1YIJV

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yijV00
3CC2V 1YJ9V 2QA4V 3CCEV 1N8RW 3G4SV 3CCSV 1S72V 1Q86W 3CCMV 3CC4V 2OTLV 1VQNV 1YITV 3CCQV 3CMAV 1YHQV 3OW2U 1QVFU 3CCLV 3CCVV 1K73W 1VQ6V 5DM6V 1NJIW 3CCUV 1M1KW 1VQ7V 3CXCU 3CMEV 3CCJV 1VQPV 1VQMV 1QVGU 3G71V 1K8AW 4WCEV 1K9MW 1VQ5V 2QEXV 3CD6V 2OTJV 3I55V 1VQKV 3CPWU 1YJNV 3G6EV 1Q7YW 3CC7V 1VQ4V 2D3OW 1YJWV 1M90W 1KQSU 4WFBV 1KD1W 1VQLV 1YI2V 1VQOV 1JJ2U 1VQ8V 3CCRV 1VQ9V 1Q81W 1W2BU 1R73A 4WF9V 1KC8W 1YIJV 3I56V 1Q82W 4WFAV
chains in the Genus database with same CATH superfamily
3CCEV 1HR0B 2G38A 3QG5A 2BTQB 1DTOA 4D6TH 1XI1A 3CCVV 3U11A 5KLVH 1H2NA 5K1PA 1FS0G 3B09A 2CTPA 4LNUB 4DV5B 1SQBH 2UXBO 2VQEO 4QJFB 1KQSU 3WB2A 5LHIA 4X66B 2QM7A 1H8HG 2YI8A 4F6RA 3VOUA 4R8CA 4CC6A 2IH3C 2PI5A 5J2TB 3JD2A 3H1LH 5B3SB 2ZT9B 3FKSG 4LF7O 1VQ6V 1HNWB 2PI4A 3CMEV 2KG7B 1NTMH 3HKEB 4JI8O 2F4VO 1D5AA 2ILMA 3E83A 3ZN1A 3RYCB 3X2QC 1P4RA 1FPOA 2LQTA 3O65A 5JVDA 3E22B 4K0KB 2EBOA 1JOYA 1SQFA 5LMUO 4FFBA 5CA0B 4NVPA 4LFCO 1Q6IA 3JARA 1HNXB 2QWRB 3K0GA 4ZHQB 4JI7B 4FLWA 2YEVA 4X20B 3RFRA 1SA0B 4J80A 1B3QA 4BR6A 1OJHA 4OXSA 4O4HB 4X8AA 1XNRB 2JVDA 3H1IH 5IWAO 2ZKOA 5H6RA 2W6IG 3H1HH 1VARA 2X6AA 2R9RB 3A8TA 2BTQA 4YJ2B 1AP5A 2UUCO 3J80N 2GHYA 3RYHB 1MG1A 3D8CA 4UFZA 3IAYA 3OW2U 3CX5F 2BE3A 1F7YA 4MTOA 4KFMA 4ZI7B 4FM0A 5J2TA 3K5OA 2B5UA 2D3OW 1BQZA 1YTFB 3DGEA 3FX7A 4Z1MG 2A0LA 4J10A 3ABTA 3ABUA 5CB4B 4I9QA 3G4SV 2DMXA 3W7UA 1SC5B 3RT3C 4DXWA 1UFIA 3ABMC 4JV5B 1GRJA 2VRZA 1BCCH 1JPXA 3OMIB 4IIJB 5LYJB 3G67A 4TV9B 1NVPB 2NR5A 1VF7A 3ZRXA 3K04A 1K3EA 3LNNA 4MVMA 4X64O 3AG7A 1Q82W 4JZGA 3ZEDA 4DYLA 4JI8B 3ZRVA 4X20A 2JK5C 1SA0A 1ZLZA 4JTAB 1K73W 3E89A 4B3SO 4J7KA 1SQGA 3CXCU 1N33B 3ABLC 4N21A 2LJ2A 5LXTA 1IURA 2PZSA 4P2ZA 4WFBV 5LMUB 2Y69B 3KKYA 2H94A 3ZMVA 1Q5OA 2AHYA 3CRQA 1BZKA 4RWUA 3RYHA 3OE7G 2CGNA 3TK1A 3AK1A 2RCVA 3B77A 1COWG 5IY5B 5JH7B 4PDVA 2B1IA 3JD3A 1WP7A 2QTSA 1XOUA 4DR3O 5CN0A 1NH2D 1KMIZ 4X65O 3HKDA 4J7ZA 2UXCB 3ZHRA 3STZC 1XMOO 1SKVA 4JYBA 3SPCA 4JPRA 1AR1B 1KU9A 5KAIZ 1IBLO 3IC9A 1DLBA 5GTIZ 3K06A 2WA3A 2OCCB 3OGIB 1OZ0A 2QWNB 3JAKA 4BIZA 1MABG 1E79G 1HWYA 2MK3A 3RN4A 2P5OA 4J41A 2BCCH 1HP8A 3RVZA 2HKOA 2Y0IA 2XNDG 4Z1VA 1LUWA 1I08A 1UPGA 5JWPA 3M99B 1QBZA 4O4IB 2FMLA 4FLZA 4X1YA 2EINC 3C3SA 4DV4B 3O9OA 2UXDO 3ZHTA 2KKWA 4DR5O 4TV8B 4FFKA 3CS5A 4JTDB 4Q20A 4JYAB 1Y67A 4DR4B 3G6EV 3CEIA 2QSAA 2ZM6B 1THZA 2NLJC 4LF4O 5JH7A 4AHCA 3LDCA 1M56C 1XNQO 1VEWA 1S5LZ 3R66A 4DV7O 2IJJA 4I7ZB 1WPBA 5DM6V 3X2QB 4RQEA 2ZE5A 4IYHA 3ZRWB 3B8MA 3SYQA 3LNMB 2UXXA 4DK1A 2ZE7A 4IT5A 3RYIA 4BW5A 3CSXA 1R1BA 3OEEG 3CRRA 5FLXN 3DTUB 4WFEA 2EX3A 3L74H 2RDCA 3OFNG 3G80A 3K03A 5HFLA 4JI1O 4PI2A 4UUJC 2YUAA 2P22C 1D2DA 2X6CA 2ZE6A 5GW7A 1XMOB 4LF8B 1Y6XA 2Q8VA 1YJ9V 5L3GA 2KB1A 2L35A 1KYOF 2R9AA 2YIDA 3Q4HB 5BXZA 2VQFO 2F66C 2QWPB 1WB7A 3AG3B 1R3KC 1VQPV 4EFEA 1S0VA 3A0HZ 3FD9A 3F5TA 2ZR2A 4DUYB 1IVSA 3F7YC 5BR8O 4DR1O 2EULA 1F4NA 4UCUA 4CBCA 1NJIW 5J9PC 3OGCC 1SRYA 2OTLV 1I5YA 4WBNB 5B5EZ 3L73H 4O4LA 4PDRA 2QR4A 3SJBC 1R3IC 4TT3G 3ZHQA 1ZTEA 5KHHA 1Q7YW 3L9DA 1JQ0A 3L71H 2UXDB 4CS2A 4J11A 1HDJA 2JGDB 1XHXA 4PDLA 4E2LA 4LR3A 3JCUZ 1JVMA 1M9NA 1TUBB 4LF4B 1GN3A 3MHHC 3B8NA 4B3RO 1GM7A 1KP3A 4DRXA 1N0JA 1WN7A 1OCCB 3K0DA 1PL0A 2P67A 5LP6C 1QLEB 1IBKB 1RP3B 3LSSA 1VQLV 2HJFC 1JFFA 3HKCB 3I56V 1HNZO 5ITZA 1UJWB 4U3JB 1NH2B 4LFAO 1BS3A 4DV1B 2FKXA 3F5WC 3DXRA 3Q4HA 3AK2A 2EIKB 4TOIA 4MTGA 3L70H 1HR0O 2HP8A 4UCOA 5B1AB 3JCZA 1AI4A 1U96A 1IXBA 1GTOA 4BWAA 2JEXA 1YHQV 3EVKA 4FZ0A 5FPOA 1WA8B 5DN6G 2CH7B 3A0RA 4X66O 5BY1A 1VQ7V 5H6QA 1KB9F 1MOFA 2WAMA 4F4LA 4YJ3A 2VQFB 1YTFD 2XAFA 5LMNB 1K92A 1V54C 3ASOC 1HNWO 3K79A 4YHHB 2ZXWC 2XHBA 2YXYA 1S3JA 4R6ZA 1US6A 3BFRA 2JGDA 3APOA 4CH6A 4DR1B 2ZIOA 1URFA 2E5LB 2Q67A 2RMKB 1SS3A 1L1FA 2WSSG 5C93A 1XEQA 5JJNB 1TUBA 1N32O 1T5EA 4K0KO 1JA8A 3UO3A 3DSQA 2IU3A 2IU0A 2GUZA 2CTQA 3ZMSA 1HNXO 2F23A 3CC4V 3K9AA 4EEQA 3W7WA 4U7OA 5H9CA 4PA6A 4O2AA 4JASA 2E75B 1RM1B 4WFGA 2EZPA 3QF7A 5L3FA 3N27A 3ABKC 1OHHG 2B9ZA 1XNRO 4MVQA 4TUYB 2EINB 2CTRA 4CH4A 1KECA 2WPDG 3CXHF 1EM1A 4B3RB 4FFBB 3JARB 2ZE8A 3H1JH 4RAIA 4NTWA 1M93A 4X62O 2YEVB 4ZOLA 2R70A 5DEDA 4XDJA 1M56B 1IDSA 1R6NA 4MVSA 1WA8A 2CH7A 2CAZC 4UB6Z 4GCZA 2YSUB 4TSFG 2BTOA 1GN4A 4DR7B 2Y4UA 4X88A 4AI8A 4HYOA 1RSOA 4FIPC 1OCOC 3CRAA 1YF2A 1K5QA 4UXNA 4GX1A 4DW0A 2ZR3A 4WCEV 4J7JA 3WG7C 2EIMC 3OT7A 4PA3A 4JV5O 2M6YA 1CPYA 2N74A 1GMGA 1TVKB 5K1XA 4I9WA 4Q6GA 4MW3A 3CMAV 3P3PA 4H37A 2XAJA 4JI4B 2LP7A 3A0BZ 1E1QG 1VQ5V 4GKJB 1XDCA 2X0LA 1S77D 2Y4TA 1X4TA 3SPJA 4CS3A 1QNMA 3A2FA 3SPIA 2W0XA 1N33O 1R6KA 3RYFA 2JDIG 4TUYA 2EILC 2DE0X 4NYKA 2QE7G 1Z5WA 4OPAA 2QKSA 1N32B 4RQFA 3OR7C 1FFTB 3RVYA 2WLJA 1Y4MA 2DWDC 4E4EA 4DV0O 1WPXA 1VQOV 3K59A 1TA8A 4GKKB 1S5JA 4FVMA 3K5LA 5H2FZ 2PUSA 1IBMB 1U97A 3RBZA 2QM8A 3H01A 4PELA 5GONA 3W7TA 5LXTB 2QDOA 4MVOA 4MS2A 2M7WA 1G4YB 2DOSA 2UXCO 2XUMA 2QTOA 4X62B 3CJHA 2GBOA 3FYIB 3UT5A 5E79Z 1MA1A 3PJSK 3UKMA 5LP6B 2ZNIA 4PJ0Z 1YVWA 1TVKA 5EK0A 2BSKA 2ARHA 3FAVA 1K4DC 4X89A 3JD0A 4JAUA 3FB7C 2O57A 1W2BU 3HKDB 4ASUG 2B1GA 2IJHA 5BMVA 4CH5A 2QA4V 1X59A 2NN4A 2Q0AA 4LF6B 1IXMA 4H0LB 5KUMA 3CWBH 3CCLV 1W59A 2LO1A 3MDSA 3EFFK 2R72A 1NT2B 2K9PA 1M5IA 2KQXA 2AHZA 4EKWA 3JAKB 3BA9A 3OAAG 5IYZB 2ADPA 