2AZ2A

Flock house virus b2-dsrna complex (p4122)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
total genus 24
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az2A00
3Q4HA 2VRZA 4GZRB 4LWSB 3TXSA 2VS0A 2AZ0A 2DE0X 3FAVA 4LWSA 3G80A 2B9ZA 4ABMA 3GWKC 3FAVB 3TXQA 2KG7B 3GVMA 4I0XB 3OGIB 3FD9A 1WA8A 2KG7A 3HR0A 3ZBHA 4I0XA 3O9OA 3Q4HB 2AZ2A 1WA8B
chains in the Genus database with same CATH superfamily
3W7TA 2HEPA 2YIBD 3E8HA 2HHHO 4X66B 1LR1A 3T4ZA 3CB2A 3JD0A 2Q69A 3HKDB 4B3RO 4GX1A 1W2BU 5LGNA 3OT7A 4WBNB 1SZTA 1SKVA 1K92A 1PPJH 3LUTB 3AG3C 4BIZA 4UCVA 1IBLO 4DV4O 4X64B 4K0KO 2ZE8A 2VS0A 2FYUH 4B3SO 2XAHA 4WFEA 2Q8VA 3K9AA 1KP3A 5J2UA 5LMUO 1DGSA 4H13B 2YEVA 1RSOB 4MVRA 1JA8A 1NTMH 4MVMA 2QKAA 2LQTA 1Q6IA 3OMIB 2CAZC 2QGNA 4YJ3A 3AG4C 4JF3A 5LMNO 2Q7GA 1Y74A 4I5SA 1GH6A 5H2FZ 2Z0AA 2X0LA 3T1CA 2FL4A 4NXMO 1GMGA 2ZNIA 4O4HB 1CP9A 1LNQA 1TAEA 2IU0A 1ZLZA 2F1MA 5EBMC 1MZFA 1W0JG 4UUJC 1KYOF 3CRRA 5DEDA 4YY3O 4DRXB 1NJIW 3WB0A 3M8AA 1AI4A 1QQCA 3UM7A 1FAFA 1W0KG 3EXAA 3MD0A 1JMKC 3VQXA 1IURA 4JAAA 4J42A 2A3QA 3ZN1A 3TXSA 1YJNV 5LA6B 4DV0B 4I0XB 5E79Z 4NR1A 1K5QA 4DR3O 4I50A 2JJ2G 3WG7B 5KHIA 4IHJB 2FMLA 2IH1C 1CPYA 3E8FA 1M56C 4X9QA 3KCXA 3B77A 3ZHQA 5KX5A 2Y0PA 3T2MA 2IJJA 4I0XA 4LF4O 1QU7A 1NT2B 1YJ9V 4WCEV 1SZXA 2Y4TA 3P32A 2VQFO 4UXNA 5JVDA 2WA4A 3ZMUA 3KKYA 1DF5A 1SC5B 4JASA 2E5LB 4AI8A 4JV5O 2ZM6O 1DK1A 4UB6Z 3JATA 3QVNA 3AK2A 5IJ9B 4R8CA 4DV4B 1FFXA 2IBZH 5CA0B 3WU2Z 1VQ8V 1MSDA 3K79A 2WA3A 4J41A 1Y74B 3ETDA 3AK3A 4N21A 4JI7O 2EJ7A 2RQ6A 4JYAO 3CX5F 5B3SB 2P90A 2KG7A 1NU1H 4X89A 1H2NA 1U97A 1W59A 5KMGA 4R7CA 2W6JG 4LF9O 1N34B 3K04A 3AG2B 3BA8A 4JI1O 4X8AA 3ZS8C 2QTSA 3ZHTA 1PNLA 4BW5A 5H5NA 3CPWU 1XNRO 3VQWA 1N36B 4UCUA 4NYKA 3SJCC 4DV5O 3RFRA 4UFZA 1AP6A 3K08A 2HJDA 4MVOA 3C3TA 3KCYA 2O57A 1B6QA 4DR7B 3ZMVA 2E5LO 4JAUA 1Y4MA 4K3AA 3FAVA 4LC1A 3ZHSA 2QWNB 1Y76B 2AHYA 1CEZA 1US6A 4E2LA 4FLYA 3FD9A 3F7YC 1PNMA 3H1KH 2X6AA 4MVZA 4PJ0Z 5J9PC 4Q20A 1FXVA 2Z5UA 5H6RA 1E1QG 4TOIA 5EYPB 4BIOA 4LF5B 4DK1A 5LP6B 5CMUA 1OCOB 1S5JA 4IGGA 5KHKA 2YSUB 3T1YO 3G67A 4RQFA 4TV9B 1KKCA 2UXCB 1KMIZ 3G4SV 1DF4A 2Q5ZA 3CJHA 3JARB 3G71V 1BQ0A 3HKDA 3J81N 2JJ1G 3JSLA 1IXBA 3ASNC 4EKWA 2ZXWC 5KAIZ 3CCMV 4CBCA 1AI5A 2CTWA 4UV9A 4I55B 3AG3B 3OMNB 3VQVA 2CTPA 2OYQA 4GKJB 2K1EA 2QWOB 4B3TB 4N23A 3W7SA 1WLEA 2Q73A 3K06A 5IYZA 2ILMA 4J7KA 1Q90D 1ZAUA 2JIZG 3E83A 3RYHB 2NN4A 1O9HA 1YJWV 2XHBA 4YXWG 2BOCC 2A79B 5EZYA 3OEEG 2Y0IA 1SQGA 5J2UB 1Z5WA 2Y4UA 3CE2A 4NTXA 2LGQA 2VRZA 3B40A 1EN5A 4DV3B 3JAKA 1TVKA 1F51A 3SYPA 5K1PA 5LA6A 1VARA 2P4KA 3CC7V 3D8CA 3OTOO 1G4YB 1HNXB 4O4JB 1FXHA 4FFBA 5B66Z 2IW5A 4OGQB 3AK1A 4JTCB 5IYCO 4Z2WA 1JFFA 5B1BC 3E86A 1QLNA 3AG2C 5B3SC 1XNRB 4P9PA 1SA0A 4KHPO 5IWAO 4LF6B 3CCQV 3SPGA 2DQ0A 2YC0A 3FFQA 4LBEC 5EK0A 4GX2A 1NTZH 2ZT9B 1VQ5V 2ZCEA 1XHZA 4AHCA 3H1LH 5BMVB 5EC1C 4I9WA 5LP6A 5HFMA 2XNDG 2Q7EA 3LSQA 3C90A 5LBQA 3MAQA 2P67A 3DC6A 1K8AW 1M1KW 2DWDC 2YIAA 3G6EV 2HR3A 3MHSC 2NLJC 2A9HA 2KQXA 3ZBHA 1AB3A 1K33A 2AZ2A 5CBGA 2LW1A 3BPZA 4J10A 2ZR2A 2DJVA 2Q67A 2HG5C 1HNXO 3ABKC 3FAVB 2JRIA 4DV7B 1K9MW 2Y69C 1N32B 3HKCA 5ITZA 2BCCH 2R9IA 4DV1B 2W0XA 1OCOC 1R3IC 3ETEA 4JAVA 4LCUC 5KUMA 3FB6C 2DQ3A 3ASOC 4FK5C 4X1YA 4YHHB 1Q5OA 5JVDB 1XL4A 2DN9A 3T1HO 2RN9A 1WPBA 1VQLV 4PA7A 2BE3A 2DMXA 4UCTA 4WFBV 2YIDA 4X1KB 1OCRC 4NXNO 5DM6V 2Q7HA 3T4DA 3BA9A 2GHYA 2UUAO 2P22C 4XBFA 4UV8A 2F23A 4MT8A 2RCVA 3VOUA 1XNQB 1Y76A 3BEHA 3JASB 1URFA 3N2KA 1I08A 1IX9A 3W7UA 4CH6A 1EN4A 3JAKB 3OW2U 1JCHA 3H1IH 4PI2A 4PDLA 3TXQA 5LOVA 1F4MA 2WWWA 2PI4A 2UUCB 3N2GA 1YZBA 1P84F 4I4TB 2V7QG 3UO3A 1FJGB 4CZZA 1ROPA 5A9GA 1NR7A 2QJ1A 2YIBA 3K0GA 4O4LB 2PYLA 4UCOA 2AW9A 3LSSA 1SQQH 3QO8A 1YXBA 3P3NA 5AG2A 4MW3A 5L3EA 3RT3C 3GVMA 1QCEA 1Q82W 4JZGA 2L6LA 4WFFA 2KSDA 2WLIB 3A0BZ 