3HB3B

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 73
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hb3B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3hb3B01
1XMEB 1QNIA 1MZZA 3FT0A 5B1BB 5IY5B 1PZCA 1KCBA 2YAHA 3DTUB 2VSKB 1TEGA 3D12B 4E9RA 1OCOB 1XB6A 1MG3C 1NWPA 3NJGA 4KO9A 1QLEB 3QJTB 2GC7C 3X1GA 1BXAA 1AZUA 3TU6A 1WA2X 1AZNA 1ID2A 3ERXA 1DZ0A 3QJSB 4DPAX 2H5UA 4HCIA 3HB3B 4HHGA 1KV7A 2YAFA 2PLTA 4JHUA 2CJ3A 1CC3A 1A4AA 1HAUA 1SJMA 2PCFA 5TK2A 4P5SA 5AKRA 4AKQA 4YSPA 3X1BA 1AS7A 1BAWA 3NJKA 5B7MA 1JXDA 1AQ8A 4E9TA 6PCYA 3NYKA 1AIZA 3TBCA 3NSYA 5PCYA 2W88A 4UF7C 2GB2A 1TEFA 4YSUA 2YAEA 1CURA 1JZJA 5I26A 2N0MA 1CUOA 3ABLB 1MG2C 3H56A 2H47C 1JERA 1BXVA 1AZCA 2I7SA 3N55A 1L9SA 2PPCA 4F2FA 2HZHA 1L9OA 2VW7A 3GYRA 5I5IA 1OF0A 1WS7A 2A3TA 1SFHA 5I6NA 3CG8A 3T71A 5D4JA 2JFCA 4HIPA 1JZHA 1ZIBA 3ABGA 1BQKA 3CDZA 4GXFA 1SHWA 4AX3A 2XVBA 5B1JA 2XX0A 3IN2A 4EF3A 1PZAA 1J5DA 3AG2B 1V54B 1OCCB 1L9TA 3FU7A 3QJUB 3HEIB 3ZX1A 2HRHA 1GW0A 2EILB 3EF4A 4YVUA 3H4FA 4KO5A 3EH4B 5E9NA 2GBAA 4ZK8A 2XU9A 1A3ZA 2BP0A 4MFHA 4YSRA 4KNUA 5B1AB 3RYMA 5ANHA 1ZPUA 2P80D 3OMNB 3AZUA 3T6VA 1NIAA 5A7EA 1J5CA 2XV2A 2XLLA 4PAZA 4UAHA 2IH8A 3FQYA 2EIJB 3PAZA 1IC0A 2I7OA 5I6MA 2FTAA 1X9RA 4G71B 4DP5X 1XB3A 1IUZA 4N8UA 2CALA 2BWDA 3TA4D 2EIKB 4A2DA 1V55B 3FPXA 1M57B 2FQFA 4GYBA 1R1CA 3MX0B 3IE9A 2FWLB 1V10A 1SF5A 2HXAA 1AG0A 3NJHA 3NP4A 2YAQA 4L0PB 3UGEA 4FA7B 1AAJA 1JZGA 1JOIA 1AOZA 2HX7A 4YL4A 2P80A 2IDQA 4G70B 1T5KA 3FYEB 1QHQA 1ZV2A 2E86A 3PLYA 2GI0A 4AKOA 1J9TA 2JXMA 2FNWA 4YVNA 1IBZA 5I6LA 1RCYA 2GSMB 3KW8A 1L9QA 3IEAA 1ILUA 1A4BA 3T6ZA 4HZ1A 2XWZA 3X1EA 3SBRA 2IH9A 4HCGA 4KOBA 4E9YA 1OE3A 2CCWA 2XUWA 2QDVA 2HLEB 4WKXA 1N68A 3BVDB 2VM4A 1B3IA 3NT0A 1PCSA 2VW6A 5B7FA 3ABKB 2X88A 4YSSA 5LDUA 3IBOA 2BP8A 2FT7A 4AKPA 3ASNB 1ADWA 1GS7A 2Q9OA 3KW7A 5FC9A 4PCYA 2PPEA 1W6WA 3AW5A 3G5WA 3FU9A 4P5RA 1BEXA 5B3SB 3T6XA 1ZIAA 1F56A 1W8EA 2ZONA 4YSTA 4F7KA 4GP4B 3X1NA 2AVFA 3SQRA 3V9CA 1IKOP 3SBPA 2HX8A 4BDVB 3GXUB 2DYSB 4BWUA 4G72B 3U25A 1DYZA 3NJMA 2TSBA 1SNRA 2WSDA 4G7QB 2WO3B 4CSZA 4HHWA 1L9PA 3MBWB 4DP7X 1PLAA 1JZFA 1AZBA 1E5ZA 4E9QA 1OCRB 3OD3A 5I5JA 3NJLA 3FS9A 1NIEA 3TBBA 1SDDA 1ZDQA 1E30A 5I6OA 1IBYA 3T6WA 2XXGA 3ZDWA 2FQGA 4A2EA 1ET8A 2R7EB 4ENZA 1L9RA 2PP7A 1NPJA 2QDWA 3WNJA 1KCWA 1J9QA 1BXUA 4HAKA 2TSAA 1JXFA 2BO0A 3FSWA 1OV8A 3H4HA 1NTDA 1PY0A 4A66A 3OMIB 1AZRA 2DWSA 2RACA 2PPAA 4DP4X 2YQBA 2W8CA 2QT6A 1FFTB 2YAPA 2UXFA 3S8GB 2BZCA 3QJRB 3OMAB 5PAZA 4M4RB 8PAZA 2BW4A 1GY1A 1JZEA 3PXLA 3EHBB 1GY2A 2FJSA 4G7SB 5B1JC 1I53A 2PP9A 2HRGA 6PAZA 3S3DB 1OE2A 2AANA 5TK4A 4K9JA 2WO2B 4WTQA 3ZBMA 2DYRB 1A8ZA 5I28A 4JHVA 3FU8A 3CVDA 2IDTA 3WIAA 4BK5C 1TKWA 1ASPA 2IDSA 3UACA 2UXTA 1E67A 3JTBA 3TASA 2YARA 1GR7A 3C75A 3FSVA 5B7EA 4YSQA 1N70A 1BQ5A 2UXVA 3V9EA 1GYCA 3BQVA 1W6LA 3DIVA 3S8FB 2B3IA 4A2GA 2CAKA 2PCYA 2XV0A 2Q5BA 2IWFA 1OE1A 2VSMB 2XXFA 4DPCX 5I6KA 4DP1X 2CUAA 2FQDA 2XYBA 5AFAA 3FQ1A 2BWIA 1WS8A 2FQEA 1XB8A 1KBWA 4DPBX 3AG3B 1OCZB 1PLCA 1NICA 4Q8BA 3WKPA 4KO6A 1A4CA 4KNSA 3UABA 3WKQA 4M3HA 3EH3B 2IWKA 3AG1B 5D4HA 1ASQA 1KBVA 3UAAA 3CDZB 3PAUA 1X9UA 4YSOA 3X2QB 3GDCA 3IN0A 4TXVB 3FU7B 3QJQB 1NPNA 3T9WA 3FYIB 1BQRA 4A2HA 2QPDB 3WG7B 2LLNA 1VLXA 1E5YA 2IDUA 2XX1A 1PZBA 2ZOOA 3QPKA 4N4YB 5D4IA 1CYXA 4GY4A 2BP0B 1AANA 1FWXA 3NJFA 3CZUB 3NSDA 5F7BA 1J9SA 2BZ7A 2Y69B 3X1FA 3FQ2A 3CVBA 4YSCA 7PAZA 3ASOB 2BW5A 1MDAA 1ASOA 2PPFA 3AY2A 1J9RA 2DV6A 3NP3A 4G7RB 9PCYA 3NSCA 2BHFA 3UAEA 2DWTA 2HX9A 2VW4A 1NINA 1WA1X 3EH5B 2I85A 1SF3A 3OM3B 2UX7A 2VMJA 4KNTA 1FA4A 4W9ZA 2AFNA 4BXVA 1NIDA 2GIMA 2DY2A 4DP6X 5B1KA 2AZUA 4E9VA 1YLBB 1SFDA 3PPSA 4W1TA 4YSDA 1PNCA 3NSFA 3S3BB 2IDFA 4A2FA 2J55A 3AG4B 3DKHA 2B08A 4BWWA 3FSZA 5AZUA 1ZDSA 1PNDA 2OV0A 3UADA 4QKTA 4A67A 1PLBA 3JT2A 1GSKA 2CBPA 2X87A 4QLWA 4NAJA 1EZLA 1ET5A 2EINB 3N2JA 4DP8X 3CVCA 1ETJA 1M9WA 2XV3A 3PAVA 4NB7A 7PCYA 1WAEA 2AZAA 3NJJA 2J5WA 2J56A 2NRDA 2H3XC 4F2EA 4UANA 4CSPA 2J57A 2ZXWB 4GP5B 2ZWNA 1JXGA 4X4KA 1GS6X 1GS8A 4RH4A 1TU2A 1HAWA 2OCCB 1WA0X 2YAMA 4BXSV 3FSAA 1AG6A 2Y1AA 1MZYA 1M56B 1E65A 3FPYA 2BP8B 4AZUA 3SBQA 4AI7A 3WI9A 2JKWA 1NDTA 2GHZA 4KO7A 2UX6A 4DP9X 1URIA 4BWTA 4NERA 4DP2X 4E9WA 2GC4C 2FT6A 1ET7A 1PF3A 1RZPA 1AS8A 1JZIA 1BYPA 1KYAA 2EIMB 1CYWA 1PMYA 3ABMB 4Q89A 3OQRA 2PP8A 3NJNA 4HALA 1SHXA 1ILSA 2UXGA 1RZQA 2YXWA 2YXVA 2MTAA 2YEVB 3PCYA 3L45A 1JVLA 1KDJA 1KGYE 4E9SA 2IAAC 2IWEA 5I5MA 2FT8A 1A65A 1KDIA 2VN3A 1NIBA 1UATA 1AS6A 4BDVA 4JKNA 1EHKB 1NZRA 1SDDB 3QQXA 1RKRA 5F7AA 4FAAB 5I6PA 4YSAA 3QJVB 2MRYA 3NJIA 1PAZA 3S3CB 4E9XA 5EHFA 2OJ1A 1HFUA 2YAOA 2QPEB 1NIFA 1AACA 1AR1B 4YSEA 1JVOA 3WNIA 4A68A 4GP8B 1OOWA 3ZIYA 4DP0X 2PPDA 1NWOA 1BYOA 4KOCA 2R7EA 4HCFA 2VM3A
chains in the Genus database with same CATH superfamily