1N36B 4PI0A 4QE9A 4DV4O 3HR0A 5IJ0A 1VF6C 2P4KA 4W4KA 4J9ZB 1N0NA 5EBLC 3IC7A 4DV2B 4F6EA 4JYAO 3ETQA 4RO2A 4DR4O 5LGTA 3AG2C 2ZM6O 1ROPA 3L72H 1V54B 3ASOB 4RUEA 4I50A 3ASNB 3E8GA 3LUTB 1XMQO 1S5HC 2ZXWB 1W0KG 2DQ0A 4NB5A 4UVBA 5A9GA 3D3IA 1MZFA 1M57B 4X1YB 1GO3F 3AG4C 1MSDA 3BABA 4H13B 4UCRA 1R73A 1M90W 1IZ3A 3HKBA 3CC2V 1VIBA 4MVUA 2UUAO 1H2KA 4OGQB 4FM2A 1FXKC 2XT9A 4DV0B 3P30A 3ZRSA 2AW9A 4UCVA 2A3QA 1SQQH 2EIJB 5LP6A 3J81N 5KMGA 1KP2A 2F93B 3ZX6A 1R6TA 2N04A 1BT8A 4IL6Z 3ABKB 1N8RW 3C3TA 2V4DA 3VQXA 5KHGA 3K58A 3OTOB 1L0LH 4TWKA 1BL8A 4LF8O 2XAQA 3UQ8A 2HFEC 2QEXV 3RYIB 1SQVH 2YIBA 2HR3A 3CCRV 5EIBC 1QQCA 4JAVA 1VMGA 2WLHA 2JRIA 5IYZA 3OTFA 4FLTA 4DUYO 2XASA 2ADQB 1SZXA 3E8BA 5GTHZ 1K5SA 1V9PA 3JASA 2N05A 3DC6A 2Q68A 4QNHB 4DK0A 3QNEA 5L3BA 4U3FH 2EIMB 5KHKA 5KAFZ 4MTXA 4FLYA 3ETEA 1NKDA 5EZYB 4O2BA 1Y74A 4NTYA 5LOVB 3AG1C 4GT1A 4J42A 1Q90D 2L6LA 4GX2A 1KD1W 5LBQA 1XMQB 1GH6A 4O4LB 1Q8IA 5CA3A 3ZIAG 2E76B 1CEZA 3UO2A 1K7DA 3N2GB 4YIOA 2IW5A 1IBKO 3PN1A 4JF3A 1BSMA 2EILB 1V55C 2H3OA 2UUAB 2JGUA 1YJWV 4JGSA 4DV3O 1SF9A 4DV1O 1PKXA 2Z3YA 1YI2V 4JI0B 1Q81W 4WF9V 1AI5A 2JIZG 2Q6AA 1SQPH 4JI2B 1K33A 1SQXH 4LWSA 5HFMA 4DRXB 3ZMUA 1J5EB 3MAQA 5L3EA 1KKCA 5JCOC 4ZIBA 1JFFB 5ITZB 2W0FC 2WLNA 5L3DA 4OX9B 1M4UA 3DXRB 1XILA 3CCQV 2JEUA 2IBZH 4JI6O 1NR7A 1NTKH 4MVZA 1LR1A 5LMNO 4YHHO 4AILC 4IHJB 1DF4A 1S76D 4D7SA 5B3SC 2LFRA 5EZYA 2IJKA 3BY6A 5LOVA 5D5PA 2DYSC 1K9MW 1FXVA 2E5LO 1A32A 4K8XA 1NQTA 2DWEC 2E3CA 2EZOA 1QVFU 3OD4A 4YJ3B 2DYRC 4NXNB 2ZDIA 4NR1A 4HNAA 3TETA 3N2GA 1ORQC 1QR9A 3BA8A 5EC2C 5IDJA 3ABMB 2X6BA 2V7QG 3BEHA 4MT8A 3GB7C 4JAAA 2Y48A 1FFXA 1JMKC 2Q69A 3P3NA 5EYPA 3CHXA 4YY3O 1FJGB 2Q7GA 5LHGA 1OV9A 2P7TC 2QWOB 2Z0AA 4X1IA 3CRCA 4LBEC 2GUZB 2PF4E 1H2MA 3AG2B 3ZN0A 2P6JA 3JD4A 4ZKIA 5FNVA 4O2AB 3ABLB 3KCYA 1AVMA 4LH7A 4KL1A 1VQNV 3K3WA 2CTWA 4DV3B 3OEHG 4DR2O 4OPHA 4DR7O 1AROP 5CBHA 4H33A 3IFXA 3BVOA 4LCUC 2CGOA 3DC5A 4IHJA 1FD9A 1G6UA 1FAFA 1YIJV 2WLIA 2PTMA 1AR4A 2WLKA 1WB8A 4LF9O 1GM9A 4ZOLB 5KUKA 1EFRG 2ZQMA 1MMMA 1NBMG 4MSWC 3APQA 2LW7A 4JI3B 1RSOB 4FJCC 2OWOA 1DK1A 4JI6B 5F2VO 1ENVA 3LDDA 4JI4O 2OIGA 4X1KA 5A2QN 2HJDA 4UV9A 4GKJO 1AJNA 2YC0A 3ICXA 1P84F 2WLLA 2GTAA 4NTXA 2YIBD 3QTCA 3SYOA 3ZS8C 1D5NA 5J2UA 4B08A 1Y66A 2FYUH 3OM3B 3SPHA 2R9IA 5LHHA 1VQ4V 2ZD9A 2YIAA 3CP1A 3SJQC 1BE3H 1VF6A 3T2MA 5LGNA 1EN5A 3MHSC 1JJ2U 2IJIA 1KC8W 1Q6UA 1YITV 4BAYA 4PA7A 3J7AU 1YDXA 1BHAA 1R3LC 2ITCC 2Y69C 4DO2A 2VWKA 3HPLC 1XBLA 4R7CA 4GKKO 2Y0PA 4R50A 2RQ6A 3H1KH 3JAWB 3RYFB 1IBMO 4G27B 4YY3B 1JJOA 3SYAA 1MNGA 4B3TB 4BIOA 1PNMA 3M7MX 1L8DA 1FXKA 4P9PA 3NR7A 3AG1B 4UV8A 2EJRA 1I0HA 1VQMV 4JYYA 3W7SA 4QE7A 4K35A 5JQGA 3H9VA 3IJ4A 5IJ9B 3ZHVA 4CH3A 4DR2B 4O4JB 1O9HA 5GONB 1V55B 2A7WA 4G2KA 3OMAB 3E35A 2PYLA 3SYPA 4LC1A 3FB5C 2ZIMA 1H8EG 4I0XA 3E86A 3JATA 4LF6O 2CUGA 4LF9B 3CJHB 2AXTZ 3UT5B 5BZBA 3ZMTA 2C2AA 3ZMZA 3OMNB 1RPRA 1ZL8A 4JTCB 5CBFA 5KA6A 4NXMO 1KBHA 4BW9A 3GWOA 2BSKB 1Q6HA 5KX5A 3FAVB 1PNKA 2BOCC 2YS8A 1N36O 3WFVA 1Q43A 5LGUA 2Q5ZA 5FL7G 4H44B 4DV2O 2CK3G 4L8JA 4ZBMA 2GV9A 2ZDIC 4FLUA 1BQ0A 1PV0A 4GX5A 4LH6A 5BMVB 3D3QA 5CA1A 1H38A 4JYCA 1SERA 1AP6A 2GSMB 3IGAC 4EFBA 3JAWA 2ZINA 5JJJB 3CRMA 4D7TA 1Z2GA 5H5NA 4FM1A 3OR6C 2RN9A 1TGOA 2QKAA 2DYSB 1XL4A 3JSLA 4I4TA 4UCSA 4DW1A 2OTJV 5IJ0B 1AILA 3GVMA 4DV6O 2WA4A 4MTFA 3ZHUA 1Q3EA 1SZTA 2DYRB 1I5XA 3M8AA 4QGPA 4QPJA 4UCTA 3GWKC 4LF5O 3TXQA 3CCSV 5IJ9A 4I50B 4GX0A 4FK5C 3VBBA 2UUBO 2UU9O 3JSNA 3S3XA 4O4JA 1DGSA 2ITDC 3ETGA 2DJVA 1I7FA 1K4CC 4HZ3A 4XBFA 2FTKA 3CPWU 1YJNV 1WLEA 2YDEA 2PY5A 3HKBB 3OTOO 3I5DA 4JI5O 2OCHA 4X9QA 1GK9A 4GUNA 1CXZB 1EZJA 1DF5A 1OCZC 3AEIA 2YICA 3K9SA 4LFBB 1F23A 3T1CA 1WAZA 1J95A 3D36C 5JCOA 5KMGB 3KCXA 2ETNA 2Q0OC 3QVNA 2WLMA 3T4DA 1ZWIC 3HB3B 1ZAUA 3T1YB 1I94B 4PA4A 3AG3C 2QKCA 4WFHA 2DQ3A 2OT5A 2YXHA 4LNUA 3ZHSA 1OCRC 3ZBHA 5B1BC 1L0NH 1N4CA 4ICGA 1QLNA 1E1RG 1JR9A 2FL4A 2BOBC 1XL6A 4B3MO 4N23A 3QO5A 2YI9A 4NXMB 2Q4PA 4B7EA 5EC1C 2Q9LA 1ZSPA 2KG7A 1BMFG 1PNLA 3S3WA 2F1MA 4DR6O 2QJ1A 3HKEA 4DUZO 5KHIA 2UXBB 3RYCA 2VQEB 2AGAA 2P90A 3L75H 4FMTA 1PM9A 2GTSA 3JASB 1WP8A 3E22A 1NI8A 1YSCA 3OUFA 4I55B 4W4LA 5CA0A 5IYDO 2CDYA 2X7RB 2VWJA 4LF7B 3TJTA 1Y76B 5FPRA 2AZ0A 1EN6A 5B1OA 4ZHQA 1S72V 2F4VB 4O2BB 1OCCC 4TQFA 1Y74B 4DV6B 4PHZA 2A9HA 1QLEC 4L87A 4K3AA 4O4HA 1NZ6A 4JI0O 3TGUH 1JCHA 2ODMA 4LF5B 2Z5UA 1VQKV 1XREA 2UUBB 1VP7A 4JI2O 2UU9B 4QPKA 4FLVA 4Z2WA 2MW2B 4YJ2A 4HAMA 4LFCB 1J5EO 1LUVA 2EIKC 1EZVH 3CYOA 4C7UA 3BRCA 2RNBA 3E2EA 2A79B 2RJZA 5B1AC 1KKDA 4JI5B 3JAMN 1JX9A 1PPJH 3T1HO 4OX9O 3FFQA 5IWAB 4ZI7A 1TAEA 1H2LA 2HVJC 3SGIA 4LWSB 4XDLA 2WWWA 1PD3A 1G8MA 1B06A 1NS1A 2YXLA 3OUSA 4XDKA 2UUCB 4U7NA 4K8ZA 5CB4A 2ATKC 5JJEB 2HEPA 3R65A 3THOA 5LL6Y 3CD6V 1OCOB 3BAAA 5LYJA 4CS4A 4IIJA 1LNQA 4TV9A 3KG2A 1VQ9V 4PDMA 4IGGA 1PL4A 4NXNO 4I55A 4B3MB 1GM8A 3UM7A 1XUQA 3WG7B 1RFYA 2XAGA 1Y76A 3WB0A 3ZJZA 2A06H 3MD0A 4IYIA 1NTZH 2EJ7A 5EIBD 3ETDA 4DR6B 5DECA 4DUZB 1ZX3A 1MSWD 3I55V 3JD1A 4B7KA 2W6JG 4RUFA 4FLXA 1GN2A 1RM1C 1FJGO 2F95B 2HLDG 2IH1C 4WFAV 3E8FA 4HNAB 1IX9A 2K1EA 4X64B 3FB6C 4JZ2A 1R3JC 2LGQA 2PGGA 4WFFA 4AQYO 1P7GA 3CE2A 1FFXB 5KA5A 1YCIA 4B3SB 5EYPB 3RW0A 5CMUA 2OYQA 1YZBA 4FZ1A 3LSQA 4X1IB 5IYBO 5CBGA 4LP8A 3CCUV 5EBMC 1FKAO 5FNVB 2F43G 3CC7V 5TISZ 