2AZ2A

Flock house virus b2-dsrna complex (p4122)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
total genus 24
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az2A00
1WA8B 4LWSB 2KG7A 3FAVA 3Q4HB 4GZRB 3ZBHA 3FD9A 3G80A 4I0XB 2B9ZA 3GVMA 2VRZA 3O9OA 1WA8A 3GWKC 4LWSA 2KG7B 3Q4HA 2AZ0A 2DE0X 3FAVB 2VS0A 3TXQA 3HR0A 3TXSA 4ABMA 2AZ2A 4I0XA 3OGIB
chains in the Genus database with same CATH superfamily
2YC0A 4YJ3B 2ZIOA 4H44B 1Q7YW 3CEIA 3F7VC 2LFSA 1KECA 2A79B 3MAQA 3SDLA 4B3MO 5AG2A 1P7BA 4BW5A 3UQ8A 2DE0X 1M56B 4FLXA 1Z5VA 4LF7B 2JS5A 2EIMC 2XUMA 4XDJA 1VQ6V 2ETNA 1ZUQA 2P06A 3L73H 5LHGA 2WLKA 1TUEB 1AP5A 2R9RB 3ZX6A 3CCEV 4MVZA 2X7RB 2JS3A 4LFAO 3ZMSA 4TV9A 3CC4V 2AZ0A 2JVDA 3CD6V 4BIUA 3WG7C 4F6RA 4JI2B 3K57A 1QHTA 2QKSA 2CH7B 2ITDC 1XNRO 4FLYA 1IBKO 2WSSG 3F5TA 2OIEA 5LP6A 1GN2A 2IJJA 2QTSA 5KX5A 1Y74B 1M57B 1Q86W 4DV0B 1N34B 2WLNA 2IM9A 1AI5A 1SZXA 4IIJB 4FPPA 2WA4A 1WNSA 1G4YB 4PDVA 3PJSK 3CRMA 2KG7A 2Z0AA 2QWRB 4AILC 2WLIB 4D7TA 3WB0A 2ZE7A 4JI4O 1J5EO 4OPHA 4YIOA 3HKCB 2ZNIA 1SESA 1P7GA 2WLJA 4X1KA 1U96A 3FB8C 2KB1A 3RW0A 5B3SC 3JASA 1J95A 3HKDB 4W4KA 3U11A 3VQXA 1NVPD 4J7ZA 5J2UB 1OCZC 4RUFA 4JI0B 2YIAA 1Z2GA 1BMFG 3AG7A 1H38A 4ZBMA 1NQTA 1Q6UA 3N2KB 4MTGA 4JI5O 5KHHA 1YVWA 4L8JA 4P2ZA 1V55C 1XMOO 3OTOB 2QTOA 1IVSA 4X66B 3QF7A 1D5NA 2F43G 4NR1A 4FIPC 2GUZA 3BAAA 3N2GB 1ZWIC 3ICXA 5EC2C 3K03A 4WFGA 1S3JA 5LGNA 5CA1A 1NH2B 4DR7O 1DF5A 1OCZB 2H94A 3DC5A 4LR3A 4OXSA 3OUFA 5L3BA 4AQYB 1PD3A 1VQ4V 4LBEC 4NTYA 3VBBA 1YDXA 4JYAB 1I94B 2ZR2A 5ITZA 4ZHQA 1V55B 2XAJA 2ZM6O 4PA6A 3SYCA 2WLLA 4PD4F 2Y69C 3OM3B 4I0XB 4I50A 2QWPB 5C93A 5B1NA 5L3EA 5JJEB 3ZN0A 3BPZA 3QNEA 3JAWA 4UUJC 3SPJA 3RYCB 3CCJV 4CS3A 1CP9A 5C8YA 1P84F 2JK5C 4B08A 1S0VA 2EIKC 3DTUB 4X1IB 5JJJB 1CPYA 1H2LA 3CMEV 1JMKC 1H2MA 4EB6A 3LDEA 4WFHA 4NKGB 1X59A 1FFXB 4WFEA 4K0KO 3CRRA 1H2NA 1MMMA 2IJHA 1D2DA 1N8RW 4B3RO 1VEWA 4LNUB 1Y76B 1XNQO 5LGUA 2UXBB 1KUQA 3F7YC 3J80N 4B3TO 1R6KA 2RQ6A 5HFMA 1YTFD 1XILA 3AG3C 4OGQB 1HW7A 1O9HA 1ZL8A 1SQXH 2Z3YA 3RVYA 3ZN1A 4DR2B 2PYJA 4O2AA 2JDIG 4O4HB 2ZINA 5BR8O 3MDSA 5IJ9B 3CCVV 2N04A 5EYPA 1R3JC 1BL8A 2P22C 3E35A 1NVPB 1FFTB 4BIZA 4NXMO 3H9VA 3ETGA 4JI7O 3GWOA 2EINC 1AVMA 2Q9LA 2PY5A 1XOUA 3KCXA 4B3SB 2ILMA 2YIBD 2VQEO 3UO3A 3AG3B 1JX9A 1IURA 2UUAB 1SS3A 4CH6A 4LF9O 5LYJB 2KQXA 2ADPA 3T4ZA 3RYHB 1I7FA 2KSDA 4MVRA 3FYEB 3OEEG 4WBNA 3HR0A 3OD4A 5FLXN 2XAFA 1R3LC 5IYZB 2XOKG 2QWQB 4WCEV 4NB5A 3TJTA 3RVZA 1JA8A 4UCSA 4DR5B 1KP2A 4O4LB 1K7DA 1IX9A 2MW2B 3J81N 4O2BB 1QLNA 3OMIB 2DJVA 2EINB 3FKSG 4UXNA 3DC6A 1BQ0A 3ML0A 2K9PA 2NNUA 3E86A 4LFBB 5FNVA 1YJNV 3CYOA 2ATKC 1K4DC 3H1IH 4ABMA 3FFQA 4EFEA 4OX9B 1ZTEA 3ZRWB 4JTCB 2ZE5A 3JD0A 2EJRA 4JASA 1HDJA 5IYBO 5JCOC 3FD9A 4HBNA 3M8AA 4GX5A 5H5NA 1V54B 2RCVA 3ZEDA 4X66O 2JEXA 3NR7A 2QDOA 1Y66A 1A32A 4PA4A 3JARA 2QM4A 3E83A 4U3FH 3ZMTA 5LXTB 1OHHG 5LMUO 4LCUC 2UUBO 4U3JA 1Q6IA 3ZCCA 1RM1C 2YXYA 2XAHA 4FZ0A 4AQYO 5E79Z 1BCCH 2E76B 4B3MB 3G4SV 3K59A 3H1KH 3A8TA 2WA3A 4Z1VA 4X1YB 3RYIA 2H3OA 1I5YA 3BEHA 4QPJA 3SPHA 3CE2A 1BHBA 2UUCO 3X2QC 4LFAB 5CB4A 3E8BA 4LH6A 1S5HC 3E22B 4DK0A 5JQGB 4YJ3A 1SZTA 4DV2O 2M6YA 4JTAB 2IJIA 1VQ8V 5KHGA 2FL4A 2D3OW 2AHYA 2OYQA 1W59A 1R3KC 1QNMA 1M4UA 3K0GA 1XNRB 4QIWF 3UKMA 5DECA 1IBKB 1RSOB 3B77A 1WAZA 4FFBB 1JPXA 4PHZA 4MTOA 5IYCO 1N32O 2ZT9B 1IDSA 3UT5B 4LF4B 1PNMA 3KG2A 1KD1W 5EZYB 2Y0PA 3EHBB 3ABUA 4CH3A 3X2QB 1SKVA 5LMNO 2R72A 1MNGA 3SYPA 5DEDA 1BQZA 3IFXA 3KZIZ 4LFCB 1OCRC 1VQPV 4JTDB 3D3IA 1JCHA 3JD1A 5B1BC 5KMGA 4GX1A 3T1YO 2VQFO 4DR6O 2C2AA 4U7NA 1EFRG 1Y74A 2ZNJA 2GTAA 1THZA 3ETDA 4LC1A 5CA3A 4TQDA 4IIJA 4B7EA 4DUZO 1SQGA 1F7YA 2B1IA 4UCOA 4X64O 1AI6A 5LHIA 2BTOA 2JGDB 2ITCC 4DV3O 2Q67A 4AHCA 4F6EA 2KKWA 1NR7A 4H13B 4JI5B 1S5LZ 1BHAA 2PYLA 1K73W 1S72V 1NTZH 4NXNO 1XMOB 