4AQYO

Structure of ribosome-apramycin complexes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4aqyO00
2UXBO 4X66O 2LW7A 4DR1O 1X59A 2AGAA 1KUQA 4GKKO 4GKJO 4DV0O 4JYAO 2UXDO 3F5TA 4DR5O 4DV2O 4KHPO 2JRIA 3JAMN 2VQEO 1HNXO 2HHHO 5FLXN 4DR4O 1G1XB 4X64O 4DV5O 1AB3A 2F4VO 4DUYO 5LL6Y 1N33O 1XMOO 4B3RO 4DV4O 1D2DA 1N36O 3J80N 4DV3O 2UXCO 2ZM6O 1FKAO 4LFBO 1F7YA 4JI7O 4DUZO 1FJGO 4K0KO 2N74A 4YY3O 1N34O 4OPHA 4B3MO 4JI6O 2ZKOA 4LF5O 1R1BA 5BR8O 5BXZA 4DV7O 1YZBA 1IBKO 1XNQO 1XNRO 4A5UB 4YHHO 1FYJA 2DJVA 4B3TO 3SDLA 4LF9O 1HNWO 2E5LO 3OTOO 4DV6O 5H5NA 4LF6O 3J81N 4JI5O 5BY1A 1R6TA 5LMNO 4JV5O 4NXMO 4LF8O 4DR3O 4AQYO 3O65A 4DR6O 4X65O 4JI4O 4B3SO 4LF7O 2FKXA 1A32A 3J7AU 5LMUO 3R66A 4LFCO 2VQFO 2DOSA 4X62O 4LF4O 1I94O 1XEQA 4JI0O 1IBMO 1DK1A 3T1HO 5IWAO 1HNZO 2Z0AA 2UUCO 4JI8O 4DR2O 4OX9O 2UUBO 1IBLO 4JI3O 4DR7O 4NXNO 4LFAO 3M8AA 4JI1O 1AILA 3T1YO 2UU9O 3RT3C 1HR0O 4JI2O 4OPAA 5IT9N 1XMQO 1J5EO 2UUAO 4DV1O 1NS1A 5A2QN 1N32O
chains in the Genus database with same CATH superfamily
2ZT9B 2VS0A 1AJQA 1PL4A 4N21A 2AGAA 2D2CB 1YCIA 2AHYA 2FTKA 1K92A 1OV9A 1H38A 1ZX3A 1N34B 5KUKA 4BIZA 1P49A 1G8MA 3CC2V 1R3LC 4CS3A 2PUSA 1XREA 3S3WA 4DUYO 4DK1A 5EYPA 5EBWC 1CP9A 3J80N 3OTOB 4DV6B 2JEXA 2ADQB 3SPGA 3MHHC 3AG4B 4ZBMA 1TUEB 1I0HA 4H0LB 1DLBA 3FKSG 2EIKC 4DK0A 5BR8O 1Q3EA 1SKVA 2ZE6A 3NR7A 4PDVA 2YSUB 4YJ3A 4X62B 1M9NA 5EBLC 4PA3A 1QR8A 2ZDIA 5H5NA 4JPRA 1VF7A 3CRCA 3JAWA 2NR5A 1IBLB 4MVOA 3E89A 4PD4F 4UB6Z 1R3KC 4LFAB 1GN4A 3QO7A 4Z1VA 1MABG 4EEQA 1WN7A 4B3SO 3HKDB 3E8BA 4UCVA 1XMQB 3N2GB 3B77A 1JJOA 1Y4MA 2XTAA 3N2KB 1TGOA 2EINC 1H2MA 3H1HH 3JCZA 4IYIA 2UUBO 3ZRWA 4I4TB 2WLMA 4O2BB 1DF4A 4AI8A 3VQXA 5B3SB 1Q82W 3SGIA 3OTFA 2HG5C 4WFEA 3ZRVA 2K1EA 3B40A 2RCVA 3CE2A 1VQ9V 1MSDA 3RYFB 1JPXA 2QKSA 2OCCC 3F7VC 4JI7B 3LDDA 4MTGA 1FFTB 4FVMA 2P7TC 4O4LA 4PV1B 1B04A 5JJNB 4LF5B 3TXSA 3IGAC 3SJBC 1BMFG 3ABLB 4KUMA 1YTFD 1WNSA 5LXTA 1THZA 5JCOA 4K35A 1X4TA 3AK3A 3CRAA 1JCHA 3TCUA 4LBEC 1IXMA 1L0LH 2E3CA 5KLVH 1Q90D 1XNQO 3RYCB 4DV7O 2EILB 4H44B 3ZEDA 1AR1B 1BS3A 4PELA 1D5AA 1XL6A 3T1HB 1HNWO 1MA1A 1PKXA 3JCUZ 1HNZB 2E5LO 3J81N 1QU7A 4JYCA 2IH3C 3ETDA 1OZ0A 4ABMA 5LOVB 1XUQA 4X65O 4JI4O 1TAEA 1VQMV 5J9PC 1YHQV 3CCRV 2XAJA 1I94O 1QVFU 3OW2U 4IHJA 1I94B 3ABKB 3LDCA 4JYBA 3O9OA 4I0XA 2ATKC 1DTOA 3ZMSA 5JQGA 4OX9O 2YI9A 1WB8A 4K8XA 4QGPA 1H8EG 4LR3A 1BHBA 4KFMA 3ZIAG 5IJ0B 2Y0PA 3LSSA 3N27A 3ZRSA 5GTHZ 1K34A 2ITCC 1BZKA 2P6JA 4O4JB 4HBNA 1WPBA 4DW0A 2QE7G 2VWKA 3AG4C 5H2FZ 1L8DA 5KHHA 4HZ3A 3CRRA 1RPOA 2QR4A 4PA6A 2W6JG 1Q8IA 4GCZA 4F6EA 3BCCH 5BZBA 4DR5O 1AR4A 3H01A 2VQEO 3BAAA 2YIDA 4YIOA 2QTSA 2VQEB 2P5OA 1UPGA 5K1XA 5JVDB 4DRXB 4FFBA 3PJSK 3K0DA 5F2VO 3CCJV 1ZUQA 3QTCA 1PP9H 3WG7B 4LF8B 3QNEA 4BWAA 4H33A 3CSXA 2ITDC 3QF7A 2Q8VA 4IIJA 3ZN0A 2HJFC 2HLDG 4JTAB 3AG7A 4P30A 3ZMTA 4ZHQB 1QR9A 3OMIB 1RSOA 2ZXWB 1PNMA 4JI5O 3OT7A 2BCCH 2DQ3A 4BR6A 3AG2B 1R3JC 1V9PA 2JVDA 3APQA 4JASA 2GUZB 2FKXA 1EFRG 3C90A 1URFA 1K73W 1Y66A 1Z2GA 1EBOA 1SQGA 5EC1C 1XEQA 1QLEC 3BA8A 2M7WA 3K5OA 3FAVA 4NTWA 3U10A 4J9YB 1BL8A 3ABLC 3T1YO 4IGGA 3CX5F 5L3GA 3BABA 3EFFK 2WWWA 1KQSU 4TT3G 5KHJA 4DV1O 4DV1B 3IJ4A 4MS2A 5JJJB 5LP6B 3ZMVA 4JZGA 5JH7B 2Q73A 4YIPA 1MMMA 2EBOA 5KHGA 2EIMB 4ZI7B 2IH1C 1XDCA 2EILC 4XDKA 3U0ZA 2IJIA 3DGEA 4J41A 1SESA 3E8GA 2YXLA 3E8HA 4X64O 1Q6UA 1XILA 4FM0A 4B3RO 1S5HC 4B3RB 3K04A 2UXCO 2IM9A 4NXMB 3ZS8C 1SQQH 3WFVA 2WLNA 4O4LB 2OTLV 1GMGA 1BT8A 5CA1B 5BXZA 3FX7A 1XNRO 1EN5A 3ABKC 4LFCB 1GH6A 2Q9LA 1B6QA 1T5EA 2QGNA 2B5UA 1L0NH 1K5SA 3MD0A 5IJ9B 3W7UA 5FPOA 4BIUA 4NXNB 4DR6O 2CK3G 2JJ2G 2LFSA 3HKDA 2RN9A 5IYDO 1YXBA 3N2GA 2VQFO 1WP7A 1EZJA 2HP8A 3QO8A 3BY6A 5IWAO 4P2ZA 1NU1H 2WPDG 5LA6A 5IWAB 1AJPA 4JI8O 3I56V 2YIAA 4I4TA 3OGCC 5L3CA 4O2BA 4WCEV 5FPRA 1SQXH 2AXTZ 3MDSA 1NI8A 2UU9O 1JR9A 2EZPA 4OPAA 3WG7C 2Q7GA 1N32O 2Y4TA 2QKCA 1ROPA 2R70A 1N32B 3H1JH 2XHBA 2CDYA 3VQYA 2OIEA 1W59A 2L35A 1R6NA 2CUGA 2FL4A 3ZHTA 1S5JA 3L72H 2JRIA 2HHHO 1HDJA 1H2LA 2HHHB 1L1FA 2A0LA 2Q69A 5FL7G 4YHHB 1OCCB 2ZXWC 4X1YB 2ZNJA 4DV4O 3JD2A 3CRQA 3AG2C 1F7YA 1SQVH 1SF9A 4UVAA 4DUZO 1YEWA 3K08A 4DUZB 4R8CA 1V54B 2DW4A 4GZRB 4OPHA 1M56B 1ZSPA 5EIBC 2L6LA 3RYCA 1Q5OA 3HKCB 1R3IC 1YZBA 3TJTA 