1XEQA 2RNBA 3IC7A 1GAXA 2DYSC 3ASOB 1Q7YW 1S3JA 2AZ0A 4MW8A 4DR3B 5IJ0B 1SERA 3IGAC 5KX5B 2A06H 4JI5B 5GTIZ 2QWRB 2PZSA 1BZKA 4DR2O 2UXDO 2EJRA 1N34O 4P9OA 5B1BB 2LO1A 3OR6C 1G6UA 1Q8IA 4EB6A 2CDYA 1X4TA 2LJ2A 1KP2A 1N36O 4OX9B 2ZDIC 1NBMG 3DSQA 4K8ZA 1ZX3A 3VBBA 2R70A 2CTQA 1PNKA 1SA0B 1FFXB 2MW2B 4FZ1A 1HNZO 3SPJA 5CA3A 3O9OA 2WSSG 4ZI7B 4RO2A 4I9QA 1AJNA 3RVYA 1RM1C 1Q81W 3OUFA 4G27B 2CH7A 1M90W 4AILC 2JGUA 4X65B 5HFLA 3S3XA 3UKMA 2E76B 2YI9A 4JGSA 1AI7A 3K58A 2ATKC 2R72A 1WA8B 2EZPA 4MVUA 3A8TA 4QIWF 4FZ0A 2OWOA 3ZJZA 2N05A 2DYSB 4IIJA 5FNVA 3APOA 2QM4A 2EIKB 1NKDA 5EC2C 2RMKB 3ABUA 4O4IA 4B3MB 3SJBC 1VQ9V 3JSNA 5L3DA 1NR1A 3CWBH 3OD4A 1OJHA 4JTAB 3Q4HB 1I7FA 4GCZA 3CCLV 2XAQA 4GZRB 1J5EO 3OUSA 2DYRB 2NR5A 4JI4O 4NB5A 4DRXA 5FPRA 2ZE7A 4JI1B 1IBKB 2PY5A 2XAGA 2EINB 3H1HH 5LYJA 1V9PA 1SESA 1V55B 3L72H 3DXRB 1FKAO 3H01A 1KECA 2JS5A 1KBHA 4QPJA 4UVAA 2B5UA 4O2BB 1PKXA 4WBNA 2ZR3A 2WLLA 1SRYA 5JH7B 2HKOA 1SETA 1FPOA 4DR4B 3A0RA 2Q68A 2GDSA 4FLUA 4HAMA 2UU9O 3ABMC 1AP5A 1IDSA 4CS2A 3L73H 4LF5O 1R6TA 2UXXA 1S72V 1XMOO 4L87A 1IXMA 4I4TA 2HHHB 1K3EA 5IYBO 2W0FC 4LH7A 3F7VC 4JPRA 1FXKC 2EIMC 2EIJC 4DR2B 2UXDB 4BWAA 2RJZA 3LDCA 4JI7B 5IYDO 3JCZA 4DR1B 1P7BA 3TETA 4QGPA 3P30A 4DUYO 1KKDA 1SF9A 5JCOA 1PP9H 4X64O 1R3JC 4J80A 1RPOA 1L0NH 3FKSG 3ZMZA 5JJEB 4FLWA 3ICXA 5L3GA 3QF7A 1L1FA 3W7WA 4AQYB 4U7NA 1S76D 3CMAV 3JCUZ 1FD9A 2UXBO 4TV9A 3ABLC 5IY5B 3IJ4A 2QWQB 3ZN0A 3JALA 1K4CC 2XUMA 1EZJA 1BMFG 1YF2A 2BTQB 1R73A 5CA0A 3AG1B 3BAAA 4DR4O 4YIPA 2JGDB 3ZCCA 3UT5B 3ABTA 4DR7O 1N8RW 5EBWC 4MSWC 3SGIA 1VQMV 3RYCB 2LFSA 1SQBH 3K5OA 4OXSA 3E22A 3QG5A 2QM7A 3Q4HA 2P5OA 2ZIOA 2E74B 4X20B 5JQGA 4FFKA 3OM3B 4QNHB 1OCCB 2YXYA 1QR9A 3H1JH 1UPGA 5CB4A 3RVZA 3HKEB 4DV1O 4PA9A 2JDIG 3KZIZ 3DXRA 4YJ2A 1MMMA 1EBOA 1SQPH 3DTUB 3BRCA 3JAWB 2UXCO 1U96A 1XBLA 4ZOLB 4ZIBA 4IIJB 4O4LA 3GWOA 1S5HC 1T5EA 2QTOA 2VQEB 3ZMTA 1VF6C 1G1XB 3QO5A 5BR8O 2YUAA 1B04A 3CRCA 4MS2A 4F6EA 3E8GA 2ZE6A 3OR7C 1EZVH 3ZRXA 3ZRVA 3AG4B 2X7RB 2FTKA 4PV1B 2UUBB 4B3TO 2AHZA 5IY5C 1BQZA 3HKBA 1D5AA 1OCRB 4OPHA 1VP7A 1VMGA 3CC4V 1HR0B 1KD1W 5DN6G 3CRAA 4D7SA 4QJFB 4WFHA 1XMQO 5KAFZ 4O2BA 4DK0A 1QVFU 5IDJA 4W4LA 1TA8A 2KG7B 1E1RG 5B5EZ 1F7YA 4EEQA 4PA4A 1NQTA 1MSWD 3OE7G 4DV7O 4I55A 1HDJA 4K35A 3SYCA 1AR5A 1ENVA 2XAFA 3D36C 2IM9A 2YXHA 2HP8A 4JYCA 4DR5O 3L9DA 3PN1A 3KG2A 3CCRV 1QR8A 1VQPV 4JYAB 3E8BA 3N2GB 2PI5A 3B4SA 1MNGA 1LUVA 3I5DA 2WLNA 4XDKA 3K5NA 3CEIA 1OCZC 3HPLC 3X2QB 4ICGA 1TVKB 3G6BA 3I56V 1TUBA 3ETGA 2C2AA 4CC5A 4X20A 5JQGB 2BSKB 4UB8Z 1GK9A 4U3FH 3FB7C 2EULA 4TQFA 5FL7G 2OTLV 3FB8C 1H2MA 4YIOA 1AVMA 5EBLC 3THOA 2PUSA 3MHHC 3B8NA 3OGCC 2M6YA 4WFAV 1ZWIC 1FXKA 1MABG 2BTQA 2ZDIA 1KB9F 5KUKA 5KA5A 1QBZA 4ABMA 2AXTZ 4ZOLA 3CMEV 5KA6A 5LYJB 1YVWA 4GT1A 2Q9LA 4X1IA 5D5PA 2IH3C 3ZHUA 2QDOA 3K5MA 1XI1A 1KU9A 1BGYH 1JOYA 1R6NA 5KHHA 4B3MO 2YDEA 5FPOA 2A0LA 1AI6A 1MOFA 5BXZA 2JEUA 3IFXA 4JI8B 5KLVH 3TJTA 3BCCH 4L8JA 1XREA 4W4KA 3J7AU 2FB5A 3CRQA 5C93A 2ZXWB 4B7EA 1CXZB 3M99B 4JI5O 1QLEB 4JI4B 4FM1A 2D2CB 5LMNB 4GKKO 5EYPA 4JI2B 2ETNA 3QTCA 2ITCC 4XDLA 4RUFA 4J7JA 3SPCA 2Y69B 2OTJV 1HR0O 4LF7B 1GKFA 4PDVA 3STLC 3SJQC 4BW9A 4LF8O 5L3BA 1XMQB 2P6JA 4X65O 2UU9B 4DR6B 2WAMA 1SQVH 4LFAO 4PI0A 2EILB 1AJQA 2G38A 4B7KA 2EBOA 4ZKIA 5J2TB 4FLVA 1ZL8A 3L70H 3OGIB 1XDCA 1TGOA 3M7MX 2ZQMA 1HP8A 1GN3A 3F5WC 4DV6B 3CXHF 3RYIB 4JYYA 4BR6A 4LWSB 1Q3EA 3UT5A 4NTYA 4DV3O 3GWKC 2P7TC 3SPIA 1Z5VA 4LFBB 3IAYA 5LGTA 5B1NA 2DOSA 3N27A 5A2QN 5LHIA 2BSKA 4MVQA 4DUYB 1I94B 1ZL8B 1WB7A 1IBMB 5GTHZ 3WB2A 5JJJB 4FVMA 1MG1A 5F2VO 1AJPA 1HNWB 2HVKC 5GONB 4TUYB 1I5XA 3E22B 1Q86W 3JYCA 2BTOA 1JX9A 1ZUQA 1GRJA 4DUZB 2WLKA 3DGEA 1FXKB 1BL8A 4F6RA 3AG7A 3E35A 2Q0OC 3NXSA 3LNNA 3SR2C 1AR1B 4Z1MG 3SJAC 1G8MA 4O2AB 2HFEC 1N4CA 1OV9A 3RBZA 2DWEC 4HYOA 2OIGA 