2E76C 2JF1A 3RZCD 1SS3A 3H2QA 2Q7GA 2N3JA 2UXCB 3LJ3A 1KEGH 1PZCA 2IH1C 1EEZB 1Y6MR 1E5AA 1FNAA 3C60A 4UNTA 5FK9A 2P5WE 2QELA 1FSKC 2JKJA 3P11L 2ENJA 2NZ9C 2DQGL 4GW5B 2K45A 4XN9A 4MMZA 4XP5L 4Z7IA 1DR9A 2O6FA 1FZKB 3QCTL 2X6MA 3ZTJG 5AB2A 1K85A 1AZZC 3ERXA 4IDJH 1FFPB 4EFEA 3L4YA 4L3AA 4APXB 2VDOH 4QEGA 3SYQA 2WTRA 4XNMB 4C59B 1MF2L 3MRKB 4DW2H 4B3RB 4MSWA 5I6XC 2O5ZH 1I8IB 2BE3A 3MI6A 2ZUVA 1A7QL 4BINA 1A4AA 3K6FA 4XPTL 2FDBP 2Q8BH 2ZR3A 1N32O 1GZQA 3BABA 2X3BA 1NH6A 4GQRA 2WO4A 2GEQA 2KB1A 4UCTA 1TGOA 3OKDB 4IRSB 3I9GL 2OL3H 2VJ0A 2EILC 3MV9E 1XBRA 3A47A 2DEWX 3OWEA 3GFUA 1H2LA 4TQDA 4WEBH 2AMGA 2BNRA 4PD4K 4HEME 4WFHE 3VFGH 4G1EA 4PDMA 4Z3JA 3SKJL 3H1JH 4J3BA 1CGXA 3ZE2F 3S97C 5JPNB 2EDNA 3FFCE 3W39A 2HCZX 2JE8A 5ICYA 1KGWA 2H2PC 3IJ7A 4PY8I 3LXUX 3SE3C 3LSSA 3NZ8B 2HKAA 1EBPA 4HIJA 4FFYL 3JARB 1A7RL 4LVEA 4PV1B 1FVCA 3CSFA 1X59A 2AHIA 3PWLB 3TBTA 1CLOL 1FXHA 4HWEH 2QA4V 5DLMH 2R2EA 1EN6A 3GVMA 3LXCA 3LIZH 3NIGF 4IBZA 4JI0B 3GMOB 4A7SA 3TONA 5IB1A 1LO3L 3MNZB 1X5MA 1OP5H 1RK1B 2XVLA 2UY7B 3V8OA 2R56L 2G5UA 3C5ZC 3VOUA 2PN5A 4DUZB 4TNEA 3BFQG 3CCUV 4O4JB 1NC2A 1KPVA 2QTSA 2E27L 2K3TA 2JTYA 5JYMA 4R7CA 4P4KC 4H4NA 3GWKC 5DEZA 2IU3A 2Z34A 4WO4D 3I6KA 5D5PA 1RJYA 2VXTL 1MIEH 3P4OA 5AUMB 3I6SA 5KBMA 2VDPL 4RDQF 1ZHBA 3SGKC 3T71A 5EOCH 4AQ8C 4EFBA 1DVYA 4NCC2 5EC2A 1SHWA 4UTCA 1B4TA 2VLJE 4KTEH 4XNXH 1KD1W 3BKCL 4Z2WA 4AEFA 1RZGB 4EIGB 4NKIH 4NTYA 3FO1A 2WB1A 3IDXL 1HHIA 2XETA 5IZ7A 4YHHO 1N19A 3DX7A 4ZZKA 5IWLA 3GK8H 4APQD 4EI5C 2JJVA 4KO5A 1A7OL 4ETQB 3SOBL 2GQHA 2R2HA 3RDTA 1U8JA 2ZX7A 1ETZA 2RHEA 5ANHA 4BZ2A 4BFRA 4MDIB 2IJJA 5F3BB 3KKYA 1N10A 1GH7A 2A83A 4ZFQA 1NGWB 2Y7LA 4M1CD 4P3WA 5JOEA 3PAZA 3MCKB 4QWWD 3TBYB 1EAPB 4MS6A 1N0LB 5AYUL 1WAAA 3HN8A 5C0CA 3ZHSA 3QJHB 2DQFA 3OAAG 1BWWA 2IW5A 1H8HG 5AG2A 1H9VA 1FIGH 1TJXA 2AJXL 2BERA 2DWEA 4HKXA 4TTDD 1NCAH 5IV2B 5FGCE 5JORB 1NFDA 2B9BA 1S7RB 5I0XA 1A7BA 5LGUA 2LAGB 3FUNA 4H1LB 1ZE3C 2EECA 5JW4Q 3AU1B 3RY4A 4DQOH 5IHHA 2CJSA 5CFAA 3BH9B 3LN4A 1WWCA 3I50H 2DLEA 2FO4B 1AOZA 3MHZA 3K1DA 4ORZC 1A64A 1LK2B 4AH2B 3ZTEA 1YJ9V 4AKOA 2HFGH 4F8QA 4XXWC 4F3FA 1AO7A 3GUTB 4N87A 4UT6L 4GX2A 4YVNA 4MWFA 5T3XL 4LLYB 5F9OH 3CJJA 3BUYB 3O3BB 5JO5A 2RR3A 4HZ1A 2YRZA 2BSCA 4HGMA 4ZOLA 3C60C 5L0QC 3O65A 5AVRB 2GJRA 5C0IB 2ICWA 4LGSB 1E6JL 5IJVA 2ORBL 3IU4H 4MMZC 3VCLA 3W5NA 4OSUL 4JFED 2EZ0C 2DPKA 3KEDA 5EU5B 3FN9A 4IU2A 2OMVB 3F00A 4UIKL 4U6XA 5KHKA 3CXFA 1S7TA 5IQ7H 1GC1C 2O1AA 4PJCF 2GTZB 5JHDD 4Y4FD 4AQAA 1KBGL 4N2HA 2AKRA 5L88H 3ME0B 3WS3B 4F7KA 1TYJA 4JNXA 2FMLA 3NFPA 3SQRA 3B77A 3EJZD 2JIXD 2GAZA 3SDDA 1XMOB 3G5VA 3V52H 2ZWYA 2DYSB 1FE8L 4BDVB 4C57C 3BT2H 4RQFA 1VQLV 2GUOA 5ANMA 3H9SA 2SODB 3MNVA 2RFXB 1OM9A 4H20L 2Y7OA 1I7ZB 3HHMA 1AHWB 4PSPA 4DUVA 4U1NA 5IW3A 4G6FD 4K5MA 2J1KA 2PUQT 5TE6H 2Q10A 1BAFL 1RP8A 5DJ2A 4FHBD 3AADB 4L4TD 4Z95H 3NJLA 3O4LD 5I74C 4WNJA 4X98A 4P9MH 4DV7B 1IAIL 3AFLA 3E2HB 1F13A 5AD0A 3CLFL 4A2EA 2KLSA 1OARL 1EUUA 5FKPA 5CD5D 4I48A 3QIWA 1FGVL 1DSWA 2FSDA 5BV7C 2KS0A 2OSXA 3F7YC 1GGUA 3DX3A 3QB7C 1SJHB 1PS3A 1Z6JT 4OFPA 2V5YA 5F0PB 3UOAB 1QUNA 4JK0D 2UXNA 2H2SC 4FE9A 2A0LA 4K3HA 4F6RB 3MRRA 2W8CA 4H25A 2FO1A 3HZ3A 2UXCO 2AJUL 4RWUA 3QUMB 3NVQA 1IGYA 2EJ1A 3DRQB 2E9IA 4NUJB 4UCRA 1I1CA 1KPRA 1HXYB 4M6AA 5JDSA 4LKXA 4ZPTA 1YEKH 2I60H 2DQHL 3L81A 4PB0L 4PJFA 4MAZA 3UBXG 3GLEA 3US1A 2EQDA 3MV8E 2YXLA 2V2XB 4QF1A 4YMPA 1XOUA 4O4IB 3UG4A 2O61B 4TVSa 1I53A 3MOBL 1JBJA 1BMWA 2HRGA 4PGEA 2D7TL 1AFVH 4FL4C 4B3RO 1DBJL 2EYSA 3C8DA 5C6WH 5IWLC 5J1SC 4WFFE 3CHQA 4GT0A 3S4SA 2WO2B 2UUDH 5JLZB 5J2TB 2XFXB 3U2SA 4JUTA 1UWEL 2QWQB 3RDTC 2PMZA 1OTUC 3TJTA 2XKSA 3BUPA 4ZI8A 1RJLB 5CP3H 3TFKD 1BHBA 2MCPL 4Z0XB 5KAQG 2BXYA 2HLDG 2WLHA 2EDLA 4C47A 2X2JA 3QI9A 4MD0B 2NN4A 4HX1B 3T4YA 1ZGLP 5FCUL 3GLZA 1GR7A 4XN1A 5GTIZ 3B37A 4JHWH 3OKMB 4YSQA 1BQ5A 4Z7WA 3MFFB 4N0YL 1LK3L 3RB5A 4ZUSA 1LE9A 3CVIL 1JWSA 4M1DL 1IFHH 1AKPA 3H7BA 1AQDB 1N67A 4HF5L 2YEZB 5G55A 1UKQA 3ELQA 5K69A 1Z3GL 1D5ZA 1KLGA 2AK4E 4QHKJ 4CH4A 3CFEA 2OMTA 2LFEA 3E3QE 4X7EC 4V2CB 4S0TD 5EBMA 3VD3A 1C1EL 3E86A 1P4IL 5CIPH 5HPMA 5L3GA 2WP3O 5JA9A 4DXWA 4OBSA 1XIWA 4NQCD 2F1EA 4GKZA 4JI0O 4KO6A 4DK3A 4P4RB 4YDLB 4N28A 3VSQA 1VSCA 3EH3B 1L0YA 1TTGA 4LSDA 2Z64C 2Z91A 2FJGB 4M8QB 4P48A 2ZE0A 5KSUB 4DUZO 2GBTA 3UAAA 3B2VH 4G8EA 4O2CB 9CGTA 2VNCA 4QLWA 5L4IA 2K6ZA 4ADJA 5CM1A 5FECA 3QEQA 5IIEB 1EPFA 2X0LA 2A6JA 3J7HA 3VA6A 3GMRB 2QPDB 4FKKA 4W6WB 3BYYA 2MPAH 4GKNB 3VQMA 3R7RA 3CZKA 2EZOA 1E90A 4GY4A 3MRNA 3CZUB 1BD2B 1IAII 1G4RA 1U6AL 1OAUH 2BW5A 4R4ND 5F7KC 3WTWA 1VADB 2CPUA 4DEWA 2OM5A 2VZSA 1H3XA 3KXFE 4HLZH 3UO3A 1I3RB 3K08A 4TS6A 5J7CC 1JZ4A 2Q76A 1OAYH 1G7MB 4LDOB 3V4UL 5GW7A 1RUKL 3BAEH 5DRNA 2KQNA 1J12A 1HE7A 1JP5A 2VDMB 3L9RA 2CZNA 1NIDA 5EU7E 2GIMA 1MNNA 1CQYA 2F66C 2A5UA 5B1KA 1B4JL 1MWOA 3SDDC 4DGUA 2HFTA 4NCDA 2OL3A 5GS3A 4J8RB 4IJ3B 5JPMA 3D18B 3N0AA 5T3ZE 1BGXL 3G6JA 3LQAH 3FUIA 3PHOB 4L3EB 1UJ3A 4HFUH 3WO4B 1VEWA 1ZDSA 3CX5J 1PYWA 1K4CB 3H0TA 4LFHD 3O6FB 4S1DC 3GIZL 1OALA 3U4BL 1QAWA 2ZKOA 3PAYA 1VZGA 1YECH 4GRLD 5GGVL 2NY0D 3C2SA 4ETYA 5CGYC 1A6TB 4HDIB 1KFAH 1KACB 2Z0AA 1VIWA 3ZHRA 1DDHA 5D6CB 3SGIA 2F4VB 3NIGE 4F7TA 2OCFD 4N3TA 1VFBA 4G42B 4UANA 5JYLA 5T1KA 2VLRA 5FX3A 1QLNA 3QUZB 2Q1EA 