2AZ2A

Flock house virus b2-dsrna complex (p4122)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
total genus 24
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az2A00
1WA8A 3O9OA 3Q4HA 3OGIB 3TXQA 4I0XB 3G80A 3GVMA 4GZRB 3FAVB 2VS0A 2VRZA 2KG7A 4ABMA 4LWSB 1WA8B 2B9ZA 3FAVA 3HR0A 2AZ0A 3Q4HB 3TXSA 4I0XA 3GWKC 3ZBHA 2DE0X 3FD9A 4LWSA 2KG7B 2AZ2A
chains in the Genus database with same CATH superfamily
2VWKA 1PL0A 2P4KA 3F7VC 4LF8O 4WCEV 1DGSA 4LFCO 2X0LA 3VQYA 3APOA 3W7SA 3ZN1A 1B04A 2XHBA 3THOA 1BCCH 1JFFA 3ABMC 4CC6A 4LF9O 2D3OW 3CPWU 3HKDA 2HVKC 1KD1W 4DR4B 4UB8Z 1YVWA 3SYCA 3E22A 3OUFA 4X1KB 5L3DA 4LH6A 3RT3C 1KMIZ 1SC5B 1P7GA 3P30A 3RGBA 2QDOA 2JRIA 3RYHA 3ZHRA 1YF2A 3VOUA 4H13B 3ABKB 4F4LA 1KP3A 1QNMA 1D2DA 2E5LB 1NTMH 2GUZB 3FYEB 1IDSA 1VEWA 2F93B 1N34B 4AQYB 4UCSA 3AG3B 1Q81W 4X20B 5CA0A 1K97A 1HW7A 2WLLA 4EB6B 5JJEB 4UV9A 1SRYA 4X65O 4E2LA 4RWUA 2RNBA 5IYZB 3H1KH 2Y69B 2AZ2A 5LXTB 1MMMA 2E76B 1K5SA 1XNQO 5IT9N 2EULA 3L71H 3LUTB 3OD4A 3N2GA 3E8BA 3KCXA 4FFBB 3P3PA 5KX5A 4WFAV 3RYCB 3ABUA 1H2NA 1Z2GA 4JI2O 2PTMA 1HDJA 2WLHA 4MSWC 2CGOA 3ZMSA 4PA7A 2BE3A 3PJSK 1XMOB 1FXKA 3K08A 4GX1A 2Q8VA 1XHZA 1W0KG 1GK9A 5CMUA 1IBLB 3STZC 5JH7B 2BOBC 3SJBC 1VF5B 4QIWF 3TJTA 2DYRC 4LF7O 5AG2A 2QTSA 3SYQA 1K8AW 1AP6A 3FKSG 1SQQH 2L35A 2ZIMA 4MS2A 4LF8B 5IJ9A 2EBOA 2QKAA 4CH5A 1GKFA 4PDMA 3ZJZA 3IFXA 2WPDG 4KP4A 3T4DA 1F23A 1WPBA 1R6TA 2WSSG 3JALB 1AI7A 3VQWA 1M93A 1NZ6A 5ITZB 3LDDA 5LBQA 2XASA 1FKAO 2P22C 4X88A 1L0NH 2X6AA 3D3IA 2E75B 2O57A 5LMNO 3O9OA 1JFFB 4JTAB 1XILA 3BEHA 4MTOA 2YEVA 4DV1O 3ZMUA 4MVZA 1VIBA 4NB5A 3SJCC 2RQ6A 3H1HH 1GM9A 3ZRWA 4DXWA 2X6BA 3LSUA 4NKGB 5LMNB 4FLXA 2QM8A 1GO3F 4TSFG 5KMGA 3C3TA 3ZRWB 2DYSB 3CJHB 1XMQB 1IXMA 3CRQA 4DV5O 1XBLA 5LA6A 1DTOA 1MG1A 2NLJC 1WN7A 3GWOA 4WFFA 4UB6Z 2ADPA 3TXQA 4K8ZA 3W7WA 2EZOA 1M4UA 2EIKC 2OTJV 4DV4B 2OTLV 3R65A 2PYLA 4XDLA 3C3SA 1XMOO 3I5DA 4GX0A 4JI4O 1PD3A 2VQEO 3RYHB 1JJ2U 4J11A 5B1OA 2EIJC 3HKEB 1Z5WA 1GTOA 5H6RA 4BWAA 1FJGO 3SPGA 3CXCU 1PL4A 3CB2A 1WP7A 1UJWB 4O4LB 4PI2A 2Q73A 1WLEA 1FXVA 2FL4A 4LF4O 1CXZB 1EN5A 2JJ2G 2X6CA 2VQFO 1TAEA 2GBOA 2UXXA 4YXWG 2XAGA 3J81N 5B3SB 4BW5A 1I0HA 1VQOV 1S3JA 2E3CA 1YJWV 1IBMO 2R9IA 5CBFA 2DQ0A 2UXDB 1URFA 5LHHA 4W4KA 4UXNA 3J7AU 2IW5A 3SDLA 3TGUH 4O4JB 3B77A 1BMFG 5B1BB 4DV1B 2ARHA 4R6ZA 3A2FA 1K92A 1Y67A 1N33O 3E8HA 1SESA 4J9ZB 2CAZC 1LUWA 3AG2B 3RYFA 3JASA 2P67A 1YIJV 1MOFA 3U0ZA 1U97A 3CCLV 1JCHA 2IH3C 4HNAA 1XHXA 1P49A 1VQLV 3EFFK 2OYQA 2XUMA 3CRMA 3FB6C 2AHYA 2NNUA 2PZSA 5KHKA 4KHPO 1B3QA 1N8RW 1BHAA 1QU7A 3KG2A 2E74B 4ZIBA 2Q6AA 3CYOA 2HJFC 3QF7A 4FZ0A 3K58A 5HFMA 3JATB 4JI0B 1SETA 4DK0A 5C93A 1N32O 2DMXA 2M6YA 1WNSA 5DM6V 3ZBHA 4GKKO 3BA9A 4RUEA 4LFCB 4MVMA 2DW4A 4HNAB 4PJ0Z 3K3WA 4Z2WA 4GYCB 4J7KA 2F66C 3FFQA 3K5OA 4AI8A 2EJ7A 1M56B 1GN3A 4FLZA 4QPJA 3OTOO 3OW2U 1HR0O 4EKWA 4LF4B 3CHXA 2CTWA 1H2MA 4GKKB 1I08A 4CS4A 1DK1A 1VQNV 5TISZ 3EHBB 1YDXA 5B1AB 1BSMA 3K59A 3TK1A 3NR7A 1KQSU 1CP9A 2DWEC 2WLJA 4DR6O 1T5EA 1S5JA 3CRCA 1QHTA 1L1FA 4MTFA 1ZAUA 3VQXA 1QQCA 3BPZA 4LFAO 2JJ1G 1R3KC 2V7QG 1VF7A 5FL7G 2IJKA 4WF9V 3CCRV 2ZM6O 2IJIA 2Z3YA 3Q4HA 2UUAB 4R7CA 3CRAA 5LP6B 1RPOA 3ML0A 4JI1B 1VP7A 5L3GA 1XDCA 3D36A 4ZHQB 2HHHB 2QWQB 3WB2A 1CPYA 1NR1A 1TA8A 5GTHZ 1N0JA 3B4SA 5H9CA 3QO8A 2PI5A 2CTQA 3JASB 4I9WA 5EBLC 4K3AA 1CEZA 3SPIA 4LFBB 1S72V 5JJJB 4QGPA 1NH2B 3ABMB 4MVSA 5GTIZ 1M56C 1WAZA 3LNNA 2Q69A 1H8EG 2WWWA 4AQYO 5LGUA 3FAVA 2UXCO 1QLEC 3ETGA 4DR3O 2PGGA 2JK5C 5KUKA 2NR5A 2YEVB 1IXBA 4KHPB 5IE9A 1ZTEA 2CGNA 1J5EO 4O2AA 5E79Z 4NTYA 4LF6B 4NYKA 1MSDA 2QR4A 3ABTA 4W4LA 3D8CA 3HR0A 3RBZA 1X59A 4BIOA 3OGCC 1SKVA 3CCJV 3UT5A 5LGTA 3CJHA 3JCZA 4JAVA 4UCRA 3FB7C 5C8YB 2F4VO 2KQXA 2ZXWB 3H1JH 3QO7A 5EC2C 4O2BA 4LF6O 4MW3A 3AK2A 5JCOC 1H2SB 3S3WA 5GONB 3QTCA 