1BGYH

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 18
structure length 64
sequence length 64
chains with identical sequence T
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bgyH00
1NTKH 2BCCH 1BGYH 3H1LH 4D6TH 3CXHF 1SQBH 3H1IH 3L75H 1L0LH 1BE3H 2IBZH 1SQVH 1KYOF 1NU1H 1SQXH 3L71H 5KLVH 1L0NH 1SQQH 3TGUH 4U3FH 1P84F 3H1KH 3L74H 3CX5F 1KB9F 1SQPH 3L72H 1NTMH 2FYUH 3H1JH 1BCCH 4PD4F 3CWBH 3H1HH 1PPJH 2A06H 1NTZH 3BCCH 3L73H 3L70H 1PP9H 1EZVH
chains in the Genus database with same CATH superfamily
3UT5B 2ZXWC 4TSFG 1K4CC 4IIJB 4DV4B 4H13B 2X0LA 1THZA 1XNRB 4GX5A 4DV4O 4BWAA 2WSSG 2GUZB 4MVOA 1N8RW 3CCJV 4JGSA 1R3IC 1ROPA 4X66B 1GM9A 1WN7A 3K04A 4U7OA 5TISZ 3LNMB 2UXBB 1Q3EA 3CRCA 4NXMB 4J9ZB 1M1KW 1B3QA 1KYOF 4DV0O 1XHZA 4EFEA 3ZJZA 4DR4B 4J7JA 4Z1MG 5FNVB 1D2DA 1CPYA 4JI6B 2UUCB 2WA4A 2OTJV 2OTLV 4LF8O 2Q67A 2LGQA 3KCYA 1KKCA 2WLLA 5J2TA 1H2GA 5AG2A 3P3NA 4DR2B 3TXSA 4WFHA 2BOCC 3QNEA 3B8NA 3FB7C 2N04A 5F2VO 1IBMB 1UPGA 1ZSPA 2ATKC 4Z2WA 5KHKA 5CBHA 3FX7A 4I55B 4OPAA 3F7YC 5K1PA 2XAQA 4QIWF 4I5SA 4AHCA 2UUAB 5B3SC 1SERA 1IURA 4JTCB 5HFMA 4FLXA 1D5AA 4JPRA 1RM1B 5EZYA 4TV8B 2R9IA 3CJHA 2DW4A 1ZUQA 4X66O 4JZ2A 3CC4V 3CE2A 2CTRA 2BTQA 1NH2B 5KHJA 2NN4A 3WB1A 3CPWU 1XNRO 3J80N 5KAFZ 2QWPB 4DR6O 3CJHB 3L73H 4UV8A 5B5EZ 4I4TB 3DTUB 1EZVH 4OX9B 2DYRC 5CA1A 1JOYA 1Q6IA 3SPHA 4JTDB 5D5PA 4GLXA 4DK1A 1HNWB 3TGUH 3E2EA 2EJRA 1F51A 2ZINA 3HKCA 1N32O 5H6QA 2UU9B 4I4TA 1YEWA 1XL6A 1VQOV 3QF7A 5GONA 4AILC 2QTSA 4DV5B 1K73W 4LFBO 1PNLA 2QKAA 4O2BA 5H5NA 1M90W 2F66C 4B3TO 4JI0B 3TCUA 4HYOA 4QE7A 3O65A 3W7WA 1HNZO 3J81N 3AG2C 3T4DA 5BXZA 5GONB 4J11A 4PA6A 1SETA 3LSSA 4R6ZA 2A7WA 1CP9A 2PI4A 1NTZH 2P7TC 3OEEG 3G80A 3JARB 1K9MW 2JK5C 4CS4A 4PELA 2CDYA 3QO5A 1UFIA 5C8YB 4RUEA 3ZRWB 1FAFA 1K3EA 4CZZA 3RYFB 2R9AA 1OCCB 1R1BA 2IU0A 4B7EA 1KU9A 1DLBA 1F23A 3STLC 1XL4A 1KC8W 4B3RO 3X2QC 2F43G 2PI5A 2XTAA 3MDSA 4O4HA 1KECA 1EZJA 3APOA 1YI2V 2ZE7A 3ZMUA 5J2TB 3KKYA 3CMEV 3OW2U 5H2FZ 1OZ0A 3EHBB 1SKVA 3SJBC 2WLJA 1Q7YW 2E3CA 5IE9A 1LUVA 3FYIB 3U10A 2YIBA 1PPJH 3QTCA 4G28B 2ZCEA 4MTXA 2AXTZ 3JAWA 4YXWG 3ZX6A 2UU9O 4LR3A 4WFGA 4JI6O 3JD3A 5CA3A 1S77D 1Y76B 4FFBA 4JI3B 1WP8A 2HJFC 3ASNC 2Q7HA 2QM8A 1AI7A 1J5EO 2LO1A 2XAFA 1YZBA 3N2KA 5DECA 1HNZB 2Q73A 4ZOLB 3M8AA 1S76D 1MSWD 4TT3G 3NR7A 1P7BA 3K79A 2ZE6A 2LFSA 4LWSA 1VQLV 3Q4HB 4PDVA 3K5OA 4Q6GA 5LHIA 1I7FA 1P7GA 2WAMA 3D3IA 4LF7B 1H2MA 3CEIA 3E35A 1N4CA 3HPLC 5JCOA 4FPPA 1WB8A 2ZKOA 2F1MA 2ZT9B 5LHGA 1EN6A 1AP5A 2Y69C 1NTKH 1PNKA 3JD1A 2EJ7A 2DN9A 2X6AA 3LNNA 1NVPB 1M4UA 1GO3F 2IW5A 3OEHG 5L3EA 2EINC 4TWKA 3CCEV 3JCUZ 4NTWA 4IGGA 1F4NA 5JVDA 1O9GA 5LXTB 4IYHA 2XOKG 2F23A 4I50B 3AG7A 3CCQV 1AROP 5EIBC 2V1DA 3U11A 1Z5WA 4PA3A 4DV6B 5E79Z 3ABMB 1EFRG 5JJEB 1R6KA 4PA4A 5FPOA 2LGWA 3WU2Z 2LW7A 2B1GA 5LXTA 3B4SA 2BSKB 2PF4E 4I9QA 2VQEB 5LP6B 1S3JA 3SYPA 3WB0A 2W6IG 4XDLA 2B1IA 3JYCA 1JR9A 3ABLB 5IYZB 4X1YA 4LFCB 4EEQA 1KQSU 3ABKC 2HLDG 4DYLA 3IFXA 2QEXV 1Q5OA 1PV0A 3WG7B 4GZRB 2DYSC 3SJQC 4EFBA 2HHHB 2UUCO 1GKFA 3K3WA 1Q43A 5L3CA 5L3BA 5IYZA 2YS8A 4LH7A 3P3PA 5LL6Y 4QNHB 4F6EA 3W7XA 5EC1C 4LF5O 3VQVA 1HNWO 4GYCB 5DN6G 1VQ9V 1DF5A 4MW8A 4JV5O 4WBNB 4OPHA 3IC9A 4Z1VA 1S5JA 3E8GA 4WF9V 4KHPB 1FS0G 4ZHQB 2GBOA 4DR6B 5JH7B 4R7CA 2HVJC 1XHXA 2VS0A 1FFXA 2UUBB 1RP3B 1JPXA 1JX9A 2E75B 3JATA 1YJWV 2ZNJA 3GWOA 3G4SV 3B77A 4Q20A 1DK1A 3ZMZA 4GX1A 3TK1A 4FM2A 3CXCU 4WFBV 4D7TA 3AK2A 3CCSV 2P90A 4BAYA 1URFA 1N33O 3TJTA 1JVMA 4YJ3B 4QPJA 1N36B 4X9QA 1NH2D 5CMUA 1J95A 3ZEDA 4UCSA 1WPXA 2NNUA 5LOVA 4JAUA 1AVMA 5H6RA 3G67A 2UXDB 4DR2O 1XQ8A 1GM8A 3A0HZ 3HKCB 3M99B 3UKMA 3SYQA 1VQ8V 1NQTA 2Q7GA 2QWNB 2XUMA 1VQ5V 5IJ9A 1FFTB 3JSLA 2L6LA 4LF8B 3ETQA 4MVRA 4JI1B 1RSOA 1TUBB 2JGDB 1WPBA 1N34B 4TOIA 2AGAA 2XNDG 2F95B 4DR3O 1FXHA 4DV0B 4DRXA 3QG5A 3CC7V 4ZIBA 2Q0AA 3ASNB 3E86A 4JI4B 4O2AB 1XMQO 2M7WA 2GHYA 