3HB3B

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1-beta
total genus 73
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hb3B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3hb3B01
5I6MA 3NP3A 1GYCA 3OQRA 1MZYA 3ZDWA 4KNUA 1WA1X 4F2FA 4E9SA 2XU9A 4PAZA 3S8GB 4JHUA 2CJ3A 2IWKA 2PCYA 2QPEB 4A2FA 1AZBA 2TSAA 2BP0B 3AG4B 1GS8A 2BW5A 1AQ8A 3IE9A 3KW8A 3MBWB 5I6PA 1J9TA 1NTDA 2WO2B 1BYPA 1BEXA 3PXLA 5A7EA 2XLLA 3AY2A 3ASNB 3NYKA 4KO5A 2AZUA 1JXFA 1L9TA 3ZX1A 4AKQA 3GDCA 1ASQA 1DYZA 2ZOOA 4AKPA 1CUOA 1NINA 3FSAA 1PZBA 4A68A 4G70B 3MX0B 2R7EA 2YAOA 3FU9A 1AZUA 1J5CA 1ZDSA 2XXGA 4G7RB 1QNIA 2N0MA 4HHGA 1XB8A 2PPFA 1E65A 1JZHA 4BWWA 2LLNA 3PLYA 4DP7X 1AZNA 3FQ1A 2CBPA 3NJMA 2UX6A 1NPJA 1BXVA 4GY4A 4DP6X 1M56B 1ILSA 3IEAA 1IC0A 4NB7A 1E30A 4N4YB 2YAHA 4E9YA 3FPYA 2QDVA 1X9UA 4YVNA 1OCCB 3TBCA 4P5SA 1JZFA 4A2HA 1E67A 4DP1X 2XWZA 3S3CB 1L9RA 4F2EA 3UACA 1F56A 1SJMA 1AACA 3WKPA 1V54B 1ADWA 3V9CA 1PNDA 4BWUA 4YSQA 1AOZA 4CSZA 4DP8X 3ASOB 2AZAA 1RZPA 2GI0A 3PPSA 1AZRA 1ZIBA 4BXVA 3AW5A 1J5DA 2PP9A 5PCYA 5I5JA 1AR1B 3CG8A 3NT0A 4HCGA 4G7SB 1KCBA 1ETJA 3X1BA 3X1EA 4F7KA 1PCSA 1OCZB 2FJSA 3IN2A 3OD3A 2XXFA 1QLEB 1A4BA 1GR7A 3PCYA 2HZHA 2X87A 3FQ2A 3S3BB 2VSMB 3T9WA 3DKHA 4UANA 2GIMA 2PPEA 2W88A 5PAZA 4HCIA 3FSZA 2IDUA 1W6LA 1L9OA 1MDAA 4N8UA 3NJIA 4AX3A 2HXAA 2EIMB 3UGEA 3NJFA 5B3SB 1BQRA 2YXWA 5I28A 2MRYA 3EH4B 3OMAB 4WTQA 4QLWA 3H4HA 2I7SA 2UXFA 1NZRA 1UATA 4G72B 1JERA 3UAAA 1T5KA 2HLEB 5B7MA 3PAUA 1GY1A 3NJKA 4GYBA 1OE3A 1NPNA 1URIA 2B3IA 1KDJA 4DP9X 4CSPA 1A4CA 2H47C 3WIAA 2HRHA 3NJJA 1ZV2A 2GC4C 1CC3A 1TU2A 2ZWNA 1JZIA 3S3DB 2DY2A 2P80D 3T6ZA 2DV6A 2BO0A 2XYBA 2BW4A 3QJQB 1AS7A 2HX8A 2MTAA 3SBPA 1NIEA 3QJTB 2YAFA 1CURA 2YXVA 2CUAA 2YAQA 5EHFA 3X1FA 3CVCA 2FNWA 3S8FB 3QJUB 3WKQA 1XB6A 4KO7A 2R7EB 4E9WA 3PAVA 4YVUA 3WI9A 2E86A 2HRGA 3V9EA 1A4AA 1V55B 1MZZA 2JKWA 4DPBX 2WSDA 3AG1B 3GXUB 4A2GA 1CYWA 3L45A 2FTAA 1NICA 4A67A 2DYSB 5I6KA 2Y69B 3FPXA 1HFUA 3ZBMA 2DWSA 3NSYA 5I6LA 5F7AA 1R1CA 2VSKB 4E9TA 4K9JA 3QJVB 5D4IA 1ET5A 3TBBA 2FT6A 4GXFA 1SNRA 1E5YA 4AZUA 1A65A 1JVLA 1YLBB 3SQRA 4M3HA 4DP0X 1NDTA 4UAHA 5D4JA 1OOWA 5I26A 1JXDA 2IDFA 1N68A 1M57B 3QJSB 2BP0A 1OE1A 2UXVA 2GB2A 4ZK8A 2IAAC 3DTUB 1IBYA 1NWOA 1J9RA 1BYOA 1V10A 4HZ1A 4G71B 3OMIB 3GYRA 2PP8A 5AFAA 3WNJA 1W8EA 1NWPA 2VM4A 5TK4A 1XMEB 3DIVA 2BZ7A 3ABKB 1MG3C 2UXGA 1SDDA 1QHQA 3FU7A 3X1NA 1PF3A 4GP8B 6PAZA 1EZLA 4AI7A 1TEGA 2XV3A 2FWLB 2HX7A 1GW0A 4UF7C 2J55A 4A2EA 3SBRA 1I53A 3FT0A 1OV8A 3TU6A 1ASOA 3KW7A 4KNTA 1IKOP 2I7OA 3AZUA 7PAZA 2BHFA 3QJRB 1KCWA 4AKOA 3H4FA 2FQDA 1XB3A 1SHXA 3T6XA 2XX0A 2FT7A 4BK5C 4DP4X 3X1GA 4X4KA 2EIKB 6PCYA 1KGYE 1PY0A 5F7BA 1ILUA 1HAWA 2Q9OA 1BXAA 3C75A 4KO9A 4W9ZA 1FFTB 4E9XA 1DZ0A 4DP2X 2VW6A 1NIDA 1WAEA 3HEIB 5B1KA 1CYXA 3NSCA 5B7FA 1AG6A 1AS6A 3FQYA 3FYIB 1SF5A 3FU8A 1ET8A 1PAZA 2J57A 1AANA 1RKRA 4KO6A 4FAAB 3HB3B 1BXUA 4BWTA 1BQKA 1W6WA 3G5WA 3CZUB 4YSDA 4GP4B 2EINB 1KYAA 2FQEA 2UXTA 4DPCX 1WS7A 2VW4A 2BWIA 4JKNA 3T71A 3EF4A 1B3IA 3X2QB 1E5ZA 3IBOA 2WO3B 2B08A 1L9QA 3H56A 7PCYA 2H3XC 5AKRA 3EH3B 2QPDB 1JOIA 3FSWA 3JTBA 1RZQA 2AVFA 1PLAA 1PNCA 1X9RA 3ABLB 2FQGA 2IDTA 1FWXA 2NRDA 4YL4A 4YSOA 4QKTA 2VW7A 2YAMA 4GP5B 2EILB 1A8ZA 4DP5X 2BP8A 3OM3B 3CVBA 3FU7B 2PP7A 2UX7A 3NJHA 4HAKA 4E9QA 4NAJA 3ABMB 1AZCA 2YQBA 2QT6A 2OCCB 4YSPA 3FYEB 3BQVA 1AIZA 2ZONA 3AG2B 1KBVA 1GY2A 1L9PA 2DYRB 1PLCA 3ZIYA 4YSUA 1WA0X 3EHBB 1A3ZA 1BQ5A 1TKWA 2PPAA 2IWEA 3JT2A 4Q89A 2AFNA 2Q5BA 2YEVB 1OF0A 2H5UA 2VMJA 4W1TA 3ABGA 1PLBA 5IY5B 4BDVA 3FS9A 5I5MA 2PPDA 4HCFA 1AG0A 5AZUA 3NJNA 3NSDA 1GS6X 1ID2A 3IN0A 4BXSV 5I6NA 5LDUA 3N55A 3ERXA 2HX9A 2IDQA 2PPCA 5FC9A 1ZPUA 1BAWA 3AG3B 2RACA 3N2JA 2GBAA 1RCYA 4KNSA 2A3TA 3BVDB 4YSSA 3WNIA 5I5IA 1PZAA 1AS8A 2FT8A 1OCOB 2XV0A 9PCYA 2DWTA 3UAEA 5ANHA 3FSVA 2VN3A 1ASPA 1JZJA 1EHKB 1N70A 4PCYA 1KV7A 1KBWA 2GHZA 1WA2X 2JFCA 4HIPA 1IUZA 1L9SA 3UADA 1GS7A 4HALA 2BWDA 4EF3A 4MFHA 2CALA 1JVOA 2IH8A 4YSCA 1HAUA 1JZEA 1AAJA 3T6VA 4HHWA 2IWFA 1SDDB 3WG7B 3CVDA 2J56A 2X88A 5I6OA 2EIJB 2AANA 2YARA 4YSRA 2XUWA 1NIAA 2XV2A 3TA4D 2XX1A 2BP8B 2YAPA 3NSFA 1TEFA 2FQFA 4KOBA 2YAEA 2BZCA 4YSEA 2QDWA 2OJ1A 1IBZA 2CCWA 4G7QB 1NIFA 4A66A 4E9VA 1VLXA 4E9RA 1SHWA 3OMNB 3CDZB 4JHVA 4Q8BA 3D12B 3NJLA 3TASA 4RH4A 2XVBA 3EH5B 1M9WA 1ET7A 4TXVB 4FA7B 1PMYA 3NP4A 1SF3A 1GSKA 1SFDA 2IDSA 2GC7C 5E9NA 1FA4A 2Y1AA 2W8CA 4YSTA 4YSAA 2VM3A 5D4HA 3NJGA 4BDVB 2TSBA 4DPAX 3QQXA 1J9SA 1KDIA 1WS8A 2CAKA 1JXGA 3UABA 1SFHA 4ENZA 5B1JA 1OE2A 2OV0A 2P80A 5B7EA 4P5RA 2PLTA 1ZIAA 8PAZA 2PCFA 3RYMA 3CDZA 3T6WA 4WKXA 3PAZA 3U25A 2I85A 2ZXWB 4NERA 5B1BB 1PZCA 2IH9A 4KOCA 1J9QA 1MG2C 4M4RB 3SBQA 5B1JC 5TK2A 2GSMB 1OCRB 2JXMA 1JZGA 4A2DA 1ZDQA 1NIBA 4L0PB 5B1AB 3QPKA 2J5WA
chains in the Genus database with same CATH superfamily