1G1XB 3KZIZ 1SETA 2HG5C 4P30A 4KHPO 2FB5A 1M1KW 5IE9A 3RWRD 2H8PC 3T1HB 4PA9A 4JI3O 2UXNA 2NNUA 3SJAC 3ZCCA 4J9YB 2LGWA 4DR3B 2QWQB 1QVGU 1CP9A 1OCZB 1GAXA 4X65B 2LFSA 2WLIB 4GZRB 4PV1B 2D2CB 1B04A 1ZUQA 2P4VA 2VS0A 3AK3A 3SDLA 1XQ8A 3ML0A 4ABMA 1IBLB 5L3CA 2XTAA 3W7XA 4O4IA 1BGYH 1AB3A 1QCEA 1OCRB 1PP9H 4P9OA 5EBWC 3G71V 2HHHO 3CB2A 5B1BB 4UVCA 4X1KB 2JS5A 4TV8A 3BHPA 1P7BA 2WLLB 2AZ2A 1K34A 2QM4A 5LA6B 5J2UB 2Q73A 4B3TO 4G28B 1AJPA 1AI6A 3B40A 3QO8A 3K57A 2IM9A 1TUEB 4I5SA 4YXWG 3BCCH 3SJCC 1YEWA 2QGNA 4FPPA 5E1AC 4DR5B 3U10A 2JJ1G 3ZRWA 5C8YB 3JALB 2DW4A 3U0ZA 4AQYB 5D5QA 3AG4B 4MW8A 3F7VC 1K8AW 1GN6A 1WJZA 1XNQB 3UCSC 1QR8A 4DV7B 2GDSA 5AG2A 1FXKB 1N34O 2JS3A 2OIEA 4HBNA 1VF5B 3TCUA 3SPGA 1AR5A 1Q86W 2V1DA 3CCMV 1P49A 3D36A 1FYJA 4EB6B 4NKGB 5JQGB 4QIWF 3FB8C 3STLC 1QU7A 3T4ZA 3VQVA 4KHPB 1F51A 5B66Z 2ZNJA 1O9GA 1H2SB 2XAHA 4MVRA 3TXSA 4JI1B 1FXHA 1EN4A 3SR2C 3N2KB 4DV5O 4UB8Z 2LW1A 3VQYA 4I0XB 1NR1A 3JATB 3E8HA 3B2EE 4KUMA 4BIUA 1H2GA 3EHBB 4WBNA 5LA6A 1AJQA 1ZL8B 3ASNC 5KX5B 1W0JG 1QHTA 3SYCA 2Q7EA 1NU1H 2E74B 2HHHB 3B4SA 1Z5VA 1WNSA 1EBOA 5BR8B 2PYJA 1M57C 5C8YA 3LSUA 3JALA 1NVPD 5CA1B 2DN9A 5IT9N 3FYEB 2P06A 1KUQA 4F6RB 2ZCEA 1AI7A 3LDEA 2Q7HA 2EIJC 4A5UB 4CZZA 3WB1A 5IY5C 5B1NA 2CE4A 4JI7O 4I4TB 4KXRA 3HKCA 2HVKC 4CC5A 5KHJA 4U3JA 3WU2Z 4YIPA 4GLXA 4EB6A 3JYCA 3VQWA 3P32A 4LFBO 3NXSA 5JVDB 4TQDA 1XHZA 3G6BA 1HW7A 3RGBA 1F4MA 1B6QA 3K5MA 3K08A 4GYCB 1SESA 1N34B 1GKFA 1K97A 3T1YO 1RPOA 2KSDA 1I94O 2OCCC 1BHBA 2JJ2G 3QO7A 3N2KA 3CCJV 1HNZB 3C90A 3K5NA 5IYCO 2XOKG 4LFAB 4KP4A 4UVAA 4PD4F 1VQ8V 3EXAA 1YXBA 3BPZA 1MZEA
chains in the Genus database with same CATH topology
5CA3A 3CCEV 3ZIAG 1NH2B 2P90A 1DTOA 1CEZA 1K7DA 2IW5A 4FMTA 3CCVV 3F5WC 4JF3A 1FS0G 2EIKB 2EILB 1YSCA 1V55C 4MTGA 3OUFA 5IYDO 4QJFB 1YJWV 1KQSU 2X7RB 4JGSA 1PKXA 2Z3YA 5B1AB 5LHIA 1YI2V 2QM7A 1H8HG 3JCZA 1Q81W 5B1OA 1AI4A 4WF9V 1AI5A 2JIZG 3VOUA 1GTOA 4R8CA 2Q6AA 2IH3C 2JEXA 1S72V 1OCCC 2PI5A 1K33A 2A9HA 1QLEC 4L87A 3JD2A 5HFMA 1YHQV 5B3SB 5DN6G 3FKSG 3ZMUA 1VQ6V 3A0RA 1JCHA 1VQ7V 5H6QA 5L3EA 3CMEV 2PI4A 1MOFA 2WAMA 4F4LA 2Z5UA 1VQKV 2W0FC 2WLNA 3E83A 4QPKA 5L3DA 3ZN1A 2XAFA 1YTFD 1K92A 4HAMA 1V54C 1P4RA 3ASOC 3K79A 3X2QC 2EIKC 2ZXWC 3CYOA 1S3JA 4R6ZA 3E2EA 3CCQV 2EBOA 2A79B 1JOYA 2JEUA 5B1AC 1KKDA 1NR7A 4MVZA 1JX9A 2Q67A 1L1FA 1DF4A 1S76D 2WSSG 3K0GA 5C93A 5B3SC 2LFRA 2YEVA 2IJKA 3BY6A 2HVJC 2IU3A 2IU0A 4XDLA 2DYSC 2WWWA 4OXSA 1K9MW 1FXVA 1PD3A 1G8MA 3ZMSA 4X8AA 3CC4V 3K9AA 3W7WA 3OUSA 4U7OA 1NQTA 4XDKA 5H9CA 4PA6A 2DWEC 2EZOA 4U7NA 1QVFU 4JASA 2W6IG 5H6RA 1RM1B 2DYRC 4WFGA 2ATKC 2EZPA 2X6AA 2R9RB 2ZDIA 3R65A 5L3FA 3ABKC 3CD6V 3TETA 1OCOB 1OHHG 1ORQC 1QR9A 1LNQA 4MVQA 2EINB 5EC2C 5IDJA 3ABMB 2X6BA 3KG2A 2GHYA 1VQ9V 1MG1A 4PDMA 2V7QG 3BEHA 4MT8A 3GB7C 1KECA 2WPDG 2Y48A 1GM8A 3UM7A 3WG7B 2Q69A 2XAGA 3OW2U 3ZJZA 3MD0A 4MTOA 4KFMA 4RAIA 5LHGA 3ETDA 2YEVB 2P7TC 4XDJA 1M56B 1MSWD 1R6NA 3I55V 3JD1A 4LBEC 2W6JG 4MVSA 2B5UA 4GCZA 2D3OW 4RUFA 3AG2B 1YTFB 2YSUB 3DGEA 4TSFG 1RM1C 3ZN0A 2P6JA 2HLDG 3JD4A 2IH1C 4X88A 2A0LA 4Z1MG 4ZKIA 3ABTA 4HYOA 3ABLB 3ABUA 4WFAV 4FIPC 1OCOC 3G4SV 3E8FA 3W7UA 1VQNV 4DXWA 3K3WA 3ABMC 2K1EA 1K5QA 3FB6C 3OEHG 1JPXA 3OMIB 4GX1A 4UXNA 1AROP 2ZR3A 1NVPB 4WCEV 3ZRXA 5CBHA 3K04A 1R3JC 3WG7C 4H33A 2EIMC 1K3EA 3IFXA 4PA3A 4LCUC 4WFFA 4MVMA 5KA5A 1CPYA 3RW0A 1GMGA 5CMUA 1YIJV 2WLIA 1Q82W 4I9WA 2WLKA 3LSQA 4MW3A 3ZRVA 1GM9A 2JK5C 3CMAV 5KUKA 4H37A 4JTAB 5IYBO 2XAJA 5CBGA 1K73W 3E89A 1EFRG 2LP7A 4LP8A 3CCUV 5EBMC 2ZQMA 3CXCU 3ABLC 1NBMG 1E1QG 1VQ5V 4MSWC 4N21A 2X0LA 1S77D 2F43G 3CC7V 3SPJA 4P2ZA 4FJCC 4WFBV 2Y69B 1SETA 3SPIA 1ENVA 3LDDA 2HG5C 4P30A 1R6KA 2H94A 1M1KW 3ZMVA 2JDIG 2EILC 2H8PC 2AHYA 4UV9A 2QE7G 2QKSA 4PA9A 1AJNA 4RQFA 2UXNA 2WLLA 2NNUA 3OE7G 3ZCCA 3SYOA 4J9YB 3OR7C 3TK1A 3B77A 1QVGU 1CP9A 1COWG 1FFTB 3RVYA 1Y66A 1OCZB 3OM3B 5IY5B 2WLJA 2R9IA 1Y4MA 3SPHA 5LHHA 1VQ4V 2LFSA 2WLIB 2ZD9A 3CP1A 3SJQC 2DWDC 2B1IA 4PDVA 3T2MA 5LGNA 1WPXA 3JD3A 3MHSC 1VQOV 2IJIA 1JJ2U 1KC8W 1YITV 4BAYA 5CN0A 3ML0A 1NH2D 4PA7A 1BHAA 1R3LC 2ITCC 5L3CA 2Y69C 3W7XA 4DO2A 3RBZA 2QM8A 3H01A 4PELA 3STZC 3W7TA 3HPLC 1QCEA 1OCRB 4JYBA 4R7CA 4MVOA 4R50A 4P9OA 5EBWC 3SPCA 3G71V 4JPRA 1AR1B 4MS2A 5B1BB 4UVCA 2M7WA 1DLBA 1G4YB 4G27B 3K06A 2OCCB 1OZ0A 2QTOA 3SYAA 1P7BA 1PNMA 4BIZA 1MABG 2WLLB 1E79G 1FXKA 3FYIB 1HWYA 4P9PA 1K34A 3AG1B 4UV8A 3PJSK 3UKMA 2MK3A 2EJRA 3RVZA 2HKOA 5EK0A 2XNDG 1VQMV 4G28B 3W7SA 4QE7A 1AJPA 1K4DC 4X89A 1AI6A 3JD0A 4JAUA 3FB7C 3QO8A 1TUEB 4I5SA 4YXWG 4FPPA 5E1AC 1W2BU 3M99B 4ASUG 1QBZA 2B1GA 2JJ1G 3ZRWA 2IJHA 1V55B 2QA4V 4G2KA 3OMAB 1IXMA 3E35A 2EINC 5KUMA 2DW4A 3SYPA 3CCLV 4LC1A 3EFFK 3FB5C 3AG4B 4MW8A 3F7VC 1K8AW 4Q20A 4JTDB 2AHZA 1H8EG 4EKWA 3E86A 3G6EV 3OAAG 1QR8A 1FXKB 1THZA 5BZBA 4QE9A 2NLJC 2C2AA 3ZMTA 4J9ZB 3ZMZA 3OMNB 1RPRA 4JTCB 3TCUA 5CBFA 5KA6A 3SPGA 3LDCA 5EBLC 3IC7A 1M56C 1Q86W 2V1DA 3CCMV 3GWOA 4RO2A 3D36A 5LGTA 3AG2C 2IJJA 1PNKA 2BOCC 3WFVA 1ROPA 4QIWF 3FB8C 1V54B 3ASOB 4RUEA 3X2QB 3ASNB 3E8GA 3LUTB 3STLC 3T4ZA 5LGUA 1S5HC 4RQEA 1F51A 2ZXWB 1W0KG 2DQ0A 5FL7G 4UVBA 3D3IA 2CK3G 4ZBMA 2ZDIC 3ZRWB 3B8MA 4GX5A 3SYQA 2XAHA 3LNMB 2UXXA 4MVRA 1M57B 1GO3F 3AG4C 1H38A 4BW5A 4JYCA 1SERA 1FXHA 1R73A 2GSMB 3IGAC 3OEEG 1M90W 3CC2V 4MVUA 3DTUB 