1WA8B 3D3QA 1NJIW 1IVSA 1SRYA 5CB4B 4FK5C 1M56C 4CC5A 2Z0AA 1XMQB 3UCSC 4X1IA 4DXWA 3K5MA 2LW1A 4CS3A 1KKDA 2ETNA 4NR1A 3CD6V 2EILB 1K34A 4O4JB 3ZRSA 4JI8B 1WA8A 2PUSA 4QGPA 1M9NA 2Q7EA 2EIKB 2ZDIA 2Z5UA 3BRCA 5H9CA 5JCOC 1BQ0A 4X1IB 3IGAC 1TVKB 1OCZC 4TQFA 4FM1A 5FL7G 2QDOA 3NXSA 3BFRA 3W7SA 1V55C 4JI1O 4IHJB 4JI7B 5FPRA 2Z3YA 1I94B 1QCEA 1W0KG 4R50A 3VQYA 3MD0A 1WP7A 1XBLA 1QNMA 2B5UA 2YDEA 3S3WA 4AQYB 3T4ZA 2K1EA 4ZBMA 2R72A 4FLWA 1GN4A 5DM6V 1XMOB 3MHHC 1BHBA 1FJGO 1E1QG 2QM4A 2CAZC 4LFAO 4FFKA 2EINB 2CGOA 2HJDA 5IYCO 1VQMV 2E5LO 3RN4A 4UVBA 4C7UA 1US6A 5JQGB 3IAYA 2IJJA 4FZ1A 2ZE8A 5CA0A 2ARHA 4JTAB 1EN4A 4JZGA 1Y74A 1BSMA 3ZHQA 5JJJB 3G71V 4EB6B 4YJ2B 5EC2C 4ASUG 3C90A 5J2UA 3JASB 5LGUA 2DE0X 1PNMA 5KMGB 1VQ6V 2ZDIC 3OT7A 1XMOO 5LP6C 2OCHA 2ZR3A 1H2SB 1FJGB 1YHQV 1MSDA 3CRRA 1DGSA 4PI2A 1Q6UA 1RPOA 3ABKB 1X59A 1O9HA 3K03A 4LF7O 2ZD9A 4KUMA 1AR1B 1V54B 3CCUV 2QGNA 4ZOLA 4GKKO 1XREA 3FKSG 1TA8A 3L74H 4A5UB 4MTOA 2FYUH 4X8AA 4PD4F 1XDCA 1I5XA 3ZRWA 4MVQA 1NKDA 2UXNA 1R73A 2BCCH 1NR1A 5BY1A 4O4IB 3CS5A 4O2BB 4GKKB 2CK3G 2O57A 3I5DA 1NI8A 2QM7A 4UXNA 3SJCC 2YEVB 1JFFB 2UXCB 4DR7O 3KZIZ 2JS5A 3AK1A 3BVOA 4UCTA 3FAVA 1RM1C 1I08A 4JYYA 2OWOA 3UQ8A 4JAVA 3TETA 3SGIA 2Q6AA 4JI2B 2DQ0A 2HEPA 3C3SA 3N2GB 1Q8IA 1N34O 2XAJA 3GVMA 5LP6A 4I7ZB 1Q86W 1LR1A 3R66A 5LA6B 3JD2A 2JGUA 2Y69B 3CRQA 5B66Z 2CH7A 1F4MA 5IWAB 4X65B 2YI8A 3CXHF 1H2KA 4I50A 2FB5A 1GH6A 2RQ6A 1KD1W 3UO2A 1S0VA 5D5QA 4BIZA 1GAXA 1G1XB 2PZSA 1PKXA 1FD9A 2X6BA 1SQGA 4I0XA 5FNVA 1AI5A 1F7YA 5KAIZ 4UCRA 1VARA 4B3MB 3AK3A 1GMGA 3JALB 3KG2A 1G6UA 4NXMO 2YIBD 4JI7O 2NLJC 4UUJC 5JH7A 1VQ7V 1BCCH 3CWBH 3OD4A 2HR3A 3BCCH 1N33B 1OCOC 1R6NA 3JD0A 4PJ0Z 3ABLC 3CYOA 2QKCA 3H1IH 2DYSB 2LQTA 2RJZA 3DC6A 4L8JA 2ZIOA 3RYIB 3E8FA 2YIAA 4KHPO 1M56B 4DV5O 3X2QB 1AJNA 4WBNA 2AZ0A 4MT8A 5IY5B 1IXMA 1SF9A 1AB3A 4QPKA 5KHHA 3JSNA 4JI4O 2V7QG 1J5EB 3RYIA 4LCUC 1NVPD 1GN3A 1QVGU 1JJ2U 2YUAA 1AR4A 4UVCA 1I0HA 4GKJO 2KG7B 4RWUA 2BE3A 3K08A 4KL1A 4DV3O 2BTQB 4K8ZA 1MOFA 3QVNA 4X64O 2IM9A 3T1YB 1JQ0A 4O4IA 1VIBA 3JAKA 1IDSA 2VRZA 4CBCA 3ABTA 4DR5O 2CTWA 4J9YB 1SQBH 1VQNV 3VQXA 3SYCA 2E76B 4U3JA 3CRMA 2P4KA 4CH4A 4ZI7A 3UT5A 4GUNA 2HHHO 1DF4A 2OIEA 2DJVA 2A0LA 3HR0A 3H1KH 3ZMTA 1COWG 2QTOA 2K9PA 4X89A 2ITDC 3UM7A 3BA8A 1LNQA 2HP8A 4PDLA 4F6RB 4KP4A 4DRXB 3ZCCA 4MTGA 5LOVB 1VF5B 3OE7G 1Y4MA 4B3RB 1SQVH 2JJ2G 2PYJA 1WB7A 4CC6A 1OCRB 4DUYO 1LUWA 4E4EA 4O4LA 2CH7B 1S5LZ 4OXSA 5L3DA 4LF6B 3G6EV 3ZHVA 2ZM6B 2IH3C 3D36C 3TXQA 4LF4B 4BW9A 3K0DA 1OV9A 2QSAA 2X6CA 2E5LB 2B9ZA 3JARA 1IX9A 1VEWA 3BPZA 2HKOA 4CS2A 4JI0O 2V4DA 2QWOB 2P5OA 3E22A 1XI1A 3T2MA 4ZHQA 3U0ZA 2OIGA 3ZHSA 1R3JC 2WLLB 4G2KA 4YHHB 2IU3A 1K92A 1KP3A 3RBZA 5DEDA 2W0XA 1H2NA 2WLHA 1H2LA 1YVWA 4O4HB 4GT1A 5KA6A 2M6YA 4H37A 1YSCA 3GB7C 2MW2B 4TQDA 2Q0OC 1YITV 4JI5O 5KHIA 2WLIB 3UO3A 2ADQB 4MSWC 3L72H 1G4YB 1E1RG 2YXYA 3B40A 1TAEA 5LYJA 3F7VC 3HKBA 2WA3A 1BGYH 2PTMA 2QE7G 1KMIZ 2EILC 4JYBA 3SYOA 3O9OA 3ABMC 5EZYB 4DUZB 2QWRB 5KUMA 1XNQO 4DV1O 2PGGA 4DV2O 2OCCC 3HKEA 1GM7A 1SZXA 1SQFA 1OCZB 5LYJB 4LNUB 3PJSK 5J2UB 2ADPA 2QWQB 2W0FC 3OUSA 3AG4C 4NXNB 4MW3A 3G6BA 4BR6A 4HNAB 1VMGA 3IJ4A 3MAQA 2YXLA 1ZLZA 2WLMA 3L71H 4XDKA 2A3QA 1S72V 2EIMC 2JGDA 2GSMB 1P4RA 2Y0PA 1G8MA 5J9PC 4TV8A 1VF7A 1S5HC 2L35A 2Q68A 1AP6A 2VWJA 4YHHO 5CA0B 4O2AA 4DR1O 5IJ0B 1FYJA 3DXRB 5E1AC 2ZM6O 2H94A 3OAAG 1T5EA 2EIKC 4RQFA 1FPOA 1QR8A 2IJIA 1IZ3A 3ETEA 1Y67A 3S3XA 1BMFG 4EKWA 3T1YO 3T1HB 3LUTB 4FLUA 1V55B 3CCRV 2IJHA 1BE3H 1ORQC 4DV3B 4BIUA 1ZX3A 1H38A 2N74A 3E8BA 4IT5A 3WFVA 1PL4A 5KX5A 3RFRA 5LHHA 1D5NA 2W6JG 4K35A 2QJ1A 4ICGA 3K0GA 1OCOB 4QE9A 3AG1B 2JEXA 4GX2A 3OR7C 3FB6C 1IBKB 1R3KC 3F5WC 3MHSC 4TUYB 4DV2B 1IXBA 3CMAV 3ZRVA 1V54C 4LC1A 3SYAA 3OGCC 1HW7A 1FKAO 3EXAA 2F4VO 5LA6A 1P84F 3N27A 4NVPA 4FIPC 1XNQB 1BZKA 4O4JA 4MVUA 4TV9B 1MABG 4XBFA 4UCOA 