2IXQA 3PWVA 4LRIA 4MMYB 5DTFA 3F62A 4DESA 4DFHA 2ADFH 3QC5X 1F1DA 1VAHA 3QULA 3OQRA 2VRKA 2XV6B 4RZCB 3BPLC 4ZMYA 1FP5A 3OE7G 4AMWA 4U1IB 1DBML 1RUAL 2C1OA 5I17B 5KSBF 3OZLA 2QADB 2QVKA 3IETA 3OZ9L 1UOWA 4OIAA 4WY7H 3ARFD 1E8ZA 4MB1A 3RKDC 3IGAA 1AYOA 1QW8A 3IB4A 1QR1B 4YR6A 2NR5A 1FH5L 5E9DB 2Q7AA 3MBWB 4R2GC 2XJLA 2XIIA 2QSAA 5I8KH 2UWEB 1N32B 3T2PA 5IBTL 1CE1H 4PWJA 1MFAH 4JFEB 3EJZD 4TV3A 5F1SA 1JMKC 5DRWB 5EZLB 2PN5A 5T33L 1H6EA 1KGXA 5EZIL 2FJFA 3NYKA 4TVPH 2QQKH 1K4DB 3C12A 4MLSA 2DQJH 1MWAL 5LGKA 1KXVC 1FAIL 1TZHB 3ZE2F 3FSAA 1PD1A 4FXKB 5KVGH 2R7EA 3WIFB 1NMAH 1PSKH 3EO0B 1FE8H 5BS0A 3POHA 3EJTA 3NZSA 2VC2L 1X4ZA 1Q86W 1MZFA 1E65A 2E75C 2W59A 4AZ8A 4Z78A 5C0CA 1O5PA 1MVUA 5DJ0B 1GJWA 2DL2A 3MJ9L 5EBMB 3TO4C 1N19A 2FCBA 3K81A 3OF6D 5MERB 2QZQA 1AKPA 1OTSD 3CFDB 4HWBL 1KXQE 4XN1A 4AGQA 4EN3C 3UJJH 2DD8L 2A7WA 2PWDA 3QZLA 4RQFA 1D7BA 3ARXA 1G94A 1M1KW 1BOYA 1MCKA 3TVMB 4ZG1A 3ATFA 1GIGL 4NQEE 1UOKA 2V9UA 2DKMA 4PJ7F 1VF6A 4RGOH 1PZ5B 1OTUC 3PXJA 4B9IA 5CEXA 3EBAA 1R5VB 5K5YA 5KSBB 4K7PL 4EPSA 3RVTD 4A5UB 3PS6A 1YUHA 1YSOA 1Z9NA 3SCMC 2O5YH 3GB7A 4O2BA 1AC0A 5KAIZ 2X6UA 3MFFA 4GT7A 3CC7V 5E4OA 4F2EA 4KRPB 5FYKD 1P5UA 2LAGB 2DJUA 5AD0B 1N9PA 1KLFB 4FMTA 3IT8D 4I13B 4PRBB 4GRMB 4BWUA 3IKCB 4X66O 4BZ1L 3BABA 3JD2A 2QEXV 4AITA 1SESA 1LO3L 2BSSB 3IMBA 2A3QA 1J5DA 3HS9A 3GIVB 1EO7A 5SWSA 4OAWA 1A6UL 4ZFFB 4X7FC 2X4RB 5JPNC 3GSWB 5J11B 1U91B 1ZVHA 4YFDB 3ZRWB 4CC4A 1MY5A 4WHTB 3VXPA 3JUYA 3GSQB 2JEUA 1J12A 4F7KA 1F97A 1K73W 2FJSA 3LX9A 4NUQA 1KB5H 4PJIE 3ZKNC 1JHLH 3LHPH 3BUDA 3TYGL 1CFSB 3K6SB 5B39A 4PA6A 5CIPA 1P4RA 4OFYD 3T9WA 3C8KB 3QNEA 2YBRA 4WI3A 2F08A 1CTOA 4R3SB 3SE4A 3MLXL 5LO7A 4OLZL 2J6EH 3CXDL 1QZ1A 3UC0H 2QQNH 1VQ5V 1NVPD 4AX3A 2ZE5A 3C8KA 4XDLA 2FL5B 2QMJA 4HJGB 3ULUD 4DRXB 4QRRB 4TPRL 3KPOB 4DR2B 5B38A 4I18A 6FABH 4PWEA 1QUNA 3BZEB 2N01B 3MLRH 1C7SA 4X99B 3VFRA 1KPRA 1JERA 3PWUA 4GW1A 3QDGE 4OGAC 3UPRA 3SKOB 2HLEB 5EV7A 3PAUA 5I6XC 4QHKJ 3T1YB 1U8HB 5GS0D 1V7NL 1DCEA 1S7WA 3CFBB 1RHFA 3UBXI 3FO0L 3LSOB 3U6RA 1MI5B 4NM4L 1Q43A 3B9DA 3QQ3B 4DP9X 3EFFK 3G6JA 3N2GA 1E27A 1H2GA 1PAMA 1UB5B 4IIJA 3OKYA 2XAJA 1K2DA 4HZLA 4I77H 4IRSD 4KTDH 5D1ZI 1NJ9A 4X4ZA 1WBZA 3ETGA 1FXKC 3GB7B 3IVKB 3VJ6A 1S9WB 2IQ9H 2TRYA 2AJYL 3CYOA 2DB8A 7FABL 5HYQB 4KDTC 3IDMB 3DC0A 4TOYL 3SJVB 4TN9A 3SKOA 3EDKA 5IB3B 3ZHSA 2OMXB 4JKKA 5AOZA 1FSKB 2ARJQ 1HIMH 2OLDA 1A7QH 1VZIA 2A9CA 2HRGA 4N2MA 3S98A 2P24B 3WN5B 3X3FH 1BHGA 3ETTA 1HOEA 3L3DA 4L8DB 2AERT 1V55B 1RK0A 2I60H 3BZFA 4NKIL 4GMSH 2JKIS 3AG1B 3V5KB 5C0CB 4Z78B 1N5AA 5EUOE 1CU4H 1UURA 1H8LA 4N3TA 4XBEL 3N43B 3LMJH 3BUQA 5IQ7H 2IOMA 2BRRL 2ICES 4ZS7L 1S5IL 1VPOL 2MKWA 1TJGL 4KQ3H 4XTRD 4G42B 4UCRA 3GI8L 3OLEA 3CSXA 3G6EV 2P5EB 3H6JA 3O41B 4LOUC 4MKMA 3BKCH 3J8F7 4DJMA 1GZHC 4TMPA 3QNXB 3GZQA 1SMDA 4HAGA 2X0LA 3LDBC 1FZJB 4L4TB 4S1SL 3VNYA 3VMPA 3ZHQA 1K4DC 3T3ME 1OALA 2R0KH 4LF6O 1DJXA 2EP6A 1AGBA 1MIML 2EYSA 3MJ7A 4OR1A 1N68A 3ZHLA 4N2GA 4OI8A 2XN1A 3IGAB 4R2GB 5KW9H 4G83A 2PTMA 5CMUA 2Y0PA 3ABLC 5HI3D 3VO0A 2IAAC 2J7LA 2HFFB 3UZEC 2V8LA 3B9AA 4K2UH 5LAPA 1V10A 2HFEC 3FQ4A 3AUWB 4UVBA 2JJWA 4E41E 1QFWH 4UQIM 2JELL 2ZX8A 2AQPA 2VWJA 5E4AA 3A67H 4LSUL 4NX0A 3VRJB 5F9WC 1JPST 4PMEA 4OBSA 2DIJA 4LF7O 3ZRSA 2F54A 3QRLA 1OB1B 2C3XA 4ZSOE 4TLSA 1A1MB 2AXHA 1UD8A 2FLMA 3JV0A 3TJHC 2IMNA 4ORZC 4R8WL 3WOVA 1M1SA 4KKNA 4RDQF 5JJJB 4MCYA 3IFLL 4U05A 4DR4O 1ADQH 5AAMC 3U0WL 3BGMB 3K6DA 3FT0A 4AGPA 4IBUA 5AOMA 4U3XA 2WWKO 1CDBA 5TGBA 4LDOB 2VLRA 4OFQA 3WAJA 2OMYB 4YDIL 4XWGH 1H19A 3BO8B 1DQQB 4X5WB 5I16B 5E79Z 1U8QB 4FNSA 2M26A 2EIKB 3L7FA 1AP2A 5EA0H 3T0EA 2Q9OA 5D7KE 5L88L 1X3DA 5FK9B 2AK4A 1SQGA 3C8DA 3LN9A 2NR6A 4I3SL 5HI4C 1WV7T 1AQDA 3RY6C 4NZDA 3WFDH 1GGCH 2N04A 1B4TA 4YXKH 3Q3GA 3MCLH 3FUJA 1MMMA 3NCEB 3STBA 3VMNA 4KO6A 1OW0C 1RKRA 4Y4FC 2ESVE 4Y2OB 4FAAB 3MRBB 1D9KC 1UWGH 3GUFA 1OSPL 1ZHLB 5HGBB 1QBZA 3H9VA 4ZW6A 1CT8B 1MJ8H 5F7DB 3MDSA 1FVDB 2V9TA 3UMNA 4KV5E 3WCYA 3MLUH 4OZIE 2IFFH 2P5EE 2D3NA 4OU3A 2IV9A 1L9NA 1WS7A 1LUWA 2OL3L 5IJKC 4KBPA 4AG4H 2E7CA 2O6PA 1OZUA 2P46B 3W11D 4F58H 4Q9QH 4JRYD 2PXYD 3NZHL 4N8VA 4JKWA 4MJ6A 4ZMTA 3QXVA 5LA6A 2K9UA 1NGPH 3FSWA 4GSDH 3HS0B 2IAMB 2OQJB 4KKAD 4MQTB 1CVRA 2YGQA 3FT3A 2E59A 5CP7B 5FYJU 3KG2A 1RUML 4HSCX 3TF7C 5GS0H 5J2UA 1HHJA 3H55A 2NT1A 4E36A 1DQLL 2H32B 2R1WB 4MVSA 5J12C 5IV2B 2VJXA 3F5WC 3GSNH 3MXVH 4IS6B 4GP5B 5KJ7E 5JORA 2EILB 3BWUF 1MAML 4UCOA 1G1OA 3CVBA 3QGVA 4K23H 1JDAA 1NCDH 3KM2A 3A5VA 3DC5A 5H4YA 2G4GA 4K2UL 4ERSL 4QY8A 4WNQA 1KTDB 3ZKSD 5IB1B 3FFCA 1JPEA 1GY2A 1L9PA 2DYRB 4W4LA 1HEHC 3BIAX 3VH8A 4KDVA 4BM7A 1U96A 4DK0A 4G43A 2UUCO 3OBAA 1M6OA 4UDTB 5A6LA 2NMSA 3B83A 4W1TA 4AQYB 1HHKB 4RFOL 4BDVA 1HZLA 1WCBB 1JBJA 2EYRB 4R5XA 3CIAA 4GYCB 1CICC 1M6OB 3O2DL 2GTWB 5D1ZA 3FH5A 1KN4L 3HIZA 5E6UB 3S36L 1QBLH 4V2BA 3UBXB 1U4FA 2YEZA 3P3YA 1V7NH 2PGGA 3BE1L 3RZCB 2JS5A 1GGYA 4JDTH 5CGTA 2VSCA 3P4MB 3DHPA 2YIDA 4JO4L 1BAGA 1HXMB 4JPKL 3VI3A 3MOAH 5ICUA 3MBXL 3NFPA 3WMSA 5AVVB 4ZD3L 1FZKA 3N2KB 5IFHL 1AS8A 1OCOB 3C2SA 1S77D 1WTGT 4OUOA 1A4KA 1U95A 1R0AH 1Q8MA 4GAAA 1DVZA 1ZY9A 1OCWH 2CWRA 4X0KA 2Z31A 2HVKC 5AVUB 3K80A 4OGAD 4PJIB 5E1AC 3EIFA 2EXSA 2CTRA 3ARQA 3NSXA 4P2RE 1GGCL 3E2EA 2HFGL 4N68A 1GSMA 3II3A 