1YIJV

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yijV00
2OTLV 3CCLV 1KC8W 1KQSU 1YITV 4WCEV 2D3OW 1VQ4V 3CC2V 1QVFU 3CCVV 2OTJV 3G71V 1YJNV 1K8AW 3CMEV 1VQOV 3CC7V 2QEXV 1VQKV 1YIJV 1YJ9V 4WFAV 1VQ7V 3CD6V 1VQ5V 5DM6V 1Q86W 1Q81W 1KD1W 1S72V 3CCQV 1VQMV 1Q7YW 3CCSV 1YJWV 1K73W 1K9MW 3CXCU 1NJIW 1M1KW 1QVGU 1VQ9V 3OW2U 3CCUV 3I56V 1JJ2U 1N8RW 1VQLV 1M90W 1YI2V 3G6EV 3G4SV 2QA4V 1VQ8V 1Q82W 3I55V 3CMAV 1W2BU 3CCJV 3CCMV 1VQ6V 1VQNV 4WF9V 3CCRV 1YHQV 3CCEV 4WFBV 3CC4V 1R73A 3CPWU 1VQPV
chains in the Genus database with same CATH superfamily
2KG7A 2IH3C 1OCCB 1H2KA 1XHXA 4J10A 5J2UB 1AROP 3CCQV 3ZBHA 4OPHA 5CA1A 1XMOO 2Z0AA 2EZPA 3ZEDA 3HKEA 1GTOA 5L3DA 5EBWC 1XMQB 2RMKB 2EINB 2E75B 3JAWB 4FIPC 1W2BU 1VQNV 4NTYA 4X1YA 2NR5A 3WB1A 4DV5B 2RJZA 3CXHF 3WG7C 3S3XA 4PA7A 4AILC 4JI0B 1YJ9V 3ABTA 1BMFG 3SGIA 3W7WA 2WLIB 3B09A 4FLVA 4JI7B 1HNXB 2Q67A 2WSSG 3FYIB 2FKXA 1IX9A 1E1QG 1OCZB 1TA8A 1SS3A 4TWKA 2QA4V 1FPOA 2DWDC 3E22A 1YSCA 3OEEG 4GZRB 5KHKA 3QG5A 4H37A 4J7KA 4O4LB 1ZX3A 3ABMC 1URFA 2HVKC 4EEQA 4TOIA 2ZM6B 2DYSB 3ASOC 1FXKA 1NT2B 1SQVH 3C3SA 3JALB 4U3JB 5D5QA 2YEVA 1BCCH 2EIJB 2W0FC 4JASA 1MZEA 2ZT9B 4BAYA 2IJIA 5JJNB 3X2QC 5IY5C 2N05A 3L70H 2ZE5A 3CSXA 3FX7A 3CYOA 3SJAC 4X1IB 1MSWD 1I7FA 1VQ9V 4LFBB 4RQFA 2DOSA 2HG5C 4K35A 5LXTB 4ASUG 2HR3A 3B77A 3SDLA 5BXZA 3JAWA 1WPBA 4MVSA 1VQ4V 4XDKA 2FL4A 4O2AB 1WB7A 3WB0A 4EFEA 4JI7O 5ITZA 1TUBA 4GKKO 4NKGB 3BAAA 3ZRSA 5B1BB 5KMGB 1N33O 3HKBB 4PA9A 2W6IG 5BR8B 1Q43A 2HP8A 2EILC 4WFFA 3KG2A 2QDOA 3FKSG 1J95A 5GTIZ 1PKXA 3CCRV 4I5SA 1OHHG 2DN9A 5LP6C 3AG1C 4X1KA 2PF4E 4JYAB 2GUZB 4W4KA 3G67A 1ENVA 2EIKC 4DV0B 5CN0A 1AB3A 3HKCA 4NXMB 4FZ0A 3CPWU 2QWRB 1IBMO 1CEZA 4D6TH 1UFIA 2G38A 5EBLC 1HNWB 4I7ZB 3O9OA 1A32A 4TSFG 3L71H 5CA0A 4DR7O 4FM2A 1M56B 3CJHB 3LDDA 4F4LA 3KKYA 4TQDA 2DJVA 4B08A 2HLDG 4ZI7B 4QNHB 2UUBB 4DV2O 1X4TA 3VQWA 1WNSA 2QM8A 2CUGA 5FPRA 1YCIA 4JV5B 1H2MA 4MW8A 2PUSA 4ICGA 2UXDO 3UT5A 3JARB 1VQMV 3CJHA 2JJ2G 2IJKA 1VQLV 3VBBA 3A0RA 2EIMC 3JYCA 1DK1A 1RM1C 2AXTZ 2XAHA 3EFFK 2R9RB 1P49A 1KKCA 1ZL8A 3KCXA 2QM7A 4GX2A 4PDVA 3ML0A 4WFAV 1DGSA 4LWSB 4UCSA 1H38A 4NXNB 4B3TO 3SYCA 1N8RW 4E2LA 2FB5A 4X1YB 4TUYA 2ILMA 3CWBH 4B3SB 2WLLA 2HKOA 2K9PA 1FXHA 3QTCA 3K0DA 1EM1A 4PDLA 4J42A 2Y0PA 4B3MO 4OX9O 2Y69C 3H1KH 2QKCA 1SQBH 4IIJA 2X0LA 3E22B 4ZI7A 2QE7G 1AI4A 2IJJA 1HNZO 1K8AW 1IZ3A 4FMTA 5LHHA 5JCOC 1Q86W 1RSOB 1GN4A 2A7WA 3K9SA 3IFXA 1I08A 3MHHC 4K8XA 4KUMA 3APOA 1R6TA 1PNLA 4I0XB 5TISZ 5EYPB 1R6KA 2QWOB 3TXSA 3PJSK 2ZDIC 4LNUA 5KHJA 3CCVV 1ZL8B 4GX5A 3OM3B 4O4IB 4EB6B 2QEXV 1DTOA 2PGGA 1J5EB 3LSQA 1YEWA 1HDJA 3QO7A 3U10A 4DR5O 2QTSA 2AW9A 3B4SA 4FVMA 1BQ0A 4GUNA 4JI3B 2BSKA 3CRQA 3TETA 1FXKC 1P4RA 2WA3A 3JD0A 2UU9O 2QSAA 3X2QB 4I55A 2X6CA 2EIJC 4JI4O 3RVZA 1M57C 2B9ZA 2BTOA 4CH6A 5A9GA 2XUMA 2VWJA 4JZGA 5GONA 5IJ0A 2GTAA 1WP7A 5JH7A 3SPGA 2QWQB 3W7XA 2P5OA 1W59A 3L73H 1O9HA 3CS5A 4EB6A 1MNGA 2NNUA 2C2AA 3N27A 1QLEC 4YIOA 3MHSC 3E8FA 1JOYA 4DK0A 3T1HO 4KXRA 3BVOA 4X9QA 5FNVB 4CS4A 3DXRB 3OMAB 1FFXB 3E86A 2XTAA 5IYZA 1YTFB 2P22C 1WA8B 3HR0A 4UCTA 2LW1A 4TQFA 1G6UA 2LFRA 1SKVA 3H9VA 1UJWB 5LHIA 1K3EA 3JAKA 1SZTA 3J7AU 5JQGA 2WLJA 5H6QA 4GKJO 2PZSA 5L3BA 1FFXA 2UUAB 3OFNG 4DV5O 2UXNA 4YHHO 1B04A 2DYRB 1DF4A 4WFEA 1XMQO 3LDCA 2ETNA 4AHCA 3SR2C 4JI4B 1VF6A 3T4DA 2Q7GA 2W6JG 2HHHO 1AVMA 1N4CA 4WFHA 4JYBA 3B8MA 1Y4MA 3E8GA 3WU2Z 1K4DC 2PTMA 3UQ8A 1H2GA 4O4HB 4GLXA 1RSOA 1T5EA 1HWYA 2UXXA 4LF4B 1PV0A 4QPKA 2D3OW 1AILA 4CH4A 1VARA 2YIAA 4LF9O 3R66A 3DC6A 3L75H 4JPRA 4LFAO 2JGDB 4FLTA 2KB1A 1XILA 5IJ9A 5IYDO 4X1KB 1HR0O 2E5LO 1XNRO 1E1RG 5KUMA 3OR6C 3ZMTA 2WAMA 1SQQH 4Z1VA 4PELA 5L3FA 2XAQA 1BE3H 4O4LA 1FS0G 3H1IH 5DN6G 3CCSV 3K08A 5LMNO 2VQEO 1H8EG 4PA3A 2RNBA 3SYAA 2AZ0A 4OPAA 3QO5A 3CMAV 4JZ2A 2AHYA 3AG2C 1GK9A 4LF8O 3M8AA 1ZLZA 4WFGA 5C93A 2PY5A 3K04A 2UXDB 4IGGA 3ABLB 1KD1W 1XUQA 2ITDC 3ABKB 4CS3A 4BW9A 2JIZG 1IXMA 4DV2B 2OCCB 3HKEB 1V55C 4X20A 1FKAO 2ADPA 3K9AA 1X59A 5K1PA 2P4KA 4DUZO 1VF6C 1F23A 1K34A 4I55B 3OAAG 1DLBA 4PHZA 1LUWA 5JJEB 4LC1A 3QF7A 4BIUA 5B1BC 1G8MA 3EXAA 1AJPA 5EC1C 4MTXA 3VOUA 3JCUZ 1L0LH 4DR1B 3AK1A 1TAEA 3RYFA 5KHGA 3K0GA 4N23A 1ORQC 1Q6HA 5EZYB 5FPOA 3OD4A 4LF5B 4LCUC 2ZNJA 2GDSA 3BPZA 4IHJA 5DEDA 4GX0A 4PI2A 4MTOA 2R9IA 3FB8C 5B1NA 4O2BB 2V1DA 2ZXWC 2UUBO 5ITZB 2LFSA 2BTQB 1AJQA 2W0XA 4DR6B 3UO2A 4JYYA 1NU1H 1XEQA 3WG7B 1BZKA 1S5JA 3P3PA 3ZHUA 4GKKB 3RGBA 2QWNB 3CXCU 4JI2B 2FMLA 4JI8B 2KG7B 4UV9A 2YDEA 4WBNB 1NR1A 1F51A 2OT5A 1SF9A 2CTQA 4DR3O 4R6ZA 3R65A 4Q20A 4X20B 3K5OA 4QE7A 2DYRC 5CBGA 2WPDG 4JAVA 1Y6XA 4LBEC 2WWWA 3RYCB 2QKSA 2EILB 1N36O 3CRMA 5KUKA 2UUAO 5LYJA 2XNDG 1BS3A 1F4NA 2GBOA 2LO1A 4GKJB 2DW4A 3K59A 1RFYA 2JGDA 4GYCB 2QWPB 2ZQMA 2EJRA 3K5MA 2UUCO 2Y48A 1VIBA 3QO8A 5JH7B 3CHXA 2ZR2A 2V7QG 3ZHRA 2JVDA 2EZOA 1AP5A 4MTGA 3JALA 1PL4A 4ZBMA 5GTHZ 4WF9V 2L6LA 1O9GA 2L35A 1R73A 1S5LZ 1MZFA 5L3EA 3OE7G 1XQ8A 2ZIOA 3HB3B 1V55B 1R3IC 1WP8A 4DR4O 1Q81W 1OCOB 2ARHA 4DYLA 2Y0IA 4TT3G 3AG3B 3F5TA 5B1OA 4UFZA 1VQ6V 4HNAA 1S76D 2BOCC 5JWPA 2JK5C 4LNUB 3CEIA 4MVUA 1BT8A 2ZR3A 4AQYB 4FLXA 2UU9B 3T1YO 1ROPA 4DW0A 3BEHA 1WA8A 2ZM6O 4DV4O 3B8NA 2EX3A 3OEHG 1JQ0A 1ZWIC 3OTOO 3SPJA 2F95B 3ZN1A 3BFRA 3ICXA 1I0HA 3RYHA 2DWEC 5KA5A 1S77D 1J5EO 2R70A 4UXNA 1QU7A 2ATKC 