2GUZB 1IBKO 2GTAA 2Z3YA 4GKJO 4DR6O 1WP8A 4KUMA 1Q6HA 5GONA 5B1AC 1JR9A 4H0LB 4H37A 1R3KC 5H9CA 1TUBB 4JYBA 4PA6A 1QNMA 2FKXA 3QO7A 2XT9A 1M93A 3CJHB 3LDEA 3JAMN 2CK3G 3D36A 1M57B 4IHJA 5BZBA 2PTMA 4O4HA 3ML0A 2M7WA 4PDMA 4U3JA 1GTOA 3OTFA 4J7ZA 4PD4F 4B08A 5BMVA 3P3PA 4DXWA 4RAIA 2ADQB 4K8XA 1XMOB 2H94A 2OIEA 2HLDG 3JD3A 5C8YB 2XTAA 3BABA 5LXTB 1WB8A 1Q43A 5LGUA 1DLBA 3U10A 1YDXA 2V4DA 3WG7C 4FLTA 3CCEV 4TQDA 3RYFA 3K03A 4DUZO 4TT3G 4AQYO 2JGDA 1YITV 1ORQC 4YHHO 5BR8B 2QR4A 1VF6A 1I5YA 4X88A 5C8YA 1JJOA 4Z1VA 5KHJA 1WA8A 1VQ4V 4E4EA 1GM8A 4CS3A 3UCSC 1YTFD 4GUNA 1DTOA 5FNVB 1NH2B 2UXBB 1EM1A 2AGAA 2UUAB 4G2KA 2N74A 4LWSA 4O4JA 3ZHVA 3R66A 4LH6A 1EN6A 3A0HZ 3CCVV 4PHZA 4G28B 1NS1A 4TV8B 2UUCO 4B3RB 1QHTA 4D6TH 4JI3O 4JI6O 1AILA 1FFTB 3N2KB 4R6ZA 3CCJV 1GN2A 4FPPA 4IT5A 1VQNV 2B1IA 3K0DA 3U0ZA 5D5QA 3BY6A 1M57C 1I94O 1IBMO 4WF9V 1VF7A 1BSMA 3R65A 3APQA 2F93B 4H33A 3JATB 4K0KB 2ITDC 1K73W 4CH4A 1VQOV 2YI8A 3RWRD 1N0JA 4HZ3A 2JS3A 5LMUB 3JD1A 4UVBA 5LP6C 3E2EA 3T1HB 2X6CA 3JD4A 3LDDA 2ARHA 3TCUA 1VQ7V 5CB4B 3SPHA 3FX7A 2W6IG 3C3SA 4JI0B 2XOKG 3LSUA 3FYIB 1FS0G 3O65A 2QWPB 4NKGB 3SYAA 3CRMA 2DE0X 5J2TA 2UXNA 4GYCB 4DV2O 2B9ZA 2EIJB 1MA1A 4ZHQA 3CHXA 2WLMA 2OCHA 5E1AC 3CC2V 1PM9A 4HNAB 4GX5A 3D3IA 4EB6B 4JI3B 4JI6B 2K9PA 1NZ6A 1AROP 1I0HA 1K7DA 1KC8W 5JCOC 1HNZB 2WLHA 2R9AA 2IU3A 1RM1B 4PDRA 5JWPA 1TUEB 1VQKV 4KFMA 5JH7A 1GM9A 4CH3A 2JEXA 2HVJC 1H2KA 1Z2GA 3SDLA 4MTGA 3B09A 3FYEB 2YS8A 1WP7A 2Q4PA 3JASA 4J9ZB 3J80N 1S5LZ 3CSXA 4KL1A 1H2LA 2A7WA 2F95B 4LF6O 3PJSK 1IBLB 1WJZA 2EILC 3ASNB 2DYRC 1RPRA 2VWJA 3K59A 4MTOA 1WN7A 2X6BA 2QSAA 3ZRWB 2GTSA 1KQSU 5EIBC 4GKKB 2OT5A 4MVSA 2WPDG 2E3CA 2Q0AA 4HBNA 4DV2B 4I7ZB 3TGUH 3CYOA 4CS4A 3HB3B 1RFYA 3ZEDA 1KUQA 4LF7O 2OCCB 3TK1A 2EINC 1Y66A 1S77D 3CD6V 5KMGB 3STZC 1BT8A 3EHBB 4U3JB 3FB5C 3ABMB 1R1BA 4FFBB 1B3QA 4LFAB 5LL6Y 4FLZA 4NXMB 3JAWA 1VQ6V 2ZM6B 2LP7A 1QVGU 5EIBD 3OTOB 1K34A 1WPXA 1X59A 3UO2A 4NVPA 1N32O 4YY3B 2ADPA 2D3OW 4DW0A 3ZX6A 2L35A 4JZ2A 4WFGA 1JJ2U 5EZYB 5LHGA 1OCZB 3JD2A 2ZKOA 4JI8O 4BAYA 1P7GA 2BOBC 4OPAA 1L0LH 5B1AB 4KHPB 1FYJA 3F5TA 5JJNB 4MTXA 2HJFC 3MDSA 1GN6A 1ZTEA 4C7UA 3RGBA 4RQEA 2EIMB 1YEWA 2IJKA 1BE3H 5FLXN 3K9SA 1NH2D 1VEWA 2QM8A 2ZINA 2YICA 4IL6Z 1YHQV 4DYLA 4DR1O 1YTFB 4JTDB 2VWKA 4H44B 2PGGA 4FLXA 5LHHA 1P4RA 1XHXA 4CC6A 3E89A 3L75H 4LFCB 4D7TA 2QEXV 3W7XA 5IJ0A 1YIJV 5CA1A 4LF8B 4TV8A 3RYFB 1V55C 1XL6A 4I50B 3AEIA 4X62O 4JV5B 4MTFA 1F23A 2EX3A 3WB1A 1PL0A 5K1XA 1R6KA 2OCCC 2VQFB 4X1KA 3U11A 3CCUV 1SQXH 1N33B 1OCCC 3S3WA 4KP4A 1OZ0A 4TUYA 1XQ8A 3K3WA 1UJWB 1JFFB 1PL4A 2IJHA 1K5SA 1VF5B 5CN0A 1M5IA 1M9NA 4F6RB 4LP8A 5BY1A 2F4VO 5IE9A 2Q6AA 2CE4A 4EFBA 1MZEA 3BVOA 4LR3A 3RYCA 1K4DC 1IZ3A 4O2AA 3VQYA 4FIPC 1R3LC 4LF9B 2GUZA 1Y6XA 3OAAG 3H9VA 4LFBO 1EFRG 4CH5A 4DV0O 5IJ9A 5L3CA 4QE9A 2LW7A 1B06A 1XNQO 4FJCC 3ZIAG 4OX9O 3EFFK 1H2GA 2Y48A 2WLLB 4LFCO 2F66C 1HNWO 5GW7A 1PV0A 3OFNG 1YCIA 2P4VA 1WAZA 3HKBB 2JK5C 4UCRA 5L3FA 2B1GA 2WLIA 4UCSA 2RDCA 3HR0A 2QA4V 1FJGO 1UFIA 3NR7A 4X62B 2XASA 1RSOA 1XOUA 2WLJA 3SYOA 1COWG 4DV5B 3AG1C 4LF4B 4QPKA 2H8PC 1AR4A 1H8EG 4YJ3B 1N33O 3G80A 2KKWA 4F4LA 1A32A 1NVPD 2UUBO 2YXLA 4P2ZA 3OMAB 4U7OA 3HKCB 5ITZB 3DC5A 4GLXA 2GV9A 5CBFA 2ODMA 5H6QA 3ZMSA 2ZIMA 1RP3B 4X1YB 2F4VB 4XDJA 1GN4A 4DV6O 1XILA 3IC9A 1SQFA 1K97A 2QKSA 1N0NA 4LNUB 5IT9N 1IVSA 2CGOA 5CA1B 2YEVB 3ABLB 2JVDA 1M4UA 2V1DA 1XUQA 2LGWA 1BCCH 3ZRSA 1JVMA 4HNAA 3ZHRA 4ASUG 4TWKA 1NVPB 2DW4A 3CCSV 1J95A 2CGNA 1ZSPA 2N04A 4IYHA 5IWAB 1THZA 2EIKC 4FM2A 4TSFG 3ETQA 1D5NA 2GSMB 3L71H 2CTRA 4B3SB 3EVKA 2CH7B 1Y67A 2LFRA 2ZE5A 1NTKH 1D2DA 2GBOA 4DR5B 4DO2A 1S0VA 1OHHG 2R9RB 1GO3F 3D3QA 3RYIA 5LXTA 3K5LA 2VQEO 1P49A 1H2SB 4A5UB 4RWUA 2MK3A 1BHBA 2E75B 3OEHG 3QNEA 4PA3A 4O4IB 4PELA 3B8MA 2H3OA 4IYIA 5TISZ 2NNUA 