4AQYO

Structure of ribosome-apramycin complexes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4aqyO00
3RT3C 3SDLA 4OX9O 4YY3O 2ZM6O 1F7YA 4LF4O 1G1XB 4JI1O 5IWAO 4X64O 1N36O 1R6TA 4KHPO 3R66A 2E5LO 4JV5O 4LF5O 2UUBO 3J80N 1YZBA 4OPHA 1HNZO 4NXNO 1N33O 3O65A 2JRIA 4X65O 1DK1A 3OTOO 2UUCO 4LF8O 4JI5O 4DV1O 2UXBO 4DR3O 4B3MO 4GKJO 1XNRO 4DR6O 1XMQO 4JI4O 4JI7O 1XEQA 4JYAO 4DV6O 5LMUO 4AQYO 4DR7O 1I94O 1AILA 5BR8O 4K0KO 2VQFO 3F5TA 2AGAA 1N32O 4DV7O 4JI3O 4LFAO 4DR4O 2FKXA 1HR0O 4LFCO 3J81N 1KUQA 3T1YO 4JI8O 3JAMN 4JI0O 1IBKO 4DUYO 1A32A 4DUZO 1HNXO 2UXCO 4LF9O 4DV0O 1FKAO 4JI6O 4DV4O 1FJGO 2F4VO 4X62O 5BY1A 4DR1O 3J7AU 4B3SO 1J5EO 4OPAA 1HNWO 1IBLO 5A2QN 2LW7A 2N74A 5LMNO 1AB3A 1XMOO 2Z0AA 2UXDO 4LF7O 4A5UB 4GKKO 4DR2O 1FYJA 2DOSA 4DV2O 2DJVA 4DR5O 4B3RO 2ZKOA 1XNQO 1IBMO 2HHHO 5BXZA 5LL6Y 4JI2O 5IT9N 1X59A 2UUAO 2VQEO 1R1BA 4B3TO 4LFBO 4NXMO 4YHHO 4X66O 1N34O 4DV5O 5H5NA 5FLXN 1NS1A 2UU9O 1D2DA 3T1HO 3M8AA 4LF6O 4DV3O
chains in the Genus database with same CATH superfamily
1OCOC 1JX9A 3ZHUA 2DW4A 2RMKB 4LF5B 2ATKC 2KQXA 1R6KA 3D36C 4ZKIA 5JJEB 1E1QG 3K3WA 3ZBHA 3CP1A 5IJ9B 1R6NA 3JARA 1VARA 4MVOA 4QGPA 4PA7A 1FFXB 4QE9A 4FVMA 2PZSA 3ASNB 1NQTA 3KKYA 1AI5A 1K7DA 5B66Z 1DGSA 1OCZC 3B8NA 4RQEA 3CJHA 2OIEA 2AHZA 2P06A 1BMFG 3HPLC 3AEIA 2IH3C 2PYJA 2ZDIC 2AGAA 1Q81W 4NYKA 2YEVA 5CN0A 2QWOB 4R50A 2YUAA 3J81N 1KUQA 1N0NA 1IXBA 1NVPB 4BW9A 1TA8A 2F95B 2UXCO 2X0LA 4GLXA 3VQWA 2EILC 1Z5VA 5BR8B 1BL8A 3DGEA 1R3KC 3TXSA 5LMNB 1JQ0A 1XMOB 1VQ6V 3K9AA 4ZBMA 4RQFA 4TT3G 2Q9LA 1QVFU 2W6IG 2EINB 2UXDO 2ZKOA 1MG1A 5IJ9A 1IBMO 4R8CA 3K08A 2JK5C 1FFXA 4JYYA 4LFBO 2AXTZ 3U11A 5K1PA 1K33A 4O4IB 3A0BZ 4YJ2B 4LF6O 5IWAB 1HDJA 5EYPB 2WLHA 3RT3C 3WU2Z 3JD0A 1B6QA 2HKOA 4JI1O 1M4UA 4O2AB 2UUBB 2UUAB 2Q73A 1W2BU 2OCCB 4RO2A 1N34B 4UCVA 4LF5O 1H2GA 3M7MX 4Q6GA 3H1KH 4JI5O 2ZNJA 2QWNB 2Q8VA 3C90A 2Q5ZA 3WB2A 4F6EA 4LBEC 3CCVV 4JI7O 3KCYA 4K0KB 1I7FA 4MW3A 3I55V 2AZ0A 4DR7O 3BVOA 3GWOA 1Y6XA 4JAAA 1DTOA 2JGDB 3VQYA 3UT5A 4OXSA 4UVAA 3T1YB 1US6A 5KUKA 2D2CB 2Y0PA 3DTUB 1SZTA 1NH2D 2RCVA 1K4DC 1DF5A 4FPPA 4J9YB 4X62B 3ASOC 4YJ2A 2X6BA 4GZRB 1WAZA 5EYPA 3STZC 3JATA 1YXBA 2XAGA 1ENVA 3QVNA 1AR1B 1NKDA 1NT2B 4O2AA 2YS8A 2E76B 1QLEB 5LMNO 1OHHG 3K06A 3OR7C 1XMOO 3CXHF 2W0XA 2ZE6A 2NR5A 5LP6C 2XASA 1ZL8A 5L3DA 2Z5UA 5B1NA 1YCIA 1G4YB 5FNVA 2QM7A 3SJCC 2H94A 5H5NA 4BIOA 5EBLC 5GW7A 2HJDA 3EXAA 1OZ0A 1XNQB 3RVYA 1JMKC 1Y4MA 1N36B 4I0XB 1S5HC 2IH1C 2WWWA 5IWAO 1YVWA 3U10A 4IIJB 1WB8A 1CPYA 1SQFA 2UUBO 4JASA 2PI4A 5CMUA 2LQTA 3VBBA 3S3XA 1OJHA 3G71V 3ZJZA 3NXSA 2OTLV 4EEQA 2XUMA 1I5YA 1L0NH 1BQZA 2CTQA 3ABLB 2QWRB 4FZ1A 1SQBH 1NH2B 4K3AA 4W4LA 4DR4B 4K0KO 1S77D 2XHBA 2N05A 2C2AA 5B1BB 5JH7B 2EIKB 1V55C 1IBKB 4DUZB 3T1YO 2D3OW 2HFEC 4LF9O 1VF6A 1NTZH 5DN6G 4DW0A 4WCEV 1W0JG 1QU7A 2PTMA 4I55B 4X62O 4R6ZA 4TSFG 2F23A 1YEWA 4DV2B 3CB2A 5F2VO 4MT8A 1YDXA 3CRMA 3D3QA 5EZYB 1PNKA 4J11A 1FYJA 4IIJA 5KHGA 3WFVA 1V55B 1XL4A 3ABKB 3DSQA 2B1IA 5B1AC 1OCRC 2QEXV 4YHHB 4DV5B 3F7VC 3HB3B 2L6LA 2Y69B 3OUSA 4JAUA 3TJTA 4ZOLB 1IBLB 3N2KB 1E79G 5DECA 2JGUA 1SA0B 1XBLA 3O9OA 1GK9A 1PL4A 4GYCB 1FFTB 3JSLA 5EC2C 1KECA 3CWBH 5GTHZ 1N36O 5LA6B 1SKVA 2IJKA 5IYDO 5EK0A 5JH7A 2Q4PA 4J42A 1B3QA 2WAMA 2R9RB 2L35A 1DK1A 5B3SB 4UV9A 2WLJA 3LSSA 1VEWA 3RYHB 4TQFA 4I55A 4O2BB 1O9GA 2EULA 3AG3B 4TUYB 2PY5A 5LOVB 2CTRA 2GBOA 4AQYO 3TGUH 3JSNA 4DR4O 3G6EV 1ZWIC 1AI6A 1S5LZ 4FLZA 4Z2WA 1GMGA 4JTAB 4MS2A 4JI6B 4RUFA 1IBKO 2CGOA 4DUZO 1V9PA 4ZOLA 1T5EA 1YJWV 3N2KA 1SQQH 1J5EB 3RW0A 2QTSA 1SA0A 4P9PA 3ZS8C 1VQ8V 2ETNA 1FXKC 3J7AU 4I9QA 3CCLV 4FFBB 2YSUB 5KLVH 3E22B 3ZCCA 4J80A 2WLIB 1SQGA 4DV2O 1D5AA 5LA6A 2JIZG 2HVKC 1NR1A 3C3SA 4NR1A 1FJGB 3LUTB 4I7ZB 3OMIB 2EBOA 4U3FH 5CBGA 2UU9B 4JGSA 2ZQMA 4YHHO 2VWJA 4X88A 4C7UA 4X8AA 4DV5O 2G38A 4TV8B 4EFEA 1VF7A 2GV9A 3E8HA 3RYHA 4WFAV 3OMAB 1FXKB 2BOBC 4CC5A 3UQ8A 4TUYA 1B04A 4WF9V 2LJ2A 5LOVA 2IM9A 1KU9A 4JF3A 1HNZB 3B77A 3CSXA 4O4JB 4DK1A 4OPHA 4ZIBA 3LDEA 3QO5A 1Q82W 5JWPA 2QWPB 3D3IA 4GKJB 1GH6A 3HR0A 4JYAB 5LMUB 4HBNA 5LXTB 2OWOA 4FFBA 2WLMA 3E22A 2K9PA 1M57C 2WLIA 4LH6A 3LSQA 4DXWA 1BGYH 1FAFA 5CA0B 3BAAA 3K9SA 5JCOA 2FTKA 2PGGA 3W7XA 2Q67A 5KHIA 2IBZH 2LP7A 4JI6O 3OT7A 