3H1HH 1IBKO 1JFFA 4X64B 1TVKA 3OTOO 2Y48A 1MMMA 1QLNA 1YCIA 1R6TA 5B1AC 3CCMV 4FZ0A 4IYIA 3CCVV 3B2EE 4XDJA 4X1YB 3AG3C 4LH6A 2PY5A 1U96A 1CEZA 1HP8A 3I55V 3SPJA 5EK0A 2AW9A 2JDIG 4K3AA 3N2KB 1Q81W 4LF9B 3ZHTA 2FMLA 5BMVB 1QLEC 2IJKA 4HBNA 5JWPA 1SESA 4U3FH 5B1BB 2RMKB 4LFCO 3DSQA 3E89A 4LF4O 1MZEA 3OUFA 1GRJA 3K58A 1B6QA 3ZBHA 5JQGA 2FTKA 3A0RA 2VQEO 1VQ4V 4HNAA 4UB6Z 1RFYA 4J41A 4LF6O 2DWEC 1Y74B 1JA8A 3D36A 1GK9A 4P30A 1M93A 4YJ2A 2QA4V 1RPRA 2OT5A 4P2ZA 1IBMO 4LFAB 1SQQH 4H0LB 1K7DA 1NBMG 3LDCA 2XAHA 4NTXA 5EYPA 1ZL8B 4X20A 3ZMVA 3H1LH 2JS3A 4YIOA 2CTPA 2XT9A 3P30A 4UB8Z 1CXZB 3ZN1A 2F93B 2CGNA 3THOA 4DUZO 5HFLA 1AJQA 5KUKA 5IWAO 1MNGA 1K97A 3VOUA 4DW1A 2EBOA 2WLNA 1GTOA 4ZI7B 2KKWA 1VQPV 5L3GA 3W7UA 3ASOB 4PV1B 3RVZA 1EM1A 1BQZA 1ENVA 1K5SA 3R65A 4NXNO 4JI2O 1M57C 2EIJC 1XILA 2UXBO 2X7RB 1MZFA 2YEVA 5CBGA 4FMTA 3OTOB 4TUYA 2EZPA 3JD4A 3JCZA 5IY5C 1ZWIC 4J42A 4PDRA 4DR7B 2ILMA 2BTOA 3BHPA 2ZNIA 3K9SA 3LSUA 4DV1B 3EFFK 5GW7A 1PM9A 4PI0A 2F4VB 5LBQA 2GUZA 2RDCA 4N23A 2LP7A 3BEHA 1N0NA 4TV9A 1K8AW 4DR3B 3K59A 5B3SB 3E83A 5EIBD 5IYBO 2WLKA 1Y66A 5FLXN 2FKXA 5CBFA 1W0JG 3RYCB 1SA0A 1W59A 1DTOA 3A2FA 3AG4B 3JALA 5CB4A 2Y4TA 4X1KB 4B08A 2UUAO 4WFFA 3E22B 3LDDA 2EULA 3ZIAG 4JYAO 5LMNO 4UV9A 3JAWB 4OGQB 1IBLB 1EBOA 3BY6A 2JJ1G 2WWWA 2EX3A 2LFRA 4J80A 2ZXWB 4MVZA 4O4LB 2DYRB 5IYDO 3GWKC 3K06A 4K8XA 2P67A 1TUEB 1AI6A 3CCLV 3F5TA 1KBHA 4DW0A 1OCRC 3APQA 1KP2A 4E2LA 1YXBA 2OYQA 1GN2A 5ITZA 1WNSA 1QBZA 3BAAA 3ZHRA 4FLYA 1AILA 3CC2V 4DR5B 1MA1A 4RO2A 3AEIA 1WLEA 2Y4UA 2CUGA 4YY3B 3C3TA 2CTQA 4J7KA 1NS1A 1JJOA 4AI8A 4X62O 4J10A 3Q4HA 3RWRD 1BS3A 2KB1A 3HKDA 1SQPH 1E79G 3CB2A 3SPCA 1YJ9V 3L9DA 2UXCO 3JATB 5IT9N 3FD9A 5C93A 2XHBA 4JV5B 1BL8A 1OCCC 3HKBB 3PN1A 1WAZA 1NU1H 3H9VA 3HKDB 4MS2A 1ZAUA 4B3SB 3HB3B 1JCHA 2E74B 4B3TB 1FXVA 4MVSA 2JRIA 3RYHB 4LFBB 2QR4A 1XUQA 1SS3A 4MTFA 4HZ3A 1K33A 2WPDG 1FXKC 1VQKV 4X88A 1HDJA 4K0KO 4HAMA 4B3SO 4PHZA 4JI8O 4FLZA 3EVKA 2IBZH 1SQXH 5KHGA 4U3JB 2H3OA 1VP7A 2ITCC 1R3LC 2P22C 1HR0O 4GX0A 1KB9F 4D7SA 4J7ZA 3I56V 4OX9O 2EZOA 1MG1A 1PD3A 1VF6A 1Q6HA 4RQEA 1YF2A 1W2BU 1XEQA 1KUQA 1H8EG 1QLEB 2Q4PA 3ZMSA 3FB8C 5KX5B 3DGEA 2P6JA 2VQFO 4PA7A 5IJ9B 1AJPA 2FL4A 5KA5A 2H8PC 2IH1C 5LMUO 1HNXO 4JF3A 4X65O 5IJ0A 4JAAA 1X4TA 5B1NA 1A32A 4ABMA 3ZS8C 4CH3A 3FFQA 5JJNB 2YI9A 4DUYB 2JIZG 4KXRA 4H44B 3SPIA 3FAVB 4YIPA 4BIOA 2A9HA 4LF9O 5L3FA 5LGNA 1JMKC 4NKGB 1L1FA 1Q82W 1SC5B 2R9RB 5EBLC 1IBLO 1QQCA 4CH5A 1YTFD 3CP1A 3HKEB 4JYCA 5EBWC 3AG2B 3ZHUA 3VQWA 1I94O 1NT2B 4DK0A 3AG1C 3T1CA 1Q90D 3H1JH 1OJHA 2WLIA 3OMAB 1VF6C 2EIMB 4K0KB 1Y6XA 1HWYA 1NZ6A 2QKSA 3SDLA 3L75H 4DR4O 1L0LH 3D8CA 1M57B 2EIJB 3OR6C 5B1OA 3K9AA 2RCVA 2YXHA 3QO8A 3WB2A 4P9OA 5A9GA 3SPGA 2DQ3A 5CA1B 2JEUA 3B09A 2A06H 2ZE5A 5CN0A 4LNUA 4ZKIA 4PA9A 2ODMA 1QU7A 2YIDA 4JI3O 1YJNV 5GTHZ 2Y0IA 3BABA 2Q5ZA 2XAGA 1SZTA 5EYPB 1OHHG 3OTFA 3FYEB 4LWSB 4YY3O 4X62B 4RAIA 1Y76A 2HVKC 2Q69A 4MVMA 2GV9A 5GTIZ 2DOSA 4D6TH 5KMGA 2GTAA 2C2AA 4UCUA 3K57A 3SJAC 1AR5A 3ZRXA 1GN6A 3ML0A 5B1BC 2ZQMA 3WG7C 3OMNB 4JASA 3RW0A 4B3MO 2D3OW 3QO7A 1RSOB 1TUBA 4W4LA 4UCVA 1N0JA 3DXRA 2YC0A 5BR8O 3L70H 1PP9H 3M7MX 3RYFA 4G27B 1ZL8A 2Q9LA 4H33A 4AQYO 5A2QN 2AHYA 4X20B 2HFEC 3OFNG 4DV7O 2DWDC 5JVDB 4JYAB 3B8MA 1ZTEA 2OCCB 4KFMA 4GCZA 4FLVA 4RUFA 1B06A 3VBBA 3AG3B 1EN5A 1HNXB 5LMUB 3OM3B 4CH6A 2UXXA 2MK3A 5BZBA 4N21A 1TGOA 2A79B 1P49A 1YIJV 3ETGA 3ETDA 4F6RA 5C8YA 1UJWB 4FM0A 4UFZA 3STZC 2P4VA 4FVMA 1PL0A 1M5IA 4IIJA 3K5NA 2VQFB 1BHAA 4WCEV 3RT3C 3CX5F 1SA0B 1NTMH 4UVAA 1B04A 1K5QA 1NR7A 4IHJA 2UUBO 3FB5C 4R8CA 4X1KA 3SR2C 2DMXA 5BMVA 4QJFB 1Z2GA 2AHZA 4FFBB 1FXKA 1AI4A 3N2GA 4JI5B 2PYLA 3P32A 2VWKA 2KSDA 4I9WA 2KQXA 4LF5B 1QVFU 4WFAV 1L0NH 4PDMA 4U7NA 1XOUA 3DC5A 2BSKA 3RGBA 4BW5A 1FXKB 1QHTA 3ZN0A 4FLTA 2RN9A 3ABUA 4P9PA 3IC7A 5ITZB 4B7KA 3ICXA 2HG5C 2XASA 2BOBC 3CRAA 1U97A 2CE4A 1V9PA 2YSUB 3OMIB 2UXDO 4I0XB 4LBEC 4EB6A 2R70A 3JASA 2GTSA 2RNBA 3BA9A 4FJCC 4IL6Z 5IDJA 2Q8VA 3ASOC 4DV6O 5LGTA 5KLVH 1N36O 3T1HO 4I55A 4NB5A 2N05A 2GDSA 1H8HG 2ZR2A 3JAMN 4NYKA 2LJ2A 5K1XA 3H01A 4DR1B 1K4DC 1FFXB 5B1AB 3RYHA 3W7TA 4DV7B 3OGIB 3E8HA 3RVYA 5EBMC 2NR5A 1I5YA 3A8TA 4WFEA 1WJZA 2D2CB 5LMNB 3CHXA 2JVDA 2YICA 3KCXA 5BR8B 4L87A 4NTYA 4W4KA 4DO2A 3K5LA 4GKJB 1HR0B 3CSXA 3J7AU 2KG7A 1N32B 3A0BZ 1BT8A 1Z5VA 4LP8A 4YJ3A 3RYCA 1YTFB 2AZ2A 1YDXA 2P06A 2ZIMA 3JAKB 3LSQA 1QR9A 2G38A 1L8DA 3LDEA 4F4LA