3C90A 2BOCC 5IWAB 3CCSV 2HEPA 1AJNA 4B08A 1NS1A 3L9DA 2LW1A 3CWBH 2NN4A 3X2QB 5F2VO 4AHCA 4ZI7A 2F4VB 2ZE5A 2FB5A 4TOIA 4J10A 2UXDO 2OCCC 1L0LH 1K34A 5KMGB 4O2AB 2A7WA 3ETDA 3HB3B 5JQGB 5LHIA 4YJ2A 2P7TC 4R8CA 4H0LB 3SPHA 4XBFA 3ZEDA 1ROPA 2YIBD 2PYJA 2ZM6B 1RM1B 3F7YC 3ETQA 4LNUA 2CUGA 1QR9A 4BIUA 1TUBA 4YHHB 1S76D 3CMAV 2GSMB 3QNEA 2WA4A 1RPRA 2ZE6A 3EXAA 1DF4A 1FPOA 4O2BB 2QWRB 4O4HB 1YHQV 4B3TB 2P6JA 3FB8C 3WB1A 2IJJA 5H2FZ 4TT3G 2Q7GA 3ABLC 2X7RB 3G4SV 3WFVA 1OCRB 3FX7A 1P4RA 5FNVB 1Y6XA 4DW1A 4X62O 2ZNIA 3OFNG 4LCUC 4Q6GA 5IJ0B 4JI3B 3R66A 2RCVA 1NJIW 4JTDB 1U96A 2ZQMA 3X2QC 5BY1A 2PY5A 4DUYB 1P7BA 4K35A 5IJ0A 1OCOC 2DOSA 1TVKB 2JDIG 1FXKC 3LSSA 1HNXB 4FLWA 4DR2B 3UT5B 4DV7B 1RP3B 5JCOA 1IZ3A 2DN9A 1Y74A 3JAKB 1RM1C 4PD4F 3SJAC 1LNQA 2N74A 4OPAA 4CC5A 5B1NA 4IL6Z 1H8HG 1V55C 2VQEB 4NXNB 3UKMA 4RAIA 3AG4B 3TXSA 3P3NA 5C8YA 1HNXO 1VF6C 3ZHVA 1SQGA 5B66Z 3ZN0A 2UUBB 1EFRG 5LYJA 2ZNJA 2Z0AA 4CH6A 2EIKB 1XREA 3E83A 3M7MX 1R6NA 3VBBA 5GW7A 5L3CA 2ZKOA 4GZRB 4JTCB 4JI5B 5LOVA 2WLIA 3ZHSA 2QA4V 3BA8A 1NT2B 4PI0A 2Q68A 3K9SA 2VQFB 5BMVA 3JD3A 4Z1MG 2R72A 2CH7A 3H1LH 4JI1O 3ZHTA 4F6RA 2OIGA 2Q9LA 1NKDA 1XEQA 1JQ0A 3UCSC 3L74H 1K9MW 3ICXA 3G80A 4BAYA 1QBZA 1N36B 2UXBB 1EZVH 2AW9A 1M5IA 1VMGA 1BHBA 2Q5ZA 4LFBO 3SYPA 2CTRA 1NVPB 1I94B 2BSKB 3K9AA 1JOYA 2L6LA 1MNGA 3D36C 5GONA 3HKCB 4G28B 1GAXA 2Q0AA 1WA8A 3T1HB 4B3SB 3L72H 5B3SC 1PP9H 2EINC 1M57C 1E79G 4J7JA 4CZZA 1VQMV 5KHHA 1G8MA 5EC1C 4Z1VA 4UVAA 5CBGA 1YZBA 1J5EB 2LFRA 4DW0A 2Q7EA 5LP6A 1I94O 1I5XA 3DXRA 1XNRB 1MA1A 5D5QA 3SYAA 5CBHA 1HR0B 3OR7C 1KECA 4JI7O 1VARA 1XOUA 3F5WC 1N0NA 1H2GA 3JCUZ 1W2BU 3JD1A 4TV8B 4JI6B 1AI4A 1G1XB 3K0DA 4DR2O 4DUZB 4RQEA 2W6JG 4GUNA 1OZ0A 3JATA 4JI0O 4G27B 1HNZB 1ZL8B 1LR1A 1G6UA 1K7DA 2Y4UA 2KG7A 4K0KO 4MVQA 2Q4PA 4R50A 1YCIA 1ZL8A 4GKJO 3E89A 4IHJB 4PELA 3K57A 5B5EZ 1ZSPA 5EIBC 4JV5B 4FM1A 2E5LO 3OTOB 1YJ9V 1MZFA 2PUSA 2YIDA 2RJZA 2HHHO 3OEEG 4DYLA 1Q6HA 1GRJA 4RO2A 4TWKA 1Q5OA 2EINB 1GN2A 3RWRD 2EJRA 1B06A 2B5UA 4K0KB 1FD9A 4YJ3A 4X66B 3DXRB 3CE2A 1JVMA 3MAQA 4O4LA 2A0LA 4DR4O 3RYIB 1UPGA 4NR1A 3M99B 2YS8A 4DR6B 1Q90D 3IAYA 3OMNB 4EEQA 3B8NA 3K5NA 2YXLA 2N04A 2CH7B 3APQA 5IDJA 3CX5F 4LFAB 4B7EA 5JVDB 2UUCO 2B9ZA 5B1AC 4CBCA 1I5YA 4I0XA 4BR6A 1WB7A 2ZIOA 3RYFB 4YJ3B 1QVGU 3ZCCA 3MHSC 5BR8O 4UVCA 3DC6A 4ZOLB 4B3MB 4TUYA 3FB5C 5KUMA 3CSXA 4JF3A 1BS3A 5LMUO 3UO2A 3UQ8A 1AR1B 4LF5O 4ZKIA 1EZJA 5EYPB 3FD9A 1VQ6V 4GCZA 1XNRO 3AEIA 1R3LC 4JI8B 2F95B 3OT7A 3L70H 4LR3A 1R1BA 2JIZG 2UXNA 3LSQA 1VF6A 4PA3A 1KB9F 4MVUA 4YIPA 4RQFA 3N2KB 2YSUB 2ZE7A 2YIBA 2DYRB 2QE7G 2EIMB 3ZX6A 4UFZA 2YI9A 4P2ZA 2Q0OC 1Y76B 4KUMA 4JAAA 2LW7A 1PM9A 5A2QN 1FXHA 4YY3B 1THZA 3CCQV 4UCTA 4P9PA 3RVYA 4I55A 4X1IA 1QLEB 2YC0A 4UV8A 5DEDA 3GVMA 3A0RA 3B8MA 3CS5A 1SA0A 4F6EA 5KA6A 3SPJA 5KLVH 4J42A 2M7WA 1SF9A 2C2AA 3H1IH 4E4EA 1NVPD 3K0GA 4OXSA 4JI5O 3P32A 1BQZA 4DV3B 4LNUB 1SZXA 3ZHUA 2UU9B 1F4NA 2F43G 3B09A 5BMVB 5L3EA 2Q67A 2JEUA 2RN9A 2JS3A 5EBMC 3GB7C 4JAUA 2LGQA 3SJQC 3T1YB 2AZ0A 4NVPA 4A5UB 2W0FC 3MDSA 3HKEA 4LH7A 1N36O 3WU2Z 1Q8IA 2OCCB 3OGIB 4CS3A 3G71V 2ZR2A 2KSDA 1VQKV 2H3OA 3OTFA 2Y4TA 2DJVA 4U3JB 3KZIZ 1AP5A 3OM3B 4O4IB 1KUQA 1YITV 2WA3A 1PNLA 2K9PA 2HP8A 4B3SO 3QO5A 5ITZA 4C7UA 3ABKC 3GWKC 1GM8A 4IIJA 5J2TA 4PDVA 4U3JA 2JS5A 1D5AA 5LOVB 1W59A 3B2EE 3IJ4A 5BR8B 5KA5A 4B3MO 2FTKA 1F4MA 4D7SA 4IYIA 3UM7A 3T2MA 3OMIB 1SQPH 2IU0A 4B3TO 1O9GA 1FFTB 3K79A 1DF5A 3ZMTA 1L8DA 1HNWO 3OR6C 3ABLB 3OAAG 4MT8A 2P5OA 4I9QA 2EX3A 4DK1A 1SA0B 2Y69C 4X9QA 4UCUA 5BZBA 4DV2O 4B7KA 3E8FA 4GLXA 4X62B 4DO2A 3JALA 2V4DA 2XT9A 2F1MA 2XOKG 3IC7A 3BAAA 4JI3O 1QLNA 3QVNA 4CS2A 4DV4O 3BABA 2IU3A 4X64B 1SQXH 2G38A 1AI5A 5KHJA 4EB6A 4LWSA 4PA6A 5K1XA 3W7UA 4DR5O 3FYIB 2HLDG 5KAFZ 1OCRC 4GKJB 3I56V 4OGQB 1OCCC 3ZRSA 3T1CA 2VRZA 4NTXA 