1BGYH

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
b'DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 64
sequence length 64
chains with identical sequence T
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bgyH00
1SQVH 1L0NH 1PP9H 3H1IH 1BE3H 2FYUH 3BCCH 3L72H 1NU1H 3H1HH 1NTMH 1BGYH 5KLVH 3CWBH 1BCCH 1SQQH 3CXHF 3H1KH 3H1JH 1NTKH 2A06H 4PD4F 1L0LH 1PPJH 3L75H 1KB9F 1NTZH 1SQBH 3TGUH 3H1LH 3L74H 4U3FH 1EZVH 1SQXH 1SQPH 3L71H 4D6TH 3L73H 1P84F 1KYOF 3CX5F 3L70H 2BCCH 2IBZH
chains in the Genus database with same CATH superfamily
4MT8A 3S3WA 1J5EO 1Y76A 1SA0B 2RQ6A 5CBGA 3WU2Z 4YJ2B 1CP9A 2RNBA 3OM3B 1VP7A 1YI2V 2Q4PA 5H6QA 3G80A 5LYJA 2UXDB 5JH7B 5KMGA 3OTOB 1KP3A 2WLMA 1FYJA 2X6AA 3O65A 4DUYB 4LBEC 3AEIA 2ODMA 5LMUB 2A06H 1YIJV 1Q81W 3E2EA 1X4TA 1KECA 3VQVA 4O2BB 2LQTA 5IDJA 3ZRVA 1VQMV 1AP5A 3E8GA 4UB6Z 3LSQA 2ZIOA 3ASNB 1AP6A 2HR3A 3EVKA 4LNUB 4LF9O 2XUMA 4X20B 3BPZA 4ZHQA 1BS3A 2UXBB 1NTMH 4YIOA 4EFBA 3ZIAG 1XREA 5IWAO 1BQZA 3CWBH 4O2AB 5LMNO 2R9RB 1HP8A 2UXNA 1ZL8A 3J80N 2QWOB 3OEHG 5LOVA 3Q4HA 2EZPA 1SS3A 1GM7A 5KX5A 2LFSA 4RUFA 2B1IA 1B3QA 5JJJB 2YC0A 4F6RA 1HNWB 4HBNA 4JI8O 2QE7G 1GN4A 5GW7A 2R9IA 1M4UA 3S3XA 4IL6Z 5IT9N 2CGNA 4UCOA 1JFFA 4HZ3A 3WB2A 4DRXB 1JOYA 2HG5C 3F7VC 4DR3O 5KHHA 3GVMA 5KHIA 5CA0A 2LO1A 3STLC 2Q69A 2XAJA 4JI3O 4QE7A 1XMOB 4B3MO 5IJ0A 4I7ZB 3B4SA 3CCLV 4GKKO 4J10A 3ZRWB 4I4TA 4IHJB 3FB5C 1Q3EA 1Q6UA 1XEQA 1OHHG 1WNSA 1MSDA 4E2LA 4CZZA 4DV4B 5D5QA 1US6A 4ZI7A 2CTRA 2EINB 3AG7A 3DC6A 4W4KA 2Q9LA 3U11A 4MW8A 5BY1A 3FB6C 1N0NA 1B06A 4EB6B 3AG3B 1QBZA 1NTZH 2FL4A 3TGUH 1FKAO 2L35A 4FZ1A 2DYSB 3HKDB 3IFXA 3L71H 4JAVA 2EIKC 4DR2B 3E83A 4X9QA 1XL6A 4FMTA 4JI5B 4JYBA 4JAAA 2BCCH 4I0XA 5JCOC 1TVKA 1S3JA 1VQ6V 1WN7A 3MDSA 3MHHC 3GWOA 5L3CA 3T1YO 4JI1O 4JYAB 5LP6A 2QM8A 3WB0A 3ETQA 2ITCC 2CTQA 4BIUA 1NR7A 4IT5A 1EN4A 2ZE7A 2ZM6O 4L87A 4DR4B 3CS5A 1H2NA 2KG7B 3C90A 4J80A 2AXTZ 1BQ0A 2YEVB 3BY6A 3SJQC 2JRIA 1MOFA 1IZ3A 3NR7A 4JI0B 5LA6A 4JV5O 3AG4C 3ZHUA 3PJSK 3CCEV 4I50A 3IJ4A 3CRRA 4QPKA 2Y4UA 2N74A 1IBLB 2ZQMA 1ZTEA 4JI7O 2CH7A 1KQSU 5EIBC 3CMAV 3I55V 3ETDA 1A32A 2HHHB 4PA4A 4B3TO 4Z2WA 3FYIB 5EYPB 4QE9A 1I94B 3QO5A 1MZFA 1YSCA 1FXKA 1XNQB 4D7SA 2YXYA 1N4CA 4OGQB 1N8RW 3ML0A 4KHPO 4CC6A 5JCOA 4UCUA 4NXMO 5KLVH 4DK0A 1V54B 4XDJA 1VQPV 2CAZC 1SQQH 4JZGA 5KHGA 1BHAA 1VEWA 5J2TA 1Q8IA 2ZT9B 3AK1A 4GX5A 4IIJA 1SQPH 1CEZA 4OPHA 3CHXA 3OFNG 1B6QA 4HNAB 1Y6XA 3ZX6A 4K0KB 3DGEA 1MA1A 1Y74A 4AILC 1BCCH 1NVPD 2RJZA 3BA9A 3K5MA 4PA3A 1VARA 2RCVA 1S77D 5KAIZ 1FJGO 5B1BB 4U3FH 3SDLA 1J5EB 4X1YB 2A9HA 1FXHA 2YI9A 1RM1B 2QTSA 4GX1A 1ORQC 1SA0A 1QHTA 3CE2A 4BWAA 4YJ2A 4X65B 2ZD9A 2QWNB 1YZBA 1SESA 2IM9A 2HJDA 1D5NA 3ZJZA 4L8JA 1G6UA 5JH7A 1OCCB 4GYCB 1F4NA 3DC5A 1VQOV 3RBZA 1XBLA 5LMUO 5B1NA 1G1XB 2RMKB 2EZOA 1HNZO 1Q90D 3K04A 2B1GA 3HPLC 3N27A 1R1BA 4O2BA 3K3WA 2P22C 1AROP 2EINC 4RQEA 4FM1A 4C7UA 4LNUA 2UXBO 1WJZA 5IWAB 1NI8A 4YJ3B 5LMNB 5L3FA 2EX3A 4X20A 2ZKOA 1FFXB 2JDIG 5H2FZ 2WLNA 2ZDIC 3OE7G 3T4ZA 1EN5A 1SETA 3VBBA 4O2AA 3T1HO 3AG3C 4H33A 3JAWB 1K97A 2DYSC 3UO3A 2XASA 2JK5C 2JJ2G 2QEXV 4PDLA 2YIBA 5LHGA 5GONB 2Y0IA 3K5NA 4PHZA 3P3NA 1WP7A 1OCOB 2GV9A 1XHXA 4DRXA 2ZXWB 2EJ7A 3SJAC 3CCMV 4DV1O 4NKGB 4JI3B 2NLJC 4B3MB 3K79A 2OTJV 1QLNA 1XMOO 3W7XA 1O9GA 3MAQA 3ZS8C 1ZWIC 3L70H 2OIEA 4JI6O 1YDXA 3FD9A 1GH6A 2JGDB 3ZRWA 3JASB 4IHJA 1M56B 4JI4B 4R50A 4DV4O 3SYQA 3CP1A 2F43G 3RYFB 3W7TA 4PA6A 4FLUA 4FM0A 2GBOA 4MVOA 2BSKB 4K8XA 1K4DC 1K8AW 4WFFA 3SPIA 1VQ5V 2C2AA 1AB3A 4JGSA 4X62B 3X2QB 2M7WA 4DW0A 2DQ3A 4EB6A 4J41A 3CC2V 4TWKA 2V1DA 4DR1O 2JGUA 3ZHQA 3HKDA 5L3DA 5KAFZ 3SYCA 1L0LH 3O9OA 4IGGA 4GZRB 3T1YB 2X6BA 4N23A 4CH6A 1NH2D 5BMVB 2ZNIA 5EBLC 2BOBC 2DOSA 1K34A 2ZM6B 1ZAUA 5EBWC 3HR0A 1GKFA 5K1PA 4NYKA 3ZMVA 1EM1A 3RN4A 4UVCA 2F4VB 1OCRC 3CCJV 1AI5A 2PGGA 3CXCU 3J7AU 2AW9A 2YIAA 4JV5B 2K1EA 