3SY0A 3EYQC 3JTSA 1NFKA 4HJEA 4GLRI 3BAXA 5GRVL 3VD4A 5F9OH 12E8H 1WBYA 4XH2A 4X8XA 3ZXAC 4N25A 4HUWB 3DTXA 3HZVB 4O51B 4OCSL 4LSQH 4FLWA 3AT8A 5DYOA 1ODUA 1SM3L 5C09A 4YDLB 1BPLB 2V2XB 3F7YB 3D2TA 2BWQA 3BD4A 1UOVA 4S0TD 4G5ZH 3V0JA 2E9GA 1NBCA 4CDGC 4ZMZA 4G7QB 4PWFA 1C7TA 3LEXB 1IBMO 1FO0B 1UM6L 4ICXA 1J5OH 4I9XA 1A7NH 1D5BB 3VWJB 1SJXA 1BQZA 4L4VE 4ZXBD 4RH4A 5HVGB 4XNMB 1TA8A 3I3BA 4R7VA 1E9QB 4PV8A 3L5XH 5DMKB 4FFKA 1GAFH 3CSTA 5DMGC 4H0IA 3NA4A 3US1A 1Z9LA 4YGVA 2F5AH 4S1QH 3D3VB 3CMAV 1X7QB 2O1AA 1EFXD 1K3IA 4AV4A 3MLXH 5D4HA 3S37H 2R83A 5DD1L 1J0HA 3US9A 5GS3A 2W94A 3RWGA 2VERN 3V0DA 2Y6SD 4CN4A 1A6TB 3OEHG 4F93B 4XWGL 2Y24A 3C6EA 4WU5B 4YIQA 1FUNA 4HUVB 1MNGA 4QNHB 3I50L 4FFVD 5I19H 4TQEL 2Q0AA 1D5NA 4JO8A 2W9EL 5IHBA 4WI5A 1IQDB 1NFDA 5FA4B 3U1SL 1CE6B 1SYSA 4I4WB 3MJWA 4AYMC 1PSKL 2VDPL 4H25B 4WKXA 4P2OA 1U2HA 1RZKL 3PAZA 4JFDA 3RDTB 2GTSA 4IRJD 1C5DB 4RGNE 5LJYH 2EE0A 4A6YH 1HTYA 3PHOA 1VFBA 5JQGA 5DUMH 5I5RA 1MW1A 2OR9H 4BD4A 2JXMA 4W9HC 2R2HB 5IJCC 1YUKB 4JL1A 1E9QA 5CEZD 1ZTMA 1YQVL 2Y0IA 3H53A 2VLJE 3LMJL 1MZYA 1DE4A 3LZOA 4O02A 4YJ2B 2DYPD 4WKZA 3WB2A 5ALBL 3ECUA 3L5WA 3OKNB 4MZRA 4EUPB 4QTFA 5C9JA 2AGAA 2IPTH 3ABTA 1G5AA 2V2XA 1YN6B 2BDNH 5IHHA 4AQEA 4HS6B 2ZT9C 5D7LE 1JPSH 4JEGB 3RY4A 1M90W 4HUWA 4PJHF 1LO0L 3FFCE 3RFRA 4JFFB 1WBYB 5EU3A 4YAQA 2HTLC 2XFXB 5ID1B 4MVBD 1KYUA 2WIIB 5D5MF 2NY2C 1JZ4A 2K4WA 1I8KB 2AITA 2JIXA 3GJFK 3GBNL 1EDYA 1ZA3A 4G9FA 2LR4A 3DURB 3LS5H 4H40A 4Y2NA 5CS7A 2NCEA 4DK1A 3LDDA 4HT1H 2Q73A 1E4XL 4HIHB 4LU5H 4N5ED 1T66C 3P30L 4CVXB 1FQ9C 5IYBO 1FNFA 4ZQTA 5F7FA 1OAUL 4EFBA 1PKQA 3NTCH 3O9OA 4WFEE 3L3IB 1OP9A 4FQPA 2FIKB 5ICXA 4MXVE 4XMLL 2WB1A 5JUEL 4L3EB 3QUXB 1WPCA 3B6SA 3MLUL 3OB8A 1QNIA 3EOAB 5F1NB 1CD1A 4B9PA 4TSAL 4DNLA 3OF6A 3UH8A 5IEKA 2QTEA 1R3JB 4JFVA 4XBGB 1KYDA 3VI3E 1M05A 4DGIH 4F7EB 4QOKD 3FQ1A 2CBPA 4FRWA 5IJDC 5KN5A 1UB5A 2Q86B 3CS5A 3PGDA 4BIKA 4I85A 4YXWG 1BXVA 1OSEA 4H0LB 4UUJA 2KZBA 2R0WH 4DP6X 4J3XA 5LGUA 4WU5A 4PY7A 4YIQB 1XAKA 4IK7A 1EZVX 1JF1A 4G3YL 4RMWA 2GITB 1E43A 3BPOC 1IL1B 1SYVA 2EYRA 1P7KB 3H3PL 1HHGA 3HI1B 5F1IB 1AHWA 3MUGB 3BAEL 3S2AA 3HG1E 5TISZ 4J3TA 1SLUA 4DP1X 3HW7A 2XTJC 1A7NL 3A6BL 3N44B 1BM7A 4XBFA 1J1OL 1NLBH 4ATWA 5IWLA 3QJFA 4MA8L 3IS1X 2HJKB 1ADWA 1Q1JL 2BNQE 2FL5A 1ZHBA 2IJJA 1TNMA 1CXEA 3BVWA 3HE7A 4LFBO 4DP8X 2ZCKH 2EDOA 3CBKB 3EDJA 1R3LB 5F7HA 4Z3JA 5L3DA 2NX5E 1FRGL 1R3IH 3ZDZF 4NRZA 1VB9A 4P46B 3I3DA 2RCVA 1DLFH 3NPSB 4Z7QF 2X4PB 3F7YA 4RAIA 3ZDYE 4IS6A 1MABG 3N04A 3KPNA 4M8UA 3QDMD 2G30A 2WKGA 2BMKB 4J1UA 1JGEB 1HHJB 3PJSB 2FH6A 3T8XA 3IPBA 4KTEL 4L0YA 4FGMA 2I5YH 3LKNA 5BXFB 5C3LD 2I9TB 5LNGA 3BQUB 4GG6F 1HNZO 2PPEA 4DXWA 2P44B 2A74A 5PAZA 5M95B 4X20B 3SY0B 5JOFA 3K8KA 4IRZL 3E8BA 5G5DA 3AQZA 4OD3L 5DRZA 4DO4A 2QADD 3S4SB 3LDEA 1L0QA 1JCVA 1UCBH 1AP5A 1W72H 4NUGH 4H1LB 4P23A 1HI6A 3UJJL 1EVUA 2R0ZL 2YXWA 1TTRA 4HGMA 4OTXL 1AKJA 3BKJH 3L9EA 4U49A 2X1XR 4ABUA 1KJMA 5CCKL 2F58H 3NUKA 4JB9L 2KPWA 3CFCL 1ANUA 3LS5L 3GDBA 1EAJA 1T5KA 1KJ2B 2QKIA 3IRCA 3NESA 3EG9B 4KX8A 3T77A 3VXQA 3HPJB 3R06A 3CSBA 1JV5B 1VGKB 1BZ8A 2B4CL 3EW3B 2OMBA 4TSCL 5DRNB 4DR4B 4LEOB 3VG0H 4ZMOA 2OT5A 3HNTH 5CKAA 2Z0UA 5IQ7L 5KVGL 1P5VB 3ZGIA 1NOLA 2HJFC 3MD0A 4OQTH 1N8OE 3BDBA 2HJLB 5IVZA 3RRQA 1KWKA 4PJFF 3QJTB 3VGDA 1JGLH 4DOHB 2WYTA 4PIRF 2V6HA 5GIRB 2OI9B 1MCJA 3UERA 4XP6H 1ZK5A 3ME0A 2CJUH 4IRZA 1VF7A 4FXLA 1EDHA 1YEWA 2HCZX 4EN3A 1Q9KB 3ZE2B 2E86A 3BE1H 4L8SA 2Q7YB 1A3QA 4MXVF 1UH2A 3DIFB 2IU0A 5KSAB 1M56C 4H44B 1FYTE 4WEBH 3PDOB 2B59A 5F3HA 4N0YH 1RUAH 1YEJL 3OKOA 5DRWA 4AQAB 4GUOA 4TQFA 1ND0B 1GZPB 1I1YB 3D30A 1KCRH 1FZOA 5MHSE 3SZ6A 1IBMB 3IMWA 5CR8A 1DVFC 4PRHD 4LPYA 1PP9H 1AI4A 1QVFU 4OW6A 4QGPA 1GMIA 4JK0D 4B95C 3VCLA 3O6FA 1FDLH 1Z5LB 4LGRB 2BSED 3CLEH 3ILEA 5G4OA 4RAVA 4JZOB 1ZANH 1S78C 4FK5C 2R2BA 2KLTA 3EFDL 4FLSA 3DRTA 1BVNT 4LPUA 1CDYA 4NQTA 3P0VL 4YMPA 3L70H 1KCSL 4AENB 4ZO8A 2YXYA 4S2SA 4LWSA 3QNXA 4KI5F 4WHYH 3ME0B 1KFAH 2YPKB 2Z7UA 3QJOA 4JFOB 1FN4A 1ZPLA 4WFHD 5D7SH 4NUPA 2H6PB 3V6FA 4ELMB 3P77B 4NIKB 3HA0A 2G75B 1KGCE 4UU9A 5JOEA 4LLWA 1J9RA 1M5IA 2VXSH 5L2KB 2MTPA 3HNVL 2CMRH 4HZ1A 1N6VA 1UM6H 4BFRA 3ZZSA 1J5OL 5BQDA 3GRWA 4JO2H 1MJUH 3ZS8C 3VXRA 3B2VH 1GM8A 4OZHE 3BCDA 1A7OL 2E6PA 4X98B 3L7FB 4WFGE 4QO1A 2OBGA 2WZPD 2RHEA 4G6ML 3QORD 3JCZA 2VE6B 4RAVB 3VYOA 4LF3B 2JNZA 2OMXA 3TU6A 3WTXA 1SY6A 1XF4B 4X8GA 2CAZC 1CDIA 1A2YA 1IBLO 3GMPB 1S9WA 1MNUL 3D9AH 5D5ME 1BIHA 2FQDA 4RFEB 4ZUVA 4YXHL 2OXHA 2DQFA 3MNDA 4OI7A 2MHAB 4M7ZC 3VFVA 4AW7A 1A1MA 2KQXA 2JJ1G 1IAKA 4TKWA 4X9FA 3ZDXF 3RVVD 4E9XA 3GJEA 4L3FA 2VW6A 4NN5C 3PL6A 5DS8A 4WO4A 4C59B 5E5LA 5E08L 1IEBB 1KACB 2EX3A 3FYIB 1EGJL 2OZNA 3FQYA 1OP5K 4GKNB 3MGOA 2EADA 2UY7B 4OLVL 5DHXB 2Q8AL 3TWCH 1KXVA 4PBWD 4LC1A 3SYQA 3MHHC 5AYUL 4TV8B 4PJ5B 4LF5O 3SPVB 1W6WA 1RP9A 3UOAB 1MCDA 1GOFA 4DR7O 4XNUH 1T1ZA 2V2TA 1KBGL 1SVBA 3MNVB 1XNRO 4JN1H 1Z6JT 1Y6XA 4UCFA 4P9HC 2SEBA 3X2QB 2PR9A 2A6DA 2XBTA 2I24N 1JGLL 3LAFA 3H56A 3CZFA 1S5IH 3EH3B 1T7YA 3WN6A 4AC4A 