chains in the Genus database with same CATH topology
1NTKH 2BCCH 1BGYH 3H1LH 4D6TH 3CXHF 1SQBH 3H1IH 3L75H 1L0LH 1BE3H 2IBZH 1SQVH 1KYOF 1NU1H 1SQXH 3L71H 5KLVH 1L0NH 1SQQH 3TGUH 4U3FH 1P84F 3H1KH 3L74H 3CX5F 1KB9F 1SQPH 3L72H 1NTMH 2FYUH 3H1JH 1BCCH 4PD4F 3CWBH 3H1HH 1PPJH 2A06H 1NTZH 3BCCH 3L73H 3L70H 1PP9H 1EZVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK H;  2BCC H;  1BGY H;  3H1L H;  4D6T H;  3CXH F;  1SQB H;  3H1I H;  3L75 H;  1L0L H;  1BE3 H;  2IBZ H;  1SQV H;  1KYO F;  1NU1 H;  1SQX H;  3L71 H;  5KLV H;  1L0N H;  1SQQ H;  3TGU H;  4U3F H;  1P84 F;  3H1K H;  3L74 H;  3CX5 F;  1KB9 F;  1SQP H;  3L72 H;  1NTM H;  2FYU H;  3H1J H;  1BCC H;  4PD4 F;  3CWB H;  3H1H H;  1PPJ H;  2A06 H;  1NTZ H;  3BCC H;  3L73 H;  3L70 H;  1PP9 H;  1EZV H; 
#chains in the Genus database with same CATH topology
 3UT5 B;  2ZXW C;  4TSF G;  1K4C C;  4IIJ B;  4DV4 B;  4H13 B;  2X0L A;  1THZ A;  1XNR B;  4GX5 A;  4DV4 O;  4BWA A;  2WSS G;  2GUZ B;  4MVO A;  1N8R W;  3CCJ V;  4JGS A;  1R3I C;  1ROP A;  4X66 B;  1GM9 A;  1WN7 A;  3K04 A;  4U7O A;  5TIS Z;  3LNM B;  2UXB B;  1Q3E A;  3CRC A;  4NXM B;  4J9Z B;  1M1K W;  1B3Q A;  1KYO F;  4DV0 O;  1XHZ A;  4EFE A;  3ZJZ A;  4DR4 B;  4J7J A;  4Z1M G;  5FNV B;  1D2D A;  1CPY A;  4JI6 B;  2UUC B;  2WA4 A;  2OTJ V;  2OTL V;  4LF8 O;  2Q67 A;  2LGQ A;  3KCY A;  1KKC A;  2WLL A;  5J2T A;  1H2G A;  5AG2 A;  3P3N A;  4DR2 B;  3TXS A;  4WFH A;  2BOC C;  3QNE A;  3B8N A;  3FB7 C;  2N04 A;  5F2V O;  1IBM B;  1UPG A;  1ZSP A;  2ATK C;  4Z2W A;  5KHK A;  5CBH A;  3FX7 A;  4I55 B;  4OPA A;  3F7Y C;  5K1P A;  2XAQ A;  4QIW F;  4I5S A;  4AHC A;  2UUA B;  5B3S C;  1SER A;  1IUR A;  4JTC B;  5HFM A;  4FLX A;  1D5A A;  4JPR A;  1RM1 B;  5EZY A;  4TV8 B;  2R9I A;  3CJH A;  2DW4 A;  1ZUQ A;  4X66 O;  4JZ2 A;  3CC4 V;  3CE2 A;  2CTR A;  2BTQ A;  1NH2 B;  5KHJ A;  2NN4 A;  3WB1 A;  3CPW U;  1XNR O;  3J80 N;  5KAF Z;  2QWP B;  4DR6 O;  3CJH B;  3L73 H;  4UV8 A;  5B5E Z;  4I4T B;  3DTU B;  1EZV H;  4OX9 B;  2DYR C;  5CA1 A;  1JOY A;  1Q6I A;  3SPH A;  4JTD B;  5D5P A;  4GLX A;  4DK1 A;  1HNW B;  3TGU H;  3E2E A;  2EJR A;  1F51 A;  2ZIN A;  3HKC A;  1N32 O;  5H6Q A;  2UU9 B;  4I4T A;  1YEW A;  1XL6 A;  1VQO V;  3QF7 A;  5GON A;  4AIL C;  2QTS A;  4DV5 B;  1K73 W;  4LFB O;  1PNL A;  2QKA A;  4O2B A;  5H5N A;  1M90 W;  2F66 C;  4B3T O;  4JI0 B;  3TCU A;  4HYO A;  4QE7 A;  3O65 A;  3W7W A;  1HNZ O;  3J81 N;  3AG2 C;  3T4D A;  5BXZ A;  5GON B;  4J11 A;  4PA6 A;  1SET A;  3LSS A;  4R6Z A;  2A7W A;  1CP9 A;  2PI4 A;  1NTZ H;  2P7T C;  3OEE G;  3G80 A;  3JAR B;  1K9M W;  2JK5 C;  4CS4 A;  4PEL A;  2CDY A;  3QO5 A;  1UFI A;  5C8Y B;  4RUE A;  3ZRW B;  1FAF A;  1K3E A;  4CZZ A;  3RYF B;  2R9A A;  1OCC B;  1R1B A;  2IU0 A;  4B7E A;  1KU9 A;  1DLB A;  1F23 A;  3STL C;  1XL4 A;  1KC8 W;  4B3R O;  3X2Q C;  2F43 G;  2PI5 A;  2XTA A;  3MDS A;  4O4H A;  1KEC A;  1EZJ A;  3APO A;  1YI2 V;  2ZE7 A;  3ZMU A;  5J2T B;  3KKY A;  3CME V;  3OW2 U;  5H2F Z;  1OZ0 A;  3EHB B;  1SKV A;  3SJB C;  2WLJ A;  1Q7Y W;  2E3C A;  5IE9 A;  1LUV A;  3FYI B;  3U10 A;  2YIB A;  1PPJ H;  3QTC A;  4G28 B;  2ZCE A;  4MTX A;  2AXT Z;  3JAW A;  4YXW G;  3ZX6 A;  2UU9 O;  4LR3 A;  4WFG A;  4JI6 O;  3JD3 A;  5CA3 A;  1S77 D;  1Y76 B;  