3HB3B

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
252
structure length
252
Chain Sequence
b'QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 73
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hb3B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3hb3B01
2ZONA 4YSDA 1MG2C 1SDDB 1AS7A 4YSAA 2OJ1A 1BQ5A 3FT0A 5F7AA 4AX3A 3NP4A 1AACA 2PPAA 4PAZA 3UAEA 1E5YA 4A2GA 3UADA 1J9RA 2HLEB 4E9XA 3UACA 3H4HA 2E86A 4DPAX 4WKXA 3NSYA 3QQXA 2R7EB 3FSVA 1MDAA 2YAOA 1FWXA 2UX7A 1M9WA 2LLNA 2IDQA 3X2QB 2IAAC 2FT6A 2YQBA 1PLAA 4KNSA 1OE1A 1IC0A 4BWWA 2QDVA 2VM3A 1AS8A 1BEXA 1PMYA 4AKOA 1AZUA 4BWTA 2IH9A 1AANA 1AZRA 4KO9A 5I6OA 1AOZA 2XYBA 1A4AA 8PAZA 4AKPA 5I6MA 1PZBA 4Q8BA 1NICA 1B3IA 5IY5B 2FJSA 2IDFA 2NRDA 5D4HA 4GXFA 2H5UA 3G5WA 4AZUA 4JHUA 4P5RA 3JTBA 5LDUA 4HHWA 1RCYA 3T6WA 3S3CB 4NERA 1OOWA 3AZUA 4HCFA 2DWTA 3NJIA 1M56B 4A68A 4YVNA 4YSSA 2CUAA 1ZDSA 1NTDA 5I5JA 1CUOA 5I26A 1JZJA 2ZWNA 1AG0A 1ZDQA 1SNRA 2I85A 4BDVB 2Q9OA 2BHFA 1OV8A 2PCYA 4YSEA 1NWPA 1SFDA 5B1KA 3GYRA 3IE9A 4NAJA 4YSQA 4YVUA 2HX9A 1MG3C 2IWEA 4DP7X 1PLBA 4E9QA 1RKRA 2BP0A 4FA7B 3T6ZA 2X87A 5AZUA 1JXDA 4PCYA 1SFHA 1IBZA 2YAMA 1OF0A 2WSDA 1WS8A 1ET5A 1NZRA 1JVOA 1L9OA 3GXUB 2BWDA 2VW4A 2PCFA 4JKNA 2WO3B 1L9TA 4F7KA 2YARA 3UGEA 1JZHA 2J5WA 5B7EA 2IWKA 3FYIB 3NJLA 3CVDA 3WKQA 1OCZB 1SHWA 4GY4A 2YEVB 4YSPA 2FQEA 2UX6A 4UAHA 4WTQA 3ZDWA 3TU6A 5B7FA 4GP4B 5B1BB 2FWLB 1WA1X 1FA4A 3NJGA 2BZCA 2BP0B 2I7OA 3RYMA 4G7SB 5B3SB 1SJMA 4F2EA 1NIEA 1KCBA 1BQKA 4E9TA 4DPBX 7PAZA 4UF7C 1SDDA 4BXVA 3S8FB 1J9SA 1V10A 3EH3B 1GSKA 4HIPA 2Q5BA 4E9RA 5I6LA 2PPEA 4HZ1A 1ET7A 1PZAA 3CVCA 2EILB 2AZAA 3QJSB 4M3HA 4EF3A 1XB8A 3PAZA 3V9CA 2UXVA 1L9RA 2R7EA 3SBPA 5FC9A 2VSMB 1NINA 2VN3A 3C75A 1GS8A 1PCSA 3ZX1A 4FAAB 3NSCA 2JKWA 2N0MA 4CSPA 1JXGA 1UATA 3DKHA 3OMAB 3EHBB 1ILSA 3DIVA 2HX8A 3IEAA 3NJKA 2B08A 4Q89A 3KW7A 4YSUA 1CYWA 4HALA 4E9WA 1QNIA 3AY2A 1J9QA 5TK4A 4G7QB 1WA0X 3PLYA 2EIMB 3NSFA 1JERA 2XX0A 3AG3B 2W88A 1ZPUA 4P5SA 3FSWA 4AI7A 1GY1A 5B7MA 5TK2A 5I6KA 3OMIB 1ZIBA 1HAWA 1CC3A 1NIDA 2UXFA 3NJHA 3QPKA 3AG1B 3WIAA 4YSRA 1AR1B 1W6WA 2XUWA 3FPXA 2GI0A 1KDJA 4N4YB 2PP9A 1V55B 1MZYA 3MX0B 1PZCA 5ANHA 3QJTB 4BDVA 2DV6A 2VMJA 4E9SA 2QPDB 2YAFA 4A2HA 4BWUA 2YXVA 4G72B 4G71B 1EZLA 4G70B 2XXGA 3CDZB 2BO0A 2P80A 2XV2A 4DP4X 2XV0A 2GB2A 4N8UA 1KYAA 1NPNA 1AZCA 1E67A 5AKRA 5B1JC 3OMNB 1ET8A 3EF4A 4TXVB 2ZOOA 5D4JA 5D4IA 2QPEB 1XB3A 2FTAA 2XVBA 1PAZA 4W9ZA 4A2FA 1OE3A 1BXAA 1NIBA 3CG8A 4HAKA 3CVBA 2EIKB 1XB6A 3EH5B 5PAZA 3IN0A 4HHGA 2JFCA 2XX1A 4DP5X 2DWSA 2XXFA 1RZPA 1KBVA 1A8ZA 1OCRB 2HZHA 2GHZA 3HB3B 6PCYA 1J5DA 3NSDA 3NJMA 1GW0A 1DYZA 3DTUB 2XV3A 2YAHA 1TKWA 1NIFA 2VW6A 1AQ8A 2W8CA 2X88A 2FQFA 3CZUB 4JHVA 3SQRA 3WI9A 4ZK8A 1NDTA 2MTAA 1CURA 2GBAA 3FPYA 1I53A 4RH4A 1GR7A 1OCOB 4DP6X 2VM4A 9PCYA 2FQGA 2BW5A 2OV0A 3MBWB 2HX7A 3FYEB 3N2JA 3OM3B 3T6VA 5E9NA 3QJRB 3NP3A 2P80D 3BQVA 3UABA 2XLLA 2QT6A 3X1BA 3IBOA 2HXAA 2H47C 2Y1AA 4A2DA 5EHFA 1KCWA 4YSTA 2BWIA 2BP8B 1ZIAA 1M57B 2EIJB 2TSBA 4M4RB 3X1NA 1ASQA 2CALA 1E5ZA 3FSZA 2Y69B 3L45A 1BXUA 4K9JA 3FU7B 3GDCA 1ETJA 3T6XA 3ABGA 1ASPA 5F7BA 1N70A 3FU9A 3QJQB 3AW5A 4GP8B 3TA4D 3UAAA 2YAEA 3X1GA 2PP7A 2CAKA 3FQ1A 2UXTA 4E9YA 3FS9A 3H56A 4DP9X 3PCYA 1JZGA 3PXLA 3X1EA 1WA2X 1ID2A 1AIZA 1X9RA 4NB7A 2FT7A 2UXGA 3PPSA 1GS7A 4DPCX 1TEFA 1CYXA 3QJUB 4QLWA 3IN2A 4AKQA 5AFAA 3CDZA 4MFHA 3PAVA 2BZ7A 1SF5A 5A7EA 1A4BA 1L9PA 2CCWA 1N68A 2PP8A 1YLBB 2PPCA 1JZIA 1AG6A 1TU2A 2GC4C 4KOCA 2DY2A 1AZNA 4YSOA 4L0PB 4A66A 3EH4B 3S3DB 2OCCB 1J9TA 3ASNB 2PPFA 3D12B 3FQ2A 4GP5B 1WAEA 4DP0X 3HEIB 4KNTA 3WNJA 3X1FA 2I7SA 1JZEA 2HRGA 1AAJA 2IWFA 1JVLA 3QJVB 3NT0A 2AANA 1PNDA 2JXMA 3OD3A 2GSMB 1SHXA 4KO7A 2PLTA 4BXSV 4GYBA 3NJFA 5I6NA 3V9EA 2XWZA 3TBBA 1BAWA 3BVDB 1NIAA 1IBYA 2MRYA 1JOIA 4E9VA 7PCYA 4A2EA 1IKOP 2CBPA 2YXWA 1A3ZA 2J56A 4KOBA 4KO5A 1AS6A 1KV7A 1BYPA 1BYOA 3SBQA 3ABKB 3PAUA 3H4FA 4CSZA 1E65A 1AZBA 1PF3A 3NJNA 4YSCA 5I5IA 1RZQA 1OCCB 3S8GB 3JT2A 1X9UA 2BP8A 3TASA 1A65A 1BQRA 3ASOB 1ZV2A 1T5KA 1F56A 4KNUA 2YAQA 2GIMA 2H3XC 5I5MA 4HCGA 4W1TA 1ILUA 1HAUA 3FU7A 3WKPA 3ZIYA 2DYSB 2IDTA 5PCYA 1PNCA 1JXFA 3SBRA 2QDWA 1QHQA 3S3BB 1GY2A 4A67A 1HFUA 2CJ3A 3FQYA 1E30A 5I28A 2EINB 3N55A 4DP2X 1ASOA 2XU9A 1TEGA 2B3IA 2WO2B 1XMEB 2BW4A 1L9QA 5B1JA 1OE2A 1ADWA 3WG7B 1WS7A 1IUZA 2VW7A 1GYCA 1URIA 2AZUA 3FU8A 3AG2B 4QKTA 4X4KA 1W6LA 2J57A 1JZFA 2IH8A 1A4CA 5B1AB 3OQRA 4G7RB 2VSKB 2AVFA 4HCIA 2FT8A 2HRHA 2RACA 1FFTB 2AFNA 1R1CA 2YAPA 3KW8A 1BXVA 2GC7C 2PPDA 4YL4A 3T9WA 4UANA 4BK5C 4ENZA 2A3TA 4F2FA 3ZBMA 3NJJA 3ABLB 3T71A 1J5CA 1QLEB 3TBCA 1NWOA 1GS6X 2TSAA 2ZXWB 2IDUA 1DZ0A 1MZZA 2IDSA 1KDIA 3WNIA 6PAZA 1KGYE 5I6PA 1PLCA 3FSAA 1SF3A 3ABMB 4DP1X 1EHKB 1W8EA 1PY0A 1NPJA 2J55A 4DP8X 1KBWA 2DYRB 1V54B 3AG4B 2FQDA 4KO6A 1L9SA 3ERXA 1VLXA 3NYKA 2FNWA 3U25A
chains in the Genus database with same CATH superfamily