1V54B 1WNSA 5B1OA 4X1IB 2QE7G 4YJ2B 4EFEA 5CBHA 4RUEA 3ZRWA 3RN4A 4FM0A 4BIUA 3JALB 2ZD9A 3CXCU 1BS3A 4J11A 4ZBMA 2KB1A 3CP1A 4X66O 2QKCA 3RW0A 5IYZB 1HW7A 1L8DA 5KHGA 3RYHA 4DW1A 4QE7A 2EZOA 4GX0A 4NTWA 1V54C 1YSCA 5LOVB 2PF4E 3T1YB 3X2QC 3LNMB 1NI8A 1JQ0A 3A2FA 4Q6GA 1J5EB 1O9GA 3BHPA 4ZHQB 1YI2V 3BFRA 4NXNB 3ABKB 2P06A 1SS3A 1M56B 1H8HG 1H38A 1Q6UA 1BHAA 3K57A 4ZI7A 2XAJA 3L74H 3HKEA 2F43G 1QLEC 1GM7A 1HWYA 3UQ8A 4FMTA 3WFVA 1LUWA 4UVCA 4LNUA 1JPXA 4JI0O 3GB7C 1E79G 1VIBA 4R50A 3SYQA 4JI2O 4P30A 3B2EE 1PD3A 2ZNJA 2CUGA 3JARA 1F4NA 2IJIA 5DECA 4KXRA 3I55V 3CS5A 2PYJA 4J9YB
chains in the Genus database with same CATH topology
3Q4HA 2VRZA 4GZRB 4LWSB 3TXSA 2VS0A 2AZ0A 2DE0X 3FAVA 4LWSA 3G80A 2B9ZA 4ABMA 3GWKC 3FAVB 3TXQA 2KG7B 3GVMA 4I0XB 3OGIB 3FD9A 1WA8A 2KG7A 3HR0A 3ZBHA 4I0XA 3O9OA 3Q4HB 2AZ2A 1WA8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4H A;  2VRZ A;  4GZR B;  4LWS B;  3TXS A;  2VS0 A;  2AZ0 A;  2DE0 X;  3FAV A;  4LWS A;  3G80 A;  2B9Z A;  4ABM A;  3GWK C;  3FAV B;  3TXQ A;  2KG7 B;  3GVM A;  4I0X B;  3OGI B;  3FD9 A;  1WA8 A;  2KG7 A;  3HR0 A;  3ZBH A;  4I0X A;  3O9O A;  3Q4H B;  2AZ2 A;  1WA8 B; 
#chains in the Genus database with same CATH topology
 3W7T A;  2HEP A;  2YIB D;  3E8H A;  2HHH O;  4X66 B;  1LR1 A;  3T4Z A;  3CB2 A;  3JD0 A;  2Q69 A;  3HKD B;  4B3R O;  4GX1 A;  1W2B U;  5LGN A;  3OT7 A;  4WBN B;  1SZT A;  1SKV A;  1K92 A;  1PPJ H;  3LUT B;  3AG3 C;  4BIZ A;  4UCV A;  1IBL O;  4DV4 O;  4X64 B;  4K0K O;  2ZE8 A;  2VS0 A;  2FYU H;  4B3S O;  2XAH A;  4WFE A;  2Q8V A;  3K9A A;  1KP3 A;  5J2U A;  5LMU O;  1DGS A;  4H13 B;  2YEV A;  1RSO B;  4MVR A;  1JA8 A;  1NTM H;  4MVM A;  2QKA A;  2LQT A;  1Q6I A;  3OMI B;  2CAZ C;  2QGN A;  4YJ3 A;  3AG4 C;  4JF3 A;  5LMN O;  2Q7G A;  1Y74 A;  4I5S A;  1GH6 A;  5H2F Z;  2Z0A A;  2X0L A;  3T1C A;  2FL4 A;  4NXM O;  1GMG A;  2ZNI A;  4O4H B;  1CP9 A;  1LNQ A;  1TAE A;  2IU0 A;  1ZLZ A;  2F1M A;  5EBM C;  1MZF A;  1W0J G;  4UUJ C;  1KYO F;  3CRR A;  5DED A;  4YY3 O;  4DRX B;  1NJI W;  3WB0 A;  3M8A A;  1AI4 A;  1QQC A;  3UM7 A;  1FAF A;  1W0K G;  3EXA A;  3MD0 A;  1JMK C;  3VQX A;  1IUR A;  4JAA A;  4J42 A;  2A3Q A;  3ZN1 A;  3TXS A;  1YJN V;  5LA6 B;  4DV0 B;  4I0X B;  5E79 Z;  4NR1 A;  1K5Q A;  4DR3 O;  4I50 A;  2JJ2 G;  3WG7 B;  5KHI A;  4IHJ B;  2FML A;  2IH1 C;  1CPY A;  3E8F A;  1M56 C;  4X9Q A;  3KCX A;  3B77 A;  3ZHQ A;  5KX5 A;  2Y0P A;  3T2M A;  2IJJ A;  4I0X A;  4LF4 O;  1QU7 A;  1NT2 B;  1YJ9 V;  4WCE V;  1SZX A;  2Y4T A;  3P32 A;  2VQF O;  4UXN A;  5JVD A;  2WA4 A;  3ZMU A;  3KKY A;  1DF5 A;  1SC5 B;  4JAS A;  2E5L B;  4AI8 A;  4JV5 O;  2ZM6 O;  1DK1 A;  4UB6 Z;  3JAT A;  3QVN A;  3AK2 A;  5IJ9 B;  4R8C A;  4DV4 B;  1FFX A;  2IBZ H;  5CA0 B;  3WU2 Z;  1VQ8 V;  1MSD A;  3K79 A;  2WA3 A;  4J41 A;  1Y74 B;  3ETD A;  3AK3 A;  4N21 A;  4JI7 O;  2EJ7 A;  2RQ6 A;  4JYA O;  3CX5 F;  5B3S B;  2P90 A;  2KG7 A;  1NU1 H;  4X89 A;  1H2N A;  1U97 A;  1W59 A;  5KMG A;  4R7C A;  2W6J G;  4LF9 O;  1N34 B;  3K04 A;  3AG2 B;  3BA8 A;  4JI1 O;  4X8A A;  3ZS8 C;  2QTS A;  3ZHT A;  1PNL A;  4BW5 A;  5H5N A;  3CPW U;  1XNR O;  3VQW A;  1N36 B;  4UCU A;  4NYK A;  3SJC C;  4DV5 O;  3RFR A;  4UFZ A;  1AP6 A;  3K08 A;  2HJD A;  4MVO A;  3C3T A;  3KCY A;  2O57 A;  1B6Q A;  4DR7 B;  3ZMV A;  2E5L O;  4JAU A;  1Y4M A;  4K3A A;  3FAV A;  4LC1 A;  3ZHS A;  2QWN B;  1Y76 B;  2AHY A;  1CEZ A;  1US6 A;  4E2L A;  4FLY A;  3FD9 A;  3F7Y C;  1PNM A;  3H1K H;  2X6A A;  4MVZ A;  4PJ0 Z;  5J9P C;  4Q20 A;  1FXV A;  2Z5U A;  5H6R A;  1E1Q G;  4TOI A;  5EYP B;  4BIO A;  4LF5 B;  4DK1 A;  5LP6 B;  5CMU A;  1OCO B;  1S5J A;  4IGG A;  5KHK A;  2YSU B;  3T1Y O;  3G67 A;  4RQF A;  4TV9 B;  1KKC A;  2UXC B;  1KMI Z;  3G4S V;  1DF4 