4FFB A;  4JI3 B;  1WP8 A;  2HJF C;  3ASN C;  2Q7H A;  2QM8 A;  1AI7 A;  1J5E O;  2LO1 A;  2XAF A;  1YZB A;  3N2K A;  5DEC A;  1HNZ B;  2Q73 A;  4ZOL B;  3M8A A;  1S76 D;  1MSW D;  4TT3 G;  3NR7 A;  1P7B A;  3K79 A;  2ZE6 A;  2LFS A;  4LWS A;  1VQL V;  3Q4H B;  4PDV A;  3K5O A;  4Q6G A;  5LHI A;  1I7F A;  1P7G A;  2WAM A;  3D3I A;  4LF7 B;  1H2M A;  3CEI A;  3E35 A;  1N4C A;  3HPL C;  5JCO A;  4FPP A;  1WB8 A;  2ZKO A;  2F1M A;  2ZT9 B;  5LHG A;  1EN6 A;  1AP5 A;  2Y69 C;  1NTK H;  1PNK A;  3JD1 A;  2EJ7 A;  2DN9 A;  2X6A A;  3LNN A;  1NVP B;  1M4U A;  1GO3 F;  2IW5 A;  3OEH G;  5L3E A;  2EIN C;  4TWK A;  3CCE V;  3JCU Z;  4NTW A;  4IGG A;  1F4N A;  5JVD A;  1O9G A;  5LXT B;  4IYH A;  2XOK G;  2F23 A;  4I50 B;  3AG7 A;  3CCQ V;  1ARO P;  5EIB C;  2V1D A;  3U11 A;  1Z5W A;  4PA3 A;  4DV6 B;  5E79 Z;  3ABM B;  1EFR G;  5JJE B;  1R6K A;  4PA4 A;  5FPO A;  2LGW A;  3WU2 Z;  2LW7 A;  2B1G A;  5LXT A;  3B4S A;  2BSK B;  2PF4 E;  4I9Q A;  2VQE B;  5LP6 B;  1S3J A;  3SYP A;  3WB0 A;  2W6I G;  4XDL A;  2B1I A;  3JYC A;  1JR9 A;  3ABL B;  5IYZ B;  4X1Y A;  4LFC B;  4EEQ A;  1KQS U;  3ABK C;  2HLD G;  4DYL A;  3IFX A;  2QEX V;  1Q5O A;  1PV0 A;  3WG7 B;  4GZR B;  2DYS C;  3SJQ C;  4EFB A;  2HHH B;  2UUC O;  1GKF A;  3K3W A;  1Q43 A;  5L3C A;  5L3B A;  5IYZ A;  2YS8 A;  4LH7 A;  3P3P A;  5LL6 Y;  4QNH B;  4F6E A;  3W7X A;  5EC1 C;  4LF5 O;  3VQV A;  1HNW O;  4GYC B;  5DN6 G;  1VQ9 V;  1DF5 A;  4MW8 A;  4JV5 O;  4WBN B;  4OPH A;  3IC9 A;  4Z1V A;  1S5J A;  3E8G A;  4WF9 V;  4KHP B;  1FS0 G;  4ZHQ B;  2GBO A;  4DR6 B;  5JH7 B;  4R7C A;  2HVJ C;  1XHX A;  2VS0 A;  1FFX A;  2UUB B;  1RP3 B;  1JPX A;  1JX9 A;  2E75 B;  3JAT A;  1YJW V;  2ZNJ A;  3GWO A;  3G4S V;  3B77 A;  4Q20 A;  1DK1 A;  3ZMZ A;  4GX1 A;  3TK1 A;  4FM2 A;  3CXC U;  4WFB V;  4D7T A;  3AK2 A;  3CCS V;  2P90 A;  4BAY A;  1URF A;  1N33 O;  3TJT A;  1JVM A;  4YJ3 B;  4QPJ A;  1N36 B;  4X9Q A;  1NH2 D;  5CMU A;  1J95 A;  3ZED A;  4UCS A;  1WPX A;  2NNU A;  5LOV A;  4JAU A;  1AVM A;  5H6R A;  3G67 A;  2UXD B;  4DR2 O;  1XQ8 A;  1GM8 A;  3A0H Z;  3HKC B;  3M99 B;  3UKM A;  3SYQ A;  1VQ8 V;  1NQT A;  2Q7G A;  2QWN B;  2XUM A;  1VQ5 V;  5IJ9 A;  1FFT B;  3JSL A;  2L6L A;  4LF8 B;  3ETQ A;  4MVR A;  4JI1 B;  1RSO A;  1TUB B;  2JGD B;  1WPB A;  1N34 B;  4TOI A;  2AGA A;  2XND G;  2F95 B;  4DR3 O;  1FXH A;  4DV0 B;  4DRX A;  3QG5 A;  3CC7 V;  4ZIB A;  2Q0A A;  3ASN B;  3E86 A;  4JI4 B;  4O2A B;  1XMQ O;  2M7W A;  2GHY A;  1WA8 B;  3D3Q A;  1NJI W;  1IVS A;  1SRY A;  5CB4 B;  4FK5 C;  1M56 C;  4CC5 A;  2Z0A A;  1XMQ B;  3UCS C;  4X1I A;  4DXW A;  3K5M A;  2LW1 A;  4CS3 A;  1KKD A;  2ETN A;  4NR1 A;  3CD6 V;  2EIL B;  1K34 A;  4O4J B;  3ZRS A;  4JI8 B;  1WA8 A;  2PUS A;  4QGP A;  1M9N A;  2Q7E A;  2EIK B;  2ZDI A;  2Z5U A;  3BRC A;  5H9C A;  5JCO C;  1BQ0 A;  4X1I B;  3IGA C;  1TVK B;  1OCZ C;  4TQF A;  4FM1 A;  5FL7 G;  2QDO A;  3NXS A;  3BFR A;  3W7S A;  1V55 C;  4JI1 O;  4IHJ B;  4JI7 B;  5FPR A;  2Z3Y A;  1I94 B;  1QCE A;  1W0K G;  4R50 A;  3VQY A;  3MD0 A;  1WP7 A;  1XBL A;  1QNM A;  2B5U A;  2YDE A;  3S3W A;  4AQY B;  3T4Z A;  2K1E A;  4ZBM A;  2R72 A;  4FLW A;  1GN4 A;  5DM6 V;  1XMO B;  3MHH C;  1BHB A;  1FJG O;  1E1Q G;  2QM4 A;  2CAZ C;  4LFA O;  4FFK A;  2EIN B;  2CGO A;  2HJD A;  5IYC O;  1VQM V;  2E5L O;  3RN4 A;  4UVB A;  4C7U A;  1US6 A;  5JQG B;  3IAY A;  2IJJ A;  4FZ1 A;  2ZE8 A;  5CA0 A;  2ARH A;  4JTA B;  1EN4 A;  4JZG A;  1Y74 A;  1BSM A;  3ZHQ A;  5JJJ B;  3G71 V;  4EB6 B;  4YJ2 B;  5EC2 C;  4ASU G;  3C90 A;  5J2U A;  3JAS B;  5LGU A;  2DE0 X;  1PNM A;  5KMG B;  1VQ6 V;  2ZDI C;  3OT7 A;  1XMO O;  5LP6 C;  2OCH A;  2ZR3 A;  1H2S B;  1FJG B;  1YHQ V;  1MSD A;  3CRR A;  1DGS A;  4PI2 A;  1Q6U A;  1RPO A;  3ABK B;  1X59 A;  1O9H A;  3K03 A;  4LF7 O;  2ZD9 