4WFEA 1FXKC 3OFNG 3P30A 1NR1A 3E8HA 3ZRSA 3K03A 4KUMA 4BIUA 5HFLA 3OR6C 1H2GA 3EHBB 2DYSB 1XL4A 4UUJC 2OTJV 1AJQA 2EIJB 1KP2A 4MTFA 2X6CA 5GW7A 1SZTA 3ASNC 2DYRB 1I5XA 1W0JG 3ABKB 3SYCA 4QPJA 5DM6V 1YJ9V 5L3GA 1N8RW 3CCSV 2KB1A 4GX0A 4FK5C 3VBBA 1EBOA 1M57C 2ITDC 3ETGA 1K4CC 3AG3B 4TWKA 1BL8A 1R3KC 4HZ3A 1VQPV 2XAQA 4XBFA 1NVPD 2HFEC 2QEXV 2FTKA 3FYEB 3CPWU 1YJNV 1WLEA 1S0VA 2ZR2A 3F7YC 1AI7A 2HR3A 3CCRV 3LDEA 1F4NA 1GK9A 4CBCA 4JAVA 2WLHA 2EIJC 1EZJA 5J9PC 1NJIW 4CZZA 3OGCC 1DF5A 1OCZC 5IY5C 3AEIA 1SRYA 2OTLV 5B1NA 1I5YA 1F23A 3T1CA 2HVKC 1J95A 4PDRA 2XASA 3E8BA 2WLMA 1R3IC 4TT3G 3T4DA 3JYCA 1K5SA 1ZWIC 3HB3B 1Q7YW 3P32A 3NXSA 4PA4A 3AG3C 4WFHA 2DQ3A 1JQ0A 2OT5A 2Q68A 4QNHB 1F4MA 1B6QA 1OCRC 3QNEA 4PDLA 5L3BA 4E2LA 2EIMB 1JVMA 1M9NA 5B1BC 3K08A 1SESA 1GKFA 1K97A 1RPOA 4MTXA 1QLNA 1E1RG 2OCCC 3ETEA 1BHBA 2BOBC 1NKDA 2JJ2G 1XL6A 3MHHC 3B8NA 3QO7A 4N23A 3CCJV 1GM7A 3QO5A 5IYCO 1KP3A 2XOKG 3AG1C 4GT1A 5EC1C 4KP4A 1OCCB 3K0DA 4UVAA 1PL0A 2P67A 4GX2A 1QLEB 1BMFG 1PNLA 1KD1W 3LSSA 1VQLV 1VQ8V 5LBQA 2HJFC 3I56V 1UJWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  1YJ9 V;  2QA4 V;  3CCE V;  1N8R W;  3G4S V;  3CCS V;  1S72 V;  1Q86 W;  3CCM V;  3CC4 V;  2OTL V;  1VQN V;  1YIT V;  3CCQ V;  3CMA V;  1YHQ V;  3OW2 U;  1QVF U;  3CCL V;  3CCV V;  1K73 W;  1VQ6 V;  5DM6 V;  1NJI W;  3CCU V;  1M1K W;  1VQ7 V;  3CXC U;  3CME V;  3CCJ V;  1VQP V;  1VQM V;  1QVG U;  3G71 V;  1K8A W;  4WCE V;  1K9M W;  1VQ5 V;  2QEX V;  3CD6 V;  2OTJ V;  3I55 V;  1VQK V;  3CPW U;  1YJN V;  3G6E V;  1Q7Y W;  3CC7 V;  1VQ4 V;  2D3O W;  1YJW V;  1M90 W;  1KQS U;  4WFB V;  1KD1 W;  1VQL V;  1YI2 V;  1VQO V;  1JJ2 U;  1VQ8 V;  3CCR V;  1VQ9 V;  1Q81 W;  1W2B U;  1R73 A;  4WF9 V;  1KC8 W;  1YIJ V;  3I56 V;  1Q82 W;  4WFA V; 
#chains in the Genus database with same CATH topology
 3CCE V;  1HR0 B;  2G38 A;  3QG5 A;  2BTQ B;  1DTO A;  4D6T H;  1XI1 A;  3CCV V;  3U11 A;  5KLV H;  1H2N A;  5K1P A;  1FS0 G;  3B09 A;  2CTP A;  4LNU B;  4DV5 B;  1SQB H;  2UXB O;  2VQE O;  4QJF B;  1KQS U;  3WB2 A;  5LHI A;  4X66 B;  2QM7 A;  1H8H G;  2YI8 A;  4F6R A;  3VOU A;  4R8C A;  4CC6 A;  2IH3 C;  2PI5 A;  5J2T B;  3JD2 A;  3H1L H;  5B3S B;  2ZT9 B;  3FKS G;  4LF7 O;  1VQ6 V;  1HNW B;  2PI4 A;  3CME V;  2KG7 B;  1NTM H;  3HKE B;  4JI8 O;  2F4V O;  1D5A A;  2ILM A;  3E83 A;  3ZN1 A;  3RYC B;  3X2Q C;  1P4R A;  1FPO A;  2LQT A;  3O65 A;  5JVD A;  3E22 B;  4K0K B;  2EBO A;  1JOY A;  1SQF A;  5LMU O;  4FFB A;  5CA0 B;  4NVP A;  4LFC O;  1Q6I A;  3JAR A;  1HNX B;  2QWR B;  3K0G A;  4ZHQ B;  4JI7 B;  4FLW A;  2YEV A;  4X20 B;  3RFR A;  1SA0 B;  4J80 A;  1B3Q A;  4BR6 A;  1OJH A;  4OXS A;  4O4H B;  4X8A A;  1XNR B;  2JVD A;  3H1I H;  5IWA O;  2ZKO A;  5H6R A;  2W6I G;  3H1H H;  1VAR A;  2X6A A;  2R9R B;  3A8T A;  2BTQ A;  4YJ2 B;  1AP5 A;  2UUC O;  3J80 N;  2GHY A;  3RYH B;  1MG1 A;  3D8C A;  4UFZ A;  3IAY A;  3OW2 U;  3CX5 F;  2BE3 A;  1F7Y A;  4MTO A;  4KFM A;  4ZI7 B;  4FM0 A;  5J2T A;  3K5O A;  2B5U A;  2D3O W;  1BQZ A;  1YTF B;  3DGE A;  3FX7 A;  4Z1M G;  2A0L A;  4J10 A;  3ABT A;  3ABU A;  5CB4 B;  4I9Q A;  3G4S V;  2DMX A;  3W7U A;  1SC5 B;  3RT3 C;  4DXW A;  1UFI A;  3ABM C;  4JV5 B;  1GRJ A;  2VRZ A;  1BCC H;  1JPX A;  3OMI B;  4IIJ B;  5LYJ B;  3G67 A;  4TV9 B;  1NVP B;  2NR5 A;  1VF7 A;  3ZRX A;  3K04 A;  1K3E A;  3LNN A;  4MVM A;  4X64 O;  3AG7 A;  1Q82 W;  4JZG A;  3ZED A;  4DYL A;  4JI8 B;  3ZRV A;  4X20 A;  2JK5 C;  1SA0 A;  1ZLZ A;  4JTA B;  1K73 W;  3E89 A;  4B3S O;  4J7K A;  1SQG A;  3CXC U;  1N33 B;  3ABL C;  4N21 A;  2LJ2 A;  5LXT A;  1IUR A;  2PZS A;  4P2Z A;  4WFB V;  5LMU B;  2Y69 B;  3KKY A;  2H94 A;  3ZMV A;  1Q5O A;  2AHY A;  3CRQ A;  1BZK A;  4RWU A;  3RYH A;  3OE7 G;  2CGN A;  3TK1 A;  3AK1 A;  2RCV A;  3B77 A;  1COW G;  5IY5 B;  5JH7 B;  4PDV A;  2B1I A;  3JD3 A;  1WP7 A;  2QTS A;  1XOU A;  4DR3 O;  5CN0 A;  1NH2 D;  1KMI Z;  4X65 O;  3HKD A;  4J7Z A;  2UXC B;  3ZHR A;  3STZ C;  1XMO O;  1SKV A;  4JYB A;  3SPC A;  4JPR A;  1AR1 B;  1KU9 A;  5KAI Z;  1IBL O;  3IC9 A;  1DLB A;  5GTI Z;  3K06 A;  2WA3 A;  2OCC B;  3OGI B;  1OZ0 A;  2QWN B;  3JAK A;  4BIZ A;  1MAB G;  1E79 G;  1HWY A;  2MK3 A;  3RN4 A;  2P5O A;  4J41 A;  2BCC H;  1HP8 A;  3RVZ A;  2HKO A;  2Y0I A;  2XND G;  4Z1V A;  1LUW A;  1I08 A;  1UPG A;  5JWP A;  3M99 B;  1QBZ A;  4O4I B;  2FML A;  4FLZ A;  4X1Y A;  2EIN C;  3C3S A;  4DV4 B;  3O9O A;  2UXD O;  3ZHT A;  2KKW A;  4DR5 O;  4TV8 B;  4FFK A;  3CS5 A;  4JTD B;  4Q20 A;  4JYA B;  1Y67 A;  4DR4 B;  3G6E V;  3CEI A;  2QSA A;  2ZM6 B;  1THZ A;  2NLJ C;  4LF4 O;  5JH7 A;  4AHC A;  3LDC A;  1M56 C;  1XNQ O;  1VEW A;  1S5L Z;  3R66 A;  4DV7 O;  2IJJ A;  4I7Z B;  1WPB A;  5DM6 V;  3X2Q B;  4RQE A;  2ZE5 A;  4IYH A;  3ZRW B;  3B8M A;  3SYQ A;  3LNM B;  2UXX A;  4DK1 A;  2ZE7 A;  4IT5 A;  3RYI A;  4BW5 A;  3CSX A;  1R1B A;  3OEE G;  3CRR A;  5FLX N;  3DTU B;  4WFE A;  2EX3 A;  3L74 H;  2RDC A;  3OFN G;  3G80 A;  3K03 A;  5HFL A;  4JI1 O;  4PI2 A;  4UUJ C;  2YUA A;  2P22 C;  1D2D A;  2X6C A;  2ZE6 A;  5GW7 A;  1XMO B;  4LF8 B;  1Y6X A;  2Q8V A;  1YJ9 V;  5L3G A;  2KB1 A;  2L35 A;  1KYO F;  2R9A A;  2YID A;  3Q4H B;  5BXZ A;  2VQF O;  2F66 C;  2QWP B;  