1BGYH

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 18
structure length 64
sequence length 64
chains with identical sequence T
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bgyH00
1P84F 1PPJH 3CWBH 1BE3H 4D6TH 3L73H 5KLVH 1NTMH 4PD4F 1SQQH 1SQVH 3L71H 1NTKH 1L0NH 1KYOF 1SQBH 3H1JH 3TGUH 3H1IH 3L70H 1PP9H 1SQXH 4U3FH 3H1HH 1EZVH 1L0LH 3CXHF 1SQPH 3H1LH 2A06H 1NTZH 1KB9F 3BCCH 2FYUH 3H1KH 1BGYH 3L75H 3L74H 3CX5F 1BCCH 3L72H 2IBZH 1NU1H 2BCCH
chains in the Genus database with same CATH superfamily
2CTWA 3BY6A 1N0NA 3I5DA 2WLHA 1AI4A 2IJJA 4X66O 4H37A 2CGOA 5FNVA 1XEQA 4DR2B 4LF9O 2AZ0A 4K3AA 4AQYB 4RWUA 2YDEA 4JI0O 4AI8A 5LHGA 2HG5C 4ZIBA 5F2VO 5KMGA 5EYPA 4HZ3A 4E2LA 5DEDA 4H13B 5B3SB 3CRQA 5B1BB 4UUJC 2OCCB 4HYOA 3LSSA 2D3OW 3FB6C 1M57C 1D5NA 3J7AU 4DV2O 1PM9A 2G38A 4CS3A 3K08A 2QWPB 5IJ9B 1SETA 3KCYA 4IIJA 3H01A 4YIPA 1YJ9V 1PNMA 2OCHA 1XUQA 1BCCH 2BTOA 4JI6O 1UPGA 5LA6B 3SGIA 1P7GA 1GO3F 1HDJA 4QNHB 1YIJV 4J42A 3M8AA 1MOFA 3WFVA 2P5OA 1Q81W 4TUYB 2BOCC 2ITCC 2X6BA 1QR9A 3N2GB 4R50A 3LSQA 1FJGB 2AGAA 3ABMC 4QIWF 3RYCA 2JGDA 5LGTA 3QNEA 4U7OA 2Q69A 1F51A 4IYHA 5KHHA 5LP6A 1K9MW 2Y0IA 2ZR2A 3JD4A 3J80N 2Q7EA 3LUTB 4DUZO 1Q7YW 3CCRV 1S0VA 1WPBA 1ORQC 3JAKA 3ZMUA 5EBMC 2KKWA 3WG7B 4JI4B 2Q68A 3LDDA 1AP6A 3AG3B 4HNAA 1WJZA 2UUAB 3BHPA 4P9PA 4DR1O 5TISZ 2W0XA 4LF8B 1SERA 1OCOB 3T1YO 1KP2A 1VARA 2LQTA 2YS8A 2EIJB 3JATA 3P3PA 4PA3A 4X65O 5JQGB 3H9VA 4ZI7B 2OIEA 1SA0B 2QA4V 5IYCO 1P4RA 1OCZC 1OCCB 3RVZA 2GDSA 2KSDA 1PL4A 4JI1O 4GZRB 1ENVA 2OYQA 4WFHA 3DSQA 1SQXH 3BABA 1XHXA 1N33O 3GVMA 1HW7A 3E2EA 1NTZH 3OUSA 2ARHA 5H6QA 4OGQB 2E5LB 4J7KA 4I50A 1NVPB 2JIZG 5BMVA 4N23A 2ADQB 4X62O 1S5HC 4DUYB 2EZPA 5BXZA 4I7ZB 5KX5A 3BFRA 1UFIA 4JI2O 2P06A 5EYPB 4X64B 2EIMB 3K5LA 5HFLA 4EB6B 4F6RA 4JI8O 1HNZO 4X9QA 1RM1C 4FM2A 3UT5B 5HFMA 1NH2D 4LFCB 4GKJB 1AROP 1K97A 1IZ3A 3G6EV 2AZ2A 4MT8A 3ZRWA 1CP9A 3CRAA 3AK3A 1AI5A 1KYOF 1SKVA 3K03A 5LXTB 4FVMA 1K5QA 4QE9A 5K1XA 3WB2A 4MTFA 1N34B 1FXKC 2A7WA 4NXMB 1SRYA 2QDOA 3AG7A 5JCOC 3OTOB 1IBKB 3G67A 1W0KG 4O2BA 5DM6V 1Z5VA 3RYCB 4DV5B 1HWYA 5CA0A 4D7SA 3SPGA 3JYCA 4KL1A 1EBOA 2V7QG 1O9HA 3BPZA 3ZMVA 1XBLA 3HKBB 2OWOA 1SQFA 1QLNA 3IC9A 4I0XA 3JAKB 1NU1H 2QR4A 4JV5B 2Q4PA 1Q6UA 1XOUA 3ASOC 4X1KB 4WFGA 1HNXB 1AB3A 1Q90D 2KG7A 4HNAB 4UV8A 3VQVA 2UU9O 1N36B 5CBGA 1IXMA 3WU2Z 1WA8A 4DR4O 2HLDG 5GTHZ 1YITV 3CE2A 2ILMA 1Q82W 4TQFA 3ZHUA 3RFRA 3A0HZ 3ZHQA 1VF6C 3OD4A 2QKAA 3C90A 4JI7B 2ZXWC 3LNMB 3N2KA 4FPPA 3CX5F 1IVSA 3NXSA 4P30A 3SPCA 1I5XA 2AHYA 4JAUA 4CH3A 1M4UA 3FB5C 4ICGA 2JK5C 2XAJA 1AP5A 3TK1A 1YI2V 3OE7G 5EZYA 4BAYA 5ITZA 1H38A 2XASA 4RUFA 5FPOA 4GX1A 1XI1A 2WPDG 3CCMV 1QR8A 5BMVB 3SYQA 4XBFA 3QG5A 3D3QA 2PY5A 2R9RB 2F23A 2N05A 4UVAA 3ICXA 3CRRA 4I5SA 3A0RA 2JGUA 1FXVA 4DR2O 3OMAB 1S77D 1AILA 3ZHSA 3CWBH 1U96A 4AQYO 5LMUB 5KLVH 4F6RB 3ABTA 3CXCU 3VBBA 1M5IA 4ZOLA 4DV3B 2Y69B 3OMIB 1I08A 3B40A 5FL7G 1JOYA 3SPJA 1EFRG 3VQWA 1NQTA 3E35A 1IXBA 2QTSA 1SQQH 4DR1B 1KUQA 4Z1VA 4DV0B 3OEEG 3T1CA 1JMKC 3KKYA 4IL6Z 2EJ7A 1VQNV 5CA0B 1G4YB 2DYSC 1G8MA 4I4TA 2BOBC 2LFSA 2QWNB 4UVBA 1K92A 1FJGO 1YDXA 2LGQA 1XMOO 3KG2A 1BL8A 1WP8A 5H5NA 2QWQB 5K1PA 1M9NA 1O9GA 4Q20A 3OW2U 1L0LH 2EZOA 4JI1B 3K0DA 1Q8IA 1OHHG 4K35A 1NVPD 4DR5B 4GKKO 4JI4O 3C3SA 1BE3H 4B3SB 1WA8B 3ASNC 3ZIAG 4MW3A 3RBZA 2UUAO 1E1QG 3D36C 4RQFA 2CUGA 1I7FA 3ZHTA 2B1IA 4LF7O 5B1AC 4K8ZA 4LF8O 4F6EA 5JH7A 1ZX3A 3U0ZA 3HKDB 3TXSA 4X88A 2RJZA 2HJFC 1BT8A 4TV8A 4PDMA 3E8FA 1QLEB 2EINC 1ZAUA 3GWKC 4P9OA 4QE7A 1TUBA 1MMMA 3ABKC 3P3NA 4B08A 3RW0A 4GYCB 1YJNV 3ETQA 4PI2A 1FFXA 3N2KB 4TV9A 5KAFZ 5DECA 3CRMA 2M6YA 4WFFA 2Y48A 5EZYB 1G6UA 1V54C 5ITZB 2XNDG 2P7TC 5LL6Y 2YICA 1JA8A 1NJIW 1WB8A 4DR6B 3JASA 3W7TA 2RN9A 3IAYA 1YXBA 4PA6A 4MVSA 5GONA 5LOVB 2Q8VA 2E5LO 1SS3A 2R9AA 2GBOA 5IT9N 3AG1B 3AEIA 3JARB 2ETNA 2F4VB 4Q6GA 4X64O 4ZOLB 