4PA7A 2X6CA 3H1HH 4ZOLB 2QSAA 3P3NA 1K5QA 4J11A 4JYCA 2YSUB 4CS4A 4NTXA 3HKDA 5KLVH 3IAYA 4GKJO 5J2UA 4TUYB 3I5DA 2CGOA 1W0KG 3QVNA 3WFVA 2QM8A 2QEXV 4MVQA 1Q6HA 1OV9A 5BMVB 3LNNA 3N2KA 2DYRC 5GONB 3W7UA 1YSCA 3ABKB 3HB3B 3FYIB 2IU0A 3K08A 4RAIA 1FXKB 4BWAA 1NR1A 5GTHZ 1GM9A 4JF3A 2N74A 2YI9A 4MVMA 1OCCC 3A0HZ 3EFFK 1NI8A 4PDRA 3UCSC 2F23A 2DWDC 1GM7A 1XI1A 1HNWO 5LA6B 1QLEC 4RWUA 3H1JH 3BA8A 3OR7C 4LF6B 1VF7A 2PI4A 1YEWA 4K3AA 1NU1H 2PI5A 4A5UB 2GDSA 4CS2A 4UV9A 2NR5A 2QR4A 2A06H 4N21A 2XT9A 2CTRA 4FLWA 1BT8A 3L9DA 5GW7A 1NH2D 1FAFA 2K1EA 1SQPH 1N36O 4K0KB 2F93B 4HNAB 1RFYA 2L35A 3RYCA 2Q0OC 5KA6A 4B3RB 3T2MA 1QLEB 2F4VO 3L70H 1WPXA 4FLUA 3K5OA 1JR9A 2E74B 4TV8A 1XNQB 2DWEC 2IBZH 3TXSA 3DSQA 4X1IA 4JZ2A 4B3TB 1KBHA 3ZHSA 2QKAA 1AJQA 3P30A 2ZDIA 2CTQA 1MZFA 3CC2V 1FFXA 2RNBA 1LUVA 3TGUH 4PDMA 4C7UA 1KKCA 5BR8B 3VOUA 3JAKA 2PTMA 4DRXB 3E89A 4TT3G 4NXMB 3ZHVA 1Y76A 4D7SA 4MTXA 4KHPB 4JI7B 2HKOA 5J2TB 4GLXA 2IW5A 2EIMB 3EVKA 1QQCA 4WFAV 2VQEB 4LF4O 3NXSA 4O4HA 3SYQA 4ZI7B 5IJ9A 4LF9B 5LOVA 3A2FA 4GX2A 4DV5O 1BGYH 4LFCO 3UM7A 2CTPA 1ZLZA 1XREA 3T1HO 2D2CB 2ADQB 4FMTA 3C90A 3CCRV 1SERA 4CBCA 1VMGA 3VQYA 4PV1B 5B66Z 3WG7B 4WF9V 2GBOA 2OCHA 3U10A 5D5PA 5E1AC 3TXQA 4E2LA 3SYOA 3AG4C 1DLBA 1E1RG 3RYHA 4FK5C 3JD3A 1K33A 1S77D 3CB2A 4YIPA 4IHJB 2V4DA 4LWSA 4O4IB 1JJOA 4R8CA 5EIBC 1AR4A 4O2BA 1ZAUA 3MHHC 4DV4O 2ZD9A 3JATB 2QM7A 1MA1A 4JI3O 1I5XA 1SF9A 1GN6A 5B3SB 5JJNB 3DXRB 1AROP 5KHIA 1Q82W 5LMUB 2UUBB 4YXWG 3SPCA 4MSWC 3A0BZ 2EIJC 1VIBA 2YS8A 3SPGA 1N33O 1ENVA 5D5QA 2JGUA 2QWOB 1G1XB 3P32A 1ROPA 4DR4O 4GUNA 4I4TB 3ASNC 4PA3A 2G38A 3CCUV 1R6NA 1U97A 3AG2C 1TUBB 4Z2WA 2QJ1A 2UUCB 5LXTA 4O4JA 3CSXA 3TCUA 4DK1A 2FB5A 1Y4MA 2AZ2A 1WJZA 4X88A 3RT3C 3L71H 4DV2B 2PUSA 4LF6O 3SJQC 3D36A 4DXWA 3HKBA 4I55B 3UO2A 2EIJB 4FLZA 2A3QA 4DW1A 5IWAO 3MD0A 3JSNA 3IC9A 4UCTA 1CXZB 1WP7A 2YXLA 4BAYA 4X1YA 3CRCA 1VQMV 3AG1C 3K58A 3ASNB 4ASUG 1GN4A 2Y69B 1N32B 2FKXA 5LP6C 5JQGA 1WB8A 3SJCC 3KCYA 3AEIA 1QVGU 4HZ3A 5LMNB 5KUMA 1AILA 1H2SB 3LUTB 1XBLA 3K9SA 3B8NA 1ORQC 2Q73A 1K4CC 3BABA 4JYBA 1RSOA 3T1YB 2EIKB 4YJ2A 3R65A 2VQFB 4DR6B 1GH6A 2CGNA 1L0NH 4FFBA 2YIBA 3L75H 4TQFA 3UT5A 3AK1A 4DUZB 1N0JA 3K9AA 4JI8O 4KL1A 5JVDB 3J7AU 3M99B 3O9OA 2YUAA 4UCVA 1VQ7V 4X64B 5LP6B 4YHHO 1US6A 4DV3B 1K8AW 4KHPO 1PM9A 1PNKA 2MK3A 3ETEA 1DGSA 2F66C 2IH3C 4X8AA 4DUYO 3TETA 4TOIA 1CEZA 2HP8A 5CA0B 4NXNB 1MG1A 2QGNA 2EILC 1XMQO 3CJHB 2BCCH 3ZRSA 1H8HG 5EBMC 4MW3A 2XHBA 1PNLA 2JRIA 4GKJB 3CC7V 1QU7A 3K06A 1F23A 2CK3G 3OW2U 3ABLC 4X1KB 2DW4A 2F95B 3VQVA 1UPGA 1BS3A 3DGEA 4J41A 3K3WA 3JASB 4J42A 4IYHA 3KKYA 2HJDA 4ZKIA 3QO7A 2HEPA 3U0ZA 1YXBA 4ZOLA 4UVBA 1MZEA 4YY3B 2VS0A 4HYOA 2HJFC 5JH7A 2EILB 2R9AA 1VQ5V 3JALA 1WA8B 4TUYA 1GKFA 1EBOA 1HNWB 4CZZA 5LGTA 3WB2A 4XBFA 5BMVA 2HVJC 3OGCC 2H8PC 4J7KA 1EN6A 4L87A 2NN4A 2CUGA 3OUSA 5GONA 2UXDO 5L3CA 1QBZA 3RYFA 3ZS8C 2BOCC 1FXKA 2LW7A 5KA5A 3JCUZ 3E8FA 2ODMA 4JI6O 5CA1B 3SYAA 5LHHA 3K5MA 4XDLA 2XAGA 5IYDO 1F4NA 5CN0A 1K97A 4NTWA 1LNQA 3CXHF 3IGAC 1BE3H 3B8MA 5LA6A 1N36B 2DQ3A 3OTFA 1M90W 1H2GA 1GK9A 1AI7A 1K3EA 5ITZB 4ZHQB 4LF5O 4DO2A 1KKDA 2GV9A 2WLLB 2F4VB 3C3SA 3CRAA 1Q43A 1B6QA 1XEQA 2P6JA 3JAWB 3T4DA 4N23A 1YF2A 2OCCC 2XNDG 2WLHA 5C8YB 4J9ZB 3FAVB 2GHYA 3AK2A 3T1CA 3R66A 4KFMA 1SQFA 2IJKA 4J9YB 5KAIZ 3SPIA 5IE9A 3FB6C 5KAFZ 5BY1A 3G67A 1M93A 1G6UA 4EB6B 1RM1B 1Y67A 4GT1A 4DV6B 3ABMC 3K5LA 3CS5A 1NKDA 3LSSA 1SA0B 2OT5A 3ZMVA 4ICGA 3JD2A 4DR1O 4PA9A 2XTAA 4QE7A 1VF5B 3THOA 4FLTA 4X62O 1NTMH 2QA4V 4K8XA 2LP7A 4QGPA 2X0LA 1ZX3A 4W4LA 4DV5B 4J7JA 1AR1B 1SC5B 3T1HB 2LO1A 2UXNA 2CH7A 3CCLV 2EULA 2AHZA 1YJWV 1N4CA 5J2TA 2YI8A 2BSKB 3ABMB 3BRCA 5CMUA 5EYPB 1WPBA 3OEHG 4PDLA 2IH1C 2DOSA 3LDDA 1JVMA 1BSMA 3K5NA 5B1OA 2PF4E 1FKAO 1W2BU 1HNZO 1GAXA 4MT8A 1FXVA 3GWKC 4DR3O 2AGAA 