3B4SA 4FFKA 4B3TO 4TUYA 4GUNA 4RAIA 4BW9A 3HKEB 1JVMA 1NT2B 2HVJC 5BY1A 1K4CC 1NJIW 4TSFG 5B66Z 5LOVA 5H9CA 2W0XA 5C93A 2QDOA 5LBQA 2QWOB 2YS8A 4MTFA 4B7EA 2Z3YA 3RYIA 5LP6C 3CCEV 3CS5A 1KU9A 4FLXA 1JJ2U 1YITV 2WLIB 2EIMC 3E35A 3LUTB 2NLJC 5J2UB 4X89A 3DSQA 1SRYA 3P3NA 5IJ0A 1XHZA 1ZLZA 2RMKB 4U3FH 1KB9F 1GO3F 3GB7C 4DR4B 3ZJZA 2DE0X 4EFBA 3E2EA 1GM8A 3W7WA 3DXRB 2R9IA 4LWSA 4MSWC 3CWBH 3W7TA 1TA8A 5DEDA 3JSNA 1KUQA 4GKJO 1K5QA 1AR5A 4TV8A 4MTOA 3CCUV 2ZE7A 4JYAO 3OMNB 4YY3B 1XL4A 4JYAB 4DV2O 5EIBD 3AEIA 4JF3A 2YIBD 5EZYB 4DRXA 5JVDA 3AG3B 2PGGA 4F6RB 1E1QG 2B1GA 1KP2A 2DYSB 2XT9A 2Q67A 3SPIA 2LO1A 5LMNB 3VQWA 1JX9A 4Q20A 1HP8A 3TXQA 5LHGA 1N34O 4ZKIA 1VIBA 3H1IH 3OR6C 2JGDB 3CEIA 3JARB 4GX1A 2DWEC 4ZHQA 1NQTA 1KKCA 4JGSA 4LP8A 2LQTA 4F4LA 5CBHA 4NYKA 3OTOO 4DV6O 5EC2C 2JS5A 4O2AB 3ZHQA 4J42A 1K97A 3L70H 2H94A 1JA8A 2GUZA 2WLJA 1FPOA 1VMGA 3VOUA 3OMAB 3SPJA 3SYPA 2A3QA 1W0JG 2YIBA 4NTYA 2CTPA 4X62O 2VWJA 5L3BA 3R65A 1IDSA 3JATB 3K0GA 2UUAB 1GN6A 1MNGA 3I5DA 4X9QA 5CA0B 2IJJA 1MG1A 1IBLO 4DR1B 4DR7O 1B3QA 4OXSA 2CAZC 4NB5A 4DR7B 4LFAO 3IAYA 2UXDB 1KKDA 4X8AA 3MHSC 1QVGU 1OCCC 3L9DA 1NR7A 1XMQO 3RYHB 4FMTA 3PN1A 3CCMV 3LSUA 5KUMA 4GYCB 1M90W 1SQBH 5CB4B 5LP6A 1FAFA 2WA4A 1H2KA 5JH7A 1PNLA 1V54C 5LA6B 1M56C 1MZFA 3EVKA 2RJZA 4I50B 4ZI7A 1G6UA 2A7WA 3F5TA 1JMKC 2X7RB 1LUWA 1NH2B 2LFRA 4I7ZB 3KKYA 3H1LH 1AP6A 2Q68A 3KZIZ 4FLUA 3L71H 1EZVH 4U3JB 1Y74B 1Z5VA 2CE4A 4JI7O 1AVMA 4DR3B 2WLLB 4B3MO 2XNDG 5CA1A 4B3MB 4LF5O 4NR1A 3K59A 2OWOA 4JAUA 3A2FA 1Q81W 4FK5C 1HW7A 4GLXA 4DXWA 1NTMH 3ABMB 5D5QA 2F95B 1S77D 1Y76A 5IJ9A 2AZ0A 3UT5A 5IY5B 3SYQA 2GBOA 1YIJV 2B9ZA 2PF4E 1YDXA 3JD3A 1FXVA 5DECA 1PD3A 2EULA 1DK1A 3T1HO 1HNZO 4B08A 1BSMA 2KG7B 2HJDA 3ML0A 1Q86W 1RFYA 2EX3A 4TUYB 5A9GA 4KL1A 2JDIG 5DN6G 1I5YA 3RBZA 3AG3C 2E76B 2DYSC 1HNXB 1MOFA 1PNKA 4CH6A 1MZEA 1F4NA 4RUFA 1N8RW 4DV5B 2CGOA 1AI4A 2CTWA 2UXBO 3RYIB 4LNUA 2JEUA 2UXBB 1F4MA 1LUVA 4UCUA 3RWRD 3FB6C 4QE9A 4ZOLA 4E4EA 4DV0O 1FJGB 2ZR3A 3TETA 4DV0B 3A8TA 4MVRA 2MK3A 4XBFA 4FPPA 1PV0A 2WA3A 4PHZA 3ZHSA 1VQNV 5B1OA 1NKDA 3FD9A 4X1YA 4I9QA 3LNMB 1I08A 1QBZA 3APOA 2KB1A 3JALB 2BE3A 2GHYA 3EHBB 2XUMA 4LWSB 5KHKA 2NN4A 4EB6B 4Z1MG 3CPWU 4AQYB 4GX2A 4CS4A 4K0KO 3HKCA 4TV8B 1FXKB 4K0KB 5DM6V 2BTQB 1VF6A 4TV9A 1VQ6V 3ICXA 1XBLA 3HKEA 2E75B 4KXRA 1I5XA 2UUCB 3DC6A 4PDLA 3CXCU 4LF8O 2NNUA 1PPJH 4FM2A 3THOA 3OFNG 1KC8W 2ZE5A 4K8ZA 1GM7A 1Z5WA 4UV9A 3STLC 1WA8B 2C2AA 5D5PA 1K3EA 1BE3H 1VF5B 2R9RB 2P06A 4NVPA 2QM8A 3K03A 3WB1A 2P90A 2WLIA 3WB0A 5IDJA 5J2UA 3CP1A 5B3SC 4J9ZB 3M8AA 4MVQA 3UM7A 4UCSA 3ZBHA 3TGUH 1P4RA 2VRZA 4WFAV 2RDCA 2F23A 4UXNA 1VQPV 2YC0A 3DXRA 3JD4A 4U7OA 3K57A 4MVUA 4CC6A 1OCZB 4JZ2A 1KBHA 3Q4HB 1QCEA 3FB5C 4KHPO 5EZYA 3JAMN 1WPXA 4R50A 4KHPB 1KMIZ 4F6RA 4GT1A 3IC9A 2KQXA 5JWPA 2ADPA 2A9HA 1P7BA 2DQ0A 2LJ2A 5IY5C 2HKOA 4LF9B 3RGBA 3SYCA 1VEWA 1WLEA 4MVZA 4BAYA 4J7ZA 4UB8Z 2KSDA 1K8AW 2JGDA 4LF7B 2K9PA 3QG5A 4P9PA 3JARA 1QHTA 3K58A 5GONB 2QEXV 1O9HA 4JI0B 1AP5A 3G80A 1QNMA 4O2AA 4RO2A 4GX0A 2DN9A 3IFXA 5KX5B 1R6TA 4NXMO 4J80A 1M57B 1IXBA 5J2TB 1U96A 3A0BZ 1RP3B 4FJCC 3CC4V 2ZINA 1NH2D 3J7AU 4JI1B 3FYIB 4PDRA 1YI2V 4LFCO 3JATA 3CB2A 2JS3A 3UKMA 2V4DA 5CA0A 2DYRB 1Y76B 4NXNO 1HWYA 1RPRA 3UT5B 2BOCC 5FNVB 5KAFZ 4HYOA 4Q6GA 1F51A 2M6YA 3RN4A 3SR2C 2OIGA 1H2NA 3RT3C 1YJ9V 4FZ1A 1N4CA 3RYHA 3JSLA 3GWOA 3SPCA 2WSSG 5CB4A 3ZHRA 3I55V 1VQKV 4CH3A 1LNQA 4GX5A 1SERA 4JAVA 4FLWA 2JIZG 3GWKC 2CTQA 3K5LA 1FXKC 4PA4A 3OEHG 4G28B 4I50A 3OR7C 2YXYA 5GTIZ 2ODMA 2V1DA 4KP4A 4CH5A 1EN6A 3UQ8A 3P3PA 3ZMUA 4BIOA 4MVSA 1SA0B 3B8MA 1BGYH 3C3TA 4U3JA 1Y74A 3ASNB 1R73A 2OT5A 4C7UA 3JASB 4LFBO 1JOYA 4LNUB 4TQDA 3E86A 4LFBB 2CH7B 1VQ5V 2BTOA 2WLLA 4JV5B 4W4KA 2N74A 4ZOLB 1IX9A 2H3OA 2P4KA 2Y69B 1KYOF 2WLKA 3P30A 1E79G 2AHZA 4YHHO 2EIKB 1VARA 4TQFA 2WAMA 2V7QG 5L3EA 4BW5A 3LNNA 5CA3A 1KP3A 5H6QA 2QWRB 2ARHA 5H6RA 2GTAA 4XDLA 5B1AB 2Q4PA 3DC5A 3SYAA 5BMVA 2W6IG 5LMUO 2Q6AA 3R66A 4K3AA 5EBMC 5LMUB 1VQ8V 2DWDC 2KG7A 4TV9B 1JFFB 1BHAA 4DR2O 2E74B 4JI3O 4DR2B 4JI3B 4O4IB 2W0FC 1S76D 4JTCB 1S0VA 4UV8A 4IYHA 1NR1A 3NXSA 5KA6A 5A2QN 3SPHA 5HFMA 4XDJA 3STZC 2YDEA 2OCHA 4WFBV 2LW7A 1X59A 1TVKB 1SC5B 2F93B 1ENVA 1IZ3A 4JI6B 5L3DA 