4PA7A 4CBCA 3C3TA 3RYFB 4DR3B 1P7BA 3B4SA 1WAZA 3CD6V 5LGUA 3KZIZ 4NTXA 3E8GA 3SPHA 3W7UA 2CGNA 4LFCO 1VQ6V 2Q73A 2UUBB 1Y74A 4GKJO 1SF9A 4CC6A 5D5PA 4GT1A 3DC5A 5CA1B 1JPXA 2UXXA 1YF2A 3FB8C 1BHAA 2YXLA 4FLTA 1AR5A 4IT5A 4B3RO 1FPOA 3I56V 5A2QN 2OT5A 3RYIB 1BQ0A 1N34O 1Q3EA 4NXMO 2LO1A 3OTOO 1UJWB 2ZE5A 3ZJZA 1Z5WA 1H8HG 1LUWA 1IBKO 3TCUA 4DV5O 2BSKA 4MVUA 3OM3B 3K0GA 5KHIA 4B7EA 2E74B 2GUZA 1VQ7V 4OX9B 5IY5B 2FKXA 4J10A 4LWSB 1H2NA 4G27B 1Y76A 2V1DA 2YIDA 3JAWA 1HNXO 1JR9A 2F95B 2WSSG 1MA1A 1N36O 2XHBA 1COWG 5B3SC 5B1BC 2VQFB 3JD2A 1HR0B 4Z1MG 4HBNA 5JH7B 2F1MA 5BZBA 1NTMH 3CCUV 2CE4A 2DN9A 3T4ZA 2DJVA 4PI0A 2DW4A 1GRJA 1VQLV 3CRCA 2ZM6O 1ZL8A 2IW5A 1QVFU 1R3KC 4RQEA 4JI7O 2NR5A 2H8PC 3SR2C 2C2AA 1RSOA 3L9DA 1Y67A 4GX5A 3E89A 3LDCA 3IGAC 3JASB 2O57A 1Y6XA 2ZE7A 2YEVA 4O4JA 3OGCC 2UXDB 3Q4HA 1VQOV 2XAQA 3AG4C 5IYZA 4GCZA 4N21A 2IH3C 3MD0A 3OT7A 1WPXA 3WG7C 3CEIA 3AG2C 4WF9V 1IBMB 5CMUA 5GTIZ 1XMOB 5CBHA 5LMUO 2DQ0A 4FM0A 4E4EA 3VOUA 2ZR3A 1OCOC 4X1IA 1HP8A 4DV3O 2RCVA 1DGSA 4QPJA 3APQA 1Y74B 3SYCA 3JAMN 2PYJA 4Z2WA 2B5UA 5B5EZ 5IYDO 2EIJC 3CC4V 4GKKB 3CCSV 2IU0A 1YHQV 3L74H 4F4LA 3OMNB 3D8CA 1US6A 4LF7B 4J41A 1OCCC 4DV0O 2LW7A 5L3FA 1FXKA 3DXRB 1LR1A 5CBFA 5JCOA 1JCHA 1YVWA 2P67A 2DYRB 2PF4E 1GAXA 2XAGA 4FZ1A 2KB1A 1ZSPA 1N0JA 1L1FA 4JYCA 4B3MB 2XT9A 3O65A 3F7YC 3E8BA 1QNMA 3SJBC 1K4DC 2ZT9B 2QSAA 2WLMA 3JAWB 1L0NH 1EM1A 1KMIZ 3TGUH 3HKCA 4U3FH 4IHJA 3T1HB 5EBLC 3K5MA 1YCIA 3S3XA 3K5OA 2FYUH 4U3JA 4DR5O 1R1BA 4O4IA 4B3SO 4ASUG 3QVNA 1N32B 1D2DA 5LYJA 2PZSA 3H1HH 1TA8A 2GTSA 5FNVB 2HJDA 4ZHQA 3SJCC 4ZBMA 1SZXA 2OIGA 2ADPA 1R6NA 4PD4F 5EBWC 2Y4TA 3CS5A 2NLJC 5KMGB 4C7UA 1ZL8B 1R73A 1GMGA 3CC7V 1TVKA 2QWRB 1RSOB 4LF5B 1ROPA 4FM1A 2VWJA 1OCZB 2XUMA 1VIBA 2R70A 1H2SB 4IIJB 1V55C 2YEVB 3CCEV 1K33A 4FLWA 3H1JH 1Q5OA 3ABLB 4O4JB 2VQEB 3Q4HB 4I55A 5IJ0A 4DR6O 5J2UA 4B3RB 5DN6G 4BIOA 5IYZB 2HKOA 2HVKC 4FFBA 4DXWA 2GHYA 1KKCA 5H6RA 1LUVA 3GWOA 1QHTA 2X0LA 4YXWG 1IBLB 1JX9A 1QCEA 1KKDA 2F4VO 2JGDB 5KA5A 1H2LA 2F43G 5LP6B 3UO3A 3BA8A 2UXBB 2ZD9A 4MVQA 3E22A 3CMEV 4DR3O 1VF7A 3BAAA 4EEQA 1NS1A 4R8CA 1R6TA 1K34A 2W6JG 4TT3G 2E75B 4NKGB 5BR8B 2UUBO 2ZIOA 4WFEA 1P49A 1QU7A 3OAAG 4LF6B 4PDVA 4X1YA 1Z2GA 2FTKA 2IH1C 3K59A 1J5EB 1FXKB 1VQ5V 2JS5A 4NB5A 3JATB 2WLKA 4LNUA 1PPJH 1NR7A 2H3OA 4MVOA 2ZM6B 3MAQA 3A2FA 3VQXA 1GN3A 1M56B 4MVZA 4OX9O 5EC1C 5EC2C 4BR6A 3A8TA 3TXQA 3ASOB 3HKCB 5JJJB 2ZCEA 1B06A 1R3LC 1WB7A 2Q6AA 4WFAV 4O4IB 2Q0OC 3STZC 4JF3A 2CDYA 2ZINA 4L87A 5LYJB 3CMAV 4LR3A 4I50B 2LW1A 1I94B 2Y69C 1I0HA 4DV7B 2VQFO 3FFQA 2IJKA 4YJ2A 1HR0O 2IJIA 5KX5B 3EFFK 4W4KA 2JDIG 3IC7A 5D5QA 3ZRVA 4WCEV 3S3WA 1EN5A 4PA9A 1TVKB 2NNUA 3ZRSA 4NXNB 3OUFA 1M1KW 1PKXA 3ZMSA 2XAHA 4GX0A 3THOA 4MS2A 5JJNB 2CK3G 5KUMA 2JEUA 2E3CA 2KQXA 3SYAA 1IDSA 3ZRWB 2BCCH 3FX7A 1X4TA 4EFEA 3UKMA 3CP1A 4I55B 5IJ0B 4J7ZA 5J2UB 3ETEA 3OTFA 4FFBB 4TQDA 2ATKC 1K5SA 1NKDA 2IU3A 4O2AA 1WP7A 2UXDO 1SZTA 2BTQA 1FAFA 2JJ2G 2FB5A 4XDKA 2JRIA 1S5LZ 4O2BB 3P30A 3E83A 3SYPA 1IBMO 5JWPA 1GH6A 2JS3A 4I0XB 4MTXA 2F93B 4OPAA 4DV6B 4J11A 2KG7B 1PL0A 1NI8A 1QLEC 2XAFA 4UV9A 3X2QC 3ABUA 3QTCA 4H33A 1LNQA 3UO2A 4X1YB 3UQ8A 3F7VC 4OXSA 3WB0A 3H1IH 4DK1A 2L6LA 4P2ZA 4UCVA 4LNUB 4LBEC 1XNQB 2X7RB 2HVJC 4UB6Z 4CH6A 5L3EA 1W0JG 1NR1A 4W4LA 2X6AA 4UVCA 4FFKA 3L73H 4PELA 3CJHA 3U10A 4DV1O 2QWOB 1XQ8A 4PA4A 4B3MO 4UXNA 2EILB 3ZBHA 3R66A 3AG1C 3CYOA 4LH6A 2P6JA 4J9ZB 2ZIMA 2K9PA 2EULA 2YSUB 5CN0A 3T1HO 5H9CA 1OCRB 4YJ2B 1N32O 5B1AB 3ZMZA 3L70H 1KD1W 1FD9A 1Q6HA 2XOKG 4LF4B 2A79B 2CH7A 3E8HA 3ABKB 4NTWA 4DR7B 3JD3A 2UXCB 1K7DA 2VWKA 1F4MA 4KFMA 2LP7A 4LC1A 1CEZA 4B3TB 1GKFA 5LA6A 2PGGA 2YIBA 4IYIA 4LF5O 4BIUA 1KBHA 4DK0A 1F7YA 3G71V 3BCCH 1QQCA 3LDEA 3SJAC 4TUYA 5IDJA 1F4NA 5LHIA 4O2AB 3P32A 4JAAA 3BVOA 2VQEO 4LFBB 3RT3C 2CTPA 2P4VA 4FZ0A 1AJPA 1NBMG 4XDJA 2MW2B 1OV9A 2YUAA 3ETDA 1GN6A 