4WIQA 5KBNC 2VWJA 3K72A 1WBZA 2A0LC 3M17B 4K55A 4UI2A 4Z7NF 3IU3A 2JH2A 3U4AA 5JJJB 1MLBB 1U8IB 1AG6A 2LGQA 1UB5B 2Y1AA 3DOSA 3HN3A 3WUWB 4MJ6A 5F6IC 1KB5L 3CUPB 1XILA 2P48B 3HE7D 3K74B 5DHVH 3WI9A 3A4FA 1K7DA 5KANI 4LCIH 5GGRA 2Z4QA 3WNOA 4GG6B 1I1AB 1AJ7H 2BC4A 4QRPE 3LVEA 2PNDA 4JKMA 3S5LG 5DJXA 5D7HA 1HL9A 3O3EB 3DSFL 1WZMA 2CHWA 2FT6A 3EDKA 1SOSA 2BP3A 4ICWA 4L8DB 4UM9B 1CDBA 1IM9B 3SD5A 4X6FA 4PA7A 3RVWC 1JV5B 1S9YA 1Z5YD 5D4QA 2R1YA 4BSWA 3WU2Z 2LQRA 5LBQA 4NS0A 4DKAA 2AJYL 4H44C 4NXNB 3BP5A 1E3ZA 3N44B 4RMTA 4TRPH 3FT9A 3N9GH 2PR9A 2J6EL 5LL6Y 1XMOO 5EC1C 1M7XA 3GBML 3RX5A 4FHKA 2VXVH 4Y2OA 2GBVA 3FN0L 4AT6A 3W0WA 3ZSSA 4PRPA 3QJVB 3ZL2A 4B7EA 1JF6A 3KPRD 3NSXA 4NI3A 5HGBB 4V11A 1HTYA 4Q9RH 5FO9A 1DQMH 5BCAA 1MJ8H 5BUPA 2Y4SA 3F62A 1VRSA 3KYMB 4DR5O 2BIIA 4EIZC 4ZUTB 1GHFH 3O6MH 3FTGA 4GFTB 4LPTA 4I3RH 4Y8AA 4TOYL 1MI5E 4HD9A 3VXSA 4BIKA 4I5BB 4F58L 4GXVL 4DV0O 5CEZL 4MLIA 3ETBJ 4UCOA 5ESAA 3TPKA 4F5CA 1I9IH 3BRDA 1XMEB 1ICTA 5FKAB 1XIWC 1XVSA 3TVMD 4JDTL 3DTUB 1RZ8A 4PTTB 5E00B 1K8IA 4N20A 1JWMA 4YOKA 4HJJH 4KO9A 3KBFA 3T2NH 3ZZQA 3P9WB 2QGBA 3EJPA 4ZI7B 1QD0A 2W9DL 5B39A 3QG7H 3WB0A 4LCCB 1OGPA 2DQEH 2XNAA 4YGVA 4CH3A 2CXKA 3EYVA 3FONB 3QNFA 4HJ0C 4WWID 4XBPA 2B14A 4NDMA 3QJSB 4RETB 5GZOD 5JCOA 4G5ZL 4RQQA 5SV3A 4EBQL 1WFUA 5CSZA 3GEFA 5F9AC 25C8L 2LU3A 2CMRH 5IB2A 2VR6A 5LQBL 5AVYB 2EKJA 3M8OL 1PL4A 5ACMA 5I1HH 4JYAB 1T0MB 3M46A 3RU8L 3JALB 3BVUA 5DJDB 4CS2A 1YVLA 2H1PH 3JWNE 3GZKA 4XCYB 3OB0K 3RY6A 4X42A 4Y19D 5BQ7A 4Y16D 1S7UB 2ZUYA 1NC2D 5B1AC 4JG5A 1HZHH 1TNNA 1M7IA 1HCVA 4P46A 3P69A 4TF4A 4JTAB 3MA7B 5CEYA 4K94H 4U3XA 3MODH 2YN5A 2R1XA 4WTZG 4A6YA 2A9BA 2C2AA 3L6FA 5E2UL 5HI4C 2ATKB 3DETD 3ZPDA 2BZDA 3HCVA 4JN1L 1S5IH 2YD4A 4PJAF 1UJ3C 1GYVA 2DQDH 5JW3H 3L3KB 4XRCB 2K7PA 3JV0A 4GAAA 1SQBH 4M43L 4PJEE 3VXPB 2BCKB 4U4IA 1K33A 2NY7H 1J8SA 1K2DB 3ROLA 3UP1A 3IDYC 1WFJA 4NENA 5HYSB 2ZCEA 3F7VB 1HI6A 1PD0A 4D0DB 5IJBC 4U6YB 2OYMA 4B9IA 3BY6A 2PPCA 2HVKA 4NQUA 5D7LD 5AW0B 4TWKA 2E5LB 3JYBA 1MSWD 2FECL 4XNZC 4DKTA 2HWZH 4U1LB 4JMNA 1JN6B 2ADIB 1J0YA 4J7ZA 3IMSA 3QFJE 5I6NA 4LEXH 5E6RB 2FHFA 3KCXA 1Q7YW 1D5IL 3ZMRA 3MGAA 5MEQA 3FQNA 4HK0B 3UC0L 2CDEA 3HNVL 2NNUA 5CCJA 3PV7A 1PZAA 1T04B 3CSXA 4XPHL 1RJCA 4K9EL 4HC1L 1A6UH 2HRHA 4ZX3A 4FFBA 4A7GA 1RZKL 1SJXA 2KZKA 3HHSA 4HAMA 3KYKL 5JJNB 1G9MC 2MK3A 2F74B 3EOYG 2TRHA 3RA7L 1JMXA 1X6NA 4XH2A 2BP0A 5DJYA 3VA2C 4DZ8A 3BP6B 1OK8A 2PUSA 2M1KA 5B8CB 4DK5A 4YIPA 3QYMA 2ZIMA 2BSKB 1JZ7A 3MCYA 5JHLH 4OCYL 4UAHA 3QDGD 2R2BB 3ARDD 3VI4A 1O6VA 1GM7A 3F6LA 4NQTA 5B3SC 5KYWB 1QRND 2R0KL 4JFFE 4JQIL 4G71B 4P5MB 5I82A 4TUKL 3BSZL 1QCEA 1XFPA 1ZSDA 2CALA 4JDVB 5IT2H 3IJEA 1OSYA 5IVXB 2JCCA 4NO3A 1IBGL 2UZYB 4D7SA 3NXSA 1R34A 4MCYB 3OUFA 35C8H 2OW7A 3NTCL 4NZTH 5KYYA 4FFVC 4X4MA 3BVNA 1E4XL 4FMKA 2R1WA 1J8HE 2Z8WC 5L9DH 1EA9C 1AHMA 2AW2A 3QORC 3SDAB 5C0NC 5D9SB 2MQCA 3DO7B 5FAAA 2O57A 1S5LZ 1JGIA 1KF9B 2ZX8A 3HBPA 3PXJA 4B95C 3QO5A 1EBAA 3THML 5FUOL 4A55A 2R0ZL 5KUMA 1OB1B 3PLYA 4P57B 2CH7A 4WENB 4Z5RB 2XTJB 5I18H 1KYOK 5FHAH 1YMMB 4FLYA 1ZS8B 2PW1B 1LO2L 4XODA 4YC2B 4ZOBA 3VFWA 1T1ZB 1URLA 2QQNL 1G6RL 1MCHA 3VQYA 4MZ2A 5IK3B 5T1LA 2VDNL 3D3QA 1GZPA 5CIPA 2F4VO 1ILUA 4KMQA 5E1AB 1Y7VA 2Z7YA 1AR5A 5F88A 4L0ZA 1XSJA 4FJCC 4UM8A 2EINC 4TSBH 4Y9CA 1ZLZA 2K1EA 5IW6B 4MCNA 3RFZA 3MN8A 1RM1C 5D1ZA 5GSVB 3NCJL 3TCXA 3TX4A 4JFOA 3ABKB 3ZMTA 1ADQL 3MCLH 4JCMA 5JCOC 5DK2B 1KQSU 1J1XL 3BO8A 3FJTA 3VRJB 1RFDL 5GGSY 5CR1A 2Y7SA 1Z9OA 4PJBB 3W9EA 1MRDL 1MJJB 2A38A 1O6TA 3JWOL 3QIWD 2F58H 4LNUB 1W8EA 1NA8A 3ETGA 4E41E 2VLLA 3HMXA 2GYSA 2JKNA 2OI9C 4XVUC 5AYTA 1B4LA 1NOAA 5D7JA 3R8QA 4Z7VE 1T0NB 2FECI 1KY7A 3RY6C 3B9VA 3UBXB 4U7NA 1WIOA 2JELL 1TZOA 4UB6Z 2XQYK 4I3SL 4EI6B 4RFOH 5TPWL 3E0GA 4GINA 4HKZB 3NEOA 4H88L 3KWUA 5T5NG 5D1XE 3S36X 3E1F1 5KAIZ 2X89A 1FL5A 1JPST 4EB6A 1PEZA 2G2NA 4XCCL 5LMUB 1WGVA 2F8VA 2HFFA 4AYBA 1FVDA 2J20A 4DKDC 3MROA 1OQXA 5EZYA 3G5YA 4ICGA 1F90H 5C0FB 1MIML 4NQDA 3ZUCA 1OAQL 1NTDA 2EC8A 5JOPE 2CIIB 3EYFB 3F3HA 2M26A 4FJYA 3OMIB 2V17L 4NKOA 3EDEA 1QFWM 3FD9A 3JD1A 4ZBJA 2EIEA 2K9UA 4A2LA 5C09B 4DN4L 2WXRA 5DQDL 2ADJB 3QJRB 1OGTA 2ZKMX 4O2EB 1HNFA 1PJWA 3QI9D 1SRDA 3UTSA 1YTFD 4LLVA 2DD8H 1F1AA 4JY5H 1GY1A 4IRJB 4P07A 3BWAB 4Z7NE 3DIDA 3MRJA 3CRQA 3GHBH 1BQLH 4KZ0A 5HHVH 1IU1A 3L3JB 2GABA 2NY2B 1UFIA 3MV7A 4JGUA 5CZVH 1NCCL 2AANA 3KM2A 4PRHE 5T33H 5TK4A 1YYLL 5I0VA 1I9RH 3DUHA 4I7ZB 5DHVA 5T5FA 2WWMD 2Y0SA 1MCRA 2W0KA 1JNLL 4LLQA 4UOJA 5HPOA 2M83A 3C3TA 4JYAO 5AKTA 4ZW8A 2C34A 1UURA 4UQAA 4TV8B 4XPAL 1HINL 3P4NA 4PRIA 2QTEA 3PQYA 5BS0A 3AM8C 4PI2A 3EGXB 2AXFB 3J27A 4EVNA 5J6HA 4PD4F 1JPSH 1H6UA 3IETB 2GK0A 2UXTA 2YARA 4DUXA 5J9PB 3QT2A 3W81A 3TZVD 4K7PY 1KULA 1NSNH 3QPQC 5CGMA 3MACH 3VG0L 3GSVB 3T0EE 3TYFB 1XR8A 4UV9A 1SEQH 2EH7H 1WZKA 4MYWB 3UQ8A 2RMKB 1QG3A 2JIZG 1LXMA 1FFQA 2VDLH 5AFAA 3HNTL 4ODXB 1H0DB 1FYTD 2B4CH 3RYCA 1KBWA 4JFPB 2BRQA 3MRHA 1I1FA 2H32A 1U93A 3FQWB 3ULVD 1WD8A 4E5XG 3PN1A 1Z5LA 2QSAA 1MLCB 5FHBH 1PAMA 2ADPA 