2VS0A 3EHBB 2UUCB 1IBMB 3SYPA 2YXHA 4RO2A 3SPGA 1LNQA 1XQ8A 3NXSA 5B1AB 1H2GA 3MHSC 2XOKG 2P06A 2P5OA 4JI7B 5B1BC 4BAYA 1NS1A 4ASUG 1QLEB 2HHHO 2Q67A 4B3TB 3CYOA 5EBMC 1HDJA 3K06A 3K59A 5IJ9B 2EBOA 5J9PC 2OCCC 1F23A 3LDCA 5EYPA 5KHKA 1XNQO 1PM9A 4WBNB 4DW1A 1SC5B 2QM7A 4KHPB 2MK3A 2CGOA 1JPXA 4NXMB 1V9PA 3AK3A 1GAXA 4UV8A 3RFRA 4B08A 3DTUB 2NN4A 4MTFA 2GDSA 3CRMA 3CXHF 3BHPA 1PNLA 1K5SA 2EULA 3E35A 3K9SA 3G71V 3BRCA 4DV3B 4HNAA 2D3OW 1XOUA 1P7GA 3G6BA 1FJGB 1BE3H 3F5TA 1KKCA 3L9DA 1N36O 1HR0O 1K5QA 2DE0X 4GKJO 2ADPA 5E79Z 1R6NA 5JVDB 4X1YA 3QG5A 3L75H 2N05A 3K08A 1PNKA 2LW7A 3B8MA 1Q82W 1TAEA 3ZHSA 1JQ0A 2UUBO 3RYCB 1OCOC 4YY3O 1YHQV 4X65O 3E89A 2ZXWC 3QO7A 4CS4A 1Q5OA 2ZE6A 3BFRA 2QWRB 1R3IC 1K4CC 2QDOA 1FPOA 5FNVB 1NBMG 1HNZB 2JEUA 4IYIA 5B3SC 2GTSA 1M57B 2QKSA 4UVAA 2H94A 2XNDG 4X1IA 1L8DA 2EIJB 2GUZB 4BR6A 3JAMN 1G4YB 3SPJA 1EZJA 4YJ3A 1W0KG 1WLEA 2EILC 2WSSG 5LHIA 3T1HB 2F1MA 1VIBA 5C93A 1FFXA 3ZHVA 4O4LB 2HP8A 4EEQA 1I5YA 3M7MX 1K3EA 4WFGA 1DGSA 4WFAV 2ATKC 3WG7C 3JAWA 5LP6C 1KKDA 4X1KB 2UU9O 3JARB 1MNGA 3UQ8A 4K3AA 2R70A 1MMMA 3AG1B 1AJNA 4LH7A 1GN3A 3JSLA 5GONA 3E22B 4DUZO 1PV0A 3B09A 4YHHO 1XI1A 4D6TH 4IYHA 4DV1B 1IX9A 1AR4A 2UXXA 1YEWA 1M1KW 4GT1A 4TQDA 3ZRXA 1RSOB 1YJ9V 4R6ZA 3F5WC 1H2SB 4WF9V 3BVOA 3RVYA 4JI6B 4X8AA 4UV9A 4JI4O 4TV9B 2CE4A 4PELA 5KA5A 2JGDA 4RAIA 3JASA 2B9ZA 2GSMB 3ABMC 5B1AC 2PI5A 2Q5ZA 1WA8B 2BOCC 2VQEO 3JATB 3RYFA 1SKVA 2WAMA 4JYCA 1Z5WA 1Q86W 1H38A 5C8YB 1QLEC 2ZR2A 2BSKA 4TUYB 4X62O 1KD1W 3K5LA 1FXKC 3IC7A 4NXNB 2ARHA 1WB8A 2HEPA 4DR1B 4O4JB 3OAAG 4P2ZA 1X59A 4DR7O 3TXQA 3ZMSA 4PI0A 3W7WA 3SYOA 1IXBA 1DK1A 1V55B 1QVFU 4G2KA 2Z3YA 5BR8O 4MTGA 3ETGA 5BMVA 3CCUV 1AR5A 2WLKA 2WLLB 4CH4A 2HFEC 2F4VO 4O4HB 4LCUC 2A7WA 4FJCC 1XILA 2F66C 3H1KH 3HKEB 2Y69B 2IU0A 4P30A 2UUCO 2WLJA 1IBMO 3ETEA 1N34O 3K58A 3LUTB 5AG2A 5EZYB 4JZ2A 4LFBB 3ABUA 4X88A 5EIBD 3M99B 1BL8A 1OCZB 3FFQA 1YVWA 3RVZA 4RQFA 4DV5O 4GUNA 5GTIZ 1TUEB 4FLYA 5B1OA 2O57A 1RP3B 1THZA 4LF7O 1Q43A 5IJ9A 4DV6B 1WAZA 4RUEA 3JAKB 1JJOA 4KUMA 2ADQB 2IJHA 4X64O 2ZE8A 4KXRA 4WBNA 2F23A 1SZXA 3ZN1A 2Q68A 1S0VA 3I56V 1I7FA 1M90W 1PKXA 4KFMA 2QTOA 5E1AC 3SYAA 3ASNC 1M57C 3JD4A 3W7UA 1JCHA 1UPGA 5IYBO 3CX5F 1TGOA 1HWYA 5HFMA 1NH2B 2EIJC 3B8NA 5HFLA 2YS8A 1JR9A 4UVBA 3ASOB 2E5LO 4LF8B 2M6YA 4DV3O 3QF7A 4UXNA 1W0JG 1N32B 4DO2A 2XAGA 3APOA 2YIBD 2Y4TA 3RYHB 4FLTA 1N36B 2IJKA 2E76B 1HR0B 3K9AA 4GKJB 3B77A 3KG2A 3SPHA 1IVSA 3D3QA 2YICA 4NTWA 3JD2A 1BZKA 4B3SB 3UKMA 1S76D 1FD9A 2UUBB 5JVDA 5JQGB 4YY3B 1AI4A 2Y48A 4GCZA 1AR1B 1M5IA 3RYCA 5H9CA 3J81N 4MVSA 1MZEA 4E4EA 3ZHTA 4UCVA 3A0BZ 3QTCA 2CK3G 5FNVA 1YTFB 2MW2B 5KHJA 3ICXA 2IH1C 4XDKA 1N0JA 4JI2O 2OTLV 2P7TC 3OR6C 4LF5B 3FB7C 3CC4V 3FAVB 2IJJA 2BTOA 3THOA 3OGIB 3CCSV 2CDYA 2QJ1A 5FLXN 4K35A 1OJHA 2GUZA 3OUSA 2X7RB 2H8PC 4FLZA 1JMKC 4U7NA 2VWKA 1W59A 3K03A 1PL0A 4JTDB 5KA6A 1Z5VA 1VQ9V 1VQ7V 2W6JG 5LHHA 4O4LA 5LGTA 2UU9B 3CSXA 3E8BA 1N33B 1V55C 3OUFA 1COWG 4DUZB 3P32A 3I5DA 4X1KA 4YHHB 3JARA 1HNXO 1AI6A 2X6CA 4D7TA 3E22A 2EIMB 2DN9A 1HW7A 3ZRSA 3CEIA 2UUAB 4DV7O 1R3JC 3A8TA 1PD3A 4BIZA 4LP8A 2ZCEA 1VF6A 5IYCO 4O4IB 4Z1VA 3WFVA 1RSOA 3CCQV 3CCRV 1KC8W 2PI4A 5J2UB 4TT3G 4LF6O 3H9VA 4I5SA 2IH3C 1WP8A 3T4DA 2QA4V 4DR6O 1DF5A 5DN6G 2VQEB 4TV9A 3VQXA 4KL1A 2DMXA 3KCXA 1S72V 1OCZC 5LL6Y 1WA8A 3JATA 2H3OA 4MVQA 4OXSA 5JWPA 1H2KA 1E79G 5F2VO 2YUAA 2YI8A 5C8YA 4NXNO 3MD0A 2Y0PA 3K0GA 4TUYA 4FFKA 3SGIA 2F93B 4G28B 4DR7B 1R3KC 1F7YA 4O4JA 4BW5A 2X0LA 2YDEA 3K5OA 2GHYA 1FAFA 5BR8B 4R8CA 2DW4A 1ENVA 1V54C 3CCVV 4J7JA 3EFFK 4HAMA 2KG7A 2VQFB 3JYCA 2WLLA 3CRQA 3T2MA 2V4DA 2YEVA 5CA1B 4DYLA 1P84F 1QR8A 4O4HA 4FLXA 1BMFG 5LGNA 1YJWV 1VQNV 2ZIMA 2G38A 1PP9H 3ASOC 1SERA 4ICGA 2FYUH 1N34B 4DR5O 2HVKC 3HKEA 3SJCC 5LA6B 4PV1B 2P6JA 4I55B 5H6RA 1I5XA 2RDCA 3RGBA 4LFBO 3OMAB 3ZCCA 4DV5B 4JYYA 3UT5B 5EZYA 1RM1C 