q A;  3RYF A;  3J80 N;  2RMK B;  1EN4 A;  1F51 A;  5LA6 B;  2HEP A;  4NKG B;  4LNU A;  4LF4 O;  4LF4 B;  2JS5 A;  2UU9 O;  2UU9 B;  4LR3 A;  5B3S B;  1N0N A;  2Z5U A;  2Y0I A;  5IYZ B;  5BR8 O;  3LSQ A;  2RQ6 A;  4DV6 B;  1EFR G;  3CJH B;  3AK3 A;  1Q6I A;  1OCR C;  3GWO A;  3L70 H;  2X7R B;  3TET A;  4X88 A;  1WP8 A;  1KUQ A;  2QTO A;  1VF5 B;  5JVD B;  1WB8 A;  4DYL A;  3JAK A;  4K3A A;  3N2K A;  3CC4 V;  2AHZ A;  2ZNJ A;  3DC6 A;  4FZ1 A;  1B6Q A;  2IU3 A;  4PDV A;  2MW2 B;  3ASN C;  5D5Q A;  2ZXW B;  1YTF D;  1QU7 A;  4KHP B;  1GN3 A;  3W7S A;  1HR0 O;  1HR0 B;  1GM7 A;  4HNA B;  4J7J A;  1NBM G;  2YIB D;  1M90 W;  1H8E G;  4FM1 A;  2JIZ G;  1VMG A;  1NR7 A;  1HNZ O;  3HKB B;  2HR3 A;  4F6E A;  1HNZ B;  3ABU A;  4WFB V;  3MHH C;  1P7B A;  4GX5 A;  3CHX A;  3AG7 A;  3R65 A;  3EFF K;  4DR5 O;  3FB7 C;  4FLZ A;  3UO2 A;  3B4S A;  1NZ6 A;  4MW3 A;  4UB6 Z;  5CA1 A;  1SS3 A;  4CS3 A;  2L35 A;  2XAS A;  3TK1 A;  3AG2 B;  3APO A;  4P9P A;  5KAI Z;  2PUS A;  2WLK A;  1P7G A;  5FNV B;  4GT1 A;  2OCC B;  5LP6 B;  4R6Z A;  5IJ9 B;  2EIM C;  4B3R O;  4B3R B;  3RYF B;  1MSD A;  2JDI G;  3OR6 C;  3D8C A;  3B8M A;  4CH5 A;  4WFH A;  3MHS C;  1N0J A;  2N05 A;  4LNU B;  5IDJ A;  3E35 A;  4UCT A;  4LF7 O;  1G4Y B;  4DW0 A;  1G1X B;  3ZMZ A;  5LHI A;  1VF7 A;  2YI9 A;  3K5N A;  3ZMS A;  3OM3 B;  5EBL C;  3FFQ A;  2O57 A;  1WPB A;  2JGU A;  2V7Q G;  1KQS U;  5IYD O;  2BOC C;  4IYH A;  5CA0 A;  1ZTE A;  3AK2 A;  3SPC A;  3JAK B;  1BE3 H;  3N2K B;  4J9Z B;  3RYH A;  4H0L B;  2QM7 A;  1JJ2 U;  5A2Q N;  2GBO A;  1XL4 A;  4F4L A;  3CXC U;  1UPG A;  1I5X A;  1KKD A;  2WWW A;  3OD4 A;  1AI4 A;  3Q4H A;  2LQT A;  4RUF A;  3ZHU A;  5B3S C;  4LP8 A;  4NXN O;  3BVO A;  5GW7 A;  2EJ7 A;  1GAX A;  2A9H A;  3LUT B;  4O4H A;  2ZR2 A;  4HBN A;  3CD6 V;  3OT7 A;  4QE9 A;  2Y48 A;  4LH7 A;  1MZF A;  4X1Y A;  3ABT A;  2AW9 A;  4JAV A;  4WFG A;  1Y67 A;  4I7Z B;  5JWP A;  3X2Q B;  2Z3Y A;  4GZR B;  4I50 A;  2ZT9 B;  4AI8 A;  1FFX A;  1X4T A;  2XUM A;  1QLN A;  2ETN A;  3A0R A;  5KUM A;  2EZP A;  2UUB B;  2ZXW C;  1XRE A;  1TVK A;  4GX1 A;  1SF9 A;  5CA1 B;  3E83 A;  3JYC A;  2HFE C;  2Q6A A;  4JYY A;  5L3E A;  2Q7H A;  1MAB G;  4JV5 B;  4JV5 O;  4FLY A;  4MVZ A;  2ZQM A;  1B06 A;  3ABK