3HB3B

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
b'QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
total genus 73
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hb3B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3hb3B01
2VSKB 1JZJA 1PLAA 4GP8B 1AR1B 3WG7B 2GIMA 1CC3A 4EF3A 1SHWA 1ZV2A 3QPKA 1WS8A 2HX7A 2PP7A 1W6LA 4RH4A 4CSPA 3WI9A 4KOCA 4YSPA 1CYWA 4E9VA 5AFAA 3ABLB 1J5DA 1NTDA 2JFCA 4E9SA 4YSUA 4G70B 3HB3B 2I7OA 5TK2A 4HHWA 4AX3A 2QT6A 1ADWA 2R7EA 4AZUA 1PNDA 4A2FA 1M56B 4HCFA 3X2QB 1L9QA 3AW5A 4GY4A 1JZHA 2VW6A 3NSCA 1GSKA 1NPNA 3NJKA 4G7RB 4P5RA 2HLEB 1BYPA 1L9PA 1DZ0A 2BHFA 8PAZA 2HX9A 1NIDA 3ABMB 5I28A 2YXVA 2IDTA 3CG8A 2BWDA 1BQKA 2J56A 3UAAA 3T71A 3DIVA 2XWZA 4PCYA 3TASA 4YVNA 3NP4A 4AI7A 1XMEB 4GYBA 1OCOB 2VW7A 1GY2A 2H5UA 3AY2A 4ENZA 1JVOA 2YQBA 1OE2A 1KDJA 2B08A 2LLNA 2PP8A 4WTQA 3FSAA 2PPDA 3SBPA 1QNIA 4QKTA 2XXGA 1NWOA 1X9UA 1KYAA 3CDZA 3NYKA 1SFHA 3QJQB 2AZAA 2BZCA 2UXTA 1L9RA 2QPEB 3H56A 2YAMA 2OV0A 2EIJB 2IH9A 4E9QA 2B3IA 3FSZA 2BP8B 4BXVA 3GXUB 1CYXA 2BW5A 2FQGA 4KO6A 2UX6A 3SBRA 4YSEA 1ASQA 2Q5BA 1W8EA 1TEFA 1NICA 1AANA 4NAJA 3OQRA 2VSMB 3IBOA 1JZFA 4Q89A 1RKRA 5B7FA 1ZDQA 2GBAA 1BQ5A 1IBYA 4N8UA 1QLEB 1JZEA 1SFDA 4DP4X 3ZX1A 1WAEA 2NRDA 7PCYA 4E9RA 1JZGA 2J5WA 1WA1X 3T6WA 2H3XC 1PF3A 4NERA 3DKHA 1AZNA 5I6PA 3D12B 2VN3A 5EHFA 3WKQA 1MG3C 2DV6A 2TSAA 5B1JC 4JHUA 1E5ZA 4BWWA 4A2EA 2IDFA 1J5CA 3AZUA 3UAEA 2AFNA 2EINB 4A66A 1OV8A 2WO2B 3ERXA 3NJFA 3ABKB 1CUOA 1ILUA 2FJSA 3OMNB 2N0MA 4YVUA 2FT6A 1PCSA 1L9TA 5I6KA 2QDVA 1ASPA 4DP9X 1T5KA 1WA2X 2J57A 4HALA 3S3DB 4Q8BA 4DP7X 2CCWA 6PCYA 1W6WA 1JXFA 4A67A 3X1BA 3ASNB 1PZCA 4E9WA 2FQDA 3SBQA 2YAEA 4F2FA 1BXAA 1KBVA 1TKWA 4KNSA 2QDWA 1WA0X 3SQRA 1E67A 2BZ7A 3FPYA 3X1FA 3C75A 1IC0A 2HX8A 1PLBA 2CUAA 3UABA 3UACA 3V9CA 4WKXA 1NPJA 2AVFA 2TSBA 5TK4A 1GS8A 1PZBA 2XX0A 1E30A 2ZXWB 1GW0A 2BP0B 4HHGA 2MTAA 3KW7A 4L0PB 4BDVA 2EILB 1FWXA 2FT8A 3CZUB 4AKPA 3T6XA 2DWTA 2JXMA 1ID2A 3AG2B 2XV0A 4DP2X 1DYZA 1JZIA 2RACA 3NJHA 1A4AA 3MBWB 2IDQA 2IWKA 1JXDA 1JXGA 1NIEA 1OE3A 2I7SA 3EH4B 2BO0A 4KO7A 3RYMA 1GS7A 1IUZA 1RZQA 2DWSA 1ZIAA 4DP0X 4DP5X 3H4FA 5D4HA 2GB2A 3NSFA 4DP8X 2FTAA 2AANA 9PCYA 1KCWA 1AZBA 1GYCA 1A3ZA 4A2DA 1ET8A 4YSSA 3T9WA 3QJVB 2ZONA 4DPAX 2PPEA 3CVCA 1VLXA 3PAUA 2FQFA 1CURA 2HRHA 2Q9OA 1UATA 3GDCA 2WSDA 4DP6X 1NIAA 3S3BB 4QLWA 1AZUA 2EIKB 3GYRA 4M3HA 1M57B 3BQVA 5B1BB 1KBWA 1A8ZA 2HXAA 3NJLA 3FSWA 2YAQA 1JERA 6PAZA 4DPCX 1AS6A 2UXVA 5I5JA 2QPDB 1EHKB 2I85A 3ASOB 1GY1A 1SDDB 2UX7A 3WIAA 3FQ2A 2MRYA 4YSDA 4E9YA 2EIMB 1NINA 1SNRA 3QJSB 3NJNA 3G5WA 3EH3B 3CDZB 1PY0A 4E9TA 1F56A 1BEXA 1OCRB 2FWLB 1N70A 3N55A 5PAZA 3V9EA 1ET5A 2XV3A 1A4BA 3CVBA 2DYSB 1JVLA 4G7QB 3EF4A 2IAAC 2AZUA 3NJIA 5B1JA 2GC4C 1URIA 5AKRA 2GSMB 1MZYA 1E5YA 1KGYE 3NJGA 3QJRB 1OE1A 3NJJA 1ZDSA 1B3IA 7PAZA 4UAHA 1L9OA 2BP8A 1ETJA 1BQRA 4G72B 3X1EA 1J9RA 2IWEA 2GC7C 4W1TA 2BP0A 2R7EB 2E86A 1N68A 4AKOA 5I6LA 4E9XA 4P5SA 1ILSA 1SF5A 2W88A 3NP3A 5F7BA 3UADA 3AG3B 2GI0A 1V54B 1YLBB 4G7SB 2YARA 3ZIYA 3WKPA 3FU7A 3PPSA 1IKOP 1J9SA 4BXSV 5B7EA 2HZHA 4MFHA 3FPXA 1OF0A 3FS9A 1ET7A 2J55A 1X9RA 2IDSA 4F2EA 3FT0A 3ABGA 3NSYA 4YSOA 2FQEA 2XV2A 4DPBX 1A65A 3OMIB 1V55B 4HZ1A 4YSQA 1AG0A 3PCYA 4X4KA 3H4HA 2PP9A 3IN0A 5B1AB 2VM4A 3WNIA 1AS8A 2UXFA 2IH8A 5I5IA 3PLYA 1KV7A 4HCGA 4BWTA 1AS7A 2CALA 4KO5A 4JHVA 1HAWA 2FT7A 4TXVB 5F7AA 4YSCA 1PZAA 4W9ZA 5E9NA 1SJMA 3N2JA 2XXFA 1EZLA 1BXVA 2HRGA 1BXUA 1MZZA 1E65A 3UGEA 2YXWA 2IWFA 2X87A 4YSTA 3DTUB 2DY2A 3CVDA 2ZWNA 3MX0B 1SF3A 2Y1AA 3T6ZA 5A7EA 1AG6A 3KW8A 5I6OA 5B1KA 4A2GA 3FU7B 1R1CA 4KNTA 1SHXA 3FQYA 1A4CA 4JKNA 2YAHA 1PNCA 3JT2A 2YAFA 3OMAB 4A68A 4YL4A 3FU9A 1NDTA 2VMJA 4HAKA 3HEIB 3EHBB 1JOIA 1NIFA 1FFTB 1SDDA 1V10A 1TU2A 3IE9A 2Y69B 4N4YB 2UXGA 3NT0A 1TEGA 1QHQA 1I53A 4KNUA 2X88A 2YEVB 5FC9A 3T6VA 3TU6A 1FA4A 2XX1A 2P80D 3X1NA 2DYRB 5ANHA 3BVDB 3TBCA 4CSZA 4UF7C 2A3TA 3OM3B 2CBPA 4A2HA 4FA7B 1IBZA 4YSRA 1OCCB 1MDAA 1RZPA 3PAVA 2FNWA 4HIPA 3OD3A 4YSAA 2BW4A 3U25A 4BK5C 3TA4D 3X1GA 5I6NA 3AG1B 4AKQA 1AOZA 1OCZB 1AZCA 4K9JA 1PAZA 4NB7A 2CJ3A 1L9SA 2CAKA 2VW4A 2BWIA 1AZRA 2PPCA 5I5MA 1PMYA 1KCBA 3FYEB 1XB3A 3L45A 3S3CB 3JTBA 2VM3A 3S8GB 1NIBA 3S8FB 1J9TA 1PLCA 1AAJA 3QQXA 4KO9A 5D4JA 5LDUA 2OCCB 2XYBA 2PPFA 1GR7A 1AACA 3FYIB 3AG4B 3PXLA 3WNJA 3ZDWA 3QJTB 3EH5B 2ZOOA 4BDVB 2XU9A 5IY5B 5PCYA 2P80A 1GS6X 4ZK8A 1HAUA 4KOBA 2GHZA 4GP4B 1AIZA 2YAPA 1J9QA 2XUWA 4GP5B 1M9WA 4FAAB 5I26A 3FQ1A 3ZBMA 4BWUA 2H47C 3IEAA 5D4IA 2PCYA 1BAWA 5I6MA 1BYOA 1NWPA 2XVBA 4F7KA 1AQ8A 2XLLA 4PAZA 5B7MA 1XB6A 1ZIBA 3PAZA 3FU8A 2W8CA 2YAOA 2OJ1A 4HCIA 1WS7A 1OOWA 1KDIA 2IDUA 4UANA 4M4RB 5B3SB 1NZRA 2PLTA 1ZPUA 2PPAA 3NSDA 1XB8A 3IN2A 1ASOA 3FSVA 4G71B 2JKWA 2PCFA 1HFUA 4DP1X 1MG2C 1RCYA 3NJMA 5AZUA 3TBBA 4GXFA 3QJUB 2WO3B
chains in the Genus database with same CATH superfamily