1FFXB 1IBKB 3CD6V 4DR4O 3BHPA 4LH7A 1NVPB 1N0JA 3SJCC 5LL6Y 3JALA 4H37A 3WB2A 1N33O 1N33B 1GTOA 1N36O 1M57C 1OCOB 4DO2A 1FKAO 1BQZA 4EB6A 1N36B 3L75H 4UCRA 2O57A 3ETQA 2QWNB 1FXKA 4YY3O 4U7NA 4X1KB 2BTQA 2XAGA 3SJQC 2QKAA 3E22B 2UXXA 4L87A 1UFIA 3H9VA 5CBFA 3LSQA 3L73H 1VQLV 3D3IA 1MSWD 2DJVA 4PI0A 2DYRC 2CTRA 1SQPH 3OEEG 4FLTA 1WB7A 3ASOB 1PM9A 5LMNO 2Y0IA 3E8FA 1P84F 2ZR2A 4EFEA 2XAFA 1YSCA 3JD0A 5EK0A 3G6BA 1WA8A 3BRCA 1P7GA 3ZMZA 4IL6Z 1G4YB 3D36C 1CEZA 4NTXA 3OAAG 2YUAA 3CCLV 4CS2A 5LYJB 4O4HB 4UVBA 3BVOA 3QVNA 4WFGA 5ITZB 2Q0AA 1WAZA 3AK2A 3ASNC 5K1PA 4J7JA 2X6CA 4CZZA 5KAIZ 2UUAO 4MT8A 4DUYB 2BSKB 4EKWA 3K9AA 1RM1B 4DR1O 1NTZH 2Y69C 2D3OW 3Q4HA 1KD1W 2UXDO 2FMLA 1WP8A 1EN4A 2R9AA 2Q0OC 2R72A 5BR8B 2ZD9A 2QA4V 3G4SV 5LGUA 2F4VO 2LP7A 2F4VB 1D2DA 1WJZA 3HKBA 2QJ1A 4DV3O 2N05A 2GV9A 3OUFA 4I55B 1ZL8B 4DV3B 2X6BA 3OUSA 4QIWF 4WBNB 5B1AC 1E1RG 2HR3A 4I5SA 4PDMA 5CN0A 4B3SB 3CMAV 2PI4A 3K3WA 1ZWIC 1VF6C 2GSMB 5B1NA 5GONA 4FLVA 1YJNV 4X20B 1CXZB 1J95A 3JYCA 5KX5A 4QJFB 2EIJB 2UUBB 5LGNA 1VQ7V 1K4DC 2UXNA 5J2TA 2GDSA 4DR3O 2QM7A 1AI6A 1ZAUA 1SZTA 4JAAA 1H2SB 4JTDB 3CJHB 4ZIBA 1K33A 2IBZH 3ZHVA 2P67A 1QLEB 1N0NA 3FB7C 5B1BB 4HAMA 5FNVA 3DTUB 2CGNA 3JAKB 2F43G 5E1AC 3RVYA 3B2EE 4FIPC 5BMVB 2F1MA 1OCOC 4B7KA 3D36A 2RQ6A 4X66O 1COWG 2ZE8A 3D8CA 4X66B 1M93A 4AHCA 3UCSC 3T4DA 1TUBB 2F66C 1HNXO 2YEVB 1DGSA 4PA9A 1XNQB 4DV7B 1SA0A 4N23A 1GM9A 4DV5O 5LHIA 1H8HG 4MVMA 2QSAA 1IURA 3ASOC 3ZCCA 2ZQMA 3JASA 1HNWB 4J7KA 2E5LB 3OM3B 2ZM6O 4NKGB 4X1IB 2CH7A 1Q43A 4LC1A 2N04A 2ZM6B 4D6TH 3FFQA 5AG2A 2IU3A 1OCRB 4RQEA 1FJGO 4X65B 1QQCA 4YJ2B 4JI4B 4HNAA 4FLZA 1XHXA 3K5NA 2LW1A 4Z2WA 3WU2Z 5LGTA 2DMXA 3HR0A 1NZ6A 1SZXA 5IYZB 3W7XA 1VQOV 4DYLA 4OX9B 4UVCA 2QTOA 4AQYO 1W2BU 3ABUA 1LR1A 3SJAC 1NVPD 1KECA 4AILC 1RM1C 3K9SA 4J11A 5HFLA 1SS3A 1JFFA 2UUCO 2G38A 3G71V 2YXHA 2PYJA 1PL0A 3CXHF 5KMGB 4O4IA 4CC5A 4LH6A 4G27B 1AILA 3X2QB 4DR5B 4OGQB 3BEHA 2FB5A 5IT9N 2Y4UA 4WFFA 2X0LA 2MW2B 4TOIA 1V55B 2WLHA 3BPZA 2EJRA 3OGIB 3ZHUA 5C8YB 1TVKA 1Y67A 3RVZA 2ZIOA 5KA5A 5JJEB 2OTJV 4L8JA 1S72V 1OJHA 3TK1A 2YICA 1VQ4V 5LHHA 3CRMA 2ZCEA 1FFXA 3U11A 3VBBA 3A0HZ 1IVSA 4MW8A 1G1XB 4UCOA 2XASA 2EIJC 5EYPB 2IJHA 4YXWG 2ILMA 3CCVV 4JI5B 3ETEA 3ZRXA 4X1KA 4R6ZA 2EZOA 2PI5A 3P32A 1F23A 4DW1A 1I7FA 3E22A 1AI5A 4A5UB 3VQVA 1FYJA 2Q5ZA 3ABMC 4YJ3B 1OHHG 4LF9O 1FD9A 3C3SA 4WFHA 2XAHA 3ETGA 5B1BC 5IYCO 2Y48A 3HKBB 3CYOA 3BFRA 2Z5UA 3F7YC 2Q7HA 3E83A 3JAWB 1VP7A 4QPJA 1BQ0A 4LF7O 1ZTEA 3ABTA 1FXHA 3T1YB 1M5IA 1K9MW 2DOSA 1DF5A 4JI0O 5LYJA 3UO3A 4O4HA 1GN2A 3AG1B 2LGWA 3CCQV 5ITZA 3L74H 3ZRWB 1M4UA 4ASUG 4JI1O 4JI2O 2QM4A 3S3XA 2X6AA 4JI2B 4RUEA 1FS0G 1Q6IA 4X64B 2BSKA 2ZIMA 2B1IA 5GW7A 4MTXA 5E79Z 4WF9V 4G2KA 4P9OA 1OCRC 2UXCB 3B09A 1JQ0A 4UCTA 1GKFA 1SQFA 1U97A 1R6KA 1M1KW 3MAQA 2Q7EA 3A0RA 5FLXN 1XQ8A 4UUJC 1XNRB 4D7TA 2JK5C 1D5NA 1S3JA 1AB3A 5LXTB 5CBGA 1GRJA 4I55A 3FB8C 2AZ2A 1ZL8A 4FLYA 4FZ0A 5CMUA 4WBNA 1K7DA 4DR6B 3RFRA 3W7SA 3CMEV 3K5MA 3OE7G 1XI1A 2QWPB 4ICGA 1S5LZ 5KHIA 1AI7A 2XOKG 4X20A 2VQFB 2P4VA 3N2KA 5IE9A 1GK9A 4CH4A 1NTKH 1H2GA 4JI8B 4JV5O 2KKWA 3X2QC 3O65A 4CBCA 2P22C 1A32A 1V55C 5B5EZ 2UU9B 3FYEB 3CJHA 3IC7A 4LCUC 4HNAB 3RYFA 1IBMO 1YF2A 1YTFB 1IBMB 4IHJB 2YI8A 2Z0AA 3G6EV 1O9GA 3H1KH 4I0XB 2ETNA 4QNHB 4IT5A 1W0KG 5JQGB 4QPKA 3JAKA 2FYUH 2BOBC 1NBMG 3EXAA 4I9WA 2GTSA 2QWQB 2HFEC 3B8NA 3GVMA 1Q7YW 2ZKOA 4DV4B 3KCXA 1XOUA 1OCZC 3CHXA 5IYBO 3AK1A 1TUBA 4PI2A 4GKKO 2EINB 2IU0A 4PA7A 4GKKB 2H8PC 3ZX6A 1B06A 3T1CA 2YEVA 1UJWB 4UFZA 2IW5A 3KCYA 2IJKA 3ZN1A 3BA9A 4D7SA 3CCSV 4FFBB 2ZDIC 4FM1A 1EM1A 4B3TB 2HEPA 1SETA 3G67A 1XMOO 5TISZ 3K06A 4JYYA 1XMOB 4X1IA 3LDEA 2JGUA 4RWUA 4YJ2A 2LGQA 2OCCB 3T2MA 4JI6O 1R1BA 1IBKO 4IIJB 2EJ7A 1Y6XA 3K79A 4R7CA 3AG1C 3SDLA 1AJNA 5IYZA 4J10A 4RQFA 1AROP 2A79B 4LF6O 3CC7V 3SYOA 1RSOB 4LF6B 3UO2A 2PTMA 3QO5A 4TWKA 4E2LA 1CPYA 4O4JA 3F5WC 4X88A 2PZSA 3JD1A 4LF4O 2RNBA 2HVKC 2PY5A 1BCCH 3HPLC 4LF4B 2ZNIA 4MW3A 3D3QA 5L3FA 2OYQA 4W4LA 3FAVB 1GAXA 2JJ1G 3RW0A 1GN3A 5KMGA 4GKJB 1YJWV 2AW9A 3HB3B 1ORQC 4PJ0Z 1YVWA 2XAQA 2A06H 4DV2B 1HR0O 4H13B 3M7MX 3M99B 3T4ZA 1HR0B 4QE7A 5JCOC 1QLNA 1J5EO 3OD4A 1US6A 1Q6HA 1NS1A 2PYLA 1J5EB 3KG2A 5C8YA