5IYBO 4I4TB 4O4LA 3K79A 2EIKB 2QEXV 1K4CC 3L75H 1IBLO 3CSXA 2R9IA 1XREA 3W7WA 3CB2A 4TWKA 3WB1A 2Q67A 2ZNJA 1BZKA 1VEWA 1N8RW 1VQ9V 2ZDIC 5KA6A 4U7NA 2PI4A 3LNNA 2UXBO 4WFBV 4FK5C 4GUNA 1QBZA 2B9ZA 1S5JA 1XL6A 4J7JA 3ZEDA 3N27A 4MSWC 5E1AC 3G4SV 3OR6C 1Q86W 3W7XA 5BR8O 3IFXA 3UCSC 4JYYA 4LFAO 4X8AA 2VS0A 5L3BA 4CZZA 4LF6O 4AILC 2OCCC 1SA0A 3FYEB 4LP8A 4AHCA 4UFZA 4HAMA 2M7WA 1J5EO 2PI5A 2AW9A 4IGGA 4TV8B 2MK3A 1TUBB 3CCQV 2UUCB 4JYBA 1XNRB 2IJHA 4YY3B 4FLVA 4NR1A 5LBQA 1FFXB 4TV9B 2QTOA 2WA4A 3B8MA 1W2BU 4BW5A 5KHJA 4NVPA 2EX3A 1WN7A 1E1RG 5FLXN 1RP3B 5B1NA 4TSFG 1H2MA 1G1XB 4J80A 3QF7A 4YJ3A 2F66C 3FYIB 4KUMA 5GONB 2P4KA 4EB6A 5FPRA 4CS4A 4JI5B 2K1EA 1I94O 3BRCA 1I5YA 2E76B 4DV7O 2PYLA 2Q5ZA 2WLLA 2YIAA 4KP4A 2JJ1G 3UT5A 5L3GA 2CH7B 4BWAA 1YEWA 2HEPA 4G2KA 3H1KH 3AG3C 1JJ2U 1XDCA 3K9AA 5LXTA 3D3IA 4NXNO 1P84F 4QJFB 3W7SA 4LH7A 5JVDA 2CTQA 3QO7A 4A5UB 2AHZA 1M57B 4UCRA 1S3JA 1GN4A 2LFRA 5J9PC 2DYRC 4X20A 5IWAB 2Z3YA 1U97A 4TOIA 1CPYA 1PNKA 3FB7C 1B3QA 4JPRA 4CS2A 3MDSA 2BE3A 3AG4B 3HKBA 3FKSG 4JASA 1K8AW 1WNSA 2DMXA 5KHGA 4KHPB 1BMFG 4O4LB 4XDLA 3QO5A 1IURA 1URFA 3AK1A 3EXAA 4JI3B 1EN4A 3AG2B 4JAVA 2BSKB 4X1KA 1SQGA 2P90A 3ABMB 3G6BA 3HPLC 3MHSC 3HB3B 4QPKA 4EFBA 2JVDA 4QGPA 4DV1B 2GUZB 3JCUZ 1D5AA 3JSNA 2QKSA 2ZE8A 4NTYA 3TETA 2JEXA 4JZ2A 4D6TH 4DV6O 3FAVA 4K0KB 3ZN0A 1Y76B 1WLEA 4JYAB 4ABMA 2EIMC 4I9QA 1AI6A 2A06H 2V4DA 3JD0A 5JJEB 5GW7A 1GM8A 3CC2V 2DQ3A 1SESA 1YTFB 4I9WA 2QGNA 4GLXA 1XNQO 1S72V 1Q43A 3UM7A 4WBNA 2YXYA 1SQBH 4FMTA 4BIZA 3ABLC 1PV0A 2D2CB 4FLZA 1VF6A 1ZTEA 4CH4A 4L8JA 1VQMV 2CAZC 1B6QA 2QM8A 3ZX6A 2GV9A 2ODMA 2N74A 4X89A 1KQSU 2EJRA 4YJ3B 1MABG 2GTAA 3SYOA 4RUEA 4FLUA 5LP6C 2RDCA 1MZFA 3H1LH 3RWRD 3RGBA 4UCSA 3LSUA 4PDLA 2WLLB 4MW8A 2QM7A 5BY1A 2Q7GA 1DK1A 1AVMA 4J9YB 5CA3A 4PJ0Z 1VP7A 3APOA 5LMNB 1BHBA 1Q6IA 1BSMA 4LF4O 4JTDB 2VRZA 3L71H 2OTLV 4YHHO 3OFNG 2A0LA 2WLNA 1HNWB 1NZ6A 5KAIZ 2P22C 4DR7O 2UXCO 4X1IB 5JVDB 1X59A 1JVMA 2Z0AA 4JTCB 1RM1B 4B3TO 5EIBD 4DV4O 3AK2A 3OGIB 3JD1A 4X20B 2GSMB 2IM9A 1V55B 1V9PA 1GN2A 1RPOA 4LFAB 2Z5UA 4FLYA 1TUEB 1SQPH 2HHHB 1KB9F 1M56C 4LFBO 5AG2A 5J2TA 1BS3A 3K58A 2A9HA 2HFEC 2Q9LA 3ZRXA 1EZJA 4UB8Z 5C8YA 1CXZB 2Q7HA 4MTGA 4RAIA 1XMQB 3TJTA 1Y4MA 1BQZA 3MHHC 3DTUB 5L3CA 1VQ8V 2ZQMA 4X66B 2WLIA 1BGYH 3FAVB 2ZE6A 1JFFA 4GX2A 5C93A 4LF9B 2WAMA 2ZNIA 4JI0B 3BEHA 3I55V 3HKDA 4IHJB 4U3JB 2W0FC 4DRXA 1M90W 3U11A 1R6KA 2CTRA 3JALA 4ZHQB 4UCUA 4DV2B 3D36A 1KECA 4WBNB 2XTAA 5KHKA 2YIBD 2UUCO 1XNRO 4PDRA 4YY3O 1PD3A 1YJWV 1N4CA 3ZN1A 4JI6B 3OR7C 3HR0A 1XL4A 2Y0PA 1YZBA 1MZEA 5CB4A 1EN6A 2ZXWB 3CXHF 3KCXA 3ZS8C 4FLXA 2Q0AA 3EHBB 5LOVA 4PV1B 4UCTA 3ZHVA 1GM7A 3A0BZ 3ML0A 3ZMTA 3K5NA 5B66Z 4OPHA 3JARA 2N04A 1DTOA 4ZKIA 3IJ4A 3B09A 2YI9A 3O9OA 2W6IG 4H44B 2DE0X 1AR1B 4DUZB 1H2GA 4JI5O 1H2KA 3RYFA 1KP3A 5B1OA 3RYHA 3HKEA 3G80A 2IBZH 2Y4UA 1VQPV 3F5WC 5CA1A 2EBOA 2LGWA 3T1YB 3E22B 1L8DA 4LCUC 1JJOA 1NT2B 2B1GA 1M93A 4MTOA 3T4DA 3JSLA 1Y66A 3RYIA 4RO2A 4R6ZA 3K9SA 2LJ2A 1FKAO 4X65B 1R3IC 2RQ6A 3K06A 1TAEA 1GK9A 1KU9A 1VMGA 3EVKA 5IWAO 1MG1A 1A32A 1ZUQA 4DO2A 1TGOA 5J2TB 1YTFD 3M99B 2PUSA 2WA3A 1JQ0A 4CH5A 2EILC 5C8YB 2RNBA 4KHPO 2QKCA 2WLJA 4R7CA 2DYSB 3JCZA 2PTMA 4JI3O 1N33B 4LWSA 3CCVV 4O4HA 3K3WA 3RVYA 2NN4A 2HP8A 3R65A 1OCRC 2WLIB 1JFFB 1FFTB 4X62B 3ZHRA 3J81N 2ZDIA 4FJCC 3VQYA 4JI2B 2L35A 4MVRA 4K0KO 3X2QB 1THZA 3DGEA 4JYAO 1K73W 4DRXB 3PN1A 1K3EA 4K8XA 3SPIA 3ASNB 3JALB 4JI8B 3SDLA 1AJQA 1HNZB 1SQVH 1DF4A 3CCLV 1QVGU 1H8EG 1KC8W 3CPWU 4JGSA 1R3JC 4D7TA 4UCOA 3BA9A 1RPRA 3QO8A 5EK0A 1FXHA 4YHHB 1VF5B 2EINB 1RFYA 5IJ9A 1ZWIC 2YI8A 4EKWA 3B2EE 5CB4B 5LGNA 2DWEC 3T2MA 3K57A 2QJ1A 3RN4A 4DV4B 1PP9H 3NR7A 1GM9A 4DUYO 4NYKA 4DYLA 2EIKC 1V54B 2QE7G 2AXTZ 5KUKA 5IE9A 2FL4A 2YC0A 1YSCA 2ITDC 3N2GA 2UXNA 3FD9A 4MVMA 4H0LB 3K04A 2BTQB 4DW1A 1E79G 4JZGA 4YIOA 3F5TA 3RYHB 3HKEB 2DWDC 1S76D 5IY5C 5LHHA 2H94A 1IX9A 3M7MX 1DLBA 3CHXA 2UU9B 4PHZA 5EIBC 5LMNO 1NH2B 1B04A 5H2FZ 1VQKV 1AJNA 1W59A 1HNWO 1MNGA 1OZ0A 4DR4B 2A3QA 3OEHG 2ZKOA 1FYJA 3SJQC 1SC5B 3STLC 3ZCCA 2RMKB 4BW9A 1MSDA 1EZVH 4DW0A 2QM4A 1MSWD 3DXRA 4B7KA 4FIPC 3B8NA 4G28B 3L72H 3B77A 5JQGA 4KXRA 3PJSK 1XHZA 1DF5A 2DOSA 2HHHO 1F23A 4JTAB 1OJHA 3DC6A 1J95A 4ZI7A 1NTKH 1FS0G 2FMLA 3ETGA 1GTOA 1PNLA 2OTJV 5L3DA 3E86A 3GB7C 5A9GA 1AI7A 1VQ4V 3CCJV 1XILA 1ZLZA 4JV5O 4O4HB 1XMQO 2WWWA 2X6CA 3CJHB 1T5EA 5E79Z 2YXHA 1AR4A 2R72A 4CC5A 2HR3A