2WQSA 3UC0H 2ZONA 3QJOA 3VGEA 2BH0A 3QGVA 1BP3B 1YC7A 3L7EA 1Q0XH 3ZDYB 1A3LH 5BRZD 3U36A 2V5SA 3OE7G 1D3CA 1JRHL 1JV5A 3D51A 3N43B 2DWXA 5E8PA 1MFBH 5FYJU 3CXHF 3T0XA 4FZ8L 2YD2A 1KCRL 3PNWA 2F08A 4CC1A 4L5FH 1OGAE 4NQED 4F5CE 2Z8WC 3H9VA 4AVIA 2ZQKA 1IAII 4GRWB 2OJEB 3US1A 2J8UF 1XGTA 1CU4L 1M9WA 4FQXA 4FXKB 4XCFH 4KJWC 3G5YB 3APCA 5AQ0A 3T2NH 1J5EO 1XOUA 1T5XB 4CN6A 4X4YA 2AF2A 4U1IA 1OPOA 1RZKC 3N2GB 3DMMB 4KBPA 5DVLA 3RVWD 4XMKH 1SOQA 3UM7A 1AZVA 2OL3L 1BW8A 3P40A 4LLYB 3TA3D 2NY5H 3B2VH 3CXCU 1WPXA 3MRHB 1AANA 1AQDB 3N42B 5BR8O 4RO2A 4FQQB 1KBGL 1WC7B 2DYRC 1FG2B 4X6CA 2BOCC 1J0JA 5EC2C 2GT9B 3QNZB 3P3UA 2WZ5A 2FJSA 1CQYA 2ODHA 4F8NA 2O57A 4NM8H 5FLUA 2RR3A 2DI9A 4LFHD 1IJNA 1XBRA 3AREA 4RIRA 2AXHA 1NH2B 3CV5A 4K2UH 1T0MB 2JKXA 1HEHC 4OR1A 3QQ4A 1RCYA 3JALB 4HEPG 2OR9L 3UX9B 2YJLA 1YY8A 3H8NA 3ESPA 4P2ZA 2NMSA 3DMMD 1E9QA 4FTVA 1DZBA 3RL2B 4MW3A 4H25A 2JGDA 3BKYL 3FQTA 2CRZA 4KKAC 4N2AA 4WWID 4JHWH 5H35B 5J1SC 3WUWB 5KHGA 4LSPL 3GSQA 1MFUA 4Y4HB 5LP6B 3UDWA 1VQLV 1H38A 1N4XH 5CEYB 1X7QA 3VG9C 4YSEA 3P0GB 2AABL 4CC6A 3H9ZA 4Q52A 2Q8BH 4JR9L 1KIPA 2NR6C 4APXB 1TYJA 2ADGB 1IGIL 5T5FH 1NH2D 3X3FL 3SYCA 1QI4A 2NUTB 5E1IA 5EBWA 3VD2A 5FX3A 2AHYA 4NO2B 3GMRA 1OCWH 1YEJL 1Q0YH 4OJAA 3NEEA 3T4AC 3CX5J 2GTWA 4JDEA 1W8NA 1XT5A 2YXLA 3LVTA 5DLMH 2VLKD 2R9RB 4GKSB 5DHEA 1UB5A 4LPTA 1WITA 4C59B 4RAIA 1OCZB 5BS0E 1MAKA 4Y4HD 2AKRB 2G5BA 3O8XB 2GIYA 3OKLA 1KXQA 3Q2WA 1TYRA 4OU3A 5GJSH 3CHXA 4DHLA 4GG6F 2P3YA 2JCCA 1B3QA 4LSUL 1UUNA 2N3JA 3Q2NA 5FGCB 3IMSA 1N32B 2NY0B 3R0MA 3VW3H 4JFPA 4LEOB 1S0VA 3NQKA 4P48A 3O4LA 1S9XA 5JXED 1S7QA 3RZCB 1R3LB 5LP6C 2VDRH 4U7KA 5D2NA 4LF3A 4HIPA 3VRLF 4N9GB 2R0LL 2DM7A 4UUJA 3VUAA 1U58A 1RM1B 3S6CA 2EILB 3OAWA 4RA0C 1UURA 4M5SA 3DVGB 4WI0A 1ND0B 3O8XD 5AW0B 3CSFA 3P69A 1HN1A 2W0PA 4JDVA 2LOEA 4JI1O 4ZTPL 3IVKA 1TVKA 3TWYA 3LNNA 1LO3L 4WWNA 2QM7A 1EFXB 1BZ8A 3CSGA 1OCOC 1SQVH 4GZRB 2V7NB 4KX8A 4RSYA 4U1KA 2F15A 3ZRCC 4D0CB 2XG5A 1ZSDB 1AHWB 3EFFK 4AI8A 1TQWA 3JTSB 4YHIA 3ASWA 3CRCA 3RZCD 3CXDH 5DR5L 4Q89A 2B08A 4LIQE 3ESVF 4ZMQA 4FG0A 5BOZG 3T3PB 4P9PA 4NO3A 5CEZH 4FHBD 1GC1C 2BY0A 2XTLA 4CU7A 2CBQA 3QEHA 1HH9B 1Q9OA 1RL1A 2EE6A 2YGPA 5C0JB 5KYNA 2NY0C 1PNMA 4ZIBA 4P46D 4PJGE 1EANA 1L6ZA 2ZKMX 5HGDA 3D4ZA 1I8MA 2PYEB 4AI7A 2V8MA 4K23L 2XWDA 1TIUA 3RDTD 1R3LC 1N2RA 1S7RB 2D2OA 4M6OH 1EFXD 5CM1A 3OSVA 1EO5A 1RJYA 2C9RA 4WK2B 5ESVA 3I3EA 2P5WA 1HOCA 1IBMO 3PWNB 3WIAA 4Z3EA 1BXXA 5CEXA 3OUFA 3F7RA 1RZGB 4CC4C 4K71B 5EBLC 2ZYRA 2FR4A 1IEBA 3NCYP 4W9DC 2H45A 3RVZA 5AVRB 1PX3A 1V55B 3BPNB 2NY3B 1PG7W 2PO6B 4BWUA 5L6YH 4DW1A 5ADPH 1GTNA 3HLAA 5I82A 4HPOL 4UTAA 4DUWA 3FN0H 1SYVB 2YZ1A 3D3VB 3G6AA 1NUNB 2JJSC 4MYPA 3VX1A 3Q1EA 2EH7L 1AZCA 2PYED 5AKTA 1X5ZA 5I74B 4YXKL 3TVMD 4UWQB 5I19H 4XNXH 2J72A 3G5VA 5BQ7A 5GS0H 1V7ML 1P4IH 4JV5O 1DUZA 2ROXA 4S0TD 3WJJA 4YDNA 2HKOA 1D2DA 5I1IL 1OE3A 3D39A 1K5QA 4KQ4H 2YWYA 1OHQA 4JDTL 1A4KB 4HHGA 3QAZC 1ZWIA 2JFCA 4WW2B 4JFSA 1DBMH 4R7CA 1TTAA 3TCTA 1CFMA 5HI3D 2I9TB 3HE7C 1PLGL 5D71L 4RWYH 5ENWB 2NY3D 1MCBA 5GQBA 3L3KB 3MACL 4ZQTA 1N6QH 3G6DH 1S8DA 2PO6D 5H4YA 3NCJH 3HB3B 4GMTL 3DJ9A 3D50A 3NCMA 1FNSH 3NJMA 1G7HA 4ZYKA 3UYOD 3X11A 1GN4A 2JI3A 3MKGA 4JFUA 4JKLA 2VW6A 2W8CA 3L1OL 1KF9B 1R6NA 3P3PA 2VR9A 5EZIH 2APSA 4WNQA 3SDDC 1KTDB 4KVNH 2QV4A 4LPVA 3FO9A 4GFXA 1SC5B 2G60L 4YZFE 2DTMH 3TV3L 2BOLA 1E0OB 2ZXCA 3UBXI 1MFEH 2VM4A 3N0PB 3LAFA 3S4SB 1XFPA 3BT2L 4NNXB 5CJXA 2FX8H 2DW5A 4I9WE 4UINL 3F04A 1ZLUK 5T33H 5I74C 4GQ9H 5FK9B 3MRCB 4A6YH 3CH1A 3HN8A 5D4QA 1WTGT 2XFXB 3TBTB 3CVHA 4GT1A 1LK3H 1JFFB 3HB3D 4HGKC 2AI0H 5MEOB 3MJGX 4JPQA 1UXSB 3ZDZF 3AAZA 4JFVA 3IBOA 5H6QA 3C60A 4YNYA 4RMWA 1CGWA 3EFDH 3FTVA 3CCRV 1JNNL 1YVLA 3BWAA 2NY7H 4MVZA 4PG2C 4YSTA 1UD3A 1ZL8A 2WKGA 5F1NB 1VFOA 3HE6B 4P2OB 3QDHA 1UWFA 1W0VA 1Z9NA 3DHPA 2EE3A 5AW3B 5FV2A 3MRJB 1UACH 2A6IB 4S1RH 5DMKB 3IT8D 3Q6FA 5IB1A 3PAYA 1R3IC 5DD5H 1T6VN 4JO1H 3VFPB 2BVPA 1QPKA 3DUSB 1KYDA 3CTTA 3NCWA 5I1LB 4H13B 1JL8A 5F7BA 3NZHL 4G8GA 2VDOH 3SYPA 1NAMA 3B7YA 2QKCA 3AW5A 4BE5A 1TZGL 2CDGA 2NY4C 3JARA 5F7MC 4YXLH 3QNXB 4O02L 3S36X 4RFOH 2QWQB 4NVPA 2Z3FA 3FH8A 4LL1A 1PYWB 1H9VA 1NCHA 3BCCH 3HE6D 4P2OD 3ZQXA 5J9PB 1CBVH 3HNVH 2VDKL 4PJAB 1L0PA 4J3BA 1L6XA 4IIQA 1XSOA 4LMQI 4NQDB 1HK6A 1NDMA 4I85A 3VXUE 4BK4A 3KPOB 1VQPV 4GIPD 1KB5A 3IN2A 4RCAA 4RLDA 1GTFA 3RVUD 1VFBB 1CI5A 2AXFB 2AJXH 4GKOA 1X5MA 2X6BA 4X6EB 5ISZB 4CW1B 1D5AA 2VE6B 2VLRA 2XHNA 2NLJB 3SOTA 1NCDH 4X6CF 4X8XA 2VN6A 5E70A 3S5LA 2CH7A 2QSCH 4X98A 3SGEH 2C7FA 4OPAA 3E3QC 4E41A 1UJ3B 3NH7H 2EDTA 3D2TA 1AGBB 1CF8H 1MAJA 4TNWF 1FXHA 2YC1B 4E36A 4MNQA 4LCUC 4PRNA 1IGCL 4H13C 4NQDD 2EICA 1UZGA 3OEEG 2R4SH 2OP4H 3V6FB 5KUMA 4LOUD 3SGKA 1NCGA 5CKAA 1CE6B 4HKXB 4N3UA 2C5DC 4LFBB 5D96B 2OK0L 5EU6A 4L3EB 5ISZD 4PJHE 2YPLA 3BW9A 1C12A 2J20A 4JPIA 3OKYA 1WLHA 4F7TA 1DFBH 3V5HA 5MEPA 1NFIB 2VDRB 4KI5C 3HN5A 4IEFA 5I0ZA 3TBBA 4U6TA 2R9HD 5HDBF 4BQ8A 4PJ9B 4WFAV 1I9RL 1XCQB 5C8YA 1XH1A 3SDAB 1FZJB 4H1LA 2AV1B 5CN0A 5L3FA 3MNZB 4UQEA 2AQ2A 3FQ4A 4WFED 5HHNA 4ACTA 5MEND 2NLJC 4MVMA 2X1QA 4O2BA 3GIVA 1RSYA 2DF3A 4HS8H 4LARL 4DEUA 1A6TB 1QQDA 1AS6A 2XXCB 2MH4A 2D7PA 3CLEH 1FVCA 2GTZA 