4LR3A 1SQFA 4JASA 4LF7B 1W2BU 2JS3A 2OYQA 1AJQA 3ZMUA 3SR2C 5H5NA 5DECA 3FYEB 5EC2C 4DV6O 4U7OA 3FB8C 4X64B 4PA9A 2PF4E 4NTXA 3RT3C 1NKDA 1OCCC 1RPRA 3JAKA 4TQFA 4XBFA 1ZX3A 3R65A 2Z5UA 3APQA 2KB1A 4QNHB 4JTAB 1E1QG 1NR1A 1U96A 4FK5C 4LFCO 4J42A 3AK2A 2BTQB 4FFBB 4GLXA 5IY5B 2UXCB 1VF5B 3CRCA 4TOIA 2QKAA 2NNUA 4MTOA 4PJ0Z 4BIOA 3U0ZA 3BABA 4J9YB 5A2QN 5EK0A 2E5LB 4LWSB 4LF8O 4UB8Z 2B5UA 3QNEA 1QNMA 2WLIB 1RFYA 1N32O 5ITZB 1O9HA 2CTWA 1K7DA 1DLBA 2FKXA 1YF2A 3BAAA 5BXZA 1NQTA 1PL4A 3CB2A 2DYRB 4R7CA 3AG4B 1GM8A 3LDEA 3KKYA 4FM2A 4U3JB 4B3SO 3TCUA 4LF4B 3QVNA 4DV0O 3N2GB 4LFAB 1XNRO 1G8MA 5GTHZ 3OMNB 2EIMC 3CRAA 5JQGA 5L3BA 1JVMA 4WFHA 1GN2A 1TUBB 4CH3A 3OW2U 3D36A 3T1CA 1JX9A 3UM7A 4MVZA 1LUVA 1GRJA 4F6EA 4FVMA 2KKWA 1M56C 1YXBA 1Y67A 2LGWA 4JI2B 1XDCA 3N2KB 3OEEG 4PDMA 4P9OA 1TA8A 4LF5O 4K8ZA 4PI2A 1K92A 2KQXA 4PD4F 2ZNJA 3FAVA 1KUQA 1IDSA 3OMIB 3JALB 3ABLB 5JJEB 4MSWC 5L3GA 3X2QC 2IBZH 3LDDA 5KUMA 3BEHA 2ETNA 4MTXA 2YIDA 3PN1A 1H8EG 2XHBA 1N33O 2YSUB 2IU3A 1T5EA 3DXRB 1MSWD 2AZ2A 1SQBH 2PZSA 1NVPB 1GM9A 1ZUQA 1HNXB 3ZN0A 1KBHA 2LGQA 4DV7B 4YXWG 4JPRA 2UUAO 1B04A 3HKCB 5LXTB 1VQ8V 1OV9A 3BCCH 4XDLA 4HYOA 4AHCA 2ITDC 4UCSA 2W0XA 2QM4A 2P4KA 2P4VA 4NR1A 3L74H 4O4IA 3STZC 3ZHRA 4LF6B 1EZVH 1SQXH 4J11A 4JTCB 4DR6B 5J2UA 1QU7A 5CMUA 4AQYB 2Z0AA 2VWJA 3CJHB 3ZBHA 4EKWA 1R6KA 1MG1A 1UFIA 1VF7A 2YXLA 3A0HZ 5KUKA 4CS2A 3GB7C 1DF4A 4B7EA 4OX9O 2FMLA 2E3CA 1MABG 4QPJA 1YITV 3H1JH 4EFEA 4FPPA 3RW0A 1ZSPA 5FPOA 4CS3A 1BT8A 3SPCA 4H44B 3KCYA 1UJWB 4DXWA 4H37A 4UCTA 5FPRA 4Q20A 1P4RA 4B3RB 2PUSA 1CPYA 2QKCA 3JD1A 3H1LH 4ZBMA 4H13B 1GO3F 4I9WA 1Y66A 1AILA 4KP4A 1H8HG 1AI7A 4AI8A 2VQFO 2N04A 5IY5C 2ZINA 5CA1A 4DR5B 1CXZB 4TV8B 2WWWA 1R3LC 5CB4B 2PYLA 3D8CA 3R66A 2A79B 4CC5A 3OD4A 2AZ0A 4I9QA 2JS5A 3OR7C 2WA4A 3FKSG 1FFTB 4I55A 5D5PA 1GMGA 1BGYH 2KSDA 2DYRC 3CD6V 1YJNV 3UT5A 2E74B 1NTKH 4GX2A 2R9AA 5CA3A 1PPJH 2PYJA 1KB9F 3LSUA 3UO2A 1SZTA 2P90A 2DWEC 2A0LA 2AHYA 5IYZB 1IBKB 1LR1A 2PTMA 2R72A 3KZIZ 3A0RA 4RWUA 3ABKB 4UCRA 3CC7V 4QIWF 4X66O 3HKBB 1M9NA 4DK1A 5TISZ 3VQYA 3JCUZ 1K33A 4LFCB 3CMEV 3C3TA 2OT5A 1QCEA 3IAYA 1R73A 4ZOLB 1K73W 1LUWA 1WPXA 4CBCA 2AHZA 3EXAA 2UXCO 3K57A 4G27B 1JA8A 3LNMB 2BTQA 4FFBA 2JIZG 1URFA 1F51A 3HB3B 2W0FC 2EJRA 1OZ0A 1IXMA 2CUGA 4LWSA 3ABLC 4FLVA 2Q7EA 4Z1MG 1OCRB 5JJNB 2QGNA 5CBFA 2WLIA 3RYIB 5ITZA 3B40A 2WPDG 4CH5A 1QVGU 1QR9A 1SQGA 2LW1A 3H1HH 4DV2B 3AG1C 1XMQO 4DV0B 2LFRA 1S5JA 4LF4O 1Y76B 1XNRB 1WB7A 2XTAA 3TETA 4U3JA 4QJFB 4LFAO 3K0DA 3OT7A 4B7KA 3M8AA 3N2GA 1VF6C 4YIPA 2Q6AA 2GTAA 2PY5A 2Q73A 3JD0A 3LSSA 1NT2B 4MS2A 1S5LZ 3D3IA 1VQKV 2ILMA 1P7BA 3DSQA 1F4MA 5LYJB 1TUBA 5KMGB 2OCCB 3UCSC 1J95A 2AGAA 3G4SV 1SRYA 2UXDO 2QSAA 3OTOO 3E86A 3OGCC 1EN6A 1PNMA 2QWPB 1FXVA 4DUYO 1XHZA 4F4LA 3ZEDA 1L1FA 3L73H 3TXSA 3AG2B 3N2KA 1NZ6A 5CN0A 2K9PA 1NU1H 3P30A 5DEDA 2HJFC 1KP2A 4ZHQB 4X89A 5EC1C 4LF9B 2XAFA 4X1IB 3E8FA 4Q6GA 5L3EA 4FLWA 2FB5A 3JALA 2Q0OC 2Q0AA 1ZL8B 2NR5A 1RPOA 1XUQA 2D2CB 5LOVB 3ABTA 3Q4HB 4H0LB 1M93A 1KYOF 4J7ZA 3ZMZA 5KX5B 4ZIBA 2CTPA 4ABMA 1E1RG 3WB1A 1SF9A 4F6RB 3E8HA 4WFEA 1KU9A 3DXRA 3OTFA 2XT9A 3TK1A 4MVRA 1HNWO 1KMIZ 4JI8B 4MVMA 1JFFB 4J7KA 1BSMA 1WPBA 4WCEV 3ZMTA 1H2LA 4NB5A 3HKCA 5LXTA 3G6EV 2A3QA 1SQVH 5CA0B 4DR3B 2HVJC 4A5UB 5A9GA 1XL4A 5IJ0B 1NJIW 2Y69C 1Q6HA 2LJ2A 4I4TB 4AQYO 2LP7A 4GKKB 2XAHA 2QR4A 4OX9B 1BHBA 1P49A 2OIGA 3CJHA 2WLHA 4ZI7B 3JSNA 4MVUA 5B3SB 4TSFG 4UFZA 5B5EZ 3LNNA 1JJ2U 1R6TA 1D2DA 4JAUA 1AVMA 3ABKC 2EILB 4B3RO 1Z2GA 4GX0A 1GTOA 2Q8VA 3VOUA 4W4LA 2ZDIA 3VQWA 1ZLZA 4I0XB 4NVPA 4WFBV 1TVKB 1EFRG 2XAQA 3WG7B 4DR2O 3SJBC 2IW5A 5LP6B 4JI5O 1QQCA 2VRZA 4PA7A 4JI1B 1H2MA 3U10A 4JYAO 2WA3A 5IYDO 1IURA 5IE9A 2FTKA 5DM6V 5CBHA 1GK9A 3B2EE 2JEXA 4FZ0A 2Q7HA 2DQ0A 5LGUA 4DR4O 1YCIA 3IGAC 2W6IG 5FL7G 1ROPA 1D5AA 4TV8A 5CB4A 3CPWU 4I50B 2DWDC 2IJIA 4JI0O 4LC1A 2ZE5A 2JJ1G 2DJVA 4FIPC 3BA8A 2ZR3A 4J9ZB 2JVDA 3P3PA 2Q7GA 2P67A 4MW3A 5B66Z 1L0NH 4ZKIA 2CH7B 3ABMB 3L72H 3GWKC 1IBLO 1S5HC 1IBKO 4UUJC 2HLDG 1VQLV 2BE3A 5IYZA 3D36C 2OWOA 2V7QG 4X66B 4LH6A 2E75B 3FX7A 1FXKB 3HKBA 2EIKB 3F7YC 1I94O 1YTFD 1I0HA 3H1IH 1K9MW 3RWRD 1DTOA 1Q7YW 1GN6A 4OPAA 1FS0G 4N21A 4PDVA 2RN9A 4P9PA 5J2TB 1U97A 3AG2C 3JCZA 1VMGA 4ZOLA 1Y4MA 2HKOA 1AJPA 3JD3A 4IIJB 1VQ4V 5LBQA 3IC9A 4NTYA 2OCHA 5BZBA 2L6LA 3W7SA 3H01A 1Y74B 4PDRA 3A2FA 3RYHA 3C3SA 4QGPA 5K1XA 3RYIA 4K0KO 1XMQB 1EBOA 1I08A 2QWQB 4BW9A 4DV2O 1Q6IA 2F95B 3QO8A 3G67A 4JF3A 3TJTA
