3HB3B

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 73
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hb3B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3hb3B01
3UADA 4DPBX 5B1JA 2CCWA 1AANA 1PLBA 2IDTA 4GP4B 5I6PA 2P80D 2XX1A 3FQ2A 1PF3A 2IWKA 1AZRA 1YLBB 2BP8A 5PCYA 2UXTA 3QJRB 1HAWA 1FA4A 3EHBB 4BWUA 4MFHA 1V55B 2H3XC 1E67A 3CG8A 2RACA 1AZNA 5B1JC 1BQKA 1F56A 1ET8A 1FWXA 1JZGA 2FT8A 5B1KA 3D12B 1SDDB 4GY4A 4KO7A 1NIFA 4BXSV 4FA7B 3NJMA 3EH4B 1MG2C 3UABA 2VM3A 3QPKA 3X1EA 2I7SA 4PCYA 1KCBA 2IWFA 4HCFA 4YL4A 4DP2X 2FT7A 1QNIA 2ZONA 3N55A 1BYPA 3PCYA 1WAEA 2HXAA 2YAMA 1JXGA 1JZIA 4A68A 1QHQA 3WNJA 4E9QA 1SF5A 5EHFA 3WKPA 5A7EA 4W1TA 1CC3A 1ZDQA 2MTAA 4KO9A 1JOIA 2BP0B 1JZJA 2ZWNA 1QLEB 3FSZA 2QDWA 2R7EA 4PAZA 1XB8A 2WSDA 2HX8A 1AOZA 2MRYA 2H47C 4G7QB 4DP9X 1J9SA 2FQEA 4BDVA 2HZHA 3FPXA 2AZAA 2YQBA 2J57A 2VMJA 3KW7A 4M4RB 1JVOA 3AG4B 2P80A 1GSKA 2AANA 4A2DA 2UX7A 4HHGA 1RKRA 1AS7A 2CAKA 5F7AA 3NSCA 3CZUB 3ABLB 4TXVB 2BP8B 2X88A 5ANHA 3JTBA 4YSSA 1WA2X 2E86A 2FTAA 2XUWA 2AFNA 3NJHA 3EH3B 3QJSB 5PAZA 1XB3A 4Q89A 1A3ZA 2PP7A 3OMNB 4YVNA 3H4FA 2QPDB 3MX0B 1RCYA 1J5CA 3ZX1A 5B1BB 4HHWA 4DP0X 4NERA 5B7EA 1SHWA 2BWDA 4KNTA 3WI9A 3ASNB 2J55A 3S3CB 2XV2A 3FSWA 1J9TA 3S3BB 1OCRB 2XXFA 4HCGA 1L9PA 1SJMA 4DP8X 2W8CA 2R7EB 1GS8A 2AZUA 2PPCA 4YSEA 1L9SA 1OCCB 2OJ1A 3NJFA 1ASOA 4GXFA 4E9VA 4P5RA 1NIEA 1BAWA 4A2EA 3FU9A 4YSDA 2HLEB 3FYIB 4BDVB 1IC0A 3ABMB 1E5ZA 3L45A 4BXVA 4AKOA 4YSRA 2FQGA 2PPFA 1E30A 4F2EA 2JFCA 2VN3A 2ZXWB 3OQRA 2Q5BA 1W6LA 3PXLA 2EIMB 1AS6A 1OF0A 2XYBA 3HB3B 3ZBMA 1A4BA 2XLLA 3N2JA 2VM4A 1URIA 4WTQA 2X87A 1TU2A 2YEVB 2DYRB 1NPJA 1TEGA 4E9RA 2PCYA 1PNCA 1VLXA 2BWIA 3AG2B 1SFHA 1AR1B 1OV8A 2XV0A 3PAUA 1NZRA 2GIMA 1OE2A 5IY5B 6PAZA 4UF7C 1A4CA 1M9WA 5F7BA 3S8GB 2GB2A 2YAQA 3KW8A 2HRGA 2PPAA 5I5JA 4KOCA 1ILSA 1ZPUA 1MDAA 3FQYA 3UAAA 1L9TA 1W8EA 2BHFA 2H5UA 2Y69B 4E9SA 1NINA 3OMIB 4HZ1A 2IDQA 1PLCA 1A8ZA 4DP6X 1JVLA 1JXFA 3FSAA 1M56B 3CDZA 1BXUA 1PZAA 1GY1A 2B08A 2UXVA 2GHZA 1PCSA 2OV0A 1CYXA 3AZUA 3BVDB 3S3DB 3T6WA 2DY2A 1CUOA 4N4YB 1R1CA 3QJQB 3PPSA 4L0PB 1WS7A 5B1AB 3IN2A 1ID2A 3SQRA 2YAPA 4KNUA 1WA0X 2NRDA 7PAZA 4M3HA 3U25A 1PNDA 3UACA 4CSZA 1OE3A 3H56A 4DP5X 2VW6A 2BW4A 3AY2A 4DP7X 2XV3A 2HX7A 3PAVA 2FQDA 4KNSA 4G71B 4P5SA 4GYBA 1BYOA 2FQFA 2FNWA 1A65A 3NSDA 1HAUA 1L9QA 3JT2A 3CVCA 1OCOB 1ASPA 1JXDA 2IH8A 5E9NA 2DWTA 3TBBA 3FT0A 4JHVA 2BW5A 5D4JA 4F2FA 1I53A 5D4HA 3T9WA 3NP4A 4AKQA 2UXGA 1GS7A 1IKOP 2HX9A 1KBWA 4NB7A 3BQVA 2XX0A 1J5DA 4Q8BA 3NSYA 3TASA 3X1NA 3GXUB 4UANA 4DPCX 2EIJB 3ABKB 1AG6A 1KDJA 3CDZB 3NJJA 4FAAB 1NWOA 2FWLB 3G5WA 3NYKA 1IBYA 1ASQA 1T5KA 1OCZB 1J9QA 1ADWA 4HALA 2PLTA 1GYCA 4BK5C 2GC7C 3RYMA 3X1FA 4YSCA 3SBQA 1BQ5A 1N68A 2YAOA 4GP8B 4A2FA 3V9EA 4NAJA 8PAZA 4YSOA 4G72B 1E65A 2DYSB 7PCYA 4QLWA 2JKWA 3IN0A 2BZCA 2CUAA 1PZCA 2PCFA 2WO2B 2ZOOA 3EH5B 2Y1AA 2VW4A 1JERA 2PP8A 3TBCA 3FU7A 1M57B 3MBWB 2EILB 1AZUA 2WO3B 1X9UA 2B3IA 3GYRA 4DP4X 4EF3A 3WIAA 3PLYA 2FT6A 2JXMA 3NT0A 1W6WA 3DIVA 5D4IA 1NIBA 1ZV2A 3HEIB 1KYAA 4AI7A 4AKPA 3NP3A 5I28A 4X4KA 4WKXA 1AIZA 1ET5A 5I6MA 4E9WA 4YSTA 3IE9A 3OM3B 3QJUB 3WNIA 2UX6A 1NICA 2YAHA 2QDVA 4YSUA 5TK2A 5AZUA 3ERXA 4AX3A 3QJVB 1WS8A 3ABGA 1OOWA 3GDCA 2AVFA 1HFUA 1IBZA 3TU6A 3ZDWA 1MG3C 4JKNA 3FYEB 1XMEB 2QPEB 4N8UA 1UATA 3AG3B 1DYZA 5I6OA 2YXWA 3NJKA 4ZK8A 5B7FA 4A2GA 1ZIBA 5I26A 3OMAB 3UAEA 3X2QB 1L9RA 2OCCB 1BQRA 4AZUA 2BO0A 4A67A 3IBOA 6PCYA 1NDTA 2DV6A 5LDUA 2EIKB 1PAZA 2XVBA 2HRHA 4E9XA 4JHUA 3FU7B 1ETJA 3QJTB 3FS9A 1JZFA 1EZLA 1ZIAA 3C75A 2YAFA 2CJ3A 1WA1X 2TSBA 1JZHA 1XB6A 2XXGA 5I5IA 1NIAA 2PPDA 1GS6X 1BXVA 2EINB 2XWZA 4HAKA 3AW5A 5TK4A 1AQ8A 1KV7A 3PAZA 1PY0A 3S8FB 1AZBA 3FQ1A 1ILUA 3H4HA 3FSVA 1IUZA 1E5YA 2N0MA 1MZZA 2LLNA 2IDUA 3CVBA 1AG0A 1KDIA 1BXAA 1AZCA 1BEXA 5AKRA 4CSPA 2TSAA 4F7KA 2YARA 2GC4C 2I85A 3SBPA 4E9TA 3WG7B 4G7SB 1L9OA 1AACA 2VSMB 3V9CA 3X1GA 3NJIA 1NIDA 4ENZA 1NWPA 3T6XA 2A3TA 4HCIA 4BWTA 4KOBA 1GR7A 1KCWA 1RZPA 1PZBA 2J56A 3T6ZA 1X9RA 9PCYA 5I5MA 2VSKB 3NJLA 3OD3A 3SBRA 1KBVA 1ZDSA 1GY2A 1DZ0A 3T6VA 4E9YA 1GW0A 3X1BA 2IH9A 1EHKB 2VW7A 3FU8A 1V10A 1CYWA 3WKQA 2QT6A 4QKTA 2DWSA 1OE1A 1PLAA 3NSFA 1AS8A 3CVDA 4K9JA 5B3SB 3DKHA 1SNRA 3AG1B 4YSPA 2CBPA 1B3IA 3TA4D 4A66A 1TEFA 4DPAX 2W88A 1SDDA 4HIPA 1RZQA 2PP9A 4BWWA 3QQXA 3ASOB 1A4AA 5I6LA 5I6KA 2GBAA 2I7OA 4A2HA 5AFAA 1JZEA 4KO6A 1AAJA 4YVUA 2J5WA 3UGEA 1CURA 1SFDA 1PMYA 2Q9OA 2PPEA 2GI0A 3T71A 1N70A 2IDFA 4UAHA 3EF4A 2YXVA 4G7RB 1NTDA 3ZIYA 1KGYE 3NJGA 5FC9A 4W9ZA 2IAAC 2BP0A 4YSAA 5I6NA 4DP1X 2GSMB 1MZYA 4G70B 1NPNA 2UXFA 1V54B 2YAEA 5B7MA 1SHXA 2FJSA 4KO5A 2CALA 4RH4A 1TKWA 3NJNA 2XU9A 2BZ7A 1ET7A 3IEAA 3DTUB 2IDSA 1J9RA 1SF3A 4GP5B 1FFTB 4YSQA 3FPYA 2IWEA
chains in the Genus database with same CATH superfamily