4LP8A 3WU2Z 2WLIA 3CXCU 4DV1O 1SQVH 1OCRB 3W7WA 1KYOF 3HKCA 2BOBC 4MTFA 5B1BB 4DV4B 5L3GA 2Z5UA 1B3QA 4H37A 1S5JA 1VQOV 4JI3B 1OZ0A 3BA9A 4FM1A 1H2KA 3CX5F 2B5UA 1PPJH 3BFRA 3JSLA 3B2EE 4IHJA 4F4LA 1GO3F 3K0DA 3RN4A 4GZRB 2EZOA 5FNVB 3QO5A 5HFLA 1N33B 4KXRA 4UVAA 3GB7C 2B1GA 1VF6A 4YY3O 3ABTA 4D6TH 1FS0G 4DR4B 4JV5O 3JATA 1BZKA 5CBHA 3QO8A 1E79G 3N2GA 4FLVA 2YICA 3RGBA 4G2KA 1Q81W 4IYIA 3DXRA 4I9QA 1FJGO 1GTOA 3OT7A 2X6AA 4UB6Z 4OPAA 3JARB 1JFFB 1HR0O 2E75B 4EFBA 4LF8O 2DYRB 1IBLB 5IWAB 4JYYA 2XASA 4R7CA 4I4TA 4H0LB 4MVOA 4U3JB 1EM1A 4I0XA 2QKCA 2DYSC 3B09A 3D3QA 1M56C 1AJPA 5DM6V 2HVKC 1TUBA 1L0LH 1OCCB 3L72H 2LW1A 2P90A 2LJ2A 2Q8VA 4TSFG 1YHQV 2HR3A 1QCEA 4PI2A 1OCOC 2AW9A 1QR9A 4FM0A 2DQ0A 2HHHO 4QJFB 5CB4B 1SQBH 1KMIZ 5EBWC 5A2QN 5EIBD 1YJ9V 1DF4A 4JAVA 3PN1A 2DYSB 1Z5WA 2P7TC 3STLC 1JQ0A 2Q7GA 4JI8B 1M57C 5J9PC 3CPWU 1YI2V 2ZKOA 4LNUA 4DV6O 4YHHB 3CP1A 3HPLC 1YITV 1VQNV 3JCZA 1PL0A 2W0FC 3I56V 3ZIAG 1OCOB 3OE7G 2ARHA 4DUYB 2VWJA 3GVMA 5K1PA 2BE3A 5BXZA 2M7WA 1XMQB 4UV8A 3SJBC 1V9PA 3HKEB 3OR6C 1Y6XA 4JI1O 1E1QG 1R6TA 4CH5A 5JVDA 4JZGA 5IJ0B 1IBMO 2YEVB 5KMGB 3LSQA 5CBGA 4BR6A 5GTIZ 3LSUA 4KP4A 1MSWD 1M9NA 2Q7HA 2QWNB 2UU9O 2JIZG 3FB5C 1VARA 4X20B 5CA0A 1AJNA 1COWG 2QE7G 2OTLV 3BHPA 3CJHA 5F2VO 4UFZA 5LYJA 5IY5C 1HWYA 1G8MA 1PL4A 1VF6C 4GKKO 4UCUA 5IYZA 1RPRA 4FFKA 3D8CA 1RP3B 2EBOA 2LGQA 4FVMA 4Z1MG 2UXDB 4O4LA 1Q8IA 3IC7A 4JI6B 2AXTZ 2RMKB 1URFA 2EJ7A 1EN5A 3ZBHA 2X6BA 1T5EA 3ZMZA 2YXHA 4GYCB 1TVKB 4ZIBA 2E5LO 1WA8A 3ZRWA 1Q3EA 2ZE6A 3AG4B 4G28B 5H6QA 5IY5B 1X4TA 4QPKA 3SJAC 3N27A 3G6EV 4LF5B 4EKWA 2BTQB 3Q4HB 4PJ0Z 2DMXA 1HNXB 3SGIA 3CHXA 2L6LA 2VRZA 1B04A 1EZVH 3CRQA 4E4EA 3TK1A 2Q4PA 1IXMA 4UB8Z 3VQWA 2JEUA 2ZDIC 1DK1A 2ZIMA 1VQ9V 2Q69A 2CDYA 4WFFA 5JCOA 1IBLO 4PI0A 4WFBV 2FTKA 4Q6GA 5A9GA 5DN6G 4DR1B 4P9PA 4GCZA 1I0HA 2ZCEA 3FAVA 1DTOA 1VQKV 3E22A 4X62B 4TV8B 5KHJA 4DV7B 3AG2B 3G80A 1NJIW 2Q68A 4QE9A 3O65A 1SQQH 4I9WA 2V7QG 1XL6A 3K04A 1NBMG 3RFRA 3ZMUA 4X65O 3H1LH 4TV9B 1M1KW 1SA0A 5FPOA 1F4MA 1YIJV 4DW0A 3G71V 3JAKB 3SR2C 1F51A 3BCCH 3QG5A 1NZ6A 4IT5A 1XL4A 1XHZA 4F6RB 4LF7O 1Q90D 5EZYA 3OFNG 2WWWA 4BIOA 3AG1B 3ZRXA 3OMAB 3BVOA 5BZBA 1HNZB 2O57A 4DR3B 5KX5B 2R70A 3EXAA 5KUKA 3L74H 3ASOC 4DV1B 4NYKA 2RN9A 5L3DA 2BSKA 2JJ2G 2ZXWC 5EC1C 5LOVB 3IJ4A 1PV0A 1K34A 5JWPA 2RJZA 3ETQA 1AR5A 2R9IA 5EBLC 3S3WA 2UXXA 2KG7B 4JI2O 1WB7A 2EX3A 1KC8W 3ZHUA 5B1AC 4J10A 3A0RA 1QVFU 4JAAA 4P30A 2JGDA 1XHXA 1S76D 4DV0O 1N34O 2Y4TA 2UXCB 2F1MA 3CCQV 3FB7C 4RQEA 3ASOB 2PGGA 3S3XA 3AK3A 1JJ2U 2CAZC 2P67A 1AP6A 1KB9F 2ZXWB 1V54C 2WLMA 2HFEC 4JV5B 1EN4A 4DYLA 2P4KA 2YIDA 4LWSB 4X9QA 1UFIA 4JPRA 1VQLV 5B1AB 1NS1A 2ZE8A 1FJGB 4X89A 1NTKH 2GUZB 4FZ1A 3ABLB 4PELA 2A0LA 4GX0A 1HR0B 4LF8B 2GSMB 4JI0O 1XQ8A 4G27B 5TISZ 3OGIB 4RUEA 3OAAG 3D36C 1GN3A 5EK0A 3W7XA 2CTWA 1RPOA 4CC5A 3OTOO 2N05A 1R3IC 3B40A 1N0NA 2FMLA 4K8ZA 1JFFA 1FD9A 2Q7EA 1HNXO 4I50B 3FX7A 2Q0AA 2HHHB 3B4SA 5CBFA 3E8HA 3RBZA 5FL7G 4O4JB 1PKXA 3ZHTA 4EEQA 4LH7A 5H9CA 2B9ZA 3H01A 1WP8A 1W0JG 3HKBB 4R6ZA 1M5IA 4JYAO 4HNAA 1I94O 3ZHRA 1KQSU 4CC6A 2XAQA 3JYCA 1OJHA 1YTFB 1IXBA 2WAMA 3W7TA 1K9MW 2IU3A 3E2EA 4IL6Z 3WB1A 3I55V 4KUMA 1LR1A 4BW9A 2OCCB 1I08A 4DV7O 2HG5C 4JI1B 1FYJA 3RWRD 4DRXA 3P3PA 3QTCA 1IBMB 1SRYA 3ZHQA 1ZL8B 4YJ2B 1KU9A 1SETA 4XDKA 4O2AB 1AB3A 5B5EZ 4UVCA 5IT9N 2Y0IA 5H6RA 2UU9B 2V1DA 3ZJZA 2CE4A 3JD4A 1WN7A 2OIGA 2LGWA 3E8GA 3M7MX 2Q5ZA 1LUWA 1TAEA 4AI8A 1FXHA 1TA8A 3HKEA 4ZI7A 2UXBO 4RQFA 5IJ0A 2YEVA 3LDCA 4JI4B 5LL6Y 1J5EB 4Q20A 4GKKB 5K1XA 4H33A 3JAMN 1MABG 5LBQA 4DR2O 2A7WA 4NVPA 2NLJC 4P9OA 3F5WC 1P49A 2P4VA 3STZC 2W6IG 2E3CA 4X20A 1IZ3A 4WBNB 1K92A 1L8DA 3ABKC 1D5AA 1L1FA 1GMGA 1WLEA 3G6BA 4I5SA 4TWKA 1FXKC 1B06A 4MVSA 5IDJA 1GM8A 2VWKA 4MW8A 4U7OA 4CH4A 2YDEA 2E5LB 4MS2A 2OTJV 3W7SA 1O9GA 