chains in the Genus database with same CATH topology
1SQVH 1L0NH 1PP9H 3H1IH 1BE3H 2FYUH 3BCCH 3L72H 1NU1H 3H1HH 1NTMH 1BGYH 5KLVH 3CWBH 1BCCH 1SQQH 3CXHF 3H1KH 3H1JH 1NTKH 2A06H 4PD4F 1L0LH 1PPJH 3L75H 1KB9F 1NTZH 1SQBH 3TGUH 3H1LH 3L74H 4U3FH 1EZVH 1SQXH 1SQPH 3L71H 4D6TH 3L73H 1P84F 1KYOF 3CX5F 3L70H 2BCCH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV H;  1L0N H;  1PP9 H;  3H1I H;  1BE3 H;  2FYU H;  3BCC H;  3L72 H;  1NU1 H;  3H1H H;  1NTM H;  1BGY H;  5KLV H;  3CWB H;  1BCC H;  1SQQ H;  3CXH F;  3H1K H;  3H1J H;  1NTK H;  2A06 H;  4PD4 F;  1L0L H;  1PPJ H;  3L75 H;  1KB9 F;  1NTZ H;  1SQB H;  3TGU H;  3H1L H;  3L74 H;  4U3F H;  1EZV H;  1SQX H;  1SQP H;  3L71 H;  4D6T H;  3L73 H;  1P84 F;  1KYO F;  3CX5 F;  3L70 H;  2BCC H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 4MT8 A;  3S3W A;  1J5E O;  1Y76 A;  1SA0 B;  2RQ6 A;  5CBG A;  3WU2 Z;  4YJ2 B;  1CP9 A;  2RNB A;  3OM3 B;  1VP7 A;  1YI2 V;  2Q4P A;  5H6Q A;  3G80 A;  5LYJ A;  2UXD B;  5JH7 B;  5KMG A;  3OTO B;  1KP3 A;  2WLM A;  1FYJ A;  2X6A A;  3O65 A;  4DUY B;  4LBE C;  3AEI A;  2ODM A;  5LMU B;  2A06 H;  1YIJ V;  1Q81 W;  3E2E A;  1X4T A;  1KEC A;  3VQV A;  4O2B B;  2LQT A;  5IDJ A;  3ZRV A;  1VQM V;  1AP5 A;  3E8G A;  4UB6 Z;  3LSQ A;  2ZIO A;  3ASN B;  1AP6 A;  2HR3 A;  3EVK A;  4LNU B;  4LF9 O;  2XUM A;  4X20 B;  3BPZ A;  4ZHQ A;  1BS3 A;  2UXB B;  1NTM H;  4YIO A;  4EFB A;  3ZIA G;  1XRE A;  5IWA O;  1BQZ A;  3CWB H;  4O2A B;  5LMN O;  2R9R B;  1HP8 A;  2UXN A;  1ZL8 A;  3J80 N;  2QWO B;  3OEH G;  5LOV A;  3Q4H A;  2EZP A;  1SS3 A;  1GM7 A;  5KX5 A;  2LFS A;  4RUF A;  2B1I A;  1B3Q A;  5JJJ B;  2YC0 A;  4F6R A;  1HNW B;  4HBN A;  4JI8 O;  2QE7 G;  1GN4 A;  5GW7 A;  2R9I A;  1M4U A;  3S3X A;  4IL6 Z;  5IT9 N;  2CGN A;  4UCO A;  1JFF A;  4HZ3 A;  3WB2 A;  4DRX B;  1JOY A;  2HG5 C;  3F7V C;  4DR3 O;  5KHH A;  3GVM A;  5KHI A;  5CA0 A;  2LO1 A;  3STL C;  2Q69 A;  2XAJ A;  4JI3 O;  4QE7 A;  1XMO B;  4B3M O;  5IJ0 A;  4I7Z B;  3B4S A;  3CCL V;  4GKK O;  4J10 A;  3ZRW B;  4I4T A;  4IHJ B;  3FB5 C;  1Q3E A;  1Q6U A;  1XEQ A;  1OHH G;  1WNS A;  1MSD A;  4E2L A;  4CZZ A;  4DV4 B;  5D5Q A;  1US6 A;  4ZI7 A;  2CTR A;  2EIN B;  3AG7 A;  3DC6 A;  4W4K A;  2Q9L A;  3U11 A;  4MW8 A;  5BY1 A;  3FB6 C;  1N0N A;  1B06 A;  4EB6 B;  3AG3 B;  1QBZ A;  1NTZ H;  2FL4 A;  3TGU H;  1FKA O;  2L35 A;  4FZ1 A;  2DYS B;  3HKD B;  3IFX A;  3L71 H;  4JAV A;  2EIK C;  4DR2 B;  3E83 A;  4X9Q A;  1XL6 A;  4FMT A;  4JI5 B;  4JYB A;  4JAA A;  2BCC H;  4I0X A;  5JCO C;  1TVK A;  1S3J A;  1VQ6 V;  1WN7 A;  3MDS A;  3MHH C;  3GWO A;  5L3C A;  3T1Y O;  4JI1 O;  4JYA B;  5LP6 A;  2QM8 A;  3WB0 A;  3ETQ A;  2ITC C;  2CTQ A;  4BIU A;  1NR7 A;  4IT5 A;  1EN4 A;  2ZE7 A;  2ZM6 O;  4L87 A;  4DR4 B;  3CS5 A;  1H2N A;  2KG7 B;  3C90 A;  4J80 A;  2AXT Z;  1BQ0 A;  2YEV B;  3BY6 A;  3SJQ C;  2JRI A;  1MOF A;  1IZ3 A;  3NR7 A;  4JI0 B;  5LA6 A;  4JV5 O;  3AG4 C;  3ZHU A;  3PJS K;  3CCE V;  4I50 A;  3IJ4 A;  3CRR A;  4QPK A;  2Y4U A;  2N74 A;  1IBL B;  2ZQM A;  1ZTE A;  4JI7 O;  2CH7 A;  1KQS U;  5EIB C;  3CMA V;  3I55 V;  3ETD A;  1A32 A;  2HHH B;  4PA4 A;  4B3T O;  4Z2W A;  3FYI B;  5EYP B;  4QE9 A;  1I94 B;  3QO5 A;  1MZF A;  1YSC A;  1FXK