1BGYH

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 64
sequence length 64
chains with identical sequence T
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bgyH00
4PD4F 1KB9F 3H1KH 3L74H 3L71H 3L75H 1SQPH 1SQVH 1SQXH 3CXHF 3H1LH 1BGYH 2IBZH 5KLVH 3CWBH 4U3FH 1NTZH 1BCCH 1P84F 3TGUH 1EZVH 3CX5F 2FYUH 1L0LH 1PPJH 3L73H 3H1JH 1NTKH 4D6TH 2BCCH 3H1HH 1BE3H 1NTMH 1L0NH 3L70H 3BCCH 1NU1H 1KYOF 1SQBH 3H1IH 1SQQH 1PP9H 2A06H 3L72H
chains in the Genus database with same CATH superfamily
1P7GA 2PF4E 1AROP 1N0JA 5CBHA 1DF4A 2WLMA 1IBKO 4KHPB 3P3NA 2DE0X 2Q0AA 2DYSC 3QG5A 2V7QG 1K7DA 3H1JH 2VWKA 3JD0A 3R65A 2GUZA 4DR7B 2WLKA 4LF6O 3PN1A 2CTRA 3AK2A 5CA0B 4IGGA 3UM7A 3W7TA 2UUBO 3D3QA 4B3TO 3N2KA 1HR0O 2BSKA 2Y0PA 1YI2V 2OCCC 1NJIW 1R6NA 2C2AA 5D5QA 4MSWC 4DRXB 3E89A 1OCCC 1FFTB 3ZRVA 1BHAA 3LDCA 4X65B 2JIZG 1MABG 2EX3A 2EIMC 1MZEA 5LHHA 1Q6IA 5BMVA 1LR1A 1X4TA 3RYIA 2PYLA 3LDEA 1I7FA 3KCXA 3VQYA 3ML0A 4O2BB 1YITV 5L3DA 2JGUA 1ZLZA 2ZQMA 5J9PC 3UT5B 3OMAB 4P9PA 4LF4O 3HKBB 3HKEB 2AW9A 4WFGA 2JGDA 4D6TH 1E79G 5E1AC 3ZMUA 2JDIG 2QSAA 1KYOF 3HKCB 2ZE8A 5JH7B 4DXWA 3W7WA 3CCSV 4J41A 1ZL8A 3MDSA 3L75H 4IT5A 3N27A 4EB6A 3CWBH 4P30A 1MSDA 3FFQA 3A0HZ 3K5NA 3HKDB 4PV1B 2HHHB 3K0GA 2F1MA 5JCOA 3A0BZ 4MW8A 5IJ0A 1WA8B 3CCVV 4DR6O 4KL1A 2PGGA 4PDVA 3E83A 3ZBHA 3EHBB 4PDRA 3K5MA 4YIPA 2P4VA 4O2AB 2F4VO 4JGSA 4BR6A 5J2UA 1F4MA 4UXNA 4WFFA 2ZT9B 3UKMA 5B3SC 2F43G 3FB8C 2HP8A 1H38A 4I50A 5JJEB 5LHGA 1Q5OA 4DW1A 4P9OA 3RYFA 4FIPC 5CMUA 3X2QB 1Z5VA 3CRCA 1AR5A 4DV1B 1CP9A 2RNBA 4PHZA 3CRAA 1Y76A 1S77D 3RYHA 3FB7C 5L3FA 4RUFA 1XL4A 2IU0A 4O4HB 2F95B 2DWDC 1WPBA 4A5UB 3L71H 3WU2Z 3ABLB 5JQGB 2LFRA 3UO3A 2UXCO 4FVMA 5C8YB 2IBZH 1V55C 1FPOA 4TQFA 1XHZA 3K5OA 2NN4A 2OT5A 4IYIA 1M1KW 4O4JB 4HNAA 4JV5O 3LSQA 2VQEO 3SJQC 1BS3A 3DXRB 2XAHA 1FKAO 4EEQA 2YIBD 3SPJA 1XEQA 5CA0A 4UCOA 3CP1A 4B7EA 3BRCA 3TXSA 4K0KB 3MHHC 4I55B 2QKCA 1VQPV 2BOBC 4UV8A 1EZVH 1VARA 2KB1A 1H2SB 1Q86W 1H2KA 5EBMC 3P32A 2YUAA 1RSOB 1I94O 2WWWA 3K03A 3E22B 1P7BA 1IVSA 4LFBO 3U10A 1G8MA 2KQXA 1HNXB 2LJ2A 3ABUA 5KLVH 1W59A 1QLNA 5L3BA 1Z5WA 3WB2A 4QE9A 4DW0A 2CUGA 4J42A 3OUSA 4LF8O 