1A7QH 1QFUL 3FDWA 1KC5L 5DECA 4AVJA 1OCCB 3PJSK 4ANUA 4ETQA 3RW0A 4H8WC 3RY6C 4ODXB 4X64O 2JCCF 4PJFB 3QG7H 3K58A 4UU9A 4CVXB 4OFYD 1AMYA 1GMEA 5D1XB 2CO7A 2XZAH 4MTOA 2G3MA 2H3XC 2J4WH 5KBDA 5CD3A 1R24A 5IKCA 5D96C 5IB5A 4BGDA 4B7LA 3ECBA 5I18H 3K5SA 5F3BB 3S3WA 2A4ZA 3LZOA 1EXUB 3ZYIA 3E9UA 1QUNB 1AGDB 1XF5B 1MF2L 2HP4A 2RCVA 4QNPE 3B43A 3MGTA 3GUTA 1A6UL 3PWUA 3ECVA 4JPRA 1CFQB 4P4KA 4UI2A 4PBVC 3QXDB 4HOWA 3RI5K 3GHEL 1M7DB 2UVFA 3FQXB 4R90L 1S46A 4WIQA 4PJ9C 1RUML 2GUOB 4PHXA 4GSDL 4RNRA 5E6UB 1BQSA 5BRZA 1JNJA 3MFGB 3JD2A 2PTVA 3SDAC 3U0PB 5KSAC 1OARH 3L5JA 4X5XB 4OZHE 2ZUQC 4MB4A 3CUPA 5HSFA 1OGAA 5KANI 3B8SA 4WF9V 1JG9A 4F5CA 4MVRA 4AILC 4NQEA 3ME0A 3INOA 4OLYL 3IPEA 5FLXN 5FXCH 5L2KB 4K3JH 2PR9A 1KV3A 2GBUA 3K6SB 1W6LA 3JZYA 5CEZE 5B1AB 1MXGA 2A7WA 2WTPA 1HHGB 1MHEA 2X9YA 4B6ZA 5EK0A 3A6BL 4DCQB 2DE0X 2QR4A 1U3HA 2UXCO 4KTEL 2BRQA 5JW4M 3UIYA 3BABA 3C8KB 2EDWA 1GKFA 3PY9A 3T9WA 1DN2A 2E8ZA 2WQAA 3NG5A 5D1XC 2QWRB 3QEQE 3NIGE 1NM9A 4L1LA 1MJUL 4Z0BL 4DERA 1KJVB 2WLZA 3TA3A 4Z77B 5B1CA 5I66A 3HS0B 4HBCL 2FTKA 1MREH 3R1GL 4PWHA 5CP3H 4IRZA 3ZO9A 2Y5EA 3KWUA 2FJHA 2VYRE 4GRLC 3EOTL 1SRDA 4NRXA 4OCYL 5L2KD 4BUQA 1MIMH 1PLCA 2C4FU 3IGUA 1S5IL 3OKNB 4PJDB 3SGDH 5HJGA 4FZ1A 1KBWA 4PCTA 4KKCC 2NXZD 4KO6A 4FLXA 1XH3A 4XMPL 2MW2B 3I9IA 1P4LA 3QIUB 3TC9A 1G7IB 3N2GA 1GM8A 3MHHC 1A7RH 2G3XA 3DMMA 4YE0A 5GS0D 2YSSB 3VQMA 1B90A 2X2IA 1BG1A 3FB6C 3W9EB 4IOSA 2V2TA 5AVSB 4AXWB 4P9HL 4Y9EA 5E6YA 1F45A 1MCDA 5B1AC 2FYYB 4X1YB 4OIIH 4ETYA 1XHXA 1WC7A 2HWZH 2VO8A 4E5XG 4H2AA 4L4VB 3AU0A 4RAVA 4UTBL 3VD0A 3FB5B 3FMGH 1UEMA 1R34A 4LESA 2DQEL 4N2NA 5IHHA 1T0MA 2G30A 5AWNL 3U0TA 3JALA 2LTQB 3TO4A 1W72H 3QIUD 1ZD6A 4N0CD 1C1EH 3T08A 3B34A 1TQBC 3ESUF 1WPCA 1A3RH 2W60A 3I6GB 4JGUA 2OFQA 3KGUA 4Q6KA 4Z7VF 1RAMA 2VLKA 3OZ9L 3N27A 4MTGA 1TZ8A 2FGWH 4LFHG 4O51B 1YDXA 4QEGA 4Y4HA 4J5VA 3BAKA 1OSEA 4M62H 4AKPA 3P32A 1BJMA 1J7VR 3FOLA 4L4VD 4MQ7B 4KPHH 5I8EB 3ZUCA 3BKJH 1YF2A 1IBBA 4X0NA 1D5BA 5ANMB 5AW2B 3BUYA 3HHMA 1Z5YD 2CGRL 4TWKA 5AAMA 2A74C 2ADGA 4NCC2 4DGYL 3S35X 4NTXA 3CMEV 1NR1A 2BSRB 5TE6H 4F8TA 1MCPL 4NKMA 4JFOB 5D5MB 2DPKA 2P24A 2VITB 4NO2A 4NRYA 5ABZA 5IB2A 2BTQB 2IW5A 3OW2U 3MV8B 1NTDA 3E8BA 4B50A 1MRCL 3A6OA 4L2LA 1L4IA 1WPBA 2WCPA 2XA3A 2Q9OA 3REVA 3DO7A 3CZSA 1OV8A 3DETC 5F8QC 3VCLB 3BZDA 3U4BH 2LTQC 5FWRA 4ORGA 1EHLL 4FF9A 2V9QA 3ZHKA 4CC5A 3SEPA 4PJ0Z 2F53E 4HH8A 1IBZA 4PI0A 3BHBB 3WCYA 4JM0A 3N85H 2PI4A 3T0ED 2WSDA 1U6AL 1ET5A 3QZPA 2IEPA 3WUWG 4D7TA 2GY7B 4XNQB 2VR5A 3C9NB 2QQQA 2XA8H 1R6TA 5FYJL 3FO0L 2WLKA 1SMAA 2VDPB 3I2CL 5D1ZC 4WW1A 1F18A 4KMTH 1INEH 4LLMA 2A6JB 4Z8FL 1YNKH 2B4CH 5EPMB 2YEVB 4P46A 2O5ZL 2W5PA 2Z31D 5ITFB 1BSIA 4ELMB 5BJTB 4KITB 3RKDD 2KL6A 4X65B 7FABL 3TONA 3RDTA 4UXNA 4IBVA 5KYXB 2GPZA 2OMUB 3TCUA 4O00A 1A4JB 5C07B 1I9IL 1AHWA 1WE5A 2ALWA 3VM5A 3WGVB 3ARFA 1EJOH 1T04A 3WL9B 3QBTB 4AQ1A 1AY1H 1JN6B 3S8FB 2YUZA 5I5RA 3B7UX 4NZ8A 3U9UA 5GS1B 2NYYC 4XMTA 4B5EA 3KDMA 2GUYA 2D03H 4DZ8B 3NVQA 1HH9A 5GRYA 2A99A 3W56A 1Y74A 2QGDA 2RHEA 3O9WA 1A6PA 5EIBD 3PAZA 1MHCA 4PTUA 4G82A 4XWOC 1NI8A 3TVMA 2NUPA 2PYEA 1MHHA 5I1JH 5GW7A 4ZJ9A 3LS5L 3MSPA 4O4JB 1EN5A 5FO9A 4WV1A 4JJ5B 3BIBX 4L1DA 2NXYB 4GIAA 3O2DL 4XODA 1PG7H 2LQRA 4XVJH 4BZ1L 1BHAA 3CIAA 3EHBB 4LRIC 2VIRB 4OBRA 3BIAX 3VBBA 3CFDB 4YWGL 1U21A 4NO0B 4XMLL 5IVZB 4DZBB 5TISZ 4Z3JA 5JLZA 2PO6A 4XOBA 1MCHA 4R4BB 2C9XA 5LQBL 3U0WH 4NWUL 1G7QA 1JFQH 4HNAB 4MJ5B 4P0DA 5LYJB 3FRUA 2W0LA 5B7MA 5T3ZH 2VZ1A 3EUUA 5D7LD 4FLTA 2JK5A 1WWWX 1NCIA 1LILA 1SQ2N 4HJ0D 1KPRA 1ZIBA 2PYFB 4JMXA 4RMQA 3K46A 5G5DB 3R65A 3QPKA 5GS1C 4TVPL 1YMMB 3W9DB 1FC1A 2JKJA 3GZOA 3MCLL 3TBVB 5J1AB 2VMDA 2DKUA 1ZLZA 2QSAA 4ZFOB 5KBMA 3ZX6A 1A4KA 3EHBD 3CZFB 1UWGL 4PMEA 5L7XL 3RX7A 2HUHA 1JZ5A 4WK0B 3VA2C 1KD1W 2WWKT 4BDVA 4B7EA 4QRBA 4NO0D 5ENWA 3ZO0A 3RYCA 1U8MB 1VGKB 2WIIA 1XF2B 5I8OL 2P5OA 2SEBA 3EYSH 2NXYC 1F1GA 5I1GL 2XV2A 2W81C 3R4RA 2XV0A 2NSMA 5AL8A 1B4JL 3MLTB 4KTDL 2JWYA 1NSNH 2HKHL 4MAUH 4M3JA 5LCVL 2M2DA 3E6HB 2Y22A 3IGKA 4TXVB 4DVBA 3WTYA 3SYOA 1BVKB 1YMMD 2O4EA 4M8QB 3L1FA 4XVTH 4UQ3A 3EH5B 3M7FB 5DVKA 5PAZA 2R0WL 4QRQB 1U95A 2MPAH 2EACA 5IJVB 4MB1A 3B77A 3LY6A 1LHZA 5GRXG 5AAWA 3GSVA 4ZOLA 5MHSE 4KGLA 3RIFF 4G43A 3RYIB 5EIQA 1J5DA 1KCSH 5EBMA 3V0VA 5ACLA 3OJVC 4KUMA 1XGQB 4FFVC 4LCCB 1NEZB 1YEDB 1REIA 1Z9SB 4OFIA 4U4BA 1KWKA 3AS2A 4ZPTB 1HINH 4FNSA 3KNBB 1EAPB 4QAMB 4JG0L 1ZEAH 5CP7B 4K7PL 4XP5L 4ZUUA 1ZX3A 4OLVL 4ZI7B 5J8OA 5ITBL 2GCYA 1BZ7B 4OD2A 5K93A 3VXUA 2R1XA 1T20A 1P69B 1IAOB 2BVQA 2ITCB 2W9DH 5DFTA 1A1NA 5EWIL 5GGVL 2RNBA 4W70A 3FQNA 3TNNB 5CZVL 2PABA 5AZ2L 5DRZB 3CJHB 1GM9A 3OF6D 3VXPA 1E8WA 1S4IA 3KVQA 3UMNA 1AE6L 4F20A 4TV9B 1FNFA 2X2UA 3NP3A 4XHJC 3BQVA 4XPTH 3BVNB 4XB7A 4ISVA 1JIBA 3WXVH 1EAOA 1QTYT 3ARGD 5AOZA 1YMHB 1FZMA 3EYOB 4K9EH 1GOHA 3MLWH 4U6XB 3S4SG 3VNYA 1I7TA 2VDNH 2R59A 4IBYA 1FC2D 1OAXH 3LXBA 4UTCA 3MCKB 1W0KG 3QVAA 1DVFA 1BIIA 4WDIA 1JD7A 43CAB 4MZIA 3CU7A 2Y69B 5G55A 4NQDA 5B39A 3NDZE 4PJCE 2ZOTA 3V4VH 4LCCC 2RTTA 3BRFA 