B;  1WJZ A;  3BRC A;  3JD4 A;  4DK1 A;  4X89 A;  3LDE A;  3CCE V;  2OWO A;  2AGA A;  1O9G A;  3S3W A;  4U7O A;  2UXN A;  2XAJ A;  4FPP A;  3ZRV A;  2PZS A;  4J10 A;  1JOY A;  4W4K A;  4UCU A;  3OEE G;  3AG2 C;  3VQY A;  3RT3 C;  1OCO B;  1AVM A;  5CA0 B;  2EIK B;  2OCC C;  1FJG O;  1FJG B;  5LP6 C;  2CAZ C;  3RYC A;  5LGU A;  2QKA A;  3RYH B;  3E8F A;  3RBZ A;  3H1I H;  1R3L C;  5JQG A;  2CUG A;  4YY3 B;  1N4C A;  5JCO A;  2N04 A;  1ARO P;  3C3S A;  2LGW A;  4CZZ A;  4O2A A;  3Q4H B;  1V55 B;  1KU9 A;  4JZG A;  4O4H B;  5JJN B;  3CS5 A;  2Y4T A;  5DM6 V;  1Q43 A;  2WA4 A;  2G38 A;  1HDJ A;  4X1Y B;  2QWR B;  4DR2 B;  3PJS K;  5GTI Z;  1OCZ C;  2HVK C;  3BPZ A;  2ITC C;  4HYO A;  2PYL A;  4NVP A;  4JI2 O;  4JI2 B;  2GV9 A;  3F5W C;  4I50 B;  3JAM N;  2JJ1 G;  3QTC A;  1H8H G;  4JI3 O;  4JI3 B;  1FFX B;  1GMG A;  3ZRS A;  3WB2 A;  4XBF A;  4JYB A;  1Q6H A;  1K92 A;  2ITD C;  4ICG A;  4DUY O;  3D3I A;  4CC6 A;  1TVK B;  1MSW D;  4TQD A;  1JMK C;  2LO1 A;  2YS8 A;  4YJ3 A;  3N2G A;  3MAQ A;  4UVC A;  1T5E A;  5CMU A;  1K5S A;  2BSK A;  3KCY A;  3TXQ A;  4J11 A;  1D5N A;  2ODM A;  2RDC A;  4FJC C;  1S5L Z;  3H1L H;  3X2Q C;  3JSN A;  2HVJ C;  2W6I G;  3FAV A;  4MW8 A;  2P4V A;  4J42 A;  5FPO A;  3LNN A;  1FXK A;  1PM9 A;  3E86 A;  1QLE B;  1FPO A;  2Q7G A;  2QKS A;  5IJ0 A;  4DV4 O;  4DV4 B;  4PI2 A;  4DR3 O;  4DR3 B;  3HKD A;  3T1Y B;  4WCE V;  3U10 A;  4TUY A;  2Y69 B;  2UXB O;  5KX5 A;  2P4K A;  1JPX A;  2PY5 A;  4B7E A;  1NU1 H;  2YEV A;  2KB1 A;  3CE2 A;  3JCU Z;  4DO2 A;  2HG5 C;  1HNW O;  3RYC B;  3L73 H;  5J2U A;  1YIT V;  3DGE A;  4TOI A;  5CBF A;  1COW G;  3OMA B;  3G6E V;  2JEU A;  4DV2 O;  5JQG B;  1GM8 A;  1PD3 A;  4JI0 O;  1P4R A;  4JI0 B;  4FVM A;  1EBO A;  4O2A B;  3ICX A;  2EIN B;  2Q8V A;  2M7W A;  1I0H A;  2WSS G;  1GRJ A;  2LFS A;  2FB5 A;  1ROP A;  1AR1 B;  4JI8 O;  4JI8 B;  1Q8I A;  4U3F H;  2H94 A;  2JS3 A;  1O9H A;  4XDJ A;  2XHB A;  4LF6 B;  1ENV A;  4KXR A;  3IGA C;  1YZB A;  2F1M A;  1R6T A;  2EIK C;  4NR1 A;  1BHA A;  3E22 A;  3I5D A;  2F66 C;  3OAA G;  1R3I C;  5TIS Z;  2ZD9 A;  3H01 A;  3SPI A;  1JR9 A;  3H1J H;  4G27 B;  4NYK A;  4PJ0 Z;  4NTW A;  1V55 C;  1IUR A;  3SPH A;  4YJ3 B;  1Y6X A;  1H2M A;  3N2G B;  5GTH Z;  1JJO