1Q8IA 1FXHA 1V54C 1FXKA 3K03A 1OCCB 1MNGA 2FYUH 1J5EO 3CCQV 2Q7EA 4EFBA 1L1FA 3OEEG 2NNUA 1KP3A 4LR3A 1PPJH 2DJVA 1EBOA 2ZE8A 3CRCA 4O4JA 3HKBB 1E1RG 2WA4A 1M56C 2GHYA 3AG4C 2Q69A 2EIJC 2P7TC 2ZINA 2CH7B 1KBHA 3CJHB 3RFRA 2Y4TA 3FB7C 4IYHA 4K8XA 1VQNV 2UU9O 2ZM6B 1BS3A 2JVDA 3F7YC 3SYAA 3AG2C 1F7YA 1DLBA 5LXTA 1WPBA 2YEVB 3RYIB 3X2QC 1N0JA 3B2EE 1JA8A 2Q6AA 1KC8W 4X65B 5KA5A 1HNZO 4HAMA 3AK1A 5JVDB 3SYOA 3CYOA 5CA0A 3ZHSA 3P3NA 4PA9A 1XNRB 1XMQB 2ZIOA 4FLWA 1YITV 3E35A 4P30A 4IGGA 2YXYA 4GKJO 3A8TA 3H01A 5CBFA 3VQVA 4JYAO 1N32B 5LMUO 3OAAG 5JJNB 4RUEA 1MZEA 1GN6A 4XDLA 2DYRC 1SQPH 4IHJB 4JI5B 2RDCA 3HKBA 1LUVA 4DW1A 2GUZB 3BA9A 3R65A 2V4DA 2KSDA 1OCOB 4JI7B 4X89A 2IJHA 5KAIZ 1SETA 1K8AW 4PA4A 4DR7B 2CH7A 3K04A 1F23A 1U97A 1ORQC 1HNWB 3DC5A 3APOA 3UO3A 1AVMA 3E86A 4CH6A 1Q86W 4MVRA 1P84F 4BIZA 1AB3A 4CS2A 3RYIA 1H2SB 1WNSA 1MMMA 4JPRA 4JI2O 3FYIB 4NXMB 1XDCA 3QF7A 1OCZB 3QG5A 4PDRA 5JVDA 5GTIZ 4KFMA 3T1CA 1VQ7V 2K1EA 2X7RB 2QM4A 1W0KG 2H3OA 1QVGU 1H2NA 4UUJC 2QJ1A 1UFIA 4DYLA 2PUSA 1QQCA 3UKMA 1MABG 2ZM6O 3UT5B 2E5LB 3ZMUA 3CRAA 3B09A 4FM1A 3D8CA 2CTPA 1YTFD 4IHJA 2CE4A 2EILB 4YIOA 3SPGA 2GUZA 3K5LA 1KYOF 3ZHQA 2F66C 2ZR3A 1SC5B 4X65O 4KP4A 3W7SA 3L9DA 1I5XA 2A79B 4D6TH 2EIMC 2WLKA 2BTQB 1P49A 3JATB 1AROP 3UO2A 1S72V 1ZLZA 1SERA 3D36A 3LNMB 1XNRO 1BHBA 1NTKH 1XMQO 3ETGA 1RM1C 5H6RA 4DV6O 3NR7A 4H0LB 1AILA 1ZL8B 4MSWC 2FL4A 1S0VA 2FB5A 1N32O 4LWSB 1WA8B 1I08A 5FNVB 4HZ3A 1OV9A 2M7WA 2XT9A 4CBCA 5ITZB 4PDMA 3ABUA 2ZDIA 1ZUQA 5KHJA 3K79A 1PL0A 5TISZ 2B5UA 4NVPA 1HNWO 5LHHA 3MHHC 4PA6A 2O57A 1WJZA 4LF9B 1BCCH 1P7GA 4JYCA 1LR1A 1UJWB 2CTWA 4H37A 4ICGA 2PI5A 1EFRG 4NXMO 3T1HB 5JQGA 5FLXN 1D2DA 2BTQA 3M8AA 3CCUV 1MSDA 4OGQB 1D5NA 1YI2V 5IYCO 4G2KA 3WB0A 4ABMA 3W7WA 3OM3B 2BTOA 1G6UA 2E5LO 4J10A 1URFA 5KX5B 4LWSA 1WLEA 3ASOB 2DQ3A 1WA8A 3O65A 1H2MA 5C93A 4I9WA 3ICXA 2DYSC 4DV1B 2JJ2G 4LP8A 3I5DA 1FS0G 5C8YB 1PP9H 2JEXA 5ITZA 2N04A 3N27A 1M5IA 1R3JC 1Y67A 3E2EA 1GRJA 3AG1C 5LP6B 3SYCA 1FPOA 4UCOA 2VWKA 3F5TA 1QHTA 3SPIA 4ASUG 4JI8B 2MW2B 3BHPA 2ZIMA 3T4ZA 3FB6C 3JAMN 3GWKC 3RYCB 2WA3A 4AQYB 4CH3A 1PV0A 2YXHA 2XAHA 4DO2A 1BSMA 5A9GA 5BY1A 2DN9A 1QLNA 4F6RB 3QTCA 1AP5A 2B9ZA 3L73H 5LGUA 2HHHB 3KG2A 3ZX6A 4FLTA 2HEPA 3OGCC 1GAXA 5KX5A 4B3TB 3IAYA 2QSAA 1YIJV 1S5JA 4FJCC 4MVQA 2R9AA 1ZX3A 2R9IA 1QBZA 1IVSA 4RWUA 3OFNG 2AW9A 2BE3A 4MTFA 1KKDA 3B40A 5C8YA 3AK2A 3T1HO 3P3PA 1YJ9V 1BT8A 4J7KA 1ZSPA 5HFLA 1BHAA 5LP6A 1SESA 1F4MA 4PDVA 5BMVB 4FLYA 3CE2A 2PYLA 3DC6A 1YZBA 3KCXA 1XL6A 1VMGA 1CEZA 2LFRA 4J41A 2YIBD 3RYCA 1WN7A 2YI9A 4DV1O 4D7SA 4I4TB 2OIGA 1EN4A 4GX1A 1SQXH 1U96A 2P67A 3EVKA 1K4CC 2VQFB 5B1AB 2ZNIA 1OCRB 4NTXA 4QIWF 4F6RA 4DV7B 5KMGA 3APQA 2Y4UA 1NR7A 4X1KB 4B7EA 1L0LH 4L8JA 2IU0A 3IC7A 4RAIA 3U0ZA 3IGAC 4JI8O 2V1DA 1MOFA 1SS3A 2EZPA 4FMTA 2P5OA 1W59A 1QCEA 2W6JG 5J2TB 1WB7A 3SPJA 1H8HG 5LBQA 3SYQA 3ETDA 3FB5C 5KUMA 3PN1A 4LF7B 2EZOA 1H8EG 5JJJB 5EBMC 4DR5B 1SRYA 2GSMB 2N74A 5IYBO 2P4VA 3JYCA 4A5UB 4GKKO 1K5SA 5BMVA 4KL1A 3K59A 1Y74B 2HHHO 4Z1MG 1QR8A 1X4TA 2Y48A 4B3TO 2XAFA 4B7KA 2CGNA 1G8MA 4WFGA 3JAKA 5LYJB 4OX9B 1Y76B 1N8RW 3ZHTA 4I4TA 2ADQB 5LGTA 2EX3A 2EJRA 1AI7A 1KMIZ 5J2UB 5HFMA 5IY5C 2NN4A 4X1IB 4TWKA 2HP8A 1LNQA 4X1KA 3RVZA 5L3FA 1DF4A 1VF5B 1GM9A 1VQ4V 1Q6HA 2ZXWC 5J2TA 3JD3A 2A7WA 4MVUA 4J7ZA 1R3LC 3JAWB 4MTXA 3AG7A 4LFAB 3ZRVA 3JD2A 2VQFO 2W0FC 2P4KA 1VP7A 3LSUA 4NKGB 4DV7O 1XREA 2LW1A 1Y74A 1JR9A 3CC7V 4JI0B 2B1GA 3FD9A 4JZGA 1GTOA 4MTGA 3JCUZ 2ADPA 4KXRA 1AP6A 4Q20A 4GT1A 1Q3EA 2YDEA 5IJ0B 3JALA 5LYJA 2RQ6A 1Y76A 4IL6Z 3A0HZ 3LDCA 2HR3A 5FPRA 1MSWD 4PHZA 3A0RA 5J2UA 3GVMA 4H13B 1XQ8A 4X1IA 4LF7O 1TUBB 1TVKB 3C3TA 1NJIW 4DR5O 3ABMC 2BOCC 3K5MA 1NBMG 4YJ3A 3E89A 3FB8C 3FAVB 1JPXA 4P2ZA 1TUEB 1GN4A 4PI2A 4JZ2A 1M57B 2QKAA 4O4HB 4X1YB 3MDSA 4X20B 2ITCC 4OX9O 2YXLA 2Y0IA 4JI2B 4K8ZA 1CXZB 2QKCA 3JAWA 1RP3B 2Q0OC 3RBZA 3SYPA 1K9MW 2AHYA 2WLLA 3LNNA 4UVCA 1L8DA 2ODMA 3SPCA 4MVZA 2UUCB 1V54B 1VQOV 4U7OA 2JEUA 4LF8B 3P32A 2RNBA 2UXBB 5IJ0A 4UCRA 4B3MB 1B06A 3UCSC 3SJBC 4UXNA 4PD4F 2HJFC 5CBHA 2R72A 5EIBD 2X6CA 1XHZA 3S3WA 1PM9A 2AZ2A 1GN3A 1JJ2U 4X9QA 1VQKV 1M56B 3BCCH 3ZN1A 1GKFA 3K0DA 1AJNA 1TUBA 3AG4B 3F5WC 4J7JA 3DXRB 1TVKA 5KHKA 2ITDC 