A;  4KUM A;  1AR1 B;  1V54 B;  3CCU V;  2QGN A;  4ZOL A;  4GKK O;  1XRE A;  3FKS G;  1TA8 A;  3L74 H;  4A5U B;  4MTO A;  2FYU H;  4X8A A;  4PD4 F;  1XDC A;  1I5X A;  3ZRW A;  4MVQ A;  1NKD A;  2UXN A;  1R73 A;  2BCC H;  1NR1 A;  5BY1 A;  4O4I B;  3CS5 A;  4O2B B;  4GKK B;  2CK3 G;  2O57 A;  3I5D A;  1NI8 A;  2QM7 A;  4UXN A;  3SJC C;  2YEV B;  1JFF B;  2UXC B;  4DR7 O;  3KZI Z;  2JS5 A;  3AK1 A;  3BVO A;  4UCT A;  3FAV A;  1RM1 C;  1I08 A;  4JYY A;  2OWO A;  3UQ8 A;  4JAV A;  3TET A;  3SGI A;  2Q6A A;  4JI2 B;  2DQ0 A;  2HEP A;  3C3S A;  3N2G B;  1Q8I A;  1N34 O;  2XAJ A;  3GVM A;  5LP6 A;  4I7Z B;  1Q86 W;  1LR1 A;  3R66 A;  5LA6 B;  3JD2 A;  2JGU A;  2Y69 B;  3CRQ A;  5B66 Z;  2CH7 A;  1F4M A;  5IWA B;  4X65 B;  2YI8 A;  3CXH F;  1H2K A;  4I50 A;  2FB5 A;  1GH6 A;  2RQ6 A;  1KD1 W;  3UO2 A;  1S0V A;  5D5Q A;  4BIZ A;  1GAX A;  1G1X B;  2PZS A;  1PKX A;  1FD9 A;  2X6B A;  1SQG A;  4I0X A;  5FNV A;  1AI5 A;  1F7Y A;  5KAI Z;  4UCR A;  1VAR A;  4B3M B;  3AK3 A;  1GMG A;  3JAL B;  3KG2 A;  1G6U A;  4NXM O;  2YIB D;  4JI7 O;  2NLJ C;  4UUJ C;  5JH7 A;  1VQ7 V;  1BCC H;  3CWB H;  3OD4 A;  2HR3 A;  3BCC H;  1N33 B;  1OCO C;  1R6N A;  3JD0 A;  4PJ0 Z;  3ABL C;  3CYO A;  2QKC A;  3H1I H;  2DYS B;  2LQT A;  2RJZ A;  3DC6 A;  4L8J A;  2ZIO A;  3RYI B;  3E8F A;  2YIA A;  4KHP O;  1M56 B;  4DV5 O;  3X2Q B;  1AJN A;  4WBN A;  2AZ0 A;  4MT8 A;  5IY5 B;  1IXM A;  1SF9 A;  1AB3 A;  4QPK A;  5KHH A;  3JSN A;  4JI4 O;  2V7Q G;  1J5E B;  3RYI A;  4LCU C;  1NVP D;  1GN3 A;  1QVG U;  1JJ2 U;  2YUA A;  1AR4 A;  4UVC A;  1I0H A;  4GKJ O;  2KG7 B;  4RWU A;  2BE3 A;  3K08 A;  4KL1 A;  4DV3 O;  2BTQ B;  4K8Z A;  1MOF A;  3QVN A;  4X64 O;  2IM9 A;  3T1Y B;  1JQ0 A;  4O4I A;  1VIB A;  3JAK A;  1IDS A;  2VRZ A;  4CBC A;  3ABT A;  4DR5 O;  2CTW A;  4J9Y B;  1SQB H;  1VQN V;  3VQX A;  3SYC A;  2E76 B;  4U3J A;  3CRM A;  2P4K A;  4CH4 A;  4ZI7 A;  3UT5 A;  4GUN A;  2HHH O;  1DF4 A;  2OIE A;  2DJV A;  2A0L A;  3HR0 A;  3H1K H;  3ZMT A;  1COW G;  2QTO A;  2K9P A;  4X89 A;  2ITD C;  3UM7 A;  3BA8 A;  1LNQ A;  2HP8 A;  4PDL A;  4F6R B;  4KP4 A;  4DRX B;  3ZCC A;  4MTG A;  5LOV B;  1VF5 B;  3OE7 G;  1Y4M A;  4B3R B;  1SQV H;  2JJ2 G;  2PYJ A;  1WB7 A;  4CC6 A;  1OCR B;  4DUY O;  1LUW A;  4E4E A;  4O4L A;  2CH7 B;  1S5L Z;  4OXS A;  5L3D A;  4LF6 B;  3G6E V;  3ZHV A;  2ZM6 B;  2IH3 C;  3D36 C;  3TXQ A;  4LF4 B;  4BW9 A;  3K0D A;  1OV9 A;  2QSA A;  2X6C A;  2E5L B;  2B9Z A;  3JAR A;  1IX9 A;  1VEW A;  3BPZ A;  2HKO A;  4CS2 A;  4JI0 O;  2V4D A;  2QWO B;  2P5O A;  3E22 A;  1XI1 A;  3T2M A;  4ZHQ A;  3U0Z A;  2OIG A;  3ZHS A;  1R3J C;  2WLL B;  4G2K A;  4YHH B;  2IU3 A;  1K92 A;  1KP3 A;  3RBZ A;  5DED A;  2W0X A;  1H2N A;  2WLH A;  1H2L A;  1YVW A;  4O4H B;  4GT1 A;  5KA6 A;  2M6Y A;  4H37 A;  1YSC A;  3GB7 C;  2MW2 B;  4TQD A;  2Q0O C;  1YIT V;  4JI5 O;  5KHI A;  2WLI B;  3UO3 A;  2ADQ B;  4MSW C;  3L72 H;  1G4Y B;  1E1R G;  2YXY A;  3B40 A;  1TAE A;  5LYJ A;  3F7V C;  3HKB A;  2WA3 A;  1BGY H;  2PTM A;  2QE7 G;  1KMI Z;  2EIL C;  4JYB A;  3SYO A;  3O9O A;  3ABM C;  5EZY B;  4DUZ B;  2QWR B;  5KUM A;  1XNQ O;  4DV1 O;  2PGG A;  4DV2 O;  2OCC C;  3HKE A;  1GM7 A;  1SZX A;  1SQF A;  1OCZ B;  5LYJ B;  4LNU B;  3PJS K;  5J2U B;  2ADP A;  2QWQ B;  2W0F C;  3OUS A;  3AG4 C;  4NXN B;  4MW3 A;  3G6B A;  4BR6 A;  4HNA B;  1VMG A;  3IJ4 A;  3MAQ A;  2YXL A;  1ZLZ A;  2WLM A;  3L71 H;  4XDK A;  2A3Q A;  1S72 V;  2EIM C;  2JGD A;  2GSM B;  1P4R A;  2Y0P A;  1G8M A;  5J9P C;  4TV8 A;  1VF7 A;  1S5H C;  2L35 A;  2Q68 A;  1AP6 A;  2VWJ A;  4YHH O;  5CA0 B;  4O2A A;  4DR1 O;  5IJ0 B;  1FYJ A;  3DXR B;  5E1A C;  2ZM6 O;  2H94 A;  3OAA G;  1T5E A;  2EIK C;  4RQF A;  1FPO A;  1QR8 A;  2IJI A;  1IZ3 A;  3ETE A;  1Y67 A;  3S3X A;  1BMF G;  4EKW A;  3T1Y O;  3T1H B;  