A;  1S77 D;  4OPA A;  1Y76 A;  2KSD A;  4H33 A;  5L3G A;  3CCR V;  2BSK B;  1RM1 C;  3BY6 A;  1S3J A;  4ABM A;  3BAB A;  1DGS A;  3QF7 A;  3I55 V;  4UVA A;  3FAV B;  3SYA A;  5LBQ A;  1Q5O A;  2CGN A;  1K73 W;  2Y0P A;  1NS1 A;  1FXK B;  1XQ8 A;  2CTQ A;  5C8Y A;  4PI0 A;  5IJ0 B;  2YSU B;  4O4I A;  4B3S B;  1EN6 A;  1NQT A;  1YI2 V;  4FK5 C;  2EIM B;  1NT2 B;  2ZKO A;  3HKD B;  1JFF A;  5ITZ A;  4FLX A;  4MS2 A;  5LMU O;  5LMU B;  4EKW A;  4TUY B;  4X64 O;  5KX5 B;  3M7M X;  3JD1 A;  3CPW U;  2YEV B;  2NR5 A;  2CDY A;  2CGO A;  1KP3 A;  4BIO A;  4GLX A;  2IH1 C;  4NXM O;  4NXM B;  5J2U B;  3PN1 A;  3K57 A;  1QR9 A;  4TV8 A;  5D5P A;  1N33 O;  1N33 B;  4UCO A;  5EBW C;  1VQK V;  1H2G A;  1TGO A;  3UM7 A;  2Q69 A;  1XNR O;  1XNR B;  5JJE B;  2X0L A;  4UV9 A;  1VF6 A;  2Q68 A;  1NI8 A;  3SYQ A;  2Y69 C;  1SQX H;  3K0D A;  3JCZ A;  2NNU A;  3UCS C;  1Q90 D;  3EHB B;  1I7F A;  3E22 B;  3IJ4 A;  3ZHT A;  2DWE C;  2VQE O;  2VQE B;  3FX7 A;  4DV6 O;  1VP7 A;  2F93 B;  1XBL A;  5L3C A;  1IX9 A;  3O65 A;  1PNL A;  2Q7E A;  2LGQ A;  3D36 A;  5JCO C;  3CCS V;  2EIN C;  3UT5 A;  1K34 A;  2HJF C;  4MVM A;  3BCC H;  1JA8 A;  3SDL A;  5KHG A;  2C2A A;  3L74 H;  1QVF U;  2VS0 A;  2LJ2 A;  3K3W A;  4WFF A;  1W2B U;  1NTM H;  1Y76 B;  4DR7 O;  3SJA C;  4DR7 B;  4KHP O;  3HB3 B;  5HFM A;  1ZL8 A;  2CTP A;  3EXA A;  1B3Q A;  3THO A;  1BSM A;  5H2F Z;  1VQ7 V;  2ZM6 O;  2ZM6 B;  2BTQ A;  2HJD A;  5C8Y B;  1YVW A;  2MK3 A;  4O4I B;  1Y74 A;  1B04 A;  4ZKI A;  3CCM V;  5IYB O;  2FYU H;  4O4L A;  1FAF A;  2F4V O;  2F4V B;  1OHH G;  1JFF B;  5ITZ B;  4BIU A;  1U96 A;  3E8G A;  3JAL A;  4ASU G;  4X1K A;  3SGI A;  3OUF A;  1Q6U A;  1THZ A;  2LW1 A;  4JYA O;  4JYA B;  3OFN G;  2IJJ A;  4PDR A;  5LHG A;  4K0K O;  4K0K B;  4TV8 B;  4UCS A;  1Y66 A;  4QNH B;  3TJT A;  4BWA A;  3SYC A;  3CRA A;  1RSO A;  3LDC A;  3E89 A;  1YIJ V;  1FXK C;  3OW2 U;  4AHC A;  2EJR A;  1IXB A;  2YIC A;  2PGG A;  4D7S A;  2A7W A;  3E8B A;  2RJZ A;  3CCQ V;  5CBH A;  1DTO A;  2P6J A;  1VQ8 V;  2XAF A; 
#chains in the Genus database with same CATH homology