4OLWL 1LWRA 3UMTA 3HAEG 1WEJL 4P9HL 3I2CL 3SE4A 4WWPA 1ASQA 3INUL 3SDYH 1RVFH 3A8TA 3B4SA 2DLHA 3CDZB 4HWBH 4XP1L 5CEZE 5KS9A 2E5LO 1U8KA 4N2EA 2WLIA 5C0BA 3PDOA 2BRRH 3VQWA 3KJ4C 5DD3H 5FYJH 1BVOA 1VEPA 3FU7B 3MRIB 1P1ZA 5GONB 1ZHLB 3QDJB 1T6BX 3UCRA 3H7LA 3O9WB 1DQIA 4GBXA 3T1YO 5FFGA 3L74H 4JY6B 3RFZC 1XR9A 3N6YA 4RISL 5D1ZC 1P7HL 1B0IA 4PHXA 1S7WB 3MYZA 1DQJB 3DX8B 1GGIH 2PCPA 2WHVA 3JZYA 5IG7B 2Q6WB 1REIA 2PWDA 5DEGB 3P77A 3WIHL 4OZFG 2V6HA 3L4WA 4ZQKA 3UJIL 9PCYA 4JM4L 1S7VA 5DRZA 3U6XS 4BRVA 2BHFA 5KX5A 5IOPA 4Z8FH 2NZIA 2E74B 2EEFA 2H45A 4MS8D 3CXCU 1SF3A 5TDPB 4BXVA 1Z32X 4FM0A 2IPKA 4H8PA 3ZIMA 5FO7B 1RP3B 1JTPA 1S7QB 2QQLH 3GSOB 3OHMB 3MLRH 5D7JC 4N8PA 4C54A 5A43C 3AMLA 2V2TA 3H6JA 2Y07H 3B2MA 3DJRA 4OGXL 3KZ8A 1PNCA 4KROC 3S5LB 2YLKA 4L23A 2DKMA 4YK4C 3MLZL 1LEKA 3RWIA 1OGSA 2F08A 2ARJA 4XZUA 4OT1H 2F18A 1XH1A 4TNWK 2KSDA 5D7IF 4L4JA 1H8OA 3QDMA 5DXWA 3NR7A 3HB3D 1A2YA 5EU6A 4M6OH 4DR4B 32C2B 3S35X 1LO5A 2PYEA 4XBMA 3WCYA 1E4KA 4J3OF 2BVQB 4CADB 3K8KA 3VU2A 5I23A 1HNWB 1TENA 4K8RH 4MCMA 4JAMB 4AIXA 3U11A 4YX2L 4U3JB 4PJAE 2AZAA 3LQAC 2Q3ZA 4OD3H 2X44D 4M1GL 1HSAA 5T1MB 3MXWL 3PG2A 3V5KB 1E5BA 4F2EA 1SBSH 3E8FA 3ZDYF 4HUCA 3UTTD 3U30B 4N6RB 5E6IB 3VTTA 5F1NA 4IBTA 3F58H 3N1GC 2PYJA 4H0IA 2YAMA 3VMNA 4BXSV 1KNOB 5CS7A 3I75A 4HWZB 5DDHB 5GGUB 3W37A 3NRFA 3WEXB 4JI3B 1JCVA 4C4KO 1BVKA 2WVSA 1NDTA 2GHZA 4JO1H 3V0VA 1HYSD 5FYLD 4DGWC 4GG6E 1NCJA 1XF5B 4EJ1C 3L5IA 4AZ8A 1EHNA 4PRPD 3RGVB 1VDGA 2EDRA 1KJ3L 4RGNE 4IKIA 4GKKB 1PF3A 3WFBL 2OZ4L 5E5MB 5GS0H 2EIMB 4Q89A 4FFKA 4ZFOA 1IBMB 4O4YH 2VQFO 3T65A 2W6JG 2UXXA 5E5LA 5BZXA 4UUJB 3ZJZA 4IIQC 4S1SL 4JGMA 5I2IB 3GHEH 1ML0A 2A74B 2CA3A 2WYZA 4PU2A 1KDIA 1KENL 1WP8A 4RZCA 2P5EB 1U92B 2ZE8A 2FUQA 4G3YL 4NN7B 2WQWA 3QQ4A 5JHLA 4X1KB 1AYRA 4XOEA 3CXDH 4ZTPH 2WINA 1P84J 2YGNA 3S3CB 5B1CA 1U58A 3N91A 2W0FB 3L3DB 1A47A 4LLWB 2NSQA 2QQKH 1IIKA 1QLFA 2D0FA 3KCPB 4OBRA 3IGUA 4Y5XB 3SGEI 3WNIA 1CFTB 1KJ2B 2WIMA 4A68A 2EXYD 4HIQA 1A25A 4MQ7B 1BYOA 4K7FB 4ZMVA 1MCNA 3QRFM 4G8GE 4M7KH 1DBKH 1RUQH 2VISB 4PJ5B 3ZE1F 3UBXI 4FABL 5IBTL 1X5YA 2XAJA 1S5HA 4LGPB 4HGKC 2BSBA 1SA0B 4F4LA 2M2DA 3OKEA 1KWKA 4OIAA 4Q6GA 3RWEA 3SE4C 2QWRB 2F53B 3X12A 2Z3YA 2FWSA 1EVTC 4CBZA 2CE4A 5EIQA 4H0HB 4F8LA 4AYMC 2R8SL 3A4DA 4UILH 3MRGB 4IBYA 3NA4A 4MNGB 5D5MF 1T22A 4P46D 3C6LB 4M4RA 3LDBC 3VI3A 4PR5B 1WPCA 3CCEV 4NM4H 4GBXC 2CJ3A 2ITCA 3ALXA 5HJ3B 2HMIC 5C0JA 4JRXB 2V0AA 3E89A 3X13B 1J5OH 1CGSL 2C9PA 3WIFA 3BIBX 4YHLL 4QR7A 3L5WB 3T3PB 4YJ2B 3LPOA 4HSQA 4IKJA 4PVBA 2N01B 3VX1A 3SQBB 4X1IB 1R5VB 3FK3A 4L9LB 3PRZA 2CTWA 2R0WL 1HH6B 2ZNWA 4G6MH 1JPFB 2VLKB 1ZL8B 1NT2B 4CH6A 2B59A 3RAJH 4DGVH 3MRPA 1SKVA 4HNAA 3GGWB 2K9FB 2X1PA 1EZVX 3P4MA 2IAND 3N43B 2KDYA 1SHSA 6PCYA 3OKLB 4ABMA 4WCEV 1QSEB 5GJTH 1AIZA 1QABA 4EO5A 1R47A 4FLHA 4ELKA 5ID1A 1HC1A 3SE6A 5LA6B 4UT7L 3QHZH 1KXVA 3MRCA 1UOVA 2WNXA 4JM2F 4XT1C 3JSSA 4QRQA 3SDXA 1UJWB 5T1DH 5E9DD 4WY7H 4B9GA 1LWJA 1J1PL 4N1EA 2LFRA 1NGQH 2JI1A 4LSSH 2AXGB 1BOYA 3IFNH 2XY2A 2Q0ZX 5AVWB 3THOA 1FZOA 1FQ9C 3IXTA 4P2OB 5ESVA 5AW8B 5IBLC 1MG1A 2DQCL 3BKYL 3MRDB 4G6KH 4JANA 4M9PA 1J9CT 5EZIH 4B9KC 1OAKH 2APFA 2I7SA 4K94C 1E4KC 2DMXA 3NDYE 1L9SA 3P2BA 1IRAY 3EFDH 5D1QB 4RQEA 3KVQA 2WANA 1EX0A 5I17A 4DIXA 4GLRH 4RRPG 2YUZA 3CC4V 3CG8A 4WFED 4A63A 4JKKA 1AXIB 1ZIBA 3C08H 3ABGA 1Q8IA 1UEYA 3UTZA 4FA8A 4MAYB 3RJDA 3MXVL 1UT2A 4NJ9L 5EZLA 3TH4T 3H3KA 4KX8A 2G2RB 1M7UA 2ZF9A 3QW9A 4Z6AT 1E8YA 4ABWA 5EN2B 2E7MA 2RQ6A 5I8KL 5IWAB 2DI9A 4HPYL 4Y4HB 3E83A 2GUZA 4YSRA 3D87B 2XVKA 1MFBL 2MHAB 4GKLA 4Q9QL 3BIKB 3R06B 5F1OB 4OLZH 2GKIA 3Q2NA 4X7CC 3DVNA 4YHOL 4L3FA 4DKFL 4YHZH 2YQ2A 3OJVC 1ODUA 3QHTC 4FTVE 4M7LL 4ODTH 1NLDL 4H26B 3RVUC 2ICEB 1Q0YH 4BW9A 4K5PA 3ZN1A 3NCCB 4Y2DA 4MJIA 4X6CB 5T1LD 3TBSB 3DBXB 4DT2A 3FMGH 4DZBA 1SY6L 2VXQL 3L4XA 1FNSL 1D7BA 4HS3B 3TCLB 2RIKA 4QI3A 1A6VL 4S11A 3N1PC 1NBYA 3FH5A 4OZHB 2IGFH 2KQMA 3UZVB 5INCA 1KMIZ 3QEGH 5FO8A 5C7XH 3KH4A 1M4UA 3D8CA 3F7KA 5KYXA 1DQQA 4XOCA 2XOKG 5EF0A 4ABUA 3VXRB 1MN4A 5CUSH 1CL7H 4JO5A 4FZ8H 4DR4O 5HHOD 5IFHL 3S37L 4ZMZA 2Y7NA 3JSNA 1VQNV 1I1RA 4LP5A 4ENED 2JQMA 4ZOEA 1YMME 2JXMA 4Z77A 1UOLA 2R9HC 3F05A 1JZ6A 3WO4C 4QRTB 1RCYA 4WWKD 4LCYA 2GSMB 4LOFA 1K4CC 4J2XA 3FUJA 4KPHL 1LNQA 1S5HC 1JL8A 5ECGA 3MU3A 5E8EA 2D2OA 4NRYB 3RWGA 4W4LA 2Z92B 1QW9A 4QHLA 4MQSB 1XEUA 3E8UH 4LPYA 2ZJSH 3MNDA 1QPPA 4M5ZL 5I1KH 2NNAA 4KJYA 5L2KE 3K0DA 4HWBA 4N85A 3IDJA 3K9AA 5FLXN 1OPGL 2B9AA 4PCKA 3IBOA 4MYPA 5L7XH 4JI3O 5MEOB 3PFQA 2Q7EA 2LR4A 3QUZC 3MTRA 3JSLA 3QK0A 3NFSH 3UM7A 2EDFA 3UO2A 5EEUA 3UYOD 3D4YA 3VM7A 1JHKH 4I4TA 1MQ8A 2AGAA 1QSFA 2MKLC 2XZCL 4GKKO 4PGCA 2IGTA 3ZE2B 4WBNB 2D3VA 2HLAA 4JMXA 4U6TA 1MCFA 1BL8A 3D30A 1E79G 3APQA 2V5TA 2GHYA 3EAKA 4RFNC 1CICB 4FM2A 1IGTB 4LB8A 2WSDA 4OF6A 5HVHC 4BBWA 2Z7UA 4OB5L 4GSRA 3FUDA 4MA3B 2H0PA 4ZNEA 2DQJL 3SPVA 4JR9H 3E38A 4JFDD 4QT5A 1HL8A 1IB5A 2JJSA 3UZQA 2NUPA 3FQRB 5DO2D 4UXNA 2Z35B 4L18A 1RUPH 3SQOH 1UD6A 1KXVC 2NXZD 5L3CA 2B39A 2A79B 3L7FA 1KJ2H 2YGPA 