chains in the Genus database with same CATH topology
2UXBO 4X66O 2LW7A 4DR1O 1X59A 2AGAA 1KUQA 4GKKO 4GKJO 4DV0O 4JYAO 2UXDO 3F5TA 4DR5O 4DV2O 4KHPO 2JRIA 3JAMN 2VQEO 1HNXO 2HHHO 5FLXN 4DR4O 1G1XB 4X64O 4DV5O 1AB3A 2F4VO 4DUYO 5LL6Y 1N33O 1XMOO 4B3RO 4DV4O 1D2DA 1N36O 3J80N 4DV3O 2UXCO 2ZM6O 1FKAO 4LFBO 1F7YA 4JI7O 4DUZO 1FJGO 4K0KO 2N74A 4YY3O 1N34O 4OPHA 4B3MO 4JI6O 2ZKOA 4LF5O 1R1BA 5BR8O 5BXZA 4DV7O 1YZBA 1IBKO 1XNQO 1XNRO 4A5UB 4YHHO 1FYJA 2DJVA 4B3TO 3SDLA 4LF9O 1HNWO 2E5LO 3OTOO 4DV6O 5H5NA 4LF6O 3J81N 4JI5O 5BY1A 1R6TA 5LMNO 4JV5O 4NXMO 4LF8O 4DR3O 4AQYO 3O65A 4DR6O 4X65O 4JI4O 4B3SO 4LF7O 2FKXA 1A32A 3J7AU 5LMUO 3R66A 4LFCO 2VQFO 2DOSA 4X62O 4LF4O 1I94O 1XEQA 4JI0O 1IBMO 1DK1A 3T1HO 5IWAO 1HNZO 2Z0AA 2UUCO 4JI8O 4DR2O 4OX9O 2UUBO 1IBLO 4JI3O 4DR7O 4NXNO 4LFAO 3M8AA 4JI1O 1AILA 3T1YO 2UU9O 3RT3C 1HR0O 4JI2O 4OPAA 5IT9N 1XMQO 1J5EO 2UUAO 4DV1O 1NS1A 5A2QN 1N32O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  4X66 O;  2LW7 A;  4DR1 O;  1X59 A;  2AGA A;  1KUQ A;  4GKK O;  4GKJ O;  4DV0 O;  4JYA O;  2UXD O;  3F5T A;  4DR5 O;  4DV2 O;  4KHP O;  2JRI A;  3JAM N;  2VQE O;  1HNX O;  2HHH O;  5FLX N;  4DR4 O;  1G1X B;  4X64 O;  4DV5 O;  1AB3 A;  2F4V O;  4DUY O;  5LL6 Y;  1N33 O;  1XMO O;  4B3R O;  4DV4 O;  1D2D A;  1N36 O;  3J80 N;  4DV3 O;  2UXC O;  2ZM6 O;  1FKA O;  4LFB O;  1F7Y A;  4JI7 O;  4DUZ O;  1FJG O;  4K0K O;  2N74 A;  4YY3 O;  1N34 O;  4OPH A;  4B3M O;  4JI6 O;  2ZKO A;  4LF5 O;  1R1B A;  5BR8 O;  5BXZ A;  4DV7 O;  1YZB A;  1IBK O;  1XNQ O;  1XNR O;  4A5U B;  4YHH O;  1FYJ A;  2DJV A;  4B3T O;  3SDL A;  4LF9 O;  1HNW O;  2E5L O;  3OTO O;  4DV6 O;  5H5N A;  4LF6 O;  3J81 N;  4JI5 O;  5BY1 A;  1R6T A;  5LMN O;  4JV5 O;  4NXM O;  4LF8 O;  4DR3 O;  4AQY O;  3O65 A;  4DR6 O;  4X65 O;  4JI4 O;  4B3S O;  4LF7 O;  2FKX A;  1A32 A;  3J7A U;  5LMU O;  3R66 A;  4LFC O;  2VQF O;  2DOS A;  4X62 O;  4LF4 O;  1I94 O;  1XEQ A;  4JI0 O;  1IBM O;  1DK1 A;  3T1H O;  5IWA O;  1HNZ O;  2Z0A A;  2UUC O;  4JI8 O;  4DR2 O;  4OX9 O;  2UUB O;  1IBL O;  4JI3 O;  4DR7 O;  4NXN O;  4LFA O;  3M8A A;  4JI1 O;  1AIL A;  3T1Y O;  2UU9 O;  3RT3 C;  1HR0 O;  4JI2 O;  4OPA A;  5IT9 N;  1XMQ O;  1J5E O;  2UUA O;  4DV1 O;  1NS1 A;  5A2Q N;  1N32 O; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  2VS0 A;  1AJQ A;  1PL4 A;  4N21 A;  2AGA A;  2D2C B;  1YCI A;  2AHY A;  2FTK A;  1K92 A;  1OV9 A;  1H38 A;  1ZX3 A;  1N34 B;  5KUK A;  4BIZ A;  1P49 A;  1G8M A;  3CC2 V;  1R3L C;  4CS3 A;  2PUS A;  1XRE A;  3S3W A;  4DUY O;  4DK1 A;  5EYP A;  5EBW C;  1CP9 A;  3J80 N;  3OTO B;  4DV6 B;  2JEX A;  2ADQ B;  3SPG A;  3MHH C;  3AG4 B;  4ZBM A;  1TUE B;  1I0H A;  4H0L B;  1DLB A;  3FKS G;  2EIK C;  4DK0 A;  5BR8 O;  1Q3E A;  1SKV A;  2ZE6 A;  3NR7 A;  4PDV A;  2YSU B;  4YJ3 A;  4X62 B;  1M9N A;  5EBL C;  4PA3 A;  1QR8 A;  2ZDI A;  5H5N A;  4JPR A;  1VF7 A;  3CRC A;  3JAW A;  2NR5 A;  1IBL B;  4MVO A;  3E89 A;  4PD4 F;  4UB6 Z;  1R3K C;  4LFA B;  1GN4 A;  3QO7 A;  4Z1V A;  1MAB G;  4EEQ A;  1WN7 A;  4B3S O;  3HKD B;  3E8B A;  4UCV A;  1XMQ B;  3N2G B;  3B77 A;  1JJO A;  1Y4M A;  2XTA A;  3N2K B;  1TGO A;  2EIN C;  1H2M A;  3H1H H;  3JCZ A;  4IYI A;  2UUB O;  3ZRW A;  4I4T B;  2WLM A;  4O2B B;  1DF4 A;  4AI8 A;  3VQX A;  5B3S B;  1Q82 W;  3SGI A;  3OTF A;  2HG5 C;  4WFE A;  3ZRV A;  2K1E A;  3B40 A;  2RCV A;  3CE2 A;  1VQ9 V;  1MSD A;  3RYF B;  1JPX A;  2QKS A;  2OCC C;  3F7V C;  4JI7 B;  3LDD A;  4MTG A;  1FFT B;  4FVM A;  2P7T C;  4O4L A;  4PV1 B;  1B04 A;  5JJN B;  4LF5 B;  3TXS A;  3IGA C;  3SJB C;  1BMF G;  3ABL B;  4KUM A;  1YTF D;  1WNS A;  5LXT A;  1THZ A;  5JCO A;  4K35 A;  1X4T A;  3AK3 A;  3CRA A;  1JCH A;  3TCU A;  4LBE C;  1IXM A;  1L0L H;  2E3C A;  5KLV H;  1Q90 D;  1XNQ O;  3RYC B;  4DV7 O;  2EIL B;  4H44 B;  3ZED A;  1AR1 B;  1BS3 A;  4PEL A;  1D5A A;  1XL6 A;  3T1H B;  1HNW O;  1MA1 A;  1PKX A;  3JCU Z;  1HNZ B;  2E5L O;  3J81 N;  1QU7 A;  4JYC A;  2IH3 C;  3ETD A;  1OZ0 A;  4ABM A;  5LOV B;  1XUQ A;  4X65 O;  4JI4 O;  1TAE A;  1VQM V;  5J9P C;  1YHQ V;  3CCR V;  2XAJ A;  1I94 O;  1QVF U;  3OW2 U;  4IHJ A;  1I94 B;  3ABK B;  3LDC A;  4JYB A;  3O9O A;  4I0X A;  2ATK C;  1DTO