2XV6B 3ECUA 1VFBA 5GSRA 1K3IA 4X8JB 4L4TE 1N70A 4N90E 3VTMA 1IBKO 4MNGE 5ISZA 3K71B 5DI8B 5E8OA 4I4TB 1BFOA 4N2CA 1QO3B 2LGWA 4M7JL 4EI6B 4R97B 3EDKA 4W9IC 3QVNA 2WZ0A 2P6JA 2ZPKL 1QSVA 2ADFH 5EU3A 4F1SA 1WP7A 3BSZH 3H56A 4MD4B 3V95A 3LN9A 4EDWL 3MRQB 4KFZC 1UJ3A 3PCYA 5GZNC 1RZJH 2C3VA 4S1QL 2YC1A 2R0KL 2JDIG 4YPGA 5TDOB 3J81N 1GHFH 1RIHL 4Q6IA 3OTOB 2I60H 3PPSA 1Q94A 2IV9A 2CBOA 3GSUB 1TEFA 3MMEB 4QRPE 3CCLV 2FHCA 4YDVB 3U4EA 3ZLQC 2JLPA 4XC3L 5MENA 1Q81W 4E4EA 5IGXH 3B6SB 5KLVH 1H8HG 1NVPB 3K0DA 4XVSH 5G4NA 2AC0A 4ZUTB 3B5HA 3R8QA 1NCTA 3RX9A 3MYZA 2VAJA 3K72A 3LZPA 5EO0B 2CRYA 1ADQH 4K5MA 4H8VA 3RBSA 1DF5A 4FG2A 3RA7L 4YQXL 3O6FB 1YLBB 3F7YB 1G0XA 3QR1A 3DX0A 4I2XA 1AG6A 3HG1B 5BUGA 4QTHB 5IYBO 3IU3B 4HSQA 5IF0B 5B39G 3VACA 1UM4H 4H26B 4ERSH 1KENH 2G3NA 4L8SC 1U9KA 5GHWH 4GXVL 2Y1ZA 5C0BB 3WIIH 4Q9BA 1XCQA 2ZUWA 3L5XL 4HIJB 3V7AE 1B0GA 1CFTA 4AW4A 4MAZA 2O61A 5HHOB 5FV1L 4AVHA 2O6CA 5EO1A 2UUDH 1HCVA 5EDXA 5INDA 4HGWA 1NVPD 1UT2A 3Q8EA 4R97C 3AB0C 1KJ2B 3BP7B 3B5TA 4MD5A 4R8CA 1M2VB 3Q9QA 4Y5YB 3MDSA 1QRNB 4FL4B 4UCTA 3O6FD 3HG1D 1FH5L 1ZJAA 5IHUL 2VDLB 4UV4L 3POHA 3EO9H 1NQTA 1QLEH 1HNYA 1LUWA 4Y7OC 4OCMC 5C0BD 3IGAB 2DD8H 3CB2A 4L9LB 4X20A 4EAEA 2KKWA 3AG4C 4XNBA 5HHOD 1KLGA 1EXUA 2Y48A 4HIEB 1XF5A 1ZY9A 1OAKL 5JW4R 2CHDA 5HJDA 4YJ3B 1KN4L 4IRSD 3FB7A 2WNGA 3QEGH 3ABKB 4CSZA 1FSKB 2ICWJ 3QXDA 1O5DT 3SE9L 2VMCA 1E5UI 1M7DA 2F0CA 3HA0A 3QDME 2DM4A 2OCFD 3IMRA 2KSDA 4LXFA 1QRND 3HNTL 5DWUL 2IGFH 2YGOA 5GSVA 2KT6A 3VFVB 3U0PA 1X9UA 4X5LA 3NCBB 1QYGL 3TO2B 1ZV2A 4R7NA 1L1FA 2YAQA 1PD3A 3OAZH 4N0UB 5DC4B 4CNIB 5L2KA 3CHPA 5DHYB 3K6SA 1RU9L 3RAJL 1A7PH 4KY1L 2DQFA 3IJYA 3V6ZB 3QRLA 4FFYL 5HI5C 5BUPA 2QDWA 1E4XL 1Z5WA 3FT4B 4R4FL 2J8HA 4X8GA 1DQVA 4HWEL 2DMGA 1MLBA 5D8JL 2JKLA 4PWKA 1F1AA 4F6RB 3RRQA 4AOFA 1ASOA 4YLQT 1K6QH 5DD0L 1DBJH 4M6NH 2Q76A 3GB7B 3RJQB 3B7TA 4EVNA 2YIAA 2FBJL 1FE8L 3CSPA 4OD3H 1FS0G 4NB5A 2YK1L 2P22C 1IUZA 4R7VA 1NTZH 1M7XA 4BINA 3WN5A 5C7XL 1QR1A 3MFFA 1OLZA 3I6LD 1N5AB 4P4RA 2PY5A 3QUML 3Q6GL 5SWZB 4K07A 2ITDB 3NGBC 1M6OB 5EO9B 4FA8A 5FYLL 2LFEA 1HHHB 1M7UA 5I1HL 4NQVA 2YAPA 2DQTL 4ABVA 5D9SA 2XWCA 2NCMA 5T3ZE 4KHPO 4J6RL 4L8BB 1WD9A 2OI9C 2XG4A 3NJJA 4NZUL 3FKUS 2DRUA 1YEIH 3FFDB 1N6VA 1OM9A 1W80A 4N6RB 5D2LE 4MD0B 2I9LA 2XJLA 3UCRA 3LZFL 3MNMA 2CHWA 4JI2O 3N9GL 4MXVE 2IDSA 1KPVB 6PAZA 1KGYE 3THMH 4A6YA 1BWMA 3DV6A 4Y16C 4I5BA 3B7SA 2J55A 4XAKE 1ZLWK 2IQAA 5SWZD 8CGTA 5I76A 4WFHE 4PGCB 2FATH 3LEYL 1KNOA 4BH8B 1KBHA 3QUKB 4NPKA 5LUMA 5CWSA 5KAQG 3ULVC 4J7JA 1HZHL 1SDDB 1YNTB 1MJJA 4PUBL 4P5TD 5DC9B 1U30A 1IBDA 1CZ8H 1LO4L 1J9RA 5CR8A 1JV2B 4OJFH 3FN3A 4N0RA 5HGHA 1D5ZB 4HSAC 3VTAA 2ITDC 5HJ3A 3VWJB 4HYOA 1O9GA 1RFYA 2DOSA 1NCBH 5FM8A 4A7GA 5I8EA 1BAFH 3T0AA 1QW9A 2F53A 2MQCA 3IFNL 4MQTB 3TZVC 1J0HA 4JZJC 4MWFB 5HPMB 1R1BA 3C5ZA 3X2QB 4QYOB 3TN0B 1XL6A 5ILTL 3T0EA 1DQQB 4IT5A 1GZQB 2YQBA 2F4VO 1HWYA 3FQUB 2HFTA 1G4MA 3MJ7A 1XUQA 3JAWB 1RJZB 4FI6A 1I8KB 5TFSL 5DEFA 3MV9E 4ZUWB 3WO3B 3RGVA 1Q5OA 4CH3A 3HG3A 5IM7B 2ITFA 4PBXA 3KH4A 1Z2KA 4BK5A 5DTFB 4TLTA 5E8DH 3CC4V 2M8XA 1B2WL 2ICWB 3KEHA 2OMXB 2E6QA 4YHPA 2Z31A 2X6UA 4XB8A 1BMFG 3VXRB 4FLVA 4IMLA 5IY5B 5ICYB 4G42B 4X5WA 1K33A 3HI6L 4PGBB 5DEJA 3O65A 1IVSA 4M29A 1C16B 1PY4A 3GJFH 4NERA 4U7SA 4J4PA 2I32A 4LO9A 2CTPA 4YVNA 1VAHA 4YGVA 3BLBA 3VWJC 3E22B 4AGLA 1NCCH 1MZEA 3WFBH 4DR3B 1SNRA 3QYCA 1WLEA 4J80A 1HP8A 2CIKB 2VH5H 3F3HA 2VC2B 1HJCA 1V3KA 3AXLB 4JFYA 2BK8A 5EPMA 3TN0C 2YEVA 4ELMA 5ITFA 1FL5B 1XGUB 3HMXL 5B1KA 1BZDA 4XCNB 2AJYH 5CSGA 1MG3C 3VFGL 4ZPVA 3OC8A 1ESOA 2W94A 3RIAK 3VFNA 3WTSA 2OMUA 1A4JA 5JHAA 3W7XA 2YXFA 4HV8B 5KMGA 3BP5B 3QA3B 3VI3E 4W9CC 3WL9A 1HL5A 2ADIA 3WO4B 4BUHA 5DS1A 5TE4L 4UVCA 5EOCH 3T2QA 3MGOB 2YXHA 1DFXA 1KZYA 3DX6B 3UO1H 3EBAA 2WZPD 5IY5C 1QCEA 4H8QA 2XUMA 3DRTA 4MJ6A 4G3YH 3FYIB 4DUYB 1MY5A 3OGOE 4ZS7H 1OP3H 2H2PD 4Z7QE 4LSQH 4P57B 4M7ZB 3ZSSA 3EYVA 3Q9PA 4QXUL 3IJHB 3JD1A 2X2JA 1Z9LA 2C7UB 5E08L 2P4VA 3MODH 1LDPH 5D7LA 4O4JA 1A7BA 2ZKHL 4PV1C 4F2EA 3VJ6A 1JCKA 3B2MA 4JJ5A 5GRVL 4AUYA 1W8OA 2HLAB 2CA4A 4E42B 1E9OB 3CC1A 4I8DA 3V5KB 2XWRA 3CX5K 2VM9A 35C8H 1IT9H 3VFUA 4GAGH 1OCRC 2BSSB 5EZLA 1OQOA 4UT7H 4QGTA 2BXYA 4FZ8H 4XXCC 3LRMA 1ACZA 1G1OA 1HW7A 1WJZA 1VZHA 4GRMA 1D5XA 1X4TA 2WAHA 1P7QA 2ZCLL 2CUGA 1FIEA 15C8H 4OJYA 1P6FA 1CU4H 4JRFA 3RPIB 3N0AA 3WO4C 4V1DD 1VQMV 5IW3A 4YMPA 2BSCA 3C75A 5FW7A 5G5DA 1PCSA 3PU7A 2BVYA 4QNPF 3NSCA 2GG1A 3I9GH 4XBPA 3NFSL 1I08A 2ZXEB 5IWLA 1P7HL 2E0PA 3I75A 4PRHE 2ROYA 3CZFA 1SQGA 4I9QA 1M4UA 3B2PA 3FAVA 3ZE0E 4RGND 1DJXA 5IP4A 2HH0H 4EN2A 1F2QA 2Y36L 2NQDA 2Q6WB 2W0FB 2GJJA 4TV3A 7CGTA 3DJSA 3KBEA 1MCIA 1QWNA 2CLZA 3QPXH 3QWOA 2VCOA 4I50B 2EDKA 4HSCX 5ALCH 3K57A 2PXYD 4ZAKB 4PJXE 1GC1H 4Y9GA 4HT1H 3ZKND 2ZUXA 5I1DB 3U0ZA 3E6HA 1SLWA 2KC0A 4HS3A 5FPRA 1LJMA 3NJHA 4GKNB 5EU4A 5KW9H 5LLIC 1XGYH 3VG0H 4NENB 3G5XB 5JIPA 3KPLB 4MVOA 1VQKV 1H8SA 2HJLB 3BKYH 2UUAB 3DBXA 3MV7B 3L16A 5CP3A 1TJHH 3NIGF 4QRQA 2M6YA 1PZCA 5ANHA 4GX2A 2GK0A 3U48A 5DZLA 1EZLA 2MK3A 1US6A 