3SJBC 4LF6O 4IYIA 4MVOA 3UT5B 2MK3A 5CBHA 4FPPA 1GN6A 3N2KA 4NB5A 3STLC 2YSUB 1AI5A 2JJ1G 1E79G 4CS2A 3ETDA 3GWOA 1OCCC 1MSDA 4J7ZA 2ZE7A 2GV9A 3GWKC 2JS3A 1QNMA 2WLLB 1SA0A 1Q6IA 3C3TA 1U96A 5CB4B 3E35A 1B3QA 5BMVA 3BA8A 4WBNA 3ABLC 1BL8A 4E4EA 4H0LB 4JTCB 1XI1A 2YXLA 3OR7C 3JD4A 4ZKIA 2MW2B 1IBKB 2EIMB 3HKDA 3L74H 2LJ2A 3K3WA 3APQA 4OX9B 4DV1O 1M9NA 4J9YB 1I94O 3A0HZ 3C90A 4XDLA 3F7YC 4DRXA 1Z5VA 3FYEB 1QQCA 1PPJH 5H6RA 4U7NA 1RPRA 3JD2A 4YXWG 4I0XA 1ZTEA 5GW7A 5JCOA 1L0NH 2Z3YA 4FLZA 3G6BA 2QGNA 2M6YA 3JASA 3UM7A 4DO2A 1WB8A 5LP6A 2CGNA 1SQFA 2YC0A 3UCSC 4X62B 3ZX6A 2H3OA 1MG1A 3RFRA 1K73W 1QHTA 1NKDA 4YY3B 4K8ZA 4P2ZA 4I4TB 2YIBD 1R3JC 2RDCA 2R72A 4G27B 1M4UA 4IIJB 4YIPA 1IBLB 1LUVA 2KSDA 2Y4UA 4F6EA 1M93A 5KAIZ 1GM9A 2XOKG 4OGQB 4IT5A 4YY3O 2D2CB 2RQ6A 2JEUA 4F6RB 5JVDA 1LNQA 4DV7B 3H1JH 4I4TA 3K79A 2HFEC 4I9WA 4RQEA 1YI2V 4N21A 1Q82W 4RO2A 4JTAB 3ASNC 4DR7B 1AR4A 3QNEA 1GRJA 2OTJV 4KFMA 5JQGB 3E89A 2LQTA 3FAVA 4FJCC 2WLKA 3A8TA 1NH2B 2CTRA 2DYSC 3JSLA 3P3NA 3FFQA 3ABMB 3RYIB 5LL6Y 2XAGA 5BY1A 1YVWA 3W7SA 1JPXA 4QIWF 2CK3G 2H94A 1D2DA 4AI8A 1BQZA 1JA8A 1US6A 4DR2B 1SESA 5FLXN 4NTWA 4FM0A 3BRCA 5LXTA 2IU3A 5C8YB 5IY5B 1I5XA 3CCUV 2F23A 3BABA 2Q0AA 5LA6A 5BMVB 1BHAA 3LSUA 1ZAUA 1SZXA 1ZUQA 1MA1A 1P7GA 2IM9A 3K5NA 2M7WA 4JI5B 4FLYA 1N32O 1KKDA 5L3GA 5CA1B 3ASNB 1YJWV 5B1AB 4X64B 2B1IA 2CTWA 3SYOA 3SJCC 1IURA 3T2MA 3AG3C 5EYPA 3CRAA 2YEVB 4DUYB 4IL6Z 2VRZA 2BOBC 4U3JA 4LFCO 4MVZA 2B1GA 2HVJC 1QVFU 1Y66A 1PNKA 2YXYA 3RYHB 3RYCA 3T1YB 5IWAO 2UUCB 5EIBD 2CH7B 5KAFZ 2PYLA 1R3LC 4AQYO 3H1LH 3THOA 1XL4A 4X66B 3CRRA 1XL6A 4NTXA 3AG1B 3M7MX 5IDJA 3CCJV 3KCYA 3SPHA 3N2GB 1SRYA 2CE4A 3E8HA 4X66O 4PD4F 4DRXB 3MAQA 2XAFA 5LOVB 3LSSA 3F5WC 1TVKB 4DR4B 3E8BA 2N04A 2IH1C 4DUYO 1THZA 1KB9F 1K33A 2OTLV 2YUAA 4LH7A 4X1IA 4DR5B 4RWUA 1SC5B 1NZ6A 1QLEB 2QKAA 4BW5A 4DR6O 3SYPA 3UO3A 2Q69A 4J80A 2BCCH 2KQXA 3FB7C 4MVRA 4C7UA 5KHHA 5LGUA 5B3SB 3JD1A 1N36B 3E2EA 2BSKB 4HZ3A 1Q8IA 3CD6V 5H2FZ 2Q7EA 4LWSA 4DR2O 2QR4A 4FZ1A 1QVGU 1JFFB 1N34B 5B5EZ 1HNZB 1NVPB 3IAYA 3DXRA 2E74B 1UPGA 3MD0A 4BWAA 5EC2C 3DTUB 1CP9A 4K0KO 1OCRC 3SPIA 3ZRXA 4ABMA 2JEXA 3ZHTA 2WLMA 2Q9LA 4JI8O 5D5PA 4JI2O 2AGAA 2O57A 1NS1A 2N74A 2HJDA 2FTKA 4JAUA 5JVDB 5LA6B 4F6RA 1Q7YW 4KHPB 2ADQB 2ZCEA 4JF3A 1K9MW 2P7TC 1NQTA 2VQFO 1OV9A 1W0JG 2IW5A 1QCEA 3G80A 4UVAA 3ZN0A 4LH6A 4ZOLB 3CCEV 1JJOA 3AG7A 4H33A 2X7RB 2ZIMA 1TGOA 4D7TA 4IHJB 2YXHA 1P7BA 4TUYB 2F4VO 1S72V 2HEPA 3CP1A 2E3CA 3JASB 3TGUH 1EN4A 2X6AA 4MVQA 4LF8B 3D8CA 4X8AA 3ZJZA 3ZCCA 4I9QA 5JJJB 5KX5A 1V9PA 1FJGB 3OMNB 1FJGO 1Q5OA 1BHBA 4R7CA 1K97A 2HJFC 1YITV 2A3QA 2EIKB 4BIZA 1SQPH 3CMEV 2CAZC 4J9ZB 1JMKC 3AK2A 1S0VA 2BE3A 2DQ3A 2GUZA 5KA6A 1G4YB 2PI5A 5DECA 2F4VB 4JV5O 1JFFA 4MT8A 3G6EV 1N0NA 1HR0B 2E5LB 3CB2A 1IDSA 4LP8A 4I50A 1EBOA 4DUZB 4G2KA 1VQPV 1KC8W 1B06A 4NYKA 1H2LA 4LFAB 1RP3B 1Y76A 4PDRA 1K92A 4R50A 4KP4A 3OTFA 2GHYA 4L8JA 4CZZA 1TUBB 4B3RB 1FYJA 1IBKO 3ZHQA 1IBMB 4O4JB 2ZE6A 4PI0A 1GM8A 1PL0A 4G28B 2Y69B 2B5UA 4GCZA 3RYIA 4MSWC 3JAKB 3CC7V 4UCUA 1IVSA 3E83A 5LMNB 1Y74B 2P67A 4DV3B 4U7OA 2V4DA 1NJIW 2ZKOA 3H1HH 4L87A 5L3CA 2ITCC 2XASA 3D3QA 3I5DA 1WPXA 3B2EE 3OMIB 3K06A 4UUJC 1AI6A 1PNMA 4ZIBA 1JX9A 1NBMG 3STZC 4MTFA 4X65O 1VF7A 1KP2A 2F1MA 4HBNA 3HKDB 2Z5UA 3K57A 1WAZA 3HPLC 2ZXWB 4TV9B 4LF9B 2F93B 1GM7A 3OTOB 4P9PA 4HNAB 4MS2A 2Q4PA 4DV4B 1GKFA 1FXVA 1IXBA 3NXSA 4EFBA 5GONB 5IJ0B 1COWG 4YJ3B 2CTPA 3IC9A 1AP6A 2LGQA 2RN9A 4NVPA 5KHIA 1K5QA 1WN7A 4DXWA 3J81N 3SPCA 1OZ0A 3AK3A 4J41A 5LP6B 4O4HA 1FD9A 1JJ2U 2WA4A 2IJHA 4PDMA 2YICA 3UKMA 3VQVA 4J11A 4YHHB 2EINC 4LF7O 3CC4V 1R1BA 1Z2GA 2Q8VA 4FK5C 4FFKA 3NR7A 4DV6B 3G71V 4P9OA 5IYZB 2OYQA 4BIOA 5J2UA 1XBLA 1GN3A 5IWAB 3EVKA 4JI3O 5CMUA 1ZSPA 1VMGA 2JGUA 4QPJA 1SETA 3RN4A 2Q0OC 3TCUA 3LDEA 3T1HB 1AR1B 2AZ2A 3D36A 4X64O 3DSQA 1MOFA 3BCCH 3FB6C 2JDIG 1V54C 3BHPA 2LGWA 4DV6O 5IT9N 3CCMV 4ZOLA 4LF7B 3ETEA 3ETQA 5LGTA 3A0BZ 3O65A 2AHZA 2XT9A 3TXQA 1R3KC 4B7EA 4R8CA 2EJ7A 4W4LA 2YI8A 3KZIZ 4OXSA 2BTQA 1M90W 1Q3EA 5J2TB 3B40A 3RT3C 1Y74A 3I55V 4B3RO 3GVMA 1Y76B 1YTFD 1FAFA 1AJNA 4B3MB 5C8YA 4JI1O 2VS0A 2DMXA 3ETGA 5LMUB 1WLEA 1VQ5V 2WLHA 1VEWA 5DM6V 4B3SO 1PP9H 4X65B 3OGIB 4XDJA 3LNNA 3AG4C 2ZNIA 1XNQO 2ZINA 1KBHA 1PD3A 5EZYA 1EN5A 4JYCA 1QR9A 5CBFA 2DQ0A 4TV8B 4Q6GA 3AG4B 1SQGA 2A79B 1K7DA 4H13B 5LBQA 4DV7O 5LGNA 4DV3O 3JCZA 3DGEA 1FXKB 2LW7A 1JVMA 5EBMC 1Z5WA 3ZRWB 2A9HA 4GT1A 2IBZH 3WFVA 2CDYA 4P30A 4QJFB 1G1XB 1IBLO 2Q68A 2XHBA 1QLNA 3ZMSA 3TK1A 2EBOA 4DR1O 4WCEV 3CC2V 3OUFA 2A0LA 1KUQA 3L72H 1K5SA 2WLIA 1VQ7V 5KX5B 3AG2B 2OIEA 3F7VC 3EHBB 3GB7C 5LOVA 4X89A 1L8DA 1YZBA 4O2BA 1VQ8V 3OT7A 2UXCB 3A2FA 1R6NA 3HKCB 3J80N 3JSNA 4GX1A 4NXNO 1HNWO 1M5IA 1KYOF 3TJTA 1I94B 5B1AC 3T1CA 4K0KB 3RWRD 4J7JA 4TV9A 4UB8Z 1EN6A 1MMMA 3ZIAG 1S3JA 4FFBB 3D36C 5B3SC 2Q6AA 4UCRA 4UV8A 5F2VO 2JRIA 3T4ZA 4CC6A 4Z2WA 4TV8A 3ZHSA 1QR8A 3ASOB 1EZVH 1YIJV 1VP7A 1KMIZ 5LHGA 4CH5A 4O4IA 4RAIA 1I5YA 3JATB 1D5AA 4JAAA 5CA0B 4FLUA 2X6BA 1PM9A 3H01A 4DK1A 2IU0A 1F7YA 2E76B 3IGAC 3DC5A 1DF5A 4YJ2B 1GAXA 5BR8O 2KKWA 5J9PC 2P06A 3S3WA 5A2QN 3BA9A 1QBZA 5J2TA 1V54B 4O4JA 1GMGA 1NH2D 4JGSA 1SA0B 5EIBC 1L1FA 1XHZA 4NXMO 1EFRG 1P84F 3CCLV 2HHHB 1BGYH 1N34O 1SERA 3OUSA 4UCOA 1N0JA 3OGCC 3Q4HB 2Q73A 1D5NA 1HW7A 