1WB7 A;  3AG3 B;  1R3K C;  1VQP V;  4EFE A;  1S0V A;  3A0H Z;  3FD9 A;  3F5T A;  2ZR2 A;  4DUY B;  1IVS A;  3F7Y C;  5BR8 O;  4DR1 O;  2EUL A;  1F4N A;  4UCU A;  4CBC A;  1NJI W;  5J9P C;  3OGC C;  1SRY A;  2OTL V;  1I5Y A;  4WBN B;  5B5E Z;  3L73 H;  4O4L A;  4PDR A;  2QR4 A;  3SJB C;  1R3I C;  4TT3 G;  3ZHQ A;  1ZTE A;  5KHH A;  1Q7Y W;  3L9D A;  1JQ0 A;  3L71 H;  2UXD B;  4CS2 A;  4J11 A;  1HDJ A;  2JGD B;  1XHX A;  4PDL A;  4E2L A;  4LR3 A;  3JCU Z;  1JVM A;  1M9N A;  1TUB B;  4LF4 B;  1GN3 A;  3MHH C;  3B8N A;  4B3R O;  1GM7 A;  1KP3 A;  4DRX A;  1N0J A;  1WN7 A;  1OCC B;  3K0D A;  1PL0 A;  2P67 A;  5LP6 C;  1QLE B;  1IBK B;  1RP3 B;  3LSS A;  1VQL V;  2HJF C;  1JFF A;  3HKC B;  3I56 V;  1HNZ O;  5ITZ A;  1UJW B;  4U3J B;  1NH2 B;  4LFA O;  1BS3 A;  4DV1 B;  2FKX A;  3F5W C;  3DXR A;  3Q4H A;  3AK2 A;  2EIK B;  4TOI A;  4MTG A;  3L70 H;  1HR0 O;  2HP8 A;  4UCO A;  5B1A B;  3JCZ A;  1AI4 A;  1U96 A;  1IXB A;  1GTO A;  4BWA A;  2JEX A;  1YHQ V;  3EVK A;  4FZ0 A;  5FPO A;  1WA8 B;  5DN6 G;  2CH7 B;  3A0R A;  4X66 O;  5BY1 A;  1VQ7 V;  5H6Q A;  1KB9 F;  1MOF A;  2WAM A;  4F4L A;  4YJ3 A;  2VQF B;  1YTF D;  2XAF A;  5LMN B;  1K92 A;  1V54 C;  3ASO C;  1HNW O;  3K79 A;  4YHH B;  2ZXW C;  2XHB A;  2YXY A;  1S3J A;  4R6Z A;  1US6 A;  3BFR A;  2JGD A;  3APO A;  4CH6 A;  4DR1 B;  2ZIO A;  1URF A;  2E5L B;  2Q67 A;  2RMK B;  1SS3 A;  1L1F A;  2WSS G;  5C93 A;  1XEQ A;  5JJN B;  1TUB A;  1N32 O;  1T5E A;  4K0K O;  1JA8 A;  3UO3 A;  3DSQ A;  2IU3 A;  2IU0 A;  2GUZ A;  2CTQ A;  3ZMS A;  1HNX O;  2F23 A;  3CC4 V;  3K9A A;  4EEQ A;  3W7W A;  4U7O A;  5H9C A;  4PA6 A;  4O2A A;  4JAS A;  2E75 B;  1RM1 B;  4WFG A;  2EZP A;  3QF7 A;  5L3F A;  3N27 A;  3ABK C;  1OHH G;  2B9Z A;  1XNR O;  4MVQ A;  4TUY B;  2EIN B;  2CTR A;  4CH4 A;  1KEC A;  2WPD G;  3CXH F;  1EM1 A;  4B3R B;  4FFB B;  3JAR B;  2ZE8 A;  3H1J H;  4RAI A;  4NTW A;  1M93 A;  4X62 O;  2YEV B;  4ZOL A;  2R70 A;  5DED A;  4XDJ A;  1M56 B;  1IDS A;  1R6N A;  4MVS A;  1WA8 A;  2CH7 A;  2CAZ C;  4UB6 Z;  4GCZ A;  2YSU B;  4TSF G;  2BTO A;  1GN4 A;  4DR7 B;  2Y4U A;  4X88 A;  4AI8 A;  4HYO A;  1RSO A;  4FIP C;  1OCO C;  3CRA A;  1YF2 A;  1K5Q A;  4UXN A;  4GX1 A;  4DW0 A;  2ZR3 A;  4WCE V;  4J7J A;  3WG7 C;  2EIM C;  3OT7 A;  4PA3 A;  4JV5 O;  2M6Y A;  1CPY A;  2N74 A;  1GMG A;  1TVK B;  5K1X A;  4I9W A;  4Q6G A;  4MW3 A;  3CMA V;  3P3P A;  4H37 A;  2XAJ A;  4JI4 B;  2LP7 A;  3A0B Z;  1E1Q G;  1VQ5 V;  4GKJ B;  1XDC A;  2X0L A;  1S77 D;  2Y4T A;  1X4T A;  3SPJ A;  4CS3 A;  1QNM A;  3A2F A;  3SPI A;  2W0X A;  1N33 O;  1R6K A;  3RYF A;  2JDI G;  4TUY A;  2EIL C;  2DE0 X;  4NYK A;  2QE7 G;  1Z5W A;  4OPA A;  2QKS A;  1N32 B;  4RQF A;  3OR7 C;  1FFT B;  3RVY A;  2WLJ A;  1Y4M A;  2DWD C;  4E4E A;  4DV0 O;  1WPX A;  1VQO V;  3K59 A;  1TA8 A;  4GKK B;  1S5J A;  4FVM A;  3K5L A;  5H2F Z;  2PUS A;  1IBM B;  1U97 A;  3RBZ A;  2QM8 A;  3H01 A;  4PEL A;  5GON A;  3W7T A;  5LXT B;  2QDO A;  4MVO A;  4MS2 A;  2M7W A;  1G4Y B;  2DOS A;  2UXC O;  2XUM A;  2QTO A;  4X62 B;  3CJH A;  2GBO A;  3FYI B;  3UT5 A;  5E79 Z;  1MA1 A;  3PJS K;  3UKM A;  5LP6 B;  2ZNI A;  4PJ0 Z;  1YVW A;  1TVK A;  5EK0 A;  2BSK A;  2ARH A;  3FAV A;  1K4D C;  4X89 A;  3JD0 A;  4JAU A;  3FB7 C;  2O57 A;  1W2B U;  3HKD B;  4ASU G;  2B1G A;  2IJH A;  5BMV A;  4CH5 A;  2QA4 V;  1X59 A;  2NN4 A;  2Q0A A;  4LF6 B;  1IXM A;  4H0L B;  5KUM A;  3CWB H;  3CCL V;  1W59 A;  2LO1 A;  3MDS A;  3EFF K;  2R72 A;  1NT2 B;  2K9P A;  1M5I A;  2KQX A;  2AHZ A;  4EKW A;  3JAK B;  3BA9 A;  3OAA G;  5IYZ B;  2ADP A;  1N36 B;  4PI0 A;  4QE9 A;  4DV4 O;  3HR0 A;  5IJ0 A;  1VF6 C;  2P4K A;  4W4K A;  4J9Z B;  1N0N A;  5EBL C;  3IC7 A;  4DV2 B;  4F6E A;  4JYA O;  3ETQ A;  4RO2 A;  4DR4 O;  5LGT A;  3AG2 C;  2ZM6 O;  1ROP A;  3L72 H;  1V54 B;  3ASO B;  4RUE A;  4I50 A;  3ASN B;  3E8G A;  3LUT B;  1XMQ O;  1S5H C;  2ZXW B;  1W0K G;  2DQ0 A;  4NB5 A;  4UVB A;  5A9G A;  3D3I A;  1MZF A;  1M57 B;  4X1Y B;  1GO3 F;  3AG4 C;  1MSD A;  3BAB A;  4H13 B;  4UCR A;  1R73 A;  1M90 W;  1IZ3 A;  3HKB A;  3CC2 V;  1VIB A;  4MVU A;  2UUA O;  1H2K A;  4OGQ B;  4FM2 A;  1FXK C;  2XT9 A;  4DV0 B;  3P30 A;  3ZRS A;  2AW9 A;  4UCV A;  2A3Q A;  1SQQ H;  2EIJ B;  5LP6 A;  3J81 N;  5KMG A;  1KP2 A;  2F93 B;  3ZX6 A;  1R6T A;  2N04 A;  1BT8 A;  4IL6 Z;  3ABK B;  1N8R W;  3C3T A;  2V4D A;  3VQX A;  5KHG A;  3K58 A;  3OTO B;  1L0L H;  4TWK A;  1BL8 A;  4LF8 O;  2XAQ A;  3UQ8 A;  2HFE C;  2QEX V;  3RYI B;  1SQV H;  2YIB A;  2HR3 A;  3CCR V;  5EIB C;  1QQC A;  4JAV A;  1VMG A;  2WLH A;  2JRI A;  5IYZ A;  3OTF A;  4FLT A;  4DUY O;  2XAS A;  2ADQ B;  1SZX A;  3E8B A;  5GTH Z;  1K5S A;  1V9P A;  3JAS A;  2N05 A;  3DC6 A;  2Q68 A;  4QNH B;  4DK0 A;  3QNE A;  5L3B A;  4U3F H;  2EIM B;  5KHK A;  5KAF Z;  4MTX A;  4FLY A;  3ETE A;  1NKD A;  5EZY B;  4O2B A;  1Y74 A;  4NTY A;  5LOV B;  3AG1 C;  4GT1 A;  4J42 A;  1Q90 D;  2L6L A;  4GX2 A;  1KD1 W;  5LBQ A;  1XMQ B;  1GH6 A;  4O4L B;  1Q8I A;  5CA3 A;  3ZIA G;  2E76 B;  1CEZ A;  3UO2 A;  1K7D A;  3N2G B;  4YIO A;  2IW5 A;  1IBK O;  3PN1 A;  4JF3 A;  1BSM A;  2EIL B;  1V55 C;  2H3O A;  2UUA B;  2JGU A;  1YJW V;  4JGS A;  4DV3 O;  1SF9 A;  4DV1 