2GTSA 1MCPL 5AWNL 3RE0A 2RH0A 5EC1A 1FAIH 2CGOA 4PD4F 2JGUA 1T7WA 3H0TA 4F58H 3MLRH 3QJOA 3C5ZC 1B0GB 3GJEB 4N6QA 5L9DH 2B2XL 2BSTB 3P4NB 2A9CA 2CA3A 3T4DA 5KAFZ 2ROXA 1LO5B 1I8MB 2WWNA 1HINL 4C47A 1JZGA 4ZOEA 4FA7B 4A38A 5ESAA 3CHOA 2LABA 2WJ7A 3VSUA 5IQ7H 5KVDE 1A7NL 4YDVA 1V3JA 2AS5M 1AR1D 5FYLH 2FX7H 3OPZH 3FOLA 4S2SB 2D4FA 3FUMA 1NCCH 5JXEA 4RFNB 3MCKB 2YAMA 1XF5A 3OB0H 2WB7A 4FM1A 2VAJA 2ZKYA 3WNJA 1C08A 1FNGB 3P0YH 5INCB 3C6SA 2F1EA 3QF7A 1CC3A 2PWEA 3EDEA 1E4WH 2GJPA 1E4KC 3VD3A 1UCBL 4APXA 4IS6B 5C0DB 1A6UL 3V6OA 3RTQC 4F8LA 2Q3AA 1UYWH 3NCEB 1SBSL 1CXIA 1MCDA 1Z5VA 4BFIB 1BD2B 1YY8B 1YEJH 4QXVA 3N85L 1AHMA 4NXSA 1R24A 5GSVA 3ZXAC 3F85A 3L9BA 3MA9L 1TO4A 1YNLL 5TE6H 2VE6A 3R8QA 3KW7A 1O9HA 2OJEA 3QFGA 4JY4A 1Q6UA 1EN4A 3AG4B 1S3RA 3UERA 5CA0B 4G5ZL 3KPNA 3UQ8A 4LEXH 3FFCE 2CDGB 5I1AA 1RQ5A 3Q3GB 1NL0L 1JPTL 5F6HI 1H5BB 2CR0A 5D70H 5B22A 5K9KA 1O7VA 2Y6TE 3K1KC 1PZUB 1LXMA 3THOA 3MRCB 3RDTD 3RUGB 4IDJH 4BE5A 2HCZX 3KZ8A 2PCPB 3K4ZA 4P2RB 4YQXL 1E4XI 2AFNA 2E75C 4RSVA 4WBNB 4EN3A 3CRMA 4Q89A 1A3ZA 3GGWB 1TMQA 3BEVB 4X7EC 3EIFA 4ONHA 3BEWA 2EIMC 2QPDB 2NN4A 1MVUA 4J4PD 4CNIB 4F20A 2WZ0A 1CD1A 2P5EB 1A5FL 3PWJB 4X99B 4YNYA 3PJNA 4ZUVB 3TV3L 4Z3HA 4JFOB 2WKGA 4DGIL 5FYKE 4JQVA 4NERA 3N1MC 4MJHA 4LRNH 3BT0A 3LNHA 4KNTA 1P5UC 3NCYP 1CXEA 4KHTH 1I85A 3AG2C 3IGAC 4LVHC 3RNKB 3C6LB 12E8L 5TE4L 2XIDA 1ZT4A 1FCCA 1B3QA 4P5MB 3AM8C 1QVFU 1F58L 3RVUD 43CAA 4I2XB 1EVUA 1YVLA 3GSQA 4I18A 1HCZA 5E7BA 1D6EB 3QZLA 1QAWA 5D7LB 5F71A 5D7SH 5AZ2H 4QAWA 3T5WA 5I0WA 4KX7A 1FZMB 1ITCA 1OAUH 4QYOA 2PYLA 4X5LA 3KS0H 4KMTL 3DX9B 1G0YR 1SQQH 5IWAO 1I1YA 2XCMC 3T3PB 2WXHA 4XVTH 5KYWB 1DJXA 1LDPH 3FYIB 4TYUA 1Z5WA 4LF5B 3NCYS 4RESB 3DC0A 4BFEA 2H4EA 4AZ8B 4F7TA 2HFTA 5BO0D 3A3YB 5FHAH 4OM1H 3AEIA 1NC2B 4AEIH 1YEGL 3PJLA 2ZDIA 3FT1A 3WIFB 5D96B 5K1XA 2ZQMA 3QGVA 4OM0L 4PJAF 5CP3H 5CD3A 1JS4A 2F7QA 2P1YA 5DGRA 3B5GA 4F2MB 4GI8A 3MR9A 4U0RC 1YDXA 1NMCC 2V3DA 1DF5A 3OR6C 3CFJA 1O6SB 4M6OH 3DUSB 3FF7A 5LCVH 2BWIA 3T2OA 4XNXH 5H2BA 1HNWB 3PJSA 3UAFA 4FG6C 1ETZB 1S9VA 4APQA 5LMUO 1L7IH 1UT1A 3LEYL 5A40E 2ATPA 2EE2A 4HSCX 3TBSB 5E8PB 4HS8H 3VFWA 1RP9A 3K8LA 2EECA 3N9GL 2VDOB 5DMKA 3X13B 4N0YH 4KY1L 1MRFH 4ANUA 4UCVA 3VRJA 1N3NA 4MVBD 4FNLH 4P3DB 4Z8FL 2DQ6A 4NWUL 3RX8A 2IU0A 3AWEA 4ODHH 1WEJH 4J3OF 4NKMB 3K6SA 1UZ8A 3QR2A 1TTCA 3QEQA 4B53A 1IBKB 3MUJA 1WUNT 2O26U 3QORD 3V0VA 4LZKA 5DU7A 1OW0A 2RN9A 4GCZA 1TSRA 4O9HH 1GY1A 4QCIA 3VMPA 3WFCH 1MI5B 3Q48A 2HFEC 3BZEB 3MRRB 3VMOA 4LF3B 3P3RA 1QFWM 3C60D 1JMZA 2WBWB 4NSKB 3NRPA 3H7BA 1I1AA 2DY2A 2G9KA 5EORL 4X9QA 1Y74A 2RCSL 4GRWB 3RB7A 1NUNB 4HD5A 1TVKB 1IAIL 2DMHA 2P24B 3I9AA 1WS7A 3D5OF 2IEPA 3MRNB 1UACH 3GB7B 3SQRA 1J12A 1SQVH 2G60H 2WYZA 3DJSA 4BE6A 1LILA 2X4UA 4B9JA 1YN7B 4QTIH 2VL5A 4NQEA 4Y9GA 4AL8H 3H56A 4YDZA 2YQ2A 1U97A 4MS6A 4OJAA 1HHKA 1QRNA 3VJ6B 4DZ8A 3G6DH 3NBNA 4YBQC 2J8UE 4XPFH 3V0DA 2UZYA 3P9LB 5LGHL 4ZG1A 4PJEF 1A14L 5E56A 3U7YH 1Y18B 1BYOA 5HHXL 4PVLA 2EILC 5JOPE 1R0AH 4JDZA 1IT9H 1N34B 4JFDE 4M7ZC 4X5QA 3N0PB 2AJ3B 5HDBE 2XQYG 4PR5A 4TNVF 5JH7B 1HVXA 4JE4B 1ACYH 2K6ZA 1ZSPA 3IAYA 3HR5B 4NUQA 3C3SA 2VL4A 1I53A 2GKIA 2XT1B 3F7QA 1K34A 1NQTA 3I6KB 3OLEA 3FUNA 3SD2A 3IGKA 1ZGLP 1AMXA 5FFOA 4AKQA 7CGTA 3G04B 5BR8O 4X4XA 3UMNA 1OB1B 1KIPB 3EFFK 3IGUA 3VFOA 2ZNJA 5D7KE 3IDYB 4QI3A 1W72L 3VE0A 4ISVB 2Y48A 4MSWC 4DAGH 3WJLA 3IDMB 5AVQB 4ZPTB 2NY4C 2WINA 1WPXA 1T5XA 3KXFA 4OV6F 1IBYA 1MFDL 1OCZB 3OT7A 3CFKA 1WFTA 5J9PB 2GC7C 4P46B 5SWQA 1GN3A 5JXAH 4BUGA 1M71A 3B09A 3WBDA 2R23A 2YRLA 4JY5L 2XRAL 2ZAGA 2R69H 3NFSL 4PRNA 3UTSB 4YHKH 3E9UA 2YBRA 1M7IB 4R8WL 2QTEA 2JI2A 3SPVA 4HUWA 1N64H 4RWHA 4K71C 3DJTA 3MXWH 3NAAH 1TETL 2VIRA 2CRMA 2PGGA 2PP8A 4JFED 4TM9A 1C5BH 1MQKL 4HT1H 2AXGB 2EO7A 3GJFA 3IK2A 2X3BA 3JV6B 1IBMB 2ZWSA 3QB7C 1ZLWH 1H15A 4KXZI 1U8NB 4OZIF 5EK0A 4WI9A 4YPJA 4ADJA 5G55A 3VGFA 1I3VA 2G3XA 1FBIL 3VFTA 2F1BA 1BMGA 2GJRA 3HEIB 5LXGL 4HIHA 1TIUA 3H7LA 4X4KA 2ZE8A 3CBJB 4RGND 1IGJB 1OTSC 3PWPA 1I9RL 4L9DA 2ZE0A 3BO8A 4N8CH 3FQXB 4DV6B 4JPWH 4QY8A 2ZYRA 1HI6B 5BZWB 5F7WC 2X12A 5ANMA 5FEBA 1JNJA 1ONQA 4HZLB 1JD7A 2VLLB 5HFLA 2Q6WB 2ADPA 1E9PA 1EGJH 2NQCA 4HP5A 2IJJA 3VXTB 3T4YA 3VB9A 2LOEA 2F5AL 2NDGA 1YXBA 5FO9B 2VLKB 4H8UA 3RY6A 2QPEB 2P42B 4L5FH 2R0ZL 1GXEA 3OZ9H 5DHXB 1HZHH 1SKVA 1JGEA 4N0UA 2K8QA 2H6PB 1MCFA 4OJCA 3PWVB 4Z23A 3C5JB 2P47B 2V5TA 3UH8A 1SHMA 4ORGA 3R8BB 3ARGB 4DFHA 2D8KA 5EBMA 3D9AH 3U0PB 4A67A 1OL0A 2A0LC 4G43A 3UEQA 1MFEL 4OPAA 3A8TA 1A7QH 3LZFH 2VOTA 3KEHA 5HI3D 2NY0D 4DEPC 1HIML 5I9QB 1HXYB 2XZCL 5E8OB 4F57L 4TUYA 2W0FC 3I56V 1WA1X 2I9TA 4MD5A 4JJ5B 3BWUF 3ZTDC 4OIBA 1YN6B 5I5IA 3EYOA 3QXDB 2YN5A 4L4TB 1LO2L 3TZVA 3ECBA 2LO1A 5DHVH 3IDGB 4N8VG 4MB1A 4NQCE 2Q7HA 3WN6A 3N50A 3QI9B 3O3AA 3WENA 4KKCC 4DR7B 1Z7JA 2AEPH 3M8OL 4XXDA 1MFBL 4YHMH 3BPNC 3N40F 3G4SV 4EUPG 1BWMA 35C8H 3ZQWA 5I73B 2BSSB 2UU9O 2UWEF 3RAJL 1HKLL 5KN5A 4UT6L 1EERB 5KBPA 3HR0A 2R4SH 5EZIH 4LF4O 4F24A 2CTPA 3GWKC 1BMZA 1KN4H 1NAMB 2YPVA 4HGMA 4J3OD 1ZKAA 2DZEA 2VDPL 1H8OA 1DP0A 2HG5A 1EVTC 2GJ6D 3WO4C 4NNXB 3EADA 2IW5A 1V7NL 2QVIA 1A22B 3LZLA 1ZLEA 4LAQH 1PZDA 3STZB 1G7MA 2E6JA 1MH5B 2AXWA 1NCIA 3VMNA 2VRZA 3HUJE 1BFOB 3F5WC 4PJIA 1EAPA 5C07E 5IB3B 3BPCA 4CN4A 1RZPA 2Q0AA 4KQ4L 