A;  3ZMS A;  5JQG A;  4OX9 O;  2YI9 A;  1WB8 A;  4K8X A;  4QGP A;  1H8E G;  4LR3 A;  1BHB A;  4KFM A;  3ZIA G;  5IJ0 B;  2Y0P A;  3LSS A;  3N27 A;  3ZRS A;  5GTH Z;  1K34 A;  2ITC C;  1BZK A;  2P6J A;  4O4J B;  4HBN A;  1WPB A;  4DW0 A;  2QE7 G;  2VWK A;  3AG4 C;  5H2F Z;  1L8D A;  5KHH A;  4HZ3 A;  3CRR A;  1RPO A;  2QR4 A;  4PA6 A;  2W6J G;  1Q8I A;  4GCZ A;  4F6E A;  3BCC H;  5BZB A;  4DR5 O;  1AR4 A;  3H01 A;  2VQE O;  3BAA A;  2YID A;  4YIO A;  2QTS A;  2VQE B;  2P5O A;  1UPG A;  5K1X A;  5JVD B;  4DRX B;  4FFB A;  3PJS K;  3K0D A;  5F2V O;  3CCJ V;  1ZUQ A;  3QTC A;  1PP9 H;  3WG7 B;  4LF8 B;  3QNE A;  4BWA A;  4H33 A;  3CSX A;  2ITD C;  3QF7 A;  2Q8V A;  4IIJ A;  3ZN0 A;  2HJF C;  2HLD G;  4JTA B;  3AG7 A;  4P30 A;  3ZMT A;  4ZHQ B;  1QR9 A;  3OMI B;  1RSO A;  2ZXW B;  1PNM A;  4JI5 O;  3OT7 A;  2BCC H;  2DQ3 A;  4BR6 A;  3AG2 B;  1R3J C;  1V9P A;  2JVD A;  3APQ A;  4JAS A;  2GUZ B;  2FKX A;  1EFR G;  3C90 A;  1URF A;  1K73 W;  1Y66 A;  1Z2G A;  1EBO A;  1SQG A;  5EC1 C;  1XEQ A;  1QLE C;  3BA8 A;  2M7W A;  3K5O A;  3FAV A;  4NTW A;  3U10 A;  4J9Y B;  1BL8 A;  3ABL C;  3T1Y O;  4IGG A;  3CX5 F;  5L3G A;  3BAB A;  3EFF K;  2WWW A;  1KQS U;  4TT3 G;  5KHJ A;  4DV1 O;  4DV1 B;  3IJ4 A;  4MS2 A;  5JJJ B;  5LP6 B;  3ZMV A;  4JZG A;  5JH7 B;  2Q73 A;  4YIP A;  1MMM A;  2EBO A;  5KHG A;  2EIM B;  4ZI7 B;  2IH1 C;  1XDC A;  2EIL C;  4XDK A;  3U0Z A;  2IJI A;  3DGE A;  4J41 A;  1SES A;  3E8G A;  2YXL A;  3E8H A;  4X64 O;  1Q6U A;  1XIL A;  4FM0 A;  4B3R O;  1S5H C;  4B3R B;  3K04 A;  2UXC O;  2IM9 A;  4NXM B;  3ZS8 C;  1SQQ H;  3WFV A;  2WLN A;  4O4L B;  2OTL V;  1GMG A;  1BT8 A;  5CA1 B;  5BXZ A;  3FX7 A;  1XNR O;  1EN5 A;  3ABK C;  4LFC B;  1GH6 A;  2Q9L A;  1B6Q A;  1T5E A;  2QGN A;  2B5U A;  1L0N H;  1K5S A;  3MD0 A;  5IJ9 B;  3W7U A;  5FPO A;  4BIU A;  4NXN B;  4DR6 O;  2CK3 G;  2JJ2 G;  2LFS A;  3HKD A;  2RN9 A;  5IYD O;  1YXB A;  3N2G A;  2VQF O;  1WP7 A;  1EZJ A;  2HP8 A;  3QO8 A;  3BY6 A;  5IWA O;  4P2Z A;  1NU1 H;  2WPD G;  5LA6 A;  5IWA B;  1AJP A;  4JI8 O;  3I56 V;  2YIA A;  4I4T A;  3OGC C;  5L3C A;  4O2B A;  4WCE V;  5FPR A;  1SQX H;  2AXT Z;  3MDS A;  1NI8 A;  2UU9 O;  1JR9 A;  2EZP A;  4OPA A;  3WG7 C;  2Q7G A;  1N32 O;  2Y4T A;  2QKC A;  1ROP A;  2R70 A;  1N32 B;  3H1J H;  2XHB A;  2CDY A;  3VQY A;  2OIE A;  1W59 A;  2L35 A;  1R6N A;  2CUG A;  2FL4 A;  3ZHT A;  1S5J A;  3L72 H;  2JRI A;  2HHH O;  1HDJ A;  1H2L A;  2HHH B;  1L1F A;  2A0L A;  2Q69 A;  5FL7 G;  4YHH B;  1OCC B;  2ZXW C;  4X1Y B;  2ZNJ A;  4DV4 O;  3JD2 A;  3CRQ A;  3AG2 C;  1F7Y A;  1SQV H;  1SF9 A;  4UVA A;  4DUZ O;  1YEW A;  3K08 A;  4DUZ B;  4R8C A;  1V54 B;  2DW4 A;  4GZR B;  4OPH A;  1M56 B;  1ZSP A;  5EIB C;  2L6L A;  3RYC A;  1Q5O A;  3HKC B;  1R3I C;  1YZB A;  3TJT A;  3B4S A;  4FFK A;  4B3T O;  4TUY A;  4GUN A;  4RAI A;  4BW9 A;  3HKE B;  1JVM A;  1NT2 B;  2HVJ C;  5BY1 A;  1K4C C;  1NJI W;  4TSF G;  5B66 Z;  5LOV A;  5H9C A;  2W0X A;  5C93 A;  2QDO A;  5LBQ A;  2QWO B;  2YS8 A;  4MTF A;  4B7E A;  2Z3Y A;  3RYI A;  5LP6 C;  3CCE V;  3CS5 A;  1KU9 A;  4FLX A;  1JJ2 U;  1YIT V;  2WLI B;  2EIM C;  3E35 A;  3LUT B;  2NLJ C;  5J2U B;  4X89 A;  3DSQ A;  1SRY A;  3P3N A;  5IJ0 A;  1XHZ A;  1ZLZ A;  2RMK B;  4U3F H;  1KB9 F;  1GO3 F;  3GB7 C;  4DR4 B;  3ZJZ A;  2DE0 X;  4EFB A;  3E2E A;  1GM8 A;  3W7W A;  3DXR B;  2R9I A;  4LWS A;  4MSW C;  3CWB H;  3W7T A;  1TA8 A;  5DED A;  3JSN A;  1KUQ A;  4GKJ O;  1K5Q A;  1AR5 A;  4TV8 A;  4MTO A;  3CCU V;  2ZE7 A;  4JYA O;  3OMN B;  4YY3 B;  1XL4 A;  4JYA B;  4DV2 O;  5EIB D;  3AEI A;  4JF3 A;  2YIB D;  5EZY B;  4DRX A;  5JVD A;  3AG3 B;  2PGG A;  4F6R B;  1E1Q G;  2B1G A;  1KP2 A;  2DYS B;  2XT9 A;  2Q67 A;  3SPI A;  2LO1 A;  5LMN B;  3VQW A;  1JX9 A;  4Q20 A;  1HP8 A;  3TXQ A;  5LHG A;  1N34 O;  4ZKI A;  1VIB A;  3H1I H;  3OR6 C;  2JGD B;  3CEI A;  3JAR B;  4GX1 A;  2DWE C;  4ZHQ A;  1NQT A;  1KKC A;  4JGS A;  4LP8 A;  2LQT A;  4F4L A;  5CBH A;  4NYK A;  3OTO O;  4DV6 O;  5EC2 C;  2JS5 A;  4O2A B;  3ZHQ A;  4J42 A;  1K97 A;  3L70 H;  2H94 A;  1JA8 A;  2GUZ A;  2WLJ A;  1FPO A;  1VMG A;  3VOU A;  3OMA B;  3SPJ A;  3SYP