 2H8P C;  3AG1 B;  4QIW F;  3W7W A;  4P2Z A;  4KUM A;  4U7O A;  3KG2 A;  3STZ C;  2ZDI A;  1N8R W;  2XOK G;  4J9Y B;  5C93 A;  4CBC A;  2UXN A;  1AI6 A;  1GO3 F;  2XAJ A;  2ATK C;  4FPP A;  3ZRV A;  4BW5 A;  1S72 V;  1PL0 A;  3TCU A;  1BMF G;  2F43 G;  2WLM A;  4UVB A;  2OT5 A;  1JOY A;  1J95 A;  1YJ9 V;  3AG4 B;  4PA6 A;  1HWY A;  3AG3 B;  3OEE G;  3AG2 C;  4G28 B;  5IYC O;  1YSC A;  4Q20 A;  3ABL C;  1SET A;  1JQ0 A;  1OCR B;  1OCO B;  2K1E A;  3FB8 C;  2EIK B;  2OCC C;  4YXW G;  2A0L A;  3STL C;  5IY5 B;  5LGU A;  1OCZ B;  3W7T A;  3ABK C;  3E8F A;  3K79 A;  3RBZ A;  4UUJ C;  3ZRX A;  1JCH A;  4P9O A;  1R3L C;  2OTJ V;  5DN6 G;  4P30 A;  3M99 B;  4MVO A;  1ARO P;  3HPL C;  4CZZ A;  1Q86 W;  5H9C A;  5B1N A;  5B1A B;  2PI4 A;  4PEL A;  3SYO A;  2IJI A;  3BEH A;  1NVP D;  1NH2 B;  4G2K A;  1V55 B;  4I9W A;  2WLL A;  3ASN B;  3RVZ A;  3FB5 C;  3AEI A;  1TUE B;  3ABM B;  3AG4 C;  3JD2 A;  2XAH A;  2IJH A;  5DM6 V;  3FYE B;  1JX9 A;  4X8A A;  3K03 A;  1VQ6 V;  1OCO C;  4U7N A;  5KA5 A;  5LHH A;  3T4Z A;  3PJS K;  3CCJ V;  1M56 C;  2EZO A;  1L1F A;  1OCZ C;  2HVK C;  1W0J G;  2ITC C;  1KEC A;  4HYO A;  4Z1M G;  1QVG U;  1I5Y A;  3RVY A;  4FIP C;  2PI5 A;  4R8C A;  4JF3 A;  3F5W C;  1QBZ A;  5L3B A;  1IXM A;  2JJ1 G;  2NLJ C;  3IFX A;  2LFR A;  5B1A C;  1H8H G;  5EBM C;  3ZJZ A;  1VQN V;  4JTC B;  3QNE A;  1OCC B;  4JYC A;  1GMG A;  3ZN0 A;  3ZRS A;  4XBF A;  3ZMT A;  4JYB A;  3CMA V;  3ZRW A;  2X6B A;  1K92 A;  2ITD C;  3K0G A;  4RO2 A;  3DTU B;  3D3I A;  5E1A C;  2FTK A;  2XAQ A;  1MSW D;  3W7U A;  3B8N A;  3B77 A;  1RPO A;  2JJ2 G;  1MOF A;  4MSW C;  3FKS G;  3ZMU A;  2X6C A;  4QPJ A;  1Q81 W;  4RUE A;  4UVC A;  4HZ3 A;  1WLE A;  5CMU A;  1K5S A;  2GHY A;  1LNQ A;  2D3O W;  3OGC C;  5CBG A;  2EIJ B;  3UKM A;  1Y4M A;  2AHY A;  3WG7 C;  3QO5 A;  4FJC C;  3ETD A;  1CPY A;  3X2Q C;  2HVJ C;  2W6I G;  1DF4 A;  1OCC C;  4MW8 A;  1K5Q A;  1FXV A;  1DLB A;  4LC1 A;  1FXK A;  2DW4 A;  2W6J G;  3CME V;  1FS0 G;  1XL6 A;  1GM9 A;  3E86 A;  4MTG A;  1E1R G;  1QLE B;  2QKS A;  2HLD G;  3FB6 C;  4R7C A;  2CK3 G;  5HFL A;  3FYI B;  3OUS A;  2XAG A;  3G4S V;  5CN0 A;  1VQL V;  1QCE A;  1YTF B;  3K08 A;  4MVS A;  4JGS A;  3CYO A;  4WCE V;  2Y69 B;  4GCZ A;  4BIZ A;  4PDL A;  1JPX A;  1YJW V;  5EC2 C;  2YEV A;  2KB1 A;  4UV8 A;  1WPX A;  4OXS A;  4PA3 A;  4DO2 A;  2HG5 C;  5CA3 A;  2QE7 G;  3LSS A;  2B1I A;  5B1O