O;  1PKX A;  2Z3Y A;  1YI2 V;  4JI0 B;  1Q81 W;  4WF9 V;  1AI5 A;  2JIZ G;  2Q6A A;  1SQP H;  4JI2 B;  1K33 A;  1SQX H;  4LWS A;  5HFM A;  4DRX B;  3ZMU A;  1J5E B;  3MAQ A;  5L3E A;  1KKC A;  5JCO C;  4ZIB A;  1JFF B;  5ITZ B;  2W0F C;  2WLN A;  5L3D A;  4OX9 B;  1M4U A;  3DXR B;  1XIL A;  3CCQ V;  2JEU A;  2IBZ H;  4JI6 O;  1NR7 A;  1NTK H;  4MVZ A;  1LR1 A;  5LMN O;  4YHH O;  4AIL C;  4IHJ B;  1DF4 A;  1S76 D;  4D7S A;  5B3S C;  2LFR A;  5EZY A;  2IJK A;  3BY6 A;  5LOV A;  5D5P A;  2DYS C;  1K9M W;  1FXV A;  2E5L O;  1A32 A;  4K8X A;  1NQT A;  2DWE C;  2E3C A;  2EZO A;  1QVF U;  3OD4 A;  4YJ3 B;  2DYR C;  4NXN B;  2ZDI A;  4NR1 A;  4HNA A;  3TET A;  3N2G A;  1ORQ C;  1QR9 A;  3BA8 A;  5EC2 C;  5IDJ A;  3ABM B;  2X6B A;  2V7Q G;  3BEH A;  4MT8 A;  3GB7 C;  4JAA A;  2Y48 A;  1FFX A;  1JMK C;  2Q69 A;  3P3N A;  5EYP A;  3CHX A;  4YY3 O;  1FJG B;  2Q7G A;  5LHG A;  1OV9 A;  2P7T C;  2QWO B;  2Z0A A;  4X1I A;  3CRC A;  4LBE C;  2GUZ B;  2PF4 E;  1H2M A;  3AG2 B;  3ZN0 A;  2P6J A;  3JD4 A;  4ZKI A;  5FNV A;  4O2A B;  3ABL B;  3KCY A;  1AVM A;  4LH7 A;  4KL1 A;  1VQN V;  3K3W A;  2CTW A;  4DV3 B;  3OEH G;  4DR2 O;  4OPH A;  4DR7 O;  1ARO P;  5CBH A;  4H33 A;  3IFX A;  3BVO A;  4LCU C;  2CGO A;  3DC5 A;  4IHJ A;  1FD9 A;  1G6U A;  1FAF A;  1YIJ V;  2WLI A;  2PTM A;  1AR4 A;  2WLK A;  1WB8 A;  4LF9 O;  1GM9 A;  4ZOL B;  5KUK A;  1EFR G;  2ZQM A;  1MMM A;  1NBM G;  4MSW C;  3APQ A;  2LW7 A;  4JI3 B;  1RSO B;  4FJC C;  2OWO A;  1DK1 A;  4JI6 B;  5F2V O;  1ENV A;  3LDD A;  4JI4 O;  2OIG A;  4X1K A;  5A2Q N;  2HJD A;  4UV9 A;  4GKJ O;  1AJN A;  2YC0 A;  3ICX A;  1P84 F;  2WLL A;  2GTA A;  4NTX A;  2YIB D;  3QTC A;  3SYO A;  3ZS8 C;  1D5N A;  5J2U A;  4B08 A;  1Y66 A;  2FYU H;  3OM3 B;  3SPH A;  2R9I A;  5LHH A;  1VQ4 V;  2ZD9 A;  2YIA A;  3CP1 A;  3SJQ C;  1BE3 H;  1VF6 A;  3T2M A;  5LGN A;  1EN5 A;  3MHS C;  1JJ2 U;  2IJI A;  1KC8 W;  1Q6U A;  1YIT V;  4BAY A;  4PA7 A;  3J7A U;  1YDX A;  1BHA A;  1R3L C;  2ITC C;  2Y69 C;  4DO2 A;  2VWK A;  3HPL C;  1XBL A;  4R7C A;  4GKK O;  2Y0P A;  4R50 A;  2RQ6 A;  3H1K H;  3JAW B;  3RYF B;  1IBM O;  4G27 B;  4YY3 B;  1JJO A;  3SYA A;  1MNG A;  4B3T B;  4BIO A;  1PNM A;  3M7M X;  1L8D A;  1FXK A;  4P9P A;  3NR7 A;  3AG1 B;  4UV8 A;  2EJR A;  1I0H A;  1VQM V;  4JYY A;  3W7S A;  4QE7 A;  4K35 A;  5JQG A;  3H9V A;  3IJ4 A;  5IJ9 B;  3ZHV A;  4CH3 A;  4DR2 B;  4O4J B;  1O9H A;  5GON B;  1V55 B;  2A7W A;  4G2K A;  3OMA B;  3E35 A;  2PYL A;  3SYP A;  4LC1 A;  3FB5 C;  2ZIM A;  1H8E G;  4I0X A;  3E86 A;  3JAT A;  4LF6 O;  2CUG A;  4LF9 B;  3CJH B;  2AXT Z;  3UT5 B;  5BZB A;  3ZMT A;  2C2A A;  3ZMZ A;  3OMN B;  1RPR A;  1ZL8 A;  4JTC B;  5CBF A;  5KA6 A;  4NXM O;  1KBH A;  4BW9 A;  3GWO A;  2BSK B;  1Q6H A;  5KX5 A;  3FAV B;  1PNK A;  2BOC C;  2YS8 A;  1N36 O;  3WFV A;  1Q43 A;  5LGU A;  2Q5Z A;  5FL7 G;  4H44 B;  4DV2 O;  2CK3 G;  4L8J A;  4ZBM A;  2GV9 A;  2ZDI C;  4FLU A;  1BQ0 A;  1PV0 A;  4GX5 A;  4LH6 A;  5BMV B;  3D3Q A;  5CA1 A;  1H38 A;  4JYC A;  1SER A;  1AP6 A;  2GSM B;  3IGA C;  4EFB A;  3JAW A;  2ZIN A;  5JJJ B;  3CRM A;  4D7T A;  1Z2G A;  5H5N A;  4FM1 A;  3OR6 C;  2RN9 A;  1TGO A;  2QKA A;  2DYS B;  1XL4 A;  3JSL A;  4I4T A;  4UCS A;  4DW1 A;  2OTJ V;  5IJ0 B;  1AIL A;  3GVM A;  4DV6 O;  2WA4 A;  4MTF A;  3ZHU A;  1Q3E A;  1SZT A;  2DYR B;  1I5X A;  3M8A A;  4QGP A;  4QPJ A;  4UCT A;  3GWK C;  4LF5 O;  3TXQ A;  3CCS V;  5IJ9 A;  4I50 B;  4GX0 A;  4FK5 C;  3VBB A;  2UUB O;  2UU9 O;  3JSN A;  3S3X A;  4O4J A;  1DGS A;  2ITD C;  3ETG A;  2DJV A;  1I7F A;  1K4C C;  4HZ3 A;  4XBF A;  2FTK A;  3CPW U;  1YJN V;  1WLE A;  2YDE A;  2PY5 A;  3HKB B;  3OTO O;  3I5D A;  4JI5 O;  2OCH A;  4X9Q A;  1GK9 A;  4GUN A;  1CXZ B;  1EZJ A;  1DF5 A;  1OCZ C;  3AEI A;  2YIC A;  3K9S A;  4LFB B;  1F23 A;  3T1C A;  1WAZ A;  1J95 A;  3D36 C;  5JCO A;  5KMG B;  3KCX A;  2ETN A;  2Q0O C;  3QVN A;  2WLM A;  3T4D A;  1ZWI C;  3HB3 B;  1ZAU A;  3T1Y B;  1I94 B;  4PA4 A;  3AG3 C;  2QKC A;  4WFH A;  2DQ3 A;  2OT5 A;  2YXH A;  4LNU A;  3ZHS A;  1OCR C;  3ZBH A;  5B1B C;  1L0N H;  1N4C A;  4ICG A;  1QLN A;  1E1R G;  1JR9 A;  2FL4 A;  2BOB C;  1XL6 A;  4B3M O;  4N23 A;  3QO5 A;  2YI9 A;  4NXM B;  2Q4P A;  4B7E A;  5EC1 C;  2Q9L A;  1ZSP A;  2KG7 A;  1BMF G;  1PNL A;  3S3W A;  2F1M A;  4DR6 O;  2QJ1 A;  3HKE A;  4DUZ O;  5KHI A;  2UXB B;  3RYC A;  2VQE B;  2AGA A;  2P90 A;  3L75 H;  4FMT A;  1PM9 A;  2GTS A;  3JAS B;  1WP8 A;  3E22 A;  1NI8 A;  1YSC A;  3OUF A;  4I55 B;  4W4L A;  5CA0 A;  5IYD O;  2CDY A;  2X7R B;  2VWJ A;  4LF7 B;  3TJT A;  1Y76 B;  5FPR A;  2AZ0 A;  1EN6 A;  5B1O A;  4ZHQ A;  1S72 V;  2F4V B;  4O2B B;  1OCC C;  4TQF A;  1Y74 B;  4DV6 B;  4PHZ A;  2A9H A;  1QLE C;  4L87 A;  4K3A A;  4O4H A;  1NZ6 A;  4JI0 O;  3TGU H;  1JCH A;  2ODM A;  4LF5 B;  2Z5U A;  1VQK V;  1XRE A;  2UUB B;  1VP7 A;  4JI2 O;  2UU9 B;  4QPK A;  4FLV A;  4Z2W A;  2MW2 B;  4YJ2 A;  4HAM A;  4LFC B;  1J5E O;  1LUV A;  2EIK C;  1EZV H;  3CYO A;  4C7U A;  3BRC A;  2RNB A;  3E2E A;  2A79 B;  2RJZ A;  5B1A C;  1KKD A;  4JI5 B;  3JAM N;  1JX9 A;  1PPJ H;  3T1H O;  4OX9 O;  3FFQ A;  5IWA B;  4ZI7 A;  1TAE A;  1H2L A;  2HVJ C;  3SGI A;  4LWS B;  