1R73A 2QKCA 4FFBA 1J95A 5IYZA 1NBMG 4ZI7B 3ASOB 2EILC 5KHIA 2QGNA 3F5TA 4K8XA 3VQVA 2Y0PA 2P06A 4X66O 4PV1B 1VQ5V 1FXKB 1HP8A 3O65A 4X1KA 1AJPA 3CD6V 4WFGA 2HG5C 2W6IG 1RSOA 4JASA 2GUZA 3B40A 2YDEA 4DV0B 4B3RO 2CDYA 3RN4A 4D6TH 4IGGA 3RW0A 1K3EA 1MABG 4FLVA 1TUBB 4CH3A 2RDCA 4XDKA 1V55B 3CMEV 1Q82W 3BY6A 1GN6A 1S5HC 4JYBA 2QWOB 3LNMB 4OX9O 2ZDIC 3MHHC 2FKXA 4DV5B 3SGIA 5E1AC 4DV6B 4JI6O 2JGUA 2Y48A 4YIOA 4D7TA 1BL8A 4GX2A 3W7TA 1A32A 3FAVB 2H8PC 2XAQA 3ZRXA 4AILC 4OX9B 4DR1O 4PDLA 5IY5B 1HNWB 3ETEA 4HZ3A 4P30A 4JI4B 2B1GA 1D5NA 1ORQC 5JVDA 4PA4A 1VQ7V 5D5PA 3OMAB 4DV2B 3EVKA 3LDEA 4X89A 1FS0G 3TCUA 4KL1A 1F51A 1Q7YW 1YEWA 4FIPC 2OT5A 4WFEA 4DR1B 2BTQA 2OWOA 1M57B 2KG7B 3D3QA 2QM7A 4QE7A 1VQ4V 4NXNO 3KCYA 1PPJH 5EK0A 3ZIAG 1QR8A 2RMKB 4I0XB 2WLKA 3DC5A 4JZ2A 4U7OA 4MW8A 1OJHA 5EZYB 2ATKC 4N23A 5FPRA 2OIEA 2GV9A 2Y0IA 3A0HZ 4O4JA 1KP2A 4I4TA 1YTFB 2CTPA 1QVFU 4LBEC 4XDJA 1E1RG 2QTOA 5H6QA 4LC1A 4QE9A 3JARA 1EN4A 3MD0A 2JGDB 1YI2V 4IYHA 2IBZH 2VWJA 1N33B 1KKDA 4I50B 2R9AA 1VQPV 4EFBA 1K33A 4G2KA 3AG1C 4TV8A 3G6BA 1BT8A 2LO1A 3RYIA 3QG5A 1O9HA 2YXYA 5L3BA 5KHGA 5DECA 3K04A 3HKCA 3KKYA 4F6RB 3U11A 3T1HO 4TQDA 4WBNB 1EM1A 5LHGA 4H44B 3S3XA 2LGWA 1IBMB 2ADQB 4I4TB 4KFMA 4EFEA 5EIBD 4FZ1A 1ZX3A 1AI6A 1M90W 1XUQA 1NH2D 4I50A 2BTQB 1JA8A 5IYDO 1V54B 2HR3A 2JGDA 2GDSA 4H37A 4YY3O 1WA8B 1WPXA 4UCOA 1G4YB 4BW9A 2UXCB 3OEHG 2FYUH 2HKOA 1H38A 2QWPB 1WB8A 2WLIB 4WBNA 5CN0A 2WLMA 2BSKA 4HYOA 4HBNA 4LP8A 4J7ZA 4LF5B 1JX9A 1EBOA 3K06A 2DWDC 5EZYA 3AK1A 3H01A 2BTOA 2ZXWC 2HVJC 1YJNV 4MVRA 4DV3O 4JI8O 2ZINA 5J9PC 4JYCA 1KKCA 4RUFA 1HNZO 4FM2A 2GTSA 2QEXV 3RFRA 1IURA 1X4TA 1AJQA 4L87A 5FLXN 1OV9A 3OUSA 1XQ8A 4LF7B 1BQ0A 3T1YO 4ZBMA 1R3IC 3BVOA 3CEIA 4WFHA 5A9GA 3HKBB 5LA6B 2Z5UA 2H94A 2P4VA 2IJHA 5EBWC 4J41A 4X1YA 2CE4A 1FFXB 2ZDIA 2PI4A 2MK3A 1K73W 2K1EA 1RSOB 3HPLC 2HFEC 2JVDA 4IIJB 5J2TB 2EIMC 4I5SA 4JPRA 1BE3H 1NTKH 1Z5VA 4UVBA 1SERA 4JYAB 4LWSB 2A79B 2XTAA 1Y74B 3JAKA 2LFSA 3AG3C 3E35A 2A9HA 2UUCB 4MTGA 2AHZA 4NXMO 5CB4B 1JR9A 3JYCA 3BFRA 4O4HA 4FLTA 3E86A 3STLC 2KKWA 2P90A 1XNQB 2IM9A 1IBKB 1AR4A 2DQ3A 1M9NA 4FPPA 4DV7O 1MSWD 4PDRA 2ITDC 3JAWB 4NTWA 1AB3A 2ZT9B 3L75H 1KYOF 1SQBH 5LYJB 1KU9A 3U10A 2UUAO 3E8GA 1EN6A 1SQFA 5IYBO 5J2UB 1IX9A 3JAWA 1FAFA 1PV0A 4GT1A 3TETA 2LQTA 2D2CB 2UUBO 5J2UA 1AROP 5DN6G 3JSLA 3PN1A 1TGOA 1XL6A 4TV9A 4L8JA 1F7YA 1S0VA 1PKXA 1OHHG 4X65B 1YTFD 4HAMA 4FVMA 3A0BZ 4ABMA 4QNHB 3I55V 2YUAA 2ETNA 1ENVA 3SR2C 1NR7A 2IH1C 4DR3B 4UUJC 4GX5A 3K03A 4FLUA 3BHPA 2R9RB 3RYCA 3JD0A 4O4IA 4YJ2B 5EYPA 5CB4A 5JQGA 3K5MA 5H5NA 4X64O 1K5QA 1SQVH 4Q20A 3CCEV 4I7ZB 3CRRA 2QJ1A 1ZUQA 3M8AA 2GHYA 2KB1A 3Q4HB 3CXHF 2QM4A 5LL6Y 3E2EA 5IJ9B 1IBLO 1R3JC 4DR7O 2WLLB 3UO3A 1TVKA 1H2KA 2DYSC 1JPXA 3N2KA 1Y66A 1P84F 2LP7A 2W0XA 4LF9B 4FK5C 2EILB 4OPHA 4JYAO 3J80N 2B1IA 4BIZA 1COWG 3HKDB 1MZEA 2QWNB 4UCVA 3ZMZA 3N2GB 1US6A 1BZKA 2N05A 2YI8A 5IWAO 1V9PA 1OCCB 5FNVA 4MVOA 4DR7B 1I7FA 1XI1A 2BCCH 1VQ9V 3WG7B 1E1QG 2WAMA 5L3FA 4PA9A 4DV0O 4NXMB 1K4CC 2QSAA 3ASOC 4U7NA 3OE7G 2UXBO 1Q6IA 3BRCA 4X20A 5CA0B 3SYOA 1TUEB 4I55B 2FMLA 1IBKO 3CP1A 2XAHA 1DLBA 1GM7A 4CH4A 2AGAA 2XNDG 4FFKA 4N21A 1XL4A 1GN4A 1WP8A 1FFXA 1ZLZA 3CC4V 1PNKA 4X1YB 2ITCC 4DUYO 3JD4A 2JEXA 4TV9B 1GMGA 2WLNA 3T4ZA 2MW2B 4JZGA 3W7XA 1S5LZ 3E22B 1QCEA 4YHHO 3CCVV 1RFYA 2EIJB 5KX5B 2XAJA 5CA3A 3DSQA 2A06H 1ZWIC 4X1IB 1FJGB 4JV5O 2DE0X 4J9YB 2XAFA 2ZE8A 2YIAA 1S77D 4JI2B 4JYYA 5IY5C 1Q86W 1N32B 3ZS8C 5JH7A 1K4DC 2A3QA 1Y4MA 1XMQO 1OCZB 4ZHQA 4JI7B 2OCHA 1Y76A 1SZTA 2VS0A 2YICA 1Q43A 4JGSA 4DR5B 1FYJA 1Q6UA 3ZRVA 1OCOB 1W0JG 4FLYA 3AK3A 3L73H 4DUZO 4P9OA 4QPKA 1NQTA 3JARB 3ASNB 1JJOA 1VQ8V 5FPOA 3WG7C 1AR5A 4PHZA 1YXBA 2EZPA 1PNMA 2ZD9A 2ZCEA 2PF4E 5IYCO 1N4CA 1H2LA 5LXTA 3NXSA 3LDCA 4DRXA 1WJZA 3AG2C 3DGEA 3AG4C 