1XDCA 2RDCA 4B3SO 4J80A 1MOFA 1JOYA 1H8EG 2UXCO 2LFRA 4O4IA 2Q6AA 2JJ1G 1YZBA 2UUAO 1ZSPA 5JH7B 3MHSC 2PZSA 1P4RA 1TGOA 2A9HA 3JALB 3APOA 5H2FZ 4K35A 1K5SA 4JAUA 1YCIA 1R73A 4JGSA 4RO2A 2HLDG 1MSDA 1XUQA 3BY6A 4FM2A 4DR7B 1TVKA 3C3TA 1GRJA 5FPRA 4DR5O 3CCSV 1KP3A 2EZPA 3RYFB 5L3FA 1HP8A 4I7ZB 3CWBH 1PP9H 1QR8A 4HAMA 2W6JG 4LFBO 2ZM6B 3CMAV 1EZJA 2BTQA 1NT2B 3Q4HA 5KHKA 2LQTA 2ZR3A 4OX9O 4QNHB 3APQA 1AI4A 3CCMV 1Q5OA 1FPOA 2OWOA 3OMNB 4B7KA 3ZRVA 4UCRA 2P5OA 3K79A 2GTSA 2W0XA 3LNMB 2DN9A 4IGGA 4FJCC 2WPDG 4MVUA 1R1BA 2Y48A 1UJWB 3RYIB 4I55A 2FYUH 1VP7A 4R50A 2Y4UA 2ZQMA 4X65B
chains in the Genus database with same CATH topology
1WA8B 4LWSB 2KG7A 3FAVA 3Q4HB 4GZRB 3ZBHA 3FD9A 3G80A 4I0XB 2B9ZA 3GVMA 2VRZA 3O9OA 1WA8A 3GWKC 4LWSA 2KG7B 3Q4HA 2AZ0A 2DE0X 3FAVB 2VS0A 3TXQA 3HR0A 3TXSA 4ABMA 2AZ2A 4I0XA 3OGIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 B;  4LWS B;  2KG7 A;  3FAV A;  3Q4H B;  4GZR B;  3ZBH A;  3FD9 A;  3G80 A;  4I0X B;  2B9Z A;  3GVM A;  2VRZ A;  3O9O A;  1WA8 A;  3GWK C;  4LWS A;  2KG7 B;  3Q4H A;  2AZ0 A;  2DE0 X;  3FAV B;  2VS0 A;  3TXQ A;  3HR0 A;  3TXS A;  4ABM A;  2AZ2 A;  4I0X A;  3OGI B; 
#chains in the Genus database with same CATH topology
 2YC0 A;  4YJ3 B;  2ZIO A;  4H44 B;  1Q7Y W;  3CEI A;  3F7V C;  2LFS A;  1KEC A;  2A79 B;  3MAQ A;  3SDL A;  4B3M O;  5AG2 A;  1P7B A;  4BW5 A;  3UQ8 A;  2DE0 X;  1M56 B;  4FLX A;  1Z5V A;  4LF7 B;  2JS5 A;  2EIM C;  2XUM A;  4XDJ A;  1VQ6 V;  2ETN A;  1ZUQ A;  2P06 A;  3L73 H;  5LHG A;  2WLK A;  1TUE B;  1AP5 A;  2R9R B;  3ZX6 A;  3CCE V;  4MVZ A;  2X7R B;  2JS3 A;  4LFA O;  3ZMS A;  4TV9 A;  3CC4 V;  2AZ0 A;  2JVD A;  3CD6 V;  4BIU A;  3WG7 C;  4F6R A;  4JI2 B;  3K57 A;  1QHT A;  2QKS A;  2CH7 B;  2ITD C;  1XNR O;  4FLY A;  1IBK O;  2WSS G;  3F5T A;  2OIE A;  5LP6 A;  1GN2 A;  2IJJ A;  2QTS A;  5KX5 A;  1Y74 B;  1M57 B;  1Q86 W;  4DV0 B;  1N34 B;  2WLN A;  2IM9 A;  1AI5 A;  1SZX A;  4IIJ B;  4FPP A;  2WA4 A;  1WNS A;  1G4Y B;  4PDV A;  3PJS K;  3CRM A;  2KG7 A;  2Z0A A;  2QWR B;  4AIL C;  2WLI B;  4D7T A;  3WB0 A;  2ZE7 A;  4JI4 O;  1J5E O;  4OPH A;  4YIO A;  3HKC B;  2ZNI A;  1SES A;  1P7G A;  2WLJ A;  4X1K A;  1U96 A;  3FB8 C;  2KB1 A;  3RW0 A;  5B3S C;  3JAS A;  1J95 A;  3HKD B;  4W4K A;  3U11 A;  3VQX A;  1NVP D;  4J7Z A;  5J2U B;  1OCZ C;  4RUF A;  4JI0 B;  2YIA A;  1Z2G A;  1BMF G;  3AG7 A;  1H38 A;  4ZBM A;  1NQT A;  1Q6U A;  3N2K B;  4MTG A;  4JI5 O;  5KHH A;  1YVW A;  4L8J A;  4P2Z A;  1V55 C;  1XMO O;  3OTO B;  2QTO A;  1IVS A;  4X66 B;  3QF7 A;  1D5N A;  2F43 G;  4NR1 A;  4FIP C;  2GUZ A;  3BAA A;  3N2G B;  1ZWI C;  3ICX A;  5EC2 C;  3K03 A;  4WFG A;  1S3J A;  5LGN A;  5CA1 A;  1NH2 B;  4DR7 O;  1DF5 A;  1OCZ B;  2H94 A;  3DC5 A;  4LR3 A;  4OXS A;  3OUF A;  5L3B A;  4AQY B;  1PD3 A;  1VQ4 V;  4LBE C;  4NTY A;  3VBB A;  1YDX A;  4JYA B;  1I94 B;  2ZR2 A;  5ITZ A;  4ZHQ A;  1V55 B;  2XAJ A;  2ZM6 O;  4PA6 A;  3SYC A;  2WLL A;  4PD4 F;  2Y69 C;  3OM3 B;  4I0X B;  4I50 A;  2QWP B;  5C93 A;  5B1N A;  5L3E A;  5JJE B;  3ZN0 A;  3BPZ A;  3QNE A;  3JAW A;  4UUJ C;  3SPJ A;  3RYC B;  3CCJ V;  4CS3 A;  1CP9 A;  5C8Y A;  1P84 F;  2JK5 C;  4B08 A;  1S0V A;  2EIK C;  3DTU B;  4X1I B;  5JJJ B;  1CPY A;  1H2L A;  3CME V;  1JMK C;  1H2M A;  4EB6 A;  3LDE A;  4WFH A;  4NKG B;  1X59 A;  1FFX B;  4WFE A;  4K0K O;  3CRR A;  1H2N A;  1MMM A;  2IJH A;  1D2D A;  1N8R W;  4B3R O;  1VEW A;  4LNU B;  1Y76 B;  1XNQ O;  5LGU A;  2UXB B;  1KUQ A;  3F7Y C;  3J80 N;  4B3T O;  1R6K A;  2RQ6 A;  5HFM A;  1YTF D;  1XIL A;  3AG3 C;  4OGQ B;  1HW7 A;  1O9H A;  1ZL8 A;  1SQX H;  2Z3Y A;  3RVY A;  3ZN1 A;  4DR2 B;  2PYJ A;  4O2A A;  2JDI G;  4O4H B;  2ZIN A;  5BR8 O;  3MDS A;  5IJ9 B;  3CCV V;  2N04 A;  5EYP A;  1R3J