A;  2Q5Z A;  3CJH A;  3JAR B;  3G71 V;  1BQ0 A;  3HKD A;  3J81 N;  2JJ1 G;  3JSL A;  1IXB A;  3ASN C;  4EKW A;  2ZXW C;  5KAI Z;  3CCM V;  4CBC A;  1AI5 A;  2CTW A;  4UV9 A;  4I55 B;  3AG3 B;  3OMN B;  3VQV A;  2CTP A;  2OYQ A;  4GKJ B;  2K1E A;  2QWO B;  4B3T B;  4N23 A;  3W7S A;  1WLE A;  2Q73 A;  3K06 A;  5IYZ A;  2ILM A;  4J7K A;  1Q90 D;  1ZAU A;  2JIZ G;  3E83 A;  3RYH B;  2NN4 A;  1O9H A;  1YJW V;  2XHB A;  4YXW G;  2BOC C;  2A79 B;  5EZY A;  3OEE G;  2Y0I A;  1SQG A;  5J2U B;  1Z5W A;  2Y4U A;  3CE2 A;  4NTX A;  2LGQ A;  2VRZ A;  3B40 A;  1EN5 A;  4DV3 B;  3JAK A;  1TVK A;  1F51 A;  3SYP A;  5K1P A;  5LA6 A;  1VAR A;  2P4K A;  3CC7 V;  3D8C A;  3OTO O;  1G4Y B;  1HNX B;  4O4J B;  1FXH A;  4FFB A;  5B66 Z;  2IW5 A;  4OGQ B;  3AK1 A;  4JTC B;  5IYC O;  4Z2W A;  1JFF A;  5B1B C;  3E86 A;  1QLN A;  3AG2 C;  5B3S C;  1XNR B;  4P9P A;  1SA0 A;  4KHP O;  5IWA O;  4LF6 B;  3CCQ V;  3SPG A;  2DQ0 A;  2YC0 A;  3FFQ A;  4LBE C;  5EK0 A;  4GX2 A;  1NTZ H;  2ZT9 B;  1VQ5 V;  2ZCE A;  1XHZ A;  4AHC A;  3H1L H;  5BMV B;  5EC1 C;  4I9W A;  5LP6 A;  5HFM A;  2XND G;  2Q7E A;  3LSQ A;  3C90 A;  5LBQ A;  3MAQ A;  2P67 A;  3DC6 A;  1K8A W;  1M1K W;  2DWD C;  2YIA A;  3G6E V;  2HR3 A;  3MHS C;  2NLJ C;  2A9H A;  2KQX A;  3ZBH A;  1AB3 A;  1K33 A;  2AZ2 A;  5CBG A;  2LW1 A;  3BPZ A;  4J10 A;  2ZR2 A;  2DJV A;  2Q67 A;  2HG5 C;  1HNX O;  3ABK C;  3FAV B;  2JRI A;  4DV7 B;  1K9M W;  2Y69 C;  1N32 B;  3HKC A;  5ITZ A;  2BCC H;  2R9I A;  4DV1 B;  2W0X A;  1OCO C;  1R3I C;  3ETE A;  4JAV A;  4LCU C;  5KUM A;  3FB6 C;  2DQ3 A;  3ASO C;  4FK5 C;  4X1Y A;  4YHH B;  1Q5O A;  5JVD B;  1XL4 A;  2DN9 A;  3T1H O;  2RN9 A;  1WPB A;  1VQL V;  4PA7 A;  2BE3 A;  2DMX A;  4UCT A;  4WFB V;  2YID A;  4X1K B;  1OCR C;  4NXN O;  5DM6 V;  2Q7H A;  3T4D A;  3BA9 A;  2GHY A;  2UUA O;  2P22 C;  4XBF A;  4UV8 A;  2F23 A;  4MT8 A;  2RCV A;  3VOU A;  1XNQ B;  1Y76 A;  3BEH A;  3JAS B;  1URF A;  3N2K A;  1I08 A;  1IX9 A;  3W7U A;  4CH6 A;  1EN4 A;  3JAK B;  3OW2 U;  1JCH A;  3H1I H;  4PI2 A;  4PDL A;  3TXQ A;  5LOV A;  1F4M A;  2WWW A;  2PI4 A;  2UUC B;  3N2G A;  1YZB A;  1P84 F;  4I4T B;  2V7Q G;  3UO3 A;  1FJG B;  4CZZ A;  1ROP A;  5A9G A;  1NR7 A;  2QJ1 A;  2YIB A;  3K0G A;  4O4L B;  2PYL A;  4UCO A;  2AW9 A;  3LSS A;  1SQQ H;  3QO8 A;  1YXB A;  3P3N A;  5AG2 A;  4MW3 A;  5L3E A;  3RT3 C;  3GVM A;  1QCE A;  1Q82 W;  4JZG A;  2L6L A;  4WFF A;  2KSD A;  2WLI B;  3A0B Z;  1XEQ A;  2RNB A;  3IC7 A;  1GAX A;  2DYS C;  3ASO B;  1Q7Y W;  1S3J A;  2AZ0 A;  4MW8 A;  4DR3 B;  5IJ0 B;  1SER A;  3IGA C;  5KX5 B;  2A06 H;  4JI5 B;  5GTI Z;  2QWR B;  2PZS A;  1BZK A;  4DR2 O;  2UXD O;  2EJR A;  1N34 O;  4P9O A;  5B1B B;  2LO1 A;  3OR6 C;  1G6U A;  1Q8I A;  4EB6 A;  2CDY A;  1X4T A;  2LJ2 A;  1KP2 A;  1N36 O;  4OX9 B;  2ZDI C;  1NBM G;  3DSQ A;  4K8Z A;  1ZX3 A;  3VBB A;  2R70 A;  2CTQ A;  1PNK A;  1SA0 B;  1FFX B;  2MW2 B;  4FZ1 A;  1HNZ O;  3SPJ A;  5CA3 A;  3O9O A;  2WSS G;  4ZI7 B;  4RO2 A;  4I9Q A;  1AJN A;  3RVY A;  1RM1 C;  1Q81 W;  3OUF A;  4G27 B;  2CH7 A;  1M90 W;  4AIL C;  2JGU A;  4X65 B;  5HFL A;  3S3X A;  3UKM A;  2E76 B;  2YI9 A;  4JGS A;  1AI7 A;  3K58 A;  2ATK C;  2R72 A;  1WA8 B;  2EZP A;  4MVU A;  3A8T A;  4QIW F;  4FZ0 A;  2OWO A;  3ZJZ A;  2N05 A;  2DYS B;  4IIJ A;  5FNV A;  3APO A;  2QM4 A;  2EIK B;  1NKD A;  5EC2 C;  2RMK B;  3ABU A;  4O4I A;  4B3M B;  3SJB C;  1VQ9 V;  3JSN A;  5L3D A;  1NR1 A;  3CWB H;  3OD4 A;  1OJH A;  4JTA B;  3Q4H B;  1I7F A;  4GCZ A;  3CCL V;  2XAQ A;  4GZR B;  1J5E O;  3OUS A;  2DYR B;  2NR5 A;  4JI4 O;  4NB5 A;  4DRX A;  5FPR A;  2ZE7 A;  4JI1 B;  1IBK B;  2PY5 A;  2XAG A;  2EIN B;  3H1H H;  5LYJ A;  1V9P A;  1SES A;  1V55 B;  3L72 H;  3DXR B;  1FKA O;  3H01 A;  