4ZOLA 4FJCC 4TQFA 4U3FH 5JJNB 2F23A 2Q7HA 5CA1B 5B1BC 1NTZH 4MTXA 1KC8W 4B3RB 1Q3EA 1AILA 1NI8A 5CA1A 5K1PA 3CC2V 5LMUB 1IVSA 2AXTZ 5KAIZ 4TUYB 1YSCA 2ILMA 1BGYH 5JWPA 2HJDA 3N27A 4FMTA 2ODMA 4ICGA 2V1DA 3K5LA 1JMKC 3HKBA 1N34O 4IHJA 5LGNA 3G67A 1OCZC 3DTUB 2ZR3A 3CCMV 3CCUV 4DV6O 4FM0A 3BCCH 3IGAC 3ZHQA 4DRXB 1SS3A 2YXHA 5HFLA 1B6QA 4QJFB 1KBHA 3ASNC 3JD2A 1AVMA 4IT5A 3ZMVA 4KXRA 4H33A 3AG1B 3IC9A 4X8AA 1NU1H 3CC7V 2CK3G 3AG7A 3RVZA 1HWYA 1M1KW 2LJ2A 2GTAA 3WB0A 3H9VA 2UU9O 1LUVA 3JSNA 4WFBV 3A8TA 4ASUG 1GH6A 3SPCA 4J80A 5LP6C 2QKSA 5BXZA 1R6KA 2R70A 3JAMN 1V54C 1UFIA 3G6EV
chains in the Genus database with same CATH topology
1WA8A 3O9OA 3Q4HA 3OGIB 3TXQA 4I0XB 3G80A 3GVMA 4GZRB 3FAVB 2VS0A 2VRZA 2KG7A 4ABMA 4LWSB 1WA8B 2B9ZA 3FAVA 3HR0A 2AZ0A 3Q4HB 3TXSA 4I0XA 3GWKC 3ZBHA 2DE0X 3FD9A 4LWSA 2KG7B 2AZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 A;  3O9O A;  3Q4H A;  3OGI B;  3TXQ A;  4I0X B;  3G80 A;  3GVM A;  4GZR B;  3FAV B;  2VS0 A;  2VRZ A;  2KG7 A;  4ABM A;  4LWS B;  1WA8 B;  2B9Z A;  3FAV A;  3HR0 A;  2AZ0 A;  3Q4H B;  3TXS A;  4I0X A;  3GWK C;  3ZBH A;  2DE0 X;  3FD9 A;  4LWS A;  2KG7 B;  2AZ2 A; 
#chains in the Genus database with same CATH topology
 2VWK A;  1PL0 A;  2P4K A;  3F7V C;  4LF8 O;  4WCE V;  1DGS A;  4LFC O;  2X0L A;  3VQY A;  3APO A;  3W7S A;  3ZN1 A;  1B04 A;  2XHB A;  3THO A;  1BCC H;  1JFF A;  3ABM C;  4CC6 A;  4LF9 O;  2D3O W;  3CPW U;  3HKD A;  2HVK C;  1KD1 W;  4DR4 B;  4UB8 Z;  1YVW A;  3SYC A;  3E22 A;  3OUF A;  4X1K B;  5L3D A;  4LH6 A;  3RT3 C;  1KMI Z;  1SC5 B;  1P7G A;  3P30 A;  3RGB A;  2QDO A;  2JRI A;  3RYH A;  3ZHR A;  1YF2 A;  3VOU A;  4H13 B;  3ABK B;  4F4L A;  1KP3 A;  1QNM A;  1D2D A;  2E5L B;  1NTM H;  2GUZ B;  3FYE B;  1IDS A;  1VEW A;  2F93 B;  1N34 B;  4AQY B;  4UCS A;  3AG3 B;  1Q81 W;  4X20 B;  5CA0 A;  1K97 A;  1HW7 A;  2WLL A;  4EB6 B;  5JJE B;  4UV9 A;  1SRY A;  4X65 O;  4E2L A;  4RWU A;  2RNB A;  5IYZ B;  3H1K H;  2Y69 B;  2AZ2 A;  5LXT B;  1MMM A;  2E76 B;  1K5S A;  1XNQ O;  5IT9 N;  2EUL A;  3L71 H;  3LUT B;  3OD4 A;  3N2G A;  3E8B A;  3KCX A;  4FFB B;  3P3P A;  5KX5 A;  4WFA V;  3RYC B;  3ABU A;  1H2N A;  1Z2G A;  4JI2 O;  2PTM A;  1HDJ A;  2WLH A;  4MSW C;  2CGO A;  3ZMS A;  4PA7 A;  2BE3 A;  3PJS K;  1XMO B;  1FXK A;  3K08 A;  4GX1 A;  2Q8V A;  1XHZ A;  1W0K G;  1GK9 A;  5CMU A;  1IBL B;  3STZ C;  5JH7 B;  2BOB C;  3SJB C;  1VF5 B;  4QIW F;  3TJT A;  2DYR C;  4LF7 O;  5AG2 A;  2QTS A;  3SYQ A;  1K8A W;  1AP6 A;  3FKS G;  1SQQ H;  2L35 A;  2ZIM A;  4MS2 A;  4LF8 B;  5IJ9 A;  2EBO A;  2QKA A;  4CH5 A;  1GKF A;  4PDM A;  3ZJZ A;  3IFX A;  2WPD G;  4KP4 A;  3T4D A;  1F23 A;  1WPB A;  1R6T A;  2WSS G;  3JAL B;  1AI7 A;  3VQW A;  1M93 A;  1NZ6 A;  5ITZ B;  3LDD A;  5LBQ A;  2XAS A;  1FKA O;  2P22 C;  4X88 A;  1L0N H;  2X6A A;  3D3I A;  2E75 B;  2O57 A;  5LMN O;  3O9O A;  1JFF B;  4JTA B;  1XIL A;  3BEH A;  4MTO A;  2YEV A;  4DV1 O;  3ZMU A;  4MVZ A;  1VIB A;  4NB5 A;  3SJC C;  2RQ6 A;  3H1H H;  1GM9 A;  3ZRW A;  4DXW A;  2X6B A;  3LSU A;  4NKG B;  5LMN B;  4FLX A;  2QM8 A;  1GO3 F;  4TSF G;  5KMG A;  3C3T A;  3ZRW B;  2DYS B;  3CJH B;  1XMQ B;  1IXM A;  3CRQ A;  4DV5 O;  1XBL A;  5LA6 A;  1DTO A;  1MG1 A;  2NLJ C;  1WN7 A;  3GWO A;  4WFF A;  4UB6 Z;  2ADP A;  3TXQ A;  4K8Z A;  3W7W A;  2EZO A;  1M4U A;  2EIK C;  2OTJ V;  4DV4 B;  2OTL V;  3R65 A;  2PYL A;  4XDL A;  3C3S A;  1XMO O;  3I5D A;  4GX0 A;  4JI4 O;  1PD3 A;  2VQE O;  3RYH B;  1JJ2 U;  4J11 A;  5B1O A;  2EIJ C;  3HKE B;  1Z5W A;  1GTO A;  5H6R A;  4BWA A;  1FJG O;  3SPG A;  3CXC U;  1PL4 A;  3CB2 A;  1WP7 A;  1UJW B;  4O4L B;  4PI2 A;  2Q73 A;  1WLE A;  1FXV A;  2FL4 A;  4LF4 O;  1CXZ B;  1EN5 A;  2JJ2 G;  2X6C A;  2VQF O;  1TAE A;  2GBO