3SJQC 1NVPD 3L75H 2EIJB 4LFAO 1IDSA 2FKXA 3ZHRA 4H44B 3RYFB 2DWDC 2R70A 1M90W 4JI0O 4CH5A 3AG2B 2XOKG 4DV6B 2H8PC 5B5EZ 3FAVA 2ZT9B 1H38A 4GX0A 1BQ0A 3CPWU 4B3SB 3MHSC 4O4HA 3X2QB 4X1YA 1ZAUA 2KG7B 4X20A 3ASNC 3KZIZ 4G27B 4DR2B 4OPAA 5BZBA 4J9ZB 3CXCU 2LW7A 2Q7GA 1SQVH 1TAEA 5L3BA 2KKWA 2VS0A 1THZA 3CCSV 1IX9A 5BXZA 1ZTEA 5LL6Y 4X66B 5EIBC 3BA8A 1X59A 1R1BA 4CS3A 1UPGA 1YJNV 4R7CA 1LUWA 3LDDA 4YY3B 4YIPA 1M9NA 4FZ0A 4GX2A 1F4NA 4PJ0Z 3OTFA 2DYRB 4JV5B 4IT5A 1Q90D 3CMEV 1EN6A 3DXRA 4TV9A 4U7NA 2YC0A 3H1HH 4JAVA 4TOIA 3RYFA 5IDJA 5GONB 3W7TA 2EINC 5E1AC 3FYEB 3CEIA 4FM2A 1FD9A 4TQDA 2UUCO 2ZE5A 4LF8O 4AI8A 4GX5A 3ETEA 2UXBO 4DR3O 4B3MO 4QPJA 1VQ5V 1VIBA 2KG7A 1XEQA 4O4LB 3CX5F 2QM8A 1HR0B 4EB6B 3JD1A 3VOUA 4UB8Z 4DUYB 3JCZA 5JQGB 1HNXB 4WFHA 4DV0B 2OCCC 3HKDB 2NLJC 1NI8A 4WFFA 1A32A 4FFKA 2QTOA 4FLVA 3JASB 3HKCB 4FK5C 5CB4B 5E79Z 3ETQA 5DM6V 1JOYA 1Q43A 2IJJA 4MTOA 2M6YA 1P4RA 5L3CA 5EBWC 4B3SO 2YIAA 1AR4A 5A2QN 2QDOA 2WLNA 4DR2O 4LH7A 3ZRSA 2FMLA 2EIMB 2P6JA 3OW2U 2PF4E 4UCSA 1IURA 4I5SA 3UM7A 2DMXA 3W7UA 3K57A 4N23A 4UVBA 5GONA 1F51A 3FKSG 1KD1W 4X66O 1KB9F 5EC1C 1RM1B 2F93B 4JTCB 5KA6A 4LF4B 1P7BA 4CH4A 3JD4A 4EKWA 1RPOA 4E4EA 4YY3O 2XAQA 2MK3A 4O4LA 1WP7A 5B1OA 1N33B 2OYQA 1R6TA 3R66A 4JV5O 4MW8A 2CDYA 1JCHA 4EB6A 1GM7A 1R3IC 4JYBA 2DQ0A 3EHBB 2QR4A 3OMNB 4QPKA 1QLEC 5D5PA 1YTFB 2JRIA 2GDSA 3G6BA 3HKDA 2QA4V 4F4LA 2HLDG 2Q7HA 3JASA 3HKCA 1WPXA 5CB4A 4AHCA 2HG5C 3ML0A 2DWEC 2XNDG 4I50B 1KQSU 1VF6C 1GM8A 3E8GA 4O4IA 4E2LA 4BWAA 1YHQV 2LGQA 1AR5A 5KHHA 5BR8O 2OCHA 3BPZA 3PJSK 2JS5A 1BZKA 3N2GB 1HP8A 4LFCB 1HR0O 2P90A 3M99B 5LGNA 2ZE7A 3WB1A 4FM0A 1JFFB 2ARHA 3K0GA 4PA3A 4N21A 1AJQA 1NTMH 4DUYO 1HNXO 4DV0O 1Q6IA 2F1MA 4DR1B 2LO1A 2X6AA 4HNAB 2CAZC 1H2KA 1HWYA 4B3RB 3CHXA 3QO7A 1TGOA 1GN2A 4WFBV 4UV8A 2DYSB 5CA3A 4HYOA 2DOSA 4NTYA 4XDJA 3ABLC 4B08A 1RSOB 2JGDA 5H6QA 3K5OA 2UUAO 1NU1H 1NZ6A 5B1BC 1N34O 3AG1B 1H2LA 1Y66A 2IU3A 4DV3B 2EIKC 3RGBA 4PI0A 1JJOA 1PD3A 3E8BA 4QJFB 4GKKB 3CS5A 3CCMV 3CCRV 3SR2C 5KMGB 1PNMA 4I50A 3SDLA 4X64B 5L3GA 1IZ3A 4LF4O 4CC6A 1N4CA 4FLXA 4QNHB 4JTDB 3N2GA 4UFZA 4CS4A 1CP9A 3FFQA 1N33O 4BW5A 4K35A 3CCJV 2JDIG 5IYZB 2CUGA 2YI8A 3OTOB 2DE0X 5L3EA 1JVMA 1EZJA 1JFFA 3ABKC 2A9HA 1VQLV 2QKSA 3TXQA 4W4KA 4DK0A 4DR6B 3RN4A 3EFFK 4HNAA 2Y69C 1I94B 5LHGA 1BE3H 4ZHQB 1XOUA 4XDKA 3ZMVA 1EZVH 2XAJA 3L71H 1S76D 1PNLA 4JI3B 3ZEDA 1K97A 2QWQB 3L70H 4I0XA 5H9CA 2A0LA 2LGWA 3OD4A 3HKEB 5J9PC 4LFCO 1EM1A 1RSOA 3BABA 3JAKB 1ROPA 2BCCH 4QE7A 1I0HA 1R73A 3L72H 4DV4B 4BR6A 1SF9A 3STLC 1FKAO 3QNEA 3ZMSA 5B3SC 4DR1O 1PKXA 4UB6Z 3IC9A 4GUNA 4B3RO 1XNQO 3AG3C 1KP2A 2IJIA 2VQEB 5DEDA 4PDLA 5IYZA 2CK3G 1J95A 4LCUC 4BAYA 2UXNA 3P30A 2OTJV 4GCZA 2QE7G 3H1JH 3E8FA 2ZD9A 3ZHVA 4XBFA 4DV3O 4FIPC 5D5QA 4ZHQA 4KHPB 3OE7G 1G1XB 3H9VA 2A3QA 3FX7A 4G28B 4X64O 1RPRA 4NXNB 3K58A 3ZMTA 5H2FZ 3K5NA 3HKEA 2OT5A 3SGIA 5EZYA 3JALB 4U3JB 1EN5A 4PV1B 1Q7YW 2ZCEA 3OTOO 5IE9A 1M93A 3CCEV 3TETA 4JI4B 3ABTA 3T4DA 2WPDG 4IYIA 5JCOC 2YICA 4DR6O 2LFSA 4NB5A 4D7TA 3A2FA 1I94O 2QGNA 4YJ3B 5CA1B 3G4SV 3TK1A 4JI3O 4CZZA 3BEHA 2RN9A 3OEHG 4FLUA 4UCUA 3I56V 4H33A 2BSKB 4LNUB 1Z5WA 4WFEA 3ZIAG 4Z1VA 3QO8A 2F4VB 4DRXB 1XHXA 5IY5B 5FPOA 3IJ4A 3ZN0A 4DV4O 2WSSG 1Z2GA 2RJZA 2WLLB 3E83A 2JS3A 3BFRA 1K92A 1IBLO 2EJ7A 1MZFA 2YIDA 3H1LH 3THOA 3CRQA 2Q0AA 4O2BA 2A06H 4PELA 4MVMA 5AG2A 3RWRD 1K5QA 3SPHA 3Q4HB 1Q5OA 2ZXWB 2E3CA 1WP8A 4U3JA 3MAQA 5IT9N 3B4SA 4L87A 1VQ9V 4BIUA 2VQEO 1O9HA 3ZMZA 4KUMA 4WBNB 1XUQA 1VQPV 3B8MA 1NS1A 2V7QG 3OGIB 1YF2A 2HVJC 2YIBA 1K3EA 2P22C 2VRZA 5FL7G 1K34A 3OUFA 1HW7A 1AI4A 3ZRWB 4ZI7B 4KHPO 3CMAV 5CA1A 3J80N 1OCCC 4NXNO 1XILA 2XTAA 2BSKA 4LNUA 4AILC 2Q68A 2UXXA 4DRXA 2Z3YA 3CC2V 3CRRA 4P9OA 4UCTA 3G67A 3ZRXA 4TV8A 1QR9A 3WG7C 3ABMB 4JI4O 4NTWA 3G80A 2ILMA 1SZXA 2JJ1G 3L74H 3JARB 1M1KW 3Q4HA 1IXMA 4DR3B 2UXCB 4LC1A 1S3JA 2GTSA 3GB7C 1XI1A 4WBNA 3MD0A 2ZR2A 3IFXA 3TCUA 3WG7B 1MA1A 1AJPA 3T2MA 1FXVA 2F43G 1FJGO 2F4VO 2UXDB 3OR6C 1KKCA 3CC4V 4TV9B 2GTAA 3ZRWA 3VQXA 1VQMV 2IW5A 1IBMB 2Z0AA 4ZI7A 3SJAC 1Q6UA 4LFBB 2E75B 3H1IH 3AK3A 4MVSA 5KAFZ 5LHIA 5K1XA 1GO3F 2E74B 3BRCA 2KB1A 3CD6V 1YSCA 1K73W 4LF6B 1COWG 4YXWG 1QNMA 3BY6A 4JI1B 1RFYA
chains in the Genus database with same CATH topology