A;  2A3Q A;  1W0J G;  2YIB A;  4NTY A;  2CTP A;  4X62 O;  2VWJ A;  5L3B A;  3R65 A;  1IDS A;  3JAT B;  3K0G A;  2UUA B;  1GN6 A;  1MNG A;  3I5D A;  4X9Q A;  5CA0 B;  2IJJ A;  1MG1 A;  1IBL O;  4DR1 B;  4DR7 O;  1B3Q A;  4OXS A;  2CAZ C;  4NB5 A;  4DR7 B;  4LFA O;  3IAY A;  2UXD B;  1KKD A;  4X8A A;  3MHS C;  1QVG U;  1OCC C;  3L9D A;  1NR7 A;  1XMQ O;  3RYH B;  4FMT A;  3PN1 A;  3CCM V;  3LSU A;  5KUM A;  4GYC B;  1M90 W;  1SQB H;  5CB4 B;  5LP6 A;  1FAF A;  2WA4 A;  1H2K A;  5JH7 A;  1PNL A;  1V54 C;  5LA6 B;  1M56 C;  1MZF A;  3EVK A;  2RJZ A;  4I50 B;  4ZI7 A;  1G6U A;  2A7W A;  3F5T A;  1JMK C;  2X7R B;  1LUW A;  1NH2 B;  2LFR A;  4I7Z B;  3KKY A;  3H1L H;  1AP6 A;  2Q68 A;  3KZI Z;  4FLU A;  3L71 H;  1EZV H;  4U3J B;  1Y74 B;  1Z5V A;  2CE4 A;  4JI7 O;  1AVM A;  4DR3 B;  2WLL B;  4B3M O;  2XND G;  5CA1 A;  4B3M B;  4LF5 O;  4NR1 A;  3K59 A;  2OWO A;  4JAU A;  3A2F A;  1Q81 W;  4FK5 C;  1HW7 A;  4GLX A;  4DXW A;  1NTM H;  3ABM B;  5D5Q A;  2F95 B;  1S77 D;  1Y76 A;  5IJ9 A;  2AZ0 A;  3UT5 A;  5IY5 B;  3SYQ A;  2GBO A;  1YIJ V;  2B9Z A;  2PF4 E;  1YDX A;  3JD3 A;  1FXV A;  5DEC A;  1PD3 A;  2EUL A;  1DK1 A;  3T1H O;  1HNZ O;  4B08 A;  1BSM A;  2KG7 B;  2HJD A;  3ML0 A;  1Q86 W;  1RFY A;  2EX3 A;  4TUY B;  5A9G A;  4KL1 A;  2JDI G;  5DN6 G;  1I5Y A;  3RBZ A;  3AG3 C;  2E76 B;  2DYS C;  1HNX B;  1MOF A;  1PNK A;  4CH6 A;  1MZE A;  1F4N A;  4RUF A;  1N8R W;  4DV5 B;  2CGO A;  1AI4 A;  2CTW A;  2UXB O;  3RYI B;  4LNU A;  2JEU A;  2UXB B;  1F4M A;  1LUV A;  4UCU A;  3RWR D;  3FB6 C;  4QE9 A;  4ZOL A;  4E4E A;  4DV0 O;  1FJG B;  2ZR3 A;  3TET A;  4DV0 B;  3A8T A;  4MVR A;  2MK3 A;  4XBF A;  4FPP A;  1PV0 A;  2WA3 A;  4PHZ A;  3ZHS A;  1VQN V;  5B1O A;  1NKD A;  3FD9 A;  4X1Y A;  4I9Q A;  3LNM B;  1I08 A;  1QBZ A;  3APO A;  2KB1 A;  3JAL B;  2BE3 A;  2GHY A;  3EHB B;  2XUM A;  4LWS B;  5KHK A;  2NN4 A;  4EB6 B;  4Z1M G;  3CPW U;  4AQY B;  4GX2 A;  4CS4 A;  4K0K O;  3HKC A;  4TV8 B;  1FXK B;  4K0K B;  5DM6 V;  2BTQ B;  1VF6 A;  4TV9 A;  1VQ6 V;  3ICX A;  1XBL A;  3HKE A;  2E75 B;  4KXR A;  1I5X A;  2UUC B;  3DC6 A;  4PDL A;  3CXC U;  4LF8 O;  2NNU A;  1PPJ H;  4FM2 A;  3THO A;  3OFN G;  1KC8 W;  2ZE5 A;  4K8Z A;  1GM7 A;  1Z5W A;  4UV9 A;  3STL C;  1WA8 B;  2C2A A;  5D5P A;  1K3E A;  1BE3 H;  1VF5 B;  2R9R B;  2P06 A;  4NVP A;  2QM8 A;  3K03 A;  3WB1 A;  2P90 A;  2WLI A;  3WB0 A;  5IDJ A;  5J2U A;  3CP1 A;  5B3S C;  4J9Z B;  3M8A A;  4MVQ A;  3UM7 A;  4UCS A;  3ZBH A;  3TGU H;  1P4R A;  2VRZ A;  4WFA V;  2RDC A;  2F23 A;  4UXN A;  1VQP V;  2YC0 A;  3DXR A;  3JD4 A;  4U7O A;  3K57 A;  4MVU A;  4CC6 A;  1OCZ B;  4JZ2 A;  1KBH A;  3Q4H B;  1QCE A;  3FB5 C;  4KHP O;  5EZY A;  3JAM N;  1WPX A;  4R50 A;  4KHP B;  1KMI Z;  4F6R A;  4GT1 A;  3IC9 A;  2KQX A;  5JWP A;  2ADP A;  2A9H A;  1P7B A;  2DQ0 A;  2LJ2 A;  5IY5 C;  2HKO A;  4LF9 B;  3RGB A;  3SYC A;  1VEW A;  1WLE A;  4MVZ A;  4BAY A;  4J7Z A;  4UB8 Z;  2KSD A;  1K8A W;  2JGD A;  4LF7 B;  2K9P A;  3QG5 A;  4P9P A;  3JAR A;  1QHT A;  3K58 A;  5GON B;  2QEX V;  1O9H A;  4JI0 B;  1AP5 A;  3G80 A;  1QNM A;  4O2A A;  4RO2 A;  4GX0 A;  2DN9 A;  3IFX A;  5KX5 B;  1R6T A;  4NXM O;  4J80 A;  1M57 B;  1IXB A;  5J2T B;  1U96 A;  3A0B Z;  1RP3 B;  4FJC C;  3CC4 V;  2ZIN A;  1NH2 D;  3J7A U;  4JI1 B;  3FYI B;  4PDR A;  1YI2 V;  4LFC O;  3JAT A;  3CB2 A;  2JS3 A;  3UKM A;  2V4D A;  5CA0 A;  2DYR B;  1Y76 B;  4NXN O;  1HWY A;  1RPR A;  3UT5 B;  2BOC C;  5FNV B;  5KAF Z;  4HYO A;  4Q6G A;  1F51 A;  2M6Y A;  3RN4 A;  3SR2 C;  2OIG A;  1H2N A;  3RT3 C;  1YJ9 V;  4FZ1 A;  1N4C A;  3RYH A;  3JSL A;  3GWO A;  3SPC A;  2WSS G;  5CB4 A;  3ZHR A;  3I55 V;  1VQK V;  4CH3 A;  1LNQ A;  4GX5 A;  1SER A;  4JAV A;  4FLW A;  2JIZ G;  3GWK C;  2CTQ A;  3K5L A;  1FXK C;  4PA4 A;  3OEH G;  4G28 B;  4I50 A;  3OR7 C;  2YXY A;  5GTI Z;  2ODM A;  2V1D A;  4KP4 A;  4CH5 A;  1EN6 A;  3UQ8 A;  3P3P A;  3ZMU A;  4BIO A;  4MVS A;  1SA0 B;  3B8M A;  1BGY H;  3C3T A;  4U3J A;  1Y74 A;  3ASN B;  1R73 A;  2OT5 A;  4C7U A;  3JAS B;  4LFB O;  1JOY A;  4LNU B;  4TQD A;  3E86 A;  4LFB B;  2CH7 B;  1VQ5 V;  2BTO A;  2WLL A;  4JV5 B;  4W4K A;  2N74 