A;  2UXX A;  4YXW G;  2XAG A;  3J81 N;  5B3S B;  4BW5 A;  1I0H A;  1VQO V;  1S3J A;  2E3C A;  1YJW V;  1IBM O;  2R9I A;  5CBF A;  2DQ0 A;  2UXD B;  1URF A;  5LHH A;  4W4K A;  4UXN A;  3J7A U;  2IW5 A;  3SDL A;  3TGU H;  4O4J B;  3B77 A;  1BMF G;  5B1B B;  4DV1 B;  2ARH A;  4R6Z A;  3A2F A;  1K92 A;  1Y67 A;  1N33 O;  3E8H A;  1SES A;  4J9Z B;  2CAZ C;  1LUW A;  3AG2 B;  3RYF A;  3JAS A;  2P67 A;  1YIJ V;  1MOF A;  3U0Z A;  1U97 A;  3CCL V;  1JCH A;  2IH3 C;  4HNA A;  1XHX A;  1P49 A;  1VQL V;  3EFF K;  2OYQ A;  2XUM A;  3CRM A;  3FB6 C;  2AHY A;  2NNU A;  2PZS A;  5KHK A;  4KHP O;  1B3Q A;  1N8R W;  1BHA A;  1QU7 A;  3KG2 A;  2E74 B;  4ZIB A;  2Q6A A;  3CYO A;  2HJF C;  3QF7 A;  4FZ0 A;  3K58 A;  5HFM A;  3JAT B;  4JI0 B;  1SET A;  4DK0 A;  5C93 A;  1N32 O;  2DMX A;  2M6Y A;  1WNS A;  5DM6 V;  3ZBH A;  4GKK O;  3BA9 A;  4RUE A;  4LFC B;  4MVM A;  2DW4 A;  4HNA B;  4PJ0 Z;  3K3W A;  4Z2W A;  4GYC B;  4J7K A;  2F66 C;  3FFQ A;  3K5O A;  4AI8 A;  2EJ7 A;  1M56 B;  1GN3 A;  4FLZ A;  4QPJ A;  3OTO O;  3OW2 U;  1HR0 O;  4EKW A;  4LF4 B;  3CHX A;  2CTW A;  1H2M A;  4GKK B;  1I08 A;  4CS4 A;  1DK1 A;  1VQN V;  5TIS Z;  3EHB B;  1YDX A;  5B1A B;  1BSM A;  3K59 A;  3TK1 A;  3NR7 A;  1KQS U;  1CP9 A;  2DWE C;  2WLJ A;  4DR6 O;  1T5E A;  1S5J A;  3CRC A;  1QHT A;  1L1F A;  4MTF A;  1ZAU A;  3VQX A;  1QQC A;  3BPZ A;  4LFA O;  2JJ1 G;  1R3K C;  2V7Q G;  1VF7 A;  5FL7 G;  2IJK A;  4WF9 V;  3CCR V;  2ZM6 O;  2IJI A;  2Z3Y A;  3Q4H A;  2UUA B;  4R7C A;  3CRA A;  5LP6 B;  1RPO A;  3ML0 A;  4JI1 B;  1VP7 A;  5L3G A;  1XDC A;  3D36 A;  4ZHQ B;  2HHH B;  2QWQ B;  3WB2 A;  1CPY A;  1NR1 A;  1TA8 A;  5GTH Z;  1N0J A;  3B4S A;  5H9C A;  3QO8 A;  2PI5 A;  2CTQ A;  3JAS B;  4I9W A;  5EBL C;  4K3A A;  1CEZ A;  3SPI A;  4LFB B;  1S72 V;  5JJJ B;  4QGP A;  1NH2 B;  3ABM B;  4MVS A;  5GTI Z;  1M56 C;  1WAZ A;  3LNN A;  2Q69 A;  1H8E G;  2WWW A;  4AQY O;  5LGU A;  3FAV A;  2UXC O;  1QLE C;  3ETG A;  4DR3 O;  2PGG A;  2JK5 C;  5KUK A;  2NR5 A;  2YEV B;  1IXB A;  4KHP B;  5IE9 A;  1ZTE A;  2CGN A;  1J5E O;  4O2A A;  5E79 Z;  4NTY A;  4LF6 B;  4NYK A;  1MSD A;  2QR4 A;  3ABT A;  4W4L A;  3D8C A;  3HR0 A;  3RBZ A;  1X59 A;  4BIO A;  3OGC C;  1SKV A;  3CCJ V;  3UT5 A;  5LGT A;  3CJH A;  3JCZ A;  4JAV A;  4UCR A;  3FB7 C;  5C8Y B;  2F4V O;  2KQX A;  2ZXW B;  3H1J H;  3QO7 A;  5EC2 C;  4O2B A;  4LF6 O;  4MW3 A;  3AK2 A;  5JCO C;  1H2S B;  3S3W A;  5GON B;  3QTC A;  3C90 A;  2BOC C;  5IWA B;  3CCS V;  2HEP A;  1AJN A;  4B08 A;  1NS1 A;  3L9D A;  2LW1 A;  3CWB H;  2NN4 A;  3X2Q B;  5F2V O;  4AHC A;  4ZI7 A;  2F4V B;  2ZE5 A;  2FB5 A;  4TOI A;  4J10 A;  2UXD O;  2OCC C;  1L0L H;  1K34 A;  5KMG B;  4O2A B;  2A7W A;  3ETD A;  3HB3 B;  5JQG B;  5LHI A;  4YJ2 A;  2P7T C;  4R8C A;  4H0L B;  3SPH A;  4XBF A;  3ZED A;  1ROP A;  2YIB D;  2PYJ A;  2ZM6 B;  1RM1 B;  3F7Y C;  3ETQ A;  4LNU A;  2CUG A;  1QR9 A;  4BIU A;  1TUB A;  4YHH B;  1S76 D;  3CMA V;  2GSM B;  3QNE A;  2WA4 A;  1RPR A;  2ZE6 A;  3EXA A;  1DF4 A;  1FPO A;  4O2B B;  2QWR B;  4O4H B;  1YHQ V;  4B3T B;  2P6J A;  3FB8 C;  3WB1 A;  2IJJ A;  5H2F Z;  4TT3 G;  2Q7G A;  3ABL C;  2X7R B;  3G4S V;  3WFV A;  1OCR B;  3FX7 A;  1P4R A;  5FNV B;  1Y6X A;  4DW1 A;  4X62 O;  2ZNI A;  3OFN G;  4LCU C;  4Q6G A;  5IJ0 B;  4JI3 B;  3R66 A;  2RCV A;  1NJI W;  4JTD B;  1U96 A;  2ZQM A;  3X2Q C;  5BY1 A;  2PY5 A;  4DUY B;  1P7B A;  4K35 A;  5IJ0 A;  1OCO C;  2DOS A;  1TVK B;  2JDI G;  1FXK C;  3LSS A;  1HNX B;  4FLW A;  4DR2 B;  3UT5 B;  4DV7 B;  1RP3 B;  5JCO A;  1IZ3 A;  2DN9 A;  1Y74 A;  3JAK B;  1RM1 C;  4PD4 F;  3SJA C;  1LNQ A;  2N74 A;  4OPA A;  4CC5 A;  5B1N A;  4IL6 Z;  1H8H G;  1V55 C;  2VQE B;  4NXN B;  3UKM A;  4RAI A;  3AG4 B;  3TXS A;  3P3N A;  