3RT3C 3SDLA 4OX9O 4YY3O 2ZM6O 1F7YA 4LF4O 1G1XB 4JI1O 5IWAO 4X64O 1N36O 1R6TA 4KHPO 3R66A 2E5LO 4JV5O 4LF5O 2UUBO 3J80N 1YZBA 4OPHA 1HNZO 4NXNO 1N33O 3O65A 2JRIA 4X65O 1DK1A 3OTOO 2UUCO 4LF8O 4JI5O 4DV1O 2UXBO 4DR3O 4B3MO 4GKJO 1XNRO 4DR6O 1XMQO 4JI4O 4JI7O 1XEQA 4JYAO 4DV6O 5LMUO 4AQYO 4DR7O 1I94O 1AILA 5BR8O 4K0KO 2VQFO 3F5TA 2AGAA 1N32O 4DV7O 4JI3O 4LFAO 4DR4O 2FKXA 1HR0O 4LFCO 3J81N 1KUQA 3T1YO 4JI8O 3JAMN 4JI0O 1IBKO 4DUYO 1A32A 4DUZO 1HNXO 2UXCO 4LF9O 4DV0O 1FKAO 4JI6O 4DV4O 1FJGO 2F4VO 4X62O 5BY1A 4DR1O 3J7AU 4B3SO 1J5EO 4OPAA 1HNWO 1IBLO 5A2QN 2LW7A 2N74A 5LMNO 1AB3A 1XMOO 2Z0AA 2UXDO 4LF7O 4A5UB 4GKKO 4DR2O 1FYJA 2DOSA 4DV2O 2DJVA 4DR5O 4B3RO 2ZKOA 1XNQO 1IBMO 2HHHO 5BXZA 5LL6Y 4JI2O 5IT9N 1X59A 2UUAO 2VQEO 1R1BA 4B3TO 4LFBO 4NXMO 4YHHO 4X66O 1N34O 4DV5O 5H5NA 5FLXN 1NS1A 2UU9O 1D2DA 3T1HO 3M8AA 4LF6O 4DV3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  3SDL A;  4OX9 O;  4YY3 O;  2ZM6 O;  1F7Y A;  4LF4 O;  1G1X B;  4JI1 O;  5IWA O;  4X64 O;  1N36 O;  1R6T A;  4KHP O;  3R66 A;  2E5L O;  4JV5 O;  4LF5 O;  2UUB O;  3J80 N;  1YZB A;  4OPH A;  1HNZ O;  4NXN O;  1N33 O;  3O65 A;  2JRI A;  4X65 O;  1DK1 A;  3OTO O;  2UUC O;  4LF8 O;  4JI5 O;  4DV1 O;  2UXB O;  4DR3 O;  4B3M O;  4GKJ O;  1XNR O;  4DR6 O;  1XMQ O;  4JI4 O;  4JI7 O;  1XEQ A;  4JYA O;  4DV6 O;  5LMU O;  4AQY O;  4DR7 O;  1I94 O;  1AIL A;  5BR8 O;  4K0K O;  2VQF O;  3F5T A;  2AGA A;  1N32 O;  4DV7 O;  4JI3 O;  4LFA O;  4DR4 O;  2FKX A;  1HR0 O;  4LFC O;  3J81 N;  1KUQ A;  3T1Y O;  4JI8 O;  3JAM N;  4JI0 O;  1IBK O;  4DUY O;  1A32 A;  4DUZ O;  1HNX O;  2UXC O;  4LF9 O;  4DV0 O;  1FKA O;  4JI6 O;  4DV4 O;  1FJG O;  2F4V O;  4X62 O;  5BY1 A;  4DR1 O;  3J7A U;  4B3S O;  1J5E O;  4OPA A;  1HNW O;  1IBL O;  5A2Q N;  2LW7 A;  2N74 A;  5LMN O;  1AB3 A;  1XMO O;  2Z0A A;  2UXD O;  4LF7 O;  4A5U B;  4GKK O;  4DR2 O;  1FYJ A;  2DOS A;  4DV2 O;  2DJV A;  4DR5 O;  4B3R O;  2ZKO A;  1XNQ O;  1IBM O;  2HHH O;  5BXZ A;  5LL6 Y;  4JI2 O;  5IT9 N;  1X59 A;  2UUA O;  2VQE O;  1R1B A;  4B3T O;  4LFB O;  4NXM O;  4YHH O;  4X66 O;  1N34 O;  4DV5 O;  5H5N A;  5FLX N;  1NS1 A;  2UU9 O;  1D2D A;  3T1H O;  3M8A A;  4LF6 O;  4DV3 O; 
#chains in the Genus database with same CATH topology
 1OCO C;  1JX9 A;  3ZHU A;  2DW4 A;  2RMK B;  4LF5 B;  2ATK C;  2KQX A;  1R6K A;  3D36 C;  4ZKI A;  5JJE B;  1E1Q G;  3K3W A;  3ZBH A;  3CP1 A;  5IJ9 B;  1R6N A;  3JAR A;  1VAR A;  4MVO A;  4QGP A;  4PA7 A;  1FFX B;  4QE9 A;  4FVM A;  2PZS A;  3ASN B;  1NQT A;  3KKY A;  1AI5 A;  1K7D A;  5B66 Z;  1DGS A;  1OCZ C;  3B8N A;  4RQE A;  3CJH A;  2OIE A;  2AHZ A;  2P06 A;  1BMF G;  3HPL C;  3AEI A;  2IH3 C;  2PYJ A;  2ZDI C;  2AGA A;  1Q81 W;  4NYK A;  2YEV A;  5CN0 A;  2QWO B;  4R50 A;  2YUA A;  3J81 N;  1KUQ A;  1N0N A;  1IXB A;  1NVP B;  4BW9 A;  1TA8 A;  2F95 B;  2UXC O;  2X0L A;  4GLX A;  3VQW A;  2EIL C;  1Z5V A;  5BR8 B;  1BL8 A;  3DGE A;  1R3K C;  3TXS A;  5LMN B;  1JQ0 A;  1XMO B;  1VQ6 V;  3K9A A;  4ZBM A;  4RQF A;  4TT3 G;  2Q9L A;  1QVF U;  2W6I G;  2EIN B;  2UXD O;  2ZKO A;  1MG1 A;  5IJ9 A;  1IBM O;  4R8C A;  3K08 A;  2JK5 C;  1FFX A;  4JYY A;  4LFB O;  2AXT Z;  3U11 A;  5K1P A;  1K33 A;  4O4I B;  3A0B Z;  4YJ2 B;  4LF6 O;  5IWA B;  1HDJ A;  5EYP B;  2WLH A;  3RT3 C;  3WU2 Z;  3JD0 A;  1B6Q A;  2HKO A;  4JI1 O;  1M4U A;  4O2A B;  2UUB B;  2UUA B;  2Q73 A;  1W2B U;  2OCC B;  4RO2 A;  1N34 B;  4UCV A;  4LF5 O;  1H2G A;  3M7M X;  4Q6G A;  3H1K H;  4JI5 O;  2ZNJ A;  2QWN B;  2Q8V A;  3C90 A;  2Q5Z A;  3WB2 A;  4F6E A;  4LBE C;  3CCV V;  4JI7 O;  3KCY A;  4K0K B;  1I7F A;  4MW3 A;  3I55 V;  2AZ0 A;  4DR7 O;  3BVO A;  3GWO A;  1Y6X A;  4JAA A;  1DTO A;  2JGD B;  3VQY A;  3UT5 A;  4OXS A;  4UVA A;  3T1Y B;  1US6 A;  5KUK A;  2D2C B;  2Y0P A;  3DTU B;  1SZT A;  1NH2 D;  2RCV A;  1K4D C;  1DF5 A;  4FPP A;  4J9Y B;  4X62 B;  3ASO C;  4YJ2 A;  2X6B A;  4GZR B;  1WAZ A;  5EYP A;  3STZ C;  3JAT A;  1YXB A;  2XAG A;  1ENV A;  3QVN A;  1AR1 B;  1NKD A;  1NT2 B;  4O2A A;  2YS8 A;  2E76 B;  1QLE B;  5LMN O;  1OHH G;  3K06 A;  3OR7 C;  1XMO O;  3CXH F;  2W0X A;  2ZE6 A;  2NR5 A;  5LP6 C;  2XAS A;  1ZL8 