A;  4ZOL B;  1IX9 A;  2H3O A;  2P4K A;  2Y69 B;  1KYO F;  2WLK A;  3P30 A;  1E79 G;  2AHZ A;  4YHH O;  2EIK B;  1VAR A;  4TQF A;  2WAM A;  2V7Q G;  5L3E A;  4BW5 A;  3LNN A;  5CA3 A;  1KP3 A;  5H6Q A;  2QWR B;  2ARH A;  5H6R A;  2GTA A;  4XDL A;  5B1A B;  2Q4P A;  3DC5 A;  3SYA A;  5BMV A;  2W6I G;  5LMU O;  2Q6A A;  3R66 A;  4K3A A;  5EBM C;  5LMU B;  1VQ8 V;  2DWD C;  2KG7 A;  4TV9 B;  1JFF B;  1BHA A;  4DR2 O;  2E74 B;  4JI3 O;  4DR2 B;  4JI3 B;  4O4I B;  2W0F C;  1S76 D;  4JTC B;  1S0V A;  4UV8 A;  4IYH A;  1NR1 A;  3NXS A;  5KA6 A;  5A2Q N;  3SPH A;  5HFM A;  4XDJ A;  3STZ C;  2YDE A;  2OCH A;  4WFB V;  2LW7 A;  1X59 A;  1TVK B;  1SC5 B;  2F93 B;  1ENV A;  1IZ3 A;  4JI6 B;  5L3D A;  1FFX B;  1IBK B;  3CD6 V;  4DR4 O;  3BHP A;  4LH7 A;  1NVP B;  1N0J A;  3SJC C;  5LL6 Y;  3JAL A;  4H37 A;  3WB2 A;  1N33 O;  1N33 B;  1GTO A;  1N36 O;  1M57 C;  1OCO B;  4DO2 A;  1FKA O;  1BQZ A;  4EB6 A;  1N36 B;  3L75 H;  4UCR A;  2O57 A;  3ETQ A;  2QWN B;  1FXK A;  4YY3 O;  4U7N A;  4X1K B;  2BTQ A;  2XAG A;  3SJQ C;  2QKA A;  3E22 B;  2UXX A;  4L87 A;  1UFI A;  3H9V A;  5CBF A;  3LSQ A;  3L73 H;  1VQL V;  3D3I A;  1MSW D;  2DJV A;  4PI0 A;  2DYR C;  2CTR A;  1SQP H;  3OEE G;  4FLT A;  1WB7 A;  3ASO B;  1PM9 A;  5LMN O;  2Y0I A;  3E8F A;  1P84 F;  2ZR2 A;  4EFE A;  2XAF A;  1YSC A;  3JD0 A;  5EK0 A;  3G6B A;  1WA8 A;  3BRC A;  1P7G A;  3ZMZ A;  4IL6 Z;  1G4Y B;  3D36 C;  1CEZ A;  4NTX A;  3OAA G;  2YUA A;  3CCL V;  4CS2 A;  5LYJ B;  4O4H B;  4UVB A;  3BVO A;  3QVN A;  4WFG A;  5ITZ B;  2Q0A A;  1WAZ A;  3AK2 A;  3ASN C;  5K1P A;  4J7J A;  2X6C A;  4CZZ A;  5KAI Z;  2UUA O;  4MT8 A;  4DUY B;  2BSK B;  4EKW A;  3K9A A;  1RM1 B;  4DR1 O;  1NTZ H;  2Y69 C;  2D3O W;  3Q4H A;  1KD1 W;  2UXD O;  2FML A;  1WP8 A;  1EN4 A;  2R9A A;  2Q0O C;  2R72 A;  5BR8 B;  2ZD9 A;  2QA4 V;  3G4S V;  5LGU A;  2F4V O;  2LP7 A;  2F4V B;  1D2D A;  1WJZ A;  3HKB A;  2QJ1 A;  4DV3 O;  2N05 A;  2GV9 A;  3OUF A;  4I55 B;  1ZL8 B;  4DV3 B;  2X6B A;  3OUS A;  4QIW F;  4WBN B;  5B1A C;  1E1R G;  2HR3 A;  4I5S A;  4PDM A;  5CN0 A;  4B3S B;  3CMA V;  2PI4 A;  3K3W A;  1ZWI C;  1VF6 C;  2GSM B;  5B1N A;  5GON A;  4FLV A;  1YJN V;  4X20 B;  1CXZ B;  1J95 A;  3JYC A;  5KX5 A;  4QJF B;  2EIJ B;  2UUB B;  5LGN A;  1VQ7 V;  1K4D C;  2UXN A;  5J2T A;  2GDS A;  4DR3 O;  2QM7 A;  1AI6 A;  1ZAU A;  1SZT A;  4JAA A;  1H2S B;  4JTD B;  3CJH B;  4ZIB A;  1K33 A;  2IBZ H;  3ZHV A;  2P67 A;  1QLE B;  1N0N A;  3FB7 C;  5B1B B;  4HAM A;  5FNV A;  3DTU B;  2CGN A;  3JAK B;  2F43 G;  5E1A C;  3RVY A;  3B2E E;  4FIP C;  5BMV B;  2F1M A;  1OCO C;  4B7K A;  3D36 A;  2RQ6 A;  4X66 O;  1COW G;  2ZE8 A;  3D8C A;  4X66 B;  1M93 A;  4AHC A;  3UCS C;  3T4D A;  1TUB B;  2F66 C;  1HNX O;  2YEV B;  1DGS A;  4PA9 A;  1XNQ B;  4DV7 B;  1SA0 A;  4N23 A;  1GM9 A;  4DV5 O;  5LHI A;  1H8H G;  4MVM A;  2QSA A;  1IUR A;  3ASO C;  3ZCC A;  2ZQM A;  3JAS A;  1HNW B;  4J7K A;  2E5L B;  3OM3 B;  2ZM6 O;  4NKG B;  4X1I B;  2CH7 A;  1Q43 A;  4LC1 A;  2N04 A;  2ZM6 B;  4D6T H;  3FFQ A;  5AG2 A;  2IU3 A;  1OCR B;  4RQE A;  1FJG O;  4X65 B;  1QQC A;  4YJ2 B;  4JI4 B;  4HNA A;  4FLZ A;  1XHX A;  3K5N A;  2LW1 A;  4Z2W A;  3WU2 Z;  5LGT A;  2DMX A;  3HR0 A;  1NZ6 A;  1SZX A;  5IYZ B;  3W7X A;  1VQO V;  4DYL A;  4OX9 B;  4UVC A;  2QTO A;  4AQY O;  1W2B U;  3ABU A;  1LR1 A;  3SJA C;  1NVP D;  1KEC A;  4AIL C;  1RM1 C;  3K9S A;  4J11 A;  5HFL A;  1SS3 A;  1JFF A;  2UUC O;  2G38 A;  3G71 V;  2YXH A;  2PYJ A;  1PL0 A;  3CXH F;  5KMG B;  4O4I A;  4CC5 A;  4LH6 A;  4G27 B;  1AIL A;  3X2Q B;  4DR5 B;  4OGQ B;  3BEH A;  2FB5 A;  5IT9 N;  2Y4U A;  4WFF A;  2X0L A;  2MW2 B;  4TOI A;  1V55 B;  2WLH A;  3BPZ A;  2EJR A;  3OGI B;  3ZHU A;  5C8Y B;  1TVK A;  1Y67 A;  3RVZ A;  2ZIO A;  5KA5 A;  5JJE B;  2OTJ V;  4L8J A;  1S72 V;  1OJH A;  3TK1 A;  2YIC A;  1VQ4 V;  5LHH A;  3CRM A;  2ZCE A;  1FFX A;  3U11 A;  3VBB A;  3A0H Z;  1IVS A;  4MW8 A;  1G1X B;  4UCO A;  2XAS A;  2EIJ C;  5EYP B;  2IJH A;  4YXW G;  2ILM A;  3CCV V;  4JI5 B;  3ETE A;  3ZRX A;  4X1K A;  4R6Z A;  2EZO A;  2PI5 A;  3P32 A;  1F23 A;  4DW1 A;  1I7F A;  3E22 A;  1AI5 A;  4A5U B;  3VQV