4PJ0Z 1TVKA 4JYAO 5CA3A 1YDXA 4UVCA 3RBZA 4B7KA 1NVPD 1NI8A 3U11A 2YIDA 4WFBV 5FNVA 3CRCA 4O2AA 2XAJA 2OCHA 3ZMUA 3IC7A 1N33B 1KP3A 3W7UA 1VF5B 5EK0A 3BY6A 3U0ZA 2UXBB 4PA6A 2RCVA 2Q7HA 3JD3A 2R9AA 2JS5A 1JCHA 3ABKC 3LUTB 4YJ2A 2K1EA 4RUFA 4U3FH 2YIBA 2P4VA 3OW2U 1WJZA 2DE0X 5CB4A 1AR5A 1HNXO 1RPOA 4ZHQA 4LFBO 3D3IA 3JARA 1VQOV 1VQKV 2UXBO 5H5NA 4LR3A 2QTOA 5H9CA 4JI5O 1N32B 4JI0O 1NTZH 5HFLA 1YF2A 3QVNA 3K58A 1B6QA 1XDCA 3N2KB 5KMGA 2F66C 2P90A 3ZRVA 4MVMA 4ZHQB 2ODMA 1NTKH 1XMOB 4YJ3A 3K5LA 4KL1A 5AG2A 4UVBA 4CH3A 4IYHA 4D7SA 2YI9A 1FFTB 3N2GA 1XREA 4LFCB 3ZMVA 3ZHVA 5LYJB 1NR7A 4DR3B 1OJHA 2WLNA 5BZBA 1K4CC 3SJQC 1GH6A 3WB2A 2CH7A 4Z1MG 1Y67A 3K03A 3SYQA 4DW1A 4HYOA 1LR1A 1YHQV 2ZD9A 3RW0A 1SQXH 3VQXA 1HP8A 2A06H 4XBFA 5IJ9B 3RVYA 4EKWA 5E79Z 5IE9A 2OIGA 1BSMA 3MDSA 4UB6Z 4HAMA 4K3AA 4H44B 2NN4A 1Q6UA 3L9DA 4LF5O 1H2SB 1RM1B 2CGOA 1H8HG 1XOUA 1KQSU 3VQYA 2ZDIA 3ZS8C 1NTMH 1KECA 1OCZC 4BR6A 1EZJA 4X62O 1MABG 5KLVH 2GSMB 3FB5C 1GO3F 4JI6B 4A5UB 4PV1B 2OCCC 2FYUH 3JATA 4MW3A 3P32A 1H2NA 1KU9A 4CC5A 2UXCO 4B3TB 4FLWA 1CPYA 2QM4A 2H8PC 4JI6O 1AI7A 4UCVA 3FAVB 4DV1B 1TUEB 1M56C 5IYBO 4FM1A 3JAMN 1M57B 2LP7A 3HKBA 5FL7G 1OCOC 3P30A 2PYJA 1S5HC 1Q90D 5E1AC 2OWOA 1GN2A 1YJNV 2NLJC 5K1XA 4QGPA 4X88A 2VQEB 3PN1A 3W7TA 4PA4A 1M1KW 1W0KG 3ABUA 3M99B 2YS8A 3IJ4A 4JTDB 1CXZB 2VWKA 5IYCO 3G4SV 4RUEA 2GTSA 3CX5F 1XNRB 2ZE8A 2PI4A 2VQFB 1OCRB 2P6JA 2Q5ZA 1XNQB 1F4MA 1YXBA 1JR9A 4KHPO 4QE9A 4NR1A 3AEIA 4LF6B 2F43G 3LNMB 3RYFB 2EULA 5LMUO 3FD9A 3I56V 3ZRWA 4CBCA 4JI1B 3CE2A 4FFBA 3Q4HA 3ZMZA 4I50B 1U97A 4DV0O 4LF4O 2QJ1A 5B66Z 2Y4TA 5HFMA
chains in the Genus database with same CATH topology
3W7SA 4QPKA 1AJNA 1JPXA 2D3OW 4QIWF 2CK3G 2H94A 2IH3C 3ETGA 1OCCB 1WLEA 4JPRA 1VQ5V 2WLHA 5DM6V 1SESA 1AROP 3CCQV 2KB1A 4XDJA 2IU3A 2EZPA 5IY5B 1I5XA 3AG4C 3CCUV 5IYDO 1GTOA 5L3DA 5EBWC 2EINB 1PD3A 4FIPC 1W2BU 1VQNV 4JYCA 1E1RG 5KUMA 1QR9A 1BHAA 3OR6C 3ZMTA 5CBFA 2DQ0A 3WG7C 2WAMA 3AG4B 4PA7A 4PELA 5L3FA 2M7WA 2A79B 1KKDA 1K7DA 2XAQA 5L3GA 1YJ9V 5LBQA 3ABTA 1BMFG 5LGNA 3W7WA 1FS0G 3DGEA 3JCZA 1FXKB 2WLIB 5DN6G 3ASNB 3CCSV 3K08A 1JVMA 1YJWV 5EBMC 1H8EG 5B1AB 3ZRWB 4PA3A 2Q67A 2A9HA 2WSSG 2B1IA 3FYIB 4GT1A 3SYAA 3SYOA 3WFVA 4P30A 4QJFB 1E1QG 1OCZB 4TWKA 3T2MA 2QA4V 3AG3C 2DWDC 3OEEG 2Q68A 1YSCA 3QO5A 3CMAV 2YEVB 2AHYA 3AG2C 3ZMSA 1QLNA 1GK9A 2BOBC 4H37A 3TK1A 3ABMC 2B1GA 2EBOA 2HVJC 4MVZA 2HVKC 4WFGA 4WCEV 5C93A 3CC2V 1Y66A 1QVFU 2DYSB 3OUFA 1PNKA 3K04A 2A0LA 1K5SA 1FXKA 2WLIA 3ASOC 1VQ7V 3ABLB 3AG2B 1R3LC 3F7VC 3EHBB 1KD1W 2ITDC 3ABKB 2YEVA 1XL4A 3GB7C 2EIJB 4X89A 2W0FC 2JIZG 1IXMA 1XL6A 2OCCB 3AG1B 1V55C 1VQ8V 4JASA 3K9AA 5IDJA 3CCJV 1R6NA 4BAYA 3SPHA 2IJIA 1SRYA 3E8HA 1F23A 1K34A 3X2QC 3OAAG 5IY5C 1DLBA 2XAFA 4LC1A 4BIUA 1G8MA 4GX1A 5B1BC 3LSSA 1AJPA 5EC1C 3CYOA 4MTXA 3VOUA 3F5WC 1MSWD 5B1AC 3E8BA 1VQ9V 3T1CA 4RQFA 2HG5C 2IH1C 4ASUG 3K0GA 4N23A 1ORQC 3ZIAG 1THZA 1K33A 4LCUC 1S3JA 2HR3A 3B77A 5B3SC 2OTLV 2Q6AA 4UV8A 3T4ZA 4MVSA 1VQ4V 4XDKA 1QR8A 3ASOB 4GX0A 3ZRSA 1YIJV 4MTOA 5LHGA 1QLEB 5B1BB 2R9IA 4BW5A 4RAIA 3FB8C 4PA9A 1I5YA 2W6IG 5B1NA 2EILC 4WFFA 2V1DA 3SYPA 2ZXWC 2X6BA 3KG2A 2Q69A 3FKSG 3H01A 1J95A 2IU0A 1PKXA 3IGAC 3CCRV 1DF5A 3FB7C 4I5SA 1OHHG 4MVRA 5LGUA 2LFSA 3AG1C 3JD1A 1AJQA 5B3SB 5J9PC 3WG7B 3E2EA 4HZ3A 3CD6V 1QBZA 1V54B 1GMGA 3CXCU 1NH2D 1QVGU 1ENVA 4JGSA 2EIKC 1NVPB 4UV9A 1NR1A 1F51A 2OT5A 1L1FA 5CN0A 4R6ZA 3MD0A 3DTUB 1CP9A 3R65A 1EFRG 4Q20A 5EC2C 4QE7A 3CPWU 1OCRC 2DYRC 3CCLV 3SPIA 1CEZA 5CBGA 3ZRXA 2JEXA 2WPDG 2WLMA 5EBLC 1SERA 4JAVA 3OUSA 4TSFG 2FTKA 4JAUA 1Q7YW 3OGCC 4JF3A 1K9MW 4LBEC 2WWWA 2P7TC 2QKSA 2EILB 1NQTA 1M56B 3LDDA 4F4LA 5CA3A 4UVCA 3RBZA 1W0JG 5KUKA 1NVPD 2IW5A 1QCEA 2XNDG 1F4NA 4UVAA 3ZN0A 3CCEV 2HLDG 4WFBV 4H33A 4QNHB 2X7RB 2DW4A 2QM8A 1P7BA 4MW8A 2ZQMA 2EJRA 2XAJA 3ZMUA 3IC7A 2Y48A 3QO8A 1S72V 1KP3A 3CP1A 3W7UA 1VQMV 5EK0A 3BY6A 2JJ2G 2ZR2A 2V7QG 2IJKA 4PA6A 2EZOA 2X6AA 4MVQA 1VQLV 4MTGA 3VBBA 3JD3A 3ZJZA 4X8AA 3A0RA 3ZCCA 2EIMC 3JYCA 1JCHA 3ABKC 1RM1C 4ZBMA 3LUTB 4WF9V 2K1EA 3OMNB 4RUFA 3EFFK 2XAHA 1R73A 3OW2U 2R9RB 1BHBA 4R7CA 1K97A 2HJFC 1YITV 2EIKB 4BIZA 5L3EA 1RPOA 2QM7A 4GX2A 4PDVA 3CMEV 3ML0A 3D3IA 1VQOV 3OE7G 4J9ZB 1VQKV 4WFAV 3HB3B 1V55B 1S0VA 1R3IC 2QTOA 5H9CA 1Q81W 1OCOB 2DQ3A 5KA6A 1G4YB 1H38A 5HFLA 2PI5A 3SYCA 1N8RW 4TT3G 3AG3B 1B6QA 4MT8A 3G6EV 4E2LA 5B1OA 2P90A 1VQ6V 3ZRVA 1S76D 4LP8A 1EBOA 2BOCC 4MVMA 4G2KA 1VQPV 1KC8W 2JK5C 2WLLA 4PDRA 4MVUA 2HKOA 1K92A 4UVBA 4R50A 2ZR3A 1FXHA 4KP4A 3K0DA 2GHYA 4PDLA 4CZZA 1ROPA 2Y69C 1FFTB 3BEHA 2X0LA 3B8NA 3ZMVA 2QE7G 3OEHG 1JQ0A 1AI4A 1ZWIC 3SPJA 1GM8A 1NR7A 2IJJA 3ZN1A 1PL0A 4G28B 2WLNA 2Y69B 2DWEC 2B5UA 1K4CC 5BZBA 4GCZA 3SJQC 5KA5A 1S77D 1K8AW 4FMTA 4MSWC 4UXNA 3CC7V 2ATKC 5LHHA 3E83A 1Q86W 4MVOA 2MK3A 2P67A 5CBHA 4Z1MG 4U7OA 1NJIW 4FPPA 3K03A 3SYQA 3IFXA 3MHHC 2YSUB 3STLC 1AI5A 2JJ1G 1E79G 4HYOA 4KUMA 3ETDA 3GWOA 4L87A 1OCCC 5L3CA 1YHQV 2ITCC 1PNLA 2ZD9A 3RW0A 2XASA 1R6KA 1WPXA 3OMIB 2WLLB 1AI6A 1PNMA 3K06A 3PJSK 1JX9A 2ZDIC 4UUJC 4XBFA 3CCVV 4GX5A 3OM3B 1NBMG 3RVYA 2QEXV 1DTOA 3STZC 3E35A 4MTFA 1KP2A 2Z5UA 3ABLC 1BL8A 3LSQA 4EKWA 3HPLC 2ZXWB 3QO7A 1GM7A 4JTCB 3OR7C 3JD4A 4HAMA 4P9PA 4ZKIA 4MS2A 1GKFA 2EIMB 1FXVA 1RM1B 3NXSA 1H8HG 3K3WA 3TETA 1COWG 1FXKC 1KQSU 