4UQEA 3R18A 4LHUA 4HUXB 4XAWL 4K5NA 4DOHB 1FBIL 3H6AA 5FUCE 1BVNT 2NUTB 4NKDA 3RWDB 4X99A 1PY0A 4RAUA 3QJFA 1XGQA 3QXDB 3R7QA 4AEIH 1N3NB 3CYOA 2UUBB 4WTWA 2YQBA 4O00A 4V2BA 3S88L 3TN0A 3RQ3A 4KHXH 2QSQA 5C09E 2LLGA 5E8NB 1WSST 5JQ6H 3QZNA 4ZRGA 5FW6A 4TQEH 2BOBB 1TUPA 5DJAA 3ZE0E 4DAGH 3HI5H 2CUGA 3WHXB 4JO2L 3VFUB 4E5XB 1IAKB 5BO0D 3S34L 5H94A 5TE4H 2C4FT 5HDBB 5HDLA 3QA3A 3GRBA 1BMFG 1D5BA 3HAEB 4FQLH 3D06A 2AGJH 2UWEF 1BZ9B 1G1YA 1USZA 3CCHB 3VQ2C 5M94B 5KVDH 2DMGA 4XNYH 4JYYA 5EZJB 5IJ0A 3G4SV 2ALWA 3HC0B 3BZ4B 3PHAA 2OXHB 2ZE6A 1VFUA 4UT9L 6FABL 3QZOA 1X9QA 1BQZA 5D70L 3U7WL 1A8ZA 1MPAL 1MCPL 4F20A 3FU8A 1DANT 3WIAA 1OY3B 3SGDI 4Z3TA 2IDSA 3QXUA 2PO6A 1YY8B 3BYTA 1PCXA 1WFOA 2DQTL 3DK0A 1SJVA 4ODHH 2F1AA 3FB6B 4ZAKB 2J72A 5EU4A 5TQ2H 2VMEA 5JH7B 4P2ZA 3EF7A 2BP5M 4PMFA 4WCYH 5HGDB 1D6VL 4Y2DC 3QPXH 1UUSA 2GTWB 2XWCA 3DIVA 5IYCO 3HUJE 2PCYA 3W11D 4WK0B 1GGCL 4OZFB 1O9VA 3ZMVA 3SD2A 4FLVA 1X5HA 4N5UA 3HG3A 3E6HA 4X4ZA 1NGPH 2XTSA 4BUHA 3ZHKA 2QGCA 3PDDA 3F5WA 3CFJB 3OLGA 5IROD 1HIMH 2QJDA 3HR6A 1E27B 3ZRFC 3TJHC 1QFPA 1A4CA 4Q97A 2FX8H 4PJIE 4NJAH 4IL6Z 3HLAB 3LY6A 5IHZB 1PFCA 1QTSA 4PJHE 4QJ3B 4GRWB 3D2TA 2YEQA 3DJ9A 3SKMB 1KT2B 1WAZA 1NC4B 3QUYB 1TTCA 2EIZB 5CD3A 5KSBE 1UKSA 1CDUA 1JPXA 3FX7A 1D5MB 3RTQD 5I1JL 3ABTA 1AY1L 2VM9A 3HN5A 4QOKA 4XBGB 1BQRA 4LSUH 1DBBL 2WWOA 3NSJA 4HAFA 4V1DA 3WGUB 2DJVA 2VDQB 1E6OL 3QHFH 2ZP8A 1PZ2A 4XI5D 1G9NL 1A32A 1Q1PA 1PNMA 3KWXA 5I76A 2X6AA 1U3ZA 3ECQA 4IIJB 4KAQH 5GGVY 2MH4A 5AOKA 3AUWB 1J9RA 3LVTA 2DV6A 1V7NH 1KIUA 5FPOA 2XN9B 3NSCA 1US6A 4NXKA 1VHPA 5IWAO 2VW4A 3PWJA 4XBEH 1FL3B 3KPMA 1RPOA 5EK0A 4RNRB 1QI5A 4XP4L 1RZ7H 4FM1A 4KNTA 1LR1A 3OKYA 5E2TL 2AFNA 3F7LA 5EA0H 3GB7A 4RGOL 1T66C 1F42A 2VTFA 4KTDL 1IL1A 3LRSB 4HQQL 4RIRA 4DP6X 3JD2A 5FDWB 1EAJA 4GQ9H 1LYQA 5GZOA 3HG1B 1LMIA 2DYPB 3LPWA 5ENWB 5FM8A 3IAGC 3NSFA 5K9JL 1YEGH 2IDFA 2W38A 3BD5A 4NYKA 1IGMH 3C3SA 2FYYA 5E1HB 4XPBL 4AENB 1OWWA 1ZHKA 3DIFA 4P9OA 1CDGA 5AOZA 2JJSC 3VRIA 1HHKB 1ZT7B 5CU5A 3SJVD 3A6BL 1QA9A 2AJSL 4L8SA 4FMVA 3MLXL 3EJYC 1KTCA 3IK2A 3PAVA 2XV3A 5EDSA 3ETQA 1R0AL 2HVJA 4YHYC 1YQVH 1PDKB 2YJLA 4G7YL 1KYOF 4NI6A 1Q72L 2ZXWB 1KGJA 3ARVA 4IS6A 2DQGH 4ODVH 4Z7OB 3HS0B 5A2IH 5IMMA 4AL8L 4N1CA 4RH4A 4AJWA 5KA5A 3L9YA 3MQIA 4PJDB 1NKDA 3DLQR 3QCTH 2OLDA 3TN0C 1A3QA 3FSAA 3B09A 5DQJB 4NO5A 4NWUL 1A5FH 1CGYA 2FVNA 3LS4L 2OT5A 4K8RC 4MNQA 3KPSB 1MF2H 4LOUC 2HT2C 2XTJC 4LMQI 5C0AD 3TURA 5HYEA 4CILA 4CVZB 4G7VL 5BQDA 2GCYA 5ICZA 4F9PA 3GPEA 4NERA 2GITB 2OTUA 1BVNP 1BFSA 5GPRA 4LF5B 1WLEA 1E7VA 1AGCA 2HUHA 1KTLA 3UYPA 3I9GH 4FG6D 3LKOB 1FAIL 2B1HL 1QR8A 4WFAV 1GK9A 2FTKA 1PMYA 2N1KA 3P40A 1N4XH 1X5JA 4H33A 3OAZH 1P69B 4W81A 3SKJH 3L71H 4WFHA 1EXUA 1MCBA 2YQ3A 3CFDB 4GKOA 4X7SL 3V2AR 4XTRC 3B7SA 4ANWA 5CEXB 5HVWA 5E24E 3RUGB 4B5ZA 3FFCA 4LF9B 4R5TA 3V0WL 3HKEB 4DV2O 1KLUB 1ZVYA 2MWCA 3IS1X 4FFYH 1A7RH 2D0GA 3RYIB 1QI3A 4LWSA 3DX6B 2G9HA 3JVGA 5GS0C 5ETUA 3JYCA 1IGCH 1FFOB 2DOCA 4R9HA 5EH1A 1CLOH 1YYML 1LQBC 3FT2B 4HLJA 4NZJA 1UT9A 4TL4A 5EHFA 3BW9B 1VGKA 4AYFB 1INQA 2EO9A 2MIZA 4H8VA 3PL6D 4NOBA 4IHOA 1NIFA 2M7WA 1AR1B 3CCMV 2ARWA 3ETTA 5SX4H 2EDOA 5F97E 1PSKH 5HHMB 1AGDA 3IT8D 2R56H 3WU1A 4N6QA 2IV9A 3ZIAG 4UBDD 4QCIA 4MA8L 4ZMTA 4QXUL 4O2BA 1WTGT 2BSRA 4PJ5E 3LPPA 1EJ8A 2OCHA 3KH3A 3QJZA 2DMHA 4U1KB 4FKEA 3WFHB 5KOVC 5L4FA 4OGYL 4WUKH 5GGSA 1JGLL 2YUAA 1O0VA 3GO1L 2UUBO 4MVOA 2ZUQC 4L1LA 4JPQA 3BKCH 2GC7C 4PWIA 2VLJA 4XX5A 1W8OA 4BZ1L 2E6JA 3DJTA 3O6KL 3UXFA 1X3DA 1UM6L 3IDXH 4QHMA 3TV3H 3VGHA 1XF2A 4MNGE 1UD3A 1T7WA 1UASA 3V0IA 2D2CB 3VXOA 5I15L 1A7OH 5HYQB 5J56B 5AENA 4DK1A 4JRXE 4JDEA 5MERA 4JPKL 3H9YA 4DUYB 1OZUA 2OYLA 4G6JL 1EAQA 4HUUA 2NY1C 3AG2C 4FNUA 1OCCC 2CR6A 3UT5A 1HHJA 2ITFA 2X4QB 3FU6A 5E8DH 5I8EA 4AKQA 3QRBA 2D03L 3FOLB 4Y5VB 2OQJA 4U6HA 5IB5B 4PJ9A 1RU9H 1DFBH 5FV2A 4NQSB 3BN9C 4Y9FA 5EUOF 3ATEA 2OJZL 5EUKA 1I94B 1KIQA 1NEUA 2AJXH 5CZXC 3SZ6A 4DJMA 4QHNB 5H2BB 3IWUA 5TGBB 4CJ1A 3GB7C 4AQOA 2DQUL 3F7QA 1WISA 4XVTL 3TBCA 2APXA 1YJDC 4WJG3 5GZOC 1QNMA 1SF9A 2EAEA 3TT1L 4OZFH 1QACA 1D9KA 4KKAC 4QYOB 4LKCA 5EU3B 1IE4A 4OAWA 4WNQA 1RK0A 4CN6A 1JZJA 2CLRB 5I16A 3DVGA 4FYRA 1H38A 5F1KC 3S96B 2QVTA 2NXYB 1PKQE 4PH8A 1R3JB 4P5TD 3G08A 4PVLA 4ACPA 3VWKA 3K8MA 2BIQA 3I9PA 4FDWA 4UT6H 1UH4A 2UZIH 4NX0A 5T3XH 1LWHA 3PP4L 2NY4D 4YHNA 2HVJC 4OF8A 5FYJU 4GRWH 5D1QE 2H0FA 2PZSA 4CMMB 1LQSR 2R51A 4OF5A 2Z31A 4K4KA 2K6YA 1YXBA 3MRBB 3IF1B 2Q73A 3FO9B 4OSUH 4CGUB 4AX3A 1T3FA 2VR9A 2XVBA 1E0OB 3OSKA 4NPJA 4UTBA 3MGTA 5KHHA 2VDQH 3P9LA 3BESR 4UIKH 3EF4A 3HE6B 2Y2WA 1BSIA 3KDMA 5D7EA 3ET9F 4X5RA 3WTYA 2NYZA 1WWBX 3QQDA 2EKSA 4KDVA 3LQZA 1EM1A 2FNBA 1KBGH 4GO8A 2PXYA 1MXDA 4FERA 4BM7A 1ETA1 2XG5A 3JAWB 3D08A 4PRDB 1GOFA 1V3JA 3JV5A 3WEMA 1DEEB 1J0JA 1SLUA 2H9GA 4GX1A 1JFQL 3FQYA 1NGXA 2EIJB 1QEWA 2ZOKB 3NEXA 4QY8B 5KTEH 3WD5H 3FSOA 5JWPA 2I7OA 4H8WH 5IUSA 4IJTA 1BBJB 1HL5A 3G5ZB 2OMUB 1BAFH 4UQ2A 5AOIA 4ONFH 2IQAA 4YBLB 4CSSA 3T2OA 2VSCA 3JVGC 4BEIA 3NABL 1SYVA 4JFEE 5F9DC 1V10A 2WCSA 