2J20A 2AJUH 3RGVD 1G7JA 5ADPL 5IFHH 3MXVL 1B4LA 1PG7H 3N85L 5L88L 2VSKB 2WCPA 4O2EA 4J11A 4OGXH 2F18A 3ZHRA 2ATKA 2LAAA 5H4ZA 4L5FE 2ZX8A 4S10A 4WUUA 4W70A 4KJYB 5INDA 5IB2B 4PJ9B 1KTRL 2YI8A 3ZUCA 4KOCA 2NQCA 1E7VA 2WTRB 3UM7A 2VQ1A 5IWAO 2Y2TA 4X7DC 3QEHA 1EV2E 3CSXA 1FG2A 4JN2B 2IAMD 3FO2B 2VDKL 4K3EH 4OZFB 5IB5B 3VXTB 1ZVSA 4IYHA 3NDYE 5K9KA 2F74A 4PJGA 3C2AL 4NN5B 3RFRA 2BSBA 2F8IA 5IEHB 1NBCA 2BXZA 2KZWA 5L7XL 1L6ZA 1QFUH 3VCLA 2JKLA 3BGMA 1T1WB 3HPJB 5BVJA 4N85A 43C9B 1CLZL 1UA6L 5GRUL 4GW1A 5ESAB 1W0WB 3BKML 3DMMC 3EBAA 4NCC1 4ZOAA 3CX5F 4NN6B 3O8XB 4Q97A 4E41A 1H0DB 2QMKA 2W07B 4D7SA 4R7CA 4DUZO 3EJYD 3NESA 4KKPA 5GZND 5G55A 4PJ8D 4NRZB 1ZRUA 4OM1H 1JZ2A 2IOOA 1U93B 1AIFB 4ZMNA 1RZ7L 4G6ML 4BD4A 2EJRA 3LD8C 3BVNA 1BQKA 4YR6A 2VT0A 1KXTB 4AITA 4L3EB 2HKHL 1NBYB 5F7WC 3Q8BA 3RZCC 2KG7A 2NR6D 3GXMA 2H5UA 4GKKO 4KFMA 2ZNIA 4LCVA 1T1ZA 4TSFG 3MLUH 3STLA 4G9FD 1E28A 3IJHB 4M03A 4ODVL 1WJZA 1KDJA 1L0QA 1ZTEA 2Y2WA 4GRWB 3L6FA 3PV6B 5LXGH 4LPUA 3QQ9D 4MXQD 4MDJB 3T8MA 1WFJA 3MV9E 5E4AA 1BEYL 3HLAA 3SCMD 2O5ZL 3OHXC 4XPBL 2ZWKA 1T5XB 4LF9O 1XF2A 1G7IB 3KEHA 1ZHBA 4HS3B 4Y7MA 5GSVB 5JIHA 4E9QA 2VZ3A 1EPFA 3C9NA 3KJ4C 3MMEB 3D25B 1B2WH 2QEJA 2FQGA 1NFDF 2DQGH 2N0KA 3W9EB 4FABH 4HGWB 3CIAA 1A6AA 2BWQA 3MBEB 4DUXA 5FO8B 4ADGA 1C8PA 4JI2O 3IFNL 3TVMB 1J95A 3ATDA 1D5BA 5DFTA 4PJDE 3IBOA 2MNJB 1O9HA 1P53A 4I5BB 2JTYA 5T5FL 3QZOA 5C08E 1U8IA 1MQKL 1USZA 2KB1A 4GT1A 2VN5A 4WW2C 3O6LL 4Y4FD 5FX3A 1AMYA 5IHWA 1HCVA 1SHMA 2AEPL 2JKSA 3SJVE 1D7BA 3FB5A 4DKEL 4CGTA 1WA1X 5K9JL 5JA9A 3G6JF 4MA3B 2AABH 2AQRA 2JGUA 3ZMZA 2UZPA 3GQFA 3IMBA 1YAZA 4H8UA 3CFMA 4OGAD 5I15L 1EJ6A 2JCWA 1H8LA 2V5YA 5KUKA 4N3TA 3ESPA 1F1AA 1FD9A 3PGCB 4FQJH 4FP8H 4ODHL 1NVPB 1U58A 4OJFH 1F4XL 4JY6A 3B40A 2ODMA 4PRBB 1M2OA 4P5TA 3TBVA 3ASOC 4WBNB 3UAEA 4DR2O 4PB9L 4MJIB 1FHNA 1WIUA 3B9AA 4IBZA 4IRJB 3WAJA 3ABKB 3F8UB 1DQJB 1JF5A 2VAAB 1BHGA 4BQ8A 1CICD 4WV1A 1JV5A 5J56B 1RZFH 3QUZD 1KYUA 4PA9A 1VQMV 1QPXA 1FLTX 4LSUH 1P0SE 3IGAC 5BR8O 4P48A 1DANU 4KHPO 3CHQA 4YHPB 4ZW5A 4YJZL 4GUCA 1E2VA 2EEAA 3SDYH 2CBOA 4PTTB 1W6WA 4JL2A 2XBZA 3OKNA 3X1BA 2WINA 4XXDB 5KHKA 2O6CA 5HYSA 2KQXA 1EO8L 4PV1C 1LNUA 5DUPL 3KVDD 5D1XD 4BW9A 4QXVA 1ZJBA 2XA8H 2IW5A 1BXAA 2G3NA 3DMMB 5GGTA 4RFOL 4K3EL 4MRBA 4PV9A 3RG1C 2J8OA 3S5LA 4RDQG 1AHWC 1QRNA 1IGTB 2J6EL 3UO8B 4RRPA 4CRPA 3MJWA 3VXPA 3NCJL 2HX8A 4WKXA 4NKDB 4OF5A 1Q4NX 1YTFD 3ALXA 5JPMC 4UNIA 2JXMB 1KYOK 1QASA 2XX0A 1B0RB 1SUHA 1UFGA 1W72L 1J8HB 2EIZB 4RGNB 2HVKA 1EIBA 2OR8A 1GKFA 5IJ0B 2QGCA 4YIQA 2B3RA 1UZ8A 2AGAA 2LV4A 5J2TB 3TO2B 1PPJH 3G5ZA 3NDZE 4KAQL 4RQFA 1XGTB 3G5VB 3JVFC 2I60H 4P30A 5KAFZ 3MV9B 4PJ8B 1VKXA 5EULV 3D30A 5HHXL 4J12A 3AB0C 3P4NA 1CDGA 2R72A 3R1GL 4X9IA 6TAAA 1EM1A 1SS3A 5DJYB 4HKZB 3Q4HB 3RYMA 4AE1A 3HN8A 3K9AA 1W0YT 2PYEB 4KDTA 4RQEA 1QLFB 4UUJC 2OP4H 1XCXA 1FZOB 4IEFB 1VQ5V 2PTUA 2B2XH 5IE9A 1MAML 9PCYA 3BVWA 3A24A 4N8VB 3RZWA 1A3ZA 2O72A 3MLXL 3VXMA 4YXKH 3UDWA 1MWAA 1U8CB 4ISVB 4HSCX 3ECBB 5I1CH 3L9BA 3FU5A 4L3EA 4BUGA 4W6WB 4X6CE 1XSOA 1A6VL 4GKJB 1TZAA 4JJ5A 1C5DB 4GSDL 3VFUB 4JAAA 2QPUA 4Z76A 4HUVB 4U3XA 4PJ5D 4NKMA 4EI6A 6FABL 5JHBA 4K5MA 2WZ6A 2Q8BH 4BKLA 1MHCA 5E6IA 1XGRB 2HXAA 4KNQA 1A8ZA 3CQPA 4ZUUB 1SQVH 2CNZA 3HKZA 2EXWD 3SCMB 1EZUA 1SJHA 2CO2A 3QDJA 5HGHA 5GGSY 2R0KL 2YJQA 5BVJB 3SBWC 3VD0A 2ZOWA 4Q74A 3N41B 5EN3A 4MS2A 2E27H 4MTMA 4DVBA 2AJYH 1YYLH 3P0VH 1E9OA 4Y16D 4ZUWA 1K8AW 1A7PH 4AG4H 5C8JB 1D6EA 5KMGA 2NY4D 4JPQA 4LL1A 2Y6TE 4YAQB 4NXKA 1U4EA 1UKQA 1KZQA 4ZXBB 2GY7B 4H25A 1M57C 1AYRA 4UMSA 4X0NA 1GCYA 4FQXD 4U4BA 2Z4QB 4OLXL 4MJ6B 4B9GA 4YHZL 4O4YL 1OSZB 5IMLA 3KYKL 2F19H 5D7KD 3KS0H 4POZC 3G71V 3FW6A 2X1XR 5BZXA 3QJRB 4R0LB 5FYJL 1OE1A 2O5XL 3TH3T 3RIFF 3VQXA 1ORSA 4QF1B 4Y4HD 3AY4A 1A5FL 1ODAA 2P8MA 3TV3H 4JO3L 1ZTXH 4TUYA 2NSMA 1LO4H 4YDNA 4ORZC 5HI3D 5EUOE 1MCWM 2GC7C 2XWBA 1HCYA 1N68A 4B3RO 4KGJA 2IJIA 1SF5A 2ZF8A 1FFNA 1E50A 3FQ4A 2DD8L 1JNHA 1N4XL 4PJXE 4FMFA 3MRQB 4X4ZA 3K6OA 2CR0A 3KPTA 2HA1A 4UQBA 3V0JA 4LPWA 1KG0A 5LQBL 4XC1H 4NQDB 5IJBC 3UAJD 5B7EA 2WYIA 5IM7A 4IKIA 4HA1A 2ZKMX 4XVSL 1ET7A 2YD6A 2V17L 4CC5A 3IXAB 3GT6A 1YUHA 4ANWA 1D9KC 2C1OB 3SDXE 4L4VD 3R7RA 4DTGL 2DM2A 3ZKMC 1TMCB 2FLRT 2APSA 4UCVA 1YVWA 4F6EA 2GSGA 3QR1A 3DRTB 5F9WC 4EDWH 2F61A 5JR1H 3T3PE 3B7TA 3BT0A 2LW7A 3CFDA 5IBTL 1B9ZA 1NR1A 5L6YL 4NZUH 3SR2C 4HYTB 3WE1A 4ABMA 1MWAH 1HWWA 1T1XB 3WS3A 1N5YH 3P1VA 5F6HI 3ZMUA 3NIGE 2XWXA 1IX9A 3HC4H 3F83A 1G87A 4P57A 1AD0B 1ED3B 3OTTA 4OR1A 1E2WA 3EYFA 2DI9A 5GGUA 4CDGC 4MYPA 1Z9SA 3SO3C 4X4YB 4CSTA 2YUVA 4Z7QE 1B0WA 1BMFG 4PRPD 1YEWA 1E9PA 1FCGA 3K74B 4FDWA 2YUXA 3D3VB 2FBRA 2F19L 5DRXB 5I73C 4QO1A 1RULH 3MBXH 3SKMB 1KCVL 3QEUB 3LZPA 3DSNB 3QZNA 3PDOA 1MAJA 3LHPH 2CR3A 3CN3A 3MRQA 1W80A 1OWRM 4EE2A 3TBWA 1GA2A 4WQOA 4YHHB 1TTCA 1VACB 2FECI 2MCMA 4MJ4A 1TETH 2YC0A 3DTXA 3C8DA 4JYBA 2WVVB 2X4PB 5FM5M 1SDDA 2CCVA 4DOHE 5AAMC 3MGOB 3VXRA 4WV1C 4QPKA 3KG5A 1DQLH 4JS7A 1AJ7H 1Q1PA 2A9AA 3DVGB 2WNXA 3RWHA 1BA9A 1ORSB 4GMSL 4QF1A 5FL7G 2VR5A 1KECA 5IR1B 3IMWA 4L9LB 2QQNL 1H8NA 2CBPA 2ARJA 3MOAL 3T0ED 4FCAA 2ZWZA 4AEHH 4BQ9A 2MHAB 1VF5B 5DZLA 1KELH 4A6YH 3LUTB 1Q90A 3FOLB 5HFMA 1FPOA 2JCCA 3ZTDC 1THCA 