3GIZL 5HHME 2QMJA 1BFVL 1JHKL 2X4OA 4PEEA 5GZOA 1GCYA 3FO1A 1QLFB 1F4WH 1YEDA 1Z9SA 1A9BA 1IGIH 3ARGA 1B4LA 3N44F 3Q5TA 4MNHA 4ZPTA 3X3FH 5B1JC 3EF7A 1T7XA 1GTOA 2VJXA 2Q7HA 1FAFA 1ZS8A 4LSVL 3VGHA 1YAIA 2DWEB 5F7EL 2QLYA 3QNYA 3TF4A 2BMKB 2NT1A 3M1BB 4HX1B 2IJIA 4ZI7A 3D18A 4NT6A 3ZMRA 4JM2F 1AP5A 1BZ7A 1ZSHA 3DGCR 3P0VL 4PJCA 5C08B 3ELAT 3EGDA 2GYSA 3F7KA 4MXQD 2ITCA 3MV7D 4LCYA 5L8KB 3VFTB 3L75H 1LGVA 3ZK0A 4POZC 4GXUM 2DWSA 2ZWYA 4ZAKC 3A22A 4U3JB 4MNGA 3PRZA 5JQHC 4AQ8C 2R51A 2BSBA 5DRZA 2Q8AH 1FZOA 4LSUH 3KZ8A 3NCXA 2I25N 1NC2A 4HXBL 4PJ8B 4TQEH 5FW6A 1TKWA 3DX7A 2BDNH 2JXMB 1R5IB 1YMHA 2V5RA 1SBSL 1W72A 3PHAA 1IJ9A 5C09B 5JW3L 3KXFD 3T1HO 1JPFB 2B2XL 3EDDA 4PV9B 1D9KB 1KBBA 2XKUA 3X13A 4B3RB 1QWHA 4QRPA 2E9BA 5C08D 1UVQA 3ARYA 2AQPA 3L5IA 2FLBT 3S2AA 4NP4H 4MA7L 4O2CA 4TULL 1NEZG 3MLSH 1U33A 3ZMVA 2XKNB 4R84A 4Q0XL 3D36C 5J3HC 2UXDB 3N2KA 2QVMA 3GK8H 4HAGA 4M03A 2Q1EA 2X44D 3NAAH 5MEQA 3Q5OA 2BIIA 1AD0B 3RWJA 3S2CA 4M1CD 4PJ8D 1NAKL 3ETBF 3OHMB 4Y5XB 3QFJB 3OPZH 3VX0A 1PG7X 4I55A 4NXMO 1ZE3H 2BWIA 3SE4C 4TUOA 4QWWC 5EF2A 1D9KD 3IC9A 1Q38A 1W59A 4OF5A 3G6EV 1CL7I 3C6LA 4HWBH 2N59A 2CXGA 4RGMB 3RX5A 3IJ4A 2X0UA 3MLXH 3GSUA 3K59A 1A2YB 3IU4L 2X1XR 4PREB 4ZX4A 3ZHVA 4OFPA 3WHXA 1CFVL 1N26A 3GLEA 1GIGL 4QJ4B 4ZD3L 1R3IH 1XH2A 3OX8B 3QORB 4QD2E 1UM5L 3X1GA 1CDJA 1YC8A 4E2OA 3ZRVA 3FQ1A 5IFAL 1W0JG 4NX0A 1SLUA 2UXTA 1WHPA 1Q7YW 3QFJD 3LKNB 5HDRA 1V9PA 3FS9A 2P47B 4WTXA 2XT1B 4HC1L 3EJZD 5CBHA 2CBTA 1SXNA 5JXEA 4HIJA 2WIMA 1YJ9V 1AIZA 1DVZA 2FT7A 5HHOA 2WXRA 5JW4Q 2A6DB 2Q7YA 3ZQ9A 1CYGA 3QJUB 4LEBA 4BIZA 5HYJE 4IRSA 4HPOH 4Y5XC 1DTOA 2E5LB 1BG9A 2K3TA 3CDZA 5ID1A 4V33A 2WW8A 3QDMA 1B0IA 2V4LA 4YXKH 5LG6A 1MLCA 1TO4A 1FAIH 3BP7A 1N18A 1DQML 3TWCL 1V7MH 1QRNA 2WO4A 5BMVA 4P2QB 3GBML 3BPCB 1BOGA 3SGIA 3MA7B 3MKKA 1I9JH 1XMOB 3QCTL 1JDCA 4XMWA 3IGAA 3MZGB 3HPLB 3B2EE 1XSKA 2WXFA 1CGUA 3IXAB 4MGXA 3ZDYE 1U96A 5CGYC 5D71H 5IQ7H 4KKBD 1RK1B 3WNKA 3SJBC 3MACH 1XDTT 2QR0B 3GEFA 4JAUA 3QORC 4HGMA 2DQUL 2X9XA 1AILA 3OAUH 5HHXH 4MMZC 1H8OA 1LMKA 1S9WA 4FFKA 3LQAL 2K9FB 4C4KT 1YEWA 1F4AA 3LD8C 3HC0A 4FXGA 5F44A 2EYRA 4ZX5A 1YEEH 2PF4E 1FFOB 4PJEB 2GSMB 3WFVA 1CVSC 5IZ7A 2NW2B 1VA9A 4FNTA 3LZNA 5GTHZ 3BAEH 3VB9A 1D5RA 4GYBA 4JO3L 4DFIA 5AB0A 4P2QD 1UWXH 3UP1A 2P9RA 2YFOA 4EZLA 3KZIZ 1A7NL 2E6JA 4EQ3A 2Z92B 4Y2LA 4N0UA 5KX5A 1TFHA 5K1JA 5I0WA 4Z0XA 4QRRB 3D87B 1QAWA 4UB0L 2Z7UA 3ZHFA 4XBGB 4XPFH 3V6ZA 4Y7MA 4PPTA 3IDMB 1INQB 4R5TA 2P90A 1CTNA 3IAQA 3ZBHA 3EXJA 4KRPB 5TJWK 4WEMB 3TXSA 3II3A 3NJNA 1WYJA 1JNNH 3D34A 2WPDG 1F3JB 1IFHH 1IBGL 1IVTA 4Y1AE 4HUVA 5JCOC 1NJ9B 4NNPL 3SE3A 3WUZA 3H3PL 1BSMA 4AE1A 2DMXA 2OL3B 3SCMC 1T5KA 5J6HA 5IT9N 4YHML 32C2A 5IREA 2ATKC 4AIEA 1NBMG 1LM8V 1ZAGA 4N8VA 1DBKL 3TBWB 4AYID 4F7PA 2Q10A 3K1KC 1HNWB 5DA0B 1VQ4V 1TPXC 3OAAG 1ITBB 3RWEA 3DPBA 3NACH 4WFHA 4JHAH 2YD1A 3LH9A 1YYLL 3WXWH 1AO7B 2CMRH 1VGEH 1WV7T 3Q2LA 5DFVC 3LUTB 4WF7A 1I7ZA 2ERJB 3FZUC 3CHRA 5EA0L 1TZGH 2AJ3A 4QI3A 1MFDH 4PGEA 4ZBMA 4HUWB 4KRPD 4LH7A 4OZGB 1WB7A 4H20H 1XL4A 1XAKA 4BKSC 2K4WA 4P5TA 4KQ0A 3MRNB 2XAFA 1IGJA 3HCVB 2G2NA 4KXZH 3UROR 1NMBH 3HNSH 1CDHA 3CN1A 4AG4L 4EN3C 4EXPX 3S3XA 2AZUA 4JAMA 1EHNA 4K8RC 3AG2B 5E23A 5JW5B 3BZEA 4AUJA 2Y5QA 3I50H 1J5OH 1A4CA 4IBZA 1HR0O 2RMNA 3CSBA 5DUPH 2WLLB 1AO7D 3P1VA 1SVZA 1NKGA 4BH8A 3MV9A 1LO2H 5A2KH 3CVIL 4JPWL 2WWKO 5AZEH 4GUQA 4LBEC 1IQWH 3DIFA 3D06A 5FGCE 3LHPH 1T66C 1J88A 4JZOB 4Y4FA 5T3XL 1J5CA 3U4AA 2OZ4H 2CJUH 2Z65C 1JV2A 2X05A 1IGCH 2BC4A 2XNAA 3FTUA 4W9GC 5CIPH 3V0AC 2F9BT 3CEIA 2D0GA 2KDYA 4OAWB 5FGBC 1DK1A 1DR9A 1VFUA 1XD1A 1DZ0A 2E9JA 4PIRF 5DEGA 3HKEA 4N23A 1AGFA 2FX7L 3QQ3B 3LDEA 1YHQV 2UXNA 4IGGA 2Q5ZA 1J05B 5IG7A 2F1AA 3CZNA 3FTSA 5LNGA 3V0JA 3ERXA 4XN1A 1IGYA 3UTTB 3JAWA 2V6HA 1TJIH 3GMNB 3QEUA 3P73B 1TTCA 2Y7QA 5L8JB 2HRLA 2JQMA 2FO4A 1DL7H 4OGAD 3TIDB 1NANI 1P5UA 4UM9B 4JN2B 1PZUB 5CZRA 1MFVA 3D69A 1TUBB 2OMXA 1MIEH 4MQXC 1BQLL 5CAYB 3VFMA 4ODVH 3KM2A 5B3SC 1MG1A 1RUKL 2AAAA 2HT4D 4HULB 1G9MC 2GJPA 5DGQA 3T3PE 1W0WA 1JE6A 2J5LB 3GXPA 1MDAA 1LO0H 1TJXA 4LARH 1FHGA 4UYQA 4CGUB 1U8LB 4P5KA 4PJCF 5F1IB 3SOBL 3Q1SH 1AQMA 1ZTEA 1JDAA 4G8FB 2FJGB 3BMWA 2D7TL 1QEWB 1A6ZB 4DV4O 3BSZA 1JK8A 4ZXBC 3AC0A 2C3HA 4M7LL 3RNQB 1XNRO 3AXIA 3G6BA 4R50A 1EZVY 2WZPA 3WMSA 4A38A 1IGML 3EXLA 3BRCA 3MUZ1 5IHLB 4PJBE 3K8MA 4WHYH 4UM9D 4KO9A 5EIVA 5I6OA 3AXLA 4EJ1C 2DLHA 2ZE6A 2VQ4A 2VL5A 2EDMA 4QRSB 4CADB 4BCZA 1MF2H 5CCGE 4ZSOA 4IKNA 3GHPA 4GKLA 4GSRA 2H0PA 2XVKA 1A6UH 3FCGA 1M90W 1O7DC 1T4KB 1ADQA 1AXIB 4F8PA 1UFIA 4FHKA 4L3CB 3JV4B 2UY7A 2GABA 1RUMH 2RDCA 3D3VE 3CQFA 4GSDH 3BP5A 4JQVC 2DWTA 3NJIA 4KUCD 2OMYB 2VGLM 1H19A 5F1SA 1SXCA 3MGOA 3WS3B 4WFGE 4PP1D 4F93B 2Y3AA 3DC5A 1ES0B 5CJBA 3B7RL 4GAJH 5EFIB 1D6VL 1LL1A 2J5LC 2FH8A 1C5DB 1GYWA 2CK0H 2WYIA 3L1EA 4C83A 1BGYH 4MJIB 1CDGA 2BHFA 3AT8A 4FVMA 3D6GA 1U41A 3IE9A 4S1SL 4V1DA 4YVUA 1S3JA 5GTIZ 1KEGH 1RKRA 1WISA 3FOMB 2XKSA 4KTEH 4OIFA 2V37A 2YAMA 4K3DH 4B3MB 4Q9RH 2WINA 5CJOH 3VDBA 4Z0BH 4KK5D 4MT8A 3KWXA 5EIIB 3JTTA 