chains in the Genus database with same CATH topology
1P84F 1PPJH 3CWBH 1BE3H 4D6TH 3L73H 5KLVH 1NTMH 4PD4F 1SQQH 1SQVH 3L71H 1NTKH 1L0NH 1KYOF 1SQBH 3H1JH 3TGUH 3H1IH 3L70H 1PP9H 1SQXH 4U3FH 3H1HH 1EZVH 1L0LH 3CXHF 1SQPH 3H1LH 2A06H 1NTZH 1KB9F 3BCCH 2FYUH 3H1KH 1BGYH 3L75H 3L74H 3CX5F 1BCCH 3L72H 2IBZH 1NU1H 2BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  1PPJ H;  3CWB H;  1BE3 H;  4D6T H;  3L73 H;  5KLV H;  1NTM H;  4PD4 F;  1SQQ H;  1SQV H;  3L71 H;  1NTK H;  1L0N H;  1KYO F;  1SQB H;  3H1J H;  3TGU H;  3H1I H;  3L70 H;  1PP9 H;  1SQX H;  4U3F H;  3H1H H;  1EZV H;  1L0L H;  3CXH F;  1SQP H;  3H1L H;  2A06 H;  1NTZ H;  1KB9 F;  3BCC H;  2FYU H;  3H1K H;  1BGY H;  3L75 H;  3L74 H;  3CX5 F;  1BCC H;  3L72 H;  2IBZ H;  1NU1 H;  2BCC H; 
#chains in the Genus database with same CATH topology
 2CTW A;  3BY6 A;  1N0N A;  3I5D A;  2WLH A;  1AI4 A;  2IJJ A;  4X66 O;  4H37 A;  2CGO A;  5FNV A;  1XEQ A;  4DR2 B;  4LF9 O;  2AZ0 A;  4K3A A;  4AQY B;  4RWU A;  2YDE A;  4JI0 O;  4AI8 A;  5LHG A;  2HG5 C;  4ZIB A;  5F2V O;  5KMG A;  5EYP A;  4HZ3 A;  4E2L A;  5DED A;  4H13 B;  5B3S B;  3CRQ A;  5B1B B;  4UUJ C;  2OCC B;  4HYO A;  3LSS A;  2D3O W;  3FB6 C;  1M57 C;  1D5N A;  3J7A U;  4DV2 O;  1PM9 A;  2G38 A;  4CS3 A;  3K08 A;  2QWP B;  5IJ9 B;  1SET A;  3KCY A;  4IIJ A;  3H01 A;  4YIP A;  1YJ9 V;  1PNM A;  2OCH A;  1XUQ A;  1BCC H;  2BTO A;  4JI6 O;  1UPG A;  5LA6 B;  3SGI A;  1P7G A;  1GO3 F;  1HDJ A;  4QNH B;  1YIJ V;  4J42 A;  3M8A A;  1MOF A;  3WFV A;  2P5O A;  1Q81 W;  4TUY B;  2BOC C;  2ITC C;  2X6B A;  1QR9 A;  3N2G B;  4R50 A;  3LSQ A;  1FJG B;  2AGA A;  3ABM C;  4QIW F;  3RYC A;  2JGD A;  5LGT A;  3QNE A;  4U7O A;  2Q69 A;  1F51 A;  4IYH A;  5KHH A;  5LP6 A;  1K9M W;  2Y0I A;  2ZR2 A;  3JD4 A;  3J80 N;  2Q7E A;  3LUT B;  4DUZ O;  1Q7Y W;  3CCR V;  1S0V A;  1WPB A;  1ORQ C;  3JAK A;  3ZMU A;  5EBM C;  2KKW A;  3WG7 B;  4JI4 B;  2Q68 A;  3LDD A;  1AP6 A;  3AG3 B;  4HNA A;  1WJZ A;  2UUA B;  3BHP A;  4P9P A;  4DR1 O;  5TIS Z;  2W0X A;  4LF8 B;  1SER A;  1OCO B;  3T1Y O;  1KP2 A;  1VAR A;  2LQT A;  2YS8 A;  2EIJ B;  3JAT A;  3P3P A;  4PA3 A;  4X65 O;  5JQG B;  3H9V A;  4ZI7 B;  2OIE A;  1SA0 B;  2QA4 V;  5IYC O;  1P4R A;  1OCZ C;  1OCC B;  3RVZ A;  2GDS A;  2KSD A;  1PL4 A;  4JI1 O;  4GZR B;  1ENV A;  2OYQ A;  4WFH A;  3DSQ A;  1SQX H;  3BAB A;  1XHX A;  1N33 O;  3GVM A;  1HW7 A;  3E2E A;  1NTZ H;  3OUS A;  2ARH A;  5H6Q A;  4OGQ B;  2E5L B;  4J7K A;  4I50 A;  1NVP B;  2JIZ G;  5BMV A;  4N23 A;  2ADQ B;  4X62 O;  1S5H C;  4DUY B;  2EZP A;  5BXZ A;  4I7Z B;  5KX5 A;  3BFR A;  1UFI A;  4JI2 O;  2P06 A;  5EYP B;  4X64 B;  2EIM B;  3K5L A;  5HFL A;  4EB6 B;  4F6R A;  4JI8 O;  1HNZ O;  4X9Q A;  1RM1 C;  4FM2 A;  3UT5 B;  5HFM A;  1NH2 D;  4LFC B;  4GKJ B;  1ARO P;  1K97 A;  1IZ3 A;  3G6E V;  2AZ2 A;  4MT8 A;  3ZRW A;  1CP9 A;  3CRA A;  3AK3 A;  1AI5 A;  1KYO F;  1SKV A;  3K03 A;  5LXT B;  4FVM A;  1K5Q A;  4QE9 A;  5K1X A;  3WB2 A;  4MTF A;  1N34 B;  1FXK C;  2A7W A;  4NXM B;  1SRY A;  2QDO A;  3AG7 A;  5JCO C;  3OTO B;  1IBK B;  3G67 A;  1W0K G;  4O2B A;  5DM6 V;  1Z5V A;  3RYC B;  4DV5 B;  1HWY A;  5CA0 A;  4D7S A;  3SPG A;  3JYC A;  4KL1 A;  1EBO A;  2V7Q G;  1O9H A;  3BPZ A;  3ZMV A;  1XBL A;  3HKB