1WWBX 4RSVA 5KYXB 1R5VA 5DLMH 2QQQA 2WXQA 4JHZA 1RM1B 3BCCH 4L0YA 5I0ZA 3KG2A 2O93L 4QRQA 1M2VB 3VO0A 5AOZA 3K0GA 3DVNB 1MJ8H 4L3CB 4JFXB 5E8DL 1HXYA 3HZ3A 2XA3A 1TVDA 1XX9C 3FT9A 1X5GA 1DR9A 1DSYA 2PPCA 4Q7DA 1DBAH 1PMYA 3TL5A 5F93C 4LOUC 1VRSA 1JRHL 1V3JA 4IU2B 2NNUA 4P3DA 4LBEC 4TUJB 4JKLA 4NQDE 5G4NA 2JSFA 1VFBA 5ENWB 2H6PB 5CBAB 4I9QA 3PXLA 1DVUA 2H1XA 2O6DA 5CEZE 4NQEE 3ZDWA 4BFGA 4XPAH 1ES0A 1LO0H 5E08L 2KQNA 3LZQA 4BDVB 4HUVA 3L3JB 3FTZA 5IBUB 4ZFFA 4DV3B 1AKPA 3FTWA 4IRZL 3DTXB 4LOUD 3U9WA 4FLOA 4BIUA 3BVXA 1ZS2A 4OIFA 3D39A 4ZOBA 4TNWF 2G60H 2N1KA 3IB4A 3UTZB 1Q72L 2J7LA 5LQBH 5KOVC 4IIJA 5FOJA 3ZBMA 1HR0O 4IGBA 2DQJL 2Y36H 3OLIA 3WD5L 3FB8C 3A4FA 3IEAA 5KVEH 4K3JL 1KCLA 4Q58C 2DIJA 4XBGB 1BVKB 1M90W 4HK0A 4U6HA 3BAWA 2XVBA 1MIEL 2OWOA 3WSQH 3RWCB 3MX0A 4QT5B 2A0LC 4KKLD 1OP3K 2LO1A 3HS0B 3N6YA 1J5OH 1WFIA 2RA1A 2ZAGA 3O2DA 1JWSA 3HMWL 2BIOA 3QCTL 1AGFA 1AD0A 1ED3A 1YJDL 2DLIA 2IMMA 2WC7A 4XN8A 2XAHA 3O0RL 5GHWL 2APVA 1I1AA 5LCVH 5AENA 3IAPA 4G3YH 3VH8A 2IAND 3CZEA 4FQ2L 4JFZH 3OC5A 4MCNA 2C3GA 1RSYA 2CO7B 3MOAH 3B2PA 3DX4A 1Q3EA 4LNUB 5IJ0A 2I24N 4ORGB 4TSBL 2WXPA 1YZBA 3N91A 4NN6C 4XX5A 5IQOA 4OZIB 3MGTB 1VF7A 4P2RB 3C6LD 4CN6A 4EFBA 1ONQA 2V2XB 2CHZA 4WDIA 1RZFL 5D7JC 1JZJA 4BFIA 2D9CA 2EO7A 4FG2A 1AR1B 4P2CG 3SHSA 1WFNA 3MC0A 5KX5B 2GIMA 4EF3A 1WP8A 4OLYL 5D5MA 1EDHA 1RSFA 5B22A 1A1MB 2ZP9A 4K7PH 2EKSB 2A73A 3AADB 5D55A 4G5AA 4PV9B 5HI5D 1MCPH 3A6CL 5DEJA 1S5HB 4DCQB 4P4RA 4OI7A 1QNMA 1Y0LA 3OAWA 1A1NB 2H0JA 3HB3B 1OAZL 1VQNV 3FTUA 1OCCC 2PXYB 1QBBA 1YEJH 4WJKB 32C2A 4GRLB 1VGKA 5K1NA 4JM0A 2JJUA 1S5IL 1BL8A 3DYPA 2ZOLA 2WA4A 4TQEL 3V6OC 4F8QA 2WQSA 1KOAA 4DUYO 4ZG1A 5MEQB 4UT9H 3W11D 5JIIA 3BEWA 3T5WA 1A64A 4F27A 2DKSA 5F0PB 4MSWC 1DQJA 2NY4B 2UWEF 3G9AB 3GK8L 1DQKA 3ZKQD 2G5UA 4TV3A 3BMVA 1UB5B 3N41F 4ZXBD 2EECA 2AW9A 3E8BA 2XT1B 4EJ1C 4MJ6A 1MIEH 4UNVA 5GS0L 5DMKB 3AK2A 4MD0A 4XPTL 3JD1A 3A4AA 1QUPA 1VFUA 5ESQA 4AMXA 3Q3GB 1YUKB 1FPTH 2B39A 4NC0B 4XMPL 5DEZA 4ZOLB 2QHRL 3QFDB 2RHEA 4O4IA 2PP8A 1AGDA 3S88L 2EH7H 3GS4A 3MO1A 1YPZA 1JOYA 1WZ1L 2OW6A 4LLAA 2WXRA 2HMID 2BE3A 1JPEA 3BN9D 4U6XA 4PYHA 1X5JA 4NP9A 2HT3D 2VWEC 1W2BU 2VLJB 1FVDA 1NEUA 1MFAL 4PY8J 5A2AA 2AK1H 1N64H 2HG5C 2IH9A 4PBVC 3EADA 4PJFA 3NEOA 1PYWA 4WO4C 4Y5YB 2OA9A 4M48L 1RHHA 1A6AB 3MBEA 4R2GD 4Z7VE 3UJTL 4S1RL 5FO8A 5IMKA 1MCRA 3R06B 3ZN0A 4BZ1H 3VXQB 3N2GA 1YEIH 4ZIBA 1DFBL 1GVIA 1KCRH 4B3MB 3L4WA 4KTGA 4Y2OA 5BUAA 4EN3A 4FKKA 1U8CA 4ISVA 4RMRA 2FIRT 5GIRA 2XKNA 3HA0A 1T5XA 3VFRB 1F5WA 3BKMH 3CZNA 5DI8A 2DM4A 5IFJB 3W0WD 5DEGA 2OTWB 1R24B 4WW2A 4Z0BL 4UILH 1SOKA 2KSDA 2MEJB 4PJAF 1B4JL 5GS0D 2IQ9H 3WAKA 5I74B 2Y5QA 1F86A 2MIZA 3DKHA 4RFNB 3BYYA 2EE6A 1BMGA 2X9YA 1GZHA 4PBXA 3ROOA 3KWWA 4PCKA 5A1AA 5T1JA 2IALA 4KQ4L 5FUZL 3S4SA 3COOA 3L5IA 1PX4A 3BP6B 4MQXD 1MG3C 4KRPD 5ES4B 1KXTA 4JHUA 1DO6A 3OUFA 3P4NB 2TRHA 4YR6B 2IG2L 3OX8B 4M29A 4XVOA 5EO9B 2H32H 2AFNA 3QG7H 3IDXL 4MYWB 4JUTA 3V52L 3VDBA 2BVPA 2Q2EB 3CBKB 3RUGA 1R3LA 1X5XA 4YHLH 1ILUA 1UYWL 1LMKA 5FYKL 3NCMA 3IGUA 1G9MH 3RVVD 5FYJU 3HI6H 2V37A 3DOIA 1OZUA 1WA8B 2F1BA 3QGVA 1TPXB 1WP6A 2P5EA 4K0KB 2CXGA 3BGMB 3LNGA 4P9HC 3JARA 3C60D 3MUHL 4JM2A 4QE7A 5F88A 5TE6H 3ARFD 4ZQTA 4NKDA 5HGDB 3MI6A 1MNUH 1TJHH 5K9KB 3EYVB 5E2TL 3OF6A 1A7NH 2C9SA 1XUQA 1O9ZA 1G4YB 4XB8A 4YBQD 3X11A 1MPAL 1A6UH 5C6TH 4IDLA 4TUOA 1EN5A 1MQKH 1X5IA 3TK1A 4LP8A 3WB2A 1IGJB 1S7TA 3MRDB 4PWEA 1MFDH 4QTFA 1UWEL 5ABAA 3SQRA 3ZL1A 3CX5K 4WUUB 4XXWC 4MA7H 5T1KA 1QW9A 3MRCB 1M42A 2H1PL 3OKNB 4I18B 2ADIA 3P2BA 3NZUA 4UOW0 5AW2B 1VA9A 5HI4C 1PX3A 1CXEA 2UY6A 4MVZA 1N0LA 4QHLB 1L6PA 2GITB 3UX9B 3VXSB 4JQVA 5JW4M 1BMZA 5SWSA 3WFHB 1EBAA 1VQ8V 3OZLA 2J5LB 2Y72A 4NSKA 2ZXWB 3BHBB 1NUGA 2CA4A 2A9HA 2WTOA 2X40A 3D39E 3H9ZA 3QUXD 3WEAA 5JHMA 2LFRA 4U6VH 5CZXD 4X1KA 2X4UB 4PD4F 4WCYH 1R5IB 3L48A 5I6XB 2FT8A 4XX1E 1Q0YH 5D1XE 3AG2B 2ZSWA 5H35A 2X6BA 1XAUA 2NX5D 3AXIA 5LGHH 2WVTA 2MW2B 3W56A 2RACA 3NJHA 3QXDB 4C56B 3UJJL 2JRIA 1DJXA 2DZEA 2X3CA 3QEQE 3P30H 3LTVA 3UJIL 3QQ3B 1CFBA 5FDWA 1U21A 1I1YA 2IADB 1UZ6F 4ZFOL 1R3KC 3D1MC 1XZWA 3B8NA 2DQMA 3AJ7A 3RY4A 3M7OA 3RYCA 2DWYA 2XFXB 2W6IG 1M6UA 3G04B 2JMRA 4R6UA 4WFED 2UUDH 4XHJC 3IFOB 1UD8A 1P84K 5CN1A 4A7QA 3RY6C 5IVNA 2Y1YA 3QDJE 1XSIA 3QNFA 1S7UB 4ODVH 4O2AA 5C0BB 4TTDC 2GEQA 3MOBH 4I8DA 1VESA 2CIIA 2EDXA 3MLSL 2A5UA 5DD3L 2FX7H 1ZSHA 3MCKB 3QZWB 3UAJA 3NIDE 5KSUA 4PRHB 4R3SB 3WFBL 1N59B 2CSPA 4JN1H 5KS9E 4HX1A 2OQJA 2W92A 3SYPA 5HHME 2YOCA 2YAQA 5BMVB 4LFAB 4UDUB 1T21B 2YLHA 2WTPA 3KYOA 1IJ9A 1R0AL 2GUOA 3NMEA 5F6HJ 1U3NA 1QLNA 2FATL 2YD8A 1RIHL 2OYLA 1HT6A 4I0PC 1I7TA 4Q9RH 5I71B 3EJZD 1NBZA 1ORQC 5ALCL 3MRPB 1OB1B 4EZLA 3N1FC 5CCJA 1WFOA 1KLUA 5HDQL 1Q0EA 2BC4B 1T66C 2YA1A 4ZMYA 1K6QL 1JVLA 5ID0A 5IMMB 3QXAB 1NCAH 2XG5B 1UOKA 1YEKL 2GSIA 3I5DA 2IAAC 4NUJB 1EFXD 2YFNA 3GSQA 2OX5B 5EA0H 2D8KA 3E80A 5DEFB 3AWFA 5I8KL 2W6JG 4XMLH 4NRZA 4R8WL 4IIQB 3OE7G 4WWID 4C56E 3CFIC 1R19A 5KBPA 1R47A 3IAQA 1B3IA 4S2SA 4OZHF 1KTDA 1S3KH 3A47A 1CI5A 1K5NB 3QUXB 