5C8Y A;  1HNX O;  1VF6 C;  3ZHV A;  1SQG A;  5B66 Z;  3ZN0 A;  2UUB B;  1EFR G;  5LYJ A;  2ZNJ A;  2Z0A A;  4CH6 A;  2EIK B;  1XRE A;  3E83 A;  3M7M X;  1R6N A;  3VBB A;  5GW7 A;  5L3C A;  2ZKO A;  4GZR B;  4JTC B;  4JI5 B;  5LOV A;  2WLI A;  3ZHS A;  2QA4 V;  3BA8 A;  1NT2 B;  4PI0 A;  2Q68 A;  3K9S A;  2VQF B;  5BMV A;  3JD3 A;  4Z1M G;  2R72 A;  2CH7 A;  3H1L H;  4JI1 O;  3ZHT A;  4F6R A;  2OIG A;  2Q9L A;  1NKD A;  1XEQ A;  1JQ0 A;  3UCS C;  3L74 H;  1K9M W;  3ICX A;  3G80 A;  4BAY A;  1QBZ A;  1N36 B;  2UXB B;  1EZV H;  2AW9 A;  1M5I A;  1VMG A;  1BHB A;  2Q5Z A;  4LFB O;  3SYP A;  2CTR A;  1NVP B;  1I94 B;  2BSK B;  3K9A A;  1JOY A;  2L6L A;  1MNG A;  3D36 C;  5GON A;  3HKC B;  4G28 B;  1GAX A;  2Q0A A;  1WA8 A;  3T1H B;  4B3S B;  3L72 H;  5B3S C;  1PP9 H;  2EIN C;  1M57 C;  1E79 G;  4J7J A;  4CZZ A;  1VQM V;  5KHH A;  1G8M A;  5EC1 C;  4Z1V A;  4UVA A;  5CBG A;  1YZB A;  1J5E B;  2LFR A;  4DW0 A;  2Q7E A;  5LP6 A;  1I94 O;  1I5X A;  3DXR A;  1XNR B;  1MA1 A;  5D5Q A;  3SYA A;  5CBH A;  1HR0 B;  3OR7 C;  1KEC A;  4JI7 O;  1VAR A;  1XOU A;  3F5W C;  1N0N A;  1H2G A;  3JCU Z;  1W2B U;  3JD1 A;  4TV8 B;  4JI6 B;  1AI4 A;  1G1X B;  3K0D A;  4DR2 O;  4DUZ B;  4RQE A;  2W6J G;  4GUN A;  1OZ0 A;  3JAT A;  4JI0 O;  4G27 B;  1HNZ B;  1ZL8 B;  1LR1 A;  1G6U A;  1K7D A;  2Y4U A;  2KG7 A;  4K0K O;  4MVQ A;  2Q4P A;  4R50 A;  1YCI A;  1ZL8 A;  4GKJ O;  3E89 A;  4IHJ B;  4PEL A;  3K57 A;  5B5E Z;  1ZSP A;  5EIB C;  4JV5 B;  4FM1 A;  2E5L O;  3OTO B;  1YJ9 V;  1MZF A;  2PUS A;  2YID A;  2RJZ A;  2HHH O;  3OEE G;  4DYL A;  1Q6H A;  1GRJ A;  4RO2 A;  4TWK A;  1Q5O A;  2EIN B;  1GN2 A;  3RWR D;  2EJR A;  1B06 A;  2B5U A;  4K0K B;  1FD9 A;  4YJ3 A;  4X66 B;  3DXR B;  3CE2 A;  1JVM A;  3MAQ A;  4O4L A;  2A0L A;  4DR4 O;  3RYI B;  1UPG A;  4NR1 A;  3M99 B;  2YS8 A;  4DR6 B;  1Q90 D;  3IAY A;  3OMN B;  4EEQ A;  3B8N A;  3K5N A;  2YXL A;  2N04 A;  2CH7 B;  3APQ A;  5IDJ A;  3CX5 F;  4LFA B;  4B7E A;  5JVD B;  2UUC O;  2B9Z A;  5B1A C;  4CBC A;  1I5Y A;  4I0X A;  4BR6 A;  1WB7 A;  2ZIO A;  3RYF B;  4YJ3 B;  1QVG U;  3ZCC A;  3MHS C;  5BR8 O;  4UVC A;  3DC6 A;  4ZOL B;  4B3M B;  4TUY A;  3FB5 C;  5KUM A;  3CSX A;  4JF3 A;  1BS3 A;  5LMU O;  3UO2 A;  3UQ8 A;  1AR1 B;  4LF5 O;  4ZKI A;  1EZJ A;  5EYP B;  3FD9 A;  1VQ6 V;  4GCZ A;  1XNR O;  3AEI A;  1R3L C;  4JI8 B;  2F95 B;  3OT7 A;  3L70 H;  4LR3 A;  1R1B A;  2JIZ G;  2UXN A;  3LSQ A;  1VF6 A;  4PA3 A;  1KB9 F;  4MVU A;  4YIP A;  4RQF A;  3N2K B;  2YSU B;  2ZE7 A;  2YIB A;  2DYR B;  2QE7 G;  2EIM B;  3ZX6 A;  4UFZ A;  2YI9 A;  4P2Z A;  2Q0O C;  1Y76 B;  4KUM A;  4JAA A;  2LW7 A;  1PM9 A;  5A2Q N;  1FXH A;  4YY3 B;  1THZ A;  3CCQ V;  4UCT A;  4P9P A;  3RVY A;  4I55 A;  4X1I A;  1QLE B;  2YC0 A;  4UV8 A;  5DED A;  3GVM A;  3A0R A;  3B8M A;  3CS5 A;  1SA0 A;  4F6E A;  5KA6 A;  3SPJ A;  5KLV H;  4J42 A;  2M7W A;  1SF9 A;  2C2A A;  3H1I H;  4E4E A;  1NVP D;  3K0G A;  4OXS A;  4JI5 O;  3P32 A;  1BQZ A;  4DV3 B;  4LNU B;  1SZX A;  3ZHU A;  2UU9 B;  1F4N A;  2F43 G;  3B09 A;  5BMV B;  5L3E A;  2Q67 A;  2JEU A;  2RN9 A;  2JS3 A;  5EBM C;  3GB7 C;  4JAU A;  2LGQ A;  3SJQ C;  3T1Y B;  2AZ0 A;  4NVP A;  4A5U B;  2W0F C;  3MDS A;  3HKE A;  4LH7 A;  1N36 O;  3WU2 Z;  1Q8I A;  2OCC B;  3OGI B;  4CS3 A;  3G71 V;  2ZR2 A;  2KSD A;  1VQK V;  2H3O A;  3OTF A;  2Y4T A;  2DJV A;  4U3J B;  3KZI Z;  1AP5 A;  3OM3 B;  4O4I B;  1KUQ A;  1YIT V;  2WA3 A;  1PNL A;  2K9P A;  2HP8 A;  4B3S O;  3QO5 A;  5ITZ A;  4C7U A;  3ABK C;  3GWK C;  1GM8 A;  4IIJ A;  5J2T A;  4PDV A;  4U3J A;  2JS5 A;  1D5A A;  5LOV B;  1W59 A;  3B2E E;  3IJ4 A;  5BR8 B;  5KA5 A;  4B3M O;  2FTK A;  1F4M A;  4D7S A;  4IYI A;  3UM7 A;  3T2M A;  3OMI B;  1SQP H;  2IU0 A;  4B3T O;  