A;  5L3D A;  2Z5U A;  5B1N A;  1YCI A;  1G4Y B;  5FNV A;  2QM7 A;  3SJC C;  2H94 A;  5H5N A;  4BIO A;  5EBL C;  5GW7 A;  2HJD A;  3EXA A;  1OZ0 A;  1XNQ B;  3RVY A;  1JMK C;  1Y4M A;  1N36 B;  4I0X B;  1S5H C;  2IH1 C;  2WWW A;  5IWA O;  1YVW A;  3U10 A;  4IIJ B;  1WB8 A;  1CPY A;  1SQF A;  2UUB O;  4JAS A;  2PI4 A;  5CMU A;  2LQT A;  3VBB A;  3S3X A;  1OJH A;  3G71 V;  3ZJZ A;  3NXS A;  2OTL V;  4EEQ A;  2XUM A;  1I5Y A;  1L0N H;  1BQZ A;  2CTQ A;  3ABL B;  2QWR B;  4FZ1 A;  1SQB H;  1NH2 B;  4K3A A;  4W4L A;  4DR4 B;  4K0K O;  1S77 D;  2XHB A;  2N05 A;  2C2A A;  5B1B B;  5JH7 B;  2EIK B;  1V55 C;  1IBK B;  4DUZ B;  3T1Y O;  2D3O W;  2HFE C;  4LF9 O;  1VF6 A;  1NTZ H;  5DN6 G;  4DW0 A;  4WCE V;  1W0J G;  1QU7 A;  2PTM A;  4I55 B;  4X62 O;  4R6Z A;  4TSF G;  2F23 A;  1YEW A;  4DV2 B;  3CB2 A;  5F2V O;  4MT8 A;  1YDX A;  3CRM A;  3D3Q A;  5EZY B;  1PNK A;  4J11 A;  1FYJ A;  4IIJ A;  5KHG A;  3WFV A;  1V55 B;  1XL4 A;  3ABK B;  3DSQ A;  2B1I A;  5B1A C;  1OCR C;  2QEX V;  4YHH B;  4DV5 B;  3F7V C;  3HB3 B;  2L6L A;  2Y69 B;  3OUS A;  4JAU A;  3TJT A;  4ZOL B;  1IBL B;  3N2K B;  1E79 G;  5DEC A;  2JGU A;  1SA0 B;  1XBL A;  3O9O A;  1GK9 A;  1PL4 A;  4GYC B;  1FFT B;  3JSL A;  5EC2 C;  1KEC A;  3CWB H;  5GTH Z;  1N36 O;  5LA6 B;  1SKV A;  2IJK A;  5IYD O;  5EK0 A;  5JH7 A;  2Q4P A;  4J42 A;  1B3Q A;  2WAM A;  2R9R B;  2L35 A;  1DK1 A;  5B3S B;  4UV9 A;  2WLJ A;  3LSS A;  1VEW A;  3RYH B;  4TQF A;  4I55 A;  4O2B B;  1O9G A;  2EUL A;  3AG3 B;  4TUY B;  2PY5 A;  5LOV B;  2CTR A;  2GBO A;  4AQY O;  3TGU H;  3JSN A;  4DR4 O;  3G6E V;  1ZWI C;  1AI6 A;  1S5L Z;  4FLZ A;  4Z2W A;  1GMG A;  4JTA B;  4MS2 A;  4JI6 B;  4RUF A;  1IBK O;  2CGO A;  4DUZ O;  1V9P A;  4ZOL A;  1T5E A;  1YJW V;  3N2K A;  1SQQ H;  1J5E B;  3RW0 A;  2QTS A;  1SA0 A;  4P9P A;  3ZS8 C;  1VQ8 V;  2ETN A;  1FXK C;  3J7A U;  4I9Q A;  3CCL V;  4FFB B;  2YSU B;  5KLV H;  3E22 B;  3ZCC A;  4J80 A;  2WLI B;  1SQG A;  4DV2 O;  1D5A A;  5LA6 A;  2JIZ G;  2HVK C;  1NR1 A;  3C3S A;  4NR1 A;  1FJG B;  3LUT B;  4I7Z B;  3OMI B;  2EBO A;  4U3F H;  5CBG A;  2UU9 B;  4JGS A;  2ZQM A;  4YHH O;  2VWJ A;  4X88 A;  4C7U A;  4X8A A;  4DV5 O;  2G38 A;  4TV8 B;  4EFE A;  1VF7 A;  2GV9 A;  3E8H A;  3RYH A;  4WFA V;  3OMA B;  1FXK B;  2BOB C;  4CC5 A;  3UQ8 A;  4TUY A;  1B04 A;  4WF9 V;  2LJ2 A;  5LOV A;  2IM9 A;  1KU9 A;  4JF3 A;  1HNZ B;  3B77 A;  3CSX A;  4O4J B;  4DK1 A;  4OPH A;  4ZIB A;  3LDE A;  3QO5 A;  1Q82 W;  5JWP A;  2QWP B;  3D3I A;  4GKJ B;  1GH6 A;  3HR0 A;  4JYA B;  5LMU B;  4HBN A;  5LXT B;  2OWO A;  4FFB A;  2WLM A;  3E22 A;  2K9P A;  1M57 C;  2WLI A;  4LH6 A;  3LSQ A;  4DXW A;  1BGY H;  1FAF A;  5CA0 B;  3BAA A;  3K9S A;  5JCO A;  2FTK A;  2PGG A;  3W7X A;  2Q67 A;  5KHI A;  2IBZ H;  2LP7 A;  4JI6 O;  3OT7 A;  1Q8I A;  1FXH A;  1V54 C;  1FXK A;  3K03 A;  1OCC B;  1MNG A;  2FYU H;  1J5E O;  3CCQ V;  2Q7E A;  4EFB A;  1L1F A;  3OEE G;  2NNU A;  1KP3 A;  4LR3 A;  1PPJ H;  2DJV A;  1EBO A;  2ZE8 A;  3CRC A;  4O4J A;  3HKB B;  1E1R G;  2WA4 A;  1M56 C;  2GHY A;  3AG4 C;  2Q69 A;  2EIJ C;  2P7T C;  2ZIN A;  2CH7 B;  1KBH A;  3CJH B;  3RFR A;  2Y4T A;  3FB7 C;  4IYH A;  4K8X A;  1VQN V;  2UU9 O;  2ZM6 B;  1BS3 A;  2JVD A;  3F7Y C;  3SYA A;  3AG2 C;  1F7Y A;  1DLB A;  5LXT A;  1WPB A;  2YEV B;  3RYI B;  3X2Q C;  1N0J A;  3B2E E;  1JA8 A;  2Q6A A;  1KC8 W;  4X65 B;  5KA5 A;  1HNZ O;  4HAM A;  3AK1 A;  5JVD B;  3SYO A;  3CYO A;  5CA0 A;  3ZHS A;  3P3N A;  4PA9 A;  1XNR B;  1XMQ B;  2ZIO A;  4FLW A;  1YIT V;  3E35 A;  4P30 A;  4IGG A;  2YXY A;  4GKJ O;  3A8T A;  3H01 A;  5CBF A;  3VQV A;  4JYA O;  1N32 B;  5LMU O;  3OAA G;  5JJN B;  4RUE A;  1MZE A;  1GN6 A;  4XDL A;  2DYR C;  1SQP H;  4IHJ B;  4JI5 B;  2RDC A;  3HKB A;  1LUV A;  4DW1 A;  2GUZ B;  3BA9 A;  3R65 A;  2V4D A;  2KSD A;  1OCO B;  4JI7 B;  4X89 A;  2IJH A;  5KAI Z;  1SET A;  1K8A W;  4PA4 A;  4DR7 B;  2CH7 A;  3K04 A;  1F23 A;  1U97 A;  1ORQ C;  1HNW B;  3DC5 A;  3APO A;  3UO3 A;  1AVM A;  3E86 A;  4CH6 A;  1Q86 W;  4MVR A;  1P84 F;  4BIZ A;  1AB3 A;  4CS2 A;  3RYI A;  1H2S B;  1WNS A;  1MMM A;  4JPR A;  4JI2 O;  3FYI B;  4NXM B;  1XDC A;  