A;  1FYJ A;  2Q5Z A;  3ABM C;  4YJ3 B;  1OHH G;  4LF9 O;  1FD9 A;  3C3S A;  4WFH A;  2XAH A;  3ETG A;  5B1B C;  5IYC O;  2Y48 A;  3HKB B;  3CYO A;  3BFR A;  2Z5U A;  3F7Y C;  2Q7H A;  3E83 A;  3JAW B;  1VP7 A;  4QPJ A;  1BQ0 A;  4LF7 O;  1ZTE A;  3ABT A;  1FXH A;  3T1Y B;  1M5I A;  1K9M W;  2DOS A;  1DF5 A;  4JI0 O;  5LYJ A;  3UO3 A;  4O4H A;  1GN2 A;  3AG1 B;  2LGW A;  3CCQ V;  5ITZ A;  3L74 H;  3ZRW B;  1M4U A;  4ASU G;  4JI1 O;  4JI2 O;  2QM4 A;  3S3X A;  2X6A A;  4JI2 B;  4RUE A;  1FS0 G;  1Q6I A;  4X64 B;  2BSK A;  2ZIM A;  2B1I A;  5GW7 A;  4MTX A;  5E79 Z;  4WF9 V;  4G2K A;  4P9O A;  1OCR C;  2UXC B;  3B09 A;  1JQ0 A;  4UCT A;  1GKF A;  1SQF A;  1U97 A;  1R6K A;  1M1K W;  3MAQ A;  2Q7E A;  3A0R A;  5FLX N;  1XQ8 A;  4UUJ C;  1XNR B;  4D7T A;  2JK5 C;  1D5N A;  1S3J A;  1AB3 A;  5LXT B;  5CBG A;  1GRJ A;  4I55 A;  3FB8 C;  2AZ2 A;  1ZL8 A;  4FLY A;  4FZ0 A;  5CMU A;  4WBN A;  1K7D A;  4DR6 B;  3RFR A;  3W7S A;  3CME V;  3K5M A;  3OE7 G;  1XI1 A;  2QWP B;  4ICG A;  1S5L Z;  5KHI A;  1AI7 A;  2XOK G;  4X20 A;  2VQF B;  2P4V A;  3N2K A;  5IE9 A;  1GK9 A;  4CH4 A;  1NTK H;  1H2G A;  4JI8 B;  4JV5 O;  2KKW A;  3X2Q C;  3O65 A;  4CBC A;  2P22 C;  1A32 A;  1V55 C;  5B5E Z;  2UU9 B;  3FYE B;  3CJH A;  3IC7 A;  4LCU C;  4HNA B;  3RYF A;  1IBM O;  1YF2 A;  1YTF B;  1IBM B;  4IHJ B;  2YI8 A;  2Z0A A;  3G6E V;  1O9G A;  3H1K H;  4I0X B;  2ETN A;  4QNH B;  4IT5 A;  1W0K G;  5JQG B;  4QPK A;  3JAK A;  2FYU H;  2BOB C;  1NBM G;  3EXA A;  4I9W A;  2GTS A;  2QWQ B;  2HFE C;  3B8N A;  3GVM A;  1Q7Y W;  2ZKO A;  4DV4 B;  3KCX A;  1XOU A;  1OCZ C;  3CHX A;  5IYB O;  3AK1 A;  1TUB A;  4PI2 A;  4GKK O;  2EIN B;  2IU0 A;  4PA7 A;  4GKK B;  2H8P C;  3ZX6 A;  1B06 A;  3T1C A;  2YEV A;  1UJW B;  4UFZ A;  2IW5 A;  3KCY A;  2IJK A;  3ZN1 A;  3BA9 A;  4D7S A;  3CCS V;  4FFB B;  2ZDI C;  4FM1 A;  1EM1 A;  4B3T B;  2HEP A;  1SET A;  3G67 A;  1XMO O;  5TIS Z;  3K06 A;  4JYY A;  1XMO B;  4X1I A;  3LDE A;  2JGU A;  4RWU A;  4YJ2 A;  2LGQ A;  2OCC B;  3T2M A;  4JI6 O;  1R1B A;  1IBK O;  4IIJ B;  2EJ7 A;  1Y6X A;  3K79 A;  4R7C A;  3AG1 C;  3SDL A;  1AJN A;  5IYZ A;  4J10 A;  4RQF A;  1ARO P;  2A79 B;  4LF6 O;  3CC7 V;  3SYO A;  1RSO B;  4LF6 B;  3UO2 A;  2PTM A;  3QO5 A;  4TWK A;  4E2L A;  1CPY A;  4O4J A;  3F5W C;  4X88 A;  2PZS A;  3JD1 A;  4LF4 O;  2RNB A;  2HVK C;  2PY5 A;  1BCC H;  3HPL C;  4LF4 B;  2ZNI A;  4MW3 A;  3D3Q A;  5L3F A;  2OYQ A;  4W4L A;  3FAV B;  1GAX A;  2JJ1 G;  3RW0 A;  1GN3 A;  5KMG A;  4GKJ B;  1YJW V;  2AW9 A;  3HB3 B;  1ORQ C;  4PJ0 Z;  1YVW A;  2XAQ A;  2A06 H;  4DV2 B;  1HR0 O;  4H13 B;  3M7M X;  3M99 B;  3T4Z A;  1HR0 B;  4QE7 A;  5JCO C;  1QLN A;  1J5E O;  3OD4 A;  1US6 A;  1Q6H A;  1NS1 A;  2PYL A;  1J5E B;  3KG2 A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 2UXB O;  4X66 O;  2LW7 A;  4DR1 O;  1X59 A;  2AGA A;  1KUQ A;  4GKK O;  4GKJ O;  4DV0 O;  4JYA O;  2UXD O;  3F5T A;  4DR5 O;  4DV2 O;  4KHP O;  2JRI A;  3JAM N;  2VQE O;  1HNX O;  2HHH O;  5FLX N;  4DR4 O;  1G1X B;  4X64 O;  4DV5 O;  1AB3 A;  2F4V O;  4DUY O;  5LL6 Y;  1N33 O;  1XMO O;  4B3R O;  4DV4 O;  1D2D A;  1N36 O;  3J80 N;  4DV3 O;  2UXC O;  2ZM6 O;  1FKA O;  4LFB O;  1F7Y A;  4JI7 O;  4DUZ O;  1FJG O;  4K0K O;  2N74 A;  4YY3 O;  1N34 O;  4OPH A;  4B3M O;  4JI6 O;  2ZKO A;  4LF5 O;  1R1B A;  5BR8 O;  5BXZ A;  4DV7 O;  1YZB A;  1IBK O;  1XNQ O;  1XNR O;  4A5U B;  4YHH O;  1FYJ A;  2DJV A;  4B3T O;  3SDL A;  4LF9 O;  1HNW O;  2E5L O;  3OTO O;  4DV6 O;  5H5N A;  4LF6 O;  3J81 N;  4JI5 O;  5BY1 A;  1R6T A;  5LMN O;  4JV5 O;  4NXM O;  4LF8 O;  4DR3 O;  4AQY O;  3O65 A;  4DR6 O;  4X65 O;  4JI4 O;  4B3S O;  4LF7 O;  2FKX A;  1A32 A;  3J7A U;  5LMU O;  3R66 A;  4LFC O;  2VQF O;  2DOS A;  4X62 O;  4LF4 O;  1I94 O;  1XEQ A;  4JI0 O;  1IBM O;  1DK1 A;  3T1H O;  5IWA O;  1HNZ O;  2Z0A A;  2UUC O;  4JI8 O;  4DR2 O;  4OX9 O;  2UUB O;  1IBL O;  4JI3 O;  4DR7 O;  4NXN O;  4LFA O;  3M8A A;  4JI1 O;  1AIL A;  3T1Y O;  2UU9 O;  3RT3 C;  1HR0 O;  4JI2 O;  4OPA A;  5IT9 N;  1XMQ O;  1J5E O;  2UUA O;  4DV1 O;  1NS1 A;  5A2Q N;  1N32 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...