5FO2A 5I1CL 3UERA 3U30B 4MNQD 4FM2A 3ECQA 2H2SD 3BDXA 4NZTH 5J13B 4FFYA 4LVHB 3U7AA 5FLUA 5HYQB 2DBJA 2JGDA 4ZO9A 2E86A 2WLKA 1KJVB 4KK9D 1K8IB 1NM4A 2VN4A 3VXSD 5I6LA 5KSAA 4PGDB 4JTCB 4ERSL 1RK7A 4W9HC 4NQCB 3C5ZA 4ODXA 3V4PL 4Z7OE 1NKRA 3E6FA 3MBED 3QEHB 3ARVA 1BX2A 3M1CA 1HILB 1KN4H 3FU7A 3I02A 5KVGL 1JGDA 3OF6D 1WJ3A 4PJ6A 1RJYB 4UQIM 5ABDE 1Y66A 4GZRB 2E27L 2WB1A 3QA3A 1N34B 1Q9WB 5H8DA 3A21A 1BVLB 2HFGL 2F9BT 1YG9A 3ABGA 2LU7A 5JXEC 1DSFL 5K59F 1T0MB 3WUWB 1CR9L 3QORB 5K9OA 3MV8D 1I1FB 4P2OD 4XPGH 2BIMA 1K3IA 3IAYA 1TTBA 4HHAB 4I1PA 1NCHA 3N43F 5E2WL 4BH8B 5JQHC 2KMWA 3PGFL 1T03H 1CWVA 2IPTL 2BHZA 4LNVA 3LRMA 3NRPA 1NCUA 5LYJA 2FYYB 1W0JG 2BK8A 1NTKH 2P7TA 3NH7L 2QQLL 3NQKA 4NLHA 3TEXA 1IZJA 2O61A 2ZOKA 3BAJA 4XZ4A 3K9SA 4M02A 3L1EA 2R4RH 1M7XA 4LBEB 4G6KL 4MB3A 1I9JH 2Y23A 1BPLB 5DYFA 5D5QA 1YA5A 4OZ4A 2WXLA 1CZ8L 5LAPA 5J1AB 3DTUB 1KKDA 5AQ0A 2XOKG 3GBEA 3U2SB 3B6SA 5IVXE 4YK4B 4TN9A 1H3WM 1YJWV 2YRZA 4A2GA 4YHML 3N9GL 5C7XH 2NTFA 3ETQA 2HUHA 4JKNA 3ZYIA 4M5ZL 1JWUA 5JHLA 3JT2A 4XC1L 3FCBA 4GUQA 1EEUA 2E7HA 3L95A 4HU2A 3LH8A 3MQIA 2A6JB 1NDTA 2VMJA 3IDNB 2X70A 4WEBH 2CWRA 3BT2L 1NAML 2F2HA 2C9UA 3THML 5KZCD 2X4SB 5DYOA 2R56L 2DS4A 1GKEA 3UTSE 3WMPA 3NIGF 4WU5A 1SYVB 4X9QA 1DVSA 1GTFA 4KNUA 2VLLB 3TU6A 1G7MA 2I27N 3QRGH 5F96L 5DHVB 4JVPA 3HR5A 2VDRH 5E6SB 3UP6A 1TU2B 1CFSB 2EABA 2OR9H 4LCWA 2O6FA 4WTZG 4YHYB 7FABL 2W65A 5J11B 4JG1H 4M1DL 5F9OH 2N56A 3V9FA 4XN4A 4D9QE 3U25A 1NEZB 5GGVL 3V95A 1OY3B 4WI8A 4FMKA 3RWJB 3X1GA 3PREA 4PJ7B 4LSVL 3E3QE 5KSBB 3K57A 4AL8C 4WGWB 4OZGE 4RIRA 1JAEA 4DVRL 3C6LA 2LLLA 3IGFA 1T2QH 4NB7A 5C9KA 3VGGA 5IJVA 3QS2A 2Z93A 3I9AA 5D70L 2E74C 1IBKO 3KHQA 5E00B 3BUDA 3S3CB 2ZYSA 3RYHA 4GQRA 4PRNA 2I9LB 3E2EA 4P2AA 1VGEL 1FGNL 1NIBA 1BQ0A 1NCBH 1SXCA 4X6FA 1OALA 2CBMA 1YMME 1GR7A 5BZWB 3PQYD 1RH8A 3H1LH 2BSCA 1G7MB 4YPJA 4W68A 1I8KA 3H54A 5JORB 4X64O 2M1KA 3LKNA 1MJJA 3CHSA 4QRTB 4P49A 2P80A 3FCTA 3PQYB 5DYOB 2E4FA 4EUPG 1F97A 2JJVA 4PGCB 4F8OA 5AB0A 5IHUH 4LEOB 5JO5B 3CXHJ 2VLKA 5SWZB 1G0XA 2CR6A 3BLKA 2VXVH 4NQVA 3N06B 2G3ZA 4DV0O 3J8F7 4BZ2H 2J1WA 4D9LL 2OMVA 2FGZA 2NTFB 3CBRA 4WHTB 1Z9NA 1E6OH 2XZAL 1JYNA 2NDGA 4HG4K 2J4WL 2GYSA 3FT3B 4KDVA 5DJ2A 4RA3A 5IW6A 2UUCB 3DX2A 4KH9A 4N8CL 2HVBA 3ARPA 4YPGA 5CZXC 5IK3A 3MRFB 3FTYA 3QCUH 1QO3B 1ZK9A 2GJZB 1WD9A 2QSVA 1A21A 1MZEA 3NCEB 2JK5B 2DLFH 3CPLB 4C4UA 5B4MC 5EU4B 2H2PC 3ZU8A 4I77H 2NUPB 4X66B 3I50H 2ZDIA 1YXBA 5J4MA 2WLZA 1CGXA 4BSWB 3LKPA 1ULVA 1Q9OA 2BIQA 4GPVA 4K15A 1I3GH 2YGQA 4UZSA 4UB0H 1QR8A 2ITDB 4HOZA 4Y5XC 1ZT7B 4NXNO 1Q9OB 1T5WB 5LYJB 2VIRA 4BSWA 4F7EB 2VLME 1ZGLP 2FAUA 2WO3B 3QH3A 4HEMA 5E0QA 1PJWA 1P5UC 4U7MA 5AW1B 3JUYA 2N3JA 1OLZA 2DJSA 4MMXB 1R17A 1QFWL 1WAAF 4E9LA 4YHHO 1HESA 4K9EC 4DOHB 4NKQB 4MD5B 2J3SA 3MJ9A 3TCXA 3PRZA 1PD1A 1WPBA 3L5XL 4HV8A 5SWZD 1CTOA 4QHKI 3EG9A 3KMDA 2ZWYA 1FFQA 1W6LA 1AO7D 5DHYA 3CV5A 4Y88A 4FRWA 1P9MC 1J5DA 3VJ6A 3RILA 2FX9L 3N44B 5LDSA 3GRBA 4OSUL 3TFKC 3S36X 3T04D 2YQ2A 2ENJA 1JZ5A 2GIYA 3VI4A 4HSQA 1JMZA 3PWJA 2OULB 2YKLH 1FNSH 35C8L 4PJHF 1SY6H 2VITB 1X7TA 2QWRB 2ZUYA 3HKDB 2KBGA 4HJGB 2HRPH 2A4CA 3FRUA 2GJJA 1DJIA 1J48A 1OSEA 2AGJL 4JAVA 2ITEA 4NQTA 2R2EB 4JRXE 5EZJA 1ROPA 4NAQA 25C8H 3U6XS 5C07B 3NIGB 4KKRA 1VARA 4Y2DB 5BZWA 3SJQC 3CB2A 2AK4D 3C5ZC 3FCGA 3UBXA 3RURA 5BOPA 5DEFA 3SGDI 1QLEL 4FYTA 4PP2A 3MV7D 3MACL 2DQ3A 1XR9B 1C12A 1D2OA 3DIFA 3G6BA 1HOEA 3CLWA 4Z5RB 4O9HL 3RNQA 2ICEC 3RTQB 3ULSB 2CJSA 3D8CA 4UI2A 4AQOA 2MCPH 1LILA 4P06A 1QNIA 3FFDA 5FXCH 1NCBL 1HNYA 3UTQB 2MQ0A 2IH1A 4JRYB 2HT4D 1BLNB 4WW2F 4BA0A 4LCWB 2XVLA 3LSQA 3DI2B 2QGBA 1MAKA 3RU8L 3EH2A 5CLXA 2D4FA 2VXUH 2HG5A 1UZ6E 3B2DC 3K2UH 4PLJC 1UB6B 4LASH 5ID1A 3WXVL 4I18C 1SEQL 2H0FA 4ZQKA 4NM4H 4LL9A 1JFHA 3SGKC 4MAZA 2AXWA 3GMPB 2ATPA 2K9FB 5I1AA 5HJ3A 4APQD 1YY8B 4HH9A 5HY9B 4NRYB 1KYDA 2NY2C 4UT9L 4E0RA 1ZKAA 5C0BA 3EFOB 4OCXH 5HVGB 5BO1H 4FNTA 1E6OL 2XZAH 4HZLB 1OARL 1X59A 1A6TA 3VXNB 4E9RA 5L0QC 5IQ7H 1RUKH 4WWPA 3QIUC 2VLMD 4X20A 4OLUL 1YJ9V 2MNUA 3L3DA 4XMWA 3OC8A 3SN6N 4YN3A 5FHBL 3CSFA 2DW4A 3C6SA 2ADFH 3QWOA 4RMWA 1MZFA 4IRSB 4F92B 1AE6L 2WW8A 1QR9A 1H5BC 2KZBA 2WAHA 1G7QA 1LWRA 1MFEH 2IADA 2EXSA 3OLGA 1JDCA 4A2EA 2CDGB 2UZIL 1LEKA 1Q9LA 3K06A 1AXTL 2W60B 3EFDL 5BXFB 2YIBD 2L8AA 4G5ZL 2A4EA 3ZE0F 1MJUH 2ZOKB 3H9SD 1TUPA 3TYGH 1WZ1H 1NBQA 2Z0UA 1NCIA 4X7CC 4R4NC 4AJWA 4XDLA 3GHBH 2ZSWB 1L0YA 1KXHA 1BF2A 1BM3H 1D7FA 3L4XA 4KHTH 3DYMA 1R46A 4OQTH 3S36L 3WNLA 4EOWL 5LOVA 4OLWH 4MBOA 5AD0B 3MRGB 5K1JA 5KYNA 3F62A 3SY0B 2L0DA 1FJGB 4HG4J 3V7MA 5HI5C 3V0EA 2J44A 3HRZA 3QPXH 1EAPB 1IBLO 2F54B 4JREC 4DP7X 2CCWA 3BKYH 4X8XA 3HJ0A 4X0KA 4FJCC 3WFHA 3W82A 3VM5A 3VU1A 4JRWA 1A22B 4Z7WF 4GI9A 3D85D 2HHHB 4G43B 2QSAA 1HNFA 1SA0A 3B37A 1AFVL 2BHYA 3QG5A 2J72A 4LVEA 5I1DB 3CSTA 4MD4A 1RJYA 4FYQA 1C08B 4PJIE 6FABH 1TYJA 4NCC2 5F0JB 4XBPB 3BH8B 3RU8H 5L7XH 2G2RA 2ZKYA 3AREA 4C47A 4ENED 5F7EH 1ZX3A 2TSBA 2RCVA 1PZBA 4XVJH 3DURB 5EEZA 3US9A 2Z7UA 5FUZH 4HT1H 4K3HA 4JFED 2YD5A 3GMRA 3I9GH 5FM5O 4UAOB 