1PNLA 2WO3B 1UUSA 1ZTXL 3GXIA 3R1GH 1EZUA 3LNFA 4QRTB 2V2WB 1G7PB 1CDBA 3TH2T 3OGIB 3MLYL 4OCXL 2JJ1G 3ARBD 1M9SA 4IDJH 2CTWA 4PJXA 5L88L 3DVNB 2UX6A 1E6JL 4WTQA 4DIXA 2PXYA 3BVXA 3CSYA 1Z9OA 1PSKH 2EECA 3RVVC 8FABA 5BZBA 2J71A 4FIPC 3BX7C 2AQRA 4OJDH 3VM7A 3UPRB 1UHVA 1SXBA 3BSGA 3VFOB 3GKWH 4XVOA 1FXKC 4X1IB 2JJVA 3LSOA 1Q6HA 4X8AA 4P23B 4P9HH 3RB7A 5K33A 2C9QA 2AJVH 3EG9A 2CO6B 2V33A 4FI8A 3WEXB 3JWNG 4DR7O 1VQNV 4UTBH 3CVCA 4IMKC 5EB9A 3K6IA 2DIAA 2XTJC 4C47A 4C57C 4DNLA 4J2XA 3W57A 4DV1B 2X4PA 3CYOA 4LAQH 2DQEH 4QCIB 3HPJA 5GGSB 2VSMB 1QOKA 5DC2A 1QABA 4Q4IA 3ZL4L 2A38A 2LU5A 1NBYA 3NIDB 2P5EE 3QG6A 4IK7A 3GZPA 1SZNA 2R2CA 3TLRA 4QPKA 3ZL1A 4XRCB 4Z7NB 2DZEA 1KYOK 1EPFA 4ABMA 2CRMA 3M7MX 3NJKA 3PGFH 4P23D 3OGCC 3P9WB 3I02A 2WLYA 4FCHA 3V0IA 5EYPA 2CPCA 4JI3B 1AP2B 1IGTA 3EGSB 5DSCA 4PJAE 2FECI 1J86A 1O0VA 2K8QA 4XVUC 2EDJA 1DN0B 1JERA 1GPOL 2W88A 2CGRH 1KFAL 1QLFA 4QHKI 4XBMA 4JI7O 4KI5E 4I1RA 3LNIA 2NNCA 1MRFH 1CFSB 1ZK9A 3HZYB 3QIWB 3IDYB 4U1GB 3VRJB 4D0DB 4DGYH 1S72V 3KXFA 1HYRC 2VAAA 3B56A 4O02B 4KTGA 5B38A 1E1RG 3B37A 5JZ7C 3JAKB 1BMZA 1JTOA 4ZO8A 4I1NB 4KAQL 5JWPA 4KDTC 4JTCB 5LA6B 2F5BL 1KDJA 2VDKB 5C97A 3QO0A 4CBZA 1YNLL 4O4IB 1MZYA 4HIIA 4XN2A 5GISH 2DH3A 3L2NA 4POUB 1NCWL 4X9GA 2ZT9C 4GBXD 5HY9A 4ECNA 2ZX9A 2VLJB 2YXVA 4AZ8B 4LSSH 1R0AL 4N2OA 3TNMA 4M1DL 2AVGA 4DP4X 3ZRFC 4WWKC 4MXVF 3ILDA 1KKCA 4O2FA 2A9CA 2EVJA 1R5IA 3QIWD 1GGUA 3ZJAA 4Z7WA 5SWSB 5D4JA 5DHVH 1FNGB 4FFTA 1SGKA 1YG9A 4PS7A 5HDQL 1HWWA 4L3EE 4K5OA 1DJSA 3FO0H 1VF6A 5L2JB 4GAAA 4NKDA 3I2CH 3MLPA 4BQ6A 1JWUB 1GKEA 2H26B 1F4XL 2E7DA 4NUJA 5C0CE 1RURH 4DP5X 4Z8FH 3WKML 2O5ZH 2XKNA 1JXKA 5T5NG 3C12A 3WS6A 4LB8A 2VLJD 6PCYA 3ZHTA 4PY7A 1S9YB 1IC7L 3ALXA 5B38G 1UM6L 3VXTA 3GRBA 1UWEH 3GM0A 1AQ8A 1Z9MA 3MREB 4MJ4A 3TJHD 1I9IH 3IRPX 5SWSD 1UCBH 1WA8A 4M9OA 5EZJA 3O6KH 3VO0A 2Q67A 5J57B 2ZICA 2VQEO 4NZRL 1MPAL 1WN7A 2APXA 1A1OA 2JJTC 1HESA 4W6XB 3IPFA 3L3GB 1KYFA 1SQMA 3QJZA 3GMLB 3I9PA 3SD5A 5D1XE 4OJEH 2WNKA 2D0HA 4QXTB 4JANA 3GS0A 3CVHL 3LRSA 3CPLA 1EN6A 2Z3YA 5IJ9B 1HOEA 2ENQA 4X80H 2ESVE 5D6CB 3PXJA 2QT6A 2BOCA 2NX5E 3X1BA 4LF7B 3GJFA 5A1AA 4A2DA 2XWJB 4L37B 1P84F 4DV0B 1JGVL 3W2DL 5I30L 3NTCL 3U7WH 1L5GB 5J13C 5CNHA 3V9FA 1WBYA 3BO8B 1XGPA 4HIXH 1TTFA 3K6DA 4XMLH 1X44A 3ML0A 5MP6L 5D70L 1NMAL 3C87A 5GS2H 4MJHA 5JHDE 3B9KB 2EEBA 5LQBH 2IH3B 3MLRL 4WVRA 1I94B 3AQYA 4OLWH 3ALPA 4D9RD 3JWOL 1D5IL 4I48A 4G1EB 3QHFL 4IU2B 1NAML 4ACPA 2GJZA 5F7KC 1IRAY 2CGOA 3RZWA 1SOSA 4UOW0 5FM5M 5KA6A 3U1PA 5C93A 3FFCB 1KUQA 3RVTD 1EXGA 5K9OB 3MCLH 4N2BA 2X4UA 1RSFA 2BNRD 3MXVH 5EN2A 1HE8A 3VE0A 1YIJV 4B3SO 2BY2A 1U4EA 4ZFZB 4R83A 5L7XH 3U10A 4IYIA 1QSFB 3ARWA 3NEXA 3V5DA 3VI3F 1WA2X 2G5UA 3IXAA 4HJGA 2Z4QA 4XCCH 5K5YA 2CKNA 4X89A 2QR0A 9CGTA 4I3GA 3SGDI 5IMMA 3ML9A 1NT2B 3T4AA 3UPAA 3B9KD 5B4MD 4ZFFB 3IETB 2JTDA 1M05B 1X9QA 4XZ4A 4KTDH 4HAFA 2XSKA 3D85B 4N2GA 4Z3TA 4WBNA 4Z7QF 5H9CA 3LN4A 4R7LA 1FFOA 4PJEA 3GD1C 3L1GA 4PJDE 5AKSA 3FFCD 4MMXA 3K1DA 2CR3A 2QBWA 1DSFL 3BH8A 1J9TA 2PPFA 5AENA 3OKEB 5CILL 1QSFD 1TQCC 3FQ2A 4Z76A 3LKOA 1OD9A 2FEJA 4XC1L 3WE1A 2YRLA 1YYCA 3A21A 4NBXB 2O26U 1XF1A 3OR7B 5E94A 2NPLX 5E9DE 5E2UL 4JFWA 3U83A 4QF1A 2Q68A 3D85D 4LQFL 2B0SH 3WN6A 3LKQA 3EFOB 4NZJA 1XXDC 3PQYE 4JUSA 3HUJE 4K7PH 4FQHB 2Z64C 4OLVH 3VRIA 4BXSV 4ZMLA 4PFEA 4AYSA 3NJFA 3DC6A 4FRWA 1VQ5V 3AMLA 2PW1A 4L2YA 3QO5A 1MRDL 5C70A 2L7UA 1ZT7B 4YEFA 1IBYA 5C0ND 5EWIH 5GGVH 2Y6TE 3VMPA 5C0EB 2B9ZA 3EOAA 1A21A 5AZ2H 5E95B 3UQ8A 3ZE0F 5T1KA 1FI8C 4DN4H 1XXFC 2BVUA 2OTUB 2FVNA 1PKQB 3OXSA 1AFVH 4OZGA 5I5IA 4PJXF 2C1PA 3HR0A 1FNHA 1U2HA 5TQ0L 3MRNA 2YICA 2E3VA 4LASH 3ZTCC 1MI5B 3A4EA 4CVUA 5D5ME 1ECYA 1S3KL 4IIJA 5C2BH 3NCCB 4PWJA 4XN7A 3CU1A 1N34B 3QIBC 2DQMA 2WMPA 3MV8E 4OW6A 4ZUVA 3UAJC 3FONA 3UJTL 1MZFA 5D7HA 3ARUA 5EBLA 4FX5A 2BNQE 4ZOEA 4YXHH 5L4FA 2H6PA 2JB5H 3F12B 4DESA 4ZNEE 2WLLA 1BREA 2VLLB 4A67A 3MJ6A 5C9JA 3GRGA 2QQKH 2VN5A 4KGJA 3G3LA 4LNUA 2EINB 2DL9A 3U9WA 5EUKB 1J0YA 3SPVA 5KVEH 3VXQA 2EC8A 3EO0A 4I88A 5I75C 2ID5A 2HLFC 1HHKB 4H2CA 1FL3B 2FD6L 3HR5B 4HUXA 5DDHB 4ALAC 3QG5A 1PEWA 2AJZB 3RYHB 2R0KH 4PMFA 4UDUA 5B8CC 5AG2A 1U8NA 3KYKH 4XAWH 2UXXA 4OAWA 3L9DA 2H2SC 1GYCA 5F2VO 1A47A 2KPWA 1UOLA 2WPGA 2XY1A 5KVDL 4DR6B 3QQ3A 2Z9TA 4CH6A 3E2EA 1UKQA 4G6KL 5DQJA 1A66A 2A9BA 3H2PA 1QD0A 4J3SA 3ISWA 1T22A 3OKMB 2P44B 4POYA 1KEML 4JDZA 3VWKB 1COBA 3MDJA 5L3CA 4N24A 1XF3A 3ABLB 3LIUA 1FL6B 4PJBA 1KGIA 4QHNB 4NFDA 6TAAA 4HQQL 4UM9A 5C07E 3SDDA 1HCZA 1T89C 2CNZA 2HJFB 3MUGB 1U8QB 5J11B 3ZRXA 1C5CH 5LMNB 3FHEA 3NZUA 4J28A 1RJCA 3FT3B 3AM8C 4F33B 1OAUL 5HTSA 4M7KL 2VUKA 3ZTNH 4RFNB 4LHJB 4J1UA 3MBEC 4RFEB 4LVHB 3WIHL 4DAGH 2FJGA 1RZ8B 3QDGB 1WBZA 4PDVA 1DVTA 4Y19E 5GRJL 3QQ9C 4IGBB 1A6ZA 2PWDA 1HNGA 3MBXL 1FH5H 4JY5H 4AX3A 1ORQB 2CHXA 2OKMA 3NP4A 2X10A 4UV4H 5IQ9B 4FG6D 4K3HA 4N28A 3F7VB 4P3CH 5FYJD 5I15L 2FEDC 1F58L 3ULVH 4Z7WF 3CCHA 3EDEA 1BGXL 4PG2A 4XN9A 5AW9B 4Z23A 1IVLA 1F0LA 1E27B 3TPUB 1OAKH 4CADA 4L48A 3LKSA 5C0AB 3QQXA 2X12A 4S1DC 2R7EB 