1P4RA 2ZDIA 3JD0A 1KECA 1OCZC 3X2QB 1K5QA 1EZJA 4DXWA 1M9NA 1MABG 4J9YB 1OZ0A 3SPCA 2GSMB 3FB5C 1GO3F 4XDLA 3F7YC 2X6CA 3FYEB 2EIJC 3RVZA 1M57C 1JJ2U 5H6RA 2OCCC 4U7NA 1RPRA 2IJHA 4MW3A 4PDMA 3JD2A 4YXWG 3P32A 3UKMA 3SPGA 5GW7A 2EINC 3W7XA 3CC4V 2Z3YA 4FK5C 1CPYA 3G71V 2H8PC 2NNUA 2C2AA 3UM7A 4DO2A 4P9OA 1AI7A 1QLEC 1TUEB 1MG1A 1K73W 3MHSC 1NKDA 3E8FA 1JOYA 1M56C 5IYBO 1M57B 4P2ZA 5CMUA 2LP7A 5FL7G 1R3JC 1OCOC 3P30A 1S5HC 4QPJA 3OMAB 4G27B 3E86A 1YTFB 1SETA 5E1AC 3TCUA 3LDEA 2LFRA 1YJNV 2NLJC 1AR1B 1GM9A 2XOKG 3D36A 4X88A 1MOFA 2JEUA 3W7TA 1LNQA 1UJWB 3FB6C 5LHIA 2JDIG 1K3EA 4PA4A 1V54C 1M1KW 1W0KG 3ABUA 1SZTA 3M99B 2WLJA 3K79A 5H6QA 2HFEC 4I9WA 4RQEA 4JTDB 5IYCO 5L3BA 3G4SV 1YI2V 4N21A 4RUEA 3OFNG 1Q82W 4RO2A 3CCMV 4JTAB 2UXNA 3ETEA 3ASNC 2PI4A 1OCRB 2DYRB 3QNEA 1DF4A 4WFEA 5LGTA 2P6JA 2AHZA 3LDCA 1F4MA 2OTJV 4KFMA 3E89A 4QE9A 1R3KC 3AEIA 4FJCC 4R8CA 2WLKA 3T4DA 2F43G 2W6JG 3LNMB 1NH2B 4OXSA 2DYSC 4WFHA 4JYBA 3B8MA 3ZRWA 3I56V 4CBCA 3ABMB 1Y4MA 3E8GA 1M90W 1K4DC 3ZMZA 1H2GA 3I55V 2XAGA 1HWYA 2UXXA 5HFMA 1YTFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL V;  3CCL V;  1KC8 W;  1KQS U;  1YIT V;  4WCE V;  2D3O W;  1VQ4 V;  3CC2 V;  1QVF U;  3CCV V;  2OTJ V;  3G71 V;  1YJN V;  1K8A W;  3CME V;  1VQO V;  3CC7 V;  2QEX V;  1VQK V;  1YIJ V;  1YJ9 V;  4WFA V;  1VQ7 V;  3CD6 V;  1VQ5 V;  5DM6 V;  1Q86 W;  1Q81 W;  1KD1 W;  1S72 V;  3CCQ V;  1VQM V;  1Q7Y W;  3CCS V;  1YJW V;  1K73 W;  1K9M W;  3CXC U;  1NJI W;  1M1K W;  1QVG U;  1VQ9 V;  3OW2 U;  3CCU V;  3I56 V;  1JJ2 U;  1N8R W;  1VQL V;  1M90 W;  1YI2 V;  3G6E V;  3G4S V;  2QA4 V;  1VQ8 V;  1Q82 W;  3I55 V;  3CMA V;  1W2B U;  3CCJ V;  3CCM V;  1VQ6 V;  1VQN V;  4WF9 V;  3CCR V;  1YHQ V;  3CCE V;  4WFB V;  3CC4 V;  1R73 A;  3CPW U;  1VQP V; 
#chains in the Genus database with same CATH topology
 2KG7 A;  2IH3 C;  1OCC B;  1H2K A;  1XHX A;  4J10 A;  5J2U B;  1ARO P;  3CCQ V;  3ZBH A;  4OPH A;  5CA1 A;  1XMO O;  2Z0A A;  2EZP A;  3ZED A;  3HKE A;  1GTO A;  5L3D A;  5EBW C;  1XMQ B;  2RMK B;  2EIN B;  2E75 B;  3JAW B;  4FIP C;  1W2B U;  1VQN V;  4NTY A;  4X1Y A;  2NR5 A;  3WB1 A;  4DV5 B;  2RJZ A;  3CXH F;  3WG7 C;  3S3X A;  4PA7 A;  4AIL C;  4JI0 B;  1YJ9 V;  3ABT A;  1BMF G;  3SGI A;  3W7W A;  2WLI B;  3B09 A;  4FLV A;  4JI7 B;  1HNX B;  2Q67 A;  2WSS G;  3FYI B;  2FKX A;  1IX9 A;  1E1Q G;  1OCZ B;  1TA8 A;  1SS3 A;  4TWK A;  2QA4 V;  1FPO A;  2DWD C;  3E22 A;  1YSC A;  3OEE G;  4GZR B;  5KHK A;  3QG5 A;  4H37 A;  4J7K A;  4O4L B;  1ZX3 A;  3ABM C;  1URF A;  2HVK C;  4EEQ A;  4TOI A;  2ZM6 B;  2DYS B;  3ASO C;  1FXK A;  1NT2 B;  1SQV H;  3C3S A;  3JAL B;  4U3J B;  5D5Q A;  2YEV A;  1BCC H;  2EIJ B;  2W0F C;  4JAS A;  1MZE A;  2ZT9 B;  4BAY A;  2IJI A;  5JJN B;  3X2Q C;  5IY5 C;  2N05 A;  3L70 H;  2ZE5 A;  3CSX A;  3FX7 A;  3CYO A;  3SJA C;  4X1I B;  1MSW D;  1I7F A;  1VQ9 V;  4LFB B;  4RQF A;  2DOS A;  2HG5 C;  4K35 A;  5LXT B;  4ASU G;  2HR3 A;  3B77 A;  3SDL A;  5BXZ A;  3JAW A;  1WPB A;  4MVS A;  1VQ4 V;  4XDK A;  2FL4 A;  4O2A B;  1WB7 A;  3WB0 A;  4EFE A;  4JI7 O;  5ITZ A;  1TUB A;  4GKK O;  4NKG B;  3BAA A;  3ZRS A;  5B1B B;  5KMG B;  1N33 O;  3HKB B;  4PA9 A;  2W6I G;  5BR8 B;  1Q43 A;  2HP8 A;  2EIL C;  4WFF A;  3KG2 A;  2QDO A;  3FKS G;  1J95 A;  5GTI Z;  1PKX A;  3CCR V;  4I5S A;  1OHH G;  2DN9 A;  5LP6 C;  3AG1 C;  4X1K A;  2PF4 E;  4JYA B;  2GUZ B;  4W4K A;  3G67 A;  1ENV A;  2EIK C;  4DV0 B;  5CN0 A;  1AB3 A;  3HKC A;  4NXM B;  4FZ0 A;  3CPW U;  2QWR B;  1IBM O;  1CEZ A;  4D6T H;  1UFI A;  2G38 A;  5EBL C;  1HNW B;  4I7Z B;  3O9O A;  1A32 A;  4TSF G;  3L71 H;  5CA0 A;  4DR7 O;  4FM2 A;  1M56 B;  3CJH B;  3LDD A;  4F4L A;  3KKY A;  4TQD A;  2DJV A;  4B08 A;  2HLD G;  4ZI7 B;  4QNH B;  2UUB B;  4DV2 O;  1X4T A;  3VQW A;  1WNS A;  2QM8 A;  2CUG A;  5FPR A;  1YCI A;  4JV5 B;  1H2M A;  4MW8 A;  2PUS A;  4ICG A;  2UXD O;  3UT5 A;  3JAR B;  1VQM V;  3CJH A;  2JJ2 G;  2IJK A;  1VQL V;  3VBB A;  3A0R A;  2EIM C;  3JYC A;  1DK1 A;  1RM1 C;  2AXT Z;  2XAH A;  3EFF K;  2R9R B;  1P49 A;  1KKC A;  1ZL8 A;  3KCX A;  2QM7 A;  4GX2 A;  4PDV A;  3ML0 A;  4WFA V;  1DGS A;  4LWS B;  4UCS A;  1H38 A;  4NXN B;  4B3T O;  3SYC A;  1N8R W;  4E2L A;  2FB5 A;  4X1Y B;  4TUY A;  2ILM A;  3CWB H;  4B3S B;  2WLL A;  2HKO A;  2K9P A;  1FXH A;  3QTC A;  3K0D A;  1EM1 A;  4PDL A;  4J42 A;  2Y0P A;  4B3M O;  4OX9 O;  2Y69 C;  3H1K H;  2QKC A;  1SQB H;  4IIJ A;  2X0L A;  3E22 B;  4ZI7 A;  2QE7 G;  1AI4 A;  2IJJ A;  1HNZ O;  1K8A W;  1IZ3 A;  4FMT A;  5LHH A;  5JCO C;  1Q86 W;  1RSO B;  1GN4 A;  2A7W A;  3K9S A;  3IFX A;  1I08 A;  3MHH C;  4K8X A;  4KUM A;  3APO A;  1R6T A;  1PNL A;  4I0X B;  5TIS Z;  5EYP B;  1R6K A;  2QWO B;  3TXS A;  3PJS K;  2ZDI C;  4LNU A;  5KHJ A;  3CCV V;  1ZL8 B;  4GX5 A;  3OM3 B;  4O4I B;  4EB6 B;  2QEX V;  1DTO A;  2PGG A;  1J5E B;  3LSQ A;  1YEW A;  1HDJ A;  3QO7 A;  3U10 A;  4DR5 O;  2QTS A;  2AW9 A;  3B4S A;  4FVM A;  1BQ0 A;  4GUN A;  4JI3 B;  2BSK A;  3CRQ A;  3TET A;  1FXK C;  1P4R A;  2WA3 A;  3JD0 A;  2UU9 O;  2QSA A;  3X2Q B;  4I55 A;  2X6C A;  2EIJ C;  4JI4 O;  3RVZ A;  1M57 C;  2B9Z A;  2BTO A;  4CH6 A;  5A9G A;  2XUM A;  2VWJ A;  4JZG A;  5GON A;  5IJ0 A;  