3P3SA 1WA8A 3LNHA 3US1A 3X14B 3IJ7A 5DK0B 1K5WA 1J0YA 4X5XB 4JRXB 3NIFE 5LP6A 2JTDA 5EO1A 1HXMB 1JYWA 4ELMB 3RUGB 5I9QC 3U36B 1EJ8A 3ZE1F 1CCZA 4JGSA 4E5XA 4EAEA 4QWWD 4JFFA 3WEXA 3ZEDA 1DQQB 5EO9A 5G4MA 2VR6A 2EEBA 3VX1A 4PGEA 2NZ9D 2G30A 3IU4L 4RMUA 4FFWD 1BAFL 2NYZA 5J9PC 4J7RA 4FLUA 5ID0B 4LEEA 2R9RB 1J8SA 4NUMA 4X4XB 4L87A 5F0MB 5CGYC 2JJWA 1V7NL 4RGMC 4DF9A 4YSSA 2P5OA 4UAOC 4XTRD 4ZMXA 3DMMD 4AY0A 1CD9B 1OZ0A 4PWFA 1DBKL 3BUQA 5DXWA 4FXGA 4R7LA 4WW2B 3LVTA 4JI6B 3GJFK 3QFJD 4LNRB 2DQGL 3TN0B 2F93B 4P23B 4DW2L 3B9KD 4LASL 4ZPVB 5LWYL 3MRGA 1DVFD 1NCDH 2V8MA 5J6HB 4X4MA 1P5VB 2NT0A 4GO8A 2WXJA 4XCYB 4KTEH 3FH8A 3OXRA 3TC9A 4AV4A 3WHXB 2D31B 1BD2D 2HLFC 4FG6C 4EEQA 5CEXB 1CGTA 4GG8A 3NJLA 1QNZL 3VFNA 5I66B 1XMOB 1AXSB 3LDCA 2B14A 3IU3B 3SBWA 3ASOB 3J2PA 3L3IA 1AHKA 1SETA 1G7QB 2EIMB 5ITZA 2VH5H 5I24A 1IBDA 3QWQB 3RVXC 3QWOB 4GRWH 4AENA 4YHIA 2NDFA 2DQUH 5D1QA 4I0PA 2J88L 3T09A 3UCQA 3GB7C 1DFBH 3H1IH 2X3BA 4IRZA 4MNQE 3QDJD 1N70A 1QFWM 1E4JA 4DTGH 1KBHA 3KXFA 1EZJA 2WQXA 3FAWA 5BZDB 2DYSB 2WV3A 3T1WA 1NC4B 2XUMA 1TVHA 3EF4A 4Y16A 5DWPA 4OD1L 3CLEL 3HNTH 2AV7B 3TYGL 5K93A 5J3HD 4MAYB 5EOCJ 2XN9E 3GMPA 3NJGA 4AEFA 1VQ4V 5SV4A 4OJAA 1LP9B 5CJ5A 3D9AH 4NDMA 4RGMB 1RD6A 1U3YA 2NY3D 4FJYA 1R3LC 1R1BA 3JZYA 4OCLC 3U11A 2PTTB 2O5NA 4G72B 1SQBH 1RM1C 3F7VA 3HN3A 4WUUD 5T1DL 2A3QA 1G1XB 2YICA 1UCBL 4K3DL 4KXZI 5CD3A 4KMLB 5MEQA 1IM3A 2FSEA 2PCFB 3CXDH 3MRBA 3O6KL 4KI1A 4NSKB 1HKLL 4XVTH 2XWRA 3TXQA 1CGVA 4U1LB 1RVFL 1N3NA 1GJWA 2WQUA 4FKEA 4LLYB 3HBGA 1NGWA 2WBXA 2F1MA 3AROA 3CPUA 4DO2A 4LCUB 1UD6A 5JUEL 2Z92B 4KX7A 1CLYH 1RI8A 1E4XI 2WLIB 5BY1A 2AI0H 3N0PB 2ICEA 4MCMA 1UACH 4WWKD 4Y1AE 4XNAA 3ILPA 5AOJA 4XPHL 3W0WE 3EZJB 4ZNEA 4TUOB 1HTYA 4PTUB 5IQ9B 2WLNA 1RPRA 4H2AA 3R4RA 2VR9A 1D9KA 3UTOA 3BA9A 1W72H 3NFSL 4K0OA 5AW9B 4EN3C 2XV2A 4P04A 4FERA 4AQ1C 4MDIB 4ZDHA 4NWTL 5TGBB 3GMOA 2QTEA 1JGUL 1LJMA 2OZNA 2X0VA 4NO3B 1JIBA 5IWLA 1HE7A 4G8EB 1FAIH 1P4IH 2HKAA 5DJ6B 4D94A 4HU8A 3BAEH 4HCGA 4FJ6A 4Z3GA 4KO5A 4NBYB 2DYPA 1UUSA 4KRPB 4QTHA 4WWKC 3FRUB 4XVUD 2K7PA 3LN5A 3MNMA 2WJ5A 4TV9A 4DK0A 4JF3A 3B4NA 5FS5A 4N6QA 1JBJA 1A1OB 2H3OA 3RJQB 2XXFA 5IJCC 3Q8FA 4FLWA 3BAXA 3H3BC 4JYAO 2G3XA 3BAKA 4LSSH 2F53D 3II3A 1HH6A 4LWSA 5F8QC 2DM7A 5JOFA 2WB7A 1F4MA 2IWFA 4P46D 3TGXA 3VQLA 5E1IA 5FFOA 5BRQA 3GJFH 3L3KB 3ARYA 3KH4A 3BY6A 4V1DB 2Y1AA 3UJJH 3KW8A 4J6RH 3RPKA 5B1KA 1M9SA 1KB9K 1JF1A 2BDNH 4P59L 4HP5A 5F21B 4X65O 1JD9A 1KN2H 1G7PA 3B1UA 5SX5K 3FHQA 2AJXH 4YH6A 3EUDA 2LVEA 3OEHG 4J3WA 3VFMA 4PU2A 1Z6JT 3LRGA 3WTVA 1I5YA 2ITDA 2ZCLH 1NIFA 1CLCA 1QR4A 3D39B 3ZZSA 3VXQA 3VXUD 2Q7YB 5HDBE 3LKPB 1GN4A 2EH8H 1LQBC 4U3CA 4PVBA 1L3WA 2ZXAA 5FO7A 3TXAA 5D5ME 1E1QG 2CUGA 3EYOA 2P6JA 4N5EC 3A2FA 1TT6A 2EICA 5BRZB 5EWIH 5I1IH 4JCWA 3QUMB 1GC1C 3IJSB 2DQUL 4LU5L 5IJKA 3EDFA 2Z0BA 4G6JH 4CSZA 2AC0A 1FZKB 2R23A 1RSOA 4XNXH 4JFEA 4D8OA 2EYRB 2QSCL 5ECJE 3N42B 2WCGA 1YPZB 2BW4A 2P46B 2ZXCA 3TCLB 1KUMA 5I6NA 4CGUB 3P3RA 2P1YA 3E2HC 3QI9C 2WJ7A 2OSXA 4WEEA 1PAMA 1NA8A 1R3HB 1FE8H 4KUMA 1SJVA 1WUNT 4R6ZA 4PGCA 5HYFA 4Z7OB 2MHAA 3LXBA 4BK4A 4F7TA 1UB5A 3I3BA 3MBWA 5HDBB 1O6VA 2PY5A 1TJIH 3N44F 4OGYH 4PJCA 3HPLA 3CK0H 1MVUA 4FMTA 1ZHLB 1O0VA 3EH5B 3FT4B 2N05A 4JM2D 2ZOLB 3DV6B 4R90H 5J0BA 3RYHB 4N2GA 2WVVA 5GS1B 1TFPA 4UT9A 5AL8A 1M9WA 1E3ZA 3S96A 3QNZB 1HQRB 4MNHA 1R6VA 3HG0A 3L5JA 3ZGIA 3BGFC 5KG9B 2IWGA 2PCYA 2PR9A 5I18H 2B59B 3F5WB 2CJUH 5DWUH 1SXBA 4FLSA 3K46A 3QEUA 4R9HA 3SKMA 1HIML 2A73B 5A3ID 2PW1B 1Z9OA 1QOKA 4IBLT 3NZ8A 2ZT9B 1ZLSL 4B3TB 2BSKA 3N27A 3ZHUA 5KA5A 2HUEA 4WSGA 4HEME 1KBBA 4M4RB 2VE6A 4PP1C 2OXHB 3WS3B 5GS1C 1NZRA 4QXTA 3KGRA 5C8YB 4MQXC 1A7QH 43CAB 3U0TA 3NSDA 3IN2A 4YDJB 1AKJA 3VFOA 4OJFL 3Q8AA 1BQHA 2ZZUT 4HPOH 1OGTA 1UADC 4X80L 5KN5B 5LJYH 1N0XH 4AUJA 1FV1B 3ZHVA 1FZJA 4KUZL 4ZZKA 4YLCA 5KJ7E 3X13B 1J7VR 3HG1D 3QO5A 5DVPA 3S36H 1WAAA 1E8WA 2F54E 1PLAA 4DW0A 5IB3A 2CBTA 3QIBA 2WYTA 2BJML 3MTRA 3Q05A 4JPSA 4XAKE 2CIKB 4N86A 3QPKA 5E4IA 5T3ZD 2SEBA 1WHPA 1A9BA 3CCSV 3WI9A 3RWCA 1EVUA 4ZX6A 3SPCA 3MCYA 2DJUA 2LHAA 4LHUG 2WP3O 5F7UA 1TJIL 1QWHA 4GRLD 4I0KA 4OT1L 3FOMB 1F6AA 2IBZX 3O3AB 5EIBD 5A2KH 8FABB 1JTOA 4N9GB 2H4EA 3UTSD 1MOEA 1OAXL 1B90A 3KPMA 4R26L 2BVUA 1NCTA 5DQDL 4RUEA 3JWNC 4ANKA 5KVGH 5GTHZ 3BPZA 1T6WA 1IC7L 4EUPA 2EXYD 4ZNCD 3BZEA 1BSMA 2QWPB 2O5ZH 5CMAA 5ITBH 4BA8A 5ILTL 3PP4H 3EGSB 4GKLA 2XASA 5AVUB 4JZJC 2GJRA 4KJWC 2Z5UA 1MIML 2CCLA 2DWDB 4HK3N 1KTCA 1S7SA 4XC3H 3I6SA 3NTCH 4KKQA 1KBKA 2QSCH 3SSGA 3EJQA 3KLQA 1IXMA 2YD2A 2R56H 4IKLA 4U6TA 5KJ4A 3PWPB 3B5HA 3GS0A 3DX8B 5KSVA 3F00A 1EO7A 4PRIA 4G6MH 1MSDA 1AGBB 1HXKA 2Z4QA 1IDSA 3H6JA 1XT5A 3PWPD 2ZUQC 1M2VA 5EN2A 3V0WL 1BX2B 4ZMZA 3I74A 5BV7L 3P3YA 3TEUA 2XZQL 4WK4B 1IM9B 3IDGA 5FYKH 1M1SA 4NQCA 3KL0A 4AL8H 1SQXH 2YPKA 2XACC 3T3MB 2JCCB 5A16A 5JPMB 5JW4Q 1HWHB 1W15A 3CDZA 1VZGA 3Q8EA 2QTVA 2SODB 4JQXC 1CZ8H 2BZCA 4OY9A 3JAWB 5IOPB 5DF0A 4E68A 1WDAA 4QCIB 4J3OH 2UVEA 4XRCA 3S2AA 2J8UB 3RA7L 2W9DH 3UROR 1NGYB 4KV5F 3U7YH 2B2XL 2XJKA 4IS6B 