1JGIA 1UURA 3IFPB 1IU1A 4AV5A 2ZG3A 3NJLA 5HGDA 1QUNA 4PDVA 5JTWA 2AVGA 4DKTA 3SJBC 1ZS2A 3KPRD 3T6VA 25C8H 2A9NH 2CCVA 3LRLA 4K23L 2VZSA 3LIZL 1RUML 1OWWA 3WMQA 4HMDA 3IJHB 2E76B 3CZSA 4P3WA 2ZCLH 4DR4B 3QCVH 1JAEA 1B0GA 1OY3B 1B4JL 1ZLZA 3ARFC 4JO3L 2H94A 1NSNH 2OBGA 1BBDH 3GJEA 1JV5B 2BSTA 3L71H 3P4NA 2VDKH 3V5DB 1LO5A 1NDGB 1I8MA 2BCCH 4QR7A 5KUKA 2F4VO 3BCDA 4FA8A 5T5FA 2E7CA 2YXLA 3DMMD 5IUSA 2ZYIA 4JAMB 3MMEB 8CGTA 4BWWA 1RSFA 1K6QL 4X0NA 4E2OA 1GA2A 3ML8A 3LPWA 4EPSA 4H37A 1DVXA 4PV8B 2YA1A 1KBHA 4KV5F 3ES6B 3S0PA 2NSQA 3FUHA 4M9OA 2YICA 1XF1A 4Q4IA 3MCKA 5GJSH 4XN5A 1A4KA 3BSZH 5INCA 3T0WA 5KVFL 3IU4L 4PJDB 2ADFL 1KN2H 3DETC 2MNWA 4NN7B 3TLRA 3TVMD 4IS6A 5C0DA 1EEYB 2OKMA 2DQJL 3CX5K 2ICWI 1Q81W 3UJJH 1I8AA 2GDSA 2ESVD 2FJSA 3AU1B 4IRJB 5J1AB 1GGUA 3NZ8A 4H20H 4BFIA 1BD2A 1GGBL 3WIIL 2OP4L 4WVRA 4UQDA 3FH7A 2VQFO 3GQFA 4TT3G 3NCCB 3FTVA 3DXAE 2YLHA 1TNNA 3FQNB 4X0KB 1E6OH 2OXHB 3ARQA 2J25A 2DQTL 2MCPL 5JHMA 1NFDF 5CA0A 5BRZB 4PI2A 2PZSA 3AITA 5G4OA 2CDGA 1QCEA 4NXNO 3LKNB 3Q3GA 1VKXB 1L9NA 4MAYD 1H5BA 2YD3A 4M43L 4F1SA 3ZE1E 4X4ME 3CRAA 1A21A 1H6FA 3RUGA 5IWLC 3MRCA 1I9IL 2YQGA 2PCPA 4P2RA 3I9GL 4J8RB 3TT1L 4WBNA 2CO7B 2DEYX 3RWIB 1DQTA 3IVKB 3GGWA 5JHAA 5C0AD 2W9EH 3BEVA 1MNGA 3ZKND 5BW7A 3ULVC 4HXBH 2PUSA 2VM3A 3PWJA 2P5EA 3QPKA 4X99A 4ZUVA 3RY4A 2KKQA 4JFOA 2OTWB 4ICGA 4NXMB 1MNUH 5DZJA 4P2OD 4U2YA 2R72A 2AJYL 5CGMA 4XOCA 2NXYB 4Q6IC 5KS9B 3OGIB 2Q7EA 2FHBA 2ZF9A 3QUHA 4JFHE 4UI2A 1L0NH 3RNKA 2JTYA 3LAFA 4PRPB 3C6LA 3OB8A 4M1DL 4P5MA 4FQLH 1G7QB 4UDUB 1OPGH 3WO3B 4O00A 4I89A 4I2XA 3GXFA 3GSXB 4P23D 1JZJA 4J7JA 5D2LB 5HJ3B 1D6EA 2EDOA 5D7LA 2R4RL 3FOMB 1UA3A 3D4YA 5I8KH 2Y2YA 2WM0A 4OLWH 4PRBB 1FZMA 3KLKA 1RIUL 3EO1B 1L3NA 3I02B 3DX9A 2K9FB 3Q05A 4LIQH 4AQOA 5KYWA 2FKXA 2FQEA 5HHNB 3CXHK 2C9QA 4MJIB 5D1QB 2KDYA 3SJQC 4TVUA 4AZ8A 4M4RB 2ENQA 3CVIH 2WW8A 4MNHB 1W91A 3ESPA 4EUPH 1MFAH 4FQ2L 5D5QA 1UB6B 4H1LB 5DDHA 4X8AA 2QGCA 2EUWA 1UC6A 4JS7A 4UV7H 3AXLB 2X88A 1KYOK 3W11D 5H37A 3UBXI 3L75H 4F2MA 5LJYH 3L54A 4PH8A 5DR5H 1N36B 3V0WH 1O6SA 3OUSA 1AQKL 1XB3A 2ITDB 1JI2A 3DUSA 3U2SA 4UQBA 4EXPX 4Z0XB 2YIBD 1ETZA 2CHXA 5JQIB 5F7NC 3TBSA 5ITFA 1SRYA 5E8PA 2H3KA 1ZEAL 1NMAL 4QHUA 3WCYA 3X13A 1HN1A 3G6JE 2EH7L 3TTSA 4JI7B 3IDXH 5DN6G 2YK1H 1XNQB 1TO5A 3D2UB 2DWXA 1CXLA 3GNMH 4P3DA 4YH6A 5TDPB 3VG9C 1CBVL 5FGRA 2DN7A 2WLNA 2ZPKH 1JCHA 5DLMH 4NKMA 3T0VA 2NUPB 4KC3B 1RPKA 4JTDB 1XL4A 2B77A 2XZZA 4X6DB 3DO3A 4Z3FA 4TOIA 1J87A 5C1MB 2F08A 4AITA 3R66A 1MI5A 1RZ8A 3BZEA 1BAWA 5JNYB 1OPOA 5C0CB 4H0HB 4LARH 1GW6A 2DKUA 3NH7H 1R17A 4NSKA 3M6DA 3HBQA 2VWEE 4KJPC 5CIPH 4RQEA 3KPQB 5D1ZC 1HHIB 3AB0C 1URLA 2PPFA 4G59C 1TVKA 2PYED 1RL1A 2P24A 1HE8A 2XPYA 3MRNA 5MI0C 3GB7A 5CZVH 2BTOA 4GKKB 2EXWD 5LL6Y 4JO8A 3MRDA 3UG3A 1QPXA 2IO5A 1MRDL 3LKQB 1TJMA 2P52A 4YS4A 3HB3B 2XZAL 3MUHL 4FMTA 1VPOL 2XLLA 5L2JB 5IFJB 3O8XD 3N2JA 2VM4A 4YXHH 5DRWB 1A7PL 1URIA 3IAQA 5DWUH 5E2UH 3UZEA 5JJJB 1UA6H 3QQ9C 1M93A 1D5ZB 4FXKC 4HZAA 4N1CA 4N3TA 3VJ6A 1KWGA 2LVCA 3MLVH 3VB8A 1JVKA 5B1AC 4KJWD 2WLJA 3P9LA 5HHVL 4FHBD 4AE0A 2OR8A 4YX2L 1Y18A 1KGUA 2WA3A 5CSBA 1OE2A 4LO9A 4TL5A 5J12C 4GQ9H 2AJ3A 2X4RA 4MDIA 5A2KH 4NUPA 5JH7A 4C83B 2BNRD 2WPGA 4JQIL 4MDRA 4KOCA 4JI4B 3HR5A 5F1KC 4BFOA 1E4XL 3BWSA 3B2DC 3CLFH 5FUOH 5DC4B 3T2NL 5CJXA 3I6KA 2ZNXA 4MCZB 1XQ8A 5C08B 2P06A 5DJXB 4JJHA 3G04A 4WHYG 3E22B 4K7PL 3AWGA 1OB1A 1Y07A 4LPYA 3T0ED 3VFGL 5FYLL 4C8XA 4L8SA 4K8RD 3P9WB 3OPZL 3NEOA 2IBZX 5D1XA 1OCOC 4PB0H 5D93B 4Q20A 3IDMA 5EOCL 4ZPTA 4L8DB 3HAEB 4FJZA 5A43C 3ZZSA 4PJGF 3QUKB 3FTYA 1MKFA 4J11A 3RIKA 3QEQE 4X9BA 4P46A 3BPOC 1TUEB 1PCSA 5FGCB 4RETB 4OCSL 5DMIH 4LNRB 3LPFA 1E4WL 1DBAH 5KVGH 1B9KA 1EPFA 2XTJB 5TH2B 5TF1L 1M7IA 4UUJB 3OSKA 3C6EA 4JZGA 2XICA 2XV6B 4R7LA 2BY0A 3QZMA 4B0MM 1YEJL 3MTRA 3NQKA 1CXHA 1DJZA 1QI5A 1UWGH 3CTTA 3QIUC 2BVUA 1LP9F 3O6FD 2AXGA 4IYIA 1QQCA 4XXCC 3OZLA 4V1DB 3FMGL 1CF8H 3KM1A 2VW6A 1VQNV 1U8NA 1C1EH 1T7YA 1WJ3A 4QKXB 4WI2A 4DV0O 4DP7X 3M46A 1B04A 2NY2C 2A79B 4LEXL 3OHXB 1SN5A 2ZSWB 3B9VA 3K81A 3KL5A 1IGJA 2QKIA 2CO2A 4FLXA 3O6KL 1ASPA 3FQXA 4IOFD 3DRQB 2IMMA 4IDJL 5B4MC 3UO3A 1PJWA 2G5RA 2GVYA 4PJCE 3WFZA 5BZWA 5JJNB 5D4HA 2ZP9A 2FB4H 3B34A 3DVIA 4HZLA 2VLLA 1DJHA 3RHWK 5FYJD 4Z9KB 5I0XA 3VXTA 5F2VO 5BZBA 1IJ9A 5L2KD 3PFUA 4O02L 3L08A 5FO9A 5FGBC 1AG6A 5BS0B 4JZJC 4LCUC 5T3ZH 4OLVH 1MHHB 4GUPB 2ORBH 2H6PA 3PWVA 3RWEB 3SKMB 2V6HA 3WTYA 3KXFE 3ARGA 3L81A 4YSOA 2J1YA 5GS0C 3VUAA 1QEXA 5IJ9B 2HKHL 1AI4A 2KC0A 3FN3A 4N2KA 4YEEA 1OAUL 5J2TA 3PQYD 5GGVY 3ESVF 3FULA 5F7EH 4G6ML 2ATKC 1XD0A 1JL8A 3MJ8B 1T83A 4WFEE 5JQHC 4J1UA 2APTA 1HXYA 5E8OA 2WO3B 1FXKB 3GM0A 4AILC 1Q0EA 3P69A 2HKOA 1JCKA 2MSPA 1YN6A 3S3SA 4MNQD 5FHAL 2Z91B 3QXDA 5E6IB 3BFRA 5I1HH 1QSED 3PWLB 2OT5A 3IDGA 1CGUA 1G9MH 2LFSA 5E4EC 5HI4C 1AVAA 1QPPA 3MRMB 3QI9A 4JYAO 2MQCA 3DHMA 4LSTL 1VFBB 2IPKB 1MCSA 1GO3F 2WUCL 5EIBC 4LSRL 1USZA 4XBGB 2Q20A 1RUQH 5CFHA 2UX6A 3VDAA 1SXNA 4X83A 4M6OL 5FB8A 4L0YA 4XNXL 3LVTA 1NAMA 5TK2A 4Z1MG 3KPLA 