4MA1C 3ZIAG 2NOYA 3SN6N 4AJWA 2OMNA 4F33A 4WFAV 1Z9OA 4PBDA 1AI1H 4OZIA 3WEAA 3IRPX 3GHPA 1DHKA 2ALAA 3X3GL 4HFUH 5L3CA 4Z0BH 4M6ML 3W5NA 4UV9A 1NL0L 3REVB 2PYFA 3CMEV 2CDFA 1IAIL 2VXQH 2BP8A 4JCMA 5I0VA 4B3TO 2XPGB 3QF7A 3QUHA 3FRPA 4KJQD 3CC2V 4BSJA 1LE9A 5CD5C 1R6KA 4F57L 1GC1C 2UXDB 1P5UC 1P2CA 3BFQG 5D71H 3UXFA 4A7UA 4WFBV 1I9IL 5BOZG 1TMQA 3KBFA 5DVPA 3DX2A 4P2QA 1WA0X 3MRIA 4ODWB 4OF6A 5I1IH 1A3ZA 3WFCH 2CZNA 1E1QG 3LKNB 5BXFA 4DN4H 5C9KA 1JDCA 3MFFB 1VQ8V 1UWFA 4AVKA 5D5PA 2AEQL 1RZIB 1Y1UA 1FL3B 1LWRA 3GMLA 4M7LH 1R5VA 4CC4C 2C9SA 3BKYL 3RWIA 3U30C 4CVXA 1RPRA 4OVVA 1GS6X 3IN0A 2IC2A 1VDGA 2LV4A 3IBEA 5AW0B 3VX1A 4D8OA 5FOBB 1K2DB 4HZLB 5I9QC 2FYYB 3GI9H 1RUQH 3FB6A 4NRYA 1IAOA 1F4AA 4RWYH 5EIIG 2ZDIC 1LD9A 1G6RH 5DZNA 4LF7B 3FONB 4WK4B 3L8QA 4ZAKD 5TD4A 4KNSA 4ZHQB 2A3TA 4DR3B 4DV2B 1IGFL 1NEZG 1L3WA 3MV7A 4NQQA 2WHVA 5C70A 2CRZA 5TQ0L 2Z64C 3ARFB 1YEEH 4N24A 2BINA 3GLEA 3O3AA 2NY3C 2W9DL 2DLFL 3IU4H 3TH4T 2DWEA 2GHZA 4NKGB 2CMRL 2V7NA 4PFEA 5I8OL 5MENA 1ETA1 2WNKA 4IK6A 4YFLF 2R2HA 2CALA 1NBMG 3JYCA 5GSVA 5EIIB 4PW3A 1KPUA 1Z2KA 2A6IA 4R7XA 3FH7A 5I8EB 3QFJB 4WTZA 1IX2A 4YSRA 5FV1L 4NP9A 3RWEA 4U1SB 4PA9A 3WNLA 2K9PA 4FQ2H 3M7FB 1RM1C 3WFVA 1MHPH 4YJ3B 5BVJB 4LF6B 2CO1A 1KGIA 1G84A 4UI2A 3CXDH 1QSZA 1TU2B 1IU1A 3N91A 5ITBL 3TBTB 1EX0A 4M7KH 4KWUA 4G1MB 2CTWA 4EQ3A 2YQ3A 1RSYA 1L7IL 4Q8BA 3APOA 4RO2A 4WCYL 1N0LA 3WNKA 2EIEA 5IJBC 4QHMA 2MH4A 5JHDB 1QYGH 3QNZB 4PRBA 1S7UA 2ZE0A 5EU5A 4HF5L 5I76A 4LSRH 3TA3B 5ACZB 1A5FL 2LABA 4DK3A 5LGJA 3IPFA 4IGGA 1RZKC 4N1EA 4Y19A 2E0PA 1MCOH 2XFXA 3NRFA 5HYJD 1YDXA 4R7LA 4Z8FH 4UV4L 3V79C 35C8H 3AUVA 4KMTH 4ZZFA 2K1EA 5EU4A 4FFYL 1MFCH 2APTA 1F4MA 4BUGA 1W0VA 4KJPD 3QJZA 3CMOH 3VWJA 4AIOA 1XMQO 1JA8A 5KAFZ 4JN2A 3GXMA 4PP2B 4HYTB 4KZDL 4QRTB 4ENZA 4WU7B 3ARDC 1UD6A 3H42L 3VMOA 1WG3A 2Y5EA 5HYIA 4K3GA 4L1DA 2F53B 1N8ZB 3PWLA 1MQ8A 2FSDA 2RFXA 2G0LA 3O9WC 3O9WD 3QEQD 1HE8A 3BPOB 3HUJF 1A02N 3NDZE 3OJDB 5DJAB 5FS5A 3TEWA 4GG8B 4M61A 1LO2L 4UM9B 1EMTH 4H0LC 1BZDA 1EEYB 2GK0B 5BY1A 2YIBA 1ZDQA 4HWBH 4W93A 4Y5VB 4Y5XB 2AVGA 1VQKV 2HT4C 1D5ZB 4PJDF 4N8VG 4CVZA 1HZKA 2G2PA 1IMHC 1LYQA 2BP3A 2VLRD 1A9EA 3H7BB 3AC0A 5G4NA 3WFZA 4J2QA 5AAWA 3AQDA 5EZJB 3OXSB 3DYPA 4XC3L 1PIGA 4G1EB 1PG7W 5AB1A 4MAUL 1KECA 4ELME 4KK6D 2MPVA 4JHUA 2WQAA 4DIXA 4NN7B 4JE0A 2EABA 2H2SD 1NR1A 3ESNA 3MCKB 5CCJA 4EI5C 3V4PA 5IB5B 3ZIMA 3QUZC 3JSLA 5I1CL 4FDWA 3UTZA 4M43H 5AW4B 2W65B 5GZOA 2NYZA 5J6GA 1M4KA 1NANI 1IBHA 3ZW3A 1CFQB 2Y7NA 2XWBB 3DV4B 3OAYH 1BYPA 3MC0A 4JKPH 5KVGE 1DBBL 3T1WA 3PWPA 2VWKA 3PWVB 4Y1AE 1BFSA 2N56A 1Y67A 3OX8B 1FC2D 4ZMVA 1WPXA 2CRIA 1JQ0A 1DCLA 1JV2B 1COWG 4AKPA 4A6YB 1SRYA 4X7EC 1P7HL 2UYLB 2WQ8A 3O2WL 4N6RB 3JAWA 2Z7WA 1HL8A 1H2NA 1SETA 1CXZB 2EJRA 3GKWH 4NC1E 5KS9F 4X1KA 1SVCP 3RWDB 2APFA 1FYTB 3QZMA 4ZUWB 3SDCA 4IRSB 4ADIA 3TNMB 1YIJV 2ETNA 1SEQL 2B20A 2OAAA 2OCCC 2VQTA 4LLMA 3DX4A 5GISL 3MV7E 1KTLA 1T89C 3L6FB 3RIKA 2EDHA 3ZBHA 5HGHA 1OJHA 1OCRC 4HUCA 1RIHH 4M5ZL 2BE3A 5DEGA 3QI9B 1J8RA 5GRYA 4JI7O 1W8OA 4DGWC 3RDTC 1EFRG 3CFKA 3HC2A 4KUMA 3CAFA 4XXCA 3TA3D 3KPMB 5FO2A 5E1AB 4PJ8A 4YWGH 5MENE 4I55A 1H3VA 3AWFA 1NKDA 1NQBA 2G3XA 2H9GA 3ARBC 2MOVA 1CXLA 4YNYB 5H4ZA 1RH8A 1YEGH 5K9JL 4PRNA 5T1KD 4KVCL 3CZJA 3LEVL 1VHPA 4JHWL 4HKZB 1TYEB 5EZJA 1E4XI 4E0RB 4UMGA 3L95B 4P46D 3RYFB 3KXFD 1DK1A 1EJFA 4QF1B 3QFJE 1D5ZA 4HKZA 3W11C 2EH7L 2AAVA 3AREB 3GMMA 3L3OC 5D9SA 4EXKA 4JVUA 5H8DA 2H9GB 3CCUV 5HHOA 1NCBH 1DN2A 4G7YH 5KLVH 1TTCA 2F1AA 2XQYA 1R4XA 4A7SA 3WLBA 4JJ5B 1U93A 2DWDB 3ZHRA 2QFRA 4X6FB 2A2QT 5HGGS 1E4KA 2NNRA 1M53A 4UANA 5BV7H 4FFYH 5ABAA 3QG7H 4PEEA 5LCVL 2OR7A 2XKNB 4A6YA 1F6AA 4JN2B 5CN2A 1I1RA 5EH1A 1OZTG 1W2KT 4I5SA 1A9VA 1M3IA 3RNKB 5IF0B 3W37A 4X1KB 2NY5L 1GKOA 5D7IA 5EO9A 1CLOH 3FB8A 1RERA 4X9GA 1T04B 3H4HA 4TSBL 4NKOB 1UATA 1BFVH 1I9RH 2OCFD 3CJHA 4EN3D 5E9AA 4XOAA 4LFAO 4NFCA 1BZ9A 2JCCA 4QE7A 3G7TA 3Q2CA 1M6UA 2YOCA 1NTZH 1OHZA 2CQVA 1G1XB 4JM4H 1URIA 2NCMA 5C07E 2BK8A 1N5YL 4B3SB 2BVPA 5KBKA 5D9SB 3CCLV 1XMQB 5DI8A 1IJNA 5LQBL 1OAKH 3CZNA 4WENB 1GC1L 3NAAL 3U4EB 1RZKH 1J9CT 1H0DA 5DK0B 2BO0A 1C1EL 4XMUA 1JTPA 5CSZA 2MCPH 2MCMA 2CUAA 3L16A 4DQOL 4PVNA 1BQ0A 1W0KG 3WV0A 2P9RA 3LZQA 1J10A 1UFGA 2J8UF 3MRCA 3D39E 1DVYA 3FFQA 4M1CC 3IFNH 5AVZB 3SOTA 1GHFH 4JGNA 3ZT7A 4N9GA 3V9EA 1VF5C 4Z7NF 1I85C 2JMRA 4LP5A 3OPUA 1CICB 4OKDA 4H1LH 2D73A 1BT8A 2F53A 3TCLB 1S9KC 4WW1A 3VGAB 2FTKA 2GEEA 3P0YL 4GIOA 3MREB 2NXYB 3K71B 3A4AA 3BESR 2VN5A 2ZWLT 1IZJA 1XHHA 2GJPA 3LVEA 4U3HA 2YD1A 1MF2H 2NNCA 4K71C 1RZFL 4Y4FD 3OKDA 3II2A 1CDGA 2Z93A 4NKDB 5EBLC 3QPXH 1OCWL 1XCQB 4MCZB 4BGDA 4D9LH 2Z65C 3L73H 1FC1A 1A21A 4W9JC 4X7SH 1T20B 2VSKB 1W9XA 3HAEA 4JE4B 3STLC 3CFQA 2F23A 2M7WA 2OMVA 3QJVB 4M6OH 4OFKA 3OB0K 1ML0A 4MD5A 3ARUA 4G80A 1I1AB 5LHGA 4WV1C 4NI6A 4N2KA 1AO7E 3OR6B 1ETZA 2ZUVA 3TA3A 3TCXA 3W0WA 2MMXA 1L3NA 3GS4A 3MO1B 1HKFA 2KKQA 2WWNA 3HRZB 5B3JE 3GINA 2QR0A 3H3PH 3R4RA 2BP0A 3IMSA 3MI6A 2X05A 1WB8A 2CRYA 2OJZH 3IJEB 1QFUH 4W9DC 1NWOA 1JX9A 