1KEC A;  2JS5 A;  1KBH A;  4QPJ A;  4UVA A;  2B5U A;  4O2B B;  1PKX A;  4WBN A;  2ZR3 A;  2WLL A;  1SRY A;  5JH7 B;  2HKO A;  1SET A;  1FPO A;  4DR4 B;  3A0R A;  2Q68 A;  2GDS A;  4FLU A;  4HAM A;  2UU9 O;  3ABM C;  1AP5 A;  1IDS A;  4CS2 A;  3L73 H;  4LF5 O;  1R6T A;  2UXX A;  1S72 V;  1XMO O;  4L87 A;  1IXM A;  4I4T A;  2HHH B;  1K3E A;  5IYB O;  2W0F C;  4LH7 A;  3F7V C;  4JPR A;  1FXK C;  2EIM C;  2EIJ C;  4DR2 B;  2UXD B;  4BWA A;  2RJZ A;  3LDC A;  4JI7 B;  5IYD O;  3JCZ A;  4DR1 B;  1P7B A;  3TET A;  4QGP A;  3P30 A;  4DUY O;  1KKD A;  1SF9 A;  5JCO A;  1PP9 H;  4X64 O;  1R3J C;  4J80 A;  1RPO A;  1L0N H;  3FKS G;  3ZMZ A;  5JJE B;  4FLW A;  3ICX A;  5L3G A;  3QF7 A;  1L1F A;  3W7W A;  4AQY B;  4U7N A;  1S76 D;  3CMA V;  3JCU Z;  1FD9 A;  2UXB O;  4TV9 A;  3ABL C;  5IY5 B;  3IJ4 A;  2QWQ B;  3ZN0 A;  3JAL A;  1K4C C;  2XUM A;  1EZJ A;  1BMF G;  1YF2 A;  2BTQ B;  1R73 A;  5CA0 A;  3AG1 B;  3BAA A;  4DR4 O;  4YIP A;  2JGD B;  3ZCC A;  3UT5 B;  3ABT A;  4DR7 O;  1N8R W;  5EBW C;  4MSW C;  3SGI A;  1VQM V;  3RYC B;  2LFS A;  1SQB H;  3K5O A;  4OXS A;  3E22 A;  3QG5 A;  2QM7 A;  3Q4H A;  2P5O A;  2ZIO A;  2E74 B;  4X20 B;  5JQG A;  4FFK A;  3OM3 B;  4QNH B;  1OCC B;  2YXY A;  1QR9 A;  3H1J H;  1UPG A;  5CB4 A;  3RVZ A;  3HKE B;  4DV1 O;  4PA9 A;  2JDI G;  3KZI Z;  3DXR A;  4YJ2 A;  1MMM A;  1EBO A;  1SQP H;  3DTU B;  3BRC A;  3JAW B;  2UXC O;  1U96 A;  1XBL A;  4ZOL B;  4ZIB A;  4IIJ B;  4O4L A;  3GWO A;  1S5H C;  1T5E A;  2QTO A;  2VQE B;  3ZMT A;  1VF6 C;  1G1X B;  3QO5 A;  5BR8 O;  2YUA A;  1B04 A;  3CRC A;  4MS2 A;  4F6E A;  3E8G A;  2ZE6 A;  3OR7 C;  1EZV H;  3ZRX A;  3ZRV A;  3AG4 B;  2X7R B;  2FTK A;  4PV1 B;  2UUB B;  4B3T O;  2AHZ A;  5IY5 C;  1BQZ A;  3HKB A;  1D5A A;  1OCR B;  4OPH A;  1VP7 A;  1VMG A;  3CC4 V;  1HR0 B;  1KD1 W;  5DN6 G;  3CRA A;  4D7S A;  4QJF B;  4WFH A;  1XMQ O;  5KAF Z;  4O2B A;  4DK0 A;  1QVF U;  5IDJ A;  4W4L A;  1TA8 A;  2KG7 B;  1E1R G;  5B5E Z;  1F7Y A;  4EEQ A;  4PA4 A;  1NQT A;  1MSW D;  3OE7 G;  4DV7 O;  4I55 A;  1HDJ A;  4K35 A;  3SYC A;  1AR5 A;  1ENV A;  2XAF A;  3D36 C;  2IM9 A;  2YXH A;  2HP8 A;  4JYC A;  4DR5 O;  3L9D A;  3PN1 A;  3KG2 A;  3CCR V;  1QR8 A;  1VQP V;  4JYA B;  3E8B A;  3N2G B;  2PI5 A;  3B4S A;  1MNG A;  1LUV A;  3I5D A;  2WLN A;  4XDK A;  3K5N A;  3CEI A;  1OCZ C;  3HPL C;  3X2Q B;  4ICG A;  1TVK B;  3G6B A;  3I56 V;  1TUB A;  3ETG A;  2C2A A;  4CC5 A;  4X20 A;  5JQG B;  2BSK B;  4UB8 Z;  1GK9 A;  4U3F H;  3FB7 C;  2EUL A;  4TQF A;  5FL7 G;  2OTL V;  3FB8 C;  1H2M A;  4YIO A;  1AVM A;  5EBL C;  3THO A;  2PUS A;  3MHH C;  3B8N A;  3OGC C;  2M6Y A;  4WFA V;  1ZWI C;  1FXK A;  1MAB G;  2BTQ A;  2ZDI A;  1KB9 F;  5KUK A;  5KA5 A;  1QBZ A;  4ABM A;  2AXT Z;  4ZOL A;  3CME V;  5KA6 A;  5LYJ B;  1YVW A;  4GT1 A;  2Q9L A;  4X1I A;  5D5P A;  2IH3 C;  3ZHU A;  2QDO A;  3K5M A;  1XI1 A;  1KU9 A;  1BGY H;  1JOY A;  1R6N A;  5KHH A;  4B3M O;  2YDE A;  5FPO A;  2A0L A;  1AI6 A;  1MOF A;  5BXZ A;  2JEU A;  3IFX A;  4JI8 B;  5KLV H;  3TJT A;  3BCC H;  4L8J A;  1XRE A;  4W4K A;  3J7A U;  2FB5 A;  3CRQ A;  5C93 A;  2ZXW B;  4B7E A;  1CXZ B;  3M99 B;  4JI5 O;  1QLE B;  4JI4 B;  4FM1 A;  2D2C B;  5LMN B;  4GKK O;  5EYP A;  4JI2 B;  2ETN A;  3QTC A;  2ITC C;  4XDL A;  4RUF A;  4J7J A;  3SPC A;  2Y69 B;  2OTJ V;  1HR0 O;  4LF7 B;  1GKF A;  4PDV A;  3STL C;  3SJQ C;  4BW9 A;  4LF8 O;  5L3B A;  1XMQ B;  2P6J A;  4X65 O;  2UU9 B;  4DR6 B;  2WAM A;  1SQV H;  4LFA O;  4PI0 A;  2EIL B;  1AJQ A;  2G38 A;  4B7K A;  2EBO A;  4ZKI A;  5J2T B;  4FLV A;  1ZL8 A;  3L70 H;  3OGI B;  1XDC A;  1TGO A;  3M7M X;  2ZQM A;  1HP8 A;  1GN3 A;  3F5W C;  4DV6 B;  3CXH F;  3RYI B;  4JYY A;  4BR6 A;  4LWS B;  1Q3E A;  3UT5 A;  4NTY A;  