3QF7 A;  1OCZ B;  3QG5 A;  4PDR A;  5JVD A;  5GTI Z;  4KFM A;  3T1C A;  1VQ7 V;  2K1E A;  2X7R B;  2QM4 A;  1W0K G;  2H3O A;  1QVG U;  1H2N A;  4UUJ C;  2QJ1 A;  1UFI A;  4DYL A;  2PUS A;  1QQC A;  3UKM A;  1MAB G;  2ZM6 O;  3UT5 B;  2E5L B;  3ZMU A;  3CRA A;  3B09 A;  4FM1 A;  3D8C A;  2CTP A;  1YTF D;  4IHJ A;  2CE4 A;  2EIL B;  4YIO A;  3SPG A;  2GUZ A;  3K5L A;  1KYO F;  3ZHQ A;  2F66 C;  2ZR3 A;  1SC5 B;  4X65 O;  4KP4 A;  3W7S A;  3L9D A;  1I5X A;  2A79 B;  4D6T H;  2EIM C;  2WLK A;  2BTQ B;  1P49 A;  3JAT B;  1ARO P;  3UO2 A;  1S72 V;  1ZLZ A;  1SER A;  3D36 A;  3LNM B;  1XNR O;  1BHB A;  1NTK H;  1XMQ O;  3ETG A;  1RM1 C;  5H6R A;  4DV6 O;  3NR7 A;  4H0L B;  1AIL A;  1ZL8 B;  4MSW C;  2FL4 A;  1S0V A;  2FB5 A;  1N32 O;  4LWS B;  1WA8 B;  1I08 A;  5FNV B;  4HZ3 A;  1OV9 A;  2M7W A;  2XT9 A;  4CBC A;  5ITZ B;  4PDM A;  3ABU A;  2ZDI A;  1ZUQ A;  5KHJ A;  3K79 A;  1PL0 A;  5TIS Z;  2B5U A;  4NVP A;  1HNW O;  5LHH A;  3MHH C;  4PA6 A;  2O57 A;  1WJZ A;  4LF9 B;  1BCC H;  1P7G A;  4JYC A;  1LR1 A;  1UJW B;  2CTW A;  4H37 A;  4ICG A;  2PI5 A;  1EFR G;  4NXM O;  3T1H B;  5JQG A;  5FLX N;  1D2D A;  2BTQ A;  3M8A A;  3CCU V;  1MSD A;  4OGQ B;  1D5N A;  1YI2 V;  5IYC O;  4G2K A;  3WB0 A;  4ABM A;  3W7W A;  3OM3 B;  2BTO A;  1G6U A;  2E5L O;  4J10 A;  1URF A;  5KX5 B;  4LWS A;  1WLE A;  3ASO B;  2DQ3 A;  1WA8 A;  3O65 A;  1H2M A;  5C93 A;  4I9W A;  3ICX A;  2DYS C;  4DV1 B;  2JJ2 G;  4LP8 A;  3I5D A;  1FS0 G;  5C8Y B;  1PP9 H;  2JEX A;  5ITZ A;  2N04 A;  3N27 A;  1M5I A;  1R3J C;  1Y67 A;  3E2E A;  1GRJ A;  3AG1 C;  5LP6 B;  3SYC A;  1FPO A;  4UCO A;  2VWK A;  3F5T A;  1QHT A;  3SPI A;  4ASU G;  4JI8 B;  2MW2 B;  3BHP A;  2ZIM A;  3T4Z A;  3FB6 C;  3JAM N;  3GWK C;  3RYC B;  2WA3 A;  4AQY B;  4CH3 A;  1PV0 A;  2YXH A;  2XAH A;  4DO2 A;  1BSM A;  5A9G A;  5BY1 A;  2DN9 A;  1QLN A;  4F6R B;  3QTC A;  1AP5 A;  2B9Z A;  3L73 H;  5LGU A;  2HHH B;  3KG2 A;  3ZX6 A;  4FLT A;  2HEP A;  3OGC C;  1GAX A;  5KX5 A;  4B3T B;  3IAY A;  2QSA A;  1YIJ V;  1S5J A;  4FJC C;  4MVQ A;  2R9A A;  1ZX3 A;  2R9I A;  1QBZ A;  1IVS A;  4RWU A;  3OFN G;  2AW9 A;  2BE3 A;  4MTF A;  1KKD A;  3B40 A;  5C8Y A;  3AK2 A;  3T1H O;  3P3P A;  1YJ9 V;  1BT8 A;  4J7K A;  1ZSP A;  5HFL A;  1BHA A;  5LP6 A;  1SES A;  1F4M A;  4PDV A;  5BMV B;  4FLY A;  3CE2 A;  2PYL A;  3DC6 A;  1YZB A;  3KCX A;  1XL6 A;  1VMG A;  1CEZ A;  2LFR A;  4J41 A;  2YIB D;  3RYC A;  1WN7 A;  2YI9 A;  4DV1 O;  4D7S A;  4I4T B;  2OIG A;  1EN4 A;  4GX1 A;  1SQX H;  1U96 A;  2P67 A;  3EVK A;  1K4C C;  2VQF B;  5B1A B;  2ZNI A;  1OCR B;  4NTX A;  4QIW F;  4F6R A;  4DV7 B;  5KMG A;  3APQ A;  2Y4U A;  1NR7 A;  4X1K B;  4B7E A;  1L0L H;  4L8J A;  2IU0 A;  3IC7 A;  4RAI A;  3U0Z A;  3IGA C;  4JI8 O;  2V1D A;  1MOF A;  1SS3 A;  2EZP A;  4FMT A;  2P5O A;  1W59 A;  1QCE A;  2W6J G;  5J2T B;  1WB7 A;  3SPJ A;  1H8H G;  5LBQ A;  3SYQ A;  3ETD A;  3FB5 C;  5KUM A;  3PN1 A;  4LF7 B;  2EZO A;  1H8E G;  5JJJ B;  5EBM C;  4DR5 B;  1SRY A;  2GSM B;  2N74 A;  5IYB O;  2P4V A;  3JYC A;  4A5U B;  4GKK O;  1K5S A;  5BMV A;  4KL1 A;  3K59 A;  1Y74 B;  2HHH O;  4Z1M G;  1QR8 A;  1X4T A;  2Y48 A;  4B3T O;  2XAF A;  4B7K A;  2CGN A;  1G8M A;  4WFG A;  3JAK A;  5LYJ B;  4OX9 B;  1Y76 B;  1N8R W;  3ZHT A;  4I4T A;  2ADQ B;  5LGT A;  2EX3 A;  2EJR A;  1AI7 A;  1KMI Z;  5J2U B;  5HFM A;  5IY5 C;  2NN4 A;  4X1I B;  4TWK A;  2HP8 A;  1LNQ A;  4X1K A;  3RVZ A;  5L3F A;  1DF4 A;  1VF5 B;  1GM9 A;  1VQ4 V;  1Q6H A;  2ZXW C;  5J2T A;  3JD3 A;  2A7W A;  4MVU A;  4J7Z A;  1R3L C;  3JAW B;  4MTX A;  3AG7 A;  4LFA B;  3ZRV A;  3JD2 A;  2VQF O;  2W0F C;  2P4K A;  1VP7 A;  3LSU A;  4NKG B;  4DV7 O;  1XRE A;  2LW1 A;  1Y74 A;  1JR9 A;  3CC7 V;  4JI0 B;  2B1G A;  3FD9 A;  4JZG A;  1GTO A;  4MTG A;  3JCU Z;  2ADP A;  4KXR A;  1AP6 A;  4Q20 A;  4GT1 A;  1Q3E A;  2YDE A;  5IJ0 B;  3JAL A;  5LYJ A;  2RQ6 A;  1Y76 A;  4IL6 Z;  3A0H Z;  3LDC A;  2HR3 A;  5FPR A;  1MSW D;  4PHZ A;  3A0R A;  5J2U A;  3GVM A;  4H13 B;  1XQ8 A;  4X1I A;  4LF7 O;  1TUB B;  1TVK B;  3C3T A;  1NJI W;  4DR5 O;  3ABM C;  2BOC C;  3K5M A;  1NBM G;  4YJ3 A;  3E89 A;  3FB8 C;  3FAV B;  