4LVNC 5J6GB 2AJVL 1H5BA 4H5SA 3VFGH 5H2BA 5AFAA 4MYWB 2X53A 3QQ3A 2DJVA 5C1MB 1GH7A 1W8EA 1S8DA 1MIEH 3KWTA 3UTTD 1N3NA 4PRIB 3SQOL 2VIRA 1U2YA 2VH5H 3UBFA 2JQZA 5J1SC 2G5BB 2R70A 4E2LA 1QHQA 5IMOA 3HNSH 5E7FA 4L4TA 1H38A 1X5MA 3S35X 1RQ5A 4P5MB 3DOSB 3O8XA 4GB9A 3UQ8A 3O6LL 5AWNL 3D8MA 3IDYC 2DBLL 5E70A 4R7NB 2RQ8A 4Y5XA 4N8PA 3ETQA 4LLVA 5LGHH 2MQ0A 3L3KA 5SWZD 2K78A 4GUQA 1RJLA 1SQXH 1J1PH 1OD7A 5T1MB 4XPHH 3U0PB 2WBKA 1CR9H 2H32H 3OPZH 2MSPA 4DERA 3DETD 5I73B 1I3GH 2M6YA 2FT7A 2H8PB 2V5YA 3CZFB 4CZZA 1HS6A 1XSKA 3DA0A 5HHOE 5DO8A 2W5PA 2D7MA 3CZLA 2J72A 3NMEA 2GJ6A 5T1DL 5DECA 1DZ0A 4XXWC 3RYCB 1JPSL 3R1GH 3F58H 4KVNH 2VLMD 3AQYA 3QH3A 3QUML 4YQXH 3B8MA 3K79A 4F8QA 2WSSG 2NY1D 1I0HA 4PCSA 4EVNB 2WBJD 5D8JH 1S5HC 4K0KO 2VXQL 4NQCB 3WELA 3EXLA 4M8RA 3RAJH 5MEPA 2XWDA 3N27A 1NCDL 3ML8A 1IEBA 3JV5A 3QQDA 1QR9A 4YFEA 2W0FC 3GSUB 2CKNA 1JWSA 1K8DB 1QU7A 4GSXA 4OZGB 3V5DB 2P8PA 3K6IA 1B6UA 4KTEH 4RAUA 2O5ZH 1KLFA 4DAGH 2EZOA 2NLJA 2IPKB 1A0QH 3MLSL 1GYUA 2O6EA 3OLDA 3GTNA 3DMMC 5TDOA 1FAFA 1XF3B 3BKJL 3JV4A 4DZBB 1HSAB 4Z7NE 3IGAC 5I0XA 2EVJA 2OSYA 1R3IL 5CLXA 3KYMB 4K7FB 4PSPA 2FKXA 4XN4A 1G9MH 5HJGA 2IANE 2IGLA 1MWAB 5K39A 3HKDB 4PW9A 3OHXA 4ZO9A 1WSST 3OLIA 2FRGP 3BFWA 4G8EA 5JYLA 3PDGA 1YEHH 1QLEC 4DRXA 1BJ8A 3NJHA 4XZUB 3RIFK 3SB3A 4QRRA 3KAAA 1ZRUA 1NGQL 2QT6A 3FYEB 1GAXA 1MF2L 5C0AD 4H26A 4K3DL 2QWPB 1BZOA 4U1MB 4WF7A 1J8HB 1T6VN 3L9RB 3WHXA 5HDQL 1PZDA 3ARPA 3SDLA 4DVBA 2NYYC 2QR4A 2Q5BA 1OF0A 3IF1A 3KGRA 4B7LA 5LYJB 2EO7A 1PLBA 3C87A 3MLTA 1RJYB 2PY5A 43C9A 2XTSA 5FUCC 3N50A 4WHTA 3VXPB 3S8WA 2Q68A 1RURL 1DF5A 3DHUA 1BGYH 2BCKA 5IVOA 4BXSV 5IB2B 1J8HD 1KC5L 3F01A 5IOPA 1KF9B 2EIDA 2QTVA 3GIVA 1BL8A 5CP3H 2AQTA 4DFIA 5ACLA 2HUEA 3PL6B 1FO0H 4TM9A 3DXRB 1N6QL 1OP5H 1MSWD 2LW3A 3AG3B 5ADOH 3BUTA 4A63A 3LSQA 2FYYA 1TQCC 4MJ5A 3JWNG 1KENH 2XV0A 3RWIB 1O6TA 9PCYA 5FM4A 1GMGA 3U9UA 1RIVH 3EJJX 3UAEA 1CI3M 1BZKA 3FSVA 4LLQA 4KRPC 1B0GB 1N70A 4HSAC 4FPPA 1R5WB 2WN2A 4PR5B 1PL0A 4ZT1A 1KIPB 3P3NA 6TAAA 3Q4HA 2YPVH 3B8YA 1FGVH 3U6XS 5SWSD 4L37A 3KPSD 3QISA 1B0IA 1U97A 2YD6A 4GKLA 2E6QA 4HKJA 4MD5B 1JK9B 2BSRB 3TN0D 3TVMC 1D3CA 2FR4A 4GRWH 3U1QA 1JYNA 2I60L 1SOSA 2AANA 3NCXA 1EJOH 2QQQA 4Y4HB 1TAEA 4GRWF 3E9TA 4KKBD 1TEFA 1UXSA 1OP4A 3REVA 4KZ0A 3IDJB 5CAYB 4KZDH 2QM8A 2YHGA 3C6LA 1NFDF 2COQA 3P3RA 2XKSA 1FDLL 3WFHA 4ZTOH 2BSTB 4LVOB 3Q06A 2CHXA 4QE9A 4BW9A 1QQDA 3TZVA 3OMNB 5C8JA 3N0AA 3OPZL 4LGSB 3MCG1 1G6RB 2CXKA 1YA5A 4LNRB 1LTXA 1YY9D 4J3UA 1BF8A 4L1SA 5A2BA 2QSCL 2G5RA 2EDWA 2I25N 1PMYA 3WTVA 3E6FB 3PWNB 2J8OA 4RDQG 2J1XA 4YHPB 3LIUA 3D2UA 3RY6A 1KCUL 1T1XB 1FA4A 4OXSA 5E6ID 3O11B 1XGUB 5JW4R 4JI1O 1ERNA 1N59B 3BT2H 1LNQA 5EU7C 4BWAA 3MGTA 2VQFO 4TV8A 3DK0A 2VLKE 1TYRA 4UQCA 2I5YL 3VQLA 2KKWA 1JXGA 2WNWA 2OZ4H 3A24A 3HI5H 4JFTA 1L5GB 4BIOA 2LVCA 5FO8A 1UG9A 3ESVF 3QDGA 2PLTA 4KMLB 3QJHA 1JFHA 4TNWK 2WLMA 4MMYA 1IDSA 3AAZB 4LL1A 3CDZA 4HWBA 1B06A 2F74B 4MGXA 1K92A 2HYMA 5LUMA 3LH2L 1A66A 1Z5LA 3O6FB 3U25A 3S35L 1HE7A 5JDSB 3CFIC 4A7QA 3WO4B 3CSFA 3VA6A 4YZFF 1SEQH 3QNYA 3KLAB 2F58L 2W07A 3NH7L 4JB9H 4A2DA 1OOAA 2VB5A 4PB0L 1NIBA 3HR6A 3BPCB 2E5LB 2IF7A 4I0XB 4DW2L 4IHOB 5HHQA 3HBZA 1P4BH 1ZHBB 1IGJB 1H6UA 1EBAA 2DQ0A 5I73C 3OR6C 5IW1B 1YTFD 4E9SA 4WNSA 2BSKB 4OD3H 2FIRT 2QFPA 2JWYA 4NO3A 2VKXA 2DWDA 1U93B 1SZTA 1MOFA 3CD4A 3PJLA 4JJ5A 2DE0X 5IMMB 3GLZA 5AG9A 4KDWA 2J6EL 5DGRA 3T2OA 1N7MH 3IE9A 3P4OB 3O6KL 5DD3H 4LL9A 4XO9A 4J5VA 2WLLB 4K71B 1JOYA 4TULL 5FHBH 5D93B 2PW1B 1I3UA 5I1HL 4AI8A 3AY2A 5DHVH 3RAJL 4AXWB 1AQHA 1EIBA 2HVJB 5LBVA 1HI6B 1DUZB 4HBQA 2VL4A 3VGAC 3QFJD 4HPOH 2R15A 5DRNA 3QXDB 3QTCA 4XMTA 4TNVF 3EYFB 1PZBA 1CK0H 3LNDA 1YJ9V 2JTYA 3FU9A 1FNLA 5GZOC 1QABA 3WE6A 4YNYA 5CN3A 4LSTH 3VBBA 1I8MA 3W5MA 3VFPA 3BEVA 1HINH 1WE5A 2XG4B 4WFFA 4MBRA 25C8L 2PPFA 3HAEH 3LB6D 3VCLB 3GGWB 3KCPB 1E5BA 2EUZA 3EFOA 1BVNP 3BAAA 3IJSA 2GBVA 4HFUL 4BSVB 4X6DE 5D6CB 1US6A 5DFVC 4GXVH 4G9FB 2WVVB 2JIXB 3POCA 3WKYA 3LQMA 1E30A 5EUKA 5JO5B 1BVLB 3GC3A 4TSBH 5F6IC 3NCYS 4FZEL 4IBQA 1RZJH 3QWOA 3RU8L 5JQIB 1Z9PA 4ZPTA 5KX5B 4U7SA 1MRDL 4N0FB 1A14H 2UYLA 5C9JB 2AZ2A 2V8MA 1P84J 3HCVA 5I75C 3PAYA 5FYLD 3BN9D 2XAFA 2Y2TA 4LKXB 5FGCB 3MACL 3T0VA 5E00B 4N8CH 3V9CA 2OSLA 1MCPH 2EXTA 5IHWA 5GGTH 3CG8A 2H2SC 2ZNIA 1EGJH 2ZX6A 1YY8A 1EUTA 1RUMH 2VABB 4UUJB 3P30H 4G7SB 1BA9A 1QTPA 4J27A 4OZFA 2G3MA 2LLLA 4NZJA 4ZS6C 2ZWSA 3TEUA 1VGKA 1VKXA 1XH3A 2XAHA 2CUGA 4U3JB 1IL1A 1SYVB 3T77B 2YC1A 2GITA 4JAUA 1WAZA 2CTPA 1XDTT 1IRAY 5ITBH 4URKA 1HHIB 2NXZD 4LLUA 3CCHA 4GKKO 3D9AL 4G1EA 4G6FD 3I9GH 4UZUA 3EF7A 3LNIA 5BRZE 2E76C 4ANVA 3CCHB 4ETQB 1TYJA 5DD0H 4NO2B 1KMGA 4J7RA 1Y18B 4O4IA 4U1GB 1LEIB 1BQRA 4LSPL 2WNGA 4AOFA 1WFMA 2YJQA 2ICWJ 4OGXL 4PJ6A 1I8KA 3UZQA 2WP3T 4TQPA 3OKKA 2GFBB 1BAFH 5ICXB 1I7UA 2ZR3A 3DJ9A 3F04A 3MJ6A 5AALA 1U8IA 4FI6A 4HC1L 5JCOA 2XXMB 3AU1B 3TESA 4D0BB 5LP6B 1ZGLB 4JFZH 1OE3A 1FJ1A 5ES4B 3OAAG 3HPLA 4IRSC 1PM9A 1YDPB 2JB5H 4PJBB 2K3HA 4BZ2L 1FO0A 4HH9B 2ZAGA 3ECBB 4FQLH 1GJIA 3EJSA 1HL4A 