1JA8A 2BE3A 1OZ0A 2UUCO 1NQTA 4X1KA 5FNVB 1Y4MA 3G6EV 2LGQA 1JQ0A 3ZIAG 1PP9H 3JYCA 1S0VA 3AG4C 3K06A 3JATB 3A8TA 4FZ1A 4CH5A 5KHKA 1SF9A 3K5LA 3RVZA 4LF9B 2X6AA 1SQGA 4AHCA 4JF3A 2IU3A 5LYJA 4H44B 5CA3A 4DR2O 3AG3B 1W2BU 2AGAA 1IBKB 2YICA 4DV4O 1I08A 2LO1A 3A2FA 3CCJV 1H2NA 1AJPA 1HNWB 2X0LA 4MVQA 4KHPO 3E86A 1CPYA 3SYCA 2WLLA 1EN4A 2HKOA 1AJQA 4LF6B 2OTJV 4MTOA 4FLXA 2UXDB 2ITDC 1GH6A 5LP6C 3CX5F 3M8AA 4DR7O 1WA8A 2UUBB 2RQ6A 4B3TB 3AK3A 1G4YB 1VMGA 2K9PA 4OPHA 3AK1A 1MA1A 4UCUA 4TSFG 4O2AA 5CA1B 2GDSA 2JS3A 1N32O 4GKJB 1NH2D 4DV5O 5A2QN 2H3OA 5EZYB 5IJ9B 3E8GA 1YTFD 3ABMC 1B3QA 5EBWC 2Q73A 2M6YA 3L74H 1CEZA 1IXMA 2KKWA 5KA6A 4YJ3B 3TK1A 4UVCA 3BVOA 3SYAA 3M7MX 1YDXA 4U7NA 4WFAV 2H8PC 3CJHB 2OTLV 1GM9A 3IGAC 1FYJA 5IYDO 1BE3H 5IY5C 1GAXA 1Y74B 4U3JB 1RM1C 5CN0A 5JQGA 3OTFA 4RAIA 5BY1A 1JMKC 4D7TA 3OR7C 4GCZA 5DEDA 3T1CA 3E8FA 3JD1A 3ZHUA 4AQYO 3BY6A 1XDCA 5EYPB 4O4JA 1YZBA 1QBZA 1BL8A 1QVFU 3DXRA 3SJAC 1BHBA 1VQNV 4PA9A 2V4DA 2CTQA 2GUZB 3FB5C 4J7KA 4DR6B 4G28B 3CMEV 4W4LA 3JSLA 3OM3B 4WF9V 2ZNIA 2ATKC 4I55A 4EFEA 4U3FH 1FJGO 3AG1C 2F4VB 5FLXN 1L0LH 3SYOA 2XT9A 3C3TA 1XHXA 2BSKB 4TT3G 4MW3A 2PZSA 1GK9A 1ENVA 1NBMG 3I5DA 1NU1H 2W0FC 4CH3A 2EIJB 3RVYA 3JSNA 3E22A 2MW2B 2HG5C 4XDLA 4OGQB 3FB6C 4C7UA 3VQVA 2DQ3A 2CGNA 3LSSA 1VQOV 3APOA 5LP6A 4J9ZB 1VQ6V 3B8NA 4NKGB 2LQTA 1LUVA 1I5YA 1UFIA 2B1GA 1FS0G 3LDDA 1WAZA 3SPGA 2UXCB 1GMGA 2HLDG 2QGNA 2JJ2G 4JTDB 2UU9B 1EBOA 2OYQA 4LNUB 1SQBH 1UPGA 5LOVB 2WSSG 4JV5B 3T1HB 2VQEB 1BGYH 1Y66A 2N04A 3VQWA 2E74B 4F4LA 1R3IC 4EB6B 1NTZH 1EN6A 3ZRWA 1JCHA 3K79A 4N23A 4AILC 4DR5B 4LBEC 1NTKH 2DW4A 3F7YC 4GX2A 1FAFA 4IYHA 1N34O 1OJHA 1VQ8V 3OE7G 1XNRO 4DUYB 3ZHVA 1QHTA 3OT7A 1N33B 2EIKC 5L3GA 4JI4O 3ZEDA 1I94B 3CSXA 2WLHA 4I4TB 5EC2C 5J2UB 4LFBB 5LMUO 2DYSB 4JI0O 2B9ZA 2GTSA 3WG7C 4ASUG 2YXHA 2ZE6A 3JD3A 4I50B 4LF8B 3CC7V 4YJ3A 2PI4A 3MAQA 1T5EA 2QWRB 1IDSA 1I5XA 3OGCC 2PUSA 1LUWA 3B8MA 1BCCH 3ZRXA 1G1XB 2EZPA 2L6LA 2ZINA 2Q6AA 1YJNV 5K1PA 2OCCB 1XOUA 3B77A 1Y74A 4DR2B 1Q8IA 4LF9O 3U0ZA 3KG2A 4QPKA 1S72V 3CCUV 1O9HA 2BTOA 3D36C 3HR0A 4DV4B 3C90A 1OCCB 1R6KA 4X62O 4FM0A 5EYPA 1KMIZ 2EIMB 4DR3O 2P6JA 