4UM9D 5AW8B 2GK0B 2HVKC 3ZMSA 4HWUA 4OCSH 5FGCE 3TJEL 4J3XA 5EIIA 2MKWA 4IIQA 2UZYA 3BGAA 1RJLB 1INQB 2E9IA 1WCBA 4ADIA 1Z2KA 3NEXA 4QNPE 2AEOA 1Q1JH 1X7QA 3MROA 5E8NB 5BZBA 1XDTT 1ZDQA 5D6CA 2GSIB 25C8L 5IMMA 1M3IA 2CJUL 2VUKA 5DWUL 5AVVB 3QPQC 1OM3L 1MWAB 2C7FA 1PL0A 3KHOA 3QSKB 3GXIA 4JZNB 4U3SA 3GUTA 1IEHA 2CLZB 3JAKA 2HN7A 4MW3A 4B9JA 4Z3FA 4LPCA 5KANI 3TFKD 1CF8L 4HMDA 3O6FD 4CBPA 1AXIB 1A9BB 3LPWA 2CDEB 3NIFB 4BWWA 5IT9N 2OMBA 5B1JC 1CQYA 4HD5A 3OHMB 1NDMA 4F91B 4XVUC 2VDPH 4ZBMA 3Q4HA 1DJYA 5DJCA 3LXCA 3ZDYB 4PRPE 4AG4L 2D7PA 3TOPA 2F15A 4XN9A 1J5EB 5AOLA 1BVNP 4F80A 1FZJB 1Q0XL 1ZXKA 3OL2A 3OMNB 4PJXF 1T1XA 2NLJC 4ZUVB 4UQ3B 2JVDA 4KY1H 4PREA 4OH2A 4DNLA 3MXVH 4M8UA 2XT9A 1UA3A 1GN6A 5J2UB 3E8VA 2OW7A 1DJSA 3OR7B 2GSGB 3CXFA 5IT2L 1O6TA 4X89A 5F9JB 1TFHA 1NUNB 1SLXA 1INDL 2XFXA 2ZKXA 3G04A 1I3GL 4PDMA 4PA3A 4A67A 1ZLWK 1OF2B 3Q9QA 2AERT 5D72L 2FQDA 2AQTA 1TZHB 5HHXH 3SBQA 1MCKA 4BH7A 2ZJSL 2YAEA 3P2TA 2EILC 4LT7A 1HHIB 3BO8B 4PLKD 1F8TH 2DOCA 1L4IA 3L3HB 3CWGA 3LV3A 3O6FA 2P8LB 5FCSH 5F9AC 3AUVA 4OX9O 2XKUA 4Y2DD 4BQBA 4D9RD 2FR4A 1WIOA 2Y7MA 1LUVA 4LARH 3PQYE 5GRYA 2W9DL 3FU6A 4F6RB 1V27A 5TDOB 1NGZB 1U8JA 2E59A 3BEVB 3FQXB 4HUXA 1U41A 3FB8B 4O51B 4MNGE 2ADFL 1S8DB 1ML0A 4GFTB 4B7KA 4J6IA 2CG9X 3L5WB 5EZIH 4H33A 5ILTH 3HNSH 2NY5H 2CUHA 4TUKL 3ETGA 5C0EB 5JOPD 4MCYB 2I5YH 3AY4C 3KW7A 4KRNA 3U7WH 5ACMA 5FFLA 1RPUA 4AYFA 1Y74A 4HXAL 4YE4L 4AKPA 1ZHLA 5IQLA 4JFYA 3ILQC 4IK7A 4OIBA 1N0LB 4QHLA 5AVQB 4YXHL 1CU4L 3MV01 1A2YA 2ZCHH 3MBWB 3APDA 2EEFA 4O4LA 2C9AA 3MNWA 2CO6B 1GS7A 1JTPA 5CB4B 1ZIAA 4F9PC 3VGHA 3X11B 2E9BA 3BX7C 4MT8A 4A7VA 5ADOL 1UM4H 2XRAL 3IRZA 3P4MB 2GVYA 4S0TD 1NCNA 3V7AG 1SZTA 2X3AA 1X6LA 3N1QC 4YWGL 3DXAE 1J88A 5HGDA 4KC3B 2EJ1A 2Q8AL 2LU5A 5J9PB 1E9OB 3DGEA 1KGJA 4DN3H 4RDBA 5F88B 3FZUD 1IAII 1WTGT 3QWRD 3TZVD 4F33A 2BP3A 2Y4TA 1G9NC 2Y7SA 2WOYA 5EBLB 3D39D 1SJHB 2MCPL 4JFFD 4JPVL 4PI0A 2YPVL 3WDJA 4QHNA 1XGRA 1R3LB 4N24A 2Z31D 2R2HA 1CICB 3PWPE 5FO7B 3W9EA 3QS3A 4HKJA 3KEDA 3K8MA 3Q2NA 4JJ5B 2UXVA 1GY1A 3MNZA 4WU7B 1IBLB 4Z77B 4HWZB 4HEPG 1Z5WA 1OGSA 1ZLVK 1SNRA 2ATKC 3BISA 3EUUA 3BWAB 1D2PA 3QQNA 3RAJH 3QDAA 3ROOB 4FFWC 4JFHD 1QR1A 3SPHA 2HB0A 3U1PA 3MUY1 5B21A 2FB4H 5JPNC 2Y9RT 3WL9A 4HJIA 2Z91B 1R24A 4D0BB 4V1DA 2B4CL 4P5MA 2PYEA 2E7LA 3HNSL 3VFRA 2AS5M 2KG7B 1ZK5A 4NJ9L 4OQTA 1X9LA 1EEYA 2GAZA 3SKOB 3VXRD 4LWSB 4N9OB 4YHZH 4HXAH 1X5LA 3BVNB 3MDJA 3MRJB 3PJSK 4IMLA 4C7UA 4LKCA 3VXUE 2DPKA 4D7TA 1B0GB 4ONGL 3GHEL 1RHHB 3MLVH 1VCBC 3VBBA 2VN7A 1GIGL 1PYWB 3MXWL 1RZ8A 1RUPH 4G6KH 4WNJA 5IT2H 4YBLB 3R0NA 4ELDA 3AM8A 3CE1A 1GN2A 3U4BL 1WC7B 4FL4C 3LZLA 5DJ6A 2WPDG 3HRZC 1LUWA 4QNPF 4DR3B 2V2WB 1A3QA 5IEHA 1U8PB 1IM9D 3R19A 1F8TL 1CB4A 3WKPA 2AVGA 4ZOLA 1IC4L 4FXKB 1AJQA 3D05A 5JJEB 1D9KB 2E56A 2OCFD 4TSAH 3PV7A 5C6PB 2ZG3A 3FFCB 3VXMD 1FG9C 1M05A 5J06A 3GLDA 4LSTL 4QRUB 5JXEA 5ICXB 3F65A 3QFJA 4JI7B 5EZIL 3E9TA 3DOSA 4JQXA 5DR5L 5CZVL 2V5TA 3EJUA 4QJ3B 5DT1L 1EXUA 2YMOA 5I1KH 3MVSA 4K5NA 4MA8L 4NNPL 3FCSB 2CGRL 2QGNA 2L3BA 2NY7L 5FNVB 4CC6A 1QFWI 2RGSA 2LP7A 3KBHE 1OP4A 4X4ME 1TUEB 3AK1A 3SPIA 2CALA 2PGGA 1PNMA 3IRPX 3SDCA 4WV1B 1GMEA 4I3SH 2OXGB 4I9WA 1HI6A 1Y67A 2Y5EA 2VERA 4EVNA 2L4OA 4JB9H 1AQKH 1IGYB 3O2WL 3UXFA 5LP6C 1IXBA 3N2JA 5IVXA 5CXPA 2G5BB 1EZLA 2X4QB 1MHHB 3V4UH 4P5TB 3TBVB 4G9FE 2RQ6A 4F6RA 2OP4L 3WS6A 3ZDXE 5AW0B 2XWTB 5E9DA 2X87A 3ELAT 2PETA 2JQAA 5J89A 5HGBB 3K0YA 2UUDK 3P3TA 1JNLL 2VN6A 3T6ZA 4ZUSA 1ZE3C 5KX5A 3EOAB 1RK0B 2BVYA 3D3VE 4A63A 3GM8A 4RZKA 2ARHA 4FTVD 5FW7A 3LKQB 3RB5A 4DO6A 5D1QB 3NOIA 3ZL4H 1PNCA 4LLQB 3BSZH 5G4OA 4GXVL 2Q7EA 4U1GB 5F9JA 3UMTA 3CJHB 1NQBA 3K59A 1JF6A 3GMNA 3ZKXB 2NR6C 3NK3A 4OT1H 1MY5A 1V10A 4QIRA 4KKBD 3PHQB 1I8MA 1JRHH 3KDPB 4ZUVA 1B4RA 1F13A 2CXKA 5DJZB 5D7SL 1TEGA 3NJXA 3TO4D 2ZUUA 1WZKA 4UCFA 4JTDB 2MFNA 3AREC 2DWEB 3NJVA 3QJFA 2RJMA 4TLTA 4NUGH 3BVDB 1OGPA 4FA7B 1E5AA 5DK2A 4QT5A 5E1HB 4YSRA 4K23H 1YNTB 4JQIA 1HQ4B 1JDDA 4JZOB 5E2VH 5A2JH 4MNGA 3OFNG 3M46A 1ZAGA 4BK5C 1JZ7A 5F7YC 1YF2A 3JV4A 2BSDA 5BS0A 1AOZA 5BW7A 2B1GA 4OF7A 2WIMA 1CFQA 4IGBB 3VRJA 3G6AB 2JQMA 4DV2B 4YDIH 3UTZA 1MF2L 5KYYA 5JR1L 2F4VO 1G9HA 2CAKA 3SPGA 3QAZC 4WI3A 3TLRA 3E22A 1CTNA 3VTMA 3MRNA 1M1KW 2XSKA 5E8NA 1IVLA 2DMBA 3L3JA 3MFGB 1CD0A 2NX5B 2O6EA 2GIXA 1L9MA 4ELMA 5TISZ 3TBYB 2K3TA 5CILL 2K4AA 3WTXA 4X5XA 4Z95H 2AJXL 2H32B 1PEZA 4KZDL 3QJTB 5DFWH 3P9WB 4IU2A 4F93B 3OGOE 3NPZB 4HIHB 3SJVD 3VCLB 3GMRB 3ZHDA 1BZ9B 4MX7A 4RGND 4CC1A 3ZRWA 5EBLC 2CU9A 4DV4B 2E74B 4RWHA 3VFSA 4FAAB 1AQMA 3I6KA 3U9UB 2PYJA 1R73A 2RN9A 1TPXC 1LQSR 3L70H 3VE0A 2JLPA 4AYBA 4KI5E 1IM9A 1OL0A 1A8JH 1KJ3L 4JCMA 4U1KB 4OKVA 4XNYH 1PDKA 3QEQD 2VQ1B 3TZVB 3B2VH 1F3JB 3T4AC 1Q86W 4P0DA 5F8RC 1KCSL 2XLLA 2WYHA 4PJCF 3S3XA 2ZCKL 5L8KB 1UWYA 4NX0A 4J42A 4PRHE 3E1F1 2YPVA 5I1KL 1XHHA 2ATKB 3H2WA 4IKKA 1IBMO 1FO0A 1TJGH 2DDQL 4YXWG 2XN9B 3REVB 3HB3C 3R0MA 3MN8A 3VFPA 3U1SL 3WNKA 4L8DA 3DV4B 2PLTA 1I4FB 4AVJA 2DMCA 2P4VA 4HXBH 1AZZC 1KV3A 2D7MA 2LTQB 3DHPA 3TJHD 5I75B 2VKWA 1BBJA 