4AEFA 1DVQA 1SXAA 2WKOF 2YGVA 5KX5A 5HGDB 2MTAA 4F6EA 2YAFA 3PGFH 5SV4A 2H26A 5FV2A 4UCSA 1MXGA 3QZBA 4P2YA 5GRWA 1Z5YD 3KH4A 4UQ3A 3LZPA 1XEDA 3EFDH 5C6PB 4KO7A 5BV7B 3AREC 2ALWA 4A39A 2J5LC 1KGCD 4YVUA 1K6QL 1ZHKA 1XGTB 4JKPL 1KWGA 1BFOA 4QLRA 4O4IB 1KY6A 1O0VA 1TITA 1X9LA 4N2BA 4NOBA 1BG1A 1K85A 4PRPA 2WWMC 4LRIC 1O75A 4FL4C 1QLFA 1N64H 4NZ8A 1IKFL 1WD9A 3HUJB 4LRNL 3GUTB 5CUSH 2F0CA 1QAWA 3O6ML 1I8MB 5JQGB 4HK3N 4JHZA 4LNUA 2YR3A 4ODHH 3LH8A 1I75A 1MCPL 3V4UH 1X44A 1YSCA 3NSYA 5IEKB 4JO3H 2PKDA 2A9DA 5F7AA 1I85A 3BSHA 1R1CA 2WXHA 3TO2B 2CBMA 4GG6B 1MJJB 1VKXB 1KBPA 1SJHA 3VDAA 3OWRA 1DSFH 5C6WH 3BGAA 3P4MA 5F89B 1ZAUA 4Z0BL 4Y16C 5MHSD 2Q67A 4U3CA 1A65A 4O2EA 5EN2A 5KSUA 3QG6B 4B3VA 3RJQB 1WISA 5FF6B 3EDEA 2YEZB 3IAPA 2ZUWA 4XPAH 5DEJA 4UINH 1Q1PA 1A6TA 1OOWA 4KZEL 3STZA 4DCQB 2X9WA 3S34H 3APCA 5LQBH 2NZ9C 2OSLB 3F7KA 3I85A 1URLA 4ZK8A 3KYKL 5CN0A 3F7RA 5DK2B 3WIHH 4P2RA 3U83A 4WFGA 2NQCA 3LS4L 3DTUB 5KS9E 4JM2D 1XDCA 3CN0A 3K72B 4ZPTB 1AE6H 3FOMA 2QTSA 3F65A 5AG8A 4R8CA 2AI0H 4RFNB 3QEQB 4R4BA 1XMEB 2CO7A 4TNVK 4HDIB 4X4ME 3VACA 4Z7IA 3GZKA 4B5EA 5D5MA 1G9NC 2L7JA 3EHBC 1WDAA 1X5YA 3FU7A 1QRNB 2XWTA 4L05A 2UZIL 3O65A 4TTDC 4ZOLA 5FOBA 5MEOB 2VDPB 1JHTB 4I48A 4X83A 4EOWL 1QEWA 2J1WA 3RB7A 1O9GA 5DU7A 4G2KA 4F5CA 2VXVL 1KBHA 3BKMH 3C9NB 3ZTDC 3MJGX 4TSFG 1S7SB 3GK8H 4PJBE 4EI5B 4Z3IA 4DR3O 3KW7A 1TETL 2WZAA 2UUCB 5M94B 4XH2B 3AZUA 2WWKT 2HKOA 3QP3A 4P57B 3FT3B 3QJRB 4IOSD 4LAJH 4OZHA 3C08H 5E6YA 5F44A 4MSWB 5FIEA 5KZCB 2XWRA 3U2SA 1WGOA 5L4JA 1UB6A 1B6DA 4LHJB 2KSDA 2Y07L 4KFMA 5B21A 4NTXA 5L2JB 2EH7H 5HBBA 3AGWA 2V3DA 3O2WH 2Z31B 1HWGB 1XFPA 4Y5XC 4DP2X 4YFLI 3N43F 4TOYH 4HKXB 1NAMB 3BEVB 4NAMA 2ISDA 4X7CC 1AG6A 4H4NA 4ISVA 4AQZA 5B7FA 1A4KB 1U95B 2QKIC 3MHZA 3SOBH 5IBUG 2E9JA 4I3SH 4KXCA 3RNQB 5JPNA 5I1DA 1TENA 1L6ZA 1LR1A 4Z7UE 4Q58C 2F18A 5B3NA 1RIHL 3FQTA 1ZE3C 1ED3B 4FQIL 4M5ZH 5TFSL 4F15B 3VXOA 1ENVA 4Z6AT 2DS4A 1RP3B 4LCUA 4GP4B 3T8VA 4QPJA 1G7HA 4LVHC 2HVBA 3GBLA 3SZKC 5FK9A 1P84K 3L17A 5DT1H 4MA3A 5DQDH 4PGDB 1GZQA 2AW2A 3ARDB 3D0LA 3D5OF 3Q48A 4N5EC 3IBOA 3NIDE 3VH8B 3I56V 5I16A 1MFUA 1Q94A 3FQRB 5E6ZA 1JOIA 4G9DA 4XWOD 4WNQB 5EG6C 3K2IA 5ICYB 4FEIA 4HOZA 4X5RA 3KXFA 3T0XA 4QNPE 2BTQB 4UB8Z 1A3RL 3APFA 4QRSB 5MP6H 5JVDB 5CBGA 4M7LT 3COOA 5IT2L 1TCMA 5FGCE 2ARJB 5I18L 2UY7A 1NH2D 3SDDB 5FUZH 3ZQ9A 5A7BA 3CZSA 4QJFB 2DI8A 3RVXD 4P4RA 3RBZA 2R69H 5KUKA 3FUKA 2V4LA 1G0YR 5F3BB 4APQB 4Q56A 3MODH 4WWPA 5IK3A 5CA0B 1HESA 2LU5A 2QQLH 4PJXE 3AK2A 5IUSA 4UILL 4ZI7A 3BPCA 1Z32X 1F18A 1JPFB 4JY6B 1WBXA 4OKVA 2AK1H 4U1LB 3WTWA 1EV2E 1PLCA 2O5NA 2AV1B 5DJ6A 2EBOA 2ZE8A 2V5RA 1ZTXE 1OAUH 4W4KA 4TQIA 5FKPB 1AROP 1M1XA 2R1WA 2PF6A 3B2UC 4XAWL 1SJEA 2H5UA 2VMJA 3ABGA 4YC2B 3FS9A 2QZ5A 3KEHA 3KPRA 4LF3A 3E3QE 2WCPA 1DQIA 5EUOA 1RPQA 3NJNA 3WGUB 1ZWIA 1FYHB 1RULH 3BWAB 4MMZC 1DBJH 3EO1A 3MYJA 1A6ZA 5FO8B 2ZM6B 1YEIH 2GJRA 3CSPA 3ILQD 2OTJV 4OZFH 4FM1A 5EPMA 1OVZA 3ZX6A 1UACH 2ZKOA 5JW4N 3D0VA 1ZLVK 7TAAA 4L9DA 2DI9A 2QDOA 3D25B 3K9AA 4OJYA 3BPNB 5CB4A 3NDYE 2Y4UA 4J10A 1A6WH 2JJVA 4PJHE 5HGBA 1J8HE 3B1TA 5J56B 4UYPA 3BDYL 2FHFA 2WVSA 1MWAH 3HZKB 1FV1A 5CFAA 3UTSE 3VXSE 4DR5B 1N33O 3VXRD 3Q3GB 1MRCL 3CLWA 4UQAA 1QO3A 3TO4A 1E28A 4NR1A 1WCBA 4Y4HA 3V95A 4YHYC 5LLIC 3TZVD 1IUZA 1BCIA 1FHNA 3ES6A 5LNDA 3INUH 3UADA 4G8IA 4BQ8A 5FO9B 4JI0O 4R5VA 1JVOA 4OTXH 4ETYA 3WN5A 2V7HB 3FUIA 4PPTA 2HRLA 4UOZA 3IJYA 3PUCA 3B09A 1VQNV 2J43A 3LQZA 4IHOA 1IAIM 1DN0A 3DV6A 4PJCE 3VXMB 3L4XA 3O2DA 1HL9A 4NN5B 3O6MH 3R19A 2PMZA 4KGJA 3Q1EA 1RZ8A 3NSFA 2BVQB 3R65A 3RGVC 4KOBA 5AVSB 1XF3A 3JV4B 2AC0A 2YAEA 4PJAB 5B1OA 2HFEA 5ISZB 2ENJA 5DYFA 3B77A 4L37B 1A7BA 2HKAA 2ZCLH 1PS3A 1EXUA 2JH2A 1F1AA 4GS7B 2Y7LA 3CDZB 2W9LA 3ZKMC 4YXHH 1YYML 3MV8A 3MJ7B 4WCEV 5AZEH 2KQNA 1Z5VA 3B7RL 1U3HC 5IT2H 2D2OA 5LBSH 5L6YH 3BISA 3KGUA 3QRFM 1EO8H 3K4ZA 1GYWA 1XR9A 3VD9A 3MLYH 1F3DJ 4N1HB 5EC1B 1MFEH 1TJHL 2A7BA 4S1RL 3QS3A 4F92B 1FVDA 3QH3B 4PP1D 1LDPL 1QEXA 3NJGA 4IBZA 2P4AB 3V8OA 2ADFL 4JG1L 4BCZA 4G42A 1NC2D 2VZ1A 3DK2A 3DXAE 2XVKA 3RYIA 3HHMA 5I0DA 4PTUB 2HAZA 3VFMB 2EIZB 4JBSA 5H2FZ 3A8TA 2VGLM 3R7RA 3V6ZB 3T1YO 2EZ0D 5KVDH 1A1OB 5FOJA 1YNTA 3KZ8A 1JZ7A 3D50A 5B39B 3FT9A 5B8CB 4JAVA 4FXTA 2APXA 2X6CA 2BSTA 4ZYKB 4JRWA 2P24A 3HKDA 2ZWKA 3DOSA 1SMAA 3O8XB 3QEUA 4JNXA 1YMHB 1IBGH 3MRNA 5TK2A 1JD7A 1QWHA 2XT1B 5DGQA 2BFVH 3IU3B 3K03A 3K5NA 1JZGA 3MXWL 1SQMA 4PS4H 3Q8AA 2R29H 4JZGA 3IDNB 2BSSA 3BZ5A 3EYSL 4GS7C 2IPUG 3NBNA 3V0WL 1JK9A 2BSRA 1WBZB 1FNGB 1CGSH 1SGKA 1UZ8A 1ZKAA 3TJEL 4POYA 3DO3A 3T2LA 3A4FA 3IJ4A 2C9PA 2QQNL 2IWKA 3ARGD 3QDJA 4LPCA 3QXAA 3T8XB 3ZHFA 1XAUA 3T0ED 2VDRL 2CE6A 5CHNA 2ZP9A 5BW7C 3GBNH 1PX8A 3QCUL 3QXAB 1XWVA 1X5KA 5I6PA 4D3CL 2CH7A 3K59A 1HXYA 3H9YA 1FXHA 5I1CH 1SXZA 3TT3H 1W0YT 2XDHA 3PUUA 4X8AA 1YO4A 3K2UH 5B38B 5CGBA 1HNZB 3V5DA 2DBLH 4W6WB 5AW3B 1Z0MA 3CSYA 1K8IB 4OGQB 1THCA 3EJYC 1MW2A 1E8YA 3CVIH 1FFPB 3KCXA 4KKCD 4MAYA 3QORC 5D1QD 1XCQA 1BS3A 4BHUI 5EOCL 4JY5H 4NQDE 3EGDA 4P9MH 2UUAO 3RG1C 2JJ2G 