1O9G A;  1FFT B;  3K79 A;  1DF5 A;  3ZMT A;  1L8D A;  1HNW O;  3OR6 C;  3ABL B;  3OAA G;  4MT8 A;  2P5O A;  4I9Q A;  2EX3 A;  4DK1 A;  1SA0 B;  2Y69 C;  4X9Q A;  4UCU A;  5BZB A;  4DV2 O;  4B7K A;  3E8F A;  4GLX A;  4X62 B;  4DO2 A;  3JAL A;  2V4D A;  2XT9 A;  2F1M A;  2XOK G;  3IC7 A;  3BAA A;  4JI3 O;  1QLN A;  3QVN A;  4CS2 A;  4DV4 O;  3BAB A;  2IU3 A;  4X64 B;  1SQX H;  2G38 A;  1AI5 A;  5KHJ A;  4EB6 A;  4LWS A;  4PA6 A;  5K1X A;  3W7U A;  4DR5 O;  3FYI B;  2HLD G;  5KAF Z;  1OCR C;  4GKJ B;  3I56 V;  4OGQ B;  1OCC C;  3ZRS A;  3T1C A;  2VRZ A;  4NTX A;  1R73 A;  2QKC A;  4FFB A;  1J95 A;  5IYZ A;  1NBM G;  4ZI7 B;  3ASO B;  2EIL C;  5KHI A;  2QGN A;  3F5T A;  4K8X A;  3VQV A;  2Y0P A;  2P06 A;  4X66 O;  4PV1 B;  1VQ5 V;  1FXK B;  1HP8 A;  3O65 A;  4X1K A;  1AJP A;  3CD6 V;  4WFG A;  2HG5 C;  2W6I G;  1RSO A;  4JAS A;  2GUZ A;  3B40 A;  2YDE A;  4DV0 B;  4B3R O;  2CDY A;  3RN4 A;  4D6T H;  4IGG A;  3RW0 A;  1K3E A;  1MAB G;  4FLV A;  1TUB B;  4CH3 A;  2RDC A;  4XDK A;  1V55 B;  3CME V;  1Q82 W;  3BY6 A;  1GN6 A;  1S5H C;  4JYB A;  2QWO B;  3LNM B;  4OX9 O;  2ZDI C;  3MHH C;  2FKX A;  4DV5 B;  3SGI A;  5E1A C;  4DV6 B;  4JI6 O;  2JGU A;  2Y48 A;  4YIO A;  4D7T A;  1BL8 A;  4GX2 A;  3W7T A;  1A32 A;  3FAV B;  2H8P C;  2XAQ A;  3ZRX A;  4AIL C;  4OX9 B;  4DR1 O;  4PDL A;  5IY5 B;  1HNW B;  3ETE A;  4HZ3 A;  4P30 A;  4JI4 B;  2B1G A;  1D5N A;  1ORQ C;  5JVD A;  4PA4 A;  1VQ7 V;  5D5P A;  3OMA B;  4DV2 B;  3EVK A;  3LDE A;  4X89 A;  1FS0 G;  3TCU A;  4KL1 A;  1F51 A;  1Q7Y W;  1YEW A;  4FIP C;  2OT5 A;  4WFE A;  4DR1 B;  2BTQ A;  2OWO A;  1M57 B;  2KG7 B;  3D3Q A;  2QM7 A;  4QE7 A;  1VQ4 V;  4NXN O;  3KCY A;  1PPJ H;  5EK0 A;  3ZIA G;  1QR8 A;  2RMK B;  4I0X B;  2WLK A;  3DC5 A;  4JZ2 A;  4U7O A;  4MW8 A;  1OJH A;  5EZY B;  2ATK C;  4N23 A;  5FPR A;  2OIE A;  2GV9 A;  2Y0I A;  3A0H Z;  4O4J A;  1KP2 A;  4I4T A;  1YTF B;  2CTP A;  1QVF U;  4LBE C;  4XDJ A;  1E1R G;  2QTO A;  5H6Q A;  4LC1 A;  4QE9 A;  3JAR A;  1EN4 A;  3MD0 A;  2JGD B;  1YI2 V;  4IYH A;  2IBZ H;  2VWJ A;  1N33 B;  1KKD A;  4I50 B;  2R9A A;  1VQP V;  4EFB A;  1K33 A;  4G2K A;  3AG1 C;  4TV8 A;  3G6B A;  1BT8 A;  2LO1 A;  3RYI A;  3QG5 A;  1O9H A;  2YXY A;  5L3B A;  5KHG A;  5DEC A;  3K04 A;  3HKC A;  3KKY A;  4F6R B;  3U11 A;  3T1H O;  4TQD A;  4WBN B;  1EM1 A;  5LHG A;  4H44 B;  3S3X A;  2LGW A;  1IBM B;  2ADQ B;  4I4T B;  4KFM A;  4EFE A;  5EIB D;  4FZ1 A;  1ZX3 A;  1AI6 A;  1M90 W;  1XUQ A;  1NH2 D;  4I50 A;  2BTQ B;  1JA8 A;  5IYD O;  1V54 B;  2HR3 A;  2JGD A;  2GDS A;  4H37 A;  4YY3 O;  1WA8 B;  1WPX A;  4UCO A;  1G4Y B;  4BW9 A;  2UXC B;  3OEH G;  2FYU H;  2HKO A;  1H38 A;  2QWP B;  1WB8 A;  2WLI B;  4WBN A;  5CN0 A;  2WLM A;  2BSK A;  4HYO A;  4HBN A;  4LP8 A;  4J7Z A;  4LF5 B;  1JX9 A;  1EBO A;  3K06 A;  2DWD C;  5EZY A;  3AK1 A;  3H01 A;  2BTO A;  2ZXW C;  2HVJ C;  1YJN V;  4MVR A;  4DV3 O;  4JI8 O;  2ZIN A;  5J9P C;  4JYC A;  1KKC A;  4RUF A;  1HNZ O;  4FM2 A;  2GTS A;  2QEX V;  3RFR A;  1IUR A;  1X4T A;  1AJQ A;  4L87 A;  5FLX N;  1OV9 A;  3OUS A;  1XQ8 A;  4LF7 B;  1BQ0 A;  3T1Y O;  4ZBM A;  1R3I C;  3BVO A;  3CEI A;  4WFH A;  5A9G A;  3HKB B;  5LA6 B;  2Z5U A;  2H94 A;  2P4V A;  2IJH A;  5EBW C;  4J41 A;  4X1Y A;  2CE4 A;  1FFX B;  2ZDI A;  2PI4 A;  2MK3 A;  1K73 W;  2K1E A;  1RSO B;  3HPL C;  2HFE C;  2JVD A;  4IIJ B;  5J2T B;  2EIM C;  4I5S A;  4JPR A;  1BE3 H;  1NTK H;  1Z5V A;  4UVB A;  1SER A;  4JYA B;  4LWS B;  2A79 B;  2XTA A;  1Y74 B;  3JAK A;  2LFS A;  3AG3 C;  3E35 A;  2A9H A;  2UUC B;  4MTG A;  2AHZ A;  4NXM O;  5CB4 B;  1JR9 A;  3JYC A;  3BFR A;  4O4H A;  4FLT A;  3E86 A;  3STL C;  2KKW A;  2P90 A;  1XNQ B;  2IM9 A;  1IBK B;  1AR4 A;  2DQ3 A;  1M9N A;  4FPP A;  4DV7 