4XMPL 2FH6A 4LVNC 4P48A 4OZHB 1OOAA 1HTYA 4NJAH 5DFTA 2RFXB 1H8LA 4UINL 2AVFA 5ANME 4NNXA 1DFXA 3Q5TA 2CXKA 1P7QB 3WHXB 4JK0D 2W92A 3QDGE 2RTTA 1MRFL 1OALA 2QV2A 3STZA 4G83A 1MG1A 4NS0A 3RRQA 3FAVB 1BFOA 1LQBC 1NEZA 1RFDL 4NM4L 4JFFE 4GLXA 1P4BH 3A67H 1ACCA 1HNGA 2NTSP 1PVHA 3IFPA 2EE0A 3IAGC 3FB7C 3WG7C 3JWNG 3L4TA 4ES8A 2ED9A 4ODHL 4HIXL 4WEBH 3RZWA 5ISZD 3QHZH 3GKWH 1IFRA 4PW4A 4AZUA 3L4UA 3QRFM 1U3HC 1H2NA 3RBZA 3S3WA 4HW6A 2X0LA 3E3QC 4L3CB 4OB5H 4RQQA 2VS0A 3A0OA 4ZTOH 2K4WA 5FF6B 3IJHA 5J06A 2J1XA 2VDLL 2IBBA 5IFHL 5LDSA 1EZLA 1NCWH 1FHGA 3H2WA 3BD3A 2FJFB 1P7GA 1F41A 2C3XA 2H0EA 4IRZA 4QTFA 4WHYH 1JV5A 5DEGB 3V5DA 1RPOA 5IBLC 3SKNB 3H3PH 4GAGH 4ZX6A 2XWZA 4XBEL 2W0LA 4U7NA 3DUUB 5ESQB 4TLUA 1UJ3B 1XCXA 3MMEA 3QUYB 4JAMA 3S8FB 3HKCB 5JWPA 1P6WA 4TL4A 1ZLVH 3U6XA 3MRBA 2E8ZA 1I1FB 3L2MA 4QTIL 5D2NC 3EO9H 4NC2B 4K73A 3EYQD 4PV8A 4K2UH 3ES6A 3QUXD 3VQWA 3BAEL 2ENYA 2I07B 3NRQA 5JMOC 5HHME 2OMZB 3FXIC 3GLDA 4IKJA 4PWJA 4XPTH 5K1JA 3L4YA 5A2AA 3ULVL 1DUZB 3QG7L 1MNNA 4IGBB 1S76D 1MCHA 2YRBA 1SJXA 4PJDA 3LD8C 3U7YL 5JPMB 4NM8L 4XR8C 5F89B 2X7LB 3B8MA 3ASWA 4TNWF 1R0AL 2KB1A 3D48R 2ISDA 1T0MB 2XHBA 4A63A 1EEYA 2OAAA 2WOYA 4B5EA 4KUMA 5DTFA 3AU1A 4IRJA 1D5RA 4H4NA 3C8DA 5J1AA 3UO2A 5IIEB 4B7EA 1Z9SA 1BZ7B 1MMMA 2D4DA 1YC8A 4M61B 3BRDA 2WZ5A 3OD3A 3FQNA 4MZRA 4X0KA 5C3TA 2OXHA 3LJ3A 4AGQA 2CIIB 1Q82W 3LZNA 4ETYA 1V54C 3B2MA 1YSCA 2AGJH 2TAAA 4HJSA 1R1BA 5BRZA 4DV1B 3BVNB 5J2UB 5F7FA 4JJOA 3WKQA 4G9DB 3HE7C 3ELAT 3LKNA 1VKXA 3IDJB 5IHBA 3OPUA 2UY7B 1GOHA 3EFFA 3IRCA 3BZ4A 2D7TL 2NOYA 1U8IB 2E9IA 4IW4C 2ZXBA 4YDJB 3O3DB 4J8RA 1W72B 4O2AB 1LMKA 2CO7A 4YHKL 5DHYB 3QISA 3RWIA 3N2GA 3IVKA 3CFDB 2J8UF 3GSUB 1DQMH 3QH3B 3QWQB 4R6ZA 4OIIH 3TURA 2W88A 1U93B 3NAAL 1RZQA 1N7ML 1VZHA 4UYQA 4LPVA 1D2PA 1YUKB 3VGGA 2KT6A 4HT1L 4XN9A 4YWGL 3EDFA 2OTWA 3LUTB 1DN2A 1ZHLB 3EHBC 1CURA 3D69A 1ODAA 1HJBC 3VXSA 1CFSB 5AG9A 4WHCA 4A04A 4HJ0D 1BIIB 1X5KA 2E7LC 5IZ7A 4J7ZA 4UDUA 3T1HO 3GSXA 5TJWK 5HJ3A 5D2LA 4KHPB 1GN2A 2UXFA 4IYKA 4PRBA 3NZHH 1IB5A 3QCUH 4JPWL 1RLBA 4AOFA 3EO1A 1IEBA 3E7JA 3I02A 2CALA 4YHOH 2HJDA 2IC2A 5A3ID 3SDDB 4JF3A 4AVKA 1YNTB 2IPUG 1GMEA 5HHNA 4XHJC 1YF2A 4MJIA 4OLEA 4KFZC 5CLYA 2V8MA 5EZYB 3SJAC 2ZYHA 4M4RA 4PRDB 1TG8A 2WAQA 3FT3B 3SGJA 1PG7H 4MNHA 3TYFA 1QW9A 2AITA 3VQ2C 1AKPA 1CICB 4KZCA 4PGBB 1UB6A 4H1LA 4FL4B 1MSPA 3NACH 3O2DH 4JEGB 4N5EC 1S6NA 5EIVA 1AZRA 3AXLA 4R4NC 4YFEA 3ARWA 3QEGL 4JFQB 5IJDC 4KKLC 2RQ6A 1TJHL 4MAZA 4JI3O 1NBYB 1NTZH 5DFWH 2ITDA 1Q9LB 3M1OA 4P4RB 3CCVV 4GBXB 4Z0XA 1TYRA 3RUGE 3G5ZB 3L1GA 1NIFA 3R19A 4J3WA 3JARB 3UABA 4ECNA 3K71B 2VR3A 1SXZA 2F1MA 5JW4N 5DK2B 1FFQA 3TFKC 4JFUA 3JWNH 2FT7A 2XTAA 4WFFA 1BVNP 1FIGH 1S78D 1XXDC 3D2UA 1NUGA 4NB5A 4HAGA 5TDPA 4E9QA 3JYBA 2DH2A 4NTXA 1BVZA 2A73B 3WS6A 1K8DB 2AEPL 2ARJQ 2NUPA 4FP8L 1HH6B 3RYIB 5IQNA 1SUHA 4OZ4A 1MFCH 5AVWB 1QTYT 3QZOA 2XC8A 2XI9A 2D0GA 3BFWA 4MMXC 4YLCA 3K2IA 7TAAA 4I2XE 1IFGA 3CCMV 2R4SL 5HDWA 4KAQH 5D7LE 4YHPB 1KN4L 3W9EA 4DP9X 5JNYA 3GRWH 5C0CA 3C5ZB 4Z95H 3PNWB 3GF8A 3THMH 3QZBA 1XZ0B 4F91B 2AZAA 3KPQA 1HHIA 2CUIA 4HFWB 4JM2C 3T3PE 1NCBL 4B9PA 1UB5B 5C0RL 5T1LB 1OCCC 4K3EH 1AS7A 4X6CB 3TP4A 3CDGA 5GONB 3B9KD 2MOVA 3LKQA 5A2BA 3O4OC 2HJLB 3P2BA 4I1PA 4ZUTB 3FT2B 5L2JA 5IFJA 5IQMA 4GFXA 2VDPB 5DRWA 1N32O 2B7DT 4B3SB 1EIBA 3UGXA 1D5ZA 1TVDA 4G28B 2FTAA 25C8L 2A9NL 2EYSB 3B1UA 3EAKA 3ZOAA 4KRLB 1INDH 1ORQC 2VXQH 3PL6D 4F2ME 4LOUC 4XWGL 1VGKB 3RA7H 1CL7I 1J1OL 1PFOA 4PRIB 1DL7L 1P69B 2ZCLL 1NBZB 2APBA 3FRPG 5F21B 2KQNA 2WWOA 4U1IB 5SV4A 3RTQB 4LSUL 4C83A 4KQ3H 5I5RA 5ID0B 1SETA 5LXVA 5B7EA 4HISA 5IBUB 5C08A 4UWQB 1Q72L 5CA1B 5DJXA 3E22A 2P8MB 3BOVA 3QIWD 3S3CB 1WDAA 2YGQA 3U9PH 4TQEL 4LMQE 2R7EB 4OCMC 4XC1H 4L8DA 3HAEA 4WHTB 2VDNH 3VNYA 1BOYA 5DS1A 3QUKA 5MENB 3HUJF 1PD1A 3K0WA 3OKLB 3BSZL 4RDQG 3QZWG 4XP4H 3FX7A 3OB0K 5CU5A 4LNRA 1VF7A 3G5XB 1ZJBA 1ZGLB 3SKUD 5TH2A 4YSRA 5B39G 3IE4A 3UMTA 2JKIS 2E75B 6TAAA 1P2CA 4UUJA 2R51A 1NLDL 2JFCA 4AUJA 5CLTA 3W1ZA 3SCMC 2X0UA 5GTHZ 2NR6C 4FYQA 4OFPA 2EIMB 3DHPA 4GRWE 5GS0L 3MOAL 1CU4H 1U6AH 3FTXA 2F1AA 5BUGA 4V1DA 3E38A 5AAWA 1J5IA 4WTQA 1LD9A 2YEVB 2WQSA 2AJUH 1P5UB 2PTUA 3IC9A 4XCYB 2R56L 2UXBO 1NH2D 4DIXA 4FMKA 3AG2B 3IGAB 4LVHB 4AQYB 3OHXA 2ZSWA 2K3TA 4JI6B 5JOPD 1OGTB 1T6VN 4JFDD 2AQ1A 2FYUH 1M9WA 2A4ZA 5GRVK 3DRQA 4JKPL 1NKOA 3F5TA 4ZT1A 1KCUL 2PKDA 5LNDA 1W0YT 4WGWB 4WTZA 2H8PA 3AY4A 1GKEA 2W9EL 3DX2A 1NINA 4KKZA 1MW2A 3LN9A 2V5MA 1OLZA 4HZ1A 2JKSA 3KR3L 1L1FA 3QO5A 4PVMA 1DVFD 2G2PA 1MNUL 5GISH 5BS0A 4Z3EA 1U95B 1E5UI 4L37B 2JI3A 2EKJA 2H0JA 4PTTB 3WFBL 1BJ1J 4R0LC 1MHHA 4GUPA 3VD5A 4HCRH 3RWEA 2IBZH 1RZKC 2A6DB 3HZ3A 2PTTB 3BVDB 4JPVL 4JN1H 2W95A 4XAWL 3SKMA 1OPGL 2W81C 4BSVB 4U0RB 4JMXA 1NMCB 3JUZA 4NQQA 1K8AW 5IJ9A 1KBKA 3OR6B 5I8KL 4F8NA 1UM4H 4LSSH 1EX0A 3QCTH 2BVQB 3ULUD 3IN2A 2AKRB 3MJ8A 2YAPA 2Y3AA 3SO3C 1IVLA 3UTSE 3SR2C 2VXUH 7PAZA 1RSOB 3UO1L 1L7TH 1FXKA 1KELH 3QFJB 1FL5B 5IVZB 3TWCH 4BZYA 4S1DD 5AD0B 2ZQKA 2YSUB 1MF2L 2AQPA 1DZBA 2BS71 2Z91A 