3NK3A 2LU4A 4OQTL 2BHUA 3O4LE 2C3VA 1IURA 3P11H 3NACL 4BFJA 2ADQB 4JF3A 2XA8L 2Y1YA 1KTRL 2Q3XA 1GTOA 1HKLL 2E7DA 4MCMA 4PY7B 2X41A 1XMOB 1K4DA 1P1ZA 2QGNA 1NPJA 1YQ2A 3BP6A 4CBCA 3G80A 3ULSA 4Q2ZA 1R75A 4NHCH 3Q2LA 2F1BA 1HQRA 3RYIB 2D4FA 4LMQI 4L4VD 3BPNC 4IOFC 1VIBA 2AXFA 3O3UN 4OLVH 2WM0A 3F3HA 4JHAH 4I0PA 4YE4H 2ZNXA 2YO3A 2HRPH 2EYTA 4TNGA 5HI5C 5J4MA 3ZVVA 3FUNA 3AXLB 2K0RA 1YEFL 4GRLD 4S1DC 3KPPB 4UYQA 1FH2A 1NMBL 1NSNL 1TFPA 2EDXA 1UM4L 3IDMA 4KKPA 4IBSA 4I0KA 4MXQC 5EC2B 3PP3H 1OWWA 4JYYA 2E27L 4KHXL 3C5JA 3BJLA 2Z31C 1LUVA 1S8DB 4NWUL 4AQOA 4JUSA 3BVTA 4NFDA 3T3PE 4HF5H 1L0XA 2QGDA 1F4WL 4ZJ9A 4I88A 1ACCA 5J6HA 3HKBB 4BA0A 4KRPD 4ZMLA 2LFRA 1DFBH 2FBJL 4Q6IC 2J4WL 4JFFA 4O2BB 4J9YB 1ETJA 4L8BB 4NQVB 4UM9D 5E5MA 3X1BA 5L2KD 1NC2A 4XVSL 1GGIH 3TT1H 3ULVL 2Y06L 5HGAB 4JI3B 5KJRL 2VLME 4FS0A 3EYSH 1LLAA 2HZHA 4MX7B 4QYAA 3S3BB 2Z93B 3ULUC 5F3FA 2QLYA 3VFRB 1S7QB 2HJFB 4JYBA 1VCAA 4PB9H 1U3NA 2WA3A 2R9IA 3G9AB 4I1PA 1HCYA 1Y74A 1QRND 3O9WA 4I18B 3NJIA 1JYVA 2UY6B 1I8AA 1X5FA 1BWMA 1U3JA 2VXSL 2X1WL 4HWZA 1HVXA 1KNOB 4J28A 1S9YB 3WLBB 4Y4KA 1EEQA 2CM5A 4OB5H 1SQPH 1ZLDA 5I28A 1KIUB 1VFBB 1E1RG 2I7SA 1GO3F 3VTAA 3HMXL 2ZUUA 2BX5A 2WNXA 3TPUB 3U7WH 1WC7A 2AMUA 2L4OA 4N22A 2UZYB 4DV1B 3HR0A 2YZ1A 4K0OA 5E8EA 4L8CB 4NRXB 4QTIL 2MPAH 2ZOKA 5IZ7A 2X4NB 1KXTA 4UOW0 3T0WA 4PYHA 3CHOA 1G6RL 2MIZA 1CC3A 1INDH 4OLYH 5AAWC 3OJVC 4JREC 5C0BA 4I55B 1C12A 1RMFH 1M7IB 3VQ1C 2HX8A 4KRMB 1QR1A 4XCFH 4AYFB 2IQAA 2HN7A 4PRHE 4JYAB 3R7QA 1CD0A 2FNWA 2ATPB 3CVCA 2DMKA 1T03L 3WNNA 1QBLL 1TVKA 4P2QE 1T2QL 3PFQA 1QBMH 4MSWC 4RVBA 1JF5A 1IZ3A 2X4UA 4WEBL 1YUHB 5HGHB 4MVQA 2ZCZA 5B1AC 3NCCB 4Q9CA 1LL1A 4U1LA 4PJDA 4ZFZB 3I6GB 4NLAA 2XKUA 3GBMH 1S7RA 5CA0A 3P40A 4N2OA 1B0RB 5CGYC 4J39A 3KBEA 3RWFB 3QUYC 1TIUA 1T4KA 2EEFA 3N1FC 3VW3H 1ES0B 5DD0L 2QTOA 5KSVA 1KIQB 2N1TE 3FPXA 1IILE 3JWOH 5FECB 4L9LB 1A3LH 2E5EA 3S5ZA 2DWSA 4AZ8B 4NXMO 4GKZB 1MCWM 3RNKA 3RBGA 1RUPH 5ITZB 4PRPE 2NNXA 2YD2A 5ECJE 4TVUA 4YZFE 5E4EC 4KKZA 1TJIH 1U58A 1SNRA 1B2YA 1TNNA 2K8MA 3H9SD 4X6BB 2VO8A 3CCMV 1SBSH 5HI3C 1IV8A 1DL7H 5IROA 4ENED 1SUJA 4DKDC 1TUEB 4XVOA 4NC0B 1M7XA 3EYOA 1JXDA 2FYVA 4DEPC 4ZUTB 4Q9RL 2C9QA 1IM9B 1BBDH 3CVIL 3FH8A 1YZZA 2QLVB 3VI4B 5GGSY 2EEXA 1KCVL 2EQDA 1IKNC 4GT1A 4XHJD 1AO7A 4MJ4A 5CWSA 5DA4A 4F7MB 3C60A 5E1AA 1Z0NA 3MRJA 3JWNE 5E2VL 2MNJB 1LMIA 3C60B 2F9BT 1V8HA 3MV9A 1EZUA 3MCLL 1QUPA 4WO4D 4X6BA 5B66Z 1AJ7H 1FZMB 4XN2A 3L9BA 4B9JA 1NS1A 2F5AL 4J80A 4S1QL 3KZIZ 2WJ7A 4Z7WA 4M61B 3UTSD 3MUY1 2JLPA 5L3GA 2EXYD 4TLUA 5HDBB 1I53A 2NDFA 2ZTBA 2GJ6E 4PLJD 3QEGH 3U7AA 4KY2A 4TV9A 1V3LA 2BHFA 3MODL 2ZOWA 2J5LB 3JAWB 3RWJB 3V8CA 5CBHA 2XX0A 4FG2A 2HPTA 2EXWC 3UEZA 2EUXA 3RWFA 2ZP8A 4X4KA 2EDMA 3KG5A 4FFVC 1KGYE 1DO6A 2Y0SA 4F5CE 3EXAA 1X5XA 5LP6C 5DD5L 2ZXAA 1MCSA 4PJDB 3T2NH 4QXWA 2I69A 3WYRA 2HTKD 3BLPX 4DR1O 1CPUA 4NNYB 3K5MA 1PKXA 1JI1A 4TLKA 5T5FL 4AQYO 3BGFB 4TUYA 2UZPA 3K72A 2NY0B 2YKKA 3QQ9D 3S96B 4QHKI 3F7YC 5G4MA 1T4KB 3QUZD 4IKIA 5J2UB 4X7TA 3KS0J 4HS3B 3DJZA 5FDWB 2HFGH 5I1AB 4ZS6D 5IB5A 2AK4E 4CN6A 2EINB 3FFDB 5FLUA 3SPHA 5LA6B 2QHRH 3FMGL 4HBCH 5HYJE 3QIBC 2BWIA 1EERB 1U2CA 2O5YL 1LDPH 3ORJA 1U8NB 5DHVA 1TKWB 3HMWL 3DV4A 1G7QA 1OCOC 1L9QA 1V3JA 4GI6A 3P2DA 4POZC 4L1HA 3IMUA 4AUYA 4X66B 2DTMH 4KZCA 4OZGF 4Y5YA 3MNWB 3PP4L 4NRXA 5T5NF 1ZHLA 4F7MA 4DN3L 3QDAA 5C0BB 5LHIA 5K69A 5FYKE 4X6CB 5HHXL 3WIIH 1YMMB 1IBDA 4KVPA 1JZ5A 3RZCC 1RFYA 1AI7A 3ECVA 3WXVL 2B14A 1MLCB 4R26L 3KPMA 4X6EB 3OM3B 2PP7A 4WGWB 1NCIA 4JFQB 4TLTA 2GG1A 2WC7A 1Z2GA 5D7IF 4MW3A 4KH9A 4W4NA 2YQBA 2GQHA 4CADB 1N2RA 3E8HA 3VQMA 2BM3A 4Z3HA 1AIZA 4Q6GA 4ZMWA 4D8PA 2DQUL 5J9PB 1BFOB 1H9DA 2H3NA 4UUJC 2P5PA 4JI8O 3BI9X 3QWRD 4LR3A 4QRTA 3WE1A 4YSUA 1BE3H 5EO0A 4O58L 4X1YA 1KIRB 4UTBL 4X50A 1WH0A 2VLRB 5AVYB 5AYQA 3MJ8A 4EDWH 4DKEH 4F8LA 5KG9B 5FAAA 1AIFB 4PJDE 4ZHQA 4LF9O 5FA3B 4PELA 1CLYL 3CFUA 1CF8H 4L9LA 3N1PC 5EBLA 1M4UA 1H15B 2CO3A 4A7VA 2QV4A 2H0FA 4K9EL 3V9FA 2W80C 4GAJH 2CH7B 1REIA 2EKJA 3ERXA 3HZYB 4ZQKB 2OULB 1GKEA 1QD0A 1DQKA 3D52A 5I66A 4WWKC 4KX9A 3ULUE 4ODXB 1IM3B 3CDCA 3KPSE 3BIBX 4JW3A 2RACA 1Z7JA 3KPRE 5FM8A 3DBXB 1F41A 4HNAB 2CUMA 4M62H 4I2XE 3L2NA 1VQPV 1MPAH 2C9VA 4KXDA 5E6RB 4DV5B 2IJIA 2D3OW 1JTTA 1TVKB 4FHKA 3QHTC 5FDYA 3AU0A 3I5DA 4M1DL 1DLHA 1FG2B 5C2BH 1ZLWK 3FTSA 4FLVA 1T2QH 2HVJC 1TQSA 1JK8B 4CJ0A 3A6CL 4Q74A 4ETQA 2GUYA 3ZHNA 1LQSR 1J1XH 3OLGA 2CDFB 4JQVA 2DLTA 4XCFL 3FT1A 4YSCA 5FUOL 1A9EB 3H7BA 3RWRD 3QEUB 4C4KO 2GJZA 3OB0H 3MSPA 4XVSH 2J56A 2X88A 5IWAO 1JGVL 4FX5A 4LRNH 4QD2E 5JXAH 2ZKHL 3HE6B 5E8EB 4L8CA 2P5WE 3CQQA 1RAMA 1EZJA 2UZYA 2UZXA 2P7TC 4NO5B 2W95A 1HWYA 3L75H 3ULVF 3V5HB 2B16A 4ZSOA 3I3EA 1H8NA 3KMDA 1J0YA 4AMKH 3LNEA 3ULSB 3IK2A 1G7LA 3OJDA 1XHXA 3P9MA 2QDWA 3VFMA 1WFUA 3U0ZA 2PYJA 2FWOB 1AI6A 2WXOA 3KWWB 2X2IA 3CSYB 5A16A 2YPVA 3D12B 1SJVA 3LKSA 1QP1A 3BIKA 3QHZH 4RDBA 4FJYA 4UFZA 1KLGA 4M00A 1GH6A 3ZGHA 3L3GA 4CL7A 5IQ9A 3O81A 3CHSA 4OQTA 5CMAB 3KVDD 1KP3A 4LVOC 2Y6SC 4WBNA 4JO4H 4WHYG 2AS5M 