3NJMA 4Y1AD 5IROA 2LFGA 1QSFD 1RZ7H 3BMWA 4M62H 4FADA 2UUBO 1WWWX 5KHJA 2QQKH 1E3XA 3ARSA 2GI7A 5EMYA 1CL7I 3RUGE 5MEPB 1UURA 4OLVH 1D7DA 3DSNA 2X41A 2DQTL 3EOBB 3SQBA 4PJ5A 1UYWH 3CFCL 1UJ3A 1E90A 4K94H 2WSPA 1L7IL 1MCDA 4UV7H 2JKRM 3V0WH 2D2CC 4Z7VA 1IEAA 5BMFH 2DW5A 1BMWA 3UKMA 1CYWA 2AXJA 4UOJA 2W95A 4M3JA 3ZL4L 5FK9A 3GSVB 2Z0AA 4TLKA 3L3DB 5IB3B 4N0UA 1SM3H 4RMSA 3NPSB 2I7OA 1RZKL 2I9TA 1I8LC 4YHYC 1DBBH 3E6HB 2FVNA 1NT2B 3CMOL 4HZLA 4R97B 4XPAL 1UACL 5TDNA 1YJNV 4HH9B 4PGBB 4Q6GA 1CDCA 1XAKA 1L9QA 2JIXD 3AW5A 1MFDL 1XH3A 3CFDB 2IMNA 4X1IB 5E99H 1MCJA 4P5RA 3DK0A 1CICC 4PR5A 2FIKB 4MZ3A 4XN7A 3HNVH 3WV0A 2GJ6E 4JGNA 4DIXA 4M1DH 4M4RA 2EDKA 4AVHA 4AQ1A 5HDLA 1YUHB 1JCHA 3ZRVA 2BSKB 1JFFA 5F9DC 5JQGA 3RGVB 3QUYC 3M17B 2XWZA 4JVUA 4PCYA 2DWEC 5J12B 1IGMH 3VWKC 4P23D 3D3IA 2BNRD 3IDYC 4NAMA 5L4JA 4DV5B 3T0DA 2FK9A 4E4EA 4LDEB 2VQ4A 2ZE8A 3S48A 2DL9A 1YDPA 3EYSL 3ULSA 3MOQA 3LS4L 5LXTA 3B43A 2J2ZB 3RNQB 3S96B 3L3OA 4OZHB 4OV5B 1TQSA 1YQVL 1GYVA 1OAJA 2EDMA 1KYAA 2IFFH 4XMXA 1BYNA 2DF3A 3AITA 2G38A 1SFHA 3SZ6A 1E42A 3O2DL 3IETA 4OLWL 4R7DB 5CILH 5KS9B 3TIDA 4QY8A 4APXB 4O00A 3GXFA 3LKOB 4HIJA 5KSAD 2EZPA 1XF3A 2YZ8A 1E4WH 2EZOA 1A14L 1FNGA 2BXYA 3FC8A 1S9YA 3V6OE 1FXVA 3UPRB 3SBRA 4YSEA 4ZOCA 2A77H 1K2DA 5D7LA 2OCCC 2G9HA 3WGUB 1URZA 4IIQC 5GRVL 4UCSA 1WVZA 4JY4A 5FF6B 1KYOF 5TQ0L 2HWZL 1RURL 2JELL 3Q13A 4OI9A 5FA4B 3G80A 1HZLA 2NXZC 5MERB 3QDGB 1FBIH 1WITA 4S1SL 3RRQA 1VF5C 3U1QA 1F4WL 4IBWA 2NRDA 2ZG2A 4JO2L 4F58H 3K6FA 3OKYA 3QJXA 1T0NB 1X5HA 1QSFE 5LVEA 3DDFA 3KCPB 4LQFL 4AE0A 1BEYH 2FWOA 1ANUA 2H2PD 3HAEB 4V2BA 4Y4FB 2K1EA 4K0KO 4G7YL 2HVJB 1G8MA 1TJXA 1VB9A 5AVYB 1BWMA 3FF7A 4PS3A 3UTSA 2P49B 5EEVA 3F12A 2TSAA 4FXLA 3BFWA 4O02L 4TRPH 5HGHB 2UZXB 2PF4E 4TVUA 1QATA 4I0XB 1XIWC 3IJEB 3SQOH 1GPOH 3N50A 3D0VA 4XAWH 4BKLB 3F84A 1DVZA 5T33H 1TNMA 4XP5H 1G1YA 1A7RL 1B06A 1II4E 2IV9A 3HC3H 1OGAD 4V11A 1T5WA 2EDNA 2Q7YA 3B8SA 5D7KE 5I6KA 5KJRL 4ZXBC 2VXQA 2YOAA 3JWNG 2OMZA 1K85A 1UHVA 1WA2X 4EIBA 4TV8B 4GX5A 3GSNH 4JG9A 1QACA 1MABG 4IOFC 1F3DJ 1U91A 3N5AA 2YS4A 2XTJB 4JZ2A 3DUSB 1AO7E 4XMKL 2XZCH 1NMBL 2GJZA 4FFYL 4IEFA 3VG9C 3JT0A 4M8RA 1ZT4A 2GBTA 2NW3A 4B27A 1A3RL 1GSMA 1SM3L 1GC1H 1TVBB 3VQMA 4ELME 4KTEL 3O6FC 2Y25A 4EXKA 3M88A 1JV2B 1MCEA 1AC6A 2F5AL 3FPYA 3K6DA 3MRRA 4UIKH 3LDEA 5JOFB 1DQTA 2DL2A 2FWOB 3IDJB 5EC1B 4JV5O 4XP6H 1XGUA 4KK8D 4NT6B 4Z3IA 3CE2A 3ABZA 4DK3A 5SWZA 1SVCP 4N2LA 3KZIZ 3C6EA 3QDGA 3T0BA 2VLKE 2V8LA 3U30C 2MTAA 4AQ8A 4B95C 5EU6B 2B1OA 2AKRA 3HUJF 5DT1H 4AQAB 3SGIA 1RU9L 5FIEA 2DJMA 4G8EA 4FLQA 3NFPB 1HNXB 2EJ7A 3FN0L 4BYHA 2Y3AA 4B0MM 1NFKA 4DP2X 3GMOB 4NPYB 4JQIL 1YYLL 4Q6KA 1THZA 1KMIZ 2HJLA 1XF3B 2EQDA 1BDYA 2I7SA 1K34A 1QRNB 3EH4B 3WYRA 2EIBA 2PR4L 4FQIL 3MRLB 5KBLA 5GRVK 2ZD9A 4Y0GA 5BOZG 1QU7A 3UFIA 3C6LB 1CGYA 2F0CA 1HEZB 2OL3B 3ARXA 5C09A 4RMVA 5A2CA 3F58L 1YDPB 3N85H 5F72S 1KC8W 5KHGA 1P4BH 4QAMB 2FBJL 3B2UD 4ADJA 3L1OL 1G9NL 5E94A 5TPWH 3KYNA 5GJSH 1WB8A 1YC8A 3ZLQC 3LQZA 3D09A 4TTGA 5M94B 5BV7H 1DFXA 2V7QG 4FFVC 2A6DA 1ORQA 5JTWA 2K7QA 4B9PA 3NN8A 1E6JH 3B9EA 4K71C 1MCCA 1M57B 4FYSA 4KPHH 2BFGA 3DJSA 3VQ2C 4WBNA 4AMKL 2DIBA 5TJWK 5EF1A 2H3NB 2I85A 2IGLA 3IFNH 1F3RB 2X70B 5I1JH 4G83A 1KXQA 1PU0A 3BABA 2BSRA 1MCSA 1PZSA 1ZLUK 4BFEA 3CQFA 4FFZA 1CFVH 2X53A 4PHZA 2B9ZA 2LVCA 1N26A 3QQDB 1OK8A 4PJ8C 5CWSA 1XNQB 4DUZB 4Y2DC 4YDLC 4HKXB 1IAMA 3P77B 4I3GA 2PO6A 4F4LA 3L7EB 5EU5B 1NGPL 5DRNB 3T0EE 3G6JB 3V79C 4MAYD 1R6NA 4I0PB 1BIIA 5F1IB 4HAGA 2B9AA 5DZAA 4J3TA 5J1AA 1FFXA 5B1JA 2W59A 1HH9B 3CCHA 3EJZC 1N0NA 3L3IB 2JI1A 2PZSA 1J0KA 2K6WA 3Q0HA 4WNQB 3VYNA 4G1MA 1A3LL 5CBGA 3T4YA 3GBNL 3SQBB 3MREA 1SQQH 3FZUC 4FP8L 4LVHC 3SE4A 4KXRA 1W0KG 3BPLC 3FBKA 4YXLH 3A23A 2YD1A 3MV11 1DE4A 4AL8L 4Z3TA 3OG6B 3H7BA 2YQGA 1XF2B 3J81N 5B39A 1LO5A 3DGCR 4FQIH 4Z3JA 1SRYA 1IT9L 3TBSB 4AKOA 2ZIDA 1NCCL 4J1UA 3OHXA 5BR8B 1I4FA 1RUML 1JHKL 1B9KA 5IVXF 5HHOE 1V54B 1BZ8A 2H0EA 4F57L 1WYJA 1RIUL 4JHBA 1XREA 1U8HB 1YEGL 1E28B 1JPSL 3CJJA 3IJHA 3ALWA 3OPZL 1HINH 2ZX7A 5EOQL 4JFDB 1EEQA 3VFTB 4Z23A 4DT2A 1OTTD 4L37A 4G11A 4BXSV 5AG9A 4KXBA 3TGUH 1NBYA 1P7KA 4JPWL 4WRLA 5GGTL 3EXJA 2EUZA 3LH2H 4G9DB 1JGDB 3TZVA 1FP5A 4E5XB 2FNBA 4XP4H 1KTLB 4N2NA 4DKEH 3DRQB 2VRZA 3KPRA 2ZQKA 1FAFA 2DIAA 3I6KB 3O8XA 4X6BA 3APQA 1X5YA 5C0AE 4IGBC 2UXFA 3EOTL 4IRSC 1CF8H 2CRMA 4JY5L 4FZ1A 2VDNL 2JB6A 3MV7A 4AGMA 2HP4A 1SVBA 5M7QA 3QUXA 5DFAA 4H8VA 4X9FA 2DLEA 3S35H 1P7QD 1UPGA 1OAUL 4JFHE 4CH5A 3DO3A 3J7AU 4P23C 1GGIL 4KJPD 4EI6B 1YNLH 2NX5A 1MW2A 3PL6A 2A9CA 5C86A 3OAAG 2P52A 5HJBA 5I19H 1CL7L 1XQ8A 5AVZB 3CC1A 3QRGL 5F96H 2HMIC 3P9LA 4AGQA 5IB2A 1OSPH 2Q67A 4X99A 4XE5B 2R1WB 1S7WB 4JYYA 1MUJB 2XY2A 4NPKA 1NBVL 1XGZA 1GH7A 1NAKH 2PCPB 3L9RB 5DJ8A 4KNTA 2XTJC 4X0KB 3FQYA 1OCOC 1B88A 5CA0B 1QTSA 2VDLB 3D4CA 3ZT6A 4EDXB 1CE1H 3LNEA 3NRFA 3DA0A 1NCGA 5JJNB 3JV6B 1JPFB 4B3MO 3K6NA 4X83A 4JZOA 1AR1C 2WXIA 1JOIA 5JMOC 5AAWA 1NMAH 4UTAH 1LO5B 4JRYE 3BZ4A 4AQYO 2H8PB 2J6EA 3CDFA 3F7PC 4UDUA 2P44B 5EDXA 4ALAH 1T4KA 