3OMZA 4LSVH 5E6IA 4JO4L 4FKHA 1SZNA 2PTVA 1YJDC 4M93C 3TEXA 3GIZL 2FQDA 4K35A 2YIAA 3DOIA 3KCPA 3MRMA 2C9XA 1AY1L 4P59H 4LKXB 4UV7L 1VFBA 2IPKA 3WNLA 5FR3A 2YA2A 2R0LL 4Z7VB 4Z18A 4XBGA 4HG4K 5L3DA 4KZ0A 3FT0A 1IC4H 3MQIA 2WUBH 3RWCB 3MLSL 1U42A 2HFEB 3C87A 5EB9A 2G4GA 4NGHL 5IEHA 1U3ZA 3SBWA 3RBSA 2RFXA 4CBZA 1XGYH 4KK9D 4LQFH 5F93C 5TQ0H 1R75A 4EIZC 5C3LD 1NGPL 1P7QA 3WHXA 1AQDB 5IW6B 1XX9C 1AO7B 1KDJA 3CFUA 3OBAA 1XF3B 3QNZB 4OD3H 3MLXH 5T5NG 2Y2TA 4PWIA 3V6FB 3FAVA 3IDXL 2P4KA 3ECVA 2VLKE 3GNML 4MVOA 1Q3EA 1GRWA 3A22A 4X80L 3SOTA 4X50A 2G2NA 4K9EH 5DLML 1DFBL 3HMXA 4QLWA 5KZCB 3UTTE 2VUKA 3MCLH 3CIQA 3GXPA 2HT3D 5CGYC 4L3CA 5FF6A 4C7UA 4U1LB 3SE4A 1JPSL 3WXVH 1H6EA 1YYML 4HC1L 2EILB 1ZTXL 5TD4A 4M7ZB 2FJFA 4ICXA 3NH7L 4QRSA 5DEGA 1JRHH 3SKNA 3DURA 2G9HA 3QHTC 2EIKC 3UPCA 4NQCD 3DUUA 4IMKC 5CZVL 5ESQA 1J1PH 3QUYA 3HKCA 1FVDB 5LG6A 4MS8C 1UJTA 1CTNA 4L4TE 4U3XA 5D9SB 3VFRA 1T5EA 1JPST 5I6MA 3NABH 1QR1B 3HC2A 4NP9A 2HHHO 1T0NB 3L1OL 4MSWB 1BPLB 1OZTG 4BR6A 2I07A 1NICA 1CE1H 1UA6L 2OMZA 1F6LL 2UZXB 4GKSB 2NY4B 2Y4SA 4CC4C 2X6VA 2QDVA 5FX3A 1IGMH 1DUZA 5J0BA 1XWVA 4IGBA 2F19L 4IJ3C 5JPMA 3NJVA 3QXAB 4KUZL 1WS8A 2X7LA 2OIGA 4ZW5A 1T0MA 4GQ9L 4WWPA 2FECI 1NLBH 1KTDB 4N8UA 5C07D 2P5WE 3OW2U 1SDAB 2LU7A 4K71B 2G75B 4Z7WE 3US0A 5L4MA 4M1CC 1BZ7A 1TTBA 1FG2B 4M61A 3DYMA 4AYSA 1ZIBA 4XNBA 4TMPA 5FAAA 5ITBH 3UAEA 4GQQA 2CIIA 4XMLH 3O2VL 1WIPA 4WUUA 4XVUC 1RZ7L 2QQNH 3HG5A 3PGCB 4JO1H 4DH2A 6PCYA 3SPIA 5JPNC 1J11A 2Z3FA 5LDUA 4AGLA 3MNZB 5J2UA 1KKDA 1CF1A 4AC4A 3GMMB 3IDJA 3R06B 3ZU8A 3BQUD 3OKMB 2UY7A 4K07A 3FS9A 2QGDA 2X5PA 1D5AA 3V79C 3FH5A 3I6LD 1U8IA 4L4JA 3TWYA 5KVGL 4YDJA 1W72A 4O2AA 1RIHH 1ZHNB 3MJ9H 2JXMB 5DHYA 4WFHE 3FD9A 3SGEH 3CFDA 4UTCA 3S88H 5GTIZ 3GSUA 3QH3A 4UQ9A 1C16B 2VMCA 3V0JA 4K3DH 1U93A 4PCTA 5JJEB 5DUJA 4BQBA 2EVHA 1CGSH 2GT9B 1EA9C 4MAUL 2YD6A 3NA9L 3K3WA 3BLKA 3V6ZB 4RBPH 1ZHLA 1CWVA 2QADD 5CS7A 3NCBB 1HWWA 2YKLH 4G80A 2JQMA 1C1EL 2XWBB 1ZLWK 1SERA 4J41A 4F7KA 3QP3A 1UD8A 2YI8A 1BIIA 1EXGA 3A4EA 1FO0L 2FEEI 5FPOA 3PY9A 3BABA 1QZ1A 1TGOA 2Q5ZA 3CPLB 3F65A 3MJWA 4PGCB 4PJDE 4DR5O 2JGDA 3BLPX 4MZIA 5BJTB 3MU3A 4EQ3A 2OMYB 1NGXB 2P9RA 3GMOB 3GXDA 2F61A 4KOBA 2C1PB 1KCWA 3SDDA 2JKRM 4NENB 2VB5A 4FFVD 1CXZB 4DEPB 4WFAV 1YNTA 5GS1C 5LGJB 3DXAD 4NDMA 2WLLB 4X20B 2VSKB 3ETEA 1QMUA 2W0FB 2ZICA 4XO5A 2W6JG 1XH1A 4OZFG 4PRDA 3FT3A 1GM8A 1C8PA 1GW0A 2W60B 2WK2A 1CICA 4M48L 3U46B 3IKCA 1QBLH 1CYWA 1RK1B 4NLAA 2CR6A 1KXQA 2K9UA 4X5WB 3VXRB 1CZ8L 2BY3A 1VQPV 1JPFB 4L4VB 3HC4H 5BRZE 2O5XH 5ICZB 1BJ1H 3BPNB 4JFQA 2JKXA 3VYNA 2KH2B 5HHQB 4H2CA 4WI0B 1NBYA 3MLWL 2WOBA 3DKHA 3S34H 4DO5A 1Q9LA 5GGUB 4O02B 4P4RA 4KKBC 4GBXA 5F7EL 5C9KA 5F88B 2UXCO 4AQ8A 3G5ZA 3ZHDA 3LS5H 3FB8C 3NCJL 3IJEB 5DT1H 4AQ1C 4I87A 3K71A 5D5MB 2XA8H 3ARBC 2BSBA 3WO4B 1G5AA 1QBBA 4J6RL 3E80A 2XAGA 5DK2A 2MFNA 4MQXD 1KACB 43C9B 3OHMB 4JFHD 5CUSL 5I1HL 3AT8A 1RERA 4IHBA 4U6TA 2QTSA 2IDFA 3F5WB 1G9ML 3Q8FA 4X4YA 1AXIB 2A73A 3MROB 5IJ0B 1K8DA 5KS9E 1HH6A 2GSMB 3RYIA 2CHWA 2G5BA 2VZ1A 3DK0A 1HL4A 2CPUA 4PRPE 3L5XH 4ALAH 3U4EA 3FHQA 1G5GA 3N5AA 5AW0B 2EICA 4MA1C 4BBWA 5D2LE 2YD8A 4YHPA 1MY7A 1WT5C 1TVBB 3CC5B 3AK1A 3C5ZA 3PNWA 4LF7B 2FL5B 1XMQB 3ARFB 4WDIB 1XZ0A 5DJ2B 3UO8B 2LT9A 3T1YB 4HFWA 2OYPA 4YDKH 2D0HA 3RT3C 5IHWA 1UB5A 1WISA 5GGRY 5T1LA 4GIAA 4MJIE 5D1QE 4CC6A 3PP3H 2APFA 1XGRB 4NQTA 5GONA 1NGYA 4LBEA 4UT6A 4X6CA 4DTGH 4NO5B 1UD6A 1P4BL 1BZDA 2HJLA 1SJVA 5BUPA 1CDCA 3FT2A 4CGTA 2RMKB 2H6OA 2BHZA 3OZKA 5SWZE 3QHZL 4UQIM 4X1KB 1QYGH 1H3UA 1G0XA 3BLBA 3H9HA 2GEQA 5F7KC 1AZNA 4HPYL 5E8EB 1XL6A 4OB5L 4XMUA 1YQVL 5E5LA 1LM8V 2F74B 2VERA 5D8JL 4AEHH 4IT5A 4PRIA 3NJMA 4Z0BL 1U9KA 3ZL4H 2VQFB 2O5NA 1I7UA 1E4KA 3D39E 4XC3H 3VAEA 5IHUL 3RTQA 4M6MH 2ZUXA 5ID0A 5GRXG 1TQVA 2GY5A 1DK1A 2OULB 4GAGL 3VG0L 2JIXB 4FLQA 2R9AA 2B9AA 3LIZA 5CILH 5CA1A 2P8MA 1I31A 4KUCD 3P9MB 5A7EA 3MHHC 1WFUA 1TJGL 2VDLB 4FX5A 1JE6A 1G9NC 3EO9L 3P54A 1SOQA 2R7EA 5A2LH 4HUVA 4GKJB 3N6YA 1IGFH 4FFKA 2W0XA 4WHTA 4K94C 3VFPB 1QKZL 4CN6A 5MENA 3TXQA 1AB3A 2HWZH 2MRYA 4HWEH 1TKWB 3OKLA 4Q9RL 2PO6C 1SEBB 5EU6B 2AJXH 3EBGA 4X6DE 1ZGLA 4TTDD 4ZPVB 4QIRA 5C0CE 4K9EC 1FNAA 1GSKA 5AYUH 3BDYH 1RZKL 3O0LA 4Q56A 3PGFH 3QNXA 4G9FE 1YMME 4HYTB 2X4SB 4UILL 4HIIB 4U6VL 4YMPA 3TO4C 4LLWB 5IT2L 1GKOA 5ANHA 1BQUA 4OV5A 4HULB 3IGLA 3DWTA 4FFZH 3FU6A 4K4KA 2XFGB 2YEVA 4MVUA 1WA2X 2HT2D 3DGGB 4K3GA 5GJTH 2AJZA 4Q6IB 4OCLC 4XCYA 3TIEB 4TQFA 4UZGA 5G4MA 2L04A 3RNQB 1GKFA 1OGTA 2DIEA 4I50A 3AM8A 3TV8A 3LKPB 4AV0A 1BF8A 2X6MA 3TN0C 3QDJB 4APQD 1S3KL 2AAVA 3SKOB 2AI0L 5EF2A 4UVBA 1YJDL 4DUZB 1AHWC 1MQ8A 4OSUH 4EB6B 4ANVA 5HGHB 2BWDA 3V4VH 4OZFH 2YA0A 4HGWB 3FCSB 3ARPA 5F1NB 3KH4A 3CN1A 3VFVB 1NCHA 3ZN6A 4U7OA 4QPKA 5KHKA 5IY5C 1WICA 3S3BB 4Q9QH 1PQZB 5C08E 1MJUH 5DJYB 4PJFB 1CD9B 5ELIA 1JFQL 1U95A 4L37A 3FUDA 4H8VA 3CQFA 4PTTA 3QEQD 1QA9B 2Y69C 1KZQA 1RJYB 3BH4A 4JZNB 2A6DA 4M1GL 2PTTA 4GLRH 3CSYB 5MHSD 3HG1B 1MREH 2Z1PA 1DSWA 2GIXA 5LGTA 2ZYSA 4O4YL 3WEOA 4BSVA 5HD8D 4PJIF 3B2VH 