B;  2OWO A;  1SQF A;  1QLN A;  3IC9 A;  4I0X A;  3JAK B;  1NU1 H;  2QR4 A;  4JV5 B;  2Q4P A;  1Q6U A;  1XOU A;  3ASO C;  4X1K B;  4WFG A;  1HNX B;  1AB3 A;  1Q90 D;  2KG7 A;  4HNA B;  4UV8 A;  3VQV A;  2UU9 O;  1N36 B;  5CBG A;  1IXM A;  3WU2 Z;  1WA8 A;  4DR4 O;  2HLD G;  5GTH Z;  1YIT V;  3CE2 A;  2ILM A;  1Q82 W;  4TQF A;  3ZHU A;  3RFR A;  3A0H Z;  3ZHQ A;  1VF6 C;  3OD4 A;  2QKA A;  3C90 A;  4JI7 B;  2ZXW C;  3LNM B;  3N2K A;  4FPP A;  3CX5 F;  1IVS A;  3NXS A;  4P30 A;  3SPC A;  1I5X A;  2AHY A;  4JAU A;  4CH3 A;  1M4U A;  3FB5 C;  4ICG A;  2JK5 C;  2XAJ A;  1AP5 A;  3TK1 A;  1YI2 V;  3OE7 G;  5EZY A;  4BAY A;  5ITZ A;  1H38 A;  2XAS A;  4RUF A;  5FPO A;  4GX1 A;  1XI1 A;  2WPD G;  3CCM V;  1QR8 A;  5BMV B;  3SYQ A;  4XBF A;  3QG5 A;  3D3Q A;  2PY5 A;  2R9R B;  2F23 A;  2N05 A;  4UVA A;  3ICX A;  3CRR A;  4I5S A;  3A0R A;  2JGU A;  1FXV A;  4DR2 O;  3OMA B;  1S77 D;  1AIL A;  3ZHS A;  3CWB H;  1U96 A;  4AQY O;  5LMU B;  5KLV H;  4F6R B;  3ABT A;  3CXC U;  3VBB A;  1M5I A;  4ZOL A;  4DV3 B;  2Y69 B;  3OMI B;  1I08 A;  3B40 A;  5FL7 G;  1JOY A;  3SPJ A;  1EFR G;  3VQW A;  1NQT A;  3E35 A;  1IXB A;  2QTS A;  1SQQ H;  4DR1 B;  1KUQ A;  4Z1V A;  4DV0 B;  3OEE G;  3T1C A;  1JMK C;  3KKY A;  4IL6 Z;  2EJ7 A;  1VQN V;  5CA0 B;  1G4Y B;  2DYS C;  1G8M A;  4I4T A;  2BOB C;  2LFS A;  2QWN B;  4UVB A;  1K92 A;  1FJG O;  1YDX A;  2LGQ A;  1XMO O;  3KG2 A;  1BL8 A;  1WP8 A;  5H5N A;  2QWQ B;  5K1P A;  1M9N A;  1O9G A;  4Q20 A;  3OW2 U;  1L0L H;  2EZO A;  4JI1 B;  3K0D A;  1Q8I A;  1OHH G;  4K35 A;  1NVP D;  4DR5 B;  4GKK O;  4JI4 O;  3C3S A;  1BE3 H;  4B3S B;  1WA8 B;  3ASN C;  3ZIA G;  4MW3 A;  3RBZ A;  2UUA O;  1E1Q G;  3D36 C;  4RQF A;  2CUG A;  1I7F A;  3ZHT A;  2B1I A;  4LF7 O;  5B1A C;  4K8Z A;  4LF8 O;  4F6E A;  5JH7 A;  1ZX3 A;  3U0Z A;  3HKD B;  3TXS A;  4X88 A;  2RJZ A;  2HJF C;  1BT8 A;  4TV8 A;  4PDM A;  3E8F A;  1QLE B;  2EIN C;  1ZAU A;  3GWK C;  4P9O A;  4QE7 A;  1TUB A;  1MMM A;  3ABK C;  3P3N A;  4B08 A;  3RW0 A;  4GYC B;  1YJN V;  3ETQ A;  4PI2 A;  1FFX A;  3N2K B;  4TV9 A;  5KAF Z;  5DEC A;  3CRM A;  2M6Y A;  4WFF A;  2Y48 A;  5EZY B;  1G6U A;  1V54 C;  5ITZ B;  2XND G;  2P7T C;  5LL6 Y;  2YIC A;  1JA8 A;  1NJI W;  1WB8 A;  4DR6 B;  3JAS A;  3W7T A;  2RN9 A;  3IAY A;  1YXB A;  4PA6 A;  4MVS A;  5GON A;  5LOV B;  2Q8V A;  2E5L O;  1SS3 A;  2R9A A;  2GBO A;  5IT9 N;  3AG1 B;  3AEI A;  3JAR B;  2ETN A;  2F4V B;  4Q6G A;  4X64 O;  4ZOL B;  4PA7 A;  4CBC A;  3C3T A;  3RYF B;  4DR3 B;  1P7B A;  3B4S A;  1WAZ A;  3CD6 V;  5LGU A;  3KZI Z;  4NTX A;  3E8G A;  3SPH A;  3W7U A;  2CGN A;  4LFC O;  1VQ6 V;  2Q73 A;  2UUB B;  1Y74 A;  4GKJ O;  1SF9 A;  4CC6 A;  5D5P A;  4GT1 A;  3DC5 A;  5CA1 B;  1JPX A;  2UXX A;  1YF2 A;  3FB8 C;  1BHA A;  2YXL A;  4FLT A;  1AR5 A;  4IT5 A;  4B3R O;  1FPO A;  3I56 V;  5A2Q N;  2OT5 A;  3RYI B;  1BQ0 A;  1N34 O;  1Q3E A;  4NXM O;  2LO1 A;  3OTO O;  1UJW B;  2ZE5 A;  3ZJZ A;  1Z5W A;  1H8H G;  1LUW A;  1IBK O;  3TCU A;  4DV5 O;  2BSK A;  4MVU A;  3OM3 B;  3K0G A;  5KHI A;  4B7E A;  2E74 B;  2GUZ A;  1VQ7 V;  4OX9 B;  5IY5 B;  2FKX A;  4J10 A;  4LWS B;  1H2N A;  4G27 B;  1Y76 A;  2V1D A;  2YID A;  3JAW A;  1HNX O;  1JR9 A;  2F95 B;  2WSS G;  1MA1 A;  1N36 O;  2XHB A;  1COW G;  5B3S C;  5B1B C;  2VQF B;  3JD2 A;  1HR0 B;  4Z1M G;  4HBN A;  5JH7 B;  2F1M A;  5BZB A;  1NTM H;  3CCU V;  2CE4 A;  2DN9 A;  3T4Z A;  2DJV A;  4PI0 A;  2DW4 A;  1GRJ A;  1VQL V;  3CRC A;  2ZM6 O;  1ZL8 A;  2IW5 A;  1QVF U;  1R3K C;  4RQE A;  4JI7 O;  2NR5 A;  2H8P C;  3SR2 C;  2C2A A;  1RSO A;  3L9D A;  1Y67 A;  4GX5 A;  3E89 A;  3LDC A;  3IGA C;  3JAS B;  2O57 A;  1Y6X A;  2ZE7 A;  2YEV A;  4O4J A;  3OGC C;  2UXD B;  3Q4H A;  1VQO V;  2XAQ A;  3AG4 C;  5IYZ A;  4GCZ A;  4N21 A;  2IH3 C;  3MD0 A;  3OT7 