O;  1MSW D;  4PDR A;  2ITD C;  3JAW B;  4NTW A;  1AB3 A;  2ZT9 B;  3L75 H;  1KYO F;  1SQB H;  5LYJ B;  1KU9 A;  3U10 A;  2UUA O;  3E8G A;  1EN6 A;  1SQF A;  5IYB O;  5J2U B;  1IX9 A;  3JAW A;  1FAF A;  1PV0 A;  4GT1 A;  3TET A;  2LQT A;  2D2C B;  2UUB O;  5J2U A;  1ARO P;  5DN6 G;  3JSL A;  3PN1 A;  1TGO A;  1XL6 A;  4TV9 A;  4L8J A;  1F7Y A;  1S0V A;  1PKX A;  1OHH G;  4X65 B;  1YTF D;  4HAM A;  4FVM A;  3A0B Z;  4ABM A;  4QNH B;  3I55 V;  2YUA A;  2ETN A;  1ENV A;  3SR2 C;  1NR7 A;  2IH1 C;  4DR3 B;  4UUJ C;  4GX5 A;  3K03 A;  4FLU A;  3BHP A;  2R9R B;  3RYC A;  3JD0 A;  4O4I A;  4YJ2 B;  5EYP A;  5CB4 A;  5JQG A;  3K5M A;  5H5N A;  4X64 O;  1K5Q A;  1SQV H;  4Q20 A;  3CCE V;  4I7Z B;  3CRR A;  2QJ1 A;  1ZUQ A;  3M8A A;  2GHY A;  2KB1 A;  3Q4H B;  3CXH F;  2QM4 A;  5LL6 Y;  3E2E A;  5IJ9 B;  1IBL O;  1R3J C;  4DR7 O;  2WLL B;  3UO3 A;  1TVK A;  1H2K A;  2DYS C;  1JPX A;  3N2K A;  1Y66 A;  1P84 F;  2LP7 A;  2W0X A;  4LF9 B;  4FK5 C;  2EIL B;  4OPH A;  4JYA O;  3J80 N;  2B1I A;  4BIZ A;  1COW G;  3HKD B;  1MZE A;  2QWN B;  4UCV A;  3ZMZ A;  3N2G B;  1US6 A;  1BZK A;  2N05 A;  2YI8 A;  5IWA O;  1V9P A;  1OCC B;  5FNV A;  4MVO A;  4DR7 B;  1I7F A;  1XI1 A;  2BCC H;  1VQ9 V;  3WG7 B;  1E1Q G;  2WAM A;  5L3F A;  4PA9 A;  4DV0 O;  4NXM B;  1K4C C;  2QSA A;  3ASO C;  4U7N A;  3OE7 G;  2UXB O;  1Q6I A;  3BRC A;  4X20 A;  5CA0 B;  3SYO A;  1TUE B;  4I55 B;  2FML A;  1IBK O;  3CP1 A;  2XAH A;  1DLB A;  1GM7 A;  4CH4 A;  2AGA A;  2XND G;  4FFK A;  4N21 A;  1XL4 A;  1GN4 A;  1WP8 A;  1FFX A;  1ZLZ A;  3CC4 V;  1PNK A;  4X1Y B;  2ITC C;  4DUY O;  3JD4 A;  2JEX A;  4TV9 B;  1GMG A;  2WLN A;  3T4Z A;  2MW2 B;  4JZG A;  3W7X A;  1S5L Z;  3E22 B;  1QCE A;  4YHH O;  3CCV V;  1RFY A;  2EIJ B;  5KX5 B;  2XAJ A;  5CA3 A;  3DSQ A;  2A06 H;  1ZWI C;  4X1I B;  1FJG B;  4JV5 O;  2DE0 X;  4J9Y B;  2XAF A;  2ZE8 A;  2YIA A;  1S77 D;  4JI2 B;  4JYY A;  5IY5 C;  1Q86 W;  1N32 B;  3ZS8 C;  5JH7 A;  1K4D C;  2A3Q A;  1Y4M A;  1XMQ O;  1OCZ B;  4ZHQ A;  4JI7 B;  2OCH A;  1Y76 A;  1SZT A;  2VS0 A;  2YIC A;  1Q43 A;  4JGS A;  4DR5 B;  1FYJ A;  1Q6U A;  3ZRV A;  1OCO B;  1W0J G;  4FLY A;  3AK3 A;  3L73 H;  4DUZ O;  4P9O A;  4QPK A;  1NQT A;  3JAR B;  3ASN B;  1JJO A;  1VQ8 V;  5FPO A;  3WG7 C;  1AR5 A;  4PHZ A;  1YXB A;  2EZP A;  1PNM A;  2ZD9 A;  2ZCE A;  2PF4 E;  5IYC O;  1N4C A;  1H2L A;  5LXT A;  3NXS A;  3LDC A;  4DRX A;  1WJZ A;  3AG2 C;  3DGE A;  3AG4 C;  4ZOL A;  4FJC C;  4TQF A;  4U3F H;  5JJN B;  2F23 A;  2Q7H A;  5CA1 B;  5B1B C;  1NTZ H;  4MTX A;  1KC8 W;  4B3R B;  1Q3E A;  1AIL A;  1NI8 A;  5CA1 A;  5K1P A;  3CC2 V;  5LMU B;  1IVS A;  2AXT Z;  5KAI Z;  4TUY B;  1YSC A;  2ILM A;  1BGY H;  5JWP A;  2HJD A;  3N27 A;  4FMT A;  2ODM A;  4ICG A;  2V1D A;  3K5L A;  1JMK C;  3HKB A;  1N34 O;  4IHJ A;  5LGN A;  3G67 A;  1OCZ C;  3DTU B;  2ZR3 A;  3CCM V;  3CCU V;  4DV6 O;  4FM0 A;  3BCC H;  3IGA C;  3ZHQ A;  4DRX B;  1SS3 A;  2YXH A;  5HFL A;  1B6Q A;  4QJF B;  1KBH A;  3ASN C;  3JD2 A;  1AVM A;  4IT5 A;  3ZMV A;  4KXR A;  4H33 A;  3AG1 B;  3IC9 A;  4X8A A;  1NU1 H;  3CC7 V;  2CK3 G;  3AG7 A;  3RVZ A;  1HWY A;  1M1K W;  2LJ2 A;  2GTA A;  3WB0 A;  3H9V A;  2UU9 O;  1LUV A;  3JSN A;  4WFB V;  3A8T A;  4ASU G;  1GH6 A;  3SPC A;  4J80 A;  5LP6 C;  2QKS A;  5BXZ A;  1R6K A;  2R70 A;  3JAM N;  1V54 C;  1UFI A;  3G6E V; 
#chains in the Genus database with same CATH homology
 1WA8 A;  3O9O A;  3Q4H A;  3OGI B;  3TXQ A;  4I0X B;  3G80 A;  3GVM A;  4GZR B;  3FAV B;  2VS0 A;  2VRZ A;  2KG7 A;  4ABM A;  4LWS B;  1WA8 B;  2B9Z A;  3FAV A;  3HR0 A;  2AZ0 A;  3Q4H B;  3TXS A;  4I0X A;  3GWK C;  3ZBH A;  2DE0 X;  3FD9 A;  4LWS A;  2KG7 B;  2AZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...