4DV3 O;  3GWK C;  2P7T C;  3SPI A;  1Z5V A;  4LFB B;  3IAY A;  5LGT A;  5B1N A;  2DOS A;  3N27 A;  5A2Q N;  5LHI A;  2BSK A;  4MVQ A;  4DUY B;  1I94 B;  1ZL8 B;  1WB7 A;  1IBM B;  5GTH Z;  3WB2 A;  5JJJ B;  4FVM A;  1MG1 A;  5F2V O;  1AJP A;  1HNW B;  2HVK C;  5GON B;  4TUY B;  1I5X A;  3E22 B;  1Q86 W;  3JYC A;  2BTO A;  1JX9 A;  1ZUQ A;  1GRJ A;  4DUZ B;  2WLK A;  3DGE A;  1FXK B;  1BL8 A;  4F6R A;  3AG7 A;  3E35 A;  2Q0O C;  3NXS A;  3LNN A;  3SR2 C;  1AR1 B;  4Z1M G;  3SJA C;  1G8M A;  4O2A B;  2HFE C;  1N4C A;  1OV9 A;  3RBZ A;  2DWE C;  4HYO A;  2OIG A;  2GUZ B;  1IBK O;  2GTA A;  2Z3Y A;  4GKJ O;  4DR6 O;  1WP8 A;  4KUM A;  1Q6H A;  5GON A;  5B1A C;  1JR9 A;  4H0L B;  4H37 A;  1R3K C;  5H9C A;  1TUB B;  4JYB A;  4PA6 A;  1QNM A;  2FKX A;  3QO7 A;  2XT9 A;  1M93 A;  3CJH B;  3LDE A;  3JAM N;  2CK3 G;  3D36 A;  1M57 B;  4IHJ A;  5BZB A;  2PTM A;  4O4H A;  3ML0 A;  2M7W A;  4PDM A;  4U3J A;  1GTO A;  3OTF A;  4J7Z A;  4PD4 F;  4B08 A;  5BMV A;  3P3P A;  4DXW A;  4RAI A;  2ADQ B;  4K8X A;  1XMO B;  2H94 A;  2OIE A;  2HLD G;  3JD3 A;  5C8Y B;  2XTA A;  3BAB A;  5LXT B;  1WB8 A;  1Q43 A;  5LGU A;  1DLB A;  3U10 A;  1YDX A;  2V4D A;  3WG7 C;  4FLT A;  3CCE V;  4TQD A;  3RYF A;  3K03 A;  4DUZ O;  4TT3 G;  4AQY O;  2JGD A;  1YIT V;  1ORQ C;  4YHH O;  5BR8 B;  2QR4 A;  1VF6 A;  1I5Y A;  4X88 A;  5C8Y A;  1JJO A;  4Z1V A;  5KHJ A;  1WA8 A;  1VQ4 V;  4E4E A;  1GM8 A;  4CS3 A;  3UCS C;  1YTF D;  4GUN A;  1DTO A;  5FNV B;  1NH2 B;  2UXB B;  1EM1 A;  2AGA A;  2UUA B;  4G2K A;  2N74 A;  4LWS A;  4O4J A;  3ZHV A;  3R66 A;  4LH6 A;  1EN6 A;  3A0H Z;  3CCV V;  4PHZ A;  4G28 B;  1NS1 A;  4TV8 B;  2UUC O;  4B3R B;  1QHT A;  4D6T H;  4JI3 O;  4JI6 O;  1AIL A;  1FFT B;  3N2K B;  4R6Z A;  3CCJ V;  1GN2 A;  4FPP A;  4IT5 A;  1VQN V;  2B1I A;  3K0D A;  3U0Z A;  5D5Q A;  3BY6 A;  1M57 C;  1I94 O;  1IBM O;  4WF9 V;  1VF7 A;  1BSM A;  3R65 A;  3APQ A;  2F93 B;  4H33 A;  3JAT B;  4K0K B;  2ITD C;  1K73 W;  4CH4 A;  1VQO V;  2YI8 A;  3RWR D;  1N0J A;  4HZ3 A;  2JS3 A;  5LMU B;  3JD1 A;  4UVB A;  5LP6 C;  3E2E A;  3T1H B;  2X6C A;  3JD4 A;  3LDD A;  2ARH A;  3TCU A;  1VQ7 V;  5CB4 B;  3SPH A;  3FX7 A;  2W6I G;  3C3S A;  4JI0 B;  2XOK G;  3LSU A;  3FYI B;  1FS0 G;  3O65 A;  2QWP B;  4NKG B;  3SYA A;  3CRM A;  2DE0 X;  5J2T A;  2UXN A;  4GYC B;  4DV2 O;  2B9Z A;  2EIJ B;  1MA1 A;  4ZHQ A;  3CHX A;  2WLM A;  2OCH A;  5E1A C;  3CC2 V;  1PM9 A;  4HNA B;  4GX5 A;  3D3I A;  4EB6 B;  4JI3 B;  4JI6 B;  2K9P A;  1NZ6 A;  1ARO P;  1I0H A;  1K7D A;  1KC8 W;  5JCO C;  1HNZ B;  2WLH A;  2R9A A;  2IU3 A;  1RM1 B;  4PDR A;  5JWP A;  1TUE B;  1VQK V;  4KFM A;  5JH7 A;  1GM9 A;  4CH3 A;  2JEX A;  2HVJ C;  1H2K A;  1Z2G A;  3SDL A;  4MTG A;  3B09 A;  3FYE B;  2YS8 A;  1WP7 A;  2Q4P A;  3JAS A;  4J9Z B;  3J80 N;  1S5L Z;  3CSX A;  4KL1 A;  1H2L A;  2A7W A;  2F95 B;  4LF6 O;  3PJS K;  1IBL B;  1WJZ A;  2EIL C;  3ASN B;  2DYR C;  1RPR A;  2VWJ A;  3K59 A;  4MTO A;  1WN7 A;  2X6B A;  2QSA A;  3ZRW B;  2GTS A;  1KQS U;  5EIB C;  4GKK B;  2OT5 A;  4MVS A;  2WPD G;  2E3C A;  2Q0A A;  4HBN A;  4DV2 B;  4I7Z B;  3TGU H;  3CYO A;  4CS4 A;  3HB3 B;  1RFY A;  3ZED A;  1KUQ A;  4LF7 O;  2OCC B;  3TK1 A;  2EIN C;  1Y66 A;  1S77 D;  3CD6 V;  5KMG B;  3STZ C;  1BT8 A;  3EHB B;  4U3J B;  3FB5 C;  3ABM B;  1R1B A;  4FFB B;  1B3Q A;  4LFA B;  5LL6 Y;  4FLZ A;  4NXM B;  3JAW A;  1VQ6 V;  2ZM6 B;  2LP7 A;  1QVG U;  5EIB D;  3OTO B;  1K34 A;  1WPX A;  1X59 A;  3UO2 A;  4NVP A;  1N32 O;  4YY3 B;  2ADP A;  2D3O W;  4DW0 A;  3ZX6 A;  2L35 A;  4JZ2 A;  4WFG A;  1JJ2 U;  5EZY B;  5LHG A;  1OCZ B;  3JD2 A;  2ZKO A;  4JI8 O;  4BAY A;  1P7G A;  2BOB C;  4OPA A;  1L0L H;  5B1A B;  4KHP B;  1FYJ A;  3F5T A;  5JJN B;  4MTX A;  2HJF