C;  1BL8 A;  2P22 C;  3E35 A;  1NVP B;  1FFT B;  4BIZ A;  4NXM O;  3H9V A;  3ETG A;  4JI7 O;  3GWO A;  2EIN C;  1AVM A;  2Q9L A;  2PY5 A;  1XOU A;  3KCX A;  4B3S B;  2ILM A;  2YIB D;  2VQE O;  3UO3 A;  3AG3 B;  1JX9 A;  1IUR A;  2UUA B;  1SS3 A;  4CH6 A;  4LF9 O;  5LYJ B;  2KQX A;  2ADP A;  3T4Z A;  3RYH B;  1I7F A;  2KSD A;  4MVR A;  3FYE B;  3OEE G;  4WBN A;  3HR0 A;  3OD4 A;  5FLX N;  2XAF A;  1R3L C;  5IYZ B;  2XOK G;  2QWQ B;  4WCE V;  4NB5 A;  3TJT A;  3RVZ A;  1JA8 A;  4UCS A;  4DR5 B;  1KP2 A;  4O4L B;  1K7D A;  1IX9 A;  2MW2 B;  3J81 N;  4O2B B;  1QLN A;  3OMI B;  2DJV A;  2EIN B;  3FKS G;  4UXN A;  3DC6 A;  1BQ0 A;  3ML0 A;  2K9P A;  2NNU A;  3E86 A;  4LFB B;  5FNV A;  1YJN V;  3CYO A;  2ATK C;  1K4D C;  3H1I H;  4ABM A;  3FFQ A;  4EFE A;  4OX9 B;  1ZTE A;  3ZRW B;  4JTC B;  2ZE5 A;  3JD0 A;  2EJR A;  4JAS A;  1HDJ A;  5IYB O;  5JCO C;  3FD9 A;  4HBN A;  3M8A A;  4GX5 A;  5H5N A;  1V54 B;  2RCV A;  3ZED A;  4X66 O;  2JEX A;  3NR7 A;  2QDO A;  1Y66 A;  1A32 A;  4PA4 A;  3JAR A;  2QM4 A;  3E83 A;  4U3F H;  3ZMT A;  5LXT B;  1OHH G;  5LMU O;  4LCU C;  2UUB O;  4U3J A;  1Q6I A;  3ZCC A;  1RM1 C;  2YXY A;  2XAH A;  4FZ0 A;  4AQY O;  5E79 Z;  1BCC H;  2E76 B;  4B3M B;  3G4S V;  3K59 A;  3H1K H;  3A8T A;  2WA3 A;  4Z1V A;  4X1Y B;  3RYI A;  2H3O A;  1I5Y A;  3BEH A;  4QPJ A;  3SPH A;  3CE2 A;  1BHB A;  2UUC O;  3X2Q C;  4LFA B;  5CB4 A;  3E8B A;  4LH6 A;  1S5H C;  3E22 B;  4DK0 A;  5JQG B;  4YJ3 A;  1SZT A;  4DV2 O;  2M6Y A;  4JTA B;  2IJI A;  1VQ8 V;  5KHG A;  2FL4 A;  2D3O W;  2AHY A;  2OYQ A;  1W59 A;  1R3K C;  1QNM A;  1M4U A;  3K0G A;  1XNR B;  4QIW F;  3UKM A;  5DEC A;  1IBK B;  1RSO B;  3B77 A;  1WAZ A;  4FFB B;  1JPX A;  4PHZ A;  4MTO A;  5IYC O;  1N32 O;  2ZT9 B;  1IDS A;  3UT5 B;  4LF4 B;  1PNM A;  3KG2 A;  1KD1 W;  5EZY B;  2Y0P A;  3EHB B;  3ABU A;  4CH3 A;  3X2Q B;  1SKV A;  5LMN O;  2R72 A;  1MNG A;  3SYP A;  5DED A;  1BQZ A;  3IFX A;  3KZI Z;  4LFC B;  1OCR C;  1VQP V;  4JTD B;  3D3I A;  1JCH A;  3JD1 A;  5B1B C;  5KMG A;  4GX1 A;  3T1Y O;  2VQF O;  4DR6 O;  2C2A A;  4U7N A;  1EFR G;  1Y74 A;  2ZNJ A;  2GTA A;  1THZ A;  3ETD A;  4LC1 A;  5CA3 A;  4TQD A;  4IIJ A;  4B7E A;  4DUZ O;  1SQG A;  1F7Y A;  2B1I A;  4UCO A;  4X64 O;  1AI6 A;  5LHI A;  2BTO A;  2JGD B;  2ITC C;  4DV3 O;  2Q67 A;  4AHC A;  4F6E A;  2KKW A;  1NR7 A;  4H13 B;  4JI5 B;  1S5L Z;  1BHA A;  2PYL A;  1K73 W;  1S72 V;  1NTZ H;  4NXN O;  1XMO B;  4PA7 A;  2X6C A;  3H1H H;  4ZOL B;  2QSA A;  3P3N A;  1K5Q A;  4J11 A;  4JYC A;  2YSU B;  4CS4 A;  4NTX A;  3HKD A;  5KLV H;  3IAY A;  4GKJ O;  5J2U A;  4TUY B;  3I5D A;  2CGO A;  1W0K G;  3QVN A;  3WFV A;  2QM8 A;  2QEX V;  4MVQ A;  1Q6H A;  1OV9 A;  5BMV B;  3LNN A;  3N2K A;  2DYR C;  5GON B;  3W7U A;  1YSC A;  3ABK B;  3HB3 B;  3FYI B;  2IU0 A;  3K08 A;  4RAI A;  1FXK B;  4BWA A;  1NR1 A;  5GTH Z;  1GM9 A;  4JF3 A;  2N74 A;  2YI9 A;  4MVM A;  1OCC C;  3A0H Z;  3EFF K;  1NI8 A;  4PDR A;  3UCS C;  2F23 A;  2DWD C;  1GM7 A;  1XI1 A;  1HNW O;  5LA6 B;  1QLE C;  4RWU A;  3H1J H;  3BA8 A;  3OR7 C;  4LF6 B;  1VF7 A;  2PI4 A;  1YEW A;  4K3A A;  1NU1 H;  2PI5 A;  4A5U B;  2GDS A;  4CS2 A;  4UV9 A;  2NR5 A;  2QR4 A;  2A06 H;  4N21 A;  2XT9 A;  2CTR A;  4FLW A;  1BT8 A;  3L9D A;  5GW7 A;  1NH2 D;  1FAF A;  2K1E A;  1SQP H;  1N36 O;  4K0K B;  2F93 B;  4HNA B;  1RFY A;  2L35 A;  3RYC A;  2Q0O C;  5KA6 A;  4B3R B;  3T2M A;  1QLE B;  2F4V O;  3L70 H;  1WPX A;  4FLU A;  3K5O A;  1JR9 A;  2E74 B;  4TV8 A;  1XNQ B;  2DWE C;  2IBZ H;  3TXS A;  3DSQ A;  4X1I A;  4JZ2 A;  4B3T B;  1KBH A;  3ZHS A;  2QKA A;  1AJQ A;  3P30 A;  2ZDI A;  2CTQ A;  1MZF A;  3CC2 V;  1FFX A;  2RNB A;  1LUV A;  3TGU H;  4PDM A;  4C7U A;  1KKC A;  5BR8 B;  3VOU A;  3JAK A;  