A;  1XNQ B;  4D7S A;  2YXY A;  1N4C A;  4OGQ B;  1N8R W;  3ML0 A;  4KHP O;  4CC6 A;  5JCO A;  4UCU A;  4NXM O;  5KLV H;  4DK0 A;  1V54 B;  4XDJ A;  1VQP V;  2CAZ C;  1SQQ H;  4JZG A;  5KHG A;  1BHA A;  1VEW A;  5J2T A;  1Q8I A;  2ZT9 B;  3AK1 A;  4GX5 A;  4IIJ A;  1SQP H;  1CEZ A;  4OPH A;  3CHX A;  3OFN G;  1B6Q A;  4HNA B;  1Y6X A;  3ZX6 A;  4K0K B;  3DGE A;  1MA1 A;  1Y74 A;  4AIL C;  1BCC H;  1NVP D;  2RJZ A;  3BA9 A;  3K5M A;  4PA3 A;  1VAR A;  2RCV A;  1S77 D;  5KAI Z;  1FJG O;  5B1B B;  4U3F H;  3SDL A;  1J5E B;  4X1Y B;  2A9H A;  1FXH A;  2YI9 A;  1RM1 B;  2QTS A;  4GX1 A;  1ORQ C;  1SA0 A;  1QHT A;  3CE2 A;  4BWA A;  4YJ2 A;  4X65 B;  2ZD9 A;  2QWN B;  1YZB A;  1SES A;  2IM9 A;  2HJD A;  1D5N A;  3ZJZ A;  4L8J A;  1G6U A;  5JH7 A;  1OCC B;  4GYC B;  1F4N A;  3DC5 A;  1VQO V;  3RBZ A;  1XBL A;  5LMU O;  5B1N A;  1G1X B;  2RMK B;  2EZO A;  1HNZ O;  1Q90 D;  3K04 A;  2B1G A;  3HPL C;  3N27 A;  1R1B A;  4O2B A;  3K3W A;  2P22 C;  1ARO P;  2EIN C;  4RQE A;  4FM1 A;  4C7U A;  4LNU A;  2UXB O;  1WJZ A;  5IWA B;  1NI8 A;  4YJ3 B;  5LMN B;  5L3F A;  2EX3 A;  4X20 A;  2ZKO A;  1FFX B;  2JDI G;  5H2F Z;  2WLN A;  2ZDI C;  3OE7 G;  3T4Z A;  1EN5 A;  1SET A;  3VBB A;  4O2A A;  3T1H O;  3AG3 C;  4H33 A;  3JAW B;  1K97 A;  2DYS C;  3UO3 A;  2XAS A;  2JK5 C;  2JJ2 G;  2QEX V;  4PDL A;  2YIB A;  5LHG A;  5GON B;  2Y0I A;  3K5N A;  4PHZ A;  3P3N A;  1WP7 A;  1OCO B;  2GV9 A;  1XHX A;  4DRX A;  2ZXW B;  2EJ7 A;  3SJA C;  3CCM V;  4DV1 O;  4NKG B;  4JI3 B;  2NLJ C;  4B3M B;  3K79 A;  2OTJ V;  1QLN A;  1XMO O;  3W7X A;  1O9G A;  3MAQ A;  3ZS8 C;  1ZWI C;  3L70 H;  2OIE A;  4JI6 O;  1YDX A;  3FD9 A;  1GH6 A;  2JGD B;  3ZRW A;  3JAS B;  4IHJ A;  1M56 B;  4JI4 B;  4R50 A;  4DV4 O;  3SYQ A;  3CP1 A;  2F43 G;  3RYF B;  3W7T A;  4PA6 A;  4FLU A;  4FM0 A;  2GBO A;  4MVO A;  2BSK B;  4K8X A;  1K4D C;  1K8A W;  4WFF A;  3SPI A;  1VQ5 V;  2C2A A;  1AB3 A;  4JGS A;  4X62 B;  3X2Q B;  2M7W A;  4DW0 A;  2DQ3 A;  4EB6 A;  4J41 A;  3CC2 V;  4TWK A;  2V1D A;  4DR1 O;  2JGU A;  3ZHQ A;  3HKD A;  5L3D A;  5KAF Z;  3SYC A;  1L0L H;  3O9O A;  4IGG A;  4GZR B;  3T1Y B;  2X6B A;  4N23 A;  4CH6 A;  1NH2 D;  5BMV B;  2ZNI A;  5EBL C;  2BOB C;  2DOS A;  1K34 A;  2ZM6 B;  1ZAU A;  5EBW C;  3HR0 A;  1GKF A;  5K1P A;  4NYK A;  3ZMV A;  1EM1 A;  3RN4 A;  4UVC A;  2F4V B;  1OCR C;  3CCJ V;  1AI5 A;  2PGG A;  3CXC U;  3J7A U;  2AW9 A;  2YIA A;  4JV5 B;  2K1E A;  2VS0 A;  3EHB B;  2UUC B;  1IBM B;  3SYP A;  2YXH A;  4RO2 A;  3SPG A;  1LNQ A;  1XQ8 A;  3NXS A;  5B1A B;  1H2G A;  3MHS C;  2XOK G;  2P06 A;  2P5O A;  4JI7 B;  5B1B C;  4BAY A;  1NS1 A;  4ASU G;  1QLE B;  2HHH O;  2Q67 A;  4B3T B;  3CYO A;  5EBM C;  1HDJ A;  3K06 A;  3K59 A;  5IJ9 B;  2EBO A;  5J9P C;  2OCC C;  1F23 A;  3LDC A;  5EYP A;  5KHK A;  1XNQ O;  1PM9 A;  4WBN B;  4DW1 A;  1SC5 B;  2QM7 A;  4KHP B;  2MK3 A;  2CGO A;  1JPX A;  4NXM B;  1V9P A;  3AK3 A;  1GAX A;  4UV8 A;  3RFR A;  4B08 A;  3DTU B;  2NN4 A;  4MTF A;  2GDS A;  3CRM A;  3CXH F;  3BHP A;  1PNL A;  1K5S A;  2EUL A;  3E35 A;  3K9S A;  3G71 V;  3BRC A;  4DV3 B;  4HNA A;  2D3O W;  1XOU A;  1P7G A;  3G6B A;  1FJG B;  1BE3 H;  3F5T A;  1KKC A;  3L9D A;  1N36 O;  1HR0 O;  1K5Q A;  2DE0 X;  4GKJ O;  2ADP A;  5E79 Z;  1R6N A;  5JVD B;  4X1Y A;  3QG5 A;  3L75 H;  2N05 A;  3K08 A;  1PNK A;  2LW7 A;  3B8M A;  1Q82 W;  1TAE A;  3ZHS A;  1JQ0 A;  2UUB O;  3RYC B;  1OCO C;  4YY3 O;  1YHQ V;  4X65 O;  3E89 A;  2ZXW C;  3QO7 A;  4CS4 A;  1Q5O A;  2ZE6 A;  3BFR A;  2QWR B;  1R3I C;  1K4C C;  2QDO A;  1FPO A;  5FNV B;  1NBM G;  1HNZ B;  2JEU A;  4IYI A;  5B3S C;  2GTS A;  1M57 B;  2QKS A;  4UVA A;  2H94 A;  2XND G;  4X1I A;  1L8D A;  2EIJ B;  2GUZ B;  4BR6 A;  3JAM N;  1G4Y B;  3SPJ A;  1EZJ A;  4YJ3 A;  1W0K G;  1WLE A;  2EIL C;  2WSS G;  5LHI