3LUT B;  4FLU A;  1V55 B;  3CCR V;  2IJH A;  1BE3 H;  1ORQ C;  4DV3 B;  4BIU A;  1ZX3 A;  1H38 A;  2N74 A;  3E8B A;  4IT5 A;  3WFV A;  1PL4 A;  5KX5 A;  3RFR A;  5LHH A;  1D5N A;  2W6J G;  4K35 A;  2QJ1 A;  4ICG A;  3K0G A;  1OCO B;  4QE9 A;  3AG1 B;  2JEX A;  4GX2 A;  3OR7 C;  3FB6 C;  1IBK B;  1R3K C;  3F5W C;  3MHS C;  4TUY B;  4DV2 B;  1IXB A;  3CMA V;  3ZRV A;  1V54 C;  4LC1 A;  3SYA A;  3OGC C;  1HW7 A;  1FKA O;  3EXA A;  2F4V O;  5LA6 A;  1P84 F;  3N27 A;  4NVP A;  4FIP C;  1XNQ B;  1BZK A;  4O4J A;  4MVU A;  4TV9 B;  1MAB G;  4XBF A;  4UCO A;  3H1H H;  1IBK O;  1JFF A;  4X64 B;  1TVK A;  3OTO O;  2Y48 A;  1MMM A;  1QLN A;  1YCI A;  1R6T A;  5B1A C;  3CCM V;  4FZ0 A;  4IYI A;  3CCV V;  3B2E E;  4XDJ A;  4X1Y B;  3AG3 C;  4LH6 A;  2PY5 A;  1U96 A;  1CEZ A;  1HP8 A;  3I55 V;  3SPJ A;  5EK0 A;  2AW9 A;  2JDI G;  4K3A A;  3N2K B;  1Q81 W;  4LF9 B;  3ZHT A;  2FML A;  5BMV B;  1QLE C;  2IJK A;  4HBN A;  5JWP A;  1SES A;  4U3F H;  5B1B B;  2RMK B;  4LFC O;  3DSQ A;  3E89 A;  4LF4 O;  1MZE A;  3OUF A;  1GRJ A;  3K58 A;  1B6Q A;  3ZBH A;  5JQG A;  2FTK A;  3A0R A;  2VQE O;  1VQ4 V;  4HNA A;  4UB6 Z;  1RFY A;  4J41 A;  4LF6 O;  2DWE C;  1Y74 B;  1JA8 A;  3D36 A;  1GK9 A;  4P30 A;  1M93 A;  4YJ2 A;  2QA4 V;  1RPR A;  2OT5 A;  4P2Z A;  1IBM O;  4LFA B;  1SQQ H;  4H0L B;  1K7D A;  1NBM G;  3LDC A;  2XAH A;  4NTX A;  5EYP A;  1ZL8 B;  4X20 A;  3ZMV A;  3H1L H;  2JS3 A;  4YIO A;  2CTP A;  2XT9 A;  3P30 A;  4UB8 Z;  1CXZ B;  3ZN1 A;  2F93 B;  2CGN A;  3THO A;  4DUZ O;  5HFL A;  1AJQ A;  5KUK A;  5IWA O;  1MNG A;  1K97 A;  3VOU A;  4DW1 A;  2EBO A;  2WLN A;  1GTO A;  4ZI7 B;  2KKW A;  1VQP V;  5L3G A;  3W7U A;  3ASO B;  4PV1 B;  3RVZ A;  1EM1 A;  1BQZ A;  1ENV A;  1K5S A;  3R65 A;  4NXN O;  4JI2 O;  1M57 C;  2EIJ C;  1XIL A;  2UXB O;  2X7R B;  1MZF A;  2YEV A;  5CBG A;  4FMT A;  3OTO B;  4TUY A;  2EZP A;  3JD4 A;  3JCZ A;  5IY5 C;  1ZWI C;  4J42 A;  4PDR A;  4DR7 B;  2ILM A;  2BTO A;  3BHP A;  2ZNI A;  3K9S A;  3LSU A;  4DV1 B;  3EFF K;  5GW7 A;  1PM9 A;  4PI0 A;  2F4V B;  5LBQ A;  2GUZ A;  2RDC A;  4N23 A;  2LP7 A;  3BEH A;  1N0N A;  4TV9 A;  1K8A W;  4DR3 B;  3K59 A;  5B3S B;  3E83 A;  5EIB D;  5IYB O;  2WLK A;  1Y66 A;  5FLX N;  2FKX A;  5CBF A;  1W0J G;  3RYC B;  1SA0 A;  1W59 A;  1DTO A;  3A2F A;  3AG4 B;  3JAL A;  5CB4 A;  2Y4T A;  4X1K B;  4B08 A;  2UUA O;  4WFF A;  3E22 B;  3LDD A;  2EUL A;  3ZIA G;  4JYA O;  5LMN O;  4UV9 A;  3JAW B;  4OGQ B;  1IBL B;  1EBO A;  3BY6 A;  2JJ1 G;  2WWW A;  2EX3 A;  2LFR A;  4J80 A;  2ZXW B;  4MVZ A;  4O4L B;  2DYR B;  5IYD O;  3GWK C;  3K06 A;  4K8X A;  2P67 A;  1TUE B;  1AI6 A;  3CCL V;  3F5T A;  1KBH A;  4DW0 A;  1OCR C;  3APQ A;  1KP2 A;  4E2L A;  1YXB A;  2OYQ A;  1GN2 A;  5ITZ A;  1WNS A;  1QBZ A;  3BAA A;  3ZHR A;  4FLY A;  1AIL A;  3CC2 V;  4DR5 B;  1MA1 A;  4RO2 A;  3AEI A;  1WLE A;  2Y4U A;  2CUG A;  4YY3 B;  3C3T A;  2CTQ A;  4J7K A;  1NS1 A;  1JJO A;  4AI8 A;  4X62 O;  4J10 A;  3Q4H A;  3RWR D;  1BS3 A;  2KB1 A;  3HKD A;  1SQP H;  1E79 G;  3CB2 A;  3SPC A;  1YJ9 V;  3L9D A;  2UXC O;  3JAT B;  5IT9 N;  3FD9 A;  5C93 A;  2XHB A;  4JV5 B;  1BL8 A;  1OCC C;  3HKB B;  3PN1 A;  1WAZ A;  1NU1 H;  3H9V A;  3HKD B;  4MS2 A;  1ZAU A;  4B3S B;  3HB3 B;  1JCH A;  2E74 B;  4B3T B;  1FXV A;  4MVS A;  2JRI A;  3RYH B;  4LFB B;  2QR4 A;  1XUQ A;  1SS3 A;  4MTF A;  4HZ3 A;  1K33 A;  2WPD G;  1FXK C;  1VQK V;  4X88 A;  1HDJ A;  4K0K O;  4HAM A;  4B3S O;  4PHZ A;  4JI8 O;  4FLZ A;  3EVK A;  2IBZ H;  1SQX H;  5KHG A;  4U3J B;  2H3O A;  1VP7 A;  2ITC C;  1R3L C;  2P22 C;  1HR0 O;  4GX0 A;  1KB9 F;  4D7S A;  4J7Z A;  3I56 V;  4OX9 O;  2EZO A;  1MG1 A;  1PD3 A;  1VF6 A;  1Q6H A;  4RQE A;  1YF2 A;  1W2B U;  1XEQ A;  1KUQ A;  1H8E G;  1QLE B;  2Q4P A;  3ZMS A;  3FB8 C;  5KX5 B;  3DGE A;  2P6J