A;  3E8H A;  1PKX A;  3ZCC A;  2P7T C;  5EC1 C;  1YIT V;  4MVQ A;  2QM8 A;  3DGE A;  1VQP V;  5CBF A;  1COW G;  3OMA B;  1PNK A;  3G6E V;  2DQ3 A;  2JEU A;  5LGN A;  2A79 B;  1GM8 A;  1QLE C;  3QO8 A;  4H37 A;  1PD3 A;  1P4R A;  3JD0 A;  3CCV V;  2DWD C;  1R3K C;  1EBO A;  2UXX A;  2EIN B;  1NR1 A;  1F51 A;  5L3D A;  2M7W A;  5FL7 G;  1KC8 W;  1Q7Y W;  2WLL B;  3AG1 C;  1GKF A;  2WSS G;  1CP9 A;  2JEX A;  2LFS A;  1S76 D;  1ROP A;  1AR1 B;  1OZ0 A;  5KUK A;  5B3S B;  2H94 A;  1VQ5 V;  4XDJ A;  3OEH G;  4LBE C;  1K9M W;  2Z5U A;  3K06 A;  1MG1 A;  2BOB C;  1ENV A;  2V1D A;  3AG3 C;  3LSQ A;  3IGA C;  1EFR G;  4MT8 A;  4PA4 A;  3G71 V;  1OCR C;  3GWO A;  2EIK C;  2IJK A;  1RM1 B;  2X7R B;  3TET A;  5H6Q A;  1BHA A;  3ZMV A;  3CCU V;  5IY5 C;  4X88 A;  4L87 A;  3T1C A;  2B1G A;  3I56 V;  3OAA G;  3ASO B;  3ETG A;  4TSF G;  2QTO A;  1R3I C;  1AJP A;  1BL8 A;  5B1B B;  3ETE A;  4WF9 V;  2ZD9 A;  1H38 A;  3H01 A;  3SPI A;  3ZRW B;  2EIL B;  4KP4 A;  1SER A;  4TT3 G;  3CC4 V;  1FFT B;  4XDL A;  4R50 A;  1VQ9 V;  3F7Y C;  4G27 B;  2AHZ A;  1B6Q A;  1E1Q G;  1V55 C;  2IU3 A;  4PDV A;  3SPH A;  3ASN C;  4GX0 A;  4HAM A;  3ABM C;  1QR8 A;  4DXW A;  2ZXW B;  1YTF D;  2GSM B;  1S77 D;  3W7S A;  5L3G A;  4H33 A;  3CCR V;  1RM1 C;  3ZN1 A;  3ZIA G;  1GM7 A;  3BY6 A;  2R9R B;  1S3J A;  2EBO A;  1YHQ V;  5J9P C;  1NBM G;  3NXS A;  3I55 V;  1M90 W;  1M57 B;  4UVA A;  1NKD A;  1H8E G;  3F7V C;  2JIZ G;  3SPG A;  1NR7 A;  3SYA A;  1V54 B;  4UXN A;  2HR3 A;  4PA9 A;  5LBQ A;  1VQM V;  3LDD A;  2EIL C;  3ABU A;  4WFB V;  1K73 W;  1PNM A;  1FXK B;  1NJI W;  3MHH C;  1P7B A;  4GX5 A;  2YSU B;  1NQT A;  1YI2 V;  4FK5 C;  2WLI A;  2EIM B;  3T2M A;  2IW5 A;  3R65 A;  4JAS A;  3EFF K;  3OE7 G;  1VQO V;  4MS2 A;  5KA6 A;  3FB7 C;  4EKW A;  1R6N A;  1AJQ A;  4JTD B;  1EZJ A;  3JD1 A;  3CPW U;  5LGT A;  4MW3 A;  2YEV B;  1NH2 D;  1KP3 A;  4LCU C;  1M9N A;  1E79 G;  2IH1 C;  2XAS A;  3TK1 A;  3AG2 B;  3WFV A;  2EIJ C;  4P9P A;  2WPD G;  1F4N A;  3ABL B;  1QR9 A;  2WLK A;  1YJN V;  4GT1 A;  3GB7 C;  2OCC B;  4ZBM A;  4MTX A;  5EBW C;  4E2L A;  3IC7 A;  4XDK A;  2DQ0 A;  4R6Z A;  2EIM C;  4N23 A;  4PA7 A;  1R3J C;  4MTF A;  1VQK V;  1H2G A;  3VOU A;  2JDI G;  3OR6 C;  1SES A;  4KFM