4XDL A;  2WWW A;  1PD3 A;  1G8M A;  1B06 A;  1NS1 A;  2YXL A;  3OUS A;  4XDK A;  2UUC B;  4U7N A;  4K8Z A;  5CB4 A;  2ATK C;  5JJE B;  2HEP A;  3R65 A;  3THO A;  5LL6 Y;  3CD6 V;  1OCO B;  3BAA A;  5LYJ A;  4CS4 A;  4IIJ A;  1LNQ A;  4TV9 A;  3KG2 A;  1VQ9 V;  4PDM A;  4IGG A;  1PL4 A;  4NXN O;  4I55 A;  4B3M B;  1GM8 A;  3UM7 A;  1XUQ A;  3WG7 B;  1RFY A;  2XAG A;  1Y76 A;  3WB0 A;  3ZJZ A;  2A06 H;  3MD0 A;  4IYI A;  1NTZ H;  2EJ7 A;  5EIB D;  3ETD A;  4DR6 B;  5DEC A;  4DUZ B;  1ZX3 A;  1MSW D;  3I55 V;  3JD1 A;  4B7K A;  2W6J G;  4RUF A;  4FLX A;  1GN2 A;  1RM1 C;  1FJG O;  2F95 B;  2HLD G;  2IH1 C;  4WFA V;  3E8F A;  4HNA B;  1IX9 A;  2K1E A;  4X64 B;  3FB6 C;  4JZ2 A;  1R3J C;  2LGQ A;  2PGG A;  4WFF A;  4AQY O;  1P7G A;  3CE2 A;  1FFX B;  5KA5 A;  1YCI A;  4B3S B;  5EYP B;  3RW0 A;  5CMU A;  2OYQ A;  1YZB A;  4FZ1 A;  3LSQ A;  4X1I B;  5IYB O;  5CBG A;  4LP8 A;  3CCU V;  5EBM C;  1FKA O;  5FNV B;  2F43 G;  3CC7 V;  5TIS Z;  1G1X B;  3KZI Z;  1SET A;  2HG5 C;  4P30 A;  4KHP O;  2FB5 A;  1M1K W;  5IE9 A;  3RWR D;  2H8P C;  3T1H B;  4PA9 A;  4JI3 O;  2UXN A;  2NNU A;  3SJA C;  3ZCC A;  4J9Y B;  2LGW A;  4DR3 B;  2QWQ B;  1QVG U;  1CP9 A;  1OCZ B;  1GAX A;  4X65 B;  2LFS A;  2WLI B;  4GZR B;  4PV1 B;  2D2C B;  1B04 A;  1ZUQ A;  2P4V A;  2VS0 A;  3AK3 A;  3SDL A;  1XQ8 A;  3ML0 A;  4ABM A;  1IBL B;  5L3C A;  2XTA A;  3W7X A;  4O4I A;  1BGY H;  1AB3 A;  1QCE A;  1OCR B;  1PP9 H;  4P9O A;  5EBW C;  3G71 V;  2HHH O;  3CB2 A;  5B1B B;  4UVC A;  4X1K B;  2JS5 A;  4TV8 A;  3BHP A;  1P7B A;  2WLL B;  2AZ2 A;  1K34 A;  2QM4 A;  5LA6 B;  5J2U B;  2Q73 A;  4B3T O;  4G28 B;  1AJP A;  1AI6 A;  3B40 A;  3QO8 A;  3K57 A;  2IM9 A;  1TUE B;  4I5S A;  4YXW G;  3BCC H;  3SJC C;  1YEW A;  2QGN A;  4FPP A;  5E1A C;  4DR5 B;  3U10 A;  2JJ1 G;  3ZRW A;  5C8Y B;  3JAL B;  2DW4 A;  3U0Z A;  4AQY B;  5D5Q A;  3AG4 B;  4MW8 A;  3F7V C;  1K8A W;  1GN6 A;  1WJZ A;  1XNQ B;  3UCS C;  1QR8 A;  4DV7 B;  2GDS A;  5AG2 A;  1FXK B;  1N34 O;  2JS3 A;  2OIE A;  4HBN A;  1VF5 B;  3TCU A;  3SPG A;  1AR5 A;  1Q86 W;  2V1D A;  3CCM V;  1P49 A;  3D36 A;  1FYJ A;  4EB6 B;  4NKG B;  5JQG B;  4QIW F;  3FB8 C;  3STL C;  1QU7 A;  3T4Z A;  3VQV A;  4KHP B;  1F51 A;  5B66 Z;  2ZNJ A;  1O9G A;  1H2S B;  2XAH A;  4MVR A;  3TXS A;  4JI1 B;  1FXH A;  1EN4 A;  3SR2 C;  3N2K B;  4DV5 O;  4UB8 Z;  2LW1 A;  3VQY A;  4I0X B;  1NR1 A;  3JAT B;  3E8H A;  3B2E E;  4KUM A;  4BIU A;  1H2G A;  3EHB B;  4WBN A;  5LA6 A;  1AJQ A;  1ZL8 B;  3ASN C;  5KX5 B;  1W0J G;  1QHT A;  3SYC A;  2Q7E A;  1NU1 H;  2E74 B;  2HHH B;  3B4S A;  1Z5V A;  1WNS A;  1EBO A;  5BR8 B;  2PYJ A;  1M57 C;  5C8Y A;  3LSU A;  3JAL A;  1NVP D;  5CA1 B;  2DN9 A;  5IT9 N;  3FYE B;  2P06 A;  1KUQ A;  4F6R B;  2ZCE A;  1AI7 A;  3LDE A;  2Q7H A;  2EIJ C;  4A5U B;  4CZZ A;  3WB1 A;  5IY5 C;  5B1N A;  2CE4 A;  4JI7 O;  4I4T B;  4KXR A;  3HKC A;  2HVK C;  4CC5 A;  5KHJ A;  4U3J A;  3WU2 Z;  4YIP A;  4GLX A;  4EB6 A;  3JYC A;  3VQW A;  3P32 A;  4LFB O;  3NXS A;  5JVD B;  4TQD A;  1XHZ A;  3G6B A;  1HW7 A;  3RGB A;  1F4M A;  1B6Q A;  3K5M A;  3K08 A;  4GYC B;  1SES A;  1N34 B;  1GKF A;  1K97 A;  3T1Y O;  1RPO A;  2KSD A;  1I94 O;  2OCC C;  1BHB A;  2JJ2 G;  3QO7 A;  3N2K A;  3CCJ V;  1HNZ B;  3C90 A;  3K5N A;  5IYC O;  2XOK G;  4LFA B;  4KP4 A;  4UVA A;  4PD4 F;  1VQ8 V;  3EXA A;  1YXB A;  3BPZ A;  1MZE A; 
#chains in the Genus database with same CATH homology
 5CA3 A;  3CCE V;  3ZIA G;  1NH2 B;  2P90 A;  1DTO A;  1CEZ A;  1K7D A;  2IW5 A;  4FMT A;  3CCV V;  3F5W C;  4JF3 A;  1FS0 G;  2EIK B;  2EIL B;  1YSC A;  1V55 C;  4MTG A;  3OUF A;  5IYD O;  4QJF B;  1YJW V;  1KQS U;  2X7R B;  4JGS A;  1PKX A;  2Z3Y A;  5B1A B;  5LHI A;  1YI2 V;  2QM7 A;  1H8H G;  3JCZ A;  1Q81 W;  5B1O A;  1AI4 A;  4WF9 V;  1AI5 A;  2JIZ G;  3VOU A;  1GTO A;  4R8C A;  2Q6A A;  2IH3 C;  2JEX A;  1S72 V;  1OCC C;  2PI5 A;  1K33 A;  2A9H A;  1QLE C;  4L87 A;  3JD2 A;  5HFM A;  1YHQ V;  5B3S B;  5DN6 G;  3FKS G;  3ZMU A;  1VQ6 V;  3A0R A;  1JCH A;  1VQ7 V;  5H6Q A;  5L3E A;  3CME V;  2PI4 A;  1MOF A;  2WAM A;  4F4L A;  2Z5U A;  1VQK V;  2W0F C;  2WLN A;  3E83 A;  4QPK A;  5L3D A;  3ZN1 A;  2XAF A;  1YTF D;  1K92 A;  4HAM A;  1V54 C;  1P4R A;  3ASO C;  3K79 A;  3X2Q C;  2EIK C;  2ZXW C;  3CYO A;  1S3J A;  4R6Z A;  3E2E A;  3CCQ V;  2EBO A;  2A79 B;  1JOY A;  2JEU A;  5B1A C;  1KKD A;  1NR7 A;  4MVZ A;  1JX9 A;  2Q67 A;  1L1F A;  1DF4 A;  1S76 D;  2WSS G;  3K0G A;  5C93 A;  5B3S C;  2LFR A;  2YEV A;  2IJK A;  3BY6 A;  2HVJ C;  2IU3 A;  2IU0 A;  4XDL A;  2DYS C;  2WWW A;  4OXS A;  1K9M W;  1FXV A;  1PD3 A;  1G8M A;  3ZMS A;  4X8A A;  3CC4 V;  3K9A A;  3W7W A;  3OUS A;  4U7O A;  1NQT A;  4XDK A;  5H9C A;  4PA6 A;  2DWE C;  2EZO A;  4U7N A;  1QVF U;  4JAS A;  2W6I G;  5H6R A;  1RM1 B;  2DYR C;  4WFG A;  2ATK C;  2EZP A;  2X6A A;  2R9R B;  2ZDI A;  3R65 A;  5L3F A;  3ABK C;  3CD6 V;  3TET A;  1OCO B;  1OHH G;  1ORQ C;  1QR9 A;  1LNQ A;  4MVQ A;  2EIN B;  5EC2 C;  5IDJ A;  3ABM B;  2X6B A;  3KG2 A;  2GHY A;  1VQ9 V;  1MG1 A;  4PDM A;  2V7Q G;  3BEH A;  4MT8 A;  3GB7 C;  1KEC A;  2WPD G;  2Y48 A;  1GM8 A;  3UM7 A;  3WG7 B;  2Q69 A;  2XAG A;  3OW2 U;  3ZJZ A;  3MD0 