A;  3T1H B;  2F1M A;  1VIB A;  5C93 A;  1FFX A;  3ZHV A;  4O4L B;  2HP8 A;  4EEQ A;  1I5Y A;  3M7M X;  1K3E A;  4WFG A;  1DGS A;  4WFA V;  2ATK C;  3WG7 C;  3JAW A;  5LP6 C;  1KKD A;  4X1K B;  2UU9 O;  3JAR B;  1MNG A;  3UQ8 A;  4K3A A;  2R70 A;  1MMM A;  3AG1 B;  1AJN A;  4LH7 A;  1GN3 A;  3JSL A;  5GON A;  3E22 B;  4DUZ O;  1PV0 A;  3B09 A;  4YHH O;  1XI1 A;  4D6T H;  4IYH A;  4DV1 B;  1IX9 A;  1AR4 A;  2UXX A;  1YEW A;  1M1K W;  4GT1 A;  4TQD A;  3ZRX A;  1RSO B;  1YJ9 V;  4R6Z A;  3F5W C;  1H2S B;  4WF9 V;  3BVO A;  3RVY A;  4JI6 B;  4X8A A;  4UV9 A;  4JI4 O;  4TV9 B;  2CE4 A;  4PEL A;  5KA5 A;  2JGD A;  4RAI A;  3JAS A;  2B9Z A;  2GSM B;  3ABM C;  5B1A C;  2PI5 A;  2Q5Z A;  1WA8 B;  2BOC C;  2VQE O;  3JAT B;  3RYF A;  1SKV A;  2WAM A;  4JYC A;  1Z5W A;  1Q86 W;  1H38 A;  5C8Y B;  1QLE C;  2ZR2 A;  2BSK A;  4TUY B;  4X62 O;  1KD1 W;  3K5L A;  1FXK C;  3IC7 A;  4NXN B;  2ARH A;  1WB8 A;  2HEP A;  4DR1 B;  4O4J B;  3OAA G;  4P2Z A;  1X59 A;  4DR7 O;  3TXQ A;  3ZMS A;  4PI0 A;  3W7W A;  3SYO A;  1IXB A;  1DK1 A;  1V55 B;  1QVF U;  4G2K A;  2Z3Y A;  5BR8 O;  4MTG A;  3ETG A;  5BMV A;  3CCU V;  1AR5 A;  2WLK A;  2WLL B;  4CH4 A;  2HFE C;  2F4V O;  4O4H B;  4LCU C;  2A7W A;  4FJC C;  1XIL A;  2F66 C;  3H1K H;  3HKE B;  2Y69 B;  2IU0 A;  4P30 A;  2UUC O;  2WLJ A;  1IBM O;  3ETE A;  1N34 O;  3K58 A;  3LUT B;  5AG2 A;  5EZY B;  4JZ2 A;  4LFB B;  3ABU A;  4X88 A;  5EIB D;  3M99 B;  1BL8 A;  1OCZ B;  3FFQ A;  1YVW A;  3RVZ A;  4RQF A;  4DV5 O;  4GUN A;  5GTI Z;  1TUE B;  4FLY A;  5B1O A;  2O57 A;  1RP3 B;  1THZ A;  4LF7 O;  1Q43 A;  5IJ9 A;  4DV6 B;  1WAZ A;  4RUE A;  3JAK B;  1JJO A;  4KUM A;  2ADQ B;  2IJH A;  4X64 O;  2ZE8 A;  4KXR A;  4WBN A;  2F23 A;  1SZX A;  3ZN1 A;  2Q68 A;  1S0V A;  3I56 V;  1I7F A;  1M90 W;  1PKX A;  4KFM A;  2QTO A;  5E1A C;  3SYA A;  3ASN C;  1M57 C;  3JD4 A;  3W7U A;  1JCH A;  1UPG A;  5IYB O;  3CX5 F;  1TGO A;  1HWY A;  5HFM A;  1NH2 B;  2EIJ C;  3B8N A;  5HFL A;  2YS8 A;  1JR9 A;  4UVB A;  3ASO B;  2E5L O;  4LF8 B;  2M6Y A;  4DV3 O;  3QF7 A;  4UXN A;  1W0J G;  1N32 B;  4DO2 A;  2XAG A;  3APO A;  2YIB D;  2Y4T A;  3RYH B;  4FLT A;  1N36 B;  2IJK A;  2E76 B;  1HR0 B;  3K9A A;  4GKJ B;  3B77 A;  3KG2 A;  3SPH A;  1IVS A;  3D3Q A;  2YIC A;  4NTW A;  3JD2 A;  1BZK A;  4B3S B;  3UKM A;  1S76 D;  1FD9 A;  2UUB B;  5JVD A;  5JQG B;  4YY3 B;  1AI4 A;  2Y48 A;  4GCZ A;  1AR1 B;  1M5I A;  3RYC A;  5H9C A;  3J81 N;  4MVS A;  1MZE A;  4E4E A;  3ZHT A;  4UCV A;  3A0B Z;  3QTC A;  2CK3 G;  5FNV A;  1YTF B;  2MW2 B;  5KHJ A;  3ICX A;  2IH1 C;  4XDK A;  1N0J A;  4JI2 O;  2OTL V;  2P7T C;  3OR6 C;  4LF5 B;  3FB7 C;  3CC4 V;  3FAV B;  2IJJ A;  2BTO A;  3THO A;  3OGI B;  3CCS V;  2CDY A;  2QJ1 A;  5FLX N;  4K35 A;  1OJH A;  2GUZ A;  3OUS A;  2X7R B;  2H8P C;  4FLZ A;  1JMK C;  4U7N A;  2VWK A;  1W59 A;  3K03 A;  1PL0 A;  4JTD B;  5KA6 A;  1Z5V A;  1VQ9 V;  1VQ7 V;  2W6J G;  5LHH A;  4O4L A;  5LGT A;  2UU9 B;  3CSX A;  3E8B A;  1N33 B;  1V55 C;  3OUF A;  1COW G;  4DUZ B;  3P32 A;  3I5D A;  4X1K A;  4YHH B;  3JAR A;  1HNX O;  1AI6 A;  2X6C A;  4D7T A;  3E22 A;  2EIM B;  2DN9 A;  1HW7 A;  3ZRS A;  3CEI A;  2UUA B;  4DV7 O;  1R3J C;  3A8T A;  1PD3 A;  4BIZ A;  4LP8 A;  2ZCE A;  1VF6 A;  5IYC O;  4O4I B;  4Z1V A;  3WFV A;  1RSO A;  3CCQ V;  3CCR V;  1KC8 W;  2PI4 A;  5J2U B;  4TT3 G;  4LF6 O;  3H9V A;  4I5S A;  2IH3 C;  1WP8 A;  3T4D A;  2QA4 V;  4DR6 O;  1DF5 A;  5DN6 G;  2VQE B;  4TV9 A;  3VQX A;  4KL1 A;  2DMX A;  3KCX A;  1S72 V;  1OCZ C;  5LL6 Y;  1WA8 A;  3JAT A;  2H3O A;  4MVQ A;  4OXS A;  5JWP A;  1H2K A;  1E79 G;  5F2V O;  2YUA A;  2YI8 A;  5C8Y A;  4NXN O;  3MD0 A;  2Y0P A;  3K0G A;  4TUY A;  4FFK A;  3SGI A;  2F93 B;  4G28 B;  4DR7 B;  1R3K C;  1F7Y A;  4O4J A;  4BW5 A;  2X0L A;  2YDE A;  3K5O A;  