A;  2VQF O;  4PA7 A;  5IJ9 B;  1AJP A;  2FL4 A;  5KA5 A;  2H8P C;  2IH1 C;  5LMU O;  1HNX O;  4JF3 A;  4X65 O;  5IJ0 A;  4JAA A;  1X4T A;  5B1N A;  1A32 A;  4ABM A;  3ZS8 C;  4CH3 A;  3FFQ A;  5JJN B;  2YI9 A;  4DUY B;  2JIZ G;  4KXR A;  4H44 B;  3SPI A;  3FAV B;  4YIP A;  4BIO A;  2A9H A;  4LF9 O;  5L3F A;  5LGN A;  1JMK C;  4NKG B;  1L1F A;  1Q82 W;  1SC5 B;  2R9R B;  5EBL C;  1IBL O;  1QQC A;  4CH5 A;  1YTF D;  3CP1 A;  3HKE B;  4JYC A;  5EBW C;  3AG2 B;  3ZHU A;  3VQW A;  1I94 O;  1NT2 B;  4DK0 A;  3AG1 C;  3T1C A;  1Q90 D;  3H1J H;  1OJH A;  2WLI A;  3OMA B;  1VF6 C;  2EIM B;  4K0K B;  1Y6X A;  1HWY A;  1NZ6 A;  2QKS A;  3SDL A;  3L75 H;  4DR4 O;  1L0L H;  3D8C A;  1M57 B;  2EIJ B;  3OR6 C;  5B1O A;  3K9A A;  2RCV A;  2YXH A;  3QO8 A;  3WB2 A;  4P9O A;  5A9G A;  3SPG A;  2DQ3 A;  5CA1 B;  2JEU A;  3B09 A;  2A06 H;  2ZE5 A;  5CN0 A;  4LNU A;  4ZKI A;  4PA9 A;  2ODM A;  1QU7 A;  2YID A;  4JI3 O;  1YJN V;  5GTH Z;  2Y0I A;  3BAB A;  2Q5Z A;  2XAG A;  1SZT A;  5EYP B;  1OHH G;  3OTF A;  3FYE B;  4LWS B;  4YY3 O;  4X62 B;  4RAI A;  1Y76 A;  2HVK C;  2Q69 A;  4MVM A;  2GV9 A;  5GTI Z;  2DOS A;  4D6T H;  5KMG A;  2GTA A;  2C2A A;  4UCU A;  3K57 A;  3SJA C;  1AR5 A;  3ZRX A;  1GN6 A;  3ML0 A;  5B1B C;  2ZQM A;  3WG7 C;  3OMN B;  4JAS A;  3RW0 A;  4B3M O;  2D3O W;  3QO7 A;  1RSO B;  1TUB A;  4W4L A;  4UCV A;  1N0J A;  3DXR A;  2YC0 A;  5BR8 O;  3L70 H;  1PP9 H;  3M7M X;  3RYF A;  4G27 B;  1ZL8 A;  2Q9L A;  4H33 A;  4AQY O;  5A2Q N;  2AHY A;  4X20 B;  2HFE C;  3OFN G;  4DV7 O;  2DWD C;  5JVD B;  4JYA B;  3B8M A;  1ZTE A;  2OCC B;  4KFM A;  4GCZ A;  4FLV A;  4RUF A;  1B06 A;  3VBB A;  3AG3 B;  1EN5 A;  1HNX B;  5LMU B;  3OM3 B;  4CH6 A;  2UXX A;  2MK3 A;  5BZB A;  4N21 A;  1TGO A;  2A79 B;  1P49 A;  1YIJ V;  3ETG A;  3ETD A;  4F6R A;  5C8Y A;  1UJW B;  4FM0 A;  4UFZ A;  3STZ C;  2P4V A;  4FVM A;  1PL0 A;  1M5I A;  4IIJ A;  3K5N A;  2VQF B;  1BHA A;  4WCE V;  3RT3 C;  3CX5 F;  1SA0 B;  1NTM H;  4UVA A;  1B04 A;  1K5Q A;  1NR7 A;  4IHJ A;  2UUB O;  3FB5 C;  4R8C A;  4X1K A;  3SR2 C;  2DMX A;  5BMV A;  4QJF B;  1Z2G A;  2AHZ A;  4FFB B;  1FXK A;  1AI4 A;  3N2G A;  4JI5 B;  2PYL A;  3P32 A;  2VWK A;  2KSD A;  4I9W A;  2KQX A;  4LF5 B;  1QVF U;  4WFA V;  1L0N H;  4PDM A;  4U7N A;  1XOU A;  3DC5 A;  2BSK A;  3RGB A;  4BW5 A;  1FXK B;  1QHT A;  3ZN0 A;  4FLT A;  2RN9 A;  3ABU A;  4P9P A;  3IC7 A;  5ITZ B;  4B7K A;  3ICX A;  2HG5 C;  2XAS A;  2BOB C;  3CRA A;  1U97 A;  2CE4 A;  1V9P A;  2YSU B;  3OMI B;  2UXD O;  4I0X B;  4LBE C;  4EB6 A;  2R70 A;  3JAS A;  2GTS A;  2RNB A;  3BA9 A;  4FJC C;  4IL6 Z;  5IDJ A;  2Q8V A;  3ASO C;  4DV6 O;  5LGT A;  5KLV H;  1N36 O;  3T1H O;  4I55 A;  4NB5 A;  2N05 A;  2GDS A;  1H8H G;  2ZR2 A;  3JAM N;  4NYK A;  2LJ2 A;  5K1X A;  3H01 A;  4DR1 B;  1K4D C;  1FFX B;  5B1A B;  3RYH A;  3W7T A;  4DV7 B;  3OGI B;  3E8H A;  3RVY A;  5EBM C;  2NR5 A;  1I5Y A;  3A8T A;  4WFE A;  1WJZ A;  2D2C B;  5LMN B;  3CHX A;  2JVD A;  2YIC A;  3KCX A;  5BR8 B;  4L87 A;  4NTY A;  4W4K A;  4DO2 A;  3K5L A;  4GKJ B;  1HR0 B;  3CSX A;  3J7A U;  2KG7 A;  1N32 B;  3A0B Z;  1BT8 A;  1Z5V A;  4LP8 A;  4YJ3 A;  3RYC A;  1YTF B;  2AZ2 A;  1YDX A;  2P06 A;  2ZIM A;  3JAK B;  3LSQ A;  1QR9 A;  2G38 A;  1L8D A;  3LDE A;  4F4L A; 
#chains in the Genus database with same CATH homology
 1NTK H;  2BCC H;  1BGY H;  3H1L H;  4D6T H;  3CXH F;  1SQB H;  3H1I H;  3L75 H;  1L0L H;  1BE3 H;  2IBZ H;  1SQV H;  1KYO F;  1NU1 H;  1SQX H;  3L71 H;  5KLV H;  1L0N H;  1SQQ H;  3TGU H;  4U3F H;  1P84 F;  3H1K H;  3L74 H;  3CX5 F;  1KB9 F;  1SQP H;  3L72 H;  1NTM H;  2FYU H;  3H1J H;  1BCC H;  4PD4 F;  3CWB H;  3H1H H;  1PPJ H;  2A06 H;  1NTZ H;  3BCC H;  3L73 H;  3L70 H;  1PP9 H;  1EZV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...