3PL6B 4DR4O 1YPZB 4Q2ZB 3LQMA 2E75B 2LLNA 3VWKC 4NHUB 1IBLO 1OTUD 4LPXA 3V4UH 5HDWA 3BH9A 3KCPB 3A0HZ 1H2GA 4I0XA 4PB0H 3NFNB 4PTTB 1Y18A 3LZQA 2H32B 4QHUB 4ZMNA 3QDGD 5DWUH 4FABH 2ARJA 3SE6A 3CC2V 1RUQL 1MJ8H 3M17A 3ML8A 2HT3D 2QKIA 1PMYA 3T8VA 4RISL 4AE0A 3BXNB 1YMME 1EA9C 4ZX3A 3ARBA 3QULB 4ES8A 3LZRA 3P9LA 4RFNC 3SDYL 2XC8A 5IROC 3RJDA 1B3IA 1QQCA 1WEJL 4FFYH 4N2KA 5AUMA 1FO0B 1XF4A 2R9IA 4DV2O 5C0AD 3EBHA 4R4FH 3GMOB 4XN8A 2FJUB 4IGBC 3ZOAA 1RHHB 3TEYA 5LDUA 1CGTA 4M3KB 5JOPE 3MUY1 4Y2OB 3K2UL 3T0BA 3V4PH 2N74A 3NRPA 5IBTL 2WVVB 1G7LB 1XGRA 2J43A 3WY3A 2XN9B 3ZQWA 5EIIA 1JYXA 4FLWA 1FE8H 3IFOB 2WTRA 4OFDA 1CB4A 2ZUYA 1NMCB 3I6KB 5I5JA 5IVXB 2EVFA 4LPUA 1ZDQA 4UV7H 3PL6C 4XPBL 4MA1B 5CSZB 1NLDH 2CD0A 2XQBL 4MVBD 4FQPA 4F3FA 1KUMA 3O41A 4QXGL 5CZXC 3DVNA 1ETZA 4CU6A 2DEWX 1SFDA 5GS2D 2FLRT 2IIJA 4JB9H 4JFHE 2OCHA 5DMJB 3ZDYF 4H37A 2P5EA 1KTRL 4LCUA 5I17A 4FLZA 1AR1C 4FJ6A 4GAYB 1MW1A 3MO1A 4X4ME 4IRJB 4XI5C 1BQHA 2WBWB 4WQOA 1NUFA 2GJ6B 4J6RH 5DXWA 3MR9B 1LEKB 4LIQL 1JJUA 3JD0A 1MQKH 4LRNH 4PWEA 4KXRA 3CRRA 1TJMA 4NZUH 2BIPA 2XN9D 1KECA 2YSUB 2Y7SA 1S7TA 1JZHA 2HHHO 3FB8B 4HJTA 4PI2A 1AR2A 2HUEA 3JXAA 4MLSA 4WI4A 4X50A 2W38A 3WEXA 4EKWA 3ZMEA 5ADOH 2VZSA 1URFA 2IWKA 4XP4L 3H7BB 5F6IB 3EYUL 2PZSA 1QFWL 4UBDC 5C0RH 3F6IA 3IS1X 4HF5H 2HRPL 4UAHA 1YEKL 4QCIA 3QRGH 3QZBA 3VQVA 2PN5A 2Z1PA 4P07A 1FA4A 1WP8A 3RYMA 1I4FB 1TTGA 4OCLC 5EIIG 2RIKA 3KD4A 2MTPA 3KYOA 3GWKC 3NFPA 3FTXA 7PAZA 5B1NA 2GJ6D 4X9FA 3MHZA 3WFZA 2LAAA 1EERB 5E1AB 1ACCA 4PRAA 1T0NA 3TGXA 3PHOB 1OEZW 2ICWI 1SERA 2FX9L 2RJMA 4G5AA 4AYGA 5I6LA 2BY1A 5FO7A 1RI8A 4XDKA 3NN8B 2F7OA 4GBXA 5IW1A 3GF8A 2ZDIC 2WP3T 1PZAA 3O2VL 5KJRL 1BA9A 3RY6A 5HYSB 2EH8L 4EF3A 4NN6B 2MCPH 3F7QA 4IRJC 4KJQD 1DN0A 3Q01A 1VB9A 1QSEE 5ILTH 2VN3A 3QIWA 4D0DA 2WKOA 3HZYA 3TBYA 3IJEA 2G2RB 2WWMC 1ID5I 1T1WA 4HKBA 5CCHE 4KJPD 3S35L 4DV7B 3FB8C 4AEFA 1S2EA 3VQYA 1TO5A 1WAZA 1WHOA 2P46B 1NKRA 4GO9A 2DQJL 1N10A 5LA6A 3BP4B 5F6IC 1H3XA 5C0CA 1I3VA 2W07B 4DGVL 4Z7AA 5KBNC 3Q0HA 3DOSA 2EX3A 1B2WH 3DUHA 3II1A 3UTOA 4ATTA 3K5NA 1UPGA 1FPTL 1PL3A 1DTUA 2B59A 3BE1H 1IM9B 1TCRA 5KSAA 1HILA 4QO1A 4GS7B 1L9MA 2J21A 2EKJA 2XETA 1UD4A 2XZQH 3C6EA 3L3IA 4K5PA 2ZCZA 3ARSA 3WLWD 3RHWF 1YTFB 5HGBA 5SWSA 2G9KA 1HAWA 1GZPB 4KXDA 3TT3L 3UERA 5L4MA 1V7NL 1RVFL 1T7ZA 5C0FB 3I74A 1CICB 1MNGA 4WFFE 1XEDA 5AVTB 3DDGA 2OZ4A 2YMXH 4NN6C 3AJ7A 1UENA 1ED3B 3IKCB 4RGOH 12E8H 4J8RB 4N4YB 5CIPA 3C5JB 4JM4L 3BKCL 2QPDB 3HMXH 5LBSH 3LDBC 2KG7A 3AY4A 1IM9D 2ESVA 2C3WA 2PI5A 2B1AH 4KKLD 2UZIL 2NX5A 1K9TA 3PDOB 3VFGH 5T1MA 2AEIT 3BP6A 3IDNA 2CM6A 5ICXA 4GRLA 5AKRA 2WWNA 4K0KB 2NNAB 1YTFD 3MREA 5AYUL 1TZHB 3ROOB 4DKFL 4EI5B 3FD9A 3UC0L 3STLC 4PJIE 1F3DJ 4OCNC 3GSWA 3U2SB 2OR8A 2FTAA 1Q0XL 1HNXO 5JR1H 1BV8A 1CGSH 1CICD 2YZ8A 5KVEE 1UJWB 3ARZA 1KPUB 4DGWC 1RP9A 3F7PC 4R96B 3SB3A 4DK3A 4GS7C 3ZT5A 5CA0B 1MFBL 3B5GA 2Z35A 3QZWA 4U1JB 4ANWA 5JHDA 2XX1A 4RQQA 3RFZA 3C5SB 1KBVA 3FB6A 4QXTA 2DYPA 5GIRB 4ONHA 2W91A 3FFQA 2NY2C 5FPIA 2D3VA 1FLRL 4YJZL 2YAHA 3T2NL 1MMMA 2WB7A 2X4SA 3VGAB 3CE2A 2ZYHA 3KYMB 2F54B 3WFHB 3BEVB 4EI5D 1ZHNB 3WNPA 2BNRA 3DGGA 2F5AH 1COWG 2FB5A 2X0VA 4G59C 3P3YA 3FCTB 4XMKL 1WT5C 2RFXA 2I07A 5GONA 1YZZA 5KVFE 3BO8A 3VXOB 1GR7A 3L95A 3CN4A 4LNRB 5I0VA 3B2VL 3KL3A 1FZKA 4NNYA 3TYGL 5DFAA 3ZU8A 2BOBB 2D9CA 2F19H 2ZCLH 4LP5A 1K4CB 4AEEA 2IH3A 4JJHA 1T2QL 5IVOA 4PJBF 1AQKL 4OX9O 1O6TA 3L9YA 1IKNC 1X4ZA 4IU2A 4NM8L 3RWHB 2GIXA 3GMMB 4YBLB 3WEMA 5J89A 5BXFB 3PS6A 3HS8A 3W0WE 4K2UL 2VMEA 2HXAA 2Y1AA 4JZNA 3OHXB 4ZW5A 4B9YA 2F54D 4CU8A 3UTSE 1A7OH 3HI1A 2GFBB 4JY4A 1BAGA 4BFIA 2A74A 1QSFA 1DEDA 3J2PA 1ASQA 3FSZA 4N0FA 1EBPA 2J2ZB 3V0EA 4KUCF 1A22B 3U9PH 1TOXA 3ARDB 1NCJA 5E9DA 2IQ9H 3WU2Z 5CLWA 2V7QG 4D8OA 3ULVE 3FUNA 4ZW7A 2CCVA 4DR2O 5IMLA 1ASPA 2YMOA 1E4KA 3DX3A 3MJ8B 4PP2A 4DUZB 4DK6A 2QSVA 3PQYA 3HUJA 3EW3B 2ORBH 3IDIB 5T5FL 3ZYOA 5KBKA 4GG8A 3HIZA 1QHPA 4IOIA 1JUFA 4QOKB 3X14A 2H41A 3PIQB 5BO1H 4XN5A 1OCWL 4GUOA 4R8WH 3LRGA 4AQEB 4X4XB 3OJDB 5DJ6A 5F93C 4E41E 4P2RB 4ODSL 3NCFB 4N2EA 4YBLC 1RMFH 2A0LD 5IR1B 5GGRA 5GJSL 4F92B 4XX1G 4Z3FA 3QUMB 4PRIB 1JHKH 1ZT1B 4NLHA 4M48L 1XQ8A 3T1FB 3IF1B 5D1ZA 4JI0B 1YYML 5T1DL 3VXMB 2HFEA 4PWGA 5E0FA 1MWOA 3WNOA 1AXTL 3EJTA 5BOJA 4OXSA 3GVMA 3VW3L 4GSXA 3CDGB 4LSVH 1SA0B 1I85A 5BR8B 1NLBL 1BHBA 1AZNA 2H1LM 5FNVB 1K73W 1KCKA 1KP3A 3P0VH 2R72A 3ARDC 2KZWA 1JGIA 1VJSA 3LTVA 1KG0A 4AYBA 2E76B 4I7ZB 5GGSY 4P2RD 1WAEA 2BNQA 3PWPB 4UTBA 5ID0B 2APBA 4ZNEA 3CZEA 4WENB 2I7SA 4XPHH 3UJJH 2NZ9C 4PRID 3N1GC 1T83C 3NT0A 1SOXA 3FQRA 4UIMA 5DQDH 1PKQA 3OR6B 4JY6B 4KI1A 4UM8A 3IYLW 2UWEA 5CR1A 5IFJB 5FYLD 2EJRA 1SBSH 1H0DB 2QV2A 4BH7A 4JGNA 5H2BB 1C7SA 2WLJA 4JFDB 2DMKA 3P0YH 1KB9F 3CXDL 2IBGA 1X7TA 4KJYB 4EBQH 4J3WA 4YIPA 5DQ9B 3UYPB 5HHQB 2BS9A 5CEZL 3US0A 2ZXGA 3GMPB 4MA7H 4Y2NA 4TULH 4ZFGH 3SQBA 1SN2A 5HDLA 3PWPD 4LRIA 3EGXB 2C9SA 1U4FA 1QHTA 4U6HA 2YXWA 1UOKA 2J56A 3ISYA 3O0LA 1S7WA 4X0KB 3OLIA 4PJAF 4M6OL 3VXRE 1SHSA 2VJ8A 3CFQA 4DRXB 2OTWA 2VISB 3VXSB 3S8GB 4KI5F 