3CLFH 2VLMD 3GZOA 4R3SA 1OARH 2RALA 3NJHA 4XCNA 1YVWA 1FGVH 1OAJA 2BIHA 4MB4A 4TNWF 4XN8A 5DFVD 5DK0A 4B9FA 4LMQE 2YD1A 3DVIA 4Y1AE 3RNKB 1JOIA 2HX7A 4LAQH 5DVOA 4ZS7H 2DQ6A 3P3NA 3EYUL 1MOEA 1QHQA 4HUWA 5SWZD 3VXRE 4O51B 4OZGB 4J6RH 5LOVA 3N06B 1CD1B 4DYLA 5A9GA 2X4UA 2JKRM 2YO3A 4GI9A 3SEPA 5CN1A 1MH5B 2AJUH 2YD9A 4UIMB 1DQTA 3O81A 3B9KA 1CBVH 3VXUB 1DVFA 1QFUH 2DOSA 5EEYA 4I55A 3AS3A 4ONGL 1KCSL 1HNZO 2W0LA 4DW0A 1TQWA 1OE3A 4PB0H 2DQHH 4JHAH 4DEPB 2GTAA 3FT4B 2AMUA 1TSRA 4FLUA 1INDH 2W94A 2IOIA 2XPGA 3MV8A 3GSUB 3MOBH 2X0VA 4O2FA 1MFDL 4PG9A 4TQ8A 5IQ9B 2D7TH 4JI8B 3OE7G 4L4TE 3O4LE 5ICUA 4LDEB 1LUWA 1GKEA 1VAHA 5A2KH 3AWEA 2O5NA 2ZF8A 4I13B 3U6RA 43C9A 4WFFA 2PPEA 4D6TH 1UWEH 4EUPH 1T21A 4JTDB 3H8NA 5IYDO 4MVZA 5HI5C 3V4PL 4LF5O 2BOLA 2ZCLL 2I25N 4AQEA 4LPUA 1WT5A 3ARBB 3GWOA 2NTFB 4R7DA 3OPZL 5BRZB 1UKTA 1JTOA 4DO2A 4X62O 3NIDF 5FCUH 1U3NA 1WAAF 4F7PB 5C6PB 1MRFL 5J57B 1VCBC 2Y2TA 3C2AL 1CFNB 3ORJA 4YXKL 3KCWA 3PGDB 5DR5H 1FORH 1LK3H 4U1IA 3HZVA 4OQTL 1V9PA 4GFXA 2DBJA 1G7LB 4LF9O 3CVIH 4CMHB 1NFDF 1JZFA 4HF5H 4E0RB 3CFKA 1T5XA 1EFXD 1VF5C 3O41B 4BQ9A 5AKVA 1G7PB 1I8UA 3EGSB 4MMXB 3K03A 1F11B 1C1EH 1MVUB 3LHPL 3ZDWA 2FLRT 1A4JB 2XRAH 3KPQA 4P3CL 3TO4A 1D9KC 3U9UB 1L9RA 2G75B 4XWOC 3U0ZA 2GJZB 1PW3A 4J9YB 2AC0A 1LP9B 4ZW6A 3BDYH 1A9BB 4LCUB 1WYJA 1AMYA 3ARED 4A66A 3VWKC 4WSGA 4C83B 2RACA 2PPAA 2VWEC 4JG0L 2OFQA 1CPUA 2GHWB 5IW1A 1FFTB 1DBML 2P8LB 3QIUA 5A6LA 4RMRA 2PO6D 4R7NA 1Z9SB 4C4BA 3M1BA 1CLYH 3VH8A 4LP8A 5J13C 3BAWA 1PZDA 3OZ9H 3PGCB 1PG7X 5KHGA 1EDQA 1JZEA 4PVMA 3K3WA 2VL4A 3ARZA 3EHBB 3PWPD 1JVMA 5FF6A 3KPPA 3ULUD 4EOWL 5HDBE 2QPSA 2PP9A 3OFNG 1BPVA 1LJMA 2WBJB 1ZLSH 2DLFH 3S3DB 5BMFH 1A14L 1A6AA 3KXFA 4RAVA 4HBQA 4FQJL 1JGDB 3RYFB 1RUKH 2R27A 3V7AG 2PXYC 4Q0XL 4EEEA 2VDRB 5GS2H 1U8LB 5EIBC 3TBVA 3CVDA 3K4AA 2IDTA 5LBGA 2DJ4A 4FFWC 1UXSA 4XBFA 4PYGA 4O9HL 4XHJC 3UACA 3D3VB 4YQXH 5DJ0B 4E42A 5DS8A 3MLTA 3TASA 5I66A 3L3IB 2F1MA 5D72H 1N5YL 5L8LB 5KW9L 3DX9B 1BGXH 5JR1L 1I94O 4X5WA 3IAPA 3E8GA 5DFAA 3RGHA 2B3IA 4WW1B 4A2GA 4CVXB 4QUOA 2CKNA 4CAGA 5I0YA 3QO0A 4O4LB 4L9LC 2NY6B 1ACZA 3U4BH 2J8UF 3FT3A 1U8QA 3FCUB 3VJ6B 1T80A 2FQDA 3AAZA 1KTKE 3EO0A 4FFYA 4FKHA 1KP2A 1KGCE 4P06A 5JW4R 3EH1A 3IKKA 5GGVH 2KLRA 2EE6A 4IBVA 1KCVL 1CFBA 2OMWA 3KLDA 5C08B 1BOGB 1OCZB 4MD4A 4L3CA 3W7UA 2XCMC 1G6UA 1WIUA 2GJPA 3LZLA 3GMLA 3L1OL 5I9QB 3Q1EA 2A6IB 3GI8L 3CZGA 1AMXA 4JZGA 5E0FA 1K6QL 1KBVA 3DTXB 1UGKA 5D2NE 4L4VE 5BOPA 3PJSB 1BJ1J 4I2XB 4PCTA 1SJEA 5C2BH 4MTFA 4TSAL 4OF0A 4OLYH 3B9KC 5FO2A 5AW9B 3BHBB 4Q9BA 1DVFC 1KB5H 4MB3A 1CXEA 1F3RB 5GRYA 4KJWD 2XT1B 4RFEA 1Z7JA 3D7PA 1WVZA 4BV1A 2LLNA 3SGJA 3P54A 3WFCH 3IGAA 2HFEA 1OTTC 5DWPA 1IVLA 1MCIA 1SXCA 2WOYA 4YPGB 2NDGA 3FQUA 3GZQA 2D73A 3MJ7A 4QRPA 3ZTDC 1Y18A 3IMWA 5JOFA 5DUBB 1EDYA 2HPTA 4QHKI 4YDKH 4R8CA 3NP3A 4FG4A 2WY3B 2LO1A 3D9AL 1TUBA 2XN9E 3L3HB 2M6YA 4M56A 1VJSA 3OXSA 3ARGB 2BJMH 1E3FA 2OULB 5GTHZ 3OM3B 4JO4L 4D0BB 1NAML 2J6EH 2R69H 4EXPX 4WHTA 3L3OA 4I9WD 3GBMH 1OD7A 3VO0A 1JDDA 4E9VA 3ZEDA 2P5WD 4PYHA 3FN0H 4JRYD 4WHYH 3RWHA 3ZKMC 4FTDA 1S7SA 3IYLW 4UU9B 4Y4HC 4YSDA 3HG1E 5EO0A 5EUOE 4IOSD 2VC2L 4WEEA 2AERT 3ARQA 2J55A 3OR7A 4TULH 4X8JA 3BKMH 1T1XA 2PI5A 4HJSA 4CGTA 1U8OB 4NHUB 4DCQA 2ZD0A 1IDSA 4TQIA 4TOYH 4AYID 2BWQA 1BDYA 3MX0A 3RL2A 4F58H 4AHCA 5EIIA 2KQXA 5J2UB 3RYHA 1MI5A 3CDGB 1VQPV 3DPBA 3EOTL 4JRWA 4LLDB 3ZTNH 1RQ5A 4DP8X 2X09A 3BEWA 1UXWA 3TO4C 4DQAA 7PCYA 2VR8A 3KLHC 4L37B 3GINA 2IBZY 3BGMA 2AK1L 4LBEB 3TIDB 1JPTL 3E22A 2V8LA 1SVCP 2H41A 2CAZC 2E3VA 4YHKL 1UOKA 1XHHA 4JL2A 5EOCJ 1DBAL 3MV9D 2VERN 5J1TC 4WGWB 3D25A 4Z7OE 1GS6X 1MY5A 5L8KB 1I7TA 2F19H 1BVZA 3BPOC 4PJDE 4UT6A 3UZEC 4GRMB 3OTOO 5CSBA 1QR1A 4UCUA 1K8DB 3LS5L 3QIUC 4CNIB 1G7HA 2I9TA 4BAYA 4TVPH 5E94B 5FXCH 2ZT9B 1R3HB 3K6IA 4PP1D 5DMIL 3W9DB 4CU8A 1P7QB 1ZGLB 4GKJB 3RWJA 3ULVF 3ULVL 1GM9A 3KPRE 2CCVA 3JWDL 4OZIE 5CJ8A 3EO1B 1CG9B 4IOIB 5JIPA 1T20B 3AMKA 1CU4H 4LVNC 4ES8A 1ET7A 4ZUVA 4ZMPA 3T0DA 1XBDA 2VYRE 4RMVA 2XZQL 3OQRA 4BKSC 1EXHA 4FZEH 1N12A 4F7CB 3R4RA 3D2UB 4FQHA 4PJCA 4G43A 3VFVB 2XASA 3U36A 2NQ3A 3L45A 1S76D 1AI5A 1NKGA 5I1LA 1RHHB 4UDTA 1LDPL 1UZ8A 2UV3A 4WWNA 3LZFL 1MRCH 3LNDA 5BZWB 1M05B 4LXFA 4X0KA 2AEPL 2IH3A 2W6IG 5BUAA 3HKBB 1U8HB 3CC5B 2UUCB 1QSVA 5E2UH 1NJ9A 4YSAA 2JKIS 2VLJD 3O2DL 3OR6A 1PL3A 5DEFB 4J4PD 4PJEA 1PNKA 4AMKH 4KRPC 1A4KA 1OOWA 4KKNA 1ZANL 3RGBA 3BZFB 5IEKA 1CMOA 3H01A 4PRBB 4TSFG 2AQTA 4TN9A 2OTWA 5B7EA 5BOJA 2BDNL 2A9NL 5LO7A 2WVVA 3GMPB 1OCWH 1X5AA 4QRSA 3G6DL 4NNYA 1KCBA 3PY9A 3LCYA 2LTQB 5KJRH 2JJ1G 1JMKC 4X20A 4QIRA 4N9GA 1MG3C 2JJ2G 1QLEL 3A3YB 3ABLC 4FFZL 3QFJA 3H55A 4PJ9D 1XSIA 4HJIA 1D5IH 2A73A 4ZUUB 3RWCB 5A2FA 2EACA 5EB9A 5C1MB 4WUUD 4K3DL 3UC0H 3HNVH 1DVUA 2UVEA 5F6HJ 1ORQA 4U1MA 1MJUL 2WZ6A 4OPHA 1DZ0A 2XPYA 4IKKA 4NFDA 4YDJA 1OEZW 2H5UA 4HC1H 1G6VK 5I8CA 5C8YA 3QYNA 3BDXA 3KYKH 1MW2A 3US9A 3SGJC 4NRXB 3IGAC 3TPUA 2HFEC 2CLVA 2X4PB 3VXMA 5KSAB 3LKSA 4N0FB 1NGZA 3SCMD 2B77A 1N64L 3T0WA 4XMVA 1ZTXL 3RLSA 