A;  3B8M A;  4RQF A;  2B5U A;  4WFH A;  3MHS C;  2DYR B;  3UM7 A;  2Q69 A;  1CEZ A;  5IDJ A;  3E35 A;  2DYS B;  2ZDI C;  2X0L A;  4UV9 A;  1G4Y B;  2JK5 C;  2Q68 A;  3ZMZ A;  3K04 A;  5LHI A;  3SYQ A;  2Y69 C;  3RW0 A;  3ZMS A;  3E2E A;  4MVU A;  4WFA V;  3K0D A;  3OM3 B;  3JCZ A;  2NNU A;  5EBL C;  5BZB A;  3EHB B;  2WAM A;  1M56 B;  3SYP A;  3CC7 V;  2V7Q G;  2DWE C;  4GX2 A;  1K33 A;  1KQS U;  5IYD O;  2BOC C;  3ML0 A;  2OTL V;  3LNM B;  5L3C A;  1K7D A;  2W0F C;  1GK9 A;  4QPK A;  1PNL A;  4JPR A;  2DYR C;  1F4M A;  1ORQ C;  3SPC A;  4MTO A;  1RPR A;  3D36 A;  4J9Z B;  2DYS C;  1F23 A;  3CCS V;  4RAI A;  2EIN C;  2QM7 A;  1K34 A;  2WLH A;  4JAU A;  1JJ2 U;  2HJF C;  4MVM A;  2X6A A;  1XL4 A;  4F4L A;  3CXC U;  1K4D C;  1I5X A;  1R6K A;  2C2A A;  2WWW A;  3CP1 A;  4I5S A;  1KKD A;  2QEX V;  1QVF U;  1AI4 A;  4RUF A;  3K3W A;  5B3S C;  2WLJ A;  4WFF A;  4LP8 A;  1W2B U;  1S0V A;  5H6R A;  5GW7 A;  2A9H A;  3LUT B;  4WFE A;  2P90 A;  3CC2 V;  2ZR2 A;  3CD6 V;  4QE9 A;  1M1K W;  1K3E A;  3K9A A;  2Y48 A;  3HB3 B;  5L3F A;  5HFM A;  3ABT A;  4N21 A;  4JAV A;  4WFG A;  1VQ7 V;  3WG7 B;  5EK0 A;  3OMN B;  3X2Q B;  1K4C C;  1W0K G;  3ASO C;  3MD0 A;  1G8M A;  1K8A W;  2Z3Y A;  3T4D A;  1AI5 A;  5B1B C;  3OR7 C;  2MK3 A;  2P67 A;  4ZKI A;  2WLI B;  4QE7 A;  3CCM V;  5IYB O;  3OMI B;  1OHH G;  4QJF B;  4BAY A;  1SZT A;  1FXH A;  1KD1 W;  1NVP B;  2Q67 A;  4MVR A;  4BIU A;  4TWK A;  1QLN A;  3A0R A;  5KUM A;  3E8G A;  2EZP A;  3P32 A;  1JVM A;  4ASU G;  2ZXW C;  3OUF A;  2LP7 A;  2XND G;  4PDM A;  4GX1 A;  3JD3 A;  3SPJ A;  1VQ4 V;  1THZ A;  2IH3 C;  2QA4 V;  3QO7 A;  2R9I A;  3E83 A;  3JYC A;  3OFN G;  3VBB A;  2ZR3 A;  1SRY A;  2IJJ A;  4PDR A;  1DF5 A;  5LHG A;  1S5H C;  1R73 A;  1Y66 A;  2IU0 A;  2WLN A;  2HFE C;  2HKO A;  2Q6A A;  3P30 A;  1M57 C;  4QNH B;  1UJW B;  3W7X A;  1GTO A;  4JTA B;  5L3E A;  1V54 C;  1MAB G;  1AI7 A;  1KP2 A;  3SYC A;  1AJN A;  3LDC A;  3E89 A;  3SJQ C;  1YIJ V;  1FXK C;  3OW2 U;  2EJR A;  4MVZ A;  3CCL V;  1ZWI C;  3E8B A;  3CCQ V;  5CBH A;  2ZQM A;  1BHB A;  4RQE A;  3ABK B;  3JD4 A;  1DTO A;  2P6J A;  1VQ8 V;  1K97 A;  4X89 A;  1Q82 W;  3LDE A;  3CCE V;  2XAF A;  4FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...