2GHY A;  1FAF A;  5BR8 B;  4R8C A;  2DW4 A;  1ENV A;  1V54 C;  3CCV V;  4J7J A;  3EFF K;  4HAM A;  2KG7 A;  2VQF B;  3JYC A;  2WLL A;  3CRQ A;  3T2M A;  2V4D A;  2YEV A;  5CA1 B;  4DYL A;  1P84 F;  1QR8 A;  4O4H A;  4FLX A;  1BMF G;  5LGN A;  1YJW V;  1VQN V;  2ZIM A;  2G38 A;  1PP9 H;  3ASO C;  1SER A;  4ICG A;  2FYU H;  1N34 B;  4DR5 O;  2HVK C;  3HKE A;  3SJC C;  5LA6 B;  4PV1 B;  2P6J A;  4I55 B;  5H6R A;  1I5X A;  2RDC A;  3RGB A;  4LFB O;  3OMA B;  3ZCC A;  4DV5 B;  4JYY A;  3UT5 B;  5EZY A;  1RM1 C;  4LR3 A;  1SQF A;  4JAS A;  4LF7 B;  1W2B U;  2JS3 A;  2OYQ A;  1AJQ A;  3ZMU A;  3SR2 C;  5H5N A;  5DEC A;  3FYE B;  5EC2 C;  4DV6 O;  4U7O A;  3FB8 C;  4X64 B;  4PA9 A;  2PF4 E;  4NTX A;  3RT3 C;  1NKD A;  1OCC C;  1RPR A;  3JAK A;  4TQF A;  4XBF A;  1ZX3 A;  3R65 A;  2Z5U A;  3APQ A;  2KB1 A;  4QNH B;  4JTA B;  1E1Q G;  1NR1 A;  1U96 A;  4FK5 C;  4LFC O;  4J42 A;  3AK2 A;  2BTQ B;  4FFB B;  4GLX A;  5IY5 B;  2UXC B;  1VF5 B;  3CRC A;  4TOI A;  2QKA A;  2NNU A;  4MTO A;  4PJ0 Z;  4BIO A;  3U0Z A;  3BAB A;  4J9Y B;  5A2Q N;  5EK0 A;  2E5L B;  4LWS B;  4LF8 O;  4UB8 Z;  2B5U A;  3QNE A;  1QNM A;  2WLI B;  1RFY A;  1N32 O;  5ITZ B;  1O9H A;  2CTW A;  1K7D A;  1DLB A;  2FKX A;  1YF2 A;  3BAA A;  5BXZ A;  1NQT A;  1PL4 A;  3CB2 A;  2DYR B;  4R7C A;  3AG4 B;  1GM8 A;  3LDE A;  3KKY A;  4FM2 A;  4U3J B;  4B3S O;  3TCU A;  4LF4 B;  3QVN A;  4DV0 O;  3N2G B;  4LFA B;  1XNR O;  1G8M A;  5GTH Z;  3OMN B;  2EIM C;  3CRA A;  5JQG A;  5L3B A;  1JVM A;  4WFH A;  1GN2 A;  1TUB B;  4CH3 A;  3OW2 U;  3D36 A;  3T1C A;  1JX9 A;  3UM7 A;  4MVZ A;  1LUV A;  1GRJ A;  4F6E A;  4FVM A;  2KKW A;  1M56 C;  1YXB A;  1Y67 A;  2LGW A;  4JI2 B;  1XDC A;  3N2K B;  3OEE G;  4PDM A;  4P9O A;  1TA8 A;  4LF5 O;  4K8Z A;  4PI2 A;  1K92 A;  2KQX A;  4PD4 F;  2ZNJ A;  3FAV A;  1KUQ A;  1IDS A;  3OMI B;  3JAL B;  3ABL B;  5JJE B;  4MSW C;  5L3G A;  3X2Q C;  2IBZ H;  3LDD A;  5KUM A;  3BEH A;  2ETN A;  4MTX A;  2YID A;  3PN1 A;  1H8E G;  2XHB A;  1N33 O;  2YSU B;  2IU3 A;  1T5E A;  3DXR B;  1MSW D;  2AZ2 A;  1SQB H;  2PZS A;  1NVP B;  1GM9 A;  1ZUQ A;  1HNX B;  3ZN0 A;  1KBH A;  2LGQ A;  4DV7 B;  4YXW G;  4JPR A;  2UUA O;  1B04 A;  3HKC B;  5LXT B;  1VQ8 V;  1OV9 A;  3BCC H;  4XDL A;  4HYO A;  4AHC A;  2ITD C;  4UCS A;  2W0X A;  2QM4 A;  2P4K A;  2P4V A;  4NR1 A;  3L74 H;  4O4I A;  3STZ C;  3ZHR A;  4LF6 B;  1EZV H;  1SQX H;  4J11 A;  4JTC B;  4DR6 B;  5J2U A;  1QU7 A;  5CMU A;  4AQY B;  2Z0A A;  2VWJ A;  3CJH B;  3ZBH A;  4EKW A;  1R6K A;  1MG1 A;  1UFI A;  1VF7 A;  2YXL A;  3A0H Z;  5KUK A;  4CS2 A;  3GB7 C;  1DF4 A;  4B7E A;  4OX9 O;  2FML A;  2E3C A;  1MAB G;  4QPJ A;  1YIT V;  3H1J H;  4EFE A;  4FPP A;  3RW0 A;  1ZSP A;  5FPO A;  4CS3 A;  1BT8 A;  3SPC A;  4H44 B;  3KCY A;  1UJW B;  4DXW A;  4H37 A;  4UCT A;  5FPR A;  4Q20 A;  1P4R A;  4B3R B;  2PUS A;  1CPY A;  2QKC A;  3JD1 A;  3H1L H;  4ZBM A;  4H13 B;  1GO3 F;  4I9W A;  1Y66 A;  1AIL A;  4KP4 A;  1H8H G;  1AI7 A;  4AI8 A;  2VQF O;  2N04 A;  5IY5 C;  2ZIN A;  5CA1 A;  4DR5 B;  1CXZ B;  4TV8 B;  2WWW A;  1R3L C;  5CB4 B;  2PYL A;  3D8C A;  3R66 A;  2A79 B;  4CC5 A;  3OD4 A;  2AZ0 A;  4I9Q A;  2JS5 A;  3OR7 C;  2WA4 A;  3FKS G;  1FFT B;  4I55 A;  5D5P A;  1GMG A;  1BGY H;  2KSD A;  2DYR C;  3CD6 V;  1YJN V;  3UT5 A;  2E74 B;  1NTK H;  4GX2 A;  2R9A A;  5CA3 A;  1PPJ H;  2PYJ A;  1KB9 F;  3LSU A;  3UO2 A;  1SZT A;  2P90 A;  2DWE C;  2A0L A;  2AHY A;  5IYZ B;  1IBK B;  1LR1 A;  2PTM A;  2R72 A;  3KZI Z;  3A0R A;  4RWU A;  3ABK B;  4UCR A;  3CC7 V;  4QIW F;  4X66 O;  3HKB B;  1M9N A;  4DK1 A;  5TIS Z;  3VQY A;  3JCU Z;  1K33 A;  4LFC B;  3CME V;  3C3T A;  2OT5 A;  1QCE A;  3IAY A;  1R73 A;  4ZOL B;  1K73 W;  1LUW A;  1WPX A;  4CBC A;  2AHZ A;  3EXA A;  2UXC O;  3K57 A;  4G27 B;  1JA8 A;  3LNM