2PTM A;  4DRX B;  3E89 A;  4TT3 G;  4NXM B;  3ZHV A;  1Y76 A;  4D7S A;  4MTX A;  4KHP B;  4JI7 B;  2HKO A;  5J2T B;  4GLX A;  2IW5 A;  2EIM B;  3EVK A;  1QQC A;  4WFA V;  2VQE B;  4LF4 O;  3NXS A;  4O4H A;  3SYQ A;  4ZI7 B;  5IJ9 A;  4LF9 B;  5LOV A;  3A2F A;  4GX2 A;  4DV5 O;  1BGY H;  4LFC O;  3UM7 A;  2CTP A;  1ZLZ A;  1XRE A;  3T1H O;  2D2C B;  2ADQ B;  4FMT A;  3C90 A;  3CCR V;  1SER A;  4CBC A;  1VMG A;  3VQY A;  4PV1 B;  5B66 Z;  3WG7 B;  4WF9 V;  2GBO A;  2OCH A;  3U10 A;  5D5P A;  5E1A C;  3TXQ A;  4E2L A;  3SYO A;  3AG4 C;  1DLB A;  1E1R G;  3RYH A;  4FK5 C;  3JD3 A;  1K33 A;  1S77 D;  3CB2 A;  4YIP A;  4IHJ B;  2V4D A;  4LWS A;  4O4I B;  1JJO A;  4R8C A;  5EIB C;  1AR4 A;  4O2B A;  1ZAU A;  3MHH C;  4DV4 O;  2ZD9 A;  3JAT B;  2QM7 A;  1MA1 A;  4JI3 O;  1I5X A;  1SF9 A;  1GN6 A;  5B3S B;  5JJN B;  3DXR B;  1ARO P;  5KHI A;  1Q82 W;  5LMU B;  2UUB B;  4YXW G;  3SPC A;  4MSW C;  3A0B Z;  2EIJ C;  1VIB A;  2YS8 A;  3SPG A;  1N33 O;  1ENV A;  5D5Q A;  2JGU A;  2QWO B;  1G1X B;  3P32 A;  1ROP A;  4DR4 O;  4GUN A;  4I4T B;  3ASN C;  4PA3 A;  2G38 A;  3CCU V;  1R6N A;  1U97 A;  3AG2 C;  1TUB B;  4Z2W A;  2QJ1 A;  2UUC B;  5LXT A;  4O4J A;  3CSX A;  3TCU A;  4DK1 A;  2FB5 A;  1Y4M A;  2AZ2 A;  1WJZ A;  4X88 A;  3RT3 C;  3L71 H;  4DV2 B;  2PUS A;  4LF6 O;  3SJQ C;  3D36 A;  4DXW A;  3HKB A;  4I55 B;  3UO2 A;  2EIJ B;  4FLZ A;  2A3Q A;  4DW1 A;  5IWA O;  3MD0 A;  3JSN A;  3IC9 A;  4UCT A;  1CXZ B;  1WP7 A;  2YXL A;  4BAY A;  4X1Y A;  3CRC A;  1VQM V;  3AG1 C;  3K58 A;  3ASN B;  4ASU G;  1GN4 A;  2Y69 B;  1N32 B;  2FKX A;  5LP6 C;  5JQG A;  1WB8 A;  3SJC C;  3KCY A;  3AEI A;  1QVG U;  4HZ3 A;  5LMN B;  5KUM A;  1AIL A;  1H2S B;  3LUT B;  1XBL A;  3K9S A;  3B8N A;  1ORQ C;  2Q73 A;  1K4C C;  3BAB A;  4JYB A;  1RSO A;  3T1Y B;  2EIK B;  4YJ2 A;  3R65 A;  2VQF B;  4DR6 B;  1GH6 A;  2CGN A;  1L0N H;  4FFB A;  2YIB A;  3L75 H;  4TQF A;  3UT5 A;  3AK1 A;  4DUZ B;  1N0J A;  3K9A A;  4JI8 O;  4KL1 A;  5JVD B;  3J7A U;  3M99 B;  3O9O A;  2YUA A;  4UCV A;  1VQ7 V;  4X64 B;  5LP6 B;  4YHH O;  1US6 A;  4DV3 B;  1K8A W;  4KHP O;  1PM9 A;  1PNK A;  2MK3 A;  3ETE A;  1DGS A;  2F66 C;  2IH3 C;  4X8A A;  4DUY O;  3TET A;  4TOI A;  1CEZ A;  2HP8 A;  5CA0 B;  4NXN B;  1MG1 A;  2QGN A;  2EIL C;  1XMQ O;  3CJH B;  2BCC H;  3ZRS A;  1H8H G;  5EBM C;  4MW3 A;  2XHB A;  1PNL A;  2JRI A;  4GKJ B;  3CC7 V;  1QU7 A;  3K06 A;  1F23 A;  2CK3 G;  3OW2 U;  3ABL C;  4X1K B;  2DW4 A;  2F95 B;  3VQV A;  1UPG A;  1BS3 A;  3DGE A;  4J41 A;  3K3W A;  3JAS B;  4J42 A;  4IYH A;  3KKY A;  2HJD A;  4ZKI A;  3QO7 A;  2HEP A;  3U0Z A;  1YXB A;  4ZOL A;  4UVB A;  1MZE A;  4YY3 B;  2VS0 A;  4HYO A;  2HJF C;  5JH7 A;  2EIL B;  2R9A A;  1VQ5 V;  3JAL A;  1WA8 B;  4TUY A;  1GKF A;  1EBO A;  1HNW B;  4CZZ A;  5LGT A;  3WB2 A;  4XBF A;  5BMV A;  2HVJ C;  3OGC C;  2H8P C;  4J7K A;  1EN6 A;  4L87 A;  2NN4 A;  2CUG A;  3OUS A;  5GON A;  2UXD O;  5L3C A;  1QBZ A;  3RYF A;  3ZS8 C;  2BOC C;  1FXK A;  2LW7 A;  5KA5 A;  3JCU Z;  3E8F A;  2ODM A;  4JI6 O;  5CA1 B;  3SYA A;  5LHH A;  3K5M A;  4XDL A;  2XAG A;  5IYD O;  1F4N A;  5CN0 A;  1K97 A;  4NTW A;  1LNQ A;  3CXH F;  3IGA C;  1BE3 H;  3B8M A;  5LA6 A;  1N36 B;  2DQ3 A;  3OTF A;  1M90 W;  1H2G A;  1GK9 A;  1AI7 A;  1K3E A;  5ITZ B;  4ZHQ B;  4LF5 O;  4DO2 A;  1KKD A;  2GV9 A;  2WLL B;  2F4V B;  3C3S A;  3CRA A;  1Q43 A;  1B6Q A;  1XEQ A;  2P6J A;  3JAW B;  3T4D A;  4N23 A;  1YF2 A;  2OCC C;  2XND G;  2WLH A;  5C8Y B;  4J9Z B;  3FAV B;  2GHY A;  3AK2 A;  3T1C A;  3R66 A;  4KFM A;  1SQF A;  2IJK A;  4J9Y B;  5KAI Z;  3SPI A;  5IE9 A;  3FB6 C;  5KAF Z;  5BY1 A;  3G67 A;  1M93 A;  1G6U A;  4EB6 B;  1RM1 B;  1Y67 A;  4GT1 A;  4DV6 B;  3ABM C;  3K5L A;  3CS5 A;  