A;  1WPX A;  3WG7 C;  3CEI A;  3AG2 C;  4WF9 V;  1IBM B;  5CMU A;  5GTI Z;  1XMO B;  5CBH A;  5LMU O;  2DQ0 A;  4FM0 A;  4E4E A;  3VOU A;  2ZR3 A;  1OCO C;  4X1I A;  1HP8 A;  4DV3 O;  2RCV A;  1DGS A;  4QPJ A;  3APQ A;  1Y74 B;  3SYC A;  3JAM N;  2PYJ A;  4Z2W A;  2B5U A;  5B5E Z;  5IYD O;  2EIJ C;  3CC4 V;  4GKK B;  3CCS V;  2IU0 A;  1YHQ V;  3L74 H;  4F4L A;  3OMN B;  3D8C A;  1US6 A;  4LF7 B;  4J41 A;  1OCC C;  4DV0 O;  2LW7 A;  5L3F A;  1FXK A;  3DXR B;  1LR1 A;  5CBF A;  5JCO A;  1JCH A;  1YVW A;  2P67 A;  2DYR B;  2PF4 E;  1GAX A;  2XAG A;  4FZ1 A;  2KB1 A;  1ZSP A;  1N0J A;  1L1F A;  4JYC A;  4B3M B;  2XT9 A;  3O65 A;  3F7Y C;  3E8B A;  1QNM A;  3SJB C;  1K4D C;  2ZT9 B;  2QSA A;  2WLM A;  3JAW B;  1L0N H;  1EM1 A;  1KMI Z;  3TGU H;  3HKC A;  4U3F H;  4IHJ A;  3T1H B;  5EBL C;  3K5M A;  1YCI A;  3S3X A;  3K5O A;  2FYU H;  4U3J A;  4DR5 O;  1R1B A;  4O4I A;  4B3S O;  4ASU G;  3QVN A;  1N32 B;  1D2D A;  5LYJ A;  2PZS A;  3H1H H;  1TA8 A;  2GTS A;  5FNV B;  2HJD A;  4ZHQ A;  3SJC C;  4ZBM A;  1SZX A;  2OIG A;  2ADP A;  1R6N A;  4PD4 F;  5EBW C;  2Y4T A;  3CS5 A;  2NLJ C;  5KMG B;  4C7U A;  1ZL8 B;  1R73 A;  1GMG A;  3CC7 V;  1TVK A;  2QWR B;  1RSO B;  4LF5 B;  1ROP A;  4FM1 A;  2VWJ A;  1OCZ B;  2XUM A;  1VIB A;  2R70 A;  1H2S B;  4IIJ B;  1V55 C;  2YEV B;  3CCE V;  1K33 A;  4FLW A;  3H1J H;  1Q5O A;  3ABL B;  4O4J B;  2VQE B;  3Q4H B;  4I55 A;  5IJ0 A;  4DR6 O;  5J2U A;  4B3R B;  5DN6 G;  4BIO A;  5IYZ B;  2HKO A;  2HVK C;  4FFB A;  4DXW A;  2GHY A;  1KKC A;  5H6R A;  1LUV A;  3GWO A;  1QHT A;  2X0L A;  4YXW G;  1IBL B;  1JX9 A;  1QCE A;  1KKD A;  2F4V O;  2JGD B;  5KA5 A;  1H2L A;  2F43 G;  5LP6 B;  3UO3 A;  3BA8 A;  2UXB B;  2ZD9 A;  4MVQ A;  3E22 A;  3CME V;  4DR3 O;  1VF7 A;  3BAA A;  4EEQ A;  1NS1 A;  4R8C A;  1R6T A;  1K34 A;  2W6J G;  4TT3 G;  2E75 B;  4NKG B;  5BR8 B;  2UUB O;  2ZIO A;  4WFE A;  1P49 A;  1QU7 A;  3OAA G;  4LF6 B;  4PDV A;  4X1Y A;  1Z2G A;  2FTK A;  2IH1 C;  3K59 A;  1J5E B;  1FXK B;  1VQ5 V;  2JS5 A;  4NB5 A;  3JAT B;  2WLK A;  4LNU A;  1PPJ H;  1NR7 A;  2H3O A;  4MVO A;  2ZM6 B;  3MAQ A;  3A2F A;  3VQX A;  1GN3 A;  1M56 B;  4MVZ A;  4OX9 O;  5EC1 C;  5EC2 C;  4BR6 A;  3A8T A;  3TXQ A;  3ASO B;  3HKC B;  5JJJ B;  2ZCE A;  1B06 A;  1R3L C;  1WB7 A;  2Q6A A;  4WFA V;  4O4I B;  2Q0O C;  3STZ C;  4JF3 A;  2CDY A;  2ZIN A;  4L87 A;  5LYJ B;  3CMA V;  4LR3 A;  4I50 B;  2LW1 A;  1I94 B;  2Y69 C;  1I0H A;  4DV7 B;  2VQF O;  3FFQ A;  2IJK A;  4YJ2 A;  1HR0 O;  2IJI A;  5KX5 B;  3EFF K;  4W4K A;  2JDI G;  3IC7 A;  5D5Q A;  3ZRV A;  4WCE V;  3S3W A;  1EN5 A;  4PA9 A;  1TVK B;  2NNU A;  3ZRS A;  4NXN B;  3OUF A;  1M1K W;  1PKX A;  3ZMS A;  2XAH A;  4GX0 A;  3THO A;  4MS2 A;  5JJN B;  2CK3 G;  5KUM A;  2JEU A;  2E3C A;  2KQX A;  3SYA A;  1IDS A;  3ZRW B;  2BCC H;  3FX7 A;  1X4T A;  4EFE A;  3UKM A;  3CP1 A;  4I55 B;  5IJ0 B;  4J7Z A;  5J2U B;  3ETE A;  3OTF A;  4FFB B;  4TQD A;  2ATK C;  1K5S A;  1NKD A;  2IU3 A;  4O2A A;  1WP7 A;  2UXD O;  1SZT A;  2BTQ A;  1FAF A;  2JJ2 G;  2FB5 A;  4XDK A;  2JRI A;  1S5L Z;  4O2B B;  3P30 A;  3E83 A;  3SYP A;  1IBM O;  5JWP A;  1GH6 A;  2JS3 A;  4I0X B;  4MTX A;  2F93 B;  4OPA A;  4DV6 B;  4J11 A;  2KG7 B;  1PL0 A;  1NI8 A;  1QLE C;  2XAF A;  4UV9 A;  3X2Q C;  3ABU A;  3QTC A;  4H33 A;  1LNQ A;  3UO2 A;  4X1Y B;  3UQ8 A;  3F7V C;  4OXS A;  3WB0 A;  3H1I H;  4DK1 A;  2L6L A;  4P2Z A;  4UCV A;  4LNU B;  4LBE C;  1XNQ B;  2X7R B;  2HVJ C;  4UB6 Z;  4CH6 A;  5L3E A;  1W0J G;  1NR1 A;  4W4L A;  2X6A A;  4UVC A;  4FFK A;  3L73 H;  4PEL A;  3CJH A;  3U10 A;  4DV1 O;  2QWO B;  1XQ8 A;  4PA4 A;  4B3M O;  4UXN A;  2EIL B;  3ZBH A;  3R66 A;  3AG1 C;  3CYO A;  4LH6 A;  2P6J A;  4J9Z B;  2ZIM A;  2K9P A;  2EUL A;  2YSU B;  5CN0 A;  3T1H O;  5H9C A;  1OCR B;  4YJ2 B;  