2Q9LA 3BQUB 4ERSL 2Y48A 1I7RB 4HIEB 2VN7A 2ZXCA 3EG9A 1BZ7A 4A39A 2R0KH 2WC7A 4IGBA 4JQIH 3WKMH 2C8NA 5LAXA 4JFFA 4RVBA 4EUPA 2R59A 5E8OB 4I0XA 3R1GL 2A6KB 5KVFE 5KBLA 4E9TA 3V9FA 1L4IA 3L3OC 4BFEA 2B16A 4KHTH 1GCFA 2Z31D 4AI8A 4J7JA 3NIDE 3ZKXC 3D85A 1O9HA 1N33B 1AVMA 1E4XH 1I9JH 1KGXA 2X4NA 3GNML 3LKPB 4P2QD 5ERWB 3GXIA 3LOWA 4U1SA 5AYQA 3KJ6L 1J8HA 4UF7C 4XMUA 2W07B 3EJQA 3OR7C 2JB5H 3MUY1 5LN8A 3W38A 5DU7A 4NZRL 2X6BA 4OTXL 4X8GA 3THMH 1C7TA 2UZXA 2R0ZH 4ZAKC 3VSUA 3CLEL 2H47C 2P47B 2Z6FA 3MRMA 4KKRA 2C4FU 4R96B 1LO2H 3N27A 3RG1C 1C8PA 1BM3L 4GMTH 1G6RH 2FE0A 1JUFB 3H9HA 5DLLA 1TVKB 4FQXD 3QCVL 3F01A 4EKXA 3FUHA 3EUDA 1KU9A 1YUHA 3FZUD 1GN6A 3O3BA 4QE9A 2EBOA 3QDGE 1KKCA 1RZJH 3WJMB 1H3WM 2JFCA 4Z76A 3GLDA 2QMJA 1R73A 2F23A 1BQKA 3B40A 1PBYA 3NCJH 4F15B 2DTML 3O11A 1OAXL 2X6UA 3CCSV 2K4AA 2P22C 2JJWA 2KPWA 1ADQH 2MSPA 3Q4HA 3QJUB 3VVWA 2I26N 1J1XH 1XBLA 1QBLH 2AV7A 3MO1B 3ZX1A 1RFDH 1JF1A 4AYSA 4N21A 4PP2A 4ELDA 3DMMB 3NPZB 3QSKB 3TA3B 3IJHB 1YPZB 1S7XA 3STLB 2QKAA 2WJ7A 1MRDH 1U0QA 2WUBL 4K35A 5HYJE 1GCYA 2VMDA 2O26U 3AK2A 1LO0H 4XZ4A 4F8NA 3T4ZA 1ZPUA 1XGYL 4D3CL 4E41A 3VXTA 5F7MC 3FHAA 3JWNC 1XGPB 5CMUA 3X3GH 4Z7VA 1S77D 2JELH 1CFVL 5FDYA 4OZ4B 4I3SH 1YI2V 1ZHNA 5SWSD 1I8MB 1L8DA 3X17A 5TPWH 3TEZA 2FJHB 3DBSA 1HQRA 2CRZA 1M3JA 1CK0L 1XB3A 4PJ8D 1VMGA 1YEJL 1I7ZA 3MUGA 5GRJL 1T5WB 1IC5L 5D1XA 2IH3C 5K1VA 3C12A 4PV8B 2X3CA 1RULH 3SPJA 5DJ6A 3OR6C 3VX0A 4ZFGL 3VGAB 4JKLA 2IAMA 3HIZA 2GW5A 3DA0A 4YL4A 2P80A 3LKRA 2DM3A 4MNHA 4EN3A 3CRRA 1OAQH 1ZV2A 3ZK0A 5FLVA 1GAFH 4JASA 2V17H 2Y4TA 4XDLA 4WFFD 2E59A 3PABB 1BFTA 3IFPA 3OC8A 3BP7A 2J8OA 1IQDB 3HBGA 2ZP9A 1J9TA 4H8UA 1BMGA 2EDHA 2QBWA 1I7UB 3FB7A 4BKTC 1TQVA 5KN5B 2LU7A 4DN4H 3KBPA 2FSEB 5DQDH 3IEAA 3SDCD 5ID0A 3B3IA 2ISDA 2IH9A 2CK3G 5EZOL 1WCBB 5H6QA 2GG1A 2VITA 1E28A 1KCUL 4N2KA 3AGVA 4L8BA 4FMTA 4I18A 2GJ6B 3TNNB 4NC1E 4M5YL 1QVFU 2C3HA 3MNWA 4PSRA 5JIHA 1ORQC 4F7MB 2VW6A 2XWBA 5SX5K 3A0BZ 1MUJB 1DSFH 2RNBA 5HGHA 1NCCH 4NP4L 1YYLH 1KB5A 2NW3A 4IU3B 4PRHA 4PCYA 2AK4D 5CHNA 5EEWA 3G5WA 2X0WA 4XNQB 1MFVA 4AK2A 2WGNB 5KEZA 5BMVA 4XPAH 3H42H 1HINH 1BVLA 1ZIAA 3S35L 4TUOA 2FATL 2IBBA 4WI3A 3VI4F 4MQXD 3VYNA 2EULA 1QOKA 2BNQD 5AALA 4F8TA 3E6FB 4ZMQA 5I30H 5JXAL 1H15B 1P7KB 3NJMA 3U4EB 3IDNB 4RX4A 1L6XA 2WCGA 3T0EA 3A21A 4NQEB 1R75A 3OKNA 1ED3A 4JM2B 4RAHA 4W9KC 5HSFA 5I1AA 1XH3B 5IB3A 2J6EA 2LE9A 2W60A 1IMHC 2R69A 4XB8A 5HXMA 1EMTL 5I5JA 2YS4A 4E9LA 2FEEI 1BQHG 1BW8A 4HJUA 1A7PH 2EO1A 1SZTA 1VFMA 4KUMA 2YPLA 1FFRA 2P7TA 1WEJH 4P9HH 3I2CH 5B38G 4I50B 3CSPA 1E9QA 3FSWA 1T2JA 5FW8A 4P4RA 3INUH 5K5YA 1QMUA 4KY1L 2FJGA 2DWSA 5C07B 5ABAA 4TQPA 3CFUA 2BX5A 5MEND 4U7KA 1DLHA 1XD0A 2V3DA 1U2HA 5F21B 2H3NA 5IP4A 4JZJB 1NGYB 4FYSA 1IURA 2FWUA 3QZWG 3IC7A 4EN2A 5A2CA 1NCGA 1OF2A 4DR6B 3Q2WA 4P2RD 3OMAB 3EO9H 4HMCA 4AVJA 1OGAB 1DL7L 2BY2A 4FZ1A 1TJGH 4NO0D 1HQ4B 1KN4H 5LDSA 3RKDC 4O2AA 4S1QL 3FOMA 3NIFF 5DUML 5T3ZD 4Y9EA 5HHNB 4OLUL 3KAAA 2EJ7A 3AXLA 1D3CA 4LOEA 4NM8L 2F54D 5LB1A 1KBHA 3GSRA 1W72L 4FP8L 3ULVE 1UADC 2VQTA 4A38A 2IPUG 3F64A 4PLOB 1FNHA 1ES0B 1F45A 3AK1A 2CUMA 2JSFA 2ZG1A 3QISA 3WL9A 3FF8A 3QULA 3QIBB 1TKWA 4RBPK 3KMDA 1JFFB 2OMZB 4KVCL 2C9SA 2QFRA 3X14B 1SC5B 1U91B 3KYAA 2GY7B 4OD2B 1PZ5A 1LD9A 4WU5B 3GI9L 2Q0AA 5KOMC 1GYCA 1QWUA 1TZIA 3PWVB 3WXWL 2YD7A 5HFLA 4PB9L 4Y4KA 2Q5BA 1F2XK 1MAML 3IDGA 4AQ1A 1Q9KA 1WBYA 4OIFA 4HXBL 1ZWIB 2J3SA 3Q9PA 5D1XC 1N33O 3STZB 1GSMA 1G0XA 2ZXEB 4J3OH 1SQFA 4DPBX 3BPNB 3AG3B 5G5DB 5C08E 4JGSA 2CM5A 1SBBA 3BZ5A 4Q8BA 4YX2H 1LILA 3WKPA 1T6VN 1X4XA 2IAMC 5D2LF 5FW7A 4PJAA 4M1GH 3T4AA 4EN3C 3K6SB 3AG1B 3I02B 1T6WA 2HJDA 4GUPB 4P3DB 1TZHB 3VD0A 5INDB 3FB7C 1EVUA 2AVGA 1PFOA 3PNWB 1X5IA 2WQ8A 1KECA 1XCQB 3VQLA 1CCZA 4U3HA 3VXNA 1Q94A 1J86A 4KUZH 5IF0A 2WXPA 2WXNA 4GAGL 3ILQD 4JREC 2XG4B 1XEQA 5IKCB 1VP7A 4I18C 3TEXA 2IALB 1D6EB 1UTDA 2OCCC 1KJ3H 3W7WA 2QKIA 3DXAB 3DWTA 3F12B 3OKOA 3Q48A 5FA4B 2OZ4H 3CBRA 3EYSL 5LNDA 2XA3A 1MHCA 3A0OA 1RH8A 1MXGA 3FQXA 4G7RB 3V8CA 5I1EH 4HC1A 2JK5A 1YAIA 3BH8A 2IBZH 1JV5A 3UAEA 2Q7HA 1KYFA 4HXAH 3DECA 5F0JB 1WA1X 5GGTL 3EH5B 4CH5A 3QEUB 4OIIH 4IYIA 4R6ZA 3BD3A 3RVVC 5DHEA 4B3EA 3SYOA 4BSVB 1ZTXE 1ZPLA 6CGTA 3IE4A 2V33A 3LV3B 4I88A 2EICA 2WPDG 3ESUF 5C0DB 3UTTE 5F71A 3EOBB 1WP6A 1SFDA 3QUXA 2CKBB 3FB5B 4G3YH 1VGEL 1AROP 4HKBA 4LL4A 4OM0H 4PQXA 2JQZA 2Z4TA 1SESA 3SKNB 1KV3A 4WDIA 3MUJA 5LGTA 4X8XA 1KJVA 1UQSB 3ZGHA 4K23L 4JQIA 5CA1A 5ISZB 1MHEA 4PJGB 3T0EC 1R17A 3BSZA 2FBRA 1P84F 1JYXA 1RMFH 4P5KA 2ESVB 4JDZB 3E8HA 1PLBA 2YKKA 2X05A 5EPMA 4KZEL 2LHAA 4GAFB 5CCHE 2PTTA 4ZOCA 1GOGA 3TM6A 1ETJA 2BSTB 4HG4K 4FABH 1K4DB 4G8GA 5IBTH 4GX0A 5DQ9A 2P7TC 1MFCL 1TVBB 4WJ5B 1JD9A 3QFDA 4IRSD 3UTQA 4R2GB 3RN4A 4LQFH 3BEVA 3K7UA 5C93A 1MWAL 3M88A 1Q0EA 3ZKNC 1SQQH 2I69A 3G9AB 4XPGL 2WNWA 2XQBL 4LF6B 1YSOA 3AUVA 1IILE 5HJBA 3V0FA 3U7YL 5ELIA 5LXTA 2R8SH 3F7RA 3FONA 2QADC 1G6RA 1M56B 2J1WA 5FUZL 5IFJA 4H5SB 4OVUA 1JJOA 1J48A 1R24B 2L3BA 4YAQB 3LEVL 2JKWA 3WS6A 3FTVA 4HISA 4I0PB 1LO4L 4XC3L 