1URFA 3C8HA 3LIZL 5I74C 3LZFL 4MAYB 2R1XA 1KB9F 2YIHA 1DTUA 5T3XE 2QVIA 1A0QL 3MLZL 2F8VA 3FB6B 1EXGA 4FYQA 2O5ZL 4NC1C 1XZWA 4P2RD 5ANMA 3HKBA 3JD3A 4P49A 3A67L 4LSUH 1I9EA 4XPFL 3WJJA 1FNGA 3WO4C 2HFEB 3VI3F 4RA0C 1S7UB 1XT5A 4RCAA 5EU5B 3AGVA 2UU9O 4FQCH 3CX5K 5D7JD 2FWSA 1S2EA 5J1AA 4JKMA 5AW8B 1H2KA 2GCYA 4GPVA 4N0UB 2AQRA 3QZWB 3NCJH 1AJ7L 2Q8VA 2D9CA 4FHBD 5F9WB 3QDMB 4ZXBA 3OHXC 3PWUB 1UM5H 4GW1B 1BF5A 3WEOA 3E8UH 3QDJB 3QUMH 3HBGA 4YQXL 2MW2B 2WQSA 2X7LB 4KPHL 3MRIB 4ODWA 4HIEA 3VM5A 5GJTH 2ILLA 3RWEB 3VRLF 3BAWA 1HILA 3B8SA 4NQDD 4HJGA 5FW7A 3GIZL 3ZTEA 5EWIL 5F7KC 1D5IH 2Y72A 2Z3YA 2W0XA 2ZCHH 3SE8L 4APXB 2J5WA 3FU6A 3ILDA 4WI0B 3NIFE 4XNDA 3MOAL 5CLZA 1E0OB 1IGTB 4CILA 3G67A 3A2FA 2CK0L 5CJOH 1UVQA 1F3JB 4DV7B 4W4OC 4TNWF 5GXBB 3T1FB 4M5TA 5SX5H 2FJUB 2XTJD 4KI5C 5AVTB 3CH1A 4NFBA 4MAZA 1BGXL 1MFBH 2VDQH 3FB7B 3I6LD 3ZQWA 1U8JB 4QXTB 4GX5A 2AHIA 2APSA 3VXTB 2B7DT 1KB9K 3D0VB 4WV1A 3WIIL 2BVYA 5BRZD 5SWSB 2BOLA 4F37F 1LEKB 1A6ZB 3KD4A 1ZWIB 4RBPH 1T0OA 3CC5A 3B1UA 5D1QB 2R4SL 2C7UB 1LM8V 2I32A 4G11A 4JY5L 4XC1L 4I0XA 4EEEA 1K4CC 4JI5O 3D1MC 1OQOA 1TTUA 4RNRB 1EN6A 4E5XB 4KRLB 4PP1C 3ULVC 3K6NA 2VCOA 3CXFA 4XTRC 1XSJA 4O4YL 1AH1A 3QQ9C 2HJDA 1ZSDA 3AG3C 4JI1B 1XF4A 3SJVD 2GBTA 1JUFA 3CMGA 1I8IB 3OKOB 4I1RA 1KENL 3Q2VA 3ZDYF 2CDGB 2X4OA 2ICWI 3PLYA 4EBQL 3DGEA 3E35A 3QJHB 4DVRL 3QQ4A 4B9CA 2DQFB 4MNGA 1T6WA 1CN4A 4ADJA 5CR1A 5CBFA 4G8IB 1UT1A 3LSUA 3HG4A 4LSSH 1ADQL 3ES6B 2YAHA 5I2IB 4E9YA 1A2YB 4PG2C 5D1QC 2APBA 4CC5A 1S7XA 4IBYA 3MGTB 2BNQD 2W0FB 1A22B 3WLWC 2G60H 3B3BA 3LKQA 1DN0B 5HHMB 3VXMA 1ORSA 3ZTCC 2DN9A 5D70H 3BRGC 5KHKA 3ARDD 1KEGH 2QJDA 2GV9A 2I07A 1L9RA 2EXYC 1K5WA 5DZ9A 3MRDB 4OSUH 4EZLA 3D0LB 2VDKL 3KVPA 1GZQB 2IAMD 4UWQB 2F4VB 4AW4A 3WDIA 3UBXG 3B9VA 1M93A 1JVMA 2X10A 2D7OA 1V55C 3SDXB 1JJUA 2F19H 3TZVC 3HPJA 3R06B 1CLZH 2GPZA 1JNJA 1F4NA 1AR1B 4B27A 4I3RH 2SEBB 4RZKA 2N1KA 1F8TL 4LCWE 3JTTB 4QHUB 4XNZC 5L2KA 1FV1B 3FTGA 3JVGC 2ADJA 4YR6B 1V5JA 2V2TB 2EDRA 4GSRA 4MD0B 4M3JA 2WB7A 5L7XH 1EEUA 1QLEB 2H6UA 4NWTH 2W0FA 1FJGO 1CCZA 3L4TA 1IC7H 2X87A 1AZZC 5LBGA 3JATB 2PYLA 3F64A 1ZEAL 1TG8A 2ICEA 4FJ6A 4PJ5E 4U1IA 4JQIL 5I1KH 1JFQL 5LNEA 3DPDA 4KK5D 3FSZA 1TVHB 1ZSHA 2IDUA 3BWZA 5IE9A 4GFTB 4HJTA 4KFZC 5JXED 4ABVA 1MCNA 1AGCB 1X5IA 3UGEA 4PR5A 4LIQH 4FFTA 4XNBA 5JA9A 5I6XB 1LO2H 2EUVA 2B3RA 5B3SB 2ZJSL 1G7PA 4Q9BA 4F91B 2XI9A 3ABZA 5C07D 4JMXA 4HOXA 1YTFB 5JXAL 5E9DD 4I48B 4LVNB 4W6YB 1GGBL 3RX7A 5DFVD 3VG0L 4PJGB 4WIQA 2E8YA 4DR6B 2AJ3A 1H3UA 5IGXH 2B59B 1MAJA 5GW7A 3BY6A 1SOQA 3IJYB 3TJHD 1P7QD 5CD5D 1N36B 3FTGB 2WLZA 5HDBE 2H8PC 3WIAA 5G55A 5KYXA 4MZIA 3AABA 4HCRH 3JZYA 2Q87A 2MCPL 3ARDA 4R4FH 2VAJA 1E9PB 2G38A 2P80D 3NG5A 4K3JL 1FE8L 1OT4A 4CA4A 5IESL 2LGWA 2XYBA 2Z3FA 1XI1A 5T8IA 3SDAB 1RL1A 4U1JA 2Y36L 3IDYB 4O02L 2VM9A 4UAOB 5EHFA 2SODB 1HNGA 1KJ2A 4G9DB 1AD9B 4TWKA 1FVCA 3INUL 3LNFA 2AJUH 4GXUN 5DVMA 5LCVA 2EVFA 2P26A 2QQKL 1BDYA 4E9WA 2Q8BL 4WGKA 2FEDC 4Z7VF 5T33H 1EHLH 1FS0G 4LSVL 2R59A 1A4AA 5DFWH 3OUSA 3ARVA 5AL0A 4EN2A 3IJ9A 4LHQB 3GXTA 4KHTH 3RHWK 5BO0D 1UJWB 1NQTA 2DEYX 1ZXKA 4XZUA 5F6HJ 1HILB 1I7RA 5EOCH 2CGOA 3KWVA 3HG3A 2I27N 1R3KA 2VN6A 4K5MA 1D5AA 2FIKA 1YG9A 4R7CA 1I8IA 4FVMA 1DBAL 1CIDA 3FTUA 2JI1A 3FUMA 4TUOB 4XPFH 1KGWA 1GN6A 4U1KB 3CRQA 1LP9A 3KPNB 3AXIA 4PRPB 2C2AA 3QYCA 5DRZB 5IUCA 5D1XA 4H13C 1D2PA 1QSFE 2ZKYA 1EHXA 1YYLL 2WXFA 4HIXH 4OFVA 4DK6A 1XGTA 5DSCB 4E5XA 1JVLA 2WUCH 1GZPA 1QPXA 3D3VD 4KUCD 1P84F 4M3HA 3LIZH 5D7LB 1VEWA 1FBIL 5D4JA 1G4YB 2CO7B 2WPGA 4NUJB 4ONOA 5FFLA 1OAQL 3EDFA 1KG0A 1OE1A 2AK1L 2AV7B 2GB2A 1KPVB 2IWGA 5JH7B 2QV2A 1NAMH 3EAKA 4HHAA 3B2EE 1DJWA 1M42A 5FCUL 4WV1B 3AROA 3DX7A 3KHQA 1YPZE 4PJ9A 4M8QA 4GAFB 5H94B 3S5YA 3ZE2E 1EFQA 4MB5A 4PGBB 3UC0L 3SDYL 1AQMA 4JHBA 3BAIA 2K45A 5IVZB 2LHAA 1G9EA 3WFDL 2CSPA 4ELDA 4GBXA 5HYSG 3HFML 1LEGB 1PF3A 1UZ6F 2RGSA 5KS9A 3PJSK 3OKKB 3OW2U 2OPCA 3QPQD 2C4FT 5K1JA 4UF7C 4HFWB 4IDLA 4PJHB 2WXGA 2EDNA 4W9CC 3SJVA 2JGDB 5L4IA 4MDRA 1ASOA 1EN4A 4KNTA 1DVXA 1E3FA 3B9KD 4HG4J 4H25A 2ITEA 3B3IA 1KC8W 1BLIA 2GUOA 2X7LA 3PQYE 5JLZB 1XB3A 1KB5L 2ZAIA 1NLBL 2DM3A 4Z7UA 1T21A 2AGJL 5L8JB 3DUUA 2DEXX 1A6VL 3T0DA 5FYKU 1QSEA 3U4EA 2J73A 4HS8H 5JHLL 2GHWB 1U92A 5CZVH 3QUKA 1I7ZB 3RTLA 2VQFB 4BR6A 2DQGL 1E5UI 2O5XL 5FB8B 4GRWE 2E47A 5INDA 3ZOAA 1JWUB 4IJ3C 3X3GH 3U10A 5JCOC 3FHEA 4FFYA 4GFXA 5FPRA 2NQDA 2VDMB 3BQUA 3RA7H 1OAZL 2WIIA 2ARHA 4LO9A 4ZO7A 1KKDA 1BXUA 5LOVA 3ULVD 1EH9A 4HS6A 3RTQD 3QRGL 1BFVL 1I9RL 5T1KA 4KH2A 4JGSA 4HIHA 5GS1C 3DHJA 2NY0C 3QR1A 3P2TA 3GTTA 2WO3B 4X1IA 3IFOA 4BFBD 5H5NA 2XNDG 1FIGL 2DWDC 4X64B 1G7IA 2H26B 2W1NA 1UWXK 3RVUD 4KJYB 5IBUB 4AQ1C 5K59F 5DR5L 4XCNA 3S37X 2JXMB 3WNOA 3LUTB 4LSRL 3T65B 2FD6L 4MMXC 4CVWA 5J9PC 4P4KA 4EUPA 5EO0B 1E79G 4P2RB 1A8ZA 1HOCB 2L7QA 5D6CA 4NO5A 4YGAB 2YMOA 1C16A 1QVOB 1XGYL 5AZ2L 1T5WB 5BRQA 1KUQA 4F20A 1S9VB 3BQVA 3PY9A 3SKJH 2JKSA 1KBVA 3GSNA 2VZSA 2ZYRA 3Q8EA 2DLEA 3CXHF 3DRQA 3JT2A 1YMMA 1JE6A 4R97C 3TO2A 4M9OA 3SDYH 4CGTA 2X0VA 3