4JFPA 1WVZA 3LHPH 5FGCE 1ERNA 3NZHL 1DSFL 2EBOA 2VN3A 2AP2A 2BVQA 2QJ1A 1I1AD 2JH2A 3HLAB 2AKRA 1LWRA 3OQRA 1EAQA 1K85A 2XTJE 3PXLA 1RSOA 2XYBA 2AQQA 3BRFA 5IVZA 5AD0A 1EN5A 4H8QA 3ZKMD 1YEKH 4A2LA 2VLJE 1O7SA 5DMGC 1N0JA 4F37F 3MLZH 1GPOH 2BJMH 3DVNB 4NQED 1Y66A 1WZLA 2PCYA 1X59A 1TOXA 3RGVA 1KY7A 5HI3C 5J8OA 3VG9B 1AI1L 1QRND 2H0PA 3CNKA 4AYFB 3IGFA 4LKXA 3TBYB 3BKMH 3FQRA 1J0YA 3DDFA 2Q8BH 1GM9A 4UF7C 3G7TA 3TESA 5ADOL 4Z7VA 2YAQA 4KBPA 3IXTB 4LP8A 3CLEH 4PMEA 1ZPUA 4YUEH 2EDNA 1OSYA 3MLUH 1W59A 4UTBL 3RWCA 4B9CA 5IDJA 4A7GA 4JVPA 1OHHG 3OJVC 1CL7L 4K5LA 4M8RA 5KANG 3NTCH 4MTMA 1WD8A 2ZXAA 5DD3H 5D1ZB 4ATWA 4BELD 3AB0B 3GHEH 1A3LH 1AQDA 5CMAB 2Q87A 5IW6A 5KSUB 4JG0L 1AO7A 3S5ZA 4I3RL 1XF3A 1BXUA 5MI0B 2PCFB 5E9DE 1MJ7H 2RBLA 3OJDB 4F8QA 2JS3A 2AGAA 1KTBA 2V4LA 3KXFD 4PP1D 3JWDH 4NC1E 2DH3A 4XNYH 1JG9A 2PW2B 3K6IA 3J80N 1XF4B 4FXKB 5JOFB 1IFHL 2F54E 2VKWA 4PSPA 1P84J 4NO3B 4C55A 4GSRA 4WFED 5B1AB 2OMNA 4U1LA 2NNUA 1WA0X 1XSOA 1JGVH 3W7TA 2APVA 3MBEC 4KAQL 1BQZA 2Q2EB 3GUFA 2YWZA 5J12B 3FFQA 2WNKA 3U25A 4UV4L 2BW4A 1AR5A 4JM4H 4AWJC 1Q94B 1GMGA 1WFOA 3AQZA 4PREB 1W0JG 4IIZA 1VHPA 5JR1L 2XN9E 4TRPH 3WD5H 1FGVH 2YMXH 3RUGF 4U3CA 3RPIB 3RFRA 4YHZH 2OMUA 1FVDA 3L3DB 3L2LA 5HI5D 3WLWC 2PF6A 5D9SA 1SMAA 1NM4A 3FBKA 5AW1B 1YITV 5EOTB 3JT2A 1T0NA 2LFEA 4MSWA 1OCOB 2IH8A 4JHZA 2UZXA 4PJHB 2N04A 3HZVB 2NDFA 4GKSA 3PWPD 5E4IA 2A99A 1INDL 1IURA 2ICWB 1IGCH 2AEQH 3BPOB 3U1PA 2A9DA 2V4DA 3QXAA 4DUYO 5F1OB 4URKA 5BOZG 2NQDA 2OCJA 2PABA 2BC4B 1K3EA 3X1NA 3BCCH 4I0CC 1KTDA 1HNYA 1DTOA 4OZHE 1I82A 1BA9A 2FEDC 3NJJA 4XXWC 2Q7AA 4JFFD 1WRFA 5CA3A 2OYLA 2G75A 4ALAC 1FNSH 4O4JB 3QNEA 1ORSB 1V7MH 2VJXA 3GK8L 3FTWA 4G8GB 1FG2A 4U3HA 3ZQXA 4BK5C 3VFSA 2EABA 5I0DA 4XX5A 3NVQA 3QIUB 1SPDA 2PI5A 5AB9A 1N68A 1QD0A 1E65A 1GJWA 4XDJA 4FLZA 5JVDB 1P4LB 4K3HA 4W6XB 3PGCA 3T3PF 1ZTEA 3DPDA 1D6VH 3FFDB 3MNZA 4JQIA 3AG3C 2VDNL 2NY2B 4JGJA 4YHNB 3BMWA 3GT6A 3A5VA 3GMMA 3R06A 4QRPB 4XOBA 3OKMA 3S3JA 1F2QA 3L3GB 4DK6A 2ZOWA 1WZ1L 1YEFH 4JDEB 1GK9A 1OGAE 1WGVA 3PHAA 2PWDA 4EFEA 1ZHNA 2JXMA 2VDQL 2FHCA 3NT0A 4QRRB 1HWYA 1BZOA 4L1TA 4RAUB 1YYLH 1C16A 1KCVH 1Q90A 2UYLB 4AXWB 4F33A 4NBYB 3ORJA 3TZVD 2GT9A 5DZ9A 4DV5B 3Q8AA 5CINL 3SGDI 4E0RB 1PTZA 5DRXB 2NR5A 3FU0A 3QNYA 4C54A 1RZIB 2H2PC 2YAHA 4LU5L 4KJQC 1KC5H 3SIKA 4JZJB 4DKEH 4RGOH 2BNQB 1RP8A 2AJUL 4LCUB 2EINC 4JDTH 2GUYA 5K39A 3GS7A 3W56A 5KJRL 5I19L 3RDTC 1JYXA 3QJVB 1X5MA 2V8LA 3ABGA 2W0PA 4MB4A 3BKCH 4W9KC 4AW4A 1OOWA 2AXJA 4WCYL 3ZDWA 2LR4A 4ZSOB 3CPLA 3BUIA 2DWEC 1AYRA 1K33A 2A0LA 4HMCA 4PGCA 5IBTH 3L72H 5BJTA 2HG0A 2OMYA 2ATKB 3GMOA 2KKWA 3HFMH 4UIMB 2C1PA 1T0PB 1IC5H 3QDMB 4NENA 5LGJA 1BGYH 2WLLA 4X20A 1CPUA 4J3OH 5FM8A 1OK8A 3MVSA 4Q6KA 2F8IA 4B3EA 3M7FB 5A6LA 2AJSH 3BISA 2NZIA 2Q1EA 1B88A 1RURH 5GISL 2W60A 2VT0A 5J6GB 1F4NA 1D5BB 4F15C 1JZ5A 4X5WA 5E4EB 3VXRA 4M8UA 3U6RA 2R2EB 4L4VA 1W16A 5ICZA 1L0QA 2C9SA 3LV3B 3MJGX 2WP3O 2DBJA 2AABL 5EV7A 4WI0A 1BVKB 4NRZA 4XGZA 2NX5B 4YIQA 1ADQH 2A7BA 5GGUA 1GS6X 2HLFD 1MJ8L 4LDLB 4O02A 4OLZL 4HAKA 5DYFA 2Y24A 2OMTB 5F88A 4X4ZA 2HKFH 4DZBB 3IJEA 4LVNB 4Y1SA 3LRMA 4QOKE 5D5MA 1O6TA 1ESOA 1BXXA 1CS6A 3FSVA 1UJWB 3GI8L 2YMOA 3S37X 5J4MA 1TZGH 3F7YC 1I7ZB 1RK7A 4TSBH 1RI8A 3LMJH 5JXEC 3HN8A 4Y8DC 3EJTA 3EFDH 1F4AA 4FFYH 3WG7B 1T4KA 3FB7B 1X7TA 5H8DA 5IJ0A 2ZNWA 3S36H 3VI3E 3P4MB 5GRWA 1BW8A 2OMBA 4WO4C 4MJ6B 1MCJA 1AACA 3X1GA 4PY7B 4N8VB 5DUML 5LB1A 1KLGA 3V6OC 1U3HB 1J5EO 4XMKH 4YXKL 4BWTA 4AI8A 5AQ0A 1SQPH 4QIWF 4EUPB 1TVBA 3CC5A 1G9NL 2QJDA 3VXQB 4FM0A 2FL5A 1L4IA 3ARFA 4HUKB 4QF1A 4WDIA 3I2CH 5DJ2A 1UQSB 1XGYL 4LQFL 4XP9L 2BHUA 1SXCA 2JELH 2FECL 4DN4L 5G5DB 1A1MB 2IJIA 2W07A 3IMTA 3MLXL 4D8OA 1XGRA 2MOGA 4LLYB 2B4CC 1VACB 4NO5A 1INQB 1RUKL 3DC6A 3WAJA 5IOKA 3GSNH 2JV6A 3ARDA 5D2NB 4MXQC 1NKRA 1DBMH 3GZQA 3P2DA 1I7RB 1R46A 3UTPD 1RY7B 1KXQE 3HNVL 4K9EL 5I15L 5KAQF 4DUWA 5CJ8A 4X1KA 1E6JH 2CKBH 2EDDA 4ZMVA 3HA0A 2P4VA 5E8EA 4POYA 3L1EA 4F9LA 4P2RD 5HSFA 4FTVB 2F74A 5IOPA 3QE5A 3LD8B 3WXVL 4XBFA 4B9FA 2AXFB 4G7YH 4S1RL 5JIDA 3GRBA 3K6NA 3U9WA 3WY3A 1RJLB 1UKTA 4KO6A 1XH0A 4R26L 5HVWA 4N25A 1SFDA 4TV8B 1AJPA 2Y1VA 2Y72A 3CPWU 1DEEB 1AP5A 4W9JC 1CO1A 1I85C 2JLPA 3P9MA 4CVWA 5FO8B 2I5YL 1ED3A 3C6LD 3SPGA 3NABL 5DQ9B 3NMEA 1ZLVK 1A9BB 5LGYA 3ARRA 2XJLA 1V54B 2F8XC 5TQ2H 1DQLH 3LS4H 5CIPB 5D7LD 4OBSA 1WN7A 5A7BA 1Z3RA 5CEXB 1VIBA 1KCSH 3HE7B 1TKWA 4PB9H 1FNFA 1SEBA 5EU6A 5ACMA 4JDVB 1BGXH 1TJIH 3LN5B 4NFBA 2A9AA 2EDFA 4QJ5B 2FD6H 5JDJA 5IWLA 2X38A 3ETSA 4ZPVA 4NTYA 4X9IA 3JWDC 1NLBL 3VFMB 3T3MB 3H1ZA 4M4PA 3L48A 2L7QA 2YRPA 1AANA 2O4EA 1NC2D 3STLA 1O75A 1MCLA 2X4SA 5I1KH 3V5HB 2EJRA 4U6YB 2F9BT 4LLWA 5E8DH 3C2AH 5C0BB 3A0BZ 1MCWW 3HS0C 1PP9H 4X6CE 1WBXB 5IE9A 3DGGA 3EHBB 2E9WA 3I6GB 3MKGA 1J5HA 4JO1L 1GMIA 3ROOB 1S77D 4Q6IA 3WXWL 1ETA1 3RNQA 1FWXA 2IANE 4FM2A 5AOJA 2VQUA 3LKPA 3IJ4A 2ZAIA 5LBSH 3PUCA 4PCYA 3QDJA 1U3JA 3F58H 3LKSA 3SKOA 4HD9A 2FHFA 2XIIA 4EB6A 2ZONA 5HGHA 5C6TH 4GG6B 2B5IC 2ZSVB 3MJ9L 3RBGA 4HGWA 2VZVA 3K5OA 