B;  2BTQ A;  4FFB A;  2JIZ G;  1URF A;  1F51 A;  3HB3 B;  2W0F C;  2EJR A;  1OZ0 A;  1IXM A;  2CUG A;  4LWS A;  3ABL C;  4FLV A;  2Q7E A;  4Z1M G;  1OCR B;  5JJN B;  2QGN A;  5CBF A;  2WLI A;  3RYI B;  5ITZ A;  3B40 A;  2WPD G;  4CH5 A;  1QVG U;  1QR9 A;  1SQG A;  2LW1 A;  3H1H H;  4DV2 B;  3AG1 C;  1XMQ O;  4DV0 B;  2LFR A;  1S5J A;  4LF4 O;  1Y76 B;  1XNR B;  1WB7 A;  2XTA A;  3TET A;  4U3J A;  4QJF B;  4LFA O;  3K0D A;  3OT7 A;  4B7K A;  3M8A A;  3N2G A;  1VF6 C;  4YIP A;  2Q6A A;  2GTA A;  2PY5 A;  2Q73 A;  3JD0 A;  3LSS A;  1NT2 B;  4MS2 A;  1S5L Z;  3D3I A;  1VQK V;  2ILM A;  1P7B A;  3DSQ A;  1F4M A;  5LYJ B;  1TUB A;  5KMG B;  2OCC B;  3UCS C;  1J95 A;  2AGA A;  3G4S V;  1SRY A;  2UXD O;  2QSA A;  3OTO O;  3E86 A;  3OGC C;  1EN6 A;  1PNM A;  2QWP B;  1FXV A;  4DUY O;  1XHZ A;  4F4L A;  3ZED A;  1L1F A;  3L73 H;  3TXS A;  3AG2 B;  3N2K A;  1NZ6 A;  5CN0 A;  2K9P A;  1NU1 H;  3P30 A;  5DED A;  2HJF C;  1KP2 A;  4ZHQ B;  4X89 A;  5EC1 C;  4LF9 B;  2XAF A;  4X1I B;  3E8F A;  4Q6G A;  5L3E A;  4FLW A;  2FB5 A;  3JAL A;  2Q0O C;  2Q0A A;  1ZL8 B;  2NR5 A;  1RPO A;  1XUQ A;  2D2C B;  5LOV B;  3ABT A;  3Q4H B;  4H0L B;  1M93 A;  1KYO F;  4J7Z A;  3ZMZ A;  5KX5 B;  4ZIB A;  2CTP A;  4ABM A;  1E1R G;  3WB1 A;  1SF9 A;  4F6R B;  3E8H A;  4WFE A;  1KU9 A;  3DXR A;  3OTF A;  2XT9 A;  3TK1 A;  4MVR A;  1HNW O;  1KMI Z;  4JI8 B;  4MVM A;  1JFF B;  4J7K A;  1BSM A;  1WPB A;  4WCE V;  3ZMT A;  1H2L A;  4NB5 A;  3HKC A;  5LXT A;  3G6E V;  2A3Q A;  1SQV H;  5CA0 B;  4DR3 B;  2HVJ C;  4A5U B;  5A9G A;  1XL4 A;  5IJ0 B;  1NJI W;  2Y69 C;  1Q6H A;  2LJ2 A;  4I4T B;  4AQY O;  2LP7 A;  4GKK B;  2XAH A;  2QR4 A;  4OX9 B;  1BHB A;  1P49 A;  2OIG A;  3CJH A;  2WLH A;  4ZI7 B;  3JSN A;  4MVU A;  5B3S B;  4TSF G;  4UFZ A;  5B5E Z;  3LNN A;  1JJ2 U;  1R6T A;  1D2D A;  4JAU A;  1AVM A;  3ABK C;  2EIL B;  4B3R O;  1Z2G A;  4GX0 A;  1GTO A;  2Q8V A;  3VOU A;  4W4L A;  2ZDI A;  3VQW A;  1ZLZ A;  4I0X B;  4NVP A;  4WFB V;  1TVK B;  1EFR G;  2XAQ A;  3WG7 B;  4DR2 O;  3SJB C;  2IW5 A;  5LP6 B;  4JI5 O;  1QQC A;  2VRZ A;  4PA7 A;  4JI1 B;  1H2M A;  3U10 A;  4JYA O;  2WA3 A;  5IYD O;  1IUR A;  5IE9 A;  2FTK A;  5DM6 V;  5CBH A;  1GK9 A;  3B2E E;  2JEX A;  4FZ0 A;  2Q7H A;  2DQ0 A;  5LGU A;  4DR4 O;  1YCI A;  3IGA C;  2W6I G;  5FL7 G;  1ROP A;  1D5A A;  4TV8 A;  5CB4 A;  3CPW U;  4I50 B;  2DWD C;  2IJI A;  4JI0 O;  4LC1 A;  2ZE5 A;  2JJ1 G;  2DJV A;  4FIP C;  3BA8 A;  2ZR3 A;  4J9Z B;  2JVD A;  3P3P A;  2Q7G A;  2P67 A;  4MW3 A;  5B66 Z;  1L0N H;  4ZKI A;  2CH7 B;  3ABM B;  3L72 H;  3GWK C;  1IBL O;  1S5H C;  1IBK O;  4UUJ C;  2HLD G;  1VQL V;  2BE3 A;  5IYZ A;  3D36 C;  2OWO A;  2V7Q G;  4X66 B;  4LH6 A;  2E75 B;  3FX7 A;  1FXK B;  3HKB A;  2EIK B;  3F7Y C;  1I94 O;  1YTF D;  1I0H A;  3H1I H;  1K9M W;  3RWR D;  1DTO A;  1Q7Y W;  1GN6 A;  4OPA A;  1FS0 G;  4N21 A;  4PDV A;  2RN9 A;  4P9P A;  5J2T B;  1U97 A;  3AG2 C;  3JCZ A;  1VMG A;  4ZOL A;  1Y4M A;  2HKO A;  1AJP A;  3JD3 A;  4IIJ B;  1VQ4 V;  5LBQ A;  3IC9 A;  4NTY A;  2OCH A;  5BZB A;  2L6L A;  3W7S A;  3H01 A;  1Y74 B;  4PDR A;  3A2F A;  3RYH A;  3C3S A;  4QGP A;  5K1X A;  3RYI A;  4K0K O;  1XMQ B;  1EBO A;  1I08 A;  2QWQ B;  4BW9 A;  4DV2 O;  1Q6I A;  2F95 B;  3QO8 A;  3G67 A;  4JF3 A;  3TJT A; 
#chains in the Genus database with same CATH homology
 1SQV H;  1L0N H;  1PP9 H;  3H1I H;  1BE3 H;  2FYU H;  3BCC H;  3L72 H;  1NU1 H;  3H1H H;  1NTM H;  1BGY H;  5KLV H;  3CWB H;  1BCC H;  1SQQ H;  3CXH F;  3H1K H;  3H1J H;  1NTK H;  2A06 H;  4PD4 F;  1L0L H;  1PPJ H;  3L75 H;  1KB9 F;  1NTZ H;  1SQB H;  3TGU H;  3H1L H;  3L74 H;  4U3F H;  1EZV H;  1SQX H;  1SQP H;  3L71 H;  4D6T H;  3L73 H;  1P84 F;  1KYO F;  3CX5 F;  3L70 H;  2BCC H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...