A;  4MTO A;  4KFM A;  4RAI A;  5LHG A;  3ETD A;  2YEV B;  2P7T C;  4XDJ A;  1M56 B;  1MSW D;  1R6N A;  3I55 V;  3JD1 A;  4LBE C;  2W6J G;  4MVS A;  2B5U A;  4GCZ A;  2D3O W;  4RUF A;  3AG2 B;  1YTF B;  2YSU B;  3DGE A;  4TSF G;  1RM1 C;  3ZN0 A;  2P6J A;  2HLD G;  3JD4 A;  2IH1 C;  4X88 A;  2A0L A;  4Z1M G;  4ZKI A;  3ABT A;  4HYO A;  3ABL B;  3ABU A;  4WFA V;  4FIP C;  1OCO C;  3G4S V;  3E8F A;  3W7U A;  1VQN V;  4DXW A;  3K3W A;  3ABM C;  2K1E A;  1K5Q A;  3FB6 C;  3OEH G;  1JPX A;  3OMI B;  4GX1 A;  4UXN A;  1ARO P;  2ZR3 A;  1NVP B;  4WCE V;  3ZRX A;  5CBH A;  3K04 A;  1R3J C;  3WG7 C;  4H33 A;  2EIM C;  1K3E A;  3IFX A;  4PA3 A;  4LCU C;  4WFF A;  4MVM A;  5KA5 A;  1CPY A;  3RW0 A;  1GMG A;  5CMU A;  1YIJ V;  2WLI A;  1Q82 W;  4I9W A;  2WLK A;  3LSQ A;  4MW3 A;  3ZRV A;  1GM9 A;  2JK5 C;  3CMA V;  5KUK A;  4H37 A;  4JTA B;  5IYB O;  2XAJ A;  5CBG A;  1K73 W;  3E89 A;  1EFR G;  2LP7 A;  4LP8 A;  3CCU V;  5EBM C;  2ZQM A;  3CXC U;  3ABL C;  1NBM G;  1E1Q G;  1VQ5 V;  4MSW C;  4N21 A;  2X0L A;  1S77 D;  2F43 G;  3CC7 V;  3SPJ A;  4P2Z A;  4FJC C;  4WFB V;  2Y69 B;  1SET A;  3SPI A;  1ENV A;  3LDD A;  2HG5 C;  4P30 A;  1R6K A;  2H94 A;  1M1K W;  3ZMV A;  2JDI G;  2EIL C;  2H8P C;  2AHY A;  4UV9 A;  2QE7 G;  2QKS A;  4PA9 A;  1AJN A;  4RQF A;  2UXN A;  2WLL A;  2NNU A;  3OE7 G;  3ZCC A;  3SYO A;  4J9Y B;  3OR7 C;  3TK1 A;  3B77 A;  1QVG U;  1CP9 A;  1COW G;  1FFT B;  3RVY A;  1Y66 A;  1OCZ B;  3OM3 B;  5IY5 B;  2WLJ A;  2R9I A;  1Y4M A;  3SPH A;  5LHH A;  1VQ4 V;  2LFS A;  2WLI B;  2ZD9 A;  3CP1 A;  3SJQ C;  2DWD C;  2B1I A;  4PDV A;  3T2M A;  5LGN A;  1WPX A;  3JD3 A;  3MHS C;  1VQO V;  2IJI A;  1JJ2 U;  1KC8 W;  1YIT V;  4BAY A;  5CN0 A;  3ML0 A;  1NH2 D;  4PA7 A;  1BHA A;  1R3L C;  2ITC C;  5L3C A;  2Y69 C;  3W7X A;  4DO2 A;  3RBZ A;  2QM8 A;  3H01 A;  4PEL A;  3STZ C;  3W7T A;  3HPL C;  1QCE A;  1OCR B;  4JYB A;  4R7C A;  4MVO A;  4R50 A;  4P9O A;  5EBW C;  3SPC A;  3G71 V;  4JPR A;  1AR1 B;  4MS2 A;  5B1B B;  4UVC A;  2M7W A;  1DLB A;  1G4Y B;  4G27 B;  3K06 A;  2OCC B;  1OZ0 A;  2QTO A;  3SYA A;  1P7B A;  1PNM A;  4BIZ A;  1MAB G;  2WLL B;  1E79 G;  1FXK A;  3FYI B;  1HWY A;  4P9P A;  1K34 A;  3AG1 B;  4UV8 A;  3PJS K;  3UKM A;  2MK3 A;  2EJR A;  3RVZ A;  2HKO A;  5EK0 A;  2XND G;  1VQM V;  4G28 B;  3W7S A;  4QE7 A;  1AJP A;  1K4D C;  4X89 A;  1AI6 A;  3JD0 A;  4JAU A;  3FB7 C;  3QO8 A;  1TUE B;  4I5S A;  4YXW G;  4FPP A;  5E1A C;  1W2B U;  3M99 B;  4ASU G;  1QBZ A;  2B1G A;  2JJ1 G;  3ZRW A;  2IJH A;  1V55 B;  2QA4 V;  4G2K A;  3OMA B;  1IXM A;  3E35 A;  2EIN C;  5KUM A;  2DW4 A;  3SYP A;  3CCL V;  4LC1 A;  3EFF K;  3FB5 C;  3AG4 B;  4MW8 A;  3F7V C;  1K8A W;  4Q20 A;  4JTD B;  2AHZ A;  1H8E G;  4EKW A;  3E86 A;  3G6E V;  3OAA G;  1QR8 A;  1FXK B;  1THZ A;  5BZB A;  4QE9 A;  2NLJ C;  2C2A A;  3ZMT A;  4J9Z B;  3ZMZ A;  3OMN B;  1RPR A;  4JTC B;  3TCU A;  5CBF A;  5KA6 A;  3SPG A;  3LDC A;  5EBL C;  3IC7 A;  1M56 C;  1Q86 W;  2V1D A;  3CCM V;  3GWO A;  4RO2 A;  3D36 A;  5LGT A;  3AG2 C;  2IJJ A;  1PNK A;  2BOC C;  3WFV A;  1ROP A;  4QIW F;  3FB8 C;  1V54 B;  3ASO B;  4RUE A;  3X2Q B;  3ASN B;  3E8G A;  3LUT B;  3STL C;  3T4Z A;  5LGU A;  1S5H C;  4RQE A;  1F51 A;  2ZXW B;  1W0K G;  2DQ0 A;  5FL7 G;  4UVB A;  3D3I A;  2CK3 G;  4ZBM A;  2ZDI C;  3ZRW B;  3B8M A;  4GX5 A;  3SYQ A;  2XAH A;  3LNM B;  2UXX A;  4MVR A;  1M57 B;  1GO3 F;  3AG4 C;  1H38 A;  4BW5 A;  4JYC A;  1SER A;  1FXH A;  1R73 A;  2GSM B;  3IGA C;  3OEE G;  1M90 W;  3CC2 V;  4MVU A;  3DTU B;  4WFE A;  1FXK C;  3OFN G;  3P30 A;  1NR1 A;  3E8H A;  3ZRS A;  3K03 A;  4KUM A;  4BIU A;  5HFL A;  3OR6 C;  1H2G A;  3EHB B;  2DYS B;  1XL4 A;  4UUJ C;  2OTJ V;  1AJQ A;  2EIJ B;  1KP2 A;  4MTF A;  2X6C A;  5GW7 A;  1SZT A;  3ASN C;  2DYR B;  1I5X A;  1W0J G;  3ABK B;  3SYC A;  4QPJ A;  5DM6 V;  1YJ9 V;  5L3G A;  1N8R W;  3CCS V;  2KB1 A;  4GX0 A;  4FK5 C;  3VBB A;  1EBO A;  1M57 C;  2ITD C;  3ETG A;  1K4C C;  3AG3 B;  4TWK A;  1BL8 A;  1R3K C;  4HZ3 A;  1VQP V;  2XAQ A;  4XBF A;  1NVP D;  2HFE C;  2QEX V;  2FTK A;  3FYE B;  3CPW U;  1YJN V;  1WLE A;  1S0V A;  2ZR2 A;  3F7Y C;  1AI7 A;  2HR3 A;  3CCR V;  3LDE A;  1F4N A;  1GK9 A;  4CBC A;  4JAV A;  2WLH A;  2EIJ C;  1EZJ A;  5J9P C;  1NJI W;  4CZZ A;  3OGC C;  1DF5 A;  1OCZ C;  5IY5 C;  3AEI A;  1SRY A;  2OTL V;  5B1N A;  1I5Y A;  1F23 A;  3T1C A;  2HVK C;  1J95 A;  4PDR A;  2XAS A;  3E8B A;  2WLM A;  1R3I C;  4TT3 G;  3T4D A;  3JYC A;  1K5S A;  1ZWI C;  3HB3 B;  1Q7Y W;  3P32 A;  3NXS A;  4PA4 A;  3AG3 C;  4WFH A;  2DQ3 A;  1JQ0 A;  2OT5 A;  2Q68 A;  4QNH B;  1F4M A;  1B6Q A;  1OCR C;  3QNE A;  4PDL A;  5L3B A;  4E2L A;  2EIM B;  1JVM A;  1M9N A;  5B1B C;  3K08 A;  1SES A;  1GKF A;  1K97 A;  1RPO A;  4MTX A;  1QLN A;  1E1R G;  2OCC C;  3ETE A;  1BHB A;  2BOB C;  1NKD A;  2JJ2 G;  1XL6 A;  3MHH C;  3B8N A;  3QO7 A;  4N23 A;  3CCJ V;  1GM7 A;  3QO5 A;  5IYC O;  1KP3 A;  2XOK G;  3AG1 C;  4GT1 A;  5EC1 C;  4KP4 A;  1OCC B;  3K0D A;  4UVA A;  1PL0 A;  2P67 A;  4GX2 A;  1QLE B;  1BMF G;  1PNL A;  1KD1 W;  3LSS A;  1VQL V;  1VQ8 V;  5LBQ A;  2HJF C;  3I56 V;  1UJW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...