1N32 O;  5B1A B;  3ZMZ A;  3L70 H;  1KD1 W;  1FD9 A;  1Q6H A;  2XOK G;  4LF4 B;  2A79 B;  2CH7 A;  3E8H A;  3ABK B;  4NTW A;  4DR7 B;  3JD3 A;  2UXC B;  1K7D A;  2VWK A;  1F4M A;  4KFM A;  2LP7 A;  4LC1 A;  1CEZ A;  4B3T B;  1GKF A;  5LA6 A;  2PGG A;  2YIB A;  4IYI A;  4LF5 O;  4BIU A;  1KBH A;  4DK0 A;  1F7Y A;  3G71 V;  3BCC H;  1QQC A;  3LDE A;  3SJA C;  4TUY A;  5IDJ A;  1F4N A;  5LHI A;  4O2A B;  3P32 A;  4JAA A;  3BVO A;  2VQE O;  4LFB B;  3RT3 C;  2CTP A;  2P4V A;  4FZ0 A;  1AJP A;  1NBM G;  4XDJ A;  2MW2 B;  1OV9 A;  2YUA A;  3ETD A;  1GN6 A;  5IYB O;  4I4T B;  4O4L A;  3K79 A;  2EIK B;  2QEX V;  1K4C C;  3L75 H;  1IBL O;  3CSX A;  2R9I A;  1XRE A;  3W7W A;  3CB2 A;  4TWK A;  3WB1 A;  2Q67 A;  2ZNJ A;  1BZK A;  1VEW A;  1N8R W;  1VQ9 V;  2ZDI C;  5KA6 A;  4U7N A;  2PI4 A;  3LNN A;  2UXB O;  4WFB V;  4FK5 C;  4GUN A;  1QBZ A;  2B9Z A;  1S5J A;  1XL6 A;  4J7J A;  3ZED A;  3N27 A;  4MSW C;  5E1A C;  3G4S V;  3OR6 C;  1Q86 W;  3W7X A;  5BR8 O;  3IFX A;  3UCS C;  4JYY A;  4LFA O;  4X8A A;  2VS0 A;  5L3B A;  4CZZ A;  4LF6 O;  4AIL C;  2OCC C;  1SA0 A;  3FYE B;  4LP8 A;  4AHC A;  4UFZ A;  4HAM A;  2M7W A;  1J5E O;  2PI5 A;  2AW9 A;  4IGG A;  4TV8 B;  2MK3 A;  1TUB B;  3CCQ V;  2UUC B;  4JYB A;  1XNR B;  2IJH A;  4YY3 B;  4FLV A;  4NR1 A;  5LBQ A;  1FFX B;  4TV9 B;  2QTO A;  2WA4 A;  3B8M A;  1W2B U;  4BW5 A;  5KHJ A;  4NVP A;  2EX3 A;  1WN7 A;  1E1R G;  5FLX N;  1RP3 B;  5B1N A;  4TSF G;  1H2M A;  1G1X B;  4J80 A;  3QF7 A;  4YJ3 A;  2F66 C;  3FYI B;  4KUM A;  5GON B;  2P4K A;  4EB6 A;  5FPR A;  4CS4 A;  4JI5 B;  2K1E A;  1I94 O;  3BRC A;  1I5Y A;  2E76 B;  4DV7 O;  2PYL A;  2Q5Z A;  2WLL A;  2YIA A;  4KP4 A;  2JJ1 G;  3UT5 A;  5L3G A;  2CH7 B;  4BWA A;  1YEW A;  2HEP A;  4G2K A;  3H1K H;  3AG3 C;  1JJ2 U;  1XDC A;  3K9A A;  5LXT A;  3D3I A;  4NXN O;  1P84 F;  4QJF B;  3W7S A;  4LH7 A;  5JVD A;  2CTQ A;  3QO7 A;  4A5U B;  2AHZ A;  1M57 B;  4UCR A;  1S3J A;  1GN4 A;  2LFR A;  5J9P C;  2DYR C;  4X20 A;  5IWA B;  2Z3Y A;  1U97 A;  4TOI A;  1CPY A;  1PNK A;  3FB7 C;  1B3Q A;  4JPR A;  4CS2 A;  3MDS A;  2BE3 A;  3AG4 B;  3HKB A;  3FKS G;  4JAS A;  1K8A W;  1WNS A;  2DMX A;  5KHG A;  4KHP B;  1BMF G;  4O4L B;  4XDL A;  3QO5 A;  1IUR A;  1URF A;  3AK1 A;  3EXA A;  4JI3 B;  1EN4 A;  3AG2 B;  4JAV A;  2BSK B;  4X1K A;  1SQG A;  2P90 A;  3ABM B;  3G6B A;  3HPL C;  3MHS C;  3HB3 B;  4QPK A;  4EFB A;  2JVD A;  4QGP A;  4DV1 B;  2GUZ B;  3JCU Z;  1D5A A;  3JSN A;  2QKS A;  2ZE8 A;  4NTY A;  3TET A;  2JEX A;  4JZ2 A;  4D6T H;  4DV6 O;  3FAV A;  4K0K B;  3ZN0 A;  1Y76 B;  1WLE A;  4JYA B;  4ABM A;  2EIM C;  4I9Q A;  1AI6 A;  2A06 H;  2V4D A;  3JD0 A;  5JJE B;  5GW7 A;  1GM8 A;  3CC2 V;  2DQ3 A;  1SES A;  1YTF B;  4I9W A;  2QGN A;  4GLX A;  1XNQ O;  1S72 V;  1Q43 A;  3UM7 A;  4WBN A;  2YXY A;  1SQB H;  4FMT A;  4BIZ A;  3ABL C;  1PV0 A;  2D2C B;  4FLZ A;  1VF6 A;  1ZTE A;  4CH4 A;  4L8J A;  1VQM V;  2CAZ C;  1B6Q A;  2QM8 A;  3ZX6 A;  2GV9 A;  2ODM A;  2N74 A;  4X89 A;  1KQS U;  2EJR A;  4YJ3 B;  1MAB G;  2GTA A;  3SYO A;  4RUE A;  4FLU A;  5LP6 C;  2RDC A;  1MZF A;  3H1L H;  3RWR D;  3RGB A;  4UCS A;  3LSU A;  4PDL A;  2WLL B;  4MW8 A;  2QM7 A;  5BY1 A;  2Q7G A;  1DK1 A;  1AVM A;  4J9Y B;  5CA3 A;  4PJ0 Z;  1VP7 A;  3APO A;  5LMN B;  1BHB A;  1Q6I A;  1BSM A;  4LF4 O;  4JTD B;  2VRZ A;  3L71 H;  2OTL V;  4YHH O;  3OFN G;  2A0L A;  2WLN A;  1HNW B;  1NZ6 A;  5KAI Z;  2P22 C;  4DR7 O;  2UXC O;  4X1I B;  5JVD B;  1X59 A;  1JVM A;  2Z0A A;  4JTC B;  1RM1 B;  4B3T O;  5EIB D;  4DV4 O;  3AK2 A;  3OGI B;  3JD1 A;  4X20 B;  2GSM B;  2IM9 A;  1V55 B;  1V9P A;  1GN2 A;  1RPO A;  4LFA B;  2Z5U A;  4FLY A;  1TUE B;  1SQP H;  2HHH B;  1KB9 F;  1M56 C;  4LFB O;  5AG2 A;  5J2T A;  1BS3 A;  3K58 A;  2A9H A;  2HFE C;  2Q9L A;  3ZRX A;  