1JPX A;  4P2Z A;  1TUE B;  1GN4 A;  4PI2 A;  4JZ2 A;  1M57 B;  2QKA A;  4O4H B;  4X1Y B;  3MDS A;  4X20 B;  2ITC C;  4OX9 O;  2YXL A;  2Y0I A;  4JI2 B;  4K8Z A;  1CXZ B;  2QKC A;  3JAW A;  1RP3 B;  2Q0O C;  3RBZ A;  3SYP A;  1K9M W;  2AHY A;  2WLL A;  3LNN A;  4UVC A;  1L8D A;  2ODM A;  3SPC A;  4MVZ A;  2UUC B;  1V54 B;  1VQO V;  4U7O A;  2JEU A;  4LF8 B;  3P32 A;  2RNB A;  2UXB B;  5IJ0 A;  4UCR A;  4B3M B;  1B06 A;  3UCS C;  3SJB C;  4UXN A;  4PD4 F;  2HJF C;  5CBH A;  2R72 A;  5EIB D;  2X6C A;  1XHZ A;  3S3W A;  1PM9 A;  2AZ2 A;  1GN3 A;  1JJ2 U;  4X9Q A;  1VQK V;  1M56 B;  3BCC H;  3ZN1 A;  1GKF A;  3K0D A;  1AJN A;  1TUB A;  3AG4 B;  3F5W C;  4J7J A;  3DXR B;  1TVK A;  5KHK A;  2ITD C;  3SJQ C;  1NVP D;  3L75 H;  2EIJ B;  4LFA O;  1IDS A;  2FKX A;  3ZHR A;  4H44 B;  3RYF B;  2DWD C;  2R70 A;  1M90 W;  4JI0 O;  4CH5 A;  3AG2 B;  2XOK G;  4DV6 B;  2H8P C;  5B5E Z;  3FAV A;  2ZT9 B;  1H38 A;  4GX0 A;  1BQ0 A;  3CPW U;  4B3S B;  3MHS C;  4O4H A;  3X2Q B;  4X1Y A;  1ZAU A;  2KG7 B;  4X20 A;  3ASN C;  3KZI Z;  4G27 B;  4DR2 B;  4OPA A;  5BZB A;  4J9Z B;  3CXC U;  2LW7 A;  2Q7G A;  1SQV H;  1TAE A;  5L3B A;  2KKW A;  2VS0 A;  1THZ A;  3CCS V;  1IX9 A;  5BXZ A;  1ZTE A;  5LL6 Y;  4X66 B;  5EIB C;  3BA8 A;  1X59 A;  1R1B A;  4CS3 A;  1UPG A;  1YJN V;  4R7C A;  1LUW A;  3LDD A;  4YY3 B;  4YIP A;  1M9N A;  4FZ0 A;  4GX2 A;  1F4N A;  4PJ0 Z;  3OTF A;  2DYR B;  4JV5 B;  4IT5 A;  1Q90 D;  3CME V;  1EN6 A;  3DXR A;  4TV9 A;  4U7N A;  2YC0 A;  3H1H H;  4JAV A;  4TOI A;  3RYF A;  5IDJ A;  5GON B;  3W7T A;  2EIN C;  5E1A C;  3FYE B;  3CEI A;  4FM2 A;  1FD9 A;  4TQD A;  2UUC O;  2ZE5 A;  4LF8 O;  4AI8 A;  4GX5 A;  3ETE A;  2UXB O;  4DR3 O;  4B3M O;  4QPJ A;  1VQ5 V;  1VIB A;  2KG7 A;  1XEQ A;  4O4L B;  3CX5 F;  2QM8 A;  1HR0 B;  4EB6 B;  3JD1 A;  3VOU A;  4UB8 Z;  4DUY B;  3JCZ A;  5JQG B;  1HNX B;  4WFH A;  4DV0 B;  2OCC C;  3HKD B;  2NLJ C;  1NI8 A;  4WFF A;  1A32 A;  4FFK A;  2QTO A;  4FLV A;  3JAS B;  3HKC B;  4FK5 C;  5CB4 B;  5E79 Z;  3ETQ A;  5DM6 V;  1JOY A;  1Q43 A;  2IJJ A;  4MTO A;  2M6Y A;  1P4R A;  5L3C A;  5EBW C;  4B3S O;  2YIA A;  1AR4 A;  5A2Q N;  2QDO A;  2WLN A;  4DR2 O;  4LH7 A;  3ZRS A;  2FML A;  2EIM B;  2P6J A;  3OW2 U;  2PF4 E;  4UCS A;  1IUR A;  4I5S A;  3UM7 A;  2DMX A;  3W7U A;  3K57 A;  4N23 A;  4UVB A;  5GON A;  1F51 A;  3FKS G;  1KD1 W;  4X66 O;  1KB9 F;  5EC1 C;  1RM1 B;  2F93 B;  4JTC B;  5KA6 A;  4LF4 B;  1P7B A;  4CH4 A;  3JD4 A;  4EKW A;  1RPO A;  4E4E A;  4YY3 O;  2XAQ A;  2MK3 A;  4O4L A;  1WP7 A;  5B1O A;  1N33 B;  2OYQ A;  1R6T A;  3R66 A;  4JV5 O;  4MW8 A;  2CDY A;  1JCH A;  4EB6 A;  1GM7 A;  1R3I C;  4JYB A;  2DQ0 A;  3EHB B;  2QR4 A;  3OMN B;  4QPK A;  1QLE C;  5D5P A;  1YTF B;  2JRI A;  2GDS A;  3G6B A;  3HKD A;  2QA4 V;  4F4L A;  2HLD G;  2Q7H A;  3JAS A;  3HKC A;  1WPX A;  5CB4 A;  4AHC A;  2HG5 C;  3ML0 A;  2DWE C;  2XND G;  4I50 B;  1KQS U;  1VF6 C;  1GM8 A;  3E8G A;  4O4I A;  4E2L A;  4BWA A;  1YHQ V;  2LGQ A;  1AR5 A;  5KHH A;  5BR8 O;  2OCH A;  3BPZ A;  3PJS K;  2JS5 A;  1BZK A;  3N2G B;  1HP8 A;  4LFC B;  1HR0 O;  2P90 A;  3M99 B;  5LGN A;  2ZE7 A;  3WB1 A;  4FM0 A;  1JFF B;  2ARH A;  3K0G A;  4PA3 A;  4N21 A;  1AJQ A;  1NTM H;  4DUY O;  1HNX O;  4DV0 O;  1Q6I A;  2F1M A;  4DR1 B;  2LO1 A;  2X6A A;  4HNA B;  2CAZ C;  1H2K A;  1HWY A;  4B3R B;  3CHX A;  3QO7 A;  1TGO A;  1GN2 A;  4WFB V;  4UV8 A;  2DYS B;  5CA3 A;  4HYO A;  2DOS A;  4NTY A;  4XDJ A;  3ABL C;  4B08 A;  1RSO B;  2JGD A;  5H6Q A;  3K5O A;  2UUA O;  1NU1 H;  1NZ6 A;  5B1B C;  1N34 O;  3AG1 B;  1H2L A;  1Y66 A;  2IU3 A;  4DV3 B;  2EIK C;  3RGB A;  4PI0 A;  1JJO A;  1PD3 A;  3E8B A;  4QJF B;  4GKK B;  3CS5 A;  3CCM V;  3CCR V;  3SR2 C;  5KMG B;  1PNM A;  4I50 A;  3SDL A;  4X64 B;  5L3G A;  1IZ3 A;  4LF4 O;  4CC6 A;  1N4C A;  4FLX A;  4QNH B;  4JTD B;  3N2G A;  4UFZ A;  4CS4 A;  1CP9 A;  3FFQ A;  1N33 O;  4BW5 A;  4K35 A;  3CCJ V;  2JDI G;  5IYZ B;  2CUG A;  2YI8 A;  3OTO B;  2DE0 X;  5L3E A;  1JVM A;  1EZJ A;  1JFF A;  3ABK C;  2A9H A;  1VQL V;  2QKS A;  3TXQ A;  4W4K A;  4DK0 A;  4DR6 B;  3RN4 A;  3EFF K;  4HNA A;  2Y69 C;  1I94 B;  5LHG A;  1BE3 