C;  3MDS A;  1GN6 A;  1ZTE A;  4C7U A;  3RGB A;  4RQE A;  2EIM B;  1YEW A;  2IJK A;  1BE3 H;  5FLX N;  3K9S A;  1NH2 D;  1VEW A;  2QM8 A;  2ZIN A;  2YIC A;  4IL6 Z;  1YHQ V;  4DYL A;  4DR1 O;  1YTF B;  4JTD B;  2VWK A;  4H44 B;  2PGG A;  4FLX A;  5LHH A;  1P4R A;  1XHX A;  4CC6 A;  3E89 A;  3L75 H;  4LFC B;  4D7T A;  2QEX V;  3W7X A;  5IJ0 A;  1YIJ V;  5CA1 A;  4LF8 B;  4TV8 A;  3RYF B;  1V55 C;  1XL6 A;  4I50 B;  3AEI A;  4X62 O;  4JV5 B;  4MTF A;  1F23 A;  2EX3 A;  3WB1 A;  1PL0 A;  5K1X A;  1R6K A;  2OCC C;  2VQF B;  4X1K A;  3U11 A;  3CCU V;  1SQX H;  1N33 B;  1OCC C;  3S3W A;  4KP4 A;  1OZ0 A;  4TUY A;  1XQ8 A;  3K3W A;  1UJW B;  1JFF B;  1PL4 A;  2IJH A;  1K5S A;  1VF5 B;  5CN0 A;  1M5I A;  1M9N A;  4F6R B;  4LP8 A;  5BY1 A;  2F4V O;  5IE9 A;  2Q6A A;  2CE4 A;  4EFB A;  1MZE A;  3BVO A;  4LR3 A;  3RYC A;  1K4D C;  1IZ3 A;  4O2A A;  3VQY A;  4FIP C;  1R3L C;  4LF9 B;  2GUZ A;  1Y6X A;  3OAA G;  3H9V A;  4LFB O;  1EFR G;  4CH5 A;  4DV0 O;  5IJ9 A;  5L3C A;  4QE9 A;  2LW7 A;  1B06 A;  1XNQ O;  4FJC C;  3ZIA G;  4OX9 O;  3EFF K;  1H2G A;  2Y48 A;  2WLL B;  4LFC O;  2F66 C;  1HNW O;  5GW7 A;  1PV0 A;  3OFN G;  1YCI A;  2P4V A;  1WAZ A;  3HKB B;  2JK5 C;  4UCR A;  5L3F A;  2B1G A;  2WLI A;  4UCS A;  2RDC A;  3HR0 A;  2QA4 V;  1FJG O;  1UFI A;  3NR7 A;  4X62 B;  2XAS A;  1RSO A;  1XOU A;  2WLJ A;  3SYO A;  1COW G;  4DV5 B;  3AG1 C;  4LF4 B;  4QPK A;  2H8P C;  1AR4 A;  1H8E G;  4YJ3 B;  1N33 O;  3G80 A;  2KKW A;  4F4L A;  1A32 A;  1NVP D;  2UUB O;  2YXL A;  4P2Z A;  3OMA B;  4U7O A;  3HKC B;  5ITZ B;  3DC5 A;  4GLX A;  2GV9 A;  5CBF A;  2ODM A;  5H6Q A;  3ZMS A;  2ZIM A;  1RP3 B;  4X1Y B;  2F4V B;  4XDJ A;  1GN4 A;  4DV6 O;  1XIL A;  3IC9 A;  1SQF A;  1K97 A;  2QKS A;  1N0N A;  4LNU B;  5IT9 N;  1IVS A;  2CGO A;  5CA1 B;  2YEV B;  3ABL B;  2JVD A;  1M4U A;  2V1D A;  1XUQ A;  2LGW A;  1BCC H;  3ZRS A;  1JVM A;  4HNA A;  3ZHR A;  4ASU G;  4TWK A;  1NVP B;  2DW4 A;  3CCS V;  1J95 A;  2CGN A;  1ZSP A;  2N04 A;  4IYH A;  5IWA B;  1THZ A;  2EIK C;  4FM2 A;  4TSF G;  3ETQ A;  1D5N A;  2GSM B;  3L71 H;  2CTR A;  4B3S B;  3EVK A;  2CH7 B;  1Y67 A;  2LFR A;  2ZE5 A;  1NTK H;  1D2D A;  2GBO A;  4DR5 B;  4DO2 A;  1S0V A;  1OHH G;  2R9R B;  1GO3 F;  3D3Q A;  3RYI A;  5LXT A;  3K5L A;  2VQE O;  1P49 A;  1H2S B;  4A5U B;  4RWU A;  2MK3 A;  1BHB A;  2E75 B;  3OEH G;  3QNE A;  4PA3 A;  4O4I B;  4PEL A;  3B8M A;  2H3O A;  4IYI A;  5TIS Z;  2NNU A;  1V54 B;  1WNS A;  5B1O A;  4X1I B;  2QE7 G;  4YJ2 B;  4EFE A;  5CBH A;  4RUE A;  3ZRW A;  3RN4 A;  4FM0 A;  4BIU A;  3JAL B;  2ZD9 A;  3CXC U;  1BS3 A;  4J11 A;  4ZBM A;  2KB1 A;  3CP1 A;  4X66 O;  2QKC A;  3RW0 A;  5IYZ B;  1HW7 A;  1L8D A;  5KHG A;  3RYH A;  4DW1 A;  4QE7 A;  2EZO A;  4GX0 A;  4NTW A;  1V54 C;  1YSC A;  5LOV B;  2PF4 E;  3T1Y B;  3X2Q C;  3LNM B;  1NI8 A;  1JQ0 A;  3A2F A;  4Q6G A;  1J5E B;  1O9G A;  3BHP A;  4ZHQ B;  1YI2 V;  3BFR A;  4NXN B;  3ABK B;  2P06 A;  1SS3 A;  1M56 B;  1H8H G;  1H38 A;  1Q6U A;  1BHA A;  3K57 A;  4ZI7 A;  2XAJ A;  3L74 H;  3HKE A;  2F43 G;  1QLE C;  1GM7 A;  1HWY A;  3UQ8 A;  4FMT A;  3WFV A;  1LUW A;  4UVC A;  4LNU A;  1JPX A;  4JI0 O;  3GB7 C;  1E79 G;  1VIB A;  4R50 A;  3SYQ A;  4JI2 O;  4P30 A;  3B2E E;  1PD3 A;  2ZNJ A;  2CUG A;  3JAR A;  1F4N A;  2IJI A;  5DEC A;  4KXR A;  3I55 V;  3CS5 A;  2PYJ A;  4J9Y B; 
#chains in the Genus database with same CATH homology
 3Q4H A;  2VRZ A;  4GZR B;  4LWS B;  3TXS A;  2VS0 A;  2AZ0 A;  2DE0 X;  3FAV A;  4LWS A;  3G80 A;  2B9Z A;  4ABM A;  3GWK C;  3FAV B;  3TXQ A;  2KG7 B;  3GVM A;  4I0X B;  3OGI B;  3FD9 A;  1WA8 A;  2KG7 A;  3HR0 A;  3ZBH A;  4I0X A;  3O9O A;  3Q4H B;  2AZ2 A;  1WA8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...