2IU0A 4MCZB 5BZDA 2UWEB 4KP4A 3MAWA 4QD2E 4YY3B 1CGSH 1SOQA 1NBMG 1OHQA 2HJFB 2DWYA 3KBEA 3V6FA 4YHLH 1TEYA 4XP6L 5FEBA 1N2RA 1YAZA 2FR4A 5DRWA 1U96A 2AHYA 3LZOA 1R3KA 1KPUB 4QNHB 3Q3GA 5ESQB 3C9NB 1AI7A 1ADQA 2J88L 1YDPB 1SMOA 5E7FA 4YFDB 4WV1A 2R0WH 2BIPA 1BEYL 2FJFB 2OYQA 4I77H 1I85A 4F80A 1GGYA 3LNFA 3IGLA 3ALPA 1NBZA 3MYJA 3ARFA 2R4SL 4PWFA 1H5BB 1F3DH 2ZWKA 2ZYIA 3K80A 4X9HA 4PIBA 4HGWB 3T0XA 4YR6A 1UATA 4MJHA 3T8XB 3TXAA 2FGWH 3MLYH 4FNLH 3MA7A 1NZRA 4PWGA 1K3IA 1E2ZA 2Y06L 4GSQA 4AYDC 4Y4FB 3U0TA 4M7LT 2DEXX 4GKSB 1MFMA 1J1PH 2QPEB 4FLQA 3RPIA 4GO9A 4Y4KC 2F43G 4AQ1C 4ZDHB 4NCC1 1JNHA 2B2XH 2GFBA 4J23A 2D0HA 3W2DL 5ITBH 2ZE5A 2P3YA 3ULSB 2DQCH 1OTSC 3BKYH 5I71C 2ZYRA 4PRNB 1PP9H 4B7KA 4EDWH 3MVSA 4JN2A 2R7EA 3M1OA 4ZS6C 3OEHG 1Y76B 4OUOA 3L4UA 5B1BB 4XC1H 1IFGA 3T4AC 4IBWA 2BSDA 1TEGA 4Z7UF 1ITCA 1F6AA 1FP5A 1E42A 1Y4MA 3HPLA 1PLGH 3GSNB 1MCWW 3NN8B 4IGBD 1BXAA 4NJ9H 1WA2X 1AZNA 3ROOB 4ODWB 4KH2A 4LCUC 2R4RH 3BPLC 2VN4A 2WLJA 5DUPH 4KXDA 3GDBA 2QM8A 2R9RB 4JHUA 3KNBA 3QO1A 4HPYH 2KUTA 4RGMC 3IDIA 1A9EB 1E3XA 4LCWB 4PBXA 1J8HD 3ZHUA 3DXRB 4B27A 2QKIC 5E8PA 2PCFA 4QRUA 1ZOXA 4JO3L 4RGNC 4HPOH 5ITZB 2XHNA 4YHOH 4K9EC 2SEBB 2JK5C 4QRRB 2KI6A 3ML0A 3NJKA 4FTVA 4KH9A 3CC2V 1S4IA 1ZA3A 2OMXA 1FNEA 3DHUA 3T2PA 3CH1B 1J8KA 3C5JA 3D6GA 4K3JH 3BVOA 1FNSH 3NZSA 4HCRL 4TYUA 2DF3A 1IM3A 1A6VH 2WBKA 1L0XA 2EE2A 2LABA 3QUXC 4KFZC 1CJYA 1NAKH 3VRLE 4HH9B 2KKWA 4DFIA 2FHBA 3IJ4A 3JD0A 3SKOB 3D39A 1G84A 3QUHA 2E76B 5IVNA 4L1BA 1CDJA 2W65A 4B9JA 4FXGA 4GZRB 2HTLC 3SDAA 4JPWH 3O6LL 4ZQTA 2IH1B 4S0HA 2ZUUA 3WFVA 2P8MB 3A4AA 4HEPA 4GUOA 1EHAA 1FSKB 4P57A 1GTNA 3O3DA 3S4SG 3OPUA 2ADFH 5EO1A 3KPOB 5DK3A 1AYOA 3RVXC 2KH2B 3ARXA 3HZKB 1KZYA 1YSCA 3PV6A 2VW7A 4KPHH 4N8VG 5A16A 3LEXB 1CGVA 3Q5YA 1HILA 1OAZL 1E8XA 5F89B 3VFMB 8FABA 5I6XB 1JZHA 1FGNL 4MDJB 1QO3A 3CQQA 1OHHG 1U3JA 4A7TA 3QO7A 1B06A 1KIPA 3RX8A 3GMQB 5DC4B 1QR4A 1E2VA 4UQDA 5C0EB 5L2KA 3CHOA 1DN0B 1R19A 2J43A 5SV4A 4AITA 4BHUI 1T7VA 5I9QC 1FC1A 3O3AA 4JB9L 5DJ8B 3HEIB 2EILB 3WS6C 4U3CA 1LEIA 1MNUL 2JKXA 1O9ZA 1YPZE 5C3IA 3IJSA 3ARWA 1V8HA 3AY4A 5E03A 2AXTZ 4QGPA 2NX5A 4NQXA 2Y5QA 3B6SB 1MCSA 2P80D 5A7EA 1NCWL 3WIHA 3MBEA 4OLEA 5GISL 5JOPD 1BGYH 1V27A 2CSPA 4LFAO 1I85C 4N68A 1YNKL 1BX2B 3DHJA 5I6MA 1RPKA 4N0CD 4QTIL 2DLTA 3AQYA 3ARFC 4WK2B 4TV9B 1WRFA 2BS71 2DQJH 1HXMA 5GHWL 3TA4D 1KELL 4JEGB 4MA7L 4P05A 3ZQXA 3OC5A 2FQFA 3GC3A 1ZY9A 4J6IA 4KQ3L 1M1XA 5I73C 2KLTA 2UY6B 2JNZA 3K5RA 3GQFA 3KYOB 4PY7B 5AG9A 15C8L 4HS8H 4DUWA 2C5DC 4FLWA 3ETSA 2AQSA 3FCTA 3HBQA 1E4WH 1AG0A 1N5AA 2WWWA 3L4TA 4YDMA 3LDEA 2NY5H 4JUSA 3ZDXB 4XAWH 2WA4A 3AWFA 4N2FA 3GJFB 4QYAA 4H13C 4P4KB 1B2WL 4FXKB 1P1VA 2IDQA 2AZ2A 3ZO9A 1P4RA 4PRHD 5D7IA 4L5FH 5IJDC 3N1QC 3GSNL 4GB9A 5BXFB 3S88H 5IB4A 2HJKB 2CIKB 3CHSA 5A6IA 3V4VH 3DHPA 4P23A 5D2LE 4F8PA 1TCRB 4LPCA 1RZIB 4G9FB 4NKMA 4EI5B 1P7GA 4M93C 2UXBB 2IQ9L 2P06A 3HPLC 2VMCA 4XMKH 1BQHB 3ML8A 3MRQA 4JO2H 4PS7A 5IHUL 5HJGA 2NY0B 5L4JA 1MJ7L 3FNKA 4XP9H 2VL5A 4Z23A 1M6OA 4CU7A 3B2EE 2OP4L 4OLXH 5B38B 2GI7A 2ITEA 3ZTCC 1A1OA 5KVEE 1P5VB 4FULA 2CDFA 3GMMA 2ZQMA 3UFIA 1CXKA 2W59A 4LSVL 3BZEB 5K9QG 4XB3A 1ULVA 2ADQB 2CJUH 1AVAA 5D70H 5AEAA 1MPAH 3QZWB 5JVDA 1MCPH 1VERA 1F51A 2V9TA 4LSRH 5F0LB 2X6CA 3OB0H 3VFPA 4ZPVB 4WHCA 3MUZ1 4YDNA 3SR2C 1T1WB 2OZ4A 4ELME 3IPBA 1FO0L 3SKUD 3GSXA 5HGAB 2JJTA 2ZX9A 4B9PA 4LBAA 4NYLA 4QXGL 4JVPA 2BMKA 5CEZD 1O6SA 4HHWA 3MBWB 3HUJA 2NNCA 5CN0A 2Y72A 5IREA 2VXUL 4E9QA 2YMTA 1RURH 4WI5A 3U46B 4WAFA 3JV6B 1EJOL 1OLZA 2YJQA 3V5DA 5CAYB 5IHWA 5HD8C 3V7AE 4FLOA 4EKJA 4ENZA 1M7DA 3QH3A 1AI1H 2JDIG 3GSWA 3NZHL 5EN3A 1KCWA 3QAZC 3T3MF 1BD2D 5LYJA 1T83A 3FQTB 2WXMA 4FXGC 2CDYA 3OXRA 1DJXA 5CR8A 3C60B 5FK9B 4G82A 3EYOA 4PJIA 5HHQA 5L0QB 3UO1H 3L4VA 2UUAB 1P4UA 2WYHA 4PJHA 2PYFA 4XXDA 4HV8A 4OCXL 4NGHL 3LSUA 2NT1A 2VE6A 4MMZB 4DP4X 2MW2B 2HN7A 3T1FA 3FO0L 1ZEAL 1DVXA 4LLMA 4GMSL 5KSBA 2DJUA 3Q06A 4LC1A 3CVHH 4XWGL 5CCKH 2WTRB 2FYUH 1LTXA 2ATPA 1DBBH 4P9HC 2EJRA 4PGDA 4MJ2A 2VXSL 1E6OH 3E1ZA 3OKKA 2PWFA 1E4JA 4W9HC 1GZQB 2XIIA 3X2QC 2XKUA 1G8MA 4R0LC 4PJXF 4L3ED 2AXWA 2DS4A 1E4HA 4UNIA 1H6FA 3VTMA 5CU9A 5D5MA 3O6FD 2BNRB 4JFUA 4G1EB 2IO5A 4XP4H 3L8QA 4YXWG 3ZT5A 3AY4C 1O7DE 3WFDH 3W39B 4UTAL 2P49B 1TETL 4ES9A 1YMHA 4I1NB 5ICYB 4UVAA 4KTDH 5IT9N 4ISVA 4HIJB 4TT3G 3HVDA 3LZNA 1GMEA 3NJVA 2CR3A 3MBEC 3IFOA 3MLUL 1FVCB 5I74B 2MCMA 1G0YR 4PG2C 5B39G 3TJPA 1DLFL 3TBTB 1Q90D 2EXWD 3BQVA 5TFSL 1UCBH 2MNUA 2R2EB 1L6PA 4XPBH 5BV7B 3A0HZ 2YRLA 3GBLA 5I6KA 2IWFA 4FLXA 4DGYH 5HDQH 5IB1B 3A6BH 2AJSH 4XN7A 1ODAA 4BUQA 5SWQA 3NCYS 1AE6L 4J5VA 3AQDA 1I1AD 1KXQA 5DD0H 1R0AH 2X4OA 4HIHA 1QKZL 2XSKA 4KVNL 1NC2B 1KPVB 3Q1SL 4R6UA 4ZW7A 4KNSA 2W1NA 4UM9D 5JW5A 3I6KB 3A22A 1RI8A 1IM9D 1PD1A 1RJYB 2EYRA 2HLFD 3OG4B 3P4OB 3GHPA 4KKBD 1ZHBB 5FUCC 1L9MA 3KWWA 1MFEH 4LPWA 2AJZA 4TOIA 1S6NA 3PAUA 5F96L 3ESOA 2V5RA 1BQUA 3WO3B 1IEBA 2P52A 4J3OC 4NRZA 5KA6A 4PREB 3WFEL 1QHTA 3FO1B 4P23C 1R5WA 2BTQA 2GBOA 1HHIB 4FL4B 4CN4A 3DX7B 4OFQA 3OHXA