2GTA A;  1WP7 A;  5JH7 A;  3SPG A;  2QWQ B;  3W7X A;  2P5O A;  1W59 A;  3L73 H;  1O9H A;  3CS5 A;  4EB6 A;  1MNG A;  2NNU A;  2C2A A;  3N27 A;  1QLE C;  4YIO A;  3MHS C;  3E8F A;  1JOY A;  4DK0 A;  3T1H O;  4KXR A;  3BVO A;  4X9Q A;  5FNV B;  4CS4 A;  3DXR B;  3OMA B;  1FFX B;  3E86 A;  2XTA A;  5IYZ A;  1YTF B;  2P22 C;  1WA8 B;  3HR0 A;  4UCT A;  2LW1 A;  4TQF A;  1G6U A;  2LFR A;  1SKV A;  3H9V A;  1UJW B;  5LHI A;  1K3E A;  3JAK A;  1SZT A;  3J7A U;  5JQG A;  2WLJ A;  5H6Q A;  4GKJ O;  2PZS A;  5L3B A;  1FFX A;  2UUA B;  3OFN G;  4DV5 O;  2UXN A;  4YHH O;  1B04 A;  2DYR B;  1DF4 A;  4WFE A;  1XMQ O;  3LDC A;  2ETN A;  4AHC A;  3SR2 C;  4JI4 B;  1VF6 A;  3T4D A;  2Q7G A;  2W6J G;  2HHH O;  1AVM A;  1N4C A;  4WFH A;  4JYB A;  3B8M A;  1Y4M A;  3E8G A;  3WU2 Z;  1K4D C;  2PTM A;  3UQ8 A;  1H2G A;  4O4H B;  4GLX A;  1RSO A;  1T5E A;  1HWY A;  2UXX A;  4LF4 B;  1PV0 A;  4QPK A;  2D3O W;  1AIL A;  4CH4 A;  1VAR A;  2YIA A;  4LF9 O;  3R66 A;  3DC6 A;  3L75 H;  4JPR A;  4LFA O;  2JGD B;  4FLT A;  2KB1 A;  1XIL A;  5IJ9 A;  5IYD O;  4X1K B;  1HR0 O;  2E5L O;  1XNR O;  1E1R G;  5KUM A;  3OR6 C;  3ZMT A;  2WAM A;  1SQQ H;  4Z1V A;  4PEL A;  5L3F A;  2XAQ A;  1BE3 H;  4O4L A;  1FS0 G;  3H1I H;  5DN6 G;  3CCS V;  3K08 A;  5LMN O;  2VQE O;  1H8E G;  4PA3 A;  2RNB A;  3SYA A;  2AZ0 A;  4OPA A;  3QO5 A;  3CMA V;  4JZ2 A;  2AHY A;  3AG2 C;  1GK9 A;  4LF8 O;  3M8A A;  1ZLZ A;  4WFG A;  5C93 A;  2PY5 A;  3K04 A;  2UXD B;  4IGG A;  3ABL B;  1KD1 W;  1XUQ A;  2ITD C;  3ABK B;  4CS3 A;  4BW9 A;  2JIZ G;  1IXM A;  4DV2 B;  2OCC B;  3HKE B;  1V55 C;  4X20 A;  1FKA O;  2ADP A;  3K9A A;  1X59 A;  5K1P A;  2P4K A;  4DUZ O;  1VF6 C;  1F23 A;  1K34 A;  4I55 B;  3OAA G;  1DLB A;  4PHZ A;  1LUW A;  5JJE B;  4LC1 A;  3QF7 A;  4BIU A;  5B1B C;  1G8M A;  3EXA A;  1AJP A;  5EC1 C;  4MTX A;  3VOU A;  3JCU Z;  1L0L H;  4DR1 B;  3AK1 A;  1TAE A;  3RYF A;  5KHG A;  3K0G A;  4N23 A;  1ORQ C;  1Q6H A;  5EZY B;  5FPO A;  3OD4 A;  4LF5 B;  4LCU C;  2ZNJ A;  2GDS A;  3BPZ A;  4IHJ A;  5DED A;  4GX0 A;  4PI2 A;  4MTO A;  2R9I A;  3FB8 C;  5B1N A;  4O2B B;  2V1D A;  2ZXW C;  2UUB O;  5ITZ B;  2LFS A;  2BTQ B;  1AJQ A;  2W0X A;  4DR6 B;  3UO2 A;  4JYY A;  1NU1 H;  1XEQ A;  3WG7 B;  1BZK A;  1S5J A;  3P3P A;  3ZHU A;  4GKK B;  3RGB A;  2QWN B;  3CXC U;  4JI2 B;  2FML A;  4JI8 B;  2KG7 B;  4UV9 A;  2YDE A;  4WBN B;  1NR1 A;  1F51 A;  2OT5 A;  1SF9 A;  2CTQ A;  4DR3 O;  4R6Z A;  3R65 A;  4Q20 A;  4X20 B;  3K5O A;  4QE7 A;  2DYR C;  5CBG A;  2WPD G;  4JAV A;  1Y6X A;  4LBE C;  2WWW A;  3RYC B;  2QKS A;  2EIL B;  1N36 O;  3CRM A;  5KUK A;  2UUA O;  5LYJ A;  2XND G;  1BS3 A;  1F4N A;  2GBO A;  2LO1 A;  4GKJ B;  2DW4 A;  3K59 A;  1RFY A;  2JGD A;  4GYC B;  2QWP B;  2ZQM A;  2EJR A;  3K5M A;  2UUC O;  2Y48 A;  1VIB A;  3QO8 A;  5JH7 B;  3CHX A;  2ZR2 A;  2V7Q G;  3ZHR A;  2JVD A;  2EZO A;  1AP5 A;  4MTG A;  3JAL A;  1PL4 A;  4ZBM A;  5GTH Z;  4WF9 V;  2L6L A;  1O9G A;  2L35 A;  1R73 A;  1S5L Z;  1MZF A;  5L3E A;  3OE7 G;  1XQ8 A;  2ZIO A;  3HB3 B;  1V55 B;  1R3I C;  1WP8 A;  4DR4 O;  1Q81 W;  1OCO B;  2ARH A;  4DYL A;  2Y0I A;  4TT3 G;  3AG3 B;  3F5T A;  5B1O A;  4UFZ A;  1VQ6 V;  4HNA A;  1S76 D;  2BOC C;  5JWP A;  2JK5 C;  4LNU B;  3CEI A;  4MVU A;  1BT8 A;  2ZR3 A;  4AQY B;  4FLX A;  2UU9 B;  3T1Y O;  1ROP A;  4DW0 A;  3BEH A;  1WA8 A;  2ZM6 O;  4DV4 O;  3B8N A;  2EX3 A;  3OEH G;  1JQ0 A;  1ZWI C;  3OTO O;  3SPJ A;  2F95 B;  3ZN1 A;  3BFR A;  3ICX A;  1I0H A;  3RYH A;  2DWE C;  5KA5 A;  1S77 D;  1J5E O;  2R70 A;  4UXN A;  1QU7 A;  2ATK C;  3SJB C;  4LF6 O;  4IYI A;  4MVO A;  3UT5 B;  2MK3 A;  5CBH A;  4FPP A;  1GN6 A;  3N2K A;  4NB5 A;  3STL C;  2YSU B;  1AI5 A;  2JJ1 G;  1E79 G;  4CS2 A;  3ETD A;  3GWO A;  1OCC C;  1MSD A;  4J7Z A;  2ZE7 A;  2GV9 A;  3GWK C;  2JS3 A;  1QNM A;  2WLL B;  1SA0 A;  1Q6I A;  3C3T A;  1U96 A;  5CB4 B;  3E35 A;  1B3Q A;  5BMV A;  3BA8 A;  4WBN A;  3ABL C;  1BL8 A;  4E4E A;  4H0L B;  4JTC B;  1XI1 A;  2YXL A;  3OR7 C;  3JD4 A;  4ZKI A;  2MW2 B;  1IBK B;  2EIM B;  3HKD A;  3L74 H;  2LJ2 A;  3K3W A;  3APQ A;  4OX9 B;  4DV1 O;  1M9N A;  4J9Y B;  1I94 O;  3A0H Z;  3C90 A;  4XDL A;  3F7Y C;  4DRX A;  1Z5V A;  3FYE B;  1QQC A;  1PPJ H;  5H6R A;  4U7N A;  1RPR A;  3JD2 A;  4YXW G;  4I0X A;  1ZTE A;  5GW7 A;  5JCO A;  1L0N H;  2Z3Y A;  4FLZ A;  3G6B A;  2QGN A;  2M6Y A;  3JAS A;  3UM7 A;  4DO2 A;  1WB8 A;  5LP6 A;  2CGN A;  1SQF A;  2YC0 A;  3UCS C;  4X62 B;  3ZX6 A;  2H3O A;  1MG1 A;  3RFR A;  1K73 W;  1QHT A;  1NKD A;  4YY3 B;  4K8Z A;  4P2Z A;  4I4T B;  2YIB D;  1R3J C;  2RDC A;  2R72 A;  4G27 B;  1M4U A;  4IIJ B;  4YIP A;  1IBL B;  1LUV A;  2KSD A;  2Y4U A;  4F6E A;  1M93 A;  5KAI Z;  1GM9 A;  2XOK G;  4OGQ B;  4IT5 A;  4YY3 O;  2D2C B;  2RQ6 A;  2JEU A;  4F6R B;  5JVD A;  1LNQ A;  4DV7 B;  3H1J H;  4I4T A;  3K79 A;  2HFE C;  4I9W A;  4RQE A;  1YI2 V;  4N21 A;  1Q82 W;  4RO2 A;  4JTA B;  3ASN C;  4DR7 B;  1AR4 A;  3QNE A;  1GRJ A;  2OTJ V;  4KFM A;  5JQG B;  3E89 A;  2LQT A;  3FAV A;  4FJC C;  2WLK A;  3A8T A;  1NH2 B;  2CTR A;  2DYS C;  3JSL A;  3P3N A;  3FFQ A;  3ABM B;  3RYI B;  5LL6 Y;  2XAG A;  5BY1 A;  1YVW A;  3W7S A;  1JPX A;  4QIW F;  2CK3 