1EZJ A;  4UB8 Z;  5C8Y A;  1CXZ B;  2Q7H A;  4MTG A;  4RAI A;  1XMQ B;  3TJT A;  1Y4M A;  1BQZ A;  3MHH C;  3DTU B;  5L3C A;  1VQ8 V;  2ZQM A;  4X66 B;  2WLI A;  1BGY H;  3FAV B;  2ZE6 A;  1JFF A;  4GX2 A;  5C93 A;  4LF9 B;  2WAM A;  2ZNI A;  4JI0 B;  3BEH A;  3I55 V;  3HKD A;  4IHJ B;  4U3J B;  2W0F C;  4DRX A;  1M90 W;  3U11 A;  1R6K A;  2CTR A;  3JAL A;  4ZHQ B;  4UCU A;  4DV2 B;  3D36 A;  1KEC A;  4WBN B;  2XTA A;  5KHK A;  2YIB D;  2UUC O;  1XNR O;  4PDR A;  4YY3 O;  1PD3 A;  1YJW V;  1N4C A;  3ZN1 A;  4JI6 B;  3OR7 C;  3HR0 A;  1XL4 A;  2Y0P A;  1YZB A;  1MZE A;  5CB4 A;  1EN6 A;  2ZXW B;  3CXH F;  3KCX A;  3ZS8 C;  4FLX A;  2Q0A A;  3EHB B;  5LOV A;  4PV1 B;  4UCT A;  3ZHV A;  1GM7 A;  3A0B Z;  3ML0 A;  3ZMT A;  3K5N A;  5B66 Z;  4OPH A;  3JAR A;  2N04 A;  1DTO A;  4ZKI A;  3IJ4 A;  3B09 A;  2YI9 A;  3O9O A;  2W6I G;  4H44 B;  2DE0 X;  1AR1 B;  4DUZ B;  1H2G A;  4JI5 O;  1H2K A;  3RYF A;  1KP3 A;  5B1O A;  3RYH A;  3HKE A;  3G80 A;  2IBZ H;  2Y4U A;  1VQP V;  3F5W C;  5CA1 A;  2EBO A;  2LGW A;  3T1Y B;  3E22 B;  1L8D A;  4LCU C;  1JJO A;  1NT2 B;  2B1G A;  1M93 A;  4MTO A;  3T4D A;  3JSL A;  1Y66 A;  3RYI A;  4RO2 A;  4R6Z A;  3K9S A;  2LJ2 A;  1FKA O;  4X65 B;  1R3I C;  2RQ6 A;  3K06 A;  1TAE A;  1GK9 A;  1KU9 A;  1VMG A;  3EVK A;  5IWA O;  1MG1 A;  1A32 A;  1ZUQ A;  4DO2 A;  1TGO A;  5J2T B;  1YTF D;  3M99 B;  2PUS A;  2WA3 A;  1JQ0 A;  4CH5 A;  2EIL C;  5C8Y B;  2RNB A;  4KHP O;  2QKC A;  2WLJ A;  4R7C A;  2DYS B;  3JCZ A;  2PTM A;  4JI3 O;  1N33 B;  4LWS A;  3CCV V;  4O4H A;  3K3W A;  3RVY A;  2NN4 A;  2HP8 A;  3R65 A;  1OCR C;  2WLI B;  1JFF B;  1FFT B;  4X62 B;  3ZHR A;  3J81 N;  2ZDI A;  4FJC C;  3VQY A;  4JI2 B;  2L35 A;  4MVR A;  4K0K O;  3X2Q B;  1THZ A;  3DGE A;  4JYA O;  1K73 W;  4DRX B;  3PN1 A;  1K3E A;  4K8X A;  3SPI A;  3ASN B;  3JAL B;  4JI8 B;  3SDL A;  1AJQ A;  1HNZ B;  1SQV H;  1DF4 A;  3CCL V;  1QVG U;  1H8E G;  1KC8 W;  3CPW U;  4JGS A;  1R3J C;  4D7T A;  4UCO A;  3BA9 A;  1RPR A;  3QO8 A;  5EK0 A;  1FXH A;  4YHH B;  1VF5 B;  2EIN B;  1RFY A;  5IJ9 A;  1ZWI C;  2YI8 A;  4EKW A;  3B2E E;  5CB4 B;  5LGN A;  2DWE C;  3T2M A;  3K57 A;  2QJ1 A;  3RN4 A;  4DV4 B;  1PP9 H;  3NR7 A;  1GM9 A;  4DUY O;  4NYK A;  4DYL A;  2EIK C;  1V54 B;  2QE7 G;  2AXT Z;  5KUK A;  5IE9 A;  2FL4 A;  2YC0 A;  1YSC A;  2ITD C;  3N2G A;  2UXN A;  3FD9 A;  4MVM A;  4H0L B;  3K04 A;  2BTQ B;  4DW1 A;  1E79 G;  4JZG A;  4YIO A;  3F5T A;  3RYH B;  3HKE B;  2DWD C;  1S76 D;  5IY5 C;  5LHH A;  2H94 A;  1IX9 A;  3M7M X;  1DLB A;  3CHX A;  2UU9 B;  4PHZ A;  5EIB C;  5LMN O;  1NH2 B;  1B04 A;  5H2F Z;  1VQK V;  1AJN A;  1W59 A;  1HNW O;  1MNG A;  1OZ0 A;  4DR4 B;  2A3Q A;  3OEH G;  2ZKO A;  1FYJ A;  3SJQ C;  1SC5 B;  3STL C;  3ZCC A;  2RMK B;  4BW9 A;  1MSD A;  1EZV H;  4DW0 A;  2QM4 A;  1MSW D;  3DXR A;  4B7K A;  4FIP C;  3B8N A;  4G28 B;  3L72 H;  3B77 A;  5JQG A;  4KXR A;  3PJS K;  1XHZ A;  1DF5 A;  2DOS A;  2HHH O;  1F23 A;  4JTA B;  1OJH A;  3DC6 A;  1J95 A;  4ZI7 A;  1NTK H;  1FS0 G;  2FML A;  3ETG A;  1GTO A;  1PNL A;  2OTJ V;  5L3D A;  3E86 A;  3GB7 C;  5A9G A;  1AI7 A;  1VQ4 V;  3CCJ V;  1XIL A;  1ZLZ A;  4JV5 O;  4O4H B;  1XMQ O;  2WWW A;  2X6C A;  3CJH B;  1T5E A;  5E79 Z;  2YXH A;  1AR4 A;  2R72 A;  4CC5 A;  2HR3 A; 
#chains in the Genus database with same CATH homology
 1P84 F;  1PPJ H;  3CWB H;  1BE3 H;  4D6T H;  3L73 H;  5KLV H;  1NTM H;  4PD4 F;  1SQQ H;  1SQV H;  3L71 H;  1NTK H;  1L0N H;  1KYO F;  1SQB H;  3H1J H;  3TGU H;  3H1I H;  3L70 H;  1PP9 H;  1SQX H;  4U3F H;  3H1H H;  1EZV H;  1L0L H;  3CXH F;  1SQP H;  3H1L H;  2A06 H;  1NTZ H;  1KB9 F;  3BCC H;  2FYU H;  3H1K H;  1BGY H;  3L75 H;  3L74 H;  3CX5 F;  1BCC H;  3L72 H;  2IBZ H;  1NU1 H;  2BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...