3FCSA 5F1NA 4K3DL 4P2QB 3L6FA 1CGSL 3CH1B 3LH9A 4XP6H 4DGUA 1S7XB 1YPZB 2R9HD 2YUWA 3DX6B 4KJYB 5DJYA 4M7LT 1JYWA 4PJFA 1C7SA 1UKQA 4PWFA 4LKCA 2D7NA 5F97E 2KL6A 5ILTH 2CJSA 4YK4C 3ZRXA 1F2XK 2FATL 4AK2A 1XT5A 1RJYA 1CI3M 3JWOH 3RN4A 1NVPB 3VA6A 1A1OB 3CSYA 4RWYH 1BMFG 3HG1A 3BXNA 3H6AA 5B3NA 5MENE 2C4FU 1FE8L 4TULH 4NAMA 5HGAB 1JVOA 4PS4H 4B7LA 2E6PA 3HLAA 1F18A 4HU8A 1JGLL 3L9YA 3H2PA 1TITA 3P77B 4R7DB 2VRAA 4QPJA 3NIGE 2BP8B 5KJ4A 3JTBA 4DCQA 3D8MA 1OJHA 1FO0B 1M9NA 3DVNA 1PNLA 5PAZA 1E5CA 1THZA 3EJRA 4G3YH 1WZAA 1QBLL 3AQDA 4YVNA 4AYFA 5BVPL 2NNAB 3TBYA 4M62L 3HC4L 1RVFL 3P30L 2FGWL 3IXTA 1ZXKA 4MMXB 5A9GA 2X9XA 4YBHA 4KHXL 1FVCB 3LIUA 2A74C 2R2HB 2EAEA 4KI5C 4B9YA 3L3JB 2Y5EA 1QBMH 3WKYA 3LS5L 4H25A 2IQAB 4ZUSB 4PPTA 2XA8L 4A55A 3U0ZA 3GO1H 5D1ZA 1Y4MA 5CMAA 4JM2B 3GPEA 3KPSB 1DE4B 1WWAX 5KSUA 3KPPB 2XVLA 4PJDF 1OCCB 2OMVB 2OZNA 5D7IE 1H2KA 2YPLB 4LP4A 4NQXB 3ZDZB 5JLZB 3OJDA 4ABUA 2ZKHL 4AVIA 4ZMZA 5SWSB 2JSFA 1CB4A 2WQAA 3O4OB 1Q6HA 1KBBA 3FU9A 2BS9A 4ZTPL 2IQ9L 4BDVB 2PW2A 1IC0A 4P46D 2J6EL 4QGTA 1XF4A 5TFSH 4FXKA 5JOFA 4Z7QE 5JZ7C 5FUZH 4JKMA 3L5XL 2C9UA 4K8RH 4ALAL 1Q1JL 3U0WH 2N05A 4NO3A 4YC2C 1ORQB 4GIOA 4LOFA 3UTSD 5F0JB 3VQLA 1XBLA 5IYCO 5DHVA 1A7RL 4YPGA 3D8CA 5I1LA 2X1WL 3GMPB 4XCEB 1AHKA 4AG4L 3OSVA 3WB1A 1TQBC 1ZWIC 3CCSV 1Q94A 5BO1L 3CXCU 2EJ1A 4PREA 2RR3A 1KP3A 3QFJE 5H6QA 4P2YA 5JW5B 3I55V 3RPIA 1OV8A 3L3DA 4AEEA 4D0CB 3BAYA 3S8GB 1TPXC 1QLFB 2GB2A 5KOVC 5I71C 1K4CC 2Y5QA 1B0RB 2Z9TA 3CZKA 3HZVA 3MKKA 4MLSA 1I3RB 1MZFA 4PJHA 4PLOB 4QWWC 4RZCB 2HJFC 5I8EA 2ARHA 3PXHA 5CO1A 4D9QE 1ZV5A 3ZKXC 2ICWA 4X7FC 4DV3O 4MVZA 5T8IA 4DVRH 3D85D 1O5DT 1B9ZA 4C4KO 3GZKA 2BC4A 2DQUH 4GUOA 1N0LB 2Y1ZA 4FF9A 2AK1H 2ZUYA 4OVUA 2WSPA 4MMZC 1F23A 3SCMB 2KLSA 2VLKD 3VTTA 3MDSA 1IAIM 5D2LF 4O4JA 4GRLD 4G8GA 2XQYA 1AO7E 3QIUA 3P3NA 4ELKB 3BKYH 4XXCA 5FYJH 3CCQV 5C0EB 1P4LA 5JVDA 3BT2H 1DJWA 5B38G 4HXAL 3VD7A 4B3MO 2XAJA 5KSAA 4AH2B 3ARGD 2Z7YA 4FA6A 2YFNA 4YHNA 1QFWH 1G7JB 5BUAA 4ZS7H 1SMOA 3IRZA 4QRPA 3VRLF 4HWEL 3L3GA 4UQEA 2NZ1A 4DR3B 3ZHUA 1U8JB 4LCWB 4M3HA 2MMXA 2AJXL 4MX7B 4P57A 2N4IA 5AUMA 4PYHA 1BREA 4DQOH 3N1PC 3U83A 4JDEA 4LH6A 5F7DB 2VCOA 4DP5X 1QZNA 2Z8SA 4OQTH 2QQQA 2GHWB 4FZ8H 4PIRF 4AYEC 4QRRA 4KRPC 4RAUA 5AYUL 1CGXA 3BDYL 4G71B 4L4TD 4AXWA 3IJ9A 3UIZA 2BVOB 2YIDA 1U4FA 2FQFA 4HK0B 5DRXA 1BJ8A 3BSZA 4R9HA 2Q7YB 4OPHA 1TQSA 2WP3T 3QI9D 3IETB 5FGBA 5JQGB 5DYOB 2DM2A 1RZIA 3VSQA 4JZJA 4IBWA 5LO7A 4R0LB 2A9BA 3VYPA 1Y1UA 4PTUB 2EDJA 4MBOA 2L8AA 4NZRH 1BZ9B 3GTNA 3EJZC 3K04A 4Y1AB 2C1OB 1WPBA 7FABH 3TASA 1KB5L 3V2AR 4GKZA 5LBGA 5EC2C 2J12B 1WP7A 4ODSL 5JA9A 4OSUL 4L9LC 2FWLB 2Q10A 1VFUA 2ATKA 1ASQA 1T5KA 4UIMA 1G4RA 2IPUK 3PS6A 3QDMA 2X9WA 3SO3B 2E9JA 3QAZC 5K59E 2B5UA 2IH1A 1J0KA 5CNHA 4JKKA 4P2OC 2DQ0A 1HEHC 1HL9A 3SBQA 1ACXA 2Y25A 2ICES 5DO2C 1UM5H 4TVPE 3MNVA 4XNAA 4BGLA 1T22B 4G6KL 5K9JL 1MUJB 1FL6B 4JV5B 4E42B 5J6GA 4PDMA 4M93B 1D5BA 2WD0A 4RFOL 4I9QA 4LBAA 4UVAA 3K5MA 2Y1AA 3WNNA 4M6NH 1OTUD 4FQ1L 4HHAA 3RWJB 3LV3A 2Y1YA 1EK3A 1WP6A 4IMLB 2YJLA 1GTFA 2NX5A 4WFHD 4J2XA 3BVVA 2B4CL 3HHSB 1IGIL 4Y16C 4LVEA 3WLBA 1AKJB 2OMTA 2QVFB 3FUKA 4DZBA 3LOWA 1OXYA 1JGDB 4K0KB 3DUHA 1FYTB 1Q0YL 3SEPA 1CDHA 4JREC 1YEKL 4JB9H 5JIKA 3FU3A 3QJUB 1I7ZA 1FZKB 1MIEH 4FDWA 5E2VH 2EZ0D 4ZNCD 1JNLL 3EJSA 5L6YH 1BG1A 4BQCA 4DK5A 3FB7A 2PW1B 3B9AA 3DJZA 4NPJA 3P4MA 3MV8B 2Q8BL 1FGNH 3TU6A 2CO6B 3UZVB 1BFSA 3UROR 3CFQA 4MJ6A 3MUGB 4PY7A 4N8VA 1U3HA 1KGCE 5BY1A 5L3EA 1J7VR 1NCOA 1OANA 4I0PC 5F1IB 2GUZB 1VQ8V 4IRJD 4EUPA 3JAKA 4O2BB 4PGDB 3VXQA 3QK0A 1RHFA 3CRRA 1L9RA 4UTAH 3NTCL 1FSKC 3VOUA 5GS2D 4H40A 1EJOL 2LJ2A 5G5DA 1KPRB 4LPTA 1GYAA 2EIKB 4N2IA 4PU2A 1IQWL 4LLYA 2Z0AA 4BV1A 4Z7AA 2UZIH 3BN9C 2HRHA 2OK0L 2A4CA 4BWAA 1INQA 1IKNA 3QJTB 4R7XA 1JIBA 5BRZD 4ZNEE 5D2NA 5I76B 4U1HB 3PIQB 1Y67A 3JWDL 1I7RA 4GYCB 4NHUA 4KRNA 3VXRE 4CS3A 3L5HA 2ZCKH 4QRTB 2MPAH 4M8QB 4L4VE 2WNXA 3PV7A 2RALA 4ZW7A 2DKMA 4IJ3B 4FTVA 1QVGU 4RO2A 3ZYOA 3QBTB 3PP4H 1AZBA 1YY9D 3B4SA 2AXFA 3FQ1A 5KYYB 1ZLUH 1PCXA 4LSPH 4LL9A 1VCAA 1RJLA 1BM7A 3MI6A 2WO4A 3CVBA 1KDIA 4JM4L 3WFEH 4TV8A 2X70A 4WJ5B 5D5ME 5DZOA 1BXAA 1AP2B 4JMNA 1Q9OB 5DVLA 2QSVA 4IQHA 4M9PA 3WD5L 1DEEA 3T4AC 3MRKA 4OVVA 5H35B 2NXYD 4NIYE 2YARA 1G1YA 2DKSA 2DYPB 3CHQA 4KX8A 4YHZL 5FO8A 5KVDH 4Q6GA 3BZ5A 4PRPD 1PX3A 4HC1A 2VQTA 5DQ9A 1A9BA 1CVRA 4HAFA 5JPNB 1K2DA 5CIPA 5D6DC 3TCTA 3OXRB 3MRLB 4TUUA 2DM4A 1REIA 2A3TA 4JZ2A 5I82A 5CEXA 5CJQL 1A2YB 2R29H 3F01A 1IGCL 2AEQL 4N2OA 4JDVA 3LVEA 1NAKH 2WXNA 2VDRL 1KXVA 4R5XA 4AV4A 1X4TA 1YEDB 3BP5B 3K80A 1XBRA 2QA4V 3VFMA 2Y7NA 4MJID 5JIPA 5D1QD 4GXVH 5KBLA 1U8PB 1PS3A 1V10A 5BV7C 5F7YC 4D7BA 3IJ8A 2BOCA 4IKKA 4PDLA 1R6TA 1FNSL 5I1CL 3MOBH 1XMWA 3V5HA 3BUBA 3EYFA 4U6YA 5JUEL 5IFAH 3LH2H 5SWZD 1QHPA 4U6XB 4J39A 3TF7C 1OKEA 1ZGLM 4LF5O 5DUPH 5EO0A 3BYTA 4HMEA 3I6GA 2D3LA 4DR5B 3ROOA 3WDJA 3KEDA 4AE1A 1JK9B 1MDTA 2OFQA 1CFQA 3QC5X 2E7LA 4MJJA 5L4JA 3D39D 3NJXA 3O41A 5I6LA 2GBVA 4ONGH 3ZGIA 4Z7OB 3FO1B 4XVJH 1AGFB 3ZKSD 1YEFL 