H;  4ZHQ B;  1XOU A;  4XDK A;  3ZMV A;  1EZV H;  2XAJ A;  3L71 H;  1S76 D;  1PNL A;  4JI3 B;  3ZED A;  1K97 A;  2QWQ B;  3L70 H;  4I0X A;  5H9C A;  2A0L A;  2LGW A;  3OD4 A;  3HKE B;  5J9P C;  4LFC O;  1EM1 A;  1RSO A;  3BAB A;  3JAK B;  1ROP A;  2BCC H;  4QE7 A;  1I0H A;  1R73 A;  3L72 H;  4DV4 B;  4BR6 A;  1SF9 A;  3STL C;  1FKA O;  3QNE A;  3ZMS A;  5B3S C;  4DR1 O;  1PKX A;  4UB6 Z;  3IC9 A;  4GUN A;  4B3R O;  1XNQ O;  3AG3 C;  1KP2 A;  2IJI A;  2VQE B;  5DED A;  4PDL A;  5IYZ A;  2CK3 G;  1J95 A;  4LCU C;  4BAY A;  2UXN A;  3P30 A;  2OTJ V;  4GCZ A;  2QE7 G;  3H1J H;  3E8F A;  2ZD9 A;  3ZHV A;  4XBF A;  4DV3 O;  4FIP C;  5D5Q A;  4ZHQ A;  4KHP B;  3OE7 G;  1G1X B;  3H9V A;  2A3Q A;  3FX7 A;  4G28 B;  4X64 O;  1RPR A;  4NXN B;  3K58 A;  3ZMT A;  5H2F Z;  3K5N A;  3HKE A;  2OT5 A;  3SGI A;  5EZY A;  3JAL B;  4U3J B;  1EN5 A;  4PV1 B;  1Q7Y W;  2ZCE A;  3OTO O;  5IE9 A;  1M93 A;  3CCE V;  3TET A;  4JI4 B;  3ABT A;  3T4D A;  2WPD G;  4IYI A;  5JCO C;  2YIC A;  4DR6 O;  2LFS A;  4NB5 A;  4D7T A;  3A2F A;  1I94 O;  2QGN A;  4YJ3 B;  5CA1 B;  3G4S V;  3TK1 A;  4JI3 O;  4CZZ A;  3BEH A;  2RN9 A;  3OEH G;  4FLU A;  4UCU A;  3I56 V;  4H33 A;  2BSK B;  4LNU B;  1Z5W A;  4WFE A;  3ZIA G;  4Z1V A;  3QO8 A;  2F4V B;  4DRX B;  1XHX A;  5IY5 B;  5FPO A;  3IJ4 A;  3ZN0 A;  4DV4 O;  2WSS G;  1Z2G A;  2RJZ A;  2WLL B;  3E83 A;  2JS3 A;  3BFR A;  1K92 A;  1IBL O;  2EJ7 A;  1MZF A;  2YID A;  3H1L H;  3THO A;  3CRQ A;  2Q0A A;  4O2B A;  2A06 H;  4PEL A;  4MVM A;  5AG2 A;  3RWR D;  1K5Q A;  3SPH A;  3Q4H B;  1Q5O A;  2ZXW B;  2E3C A;  1WP8 A;  4U3J A;  3MAQ A;  5IT9 N;  3B4S A;  4L87 A;  1VQ9 V;  4BIU A;  2VQE O;  1O9H A;  3ZMZ A;  4KUM A;  4WBN B;  1XUQ A;  1VQP V;  3B8M A;  1NS1 A;  2V7Q G;  3OGI B;  1YF2 A;  2HVJ C;  2YIB A;  1K3E A;  2P22 C;  2VRZ A;  5FL7 G;  1K34 A;  3OUF A;  1HW7 A;  1AI4 A;  3ZRW B;  4ZI7 B;  4KHP O;  3CMA V;  5CA1 A;  3J80 N;  1OCC C;  4NXN O;  1XIL A;  2XTA A;  2BSK A;  4LNU A;  4AIL C;  2Q68 A;  2UXX A;  4DRX A;  2Z3Y A;  3CC2 V;  3CRR A;  4P9O A;  4UCT A;  3G67 A;  3ZRX A;  4TV8 A;  1QR9 A;  3WG7 C;  3ABM B;  4JI4 O;  4NTW A;  3G80 A;  2ILM A;  1SZX A;  2JJ1 G;  3L74 H;  3JAR B;  1M1K W;  3Q4H A;  1IXM A;  4DR3 B;  2UXC B;  4LC1 A;  1S3J A;  2GTS A;  3GB7 C;  1XI1 A;  4WBN A;  3MD0 A;  2ZR2 A;  3IFX A;  3TCU A;  3WG7 B;  1MA1 A;  1AJP A;  3T2M A;  1FXV A;  2F43 G;  1FJG O;  2F4V O;  2UXD B;  3OR6 C;  1KKC A;  3CC4 V;  4TV9 B;  2GTA A;  3ZRW A;  3VQX A;  1VQM V;  2IW5 A;  1IBM B;  2Z0A A;  4ZI7 A;  3SJA C;  1Q6U A;  4LFB B;  2E75 B;  3H1I H;  3AK3 A;  4MVS A;  5KAF Z;  5LHI A;  5K1X A;  1GO3 F;  2E74 B;  3BRC A;  2KB1 A;  3CD6 V;  1YSC A;  1K73 W;  4LF6 B;  1COW G;  4YXW G;  1QNM A;  3BY6 A;  4JI1 B;  1RFY A; 
#chains in the Genus database with same CATH homology
 3RT3 C;  3SDL A;  4OX9 O;  4YY3 O;  2ZM6 O;  1F7Y A;  4LF4 O;  1G1X B;  4JI1 O;  5IWA O;  4X64 O;  1N36 O;  1R6T A;  4KHP O;  3R66 A;  2E5L O;  4JV5 O;  4LF5 O;  2UUB O;  3J80 N;  1YZB A;  4OPH A;  1HNZ O;  4NXN O;  1N33 O;  3O65 A;  2JRI A;  4X65 O;  1DK1 A;  3OTO O;  2UUC O;  4LF8 O;  4JI5 O;  4DV1 O;  2UXB O;  4DR3 O;  4B3M O;  4GKJ O;  1XNR O;  4DR6 O;  1XMQ O;  4JI4 O;  4JI7 O;  1XEQ A;  4JYA O;  4DV6 O;  5LMU O;  4AQY O;  4DR7 O;  1I94 O;  1AIL A;  5BR8 O;  4K0K O;  2VQF O;  3F5T A;  2AGA A;  1N32 O;  4DV7 O;  4JI3 O;  4LFA O;  4DR4 O;  2FKX A;  1HR0 O;  4LFC O;  3J81 N;  1KUQ A;  3T1Y O;  4JI8 O;  3JAM N;  4JI0 O;  1IBK O;  4DUY O;  1A32 A;  4DUZ O;  1HNX O;  2UXC O;  4LF9 O;  4DV0 O;  1FKA O;  4JI6 O;  4DV4 O;  1FJG O;  2F4V O;  4X62 O;  5BY1 A;  4DR1 O;  3J7A U;  4B3S O;  1J5E O;  4OPA A;  1HNW O;  1IBL O;  5A2Q N;  2LW7 A;  2N74 A;  5LMN O;  1AB3 A;  1XMO O;  2Z0A A;  2UXD O;  4LF7 O;  4A5U B;  4GKK O;  4DR2 O;  1FYJ A;  2DOS A;  4DV2 O;  2DJV A;  4DR5 O;  4B3R O;  2ZKO A;  1XNQ O;  1IBM O;  2HHH O;  5BXZ A;  5LL6 Y;  4JI2 O;  5IT9 N;  1X59 A;  2UUA O;  2VQE O;  1R1B A;  4B3T O;  4LFB O;  4NXM O;  4YHH O;  4X66 O;  1N34 O;  4DV5 O;  5H5N A;  5FLX N;  1NS1 A;  2UU9 O;  1D2D A;  3T1H O;  3M8A A;  4LF6 O;  4DV3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...