2RALA 3LPPA 4OSUH 1VGEH 1PZUB 1F1DA 1TYRA 4NUPA 2R70A 2QKIC 1G5GA 4B97A 2W60A 4JL1A 4LLUB 3IFLL 5E99L 1MELA 5LHIA 3M99B 4KRLB 3UZEA 4YOKA 3WFDH 1OCCB 1MFMA 2PXYC 1ZXQA 4GAJL 3V10A 2LGNA 5FYKU 2PYFA 3MA7B 5EOCL 4YSAA 4C59B 1JGEA 1TQBC 2YSSB 3RYIB 4IGGA 5EUOB 1P9MA 3QDGE 2G0LA 4PJXB 1J5OL 3QQDA 4QRRB 3JASB 3QIWA 3OB0H 3D9AL 3CFKB 4B41A 3SE3A 4R8WH 3FYEB 4RISL 5F1NB 4ZTPL 4DV0B 1PY9A 2VM3A 2AXGB 3B3BA 1IV8A 2PABA 1XHXA 1J9TA 1HYRC 1QBML 2XYBA 3M7FB 5MHSD 1AACA 3W9DA 2YGNA 5FYJE 5KHIA 4JANB 3AG4B 2IH3B 4NNXA 4PMFA 4X6DB 2COVD 4EVNB 2X9XA 2EE9A 2VDOB 3L2MA 2XU9A 5IY5B 4NIYE 3G08A 1CL7H 4K8XA 1GS6X 3BUPA 4KOBA 3S35X 1ORQB 3QULA 4LCIH 5D7EA 4HFWA 3T65A 4K9EL 3PWNA 1KQSU 4B50A 4DZ8B 3PPEA 5EK0A 3LQZB 2IANA 3IKCA 2ADYA 2RMKB 3UTQA 5T5FA 2AQ2A 2F8OA 1B6QA 3HKCB 4L4TA 2FGWH 3ARED 3PP3H 2Y7QB 2MPAH 3Q6GH 4L8BB 4YGVA 1MI5B 1HHJA 1N4XH 1KP3A 3MDSA 2R1WA 2DQEH 4PJDA 2HYMA 2Y1ZA 3QFJB 3CRMA 3TN0D 1AGEB 4TF4A 5E6IC 4LVOC 1CLZH 1UA6H 3P9LB 5GRUH 5MENE 4IK6A 4JRYD 4HUWA 1QBZA 3PL6B 4WFBV 3RY5A 4HCIA 3OKLB 2XAJA 5DTFA 5BPPA 1BQLH 3QCUL 4J2XA 3WNNA 2H6OA 4XVSH 3T3PB 4H40A 4YFDB 2LU4A 4DEPB 1ERNA 1QBAA 3WTYA 3ARBC 4PV8B 4DV6O 1XSJA 1O7VA 4NQCE 4AZ8A 4N0FB 1MG2C 4NXMO 1TQWA 3KYMB 3ZRFC 1XMQO 3F7KA 4LF5B 4RNRA 3RJOA 4QRPD 1G1OA 2IM9A 1BVOA 3M1OA 1DF4A 3LB6C 3FTGA 1XGUB 1NSNL 4YZWA 4XMPH 3T77B 2WSSG 3NEEA 2QPFA 1A25A 5C0CB 1BIHA 3O3UN 1PFCA 4CKVX 2Q69A 4NIKB 1G4MA 5HHMB 3VA2C 5DO8A 2QKIB 1PZ5B 5F97E 5KTEL 1KNOB 3EGXA 4MD5A 2R1YB 4WGVB 4XN1A 3WL9B 2X9ZA 1FH2A 4PVNA 4JLRA 1I7ZA 1NAMH 4X9HA 4N3UA 1QBLL 3HZYB 2DQIH 3C3SA 4GUOA 3A8TA 4HCFA 3PDDA 3N1GC 4NYLA 5I75C 5AAMA 2Z31A 3N2GB 5AKVA 5HDWA 1N32B 4G7RB 3CWBH 1XCTB 5IMKB 3MREB 2ZIOA 3HKBB 1AGCB 4HD9A 3QORD 3ZL2A 3WENA 1CICA 4TMPA 1H8HG 4NFBA 1NIDA 1WAZA 3IJEA 2PN5A 1H3VA 2QEXV 1FFXB 3I2CL 2FO8A 2P5WE 2BP5M 2QQNH 3EBHA 5IW6B 4HNAA 3FT3A 2ZPKH 3IAGC 4GMSH 5TE7L 1UXMA 4HKXA 5I1EL 2YKKA 1IAKB 2X6UA 3ILQD 1AROP 1AGDB 1KTKE 2VLRA 2YC1A 3NCWA 2E7MA 1JFQL 2QR0A 2VDLL 1DL7L 2CHNA 3U0WH 1E0OB 2GKIA 4X1YA 3C5ZD 3GGWA 4OFIA 4WI0B 1NWOA 3O4LB 3Q5OA 4U1IB 3FB7C 4ZHQB 1FFOB 4DUVA 3TXSA 1H19A 2AZAA 5HPOA 1L9RA 2QPEB 3H01A 4GW4B 3RNKB 4O4LB 4LLDA 5AUMB 3GSXB 1CDUA 2BW5A 1GM7A 5E2JA 4ZAKC 1M71A 2Q5BA 4PELA 2YUWA 3KBFA 5IP4A 2FL5A 3PFQA 4NAJA 3BSZL 3OQRA 4F7PB 3DJZA 3DROA 1FUNA 4APXA 2WUCL 4K55A 3D3QA 2I9LA 2P28B 4R7DA 4OCYH 4P2QA 5E94B 3SY6A 4HETA 3OKMA 5E00A 5E56A 5DUJA 1JG9A 1WICA 1RK1A 4O58H 4ZKIA 4M8QA 4KZCA 2BSSB 3CNKA 3FB8A 3OJVC 3TNMA 4HUXB 1IL1B 3DXRA 5L3DA 4NEHB 5I1JL 3HE7D 4BE6A 5MI0B 2HKOA 1NGQL 1CXHA 1OAYL 3LKSB 4YDMA 1IARB 1YTFB 4FZ8H 1KLGB 2PI4A 2P8LA 4LSQL 3DWTA 3EW3B 4LCYA 2VWEE 1LGVA 4WUUE 3QZBA 4E2OA 3BD3A 4X6DE 2ALAA 1OF2A 5J8OA 3ERXA 3K1DA 1XIWA 2N7BA 4WFEE 5DLML 2X1WL 1HCFX 4PRHD 4P2RA 3IGKA 4G5ZH 4Y5VC 2N0MA 3D36C 2ZCHL 3QRFM 4BJLA 5T3ZH 1Q90D 4YNYB 5LGHL 4Z0BH 3I56V 4MVMA 3GRWH 4P9HH 2E8YA 1MAMH 1NFAA 2BJMH 1JGIA 3WY2A 2WN2A 3VH8B 3L95B 2GBUA 4Y19D 1C9SA 1BP3B 3QO7A 4EKWA 4Q52A 1I1AB 5EC1A 2C1PB 3RHWF 2NW2B 4FTVB 1AVMA 3IBEA 3QYCA 3HS9A 3WO4B 2ATAA 2NX5E 2DI7A 1KSRA 3ETBJ 5I6XC 1UCBH 3DX7B 3U2SA 3WJMA 4TQFA 1ECYA 4UUJB 3MV8E 1JPXA 2EVFA 2CO4A 2DJ4A 4KNSA 5HVHC 1B3JA 4LC1A 4PEEA 3X1FA 3GI8H 4I9WE 2VDKB 1KTJA 1BFTA 3JAKB 3UABA 2XTSA 4PJIB 2YPVH 3SEPA 4M5TA 4KY2A 1MXDA 4G42A 5GISH 1G9EA 3TA3B 2P5WB 1T7YA 3QIBD 4XOCA 1SEQH 2Q4PA 4R7NB 1SZXA 4DYLA 4F15B 4O5LL 5TTRA 2G4GA 2EDTA 4NTXA 1UM5L 5DMJB 3GFUA 2IFGA 5IESH 1I31A 1DUZA 15C8H 4I89A 3HKEB 4ZFFB 3OKEA 3EJTA 4P4KC 4NQXB 5F9WB 3RVTC 5EPMA 5KVGE 4CMHC 4CS4A 2UZYB 3CC5B 1OP3H 3O4LE 1UT1A 4B0MB 4ZX3A 4L8DB 2ZF9A 3B5GA 3QORA 1W2KT 2FATH 4OJDH 5K9OB 3OEEG 2F7RA 2AQSA 3G5YB 2VOTA 2KC0A 4X9BA 2BO0A 1WHOA 4OF6A 1IUZA 1QSEA 3K2MC 2CM6A 4DP0X 3WFCH 4PYGA 1L8DA 1NANH 1HDMA 1YNLL 3FUFA 4J8RB 3NSFA 2FTAA 3JWDH 5HDBF 1PDKB 5IROC 5A16B 3VWJA 4XWGH 3IDGB 3E6FB 3WDHA 4U1KA 4A2DA 3TX4A 1JE6A 3UTPD 4NHUB 1UKTA 5MERA 3I84A 1ITCA 3H9HB 1OWWA 4DO5A 3W7TA 1A3RH 2R69L 2O5YL 2VQFO 4PRIB 1L6XA 2DYPD 1Q9KA 3RPIB 2C9QA 4GNKB 3LS4H 2FO1A 3GI9H 4UCOA 4HIHA 1INEL 2QM8A 2NSQA 3UPRA 1ZCRA 2UY7A 1NOAA 2VZOA 1S7SB 3VRLE 3BESR 2OTLV 1NLDH 4G8IB 4M7ZC 3TIDB 1TGOA 3ZYOA 5CP3H 2V7HA 1CDJA 1AS6A 4XTRC 5GJTL 1QYGH 2QPDB 2HCZX 4LSDA 4A39A 2K45A 5DVNA 4P46A 3LNIA 4WJ5B 3C60C 4M6NH 3UJTH 5L8LB 3G5WA 3HMXA 1SN0A 5AVXB 1MCBA 1SYSA 2A74A 2FJFA 2EVIA 3EFFK 3HIZA 1MREH 3FOMA 2Q7HA 4UOQA 2HWZH 4FCHA 2XV3A 5DRXA 5DD3H 4MTFA 5C0DA 4UT6L 4HCRA 4J3OG 1LM8V 2XICA 2GUOB 2NQ3A 3AU1A 4LF8B 4BWAA 1PTZA 1TR7A 4DR1B 2J8HA 2WXFA 3MKKA 2RR3A 4R5XA 3CCEV 5E51A 5GGUB 1D5IH 1T7XA 1A66A 3BN3B 3GMQB 3SO5A 3U4AA 4L2YA 2BNUB 3ZJAA 5DHDA 3X13A 1SUJA 4DEPC 2EKJA 4HISA 4DK1A 5AKSA 4JI2B 2BP8A 3LQMA 1D7CA 1ZWIC 1U36A 1YQVH 3O9OA 4WKZA 1I8MB 3P9MB 5L3GA 1ZA6A 2BP0A 5HJDA 3V8OA 4YY3O 5D72H 3HI6L 2FYUH 2DM3A 2KKQA 1FYTE 4P07A 5C7ZA 3EH1A 4M1CC 3U0TB 3WIHL 2Y7OA 1KIUB 2GCYA 3F05A 3AG3B 4M3KB 1TYEB 3CN4A 4XNMA 1MI5E 3RWGB 3ZTEA 5LUMA 4HIEA 4L8CA 1U42A 4Z7VB 2B5IB 2XQBL 3NA9H 4KKNA 3D85A 4YUEH