1NKD A;  3LSS A;  1SA0 B;  2OT5 A;  3ZMV A;  4ICG A;  3JD2 A;  4DR1 O;  4PA9 A;  2XTA A;  4QE7 A;  1VF5 B;  3THO A;  4FLT A;  4X62 O;  1NTM H;  2QA4 V;  4K8X A;  2LP7 A;  4QGP A;  2X0L A;  1ZX3 A;  4W4L A;  4DV5 B;  4J7J A;  1AR1 B;  1SC5 B;  3T1H B;  2LO1 A;  2UXN A;  2CH7 A;  3CCL V;  2EUL A;  2AHZ A;  1YJW V;  1N4C A;  5J2T A;  2YI8 A;  2BSK B;  3ABM B;  3BRC A;  5CMU A;  5EYP B;  1WPB A;  3OEH G;  4PDL A;  2IH1 C;  2DOS A;  3LDD A;  1JVM A;  1BSM A;  3K5N A;  5B1O A;  2PF4 E;  1FKA O;  1W2B U;  1HNZ O;  1GAX A;  4MT8 A;  1FXV A;  3GWK C;  4DR3 O;  2AGA A;  4LP8 A;  3WU2 Z;  2WLI A;  3CXC U;  4DV1 O;  1SQV H;  1OCR B;  3W7W A;  1KYO F;  3HKC A;  2BOB C;  4MTF A;  5B1B B;  4DV4 B;  5L3G A;  2Z5U A;  1B3Q A;  4H37 A;  1S5J A;  1VQO V;  4JI3 B;  1OZ0 A;  3BA9 A;  4FM1 A;  1H2K A;  3CX5 F;  2B5U A;  1PPJ H;  3BFR A;  3JSL A;  3B2E E;  4IHJ A;  4F4L A;  1GO3 F;  3K0D A;  3RN4 A;  4GZR B;  2EZO A;  5FNV B;  3QO5 A;  5HFL A;  1N33 B;  4KXR A;  4UVA A;  3GB7 C;  2B1G A;  1VF6 A;  4YY3 O;  3ABT A;  4D6T H;  1FS0 G;  4DR4 B;  4JV5 O;  3JAT A;  1BZK A;  5CBH A;  3QO8 A;  1E79 G;  3N2G A;  4FLV A;  2YIC A;  3RGB A;  4G2K A;  1Q81 W;  4IYI A;  3DXR A;  4I9Q A;  1FJG O;  1GTO A;  3OT7 A;  2X6A A;  4UB6 Z;  4OPA A;  3JAR B;  1JFF B;  1HR0 O;  2E75 B;  4EFB A;  4LF8 O;  2DYR B;  1IBL B;  5IWA B;  4JYY A;  2XAS A;  4R7C A;  4I4T A;  4H0L B;  4MVO A;  4U3J B;  1EM1 A;  4I0X A;  2QKC A;  2DYS C;  3B09 A;  3D3Q A;  1M56 C;  1AJP A;  5DM6 V;  2HVK C;  1TUB A;  1L0L H;  1OCC B;  3L72 H;  2LW1 A;  2P90 A;  2LJ2 A;  2Q8V A;  4TSF G;  1YHQ V;  2HR3 A;  1QCE A;  4PI2 A;  1OCO C;  2AW9 A;  1QR9 A;  4FM0 A;  2DQ0 A;  2HHH O;  4QJF B;  5CB4 B;  1SQB H;  1KMI Z;  5EBW C;  5A2Q N;  5EIB D;  1YJ9 V;  1DF4 A;  4JAV A;  3PN1 A;  2DYS B;  1Z5W A;  2P7T C;  3STL C;  1JQ0 A;  2Q7G A;  4JI8 B;  1M57 C;  5J9P C;  3CPW U;  1YI2 V;  2ZKO A;  4LNU A;  4DV6 O;  4YHH B;  3CP1 A;  3HPL C;  1YIT V;  1VQN V;  3JCZ A;  1PL0 A;  2W0F C;  3I56 V;  3ZIA G;  1OCO B;  3OE7 G;  2ARH A;  4DUY B;  2VWJ A;  3GVM A;  5K1P A;  2BE3 A;  5BXZ A;  2M7W A;  1XMQ B;  4UV8 A;  3SJB C;  1V9P A;  3HKE B;  3OR6 C;  1Y6X A;  4JI1 O;  1E1Q G;  1R6T A;  4CH5 A;  5JVD A;  4JZG A;  5IJ0 B;  1IBM O;  2YEV B;  5KMG B;  3LSQ A;  5CBG A;  4BR6 A;  5GTI Z;  3LSU A;  4KP4 A;  1MSW D;  1M9N A;  2Q7H A;  2QWN B;  2UU9 O;  2JIZ G;  3FB5 C;  1VAR A;  4X20 B;  5CA0 A;  1AJN A;  1COW G;  2QE7 G;  2OTL V;  3BHP A;  3CJH A;  5F2V O;  4UFZ A;  5LYJ A;  5IY5 C;  1HWY A;  1G8M A;  1PL4 A;  1VF6 C;  4GKK O;  4UCU A;  5IYZ A;  1RPR A;  4FFK A;  3D8C A;  1RP3 B;  2EBO A;  2LGQ A;  4FVM A;  4Z1M G;  2UXD B;  4O4L A;  1Q8I A;  3IC7 A;  4JI6 B;  2AXT Z;  2RMK B;  1URF A;  2EJ7 A;  1EN5 A;  3ZBH A;  2X6B A;  1T5E A;  3ZMZ A;  2YXH A;  4GYC B;  1TVK B;  4ZIB A;  2E5L O;  1WA8 A;  3ZRW A;  1Q3E A;  2ZE6 A;  3AG4 B;  4G28 B;  5H6Q A;  5IY5 B;  1X4T A;  4QPK A;  3SJA C;  3N27 A;  3G6E V;  4LF5 B;  4EKW A;  2BTQ B;  3Q4H B;  4PJ0 Z;  2DMX A;  1HNX B;  3SGI A;  3CHX A;  2L6L A;  2VRZ A;  1B04 A;  1EZV H;  3CRQ A;  4E4E A;  3TK1 A;  2Q4P A;  1IXM A;  4UB8 Z;  3VQW A;  2JEU A;  2ZDI C;  1DK1 A;  2ZIM A;  1VQ9 V;  2Q69 A;  2CDY A;  4WFF A;  5JCO A;  1IBL O;  4PI0 A;  4WFB V;  2FTK A;  4Q6G A;  5A9G A;  5DN6 G;  4DR1 B;  4P9P A;  4GCZ A;  1I0H A;  2ZCE A;  3FAV A;  1DTO A;  1VQK V;  3E22 A;  4X62 B;  4TV8 B;  5KHJ A;  4DV7 B;  3AG2 B;  3G80 A;  1NJI W;  2Q68 A;  4QE9 A;  3O65 A;  1SQQ H;  4I9W A;  2V7Q G;  1XL6 A;  3K04 A;  1NBM G;  3RFR A;  3ZMU A;  4X65 O;  3H1L H;  4TV9 B;  1M1K W;  1SA0 A;  5FPO A;  1F4M A;  1YIJ V;  4DW0 A;  3G71 V;  3JAK B;  3SR2 C;  1F51 A;  3BCC H;  3QG5 A;  1NZ6 A;  4IT5 A;  1XL4 A;  1XHZ A;  4F6R B;  4LF7 O;  1Q90 D;  5EZY A;  3OFN