3SKJH 5E6UB 1EO7A 4GG6A 5AW5B 4BAYA 2ZSVA 2GI0A 4N87A 1TFPA 1SY6L 4XO9A 3LNDA 1HNWO 1KCVL 3F6LA 4MD0A 5IB1B 1E90A 2G0KA 1NTDA 2EDLA 2VDNB 1WZMA 2WCPA 1D9KB 3D2UD 3CH1A 3IAPA 4WFFD 4ZS6D 5DHMC 2QEXV 1S7XA 2NQ3A 3EYSH 1YPZA 4DP1X 3DX6A 4KJYA 4ESKA 1JDAA 5FYKH 1CDJA 1GAXA 2JS5A 1KC5L 5FYJU 1M1KW 4QRQB 2VO8A 4RBPK 3WNOA 1ZSDB 2VDQB 3CVHL 2DQCH 1K9TA 5M94B 2G4EA 3EYUL 5I1IL 1BQLH 1FORL 4NNPH 5CJOH 1SF3A 2JJ1G 5HHPB 4BCXA 3UAJC 2V9UA 4O51B 1I8LC 3BKCL 4PGJA 5C0CD 5EU6E 1IM9B 5HGAA 1R3KC 2VR8A 4DJMA 5M95B 2BH0A 5K1VA 2QQKH 1IBKO 2ZWYA 3VDBA 4JRYB 3QQ4B 3C5SB 4G9FD 1YMMD 2XJKA 1EEQA 5JIIA 4AQ1B 3UTQB 1S46A 4MW3A 2XX1A 3FQ2A 3P77A 5T1DL 1HH9B 3O9WC 5KBDA 1UH2A 3ARBB 2BP8A 1DBJH 2NLJC 3ULVE 1FO0A 3HB3D 3RIFK 1G7IB 3UZEC 2KQXA 4HUUB 1RURL 3D05A 5K69A 1FDLH 2H1PL 1VF6C 2CIKB 4YFLI 5C70A 5BVJB 3E1ZA 5FOBB 2NNAA 2CGRH 1WFNA 1FD9A 4LEOB 3L1FA 2L7JA 1UGNA 4D9LL 2P8LB 1G6RL 3U9UB 3VGHA 1S72V 5DK0B 3VQVA 1A6ZA 3WY4A 1AIFB 4PN6A 4U0QB 4MMXA 2ZG1A 4MA1B 3VTAA 1UXSB 1FVCA 2H32H 2R2HA 3GBML 4D0DB 4YIPA 1BFVL 1HZKA 2HKFL 5DVNA 1XAUA 5LNGA 2IQAA 4ZUSA 5HGBB 5KBKA 5C08D 3U4AA 4POZD 1N34O 3DOSB 3J07A 4JM2A 4OCWH 1TLMA 1DE4A 3KPSA 4XNMA 4L1HA 3KPPA 1TZGL 2OZ4L 4L8SC 4IRSC 4TSBL 4L8BB 2OMVA 1L6ZA 3CDYA 5D1XC 3W0WE 1XGPA 2YPLA 3FFOA 4NQXA 4AYMC 5JLZA 3GUTB 1CT8B 3OKOA 3ASNC 5SWSA 3I50L 4FFYL 3SDXB 2YPKB 3UIYA 4C4KT 1D2DA 4Z5RA 4BDVA 1IC1A 4LB8A 3CN4A 4QT5B 2AANA 3HG1E 4FMFA 2OTLV 5FFGA 1ORQA 2UX7A 4IKIA 1RKRA 2XTJD 4BFFA 4GKLA 4KXCA 4IEFB 2WQ8A 4HEME 5INDB 3GMPA 4XCEA 5ERWB 2GHYA 2E7DA 2IXQB 2TRYA 4MA7H 2YGVA 3WTVA 3K03A 1EFRG 3QJSB 5CWSB 2YZ1A 4V1DD 1Q0XH 1C7TA 3R7RA 3OTTA 5JW5A 1HHGB 1JFHA 2IAMC 5M7QA 1QO3B 2ADIA 4JHAL 4A37A 4D0CA 3DC5A 1F90L 1J5CA 3GSNL 2BIQA 3PP3K 3ZX1A 1Q8MA 1QLFA 1DBML 1RP3B 1WAPA 2KHAA 2QKIC 5ADPH 2WNWA 4RZCA 4ETQB 1IBMO 1I3RA 1YECH 3G80A 3KGSA 1E6JL 2YRZA 4RRPA 3V4UH 2I32A 4BW5A 3D06A 3F7VC 5IGXH 1HYSD 4LHQB 4FFTA 2PO6B 4NKGB 1RZJH 4OLXH 2XV2A 3QG5A 1KT2A 5CP7B 3KAAA 3BW9B 3MLYL 3KG5A 2LGQA 4YSEA 4DV6O 5D7JD 4DQAA 3EUUA 1QQDB 1UZ6E 1YSOA 2CD0A 2FNBA 2R15A 2NR6A 4KX9A 3SCMA 4GXFA 5BS0D 2BFVH 4Y89A 4BSWB 4WNJA 3GXNA 2ZOKB 3TO4B 1RZGB 2A1WH 2HLEB 4ELKA 1NC4B 5EEWA 1IVTA 2XN2A 4BXVA 4Z7NB 5A2JH 1G6UA 5C0EA 4UCSA 1ZK9A 1R33A 4AH2A 1YNTF 3A4AA 4ZW3A 3F7KA 1DQLL 3H42H 2KPNA 4P3CH 2FLMA 2H1XA 1G7JA 2Y6SC 1KCSL 4JCMA 1J0IA 4PB9L 4MX7A 4LCWA 1T83C 1U8JA 4G6AC 4S1SH 4YFDB 3TN0B 1TJIL 2XZQH 1QUPA 5F7DA 3APCA 5AKSA 1QG3A 3T2PA 3BVWA 1AHWB 1EHXA 2IALB 2XN9D 1VAHA 4OFQA 2AHZA 3QZWB 1RLWA 3EBAA 1KGIA 5E6ID 3ULUH 3RTLA 4KZEH 1RUAL 2G3NA 5C86A 5IY5B 4HK0A 2Q7YA 3JSSA 5AG2A 1T5WB 5B39B 1QTSA 5E8DL 1A4CA 3LRSB 5F7BA 3IETA 4NJ9L 5DYOA 1BVOA 5CBAA 1F4WH 1JYNA 2PYJA 4AVJA 2Y69B 4R0LA 3E9TA 4PTUA 5AVYB 1KF9B 4PJHE 1IBLB 4PGEB 4WEMB 5TGBB 1KENH 4KKPA 1BZ9A 1MCOH 1G4MA 3BP7B 3QTCA 3Q44A 2C1OA 2XWXA 1CGTA 1PLCA 4DR7O 4DP6X 2GJZB 2DDQH 5EN2B 3NFPB 1U30A 3F58L 4KK6C 1FYHB 4PUBH 4CN1A 3WFVA 4R2GD 2OL3H 1CK0H 3TM6A 4PWHA 5C6TL 1P7QD 3WKMH 4XDLA 4RIRB 2ZAHA 2EEFA 3AZUA 1T2QL 2BIMA 4RX4A 1HSBB 1AZVA 4JFEE 1EQWA 1OAZL 1F0LA 4OD2B 4G8GE 2WB1A 4QXGL 1R1CA 1Y76B 1MUJA 1FL6A 5ILTL 4JFZH 2NCEA 1Z9LA 1XCWA 2EZPA 1RMFL 1XBDA 3RWJA 5I1EH 3SGKA 3ULUE 1OGAD 4R90H 3GXTA 2HYMA 4IMLA 4CSZA 1OE3A 4X6CF 2P67A 3S3XA 4QRPE 3NPSC 4TULL 1TU2B 5A3IC 3HHSA 4U33A 1OSPH 4PS4L 2CSPA 4XPHL 4LPWA 1JGDA 5KW9L 1UXLA 4NUJB 5C7XH 1T66D 4PY8J 1MFVA 3QUYD 1FZKA 2W6IG 4J9ZB 4JHVA 4LF6B 3HOGA 3ZSSA 2Z4QB 2QSQA 4G3YL 4DFIA 3WB2A 3MGAA 5J1SC 4G42B 1EN6A 4HKZB 3BAIA 1OAKH 2AQ3A 5FYKU 2F43G 4DR2B 2BNQE 2PW1A 2Y2WA 1KBWA 3HE6C 4PD4K 2KZWA 3MV8A 4IGBD 2YKKA 3AQYA 2CO6A 3MUY1 5F9DC 3UZVA 1ZS8B 1HEZA 4AYGA 3MUGA 4LSQL 1SEQL 4JZOB 3H85A 4HWZB 3A23A 4ZSOE 5F1IA 1ADWA 1KTLA 2GUZA 4AQAA 4EBQL 3MBEB 4YHLH 2VQEB 1H3GA 4O2BA 1LWHA 2VR5A 3CHXA 4FFBA 2CRYA 3NXSA 1UFGA 2E7MA 4X7SH 3BHPA 3ZHKA 3FO9A 2WSKA 2Y36L 4CMMB 1SM3L 3IN0A 3B83A 1NTKH 5B1NA 3H1LH 1KPRA 3B56A 5T3XE 1X5YA 4LGSB 4DKFH 1N6QL 2UXXA 4IMKA 1INEH 2N56A 4QHKJ 1CFMA 1R5WB 3MBWB 4UTBA 1X5GA 5I76A 1F13A 3PIQA 4U1HA 3WTXA 4MA8H 1OZUA 1I8KB 3X2QC 1X9UA 4PG9B 4BZ2H 2X9YA 5H9CA 1T7VA 4O2CB 1UT2A 4PJBB 1V05A 4QRTA 5TFSL 4M8QA 4DP4X 4BIUA 5BV7L 4N9GB 4CC4A 5DVOA 1W6WA 1XNRB 5AVUB 1YJNV 1NANI 4XAKD 2Y4UA 1F42A 2AK4B 5KYYA 4Y9CA 2YWYA 5I66B 4QD2E 4JRLA 5E2JA 4AJYV 2WQVA 4MVRA 4YSTA 1A0QL 1PKQB 3ZMVA 1C9SA 1HHJB 5HDRA 1QFUH 1OTTC 1S9WB 2GJ6E 1W2BU 3COOA 4HF5L 4WJ5A 1AP2A 1FC1A 1Q9OA 2WXMA 1OV9A 3BHBA 3CQQA 4GXUN 2C7FA 5H35A 1LMIA 2IG2H 4GAFB 2DYPA 4UU9A 1L5GB 4AX3A 3VFNB 4RMUA 2VQ1B 3CP1A 3KLQA 1NT2B 3JD0A 4FYTA 1E43A 5JPNA 4NXMO 3MRLA 3WL9A 1HK6A 1XI1A 3AG3B 3KPRE 5LN8A 1Z9OA 3SDYL 2EQDA 3AXHA 4IBLT 1LE5B 1A2YA 4Y7MA 2X9ZA 5EU3B 2YD2A 5DHDA 5EEVA 3JV4B 1FPOA 3NJKA 2Q9LA 5BPPA 2N0KA 3IDNB 3IM1A 3SDDD 3TIDA 1IZKA 5I18L 2YOAA 3SDCC 2DQUL 1YEDA 3BP5A 4K7FB 2AK1L 3V0EA 1H2GA 1U8PA 1XGUB 1K9MW 5F7MC 3K06A 4KXRA 1Y6MR 1RUPL 3EGXB 2IJKA 3V5KB 2QPFA 3PGDA 1CICD 4JHUA 3MRFB 4PJEE 4PRHB 5TF0A 4U6XA 5EU5B 3RX7A 1EBAA 2CJ3A 3CAFA