G;  2H94 A;  1D2D A;  4AI8 A;  1BQZ A;  1JA8 A;  1US6 A;  4DR2 B;  1SES A;  5FLX N;  4NTW A;  4FM0 A;  3BRC A;  5LXT A;  2IU3 A;  5C8Y B;  5IY5 B;  1I5X A;  3CCU V;  2F23 A;  3BAB A;  2Q0A A;  5LA6 A;  5BMV B;  1BHA A;  3LSU A;  1ZAU A;  1SZX A;  1ZUQ A;  1MA1 A;  1P7G A;  2IM9 A;  3K5N A;  2M7W A;  4JI5 B;  4FLY A;  1N32 O;  1KKD A;  5L3G A;  5CA1 B;  3ASN B;  1YJW V;  5B1A B;  4X64 B;  2B1I A;  2CTW A;  3SYO A;  3SJC C;  1IUR A;  3T2M A;  3AG3 C;  5EYP A;  3CRA A;  2YEV B;  4DUY B;  4IL6 Z;  2VRZ A;  2BOB C;  4U3J A;  4LFC O;  4MVZ A;  2B1G A;  2HVJ C;  1QVF U;  1Y66 A;  1PNK A;  2YXY A;  3RYH B;  3RYC A;  3T1Y B;  5IWA O;  2UUC B;  5EIB D;  2CH7 B;  5KAF Z;  2PYL A;  1R3L C;  4AQY O;  3H1L H;  3THO A;  1XL4 A;  4X66 B;  3CRR A;  1XL6 A;  4NTX A;  3AG1 B;  3M7M X;  5IDJ A;  3CCJ V;  3KCY A;  3SPH A;  3N2G B;  1SRY A;  2CE4 A;  3E8H A;  4X66 O;  4PD4 F;  4DRX B;  3MAQ A;  2XAF A;  5LOV B;  3LSS A;  3F5W C;  1TVK B;  4DR4 B;  3E8B A;  2N04 A;  2IH1 C;  4DUY O;  1THZ A;  1KB9 F;  1K33 A;  2OTL V;  2YUA A;  4LH7 A;  4X1I A;  4DR5 B;  4RWU A;  1SC5 B;  1NZ6 A;  1QLE B;  2QKA A;  4BW5 A;  4DR6 O;  3SYP A;  3UO3 A;  2Q69 A;  4J80 A;  2BCC H;  2KQX A;  3FB7 C;  4MVR A;  4C7U A;  5KHH A;  5LGU A;  5B3S B;  3JD1 A;  1N36 B;  3E2E A;  2BSK B;  4HZ3 A;  1Q8I A;  3CD6 V;  5H2F Z;  2Q7E A;  4LWS A;  4DR2 O;  2QR4 A;  4FZ1 A;  1QVG U;  1JFF B;  1N34 B;  5B5E Z;  1HNZ B;  1NVP B;  3IAY A;  3DXR A;  2E74 B;  1UPG A;  3MD0 A;  4BWA A;  5EC2 C;  3DTU B;  1CP9 A;  4K0K O;  1OCR C;  3SPI A;  3ZRX A;  4ABM A;  2JEX A;  3ZHT A;  2WLM A;  2Q9L A;  4JI8 O;  5D5P A;  4JI2 O;  2AGA A;  2O57 A;  1NS1 A;  2N74 A;  2HJD A;  2FTK A;  4JAU A;  5JVD B;  5LA6 B;  4F6R A;  1Q7Y W;  4KHP B;  2ADQ B;  2ZCE A;  4JF3 A;  1K9M W;  2P7T C;  1NQT A;  2VQF O;  1OV9 A;  1W0J G;  2IW5 A;  1QCE A;  3G80 A;  4UVA A;  3ZN0 A;  4LH6 A;  4ZOL B;  3CCE V;  1JJO A;  3AG7 A;  4H33 A;  2X7R B;  2ZIM A;  1TGO A;  4D7T A;  4IHJ B;  2YXH A;  1P7B A;  4TUY B;  2F4V O;  1S72 V;  2HEP A;  3CP1 A;  2E3C A;  3JAS B;  3TGU H;  1EN4 A;  2X6A A;  4MVQ A;  4LF8 B;  3D8C A;  4X8A A;  3ZJZ A;  3ZCC A;  4I9Q A;  5JJJ B;  5KX5 A;  1V9P A;  1FJG B;  3OMN B;  1FJG O;  1Q5O A;  1BHB A;  4R7C A;  1K97 A;  2HJF C;  1YIT V;  2A3Q A;  2EIK B;  4BIZ A;  1SQP H;  3CME V;  2CAZ C;  4J9Z B;  1JMK C;  3AK2 A;  1S0V A;  2BE3 A;  2DQ3 A;  2GUZ A;  5KA6 A;  1G4Y B;  2PI5 A;  5DEC A;  2F4V B;  4JV5 O;  1JFF A;  4MT8 A;  3G6E V;  1N0N A;  1HR0 B;  2E5L B;  3CB2 A;  1IDS A;  4LP8 A;  4I50 A;  1EBO A;  4DUZ B;  4G2K A;  1VQP V;  1KC8 W;  1B06 A;  4NYK A;  1H2L A;  4LFA B;  1RP3 B;  1Y76 A;  4PDR A;  1K92 A;  4R50 A;  4KP4 A;  3OTF A;  2GHY A;  4L8J A;  4CZZ A;  1TUB B;  4B3R B;  1FYJ A;  1IBK O;  3ZHQ A;  1IBM B;  4O4J B;  2ZE6 A;  4PI0 A;  1GM8 A;  1PL0 A;  4G28 B;  2Y69 B;  2B5U A;  4GCZ A;  3RYI A;  4MSW C;  3JAK B;  3CC7 V;  4UCU A;  1IVS A;  3E83 A;  5LMN B;  1Y74 B;  2P67 A;  4DV3 B;  4U7O A;  2V4D A;  1NJI W;  2ZKO A;  3H1H H;  4L87 A;  5L3C A;  2ITC C;  2XAS A;  3D3Q A;  3I5D A;  1WPX A;  3B2E E;  3OMI B;  3K06 A;  4UUJ C;  1AI6 A;  1PNM A;  4ZIB A;  1JX9 A;  1NBM G;  3STZ C;  4MTF A;  4X65 O;  1VF7 A;  1KP2 A;  2F1M A;  4HBN A;  3HKD B;  2Z5U A;  3K57 A;  1WAZ A;  3HPL C;  2ZXW B;  4TV9 B;  4LF9 B;  2F93 B;  1GM7 A;  3OTO B;  4P9P A;  4HNA B;  4MS2 A;  2Q4P A;  4DV4 B;  1GKF A;  1FXV A;  1IXB A;  3NXS A;  4EFB A;  5GON B;  5IJ0 B;  1COW G;  4YJ3 B;  2CTP A;  3IC9 A;  1AP6 A;  2LGQ A;  2RN9 A;  4NVP A;  5KHI A;  1K5Q A;  1WN7 A;  4DXW A;  3J81 N;  3SPC A;  1OZ0 A;  3AK3 A;  4J41 A;  5LP6 B;  4O4H A;  1FD9 A;  1JJ2 U;  2WA4 A;  2IJH A;  4PDM A;  2YIC A;  3UKM A;  3VQV A;  4J11 A;  4YHH B;  2EIN C;  4LF7 O;  3CC4 V;  1R1B A;  1Z2G A;  2Q8V A;  4FK5 C;  4FFK A;  3NR7 A;  4DV6 B;  3G71 V;  4P9O A;  5IYZ B;  2OYQ A;  4BIO A;  5J2U A;  1XBL A;  1GN3 A;  5IWA B;  3EVK A;  4JI3 O;  5CMU A;  1ZSP A;  1VMG A;  2JGU A;  4QPJ A;  1SET A;  3RN4 A;  2Q0O C;  3TCU A;  3LDE A;  3T1H B;  1AR1 B;  2AZ2 A;  3D36 A;  4X64 O;  3DSQ A;  1MOF A;  3BCC H;  3FB6 C;  2JDI G;  1V54 C;  3BHP A;  2LGW A;  4DV6 O;  5IT9 N;  3CCM V;  4ZOL A;  4LF7 B;  3ETE A;  3ETQ A;  5LGT A;  3A0B Z;  3O65 A;  2AHZ A;  2XT9 A;  3TXQ A;  1R3K C;  4B7E A;  4R8C A;  2EJ7 A;  4W4L A;  2YI8 A;  3KZI Z;  4OXS A;  2BTQ A;  1M90 W;  1Q3E A;  5J2T B;  3B40 A;  3RT3 C;  1Y74 A;  3I55 V;  4B3R O;  3GVM A;  1Y76 B;  1YTF D;  1FAF A;  1AJN A;  4B3M B;  5C8Y A;  4JI1 O;  2VS0 A;  2DMX A;  3ETG A;  5LMU B;  1WLE A;  1VQ5 V;  2WLH A;  1VEW A;  5DM6 V;  4B3S O;  1PP9 H;  4X65 B;  3OGI B;  4XDJ A;  3LNN A;  3AG4 C;  2ZNI A;  1XNQ O;  2ZIN A;  1KBH A;  1PD3 A;  5EZY A;  1EN5 A;  4JYC A;  1QR9 A;  5CBF A;  2DQ0 A;  4TV8 B;  4Q6G A;  3AG4 B;  1SQG A;  2A79 B;  1K7D A;  4H13 B;  5LBQ A;  4DV7 O;  5LGN A;  4DV3 O;  3JCZ A;  3DGE A;  1FXK B;  2LW7 A;  1JVM A;  5EBM C;  1Z5W A;  3ZRW B;  2A9H A;  4GT1 A;  2IBZ H;  3WFV A;  2CDY A;  4P30 A;  4QJF B;  1G1X B;  1IBL O;  2Q68 A;  2XHB A;  1QLN A;  3ZMS A;  3TK1 A;  2EBO A;  4DR1 O;  4WCE V;  3CC2 V;  3OUF A;  2A0L A;  1KUQ A;  3L72 H;  1K5S A;  2WLI A;  1VQ7 V;  5KX5 B;  3AG2 B;  2OIE A;  3F7V C;  3EHB B;  3GB7 C;  5LOV A;  