G;  2WWW A;  4BIO A;  3AG1 B;  3ZRX A;  3OMA B;  3BVO A;  5BZB A;  1HNZ B;  2O57 A;  4DR3 B;  5KX5 B;  2R70 A;  3EXA A;  5KUK A;  3L74 H;  3ASO C;  4DV1 B;  4NYK A;  2RN9 A;  5L3D A;  2BSK A;  2JJ2 G;  2ZXW C;  5EC1 C;  5LOV B;  3IJ4 A;  1PV0 A;  1K34 A;  5JWP A;  2RJZ A;  3ETQ A;  1AR5 A;  2R9I A;  5EBL C;  3S3W A;  2UXX A;  2KG7 B;  4JI2 O;  1WB7 A;  2EX3 A;  1KC8 W;  3ZHU A;  5B1A C;  4J10 A;  3A0R A;  1QVF U;  4JAA A;  4P30 A;  2JGD A;  1XHX A;  1S76 D;  4DV0 O;  1N34 O;  2Y4T A;  2UXC B;  2F1M A;  3CCQ V;  3FB7 C;  4RQE A;  3ASO B;  2PGG A;  3S3X A;  3AK3 A;  1JJ2 U;  2CAZ C;  2P67 A;  1AP6 A;  1KB9 F;  2ZXW B;  1V54 C;  2WLM A;  2HFE C;  4JV5 B;  1EN4 A;  4DYL A;  2P4K A;  2YID A;  4LWS B;  4X9Q A;  1UFI A;  4JPR A;  1VQL V;  5B1A B;  1NS1 A;  2ZE8 A;  1FJG B;  4X89 A;  1NTK H;  2GUZ B;  4FZ1 A;  3ABL B;  4PEL A;  2A0L A;  4GX0 A;  1HR0 B;  4LF8 B;  2GSM B;  4JI0 O;  1XQ8 A;  4G27 B;  5TIS Z;  3OGI B;  4RUE A;  3OAA G;  3D36 C;  1GN3 A;  5EK0 A;  3W7X A;  2CTW A;  1RPO A;  4CC5 A;  3OTO O;  2N05 A;  1R3I C;  3B40 A;  1N0N A;  2FML A;  4K8Z A;  1JFF A;  1FD9 A;  2Q7E A;  1HNX O;  4I50 B;  3FX7 A;  2Q0A A;  2HHH B;  3B4S A;  5CBF A;  3E8H A;  3RBZ A;  5FL7 G;  4O4J B;  1PKX A;  3ZHT A;  4EEQ A;  4LH7 A;  5H9C A;  2B9Z A;  3H01 A;  1WP8 A;  1W0J G;  3HKB B;  4R6Z A;  1M5I A;  4JYA O;  4HNA A;  1I94 O;  3ZHR A;  1KQS U;  4CC6 A;  2XAQ A;  3JYC A;  1OJH A;  1YTF B;  1IXB A;  2WAM A;  3W7T A;  1K9M W;  2IU3 A;  3E2E A;  4IL6 Z;  3WB1 A;  3I55 V;  4KUM A;  1LR1 A;  4BW9 A;  2OCC B;  1I08 A;  4DV7 O;  2HG5 C;  4JI1 B;  1FYJ A;  3RWR D;  4DRX A;  3P3P A;  3QTC A;  1IBM B;  1SRY A;  3ZHQ A;  1ZL8 B;  4YJ2 B;  1KU9 A;  1SET A;  4XDK A;  4O2A B;  1AB3 A;  5B5E Z;  4UVC A;  5IT9 N;  2Y0I A;  5H6R A;  2UU9 B;  2V1D A;  3ZJZ A;  2CE4 A;  3JD4 A;  1WN7 A;  2OIG A;  2LGW A;  3E8G A;  3M7M X;  2Q5Z A;  1LUW A;  1TAE A;  4AI8 A;  1FXH A;  1TA8 A;  3HKE A;  4ZI7 A;  2UXB O;  4RQF A;  5IJ0 A;  2YEV A;  3LDC A;  4JI4 B;  5LL6 Y;  1J5E B;  4Q20 A;  4GKK B;  5K1X A;  4H33 A;  3JAM N;  1MAB G;  5LBQ A;  4DR2 O;  2A7W A;  4NVP A;  2NLJ C;  4P9O A;  3F5W C;  1P49 A;  2P4V A;  3STZ C;  2W6I G;  2E3C A;  4X20 A;  1IZ3 A;  4WBN B;  1K92 A;  1L8D A;  3ABK C;  1D5A A;  1L1F A;  1GMG A;  1WLE A;  3G6B A;  4I5S A;  4TWK A;  1FXK C;  1B06 A;  4MVS A;  5IDJ A;  1GM8 A;  2VWK A;  4MW8 A;  4U7O A;  4CH4 A;  2YDE A;  2E5L B;  4MS2 A;  2OTJ V;  3W7S A;  1O9G A;  1XDC A;  2RDC A;  4B3S O;  4J80 A;  1MOF A;  1JOY A;  1H8E G;  2UXC O;  2LFR A;  4O4I A;  2Q6A A;  2JJ1 G;  1YZB A;  2UUA O;  1ZSP A;  5JH7 B;  3MHS C;  2PZS A;  1P4R A;  1TGO A;  2A9H A;  3JAL B;  3APO A;  5H2F Z;  4K35 A;  1K5S A;  4JAU A;  1YCI A;  1R73 A;  4JGS A;  4RO2 A;  2HLD G;  1MSD A;  1XUQ A;  3BY6 A;  4FM2 A;  4DR7 B;  1TVK A;  3C3T A;  1GRJ A;  5FPR A;  4DR5 O;  3CCS V;  1KP3 A;  2EZP A;  3RYF B;  5L3F A;  1HP8 A;  4I7Z B;  3CWB H;  1PP9 H;  1QR8 A;  4HAM A;  2W6J G;  4LFB O;  2ZM6 B;  3CMA V;  1EZJ A;  2BTQ A;  1NT2 B;  3Q4H A;  5KHK A;  2LQT A;  2ZR3 A;  4OX9 O;  4QNH B;  3APQ A;  1AI4 A;  3CCM V;  1Q5O A;  1FPO A;  2OWO A;  3OMN B;  4B7K A;  3ZRV A;  4UCR A;  2P5O A;  3K79 A;  2GTS A;  2W0X A;  3LNM B;  2DN9 A;  4IGG A;  4FJC C;  2WPD G;  4MVU A;  1R1B A;  2Y48 A;  1UJW B;  3RYI B;  4I55 A;  2FYU H;  1VP7 A;  4R50 A;  2Y4U A;  2ZQM A;  4X65 B; 
#chains in the Genus database with same CATH homology
 1WA8 B;  4LWS B;  2KG7 A;  3FAV A;  3Q4H B;  4GZR B;  3ZBH A;  3FD9 A;  3G80 A;  4I0X B;  2B9Z A;  3GVM A;  2VRZ A;  3O9O A;  1WA8 A;  3GWK C;  4LWS A;  2KG7 B;  3Q4H A;  2AZ0 A;  2DE0 X;  3FAV B;  2VS0 A;  3TXQ A;  3HR0 A;  3TXS A;  4ABM A;  2AZ2 A;  4I0X A;  3OGI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...