4PGDB 2P7TB 3ZL2A 1JYWA 5F88B 1TLKA 2BP8A 1A65A 4JFDD 4IS6B 3RWCA 3RYHA 1P1ZB 2NY6B 1FNEB 1LMIA 1ACYH 1TEYA 3N41F 3FUEA 4QHMB 2NY1C 2WM0A 4HP5A 4MA3B 3IU4H 4FXTA 3P3NA 1OF2B 1YDPB 3CX2A 4NKGB 2FWUA 4WO0A 5L6YL 1WAAE 5ADPL 1L0XA 3AQZA 2MJWA 2EUVA 1GIGH 1WFUA 3FN0L 4A7SA 1JF6A 3HAEH 4Y19A 3F00A 4HHAA 2WVTA 2AEPH 5I19L 2VR4A 2VR8A 4KK8C 4XNXL 1IMHC 1IARB 2QQLH 4FFWD 3OKMA 3LN5A 1P4IL 3P4LA 1MOEA 2XU9A 4MKMA 1NL0H 3VXSD 2YFNA 5JPNB 3IM1A 4UFZA 3T3MB 1X4XA 1MSPA 4KQ4L 1HEZA 2WKOF 1G9NL 2NY6D 3CXHJ 3G9AB 4UNTA 5JQ6H 2HJFA 1DBML 4HDIA 4JPKH 4U3HA 3B9EA 4WAFA 4M8UA 4L18A 2PUQT 2ZXAA 1G1XB 4DKDC 3QAQA 1F41A 1NUDA 3G6DL 2Z7WA 1EFQA 3NCJL 3JD3A 3IXTB 3FUHA 3OPUA 1S76D 2HVJC 2OS7A 1J95A 5L0QB 4KKQA 2YJQA 3CN0A 3T1YB 4NPYB 5JNYA 4AUUA 2DKSA 2P7TC 2ZXDA 2ILLA 4RFEA 3TWCH 2WHVA 4K8RH 2PGGA 2AFNA 3DO4A 1CD9B 1UZ8B 3HS9A 4OUUA 5DUBA 3KW8A 5HP5A 1EGJL 1CPYA 3MYJA 5JDJA 3JWNE 4KVNL 1JRHI 1XEQA 4B9FA 3VH8B 2VLMD 3T71A 2DJMA 1MVUA 2B1GA 1DQJA 3P4MB 1RJLB 4OZIB 3JASA 4MS2A 1MFEL 2WSSG 1N32O 5IHBA 2FBRA 4MX7A 5AVVB 1EBAA 3N1QC 2A2QT 3RU8H 5I1CH 1Z7JA 2FX8L 5IOPA 4BR6A 5J2UB 4GQ9L 2UUBB 5D93B 4A6YL 3MRPB 3ABMB 4NAMA 2X7LA 4OF7A 1IBMB 4C56B 1LK3L 3H9HA 2AI0L 4JFZH 1RV6X 3EZJB 1V54B 2FB4H 2LU3A 5KAIZ 3KG5A 4PTTA 4QHUA 1EX0A 2DI8A 4OGYH 5E1HB 3DA0A 4K7PX 3EFDL 4FQIL 2V3DA 4UQIM 2V5MA 1LK2A 2NY7L 3O45B 3PWLB 4LFAB 4G9FD 3DXAB 4RWUA 1DO5A 2OMWB 5G2NA 1PFOA 5EF1A 1GH7A 4N86A 2CR6A 3H4HA 3W1ZA 2X4TA 5DD5L 4JO1L 5CCJA 5J0BA 2GVYA 4OF6A 4BKTC 1R3KA 4ASUG 1N0JA 2W0XA 3N6YA 4X4MA 1KY7A 4JV5B 3GMOA 4Y0GA 4ZUSB 2UX7A 2VDOL 1L7IH 2LR4A 4C56D 3WELA 1FYTB 2OXHA 4Y2OA 4QRUA 1G9MH 3E0GA 3SBWC 1IBGH 1OALA 4NNPH 4L05A 4QT5A 1IO4C 3MNVA 3IFOA 3BDXA 3I6KA 3IJ9A 1ZGLA 3NPSB 3HNVL 2YD0A 5FS5A 1BX2B 4NTWA 2ZIOA 3QHZH 1AOZA 2YUWA 3LV3A 1OTTC 3ULSA 3BD5A 3L3JA 2AS5M 1V54C 1S9VA 5CB4B 2VWJA 2ZKOA 3F65A 2AJXL 3LH8A 4J3OD 4AZUA 3LKPA 2X1OA 4LCWE 1J8KA 5DVOA 1TT6A 3SIKA 2UYLA 3PHQA 1QBLL 2NZ1A 4HHWA 1C5BH 4FNUA 5EORH 1FYTD 1NCDL 4F9LC 4XBFA 3B8YA 1GH6A 1ZJBA 4BHUA 1SEBB 1NC4D 2W9EH 2OSLB 1T1ZA 2QSCL 3DK2A 2DAVA 3S48A 4YSSA 5E00A 5JA9A 2H1PL 3NH7L 2IOMA 4EMZA 1CF8L 1G6RB 3E6FA 4KMQA 4F15B 4AG4H 3V6OC 3H3BC 4WEUD 2RALA 3BQUC 1F4NA 1BCIA 3ZKMD 3H7BA 5TF1L 3BJLA 3PJLA 3SJQC 1M3JA 4L8SA 1QSEA 5AVUB 2OP4L 5F7DB 5D7KD 1OAZH 1U97A 4N87A 4PJ5B 3QYNA 3TTSA 5IB4A 1QR4A 3NJVA 4Z78B 3IDUA 4IYHA 1OGTB 5E5MB 5FKAA 3VSVA 2QPSA 4U3SA 3HZ3A 5T3XH 3P2TA 4HWUA 2KERA 2VW4A 4F6EA 3G5ZB 2J8UB 4PR5B 2ZNWA 2YARA 5C09E 3HUJF 4BBWA 4YE4L 5CMUA 2E56A 4NN5B 3GT6A 1LXMA 3VOUA 1YUHB 3GI9H 4NKOA 3IJSB 4O9HH 4YO0A 5K1PA 3ABTA 1BD2E 1ZPLA 3FK3A 1NFKA 3MRMB 1LUVA 1N19A 3A6CL 2C3GA 2OMZA 3W37A 5B1BB 1C08A 1F11B 5IV2B 4PJ5D 1CXHA 1K4DC 5IHZA 1BJ8A 3D0LA 4G7SB 1ROWA 2N0KA 5F7UA 1B4RA 5F0JB 2BVOA 5AVYB 4RUFA 4WFFA 1A7QL 2IBZH 5KS9E 1HSBA 4EE2A 2MNWA 4HG4J 1Z6JT 3A23A 5FHBL 4G80A 1SZXA 2YIBD 1OAQL 1GSKA 1U8HA 1AVAA 5FA3A 3H0TB 2PPEA 4ZOBA 5JH7A 4HKJA 4HZ1A 2J4WL 2DN9A 1BQLH 1EN4A 3QQDB 1G4RA 3FULA 3J8F7 1AI4A 2VABB 4LSTH 4MBRA 4Z9KB 3LB6D 5DJ0B 5I18L 4BAYA 1WFMA 4D7BA 1R73A 5EC1B 2JI1A 2HVBA 3BPOB 3O11B 5LO7A 1FFXA 1I7RA 2NT0A 4QIWF 4PJIA 2CWRA 3W11D 4HUNB 1RSOA 3ZUNC 3UZVB 4U6YB 5TH2B 5JORA 2VXVL 2LW3A 1OARL 5HYSG 3ULUC 2AHIA 1M5IA 4RZCA 2FSEA 4BSWA 5A6LA 2UWEF 2XQYA 1MJ7H 3GQFA 2O5XH 5B1BC 5H37H 1NGPL 4K3JL 2X1WL 1N8RW 4U1SB 3RNKA 3ZKXC 4I18C 3SO3B 3AG3B 3LMJH 5C0GB 3HAEB 1GY1A 5CGTA 4ADGA 1I8AA 4LLVB 3GZQA 4OIAA 3ROOA 1YRKA 4LCVA 3KPTA 1EUTA 4NR1A 3HZVB 5AW8B 3SDCB 3MOAL 1AHKA 3U2SA 1BMGA 2ZX8A 3H2WA 1QLNA 4D9QE 1TJGL 2EQDA 1PD1A 2KZKA 3KPRB 4GG6B 2H4EA 3B9DA 3TOPA 2JTYA 3KLHD 1D6VH 1MREL 5EC1C 1BM3H 2NW3B 4JFFE 2BZDA 5HFMA 3MX0B 4RAUB 2GSIB 3AT0A 3C5SA 1QKZH 3JVGC 1MIML 5IYZB 2O30A 2OBGA 1EZJA 1DVQA 4CUCA 4RDQG 3DX8B 4XNMB 3UTSA 2DWDB 2JSFA 3T04D 1JYVA 1A7RL 4OF8A 1P2CB 4Y16A 2XQYG 2EXWC 3WB2A 2DICA 4LFBO 4NRZA 4WTZA 3KPRD 4LNRA 3MXWL 2C4FT 2EIKB 1TQTA 5F89B 2N1KA 3SO3C 4P04A 4P2AA 4NQCB 4OQTH 4QUOA 3SY0A 1K5NA 3L3OC 4YS4A 1AP6A 1E6JH 1PAMA 2XFGB 3SDCC 5E8EA 1U91B 3E38A 3A0RA 4QRRE 4QHLB 1DYZA 2CO3A 2HVKA 2J1WA 4AL8C 4YR6B 1UD2A 3DXRB 1W72L 4CJ1A 2EDOA 3WI9A 2LJ2A 5DVPA 4JZJA 1JWMB 2X4NB 1C1EL 2R4RH 3C09B 3A67H 4ZHQB 4IU3B 1CURA 4JE0A 5JVDB 2XN0A 5I16A 1M71B 1G7JB 2FGWL 2IAMC 3U1QA 4Z7UE 2CDFA 2HR3A 2J2ZA 5HD8D 3L48A 1B0RA 4U7OA 2A0LA 1U8PB 5K1NA 2UXCB 5CSBA 3WOVA 5LXTA 4JREB 5IFHH 1F6FB 3UTZB 2V7HA 5DO8A 1D7DA 1N3NA 1GMGA 4FFYA 3BKJL 4IOFD 2OQJA 4KPHL 5DYOB 1VADA 5DA4A 5B3NA 3BPLB 4LGPB 4PY8I 4WHDA 5E9NA 5HDOA 3FAXA 2FIRT 1MY7A 1QPPA 1HXMA 1VACA 4WTZG 5I8KH 5TE6L 2ZKYA 2EIKC 3ZCCA 3BLPX 3MRFA 3W38A 3PIQA 1N36B 4M61A 2F8IA 2P1YA 3HI5L 3FFOA 2ZCHH 1YY9C 3JYCA 3BFWA 1P9MC 1Y76B 1S7VA 3ZYJA 1ULVA 4G9DB 1HKLH 2VERA 4N5ED 3SPHA 1IBHA 4DN3H 4MZ3A 4ZG1A 2Q7AA 1TVBA 2CLVA 1B2YA 4FQLH 4PRIA 2XACC 1FV1A 4RZKA 5DJYA 4KU1A 3T1FA 2RQ8A 2Y3NA 4APQB 2EDEA 1BVLB 3BWUC 3CDGA 2EYSB 2K9UA 3TFKD 1SA0A 2H3NA 5ICZA 1A0QH 3MOQA 5LGJB 3PWJA 4GUPB 2XBDA 2XA8L 4FHJA 1X6NA 4BIUA 2V9TA 4JREC 2DJ4A 1KGUA 2YWZA