4X89 A;  1L8D A;  1YZB A;  4O2B A;  1VQ8 V;  3OT7 A;  2UXC B;  3A2F A;  1R6N A;  3HKC B;  3J80 N;  3JSN A;  4GX1 A;  4NXN O;  1HNW O;  1M5I A;  1KYO F;  3TJT A;  1I94 B;  5B1A C;  3T1C A;  4K0K B;  3RWR D;  4J7J A;  4TV9 A;  4UB8 Z;  1EN6 A;  1MMM A;  3ZIA G;  1S3J A;  4FFB B;  3D36 C;  5B3S C;  2Q6A A;  4UCR A;  4UV8 A;  5F2V O;  2JRI A;  3T4Z A;  4CC6 A;  4Z2W A;  4TV8 A;  3ZHS A;  1QR8 A;  3ASO B;  1EZV H;  1YIJ V;  1VP7 A;  1KMI Z;  5LHG A;  4CH5 A;  4O4I A;  4RAI A;  1I5Y A;  3JAT B;  1D5A A;  4JAA A;  5CA0 B;  4FLU A;  2X6B A;  1PM9 A;  3H01 A;  4DK1 A;  2IU0 A;  1F7Y A;  2E76 B;  3IGA C;  3DC5 A;  1DF5 A;  4YJ2 B;  1GAX A;  5BR8 O;  2KKW A;  5J9P C;  2P06 A;  3S3W A;  5A2Q N;  3BA9 A;  1QBZ A;  5J2T A;  1V54 B;  4O4J A;  1GMG A;  1NH2 D;  4JGS A;  1SA0 B;  5EIB C;  1L1F A;  1XHZ A;  4NXM O;  1EFR G;  1P84 F;  3CCL V;  2HHH B;  1BGY H;  1N34 O;  1SER A;  3OUS A;  4UCO A;  1N0J A;  3OGC C;  3Q4H B;  2Q73 A;  1D5N A;  1HW7 A;  4PJ0 Z;  1TVK A;  4JYA O;  5CA3 A;  1YDX A;  4UVC A;  3RBZ A;  4B7K A;  1NVP D;  1NI8 A;  3U11 A;  2YID A;  4WFB V;  5FNV A;  3CRC A;  4O2A A;  2XAJ A;  2OCH A;  3ZMU A;  3IC7 A;  1N33 B;  1KP3 A;  3W7U A;  1VF5 B;  5EK0 A;  3BY6 A;  3U0Z A;  2UXB B;  4PA6 A;  2RCV A;  2Q7H A;  3JD3 A;  2R9A A;  2JS5 A;  1JCH A;  3ABK C;  3LUT B;  4YJ2 A;  2K1E A;  4RUF A;  4U3F H;  2YIB A;  2P4V A;  3OW2 U;  1WJZ A;  2DE0 X;  5CB4 A;  1AR5 A;  1HNX O;  1RPO A;  4ZHQ A;  4LFB O;  3D3I A;  3JAR A;  1VQO V;  1VQK V;  2UXB O;  5H5N A;  4LR3 A;  2QTO A;  5H9C A;  4JI5 O;  1N32 B;  4JI0 O;  1NTZ H;  5HFL A;  1YF2 A;  3QVN A;  3K58 A;  1B6Q A;  1XDC A;  3N2K B;  5KMG A;  2F66 C;  2P90 A;  3ZRV A;  4MVM A;  4ZHQ B;  2ODM A;  1NTK H;  1XMO B;  4YJ3 A;  3K5L A;  4KL1 A;  5AG2 A;  4UVB A;  4CH3 A;  4IYH A;  4D7S A;  2YI9 A;  1FFT B;  3N2G A;  1XRE A;  4LFC B;  3ZMV A;  3ZHV A;  5LYJ B;  1NR7 A;  4DR3 B;  1OJH A;  2WLN A;  5BZB A;  1K4C C;  3SJQ C;  1GH6 A;  3WB2 A;  2CH7 A;  4Z1M G;  1Y67 A;  3K03 A;  3SYQ A;  4DW1 A;  4HYO A;  1LR1 A;  1YHQ V;  2ZD9 A;  3RW0 A;  1SQX H;  3VQX A;  1HP8 A;  2A06 H;  4XBF A;  5IJ9 B;  3RVY A;  4EKW A;  5E79 Z;  5IE9 A;  2OIG A;  1BSM A;  3MDS A;  4UB6 Z;  4HAM A;  4K3A A;  4H44 B;  2NN4 A;  1Q6U A;  3L9D A;  4LF5 O;  1H2S B;  1RM1 B;  2CGO A;  1H8H G;  1XOU A;  1KQS U;  3VQY A;  2ZDI A;  3ZS8 C;  1NTM H;  1KEC A;  1OCZ C;  4BR6 A;  1EZJ A;  4X62 O;  1MAB G;  5KLV H;  2GSM B;  3FB5 C;  1GO3 F;  4JI6 B;  4A5U B;  4PV1 B;  2OCC C;  2FYU H;  3JAT A;  4MW3 A;  3P32 A;  1H2N A;  1KU9 A;  4CC5 A;  2UXC O;  4B3T B;  4FLW A;  1CPY A;  2QM4 A;  2H8P C;  4JI6 O;  1AI7 A;  4UCV A;  3FAV B;  4DV1 B;  1TUE B;  1M56 C;  5IYB O;  4FM1 A;  3JAM N;  1M57 B;  2LP7 A;  3HKB A;  5FL7 G;  1OCO C;  3P30 A;  2PYJ A;  1S5H C;  1Q90 D;  5E1A C;  2OWO A;  1GN2 A;  1YJN V;  2NLJ C;  5K1X A;  4QGP A;  4X88 A;  2VQE B;  3PN1 A;  3W7T A;  4PA4 A;  1M1K W;  1W0K G;  3ABU A;  3M99 B;  2YS8 A;  3IJ4 A;  4JTD B;  1CXZ B;  2VWK A;  5IYC O;  3G4S V;  4RUE A;  2GTS A;  3CX5 F;  1XNR B;  2ZE8 A;  2PI4 A;  2VQF B;  1OCR B;  2P6J A;  2Q5Z A;  1XNQ B;  1F4M A;  1YXB A;  1JR9 A;  4KHP O;  4QE9 A;  4NR1 A;  3AEI A;  4LF6 B;  2F43 G;  3LNM B;  3RYF B;  2EUL A;  5LMU O;  3FD9 A;  3I56 V;  3ZRW A;  4CBC A;  4JI1 B;  3CE2 A;  4FFB A;  3Q4H A;  3ZMZ A;  4I50 B;  1U97 A;  4DV0 O;  4LF4 O;  2QJ1 A;  5B66 Z;  2Y4T A;  5HFM A; 
#chains in the Genus database with same CATH homology
 3W7S A;  4QPK A;  1AJN A;  1JPX A;  2D3O W;  4QIW F;  2CK3 G;  2H94 A;  2IH3 C;  3ETG A;  1OCC B;  1WLE A;  4JPR A;  1VQ5 V;  2WLH A;  5DM6 V;  1SES A;  1ARO P;  3CCQ V;  2KB1 A;  4XDJ A;  2IU3 A;  2EZP A;  5IY5 B;  1I5X A;  3AG4 C;  3CCU V;  5IYD O;  1GTO A;  5L3D A;  5EBW C;  2EIN B;  1PD3 A;  4FIP C;  1W2B U;  1VQN V;  4JYC A;  1E1R G;  5KUM A;  1QR9 A;  1BHA A;  3OR6 C;  3ZMT A;  5CBF A;  2DQ0 A;  3WG7 C;  2WAM A;  3AG4 B;  4PA7 A;  4PEL A;  5L3F A;  2M7W A;  2A79 B;  1KKD A;  1K7D A;  2XAQ A;  5L3G A;  1YJ9 V;  5LBQ A;  3ABT A;  1BMF G;  5LGN A;  3W7W A;  1FS0 G;  3DGE A;  3JCZ A;  1FXK B;  2WLI B;  5DN6 G;  3ASN B;  3CCS V;  3K08 A;  1JVM A;  1YJW V;  5EBM C;  1H8E G;  5B1A B;  3ZRW B;  4PA3 A;  2Q67 A;  2A9H A;  2WSS G;  2B1I A;  3FYI B;  4GT1 A;  3SYA A;  3SYO A;  3WFV A;  4P30 A;  4QJF B;  1E1Q G;  1OCZ B;  4TWK A;  3T2M A;  2QA4 V;  3AG3 C;  2DWD C;  3OEE G;  2Q68 A;  1YSC A;  3QO5 A;  3CMA V;  2YEV B;  2AHY A;  3AG2 C;  3ZMS A;  1QLN A;  1GK9 A;  2BOB C;  4H37 A;  3TK1 A;  3ABM C;  2B1G A;  2EBO A;  2HVJ C;  4MVZ A;  2HVK C;  4WFG A;  4WCE V;  5C93 A;  3CC2 V;  1Y66 A;  1QVF U;  2DYS B;  3OUF A;  1PNK A;  3K04 A;  2A0L A;  1K5S A;  1FXK A;  2WLI A;  3ASO C;  1VQ7 V;  3ABL B;  3AG2 B;  1R3L C;  3F7V C;  3EHB B;  1KD1 W;  2ITD C;  3ABK B;  2YEV A;  1XL4 A;  3GB7 C;  2EIJ B;  4X89 A;  2W0F C;  2JIZ G;  1IXM A;  1XL6 A;  2OCC B;  3AG1 B;  1V55 C;  1VQ8 V;  4JAS A;  3K9A A;  5IDJ A;  3CCJ V;  1R6N A;  4BAY A;  3SPH A;  2IJI A;  1SRY A;  3E8H A;  1F23 A;  1K34 A;  3X2Q C;  3OAA G;  5IY5 C;  1DLB A;  2XAF A;  4LC1 A;  4BIU A;  1G8M A;  4GX1 A;  5B1B C;  3LSS A;  1AJP A;  5EC1 C;  3CYO A;  4MTX A;  3VOU A;  3F5W C;  1MSW D;  5B1A C;  3E8B A;  1VQ9 V;  3T1C A;  4RQF A;  2HG5 C;  2IH1 C;  4ASU G;  3K0G A;  4N23 A;  1ORQ C;  3ZIA G;  1THZ A;  1K33 A;  4LCU C;  1S3J A;  2HR3 A;  3B77 A;  5B3S C;  2OTL V;  2Q6A A;  4UV8 A;  3T4Z A;  4MVS A;  1VQ4 V;  4XDK A;  1QR8 A;  3ASO B;  4GX0 A;  3ZRS A;  1YIJ V;  4MTO A;  5LHG A;  1QLE B;  5B1B B;  2R9I A;  4BW5 A;  4RAI A;  3FB8 C;  4PA9 A;  1I5Y A;  2W6I G;  5B1N A;  2EIL C;  4WFF A;  2V1D A;  3SYP A;  2ZXW C;  2X6B A;  3KG2 A;  2Q69 A;  3FKS G;  3H01 A;  1J95 A;  2IU0 A;  1PKX A;  3IGA C;  3CCR V;  1DF5 A;  3FB7 C;  4I5S A;  1OHH G;  4MVR A;  5LGU A;  2LFS A;  3AG1 C;  3JD1 A;  1AJQ A;  5B3S B;  5J9P C;  3WG7 B;  3E2E A;  4HZ3 A;  3CD6 V;  1QBZ A;  1V54 B;  1GMG A;  3CXC U;  1NH2 D;  1QVG U;  1ENV A;  4JGS A;  2EIK C;  1NVP B;  4UV9 A;  1NR1 A;  1F51 A;  2OT5 A;  1L1F A;  5CN0 A;  4R6Z A;  3MD0 A;  3DTU B;  1CP9 A;  3R65 A;  1EFR G;  4Q20 A;  5EC2 C;  4QE7 A;  3CPW U;  1OCR C;  2DYR C;  3CCL V;  3SPI A;  1CEZ A;  5CBG A;  3ZRX A;  2JEX A;  2WPD G;  2WLM A;  5EBL C;  1SER A;  4JAV A;  3OUS A;  4TSF G;  2FTK A;  4JAU A;  1Q7Y W;  3OGC C;  4JF3 A;  1K9M W;  4LBE C;  2WWW A;  2P7T C;  2QKS A;  2EIL B;  1NQT A;  1M56 B;  3LDD A;  4F4L A;  5CA3 A;  4UVC A;  3RBZ A;  1W0J G;  5KUK A;  1NVP D;  2IW5 A;  1QCE A;  2XND G;  1F4N A;  4UVA A;  3ZN0 A;  3CCE V;  2HLD G;  4WFB V;  4H33 A;  4QNH B;  2X7R B;  2DW4 A;  2QM8 A;  1P7B A;  4MW8 A;  2ZQM A;  2EJR A;  2XAJ A;  3ZMU A;  3IC7 A;  2Y48 A;  3QO8 A;  1S72 V;  1KP3 A;  3CP1 A;  3W7U A;  1VQM V;  5EK0 A;  3BY6 A;  2JJ2 G;  2ZR2 A;  2V7Q G;  2IJK A;  4PA6 A;  2EZO A;  2X6A A;  4MVQ A;  1VQL V;  4MTG A;  3VBB A;  3JD3 A;  3ZJZ A;  4X8A A;  3A0R A;  3ZCC A;  2EIM C;  3JYC A;  1JCH A;  3ABK C;  1RM1 C;  4ZBM A;  3LUT B;  4WF9 V;  2K1E A;  3OMN B;  4RUF A;  3EFF K;  2XAH A;  1R73 A;  3OW2 U;  2R9R B;  1BHB A;  4R7C A;  1K97 A;  2HJF C;  1YIT V;  2EIK B;  4BIZ A;  5L3E A;  1RPO A;  2QM7 A;  4GX2 A;  4PDV A;  3CME V;  3ML0 A;  3D3I A;  1VQO V;  3OE7 G;  4J9Z B;  1VQK V;  4WFA V;  3HB3 B;  1V55 B;  1S0V A;  1R3I C;  2QTO A;  5H9C A;  1Q81 W;  1OCO B;  2DQ3 A;  5KA6 A;  1G4Y B;  1H38 A;  5HFL A;  2PI5 A;  3SYC A;  1N8R W;  4TT3 G;  3AG3 B;  1B6Q A;  4MT8 A;  3G6E V;  4E2L A;  5B1O A;  2P90 A;  1VQ6 V;  3ZRV A;  1S76 D;  4LP8 A;  1EBO A;  2BOC C;  4MVM A;  4G2K A;  1VQP V;  1KC8 W;  2JK5 C;  2WLL A;  4PDR A;  4MVU A;  2HKO A;  1K92 A;  4UVB A;  4R50 A;  2ZR3 A;  1FXH A;  4KP4 A;  3K0D A;  2GHY A;  4PDL A;  4CZZ A;  1ROP A;  2Y69 C;  1FFT B;  3BEH A;  2X0L A;  3B8N A;  3ZMV A;  2QE7 G;  3OEH G;  1JQ0 A;  1AI4 A;  1ZWI C;  3SPJ A;  1GM8 A;  1NR7 A;  2IJJ A;  3ZN1 A;  1PL0 A;  4G28 B;  2WLN A;  2Y69 B;  2DWE C;  2B5U A;  1K4C C;  5BZB A;  4GCZ A;  3SJQ C;  5KA5 A;  1S77 D;  1K8A W;  4FMT A;  4MSW C;  4UXN A;  3CC7 V;  2ATK C;  5LHH A;  3E83 A;  1Q86 W;  4MVO A;  2MK3 A;  2P67 A;  5CBH A;  4Z1M G;  4U7O A;  1NJI W;  4FPP A;  3K03 A;  3SYQ A;  3IFX A;  3MHH C;  2YSU B;  3STL C;  1AI5 A;  2JJ1 G;  1E79 G;  4HYO A;  4KUM A;  3ETD A;  3GWO A;  4L87 A;  1OCC C;  5L3C A;  1YHQ V;  2ITC C;  1PNL A;  2ZD9 A;  3RW0 A;  2XAS A;  1R6K A;  1WPX A;  3OMI B;  2WLL B;  1AI6 A;  1PNM A;  3K06 A;  3PJS K;  1JX9 A;  2ZDI C;  4UUJ C;  4XBF A;  3CCV V;  4GX5 A;  3OM3 B;  1NBM G;  3RVY A;  2QEX V;  1DTO A;  3STZ C;  3E35 A;  4MTF A;  1KP2 A;  2Z5U A;  3ABL C;  1BL8 A;  3LSQ A;  4EKW A;  3HPL C;  2ZXW B;  3QO7 A;  1GM7 A;  4JTC B;  3OR7 C;  3JD4 A;  4HAM A;  4P9P A;  4ZKI A;  4MS2 A;  1GKF A;  2EIM B;  1FXV A;  1RM1 B;  3NXS A;  1H8H G;  3K3W A;  3TET A;  1COW G;  1FXK C;  1KQS U;  1P4R A;  2ZDI A;  3JD0 A;  1KEC A;  1OCZ C;  3X2Q B;  1K5Q A;  1EZJ A;  4DXW A;  1M9N A;  1MAB G;  4J9Y B;  1OZ0 A;  3SPC A;  2GSM B;  3FB5 C;  1GO3 F;  4XDL A;  3F7Y C;  2X6C A;  3FYE B;  2EIJ C;  3RVZ A;  1M57 C;  1JJ2 U;  5H6R A;  2OCC C;  4U7N A;  1RPR A;  2IJH A;  4MW3 A;  4PDM A;  3JD2 A;  4YXW G;  3P32 A;  3UKM A;  3SPG A;  5GW7 A;  2EIN C;  3W7X A;  3CC4 V;  2Z3Y A;  4FK5 C;  1CPY A;  3G71 V;  2H8P C;  2NNU A;  2C2A A;  3UM7 A;  4DO2 A;  4P9O A;  1AI7 A;  1QLE C;  1TUE B;  1MG1 A;  1K73 W;  3MHS C;  1NKD A;  3E8F A;  1JOY A;  1M56 C;  5IYB O;  1M57 B;  4P2Z A;  5CMU A;  2LP7 A;  5FL7 G;  1R3J C;  1OCO C;  3P30 A;  1S5H C;  4QPJ A;  3OMA B;  4G27 B;  3E86 A;  1YTF B;  1SET A;  5E1A C;  3TCU A;  3LDE A;  2LFR A;  1YJN V;  2NLJ C;  1AR1 B;  1GM9 A;  2XOK G;  3D36 A;  4X88 A;  1MOF A;  2JEU A;  3W7T A;  1LNQ A;  1UJW B;  3FB6 C;  5LHI A;  2JDI G;  1K3E A;  4PA4 A;  1V54 C;  1M1K W;  1W0K G;  3ABU A;  1SZT A;  3M99 B;  2WLJ A;  3K79 A;  5H6Q A;  2HFE C;  4I9W A;  4RQE A;  4JTD B;  5IYC O;  5L3B A;  3G4S V;  1YI2 V;  4N21 A;  4RUE A;  3OFN G;  1Q82 W;  4RO2 A;  3CCM V;  4JTA B;  2UXN A;  3ETE A;  3ASN C;  2PI4 A;  1OCR B;  2DYR B;  3QNE A;  1DF4 A;  4WFE A;  5LGT A;  2P6J A;  2AHZ A;  3LDC A;  1F4M A;  2OTJ V;  4KFM A;  3E89 A;  4QE9 A;  1R3K C;  3AEI A;  4FJC C;  4R8C A;  2WLK A;  3T4D A;  2F43 G;  2W6J G;  3LNM B;  1NH2 B;  4OXS A;  2DYS C;  4WFH A;  4JYB A;  3B8M A;  3ZRW A;  3I56 V;  4CBC A;  3ABM B;  1Y4M A;  3E8G A;  1M90 W;  1K4D C;  3ZMZ A;  1H2G A;  3I55 V;  2XAG A;  1HWY A;  2UXX A;  5HFM A;  1YTF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...