2R72A 5D5PA 5IYCO 1HNWO 3JCUZ 4HNAB 2H94A 1K5QA 1SQQH 2YIBA 1PNKA 3CB2A 3ZHQA 2UXDO 4B3RO 4BW5A 2OCHA 3E2EA 1JFFA 2ZXWC 1ZWIC 1Q7YW 2CGOA 3JASA 4R8CA 2Q5ZA 2FTKA 4I5SA 2FYUH 1DF5A 2R9IA 1N32B 1X59A 4FM2A 1L1FA 4DV5B 4JI3O 2WA3A 1M93A 3B2EE 3L9DA 3PJSK 2JJ1G 3ABKB 1F7YA 4GKJO 3CRRA 3UQ8A 3G80A 1VIBA 4FK5C 1KQSU 4XBFA 5BZBA 4WBNB 1KKCA 3HB3B 3WB1A 3SPCA 3G4SV 1BQZA 4X1KB 2FKXA 3HPLC 1VF6C 1K92A 3RYCA 5FL7G 3K04A 5JVDA 1H2LA 1AR4A 1XUQA 3CE2A 2PI5A 2LP7A 2LW1A 4X9QA 4BIUA 3IAYA 2ZNJA 4J80A 1GN6A 4MTGA 5LYJB 1WNSA 2Q67A 4LNUA 4AQYB 3ABKC 1KP3A 3F7VC 5B3SB 5JJJB 5LOVA 1GN2A 3F5TA 1V54C 4PD4F 1MNGA 5KHHA 1NZ6A 2DMXA 2A9HA 1P4RA 3E8HA 2WA4A 1QCEA 5KUKA 4CH6A 3EXAA 2WLLB 2V1DA 2EJRA 2A7WA 3CD6V 2GBOA 5LBQA 4NXMB 1HWYA 3DC6A 1DK1A 1FJGB 5BXZA 2JRIA 4TV9B 3BFRA 3OEEG 2DJVA 5B5EZ 3SDLA 3I55V 2XUMA 4RQEA 3QO5A 4K8ZA 3T4DA 2Y69C 5L3CA 2VS0A 3D36A 2D3OW 4I4TA 1V55B 5KHIA 3JCZA 2ZE7A 4X20A 3N2GA 1MZFA 1H2GA 4H33A 2E5LO 4CC5A 3KCYA 1VQLV 4RWUA 1GO3F 3QNEA 4JI1O 1Z2GA 3W7SA 4JASA 3WB0A 3S3XA 4Z1VA 1B04A 1P49A 5GTIZ 3OEHG 4OPAA 4CS4A 4PA7A 4TUYA 2N74A 3UCSC 4JAAA 3DC5A 2P4KA 5HFMA 4DR4B 5J2TA 2UXBO 3QO8A 4R50A 1URFA 1K9MW 2DYRC 2O57A 4K8XA 1US6A 4P2ZA 1EZJA 4X1IA 4DV0O 2UU9O 3CRQA 4CH4A 4FLVA 2GSMB 1QR8A 1TVKA 4MVUA 4PELA 1S5HC 3T2MA 3T1HO 1YHQV 1L8DA 4OX9O 1GM7A 4BW9A 1VF6A 1CXZB 5KAIZ 1N34B 4JZ2A 1TUBA 3AG4B 4DR5O 1OHHG 1XNRB 4NTXA 2IW5A 5AG2A 4Q20A 4ZKIA 4ZHQA 1N8RW 2XTAA 1H8HG 4QNHB 4JI4B 5KX5A 5KAFZ 2CE4A 2JVDA 2Q9LA 3JAWB 4DUYO 3AG2B 3CXCU 5LMUB 3L72H 1N33O 3GWOA 4JI0B 1E1RG 2L35A 2ZD9A 3J80N 1SQPH 3RGBA 4BIOA 1FD9A 3CYOA 5KHJA 1EN5A 2GTAA 5H5NA 4B3SB 4WBNA 2Y0IA 4GX5A 5LMNB 4DV2O 1FFXB 1V9PA 1XILA 1VP7A 1MOFA 4X64O 3K08A 4IIJA 2Z5UA 1YSCA 5LP6B 4KP4A 4GKKB 4UB8Z 5DECA 4BIZA 1NR7A 2QM4A 4YJ2A 3OR6C 1XBLA 4RQFA 1W0KG 4NTYA 1JOYA 1MG1A 1K73W 4JI2O 5LA6A 1IZ3A 2JEXA 5LGNA 1N36O 4O4LA 3T1YB 5DN6G 4MVZA 1HDJA 3Q4HB 2IH3C 3ASNB 4X62B 1PM9A 3AG2C 1SZXA 1JJOA 4J11A 4NTWA 3H1HH 3LNMB 3L70H 3RWRD 4QPJA 1B06A 3ABMB 4DR3B 4X66B 2HJDA 3IFXA 3QO7A 4B3RB 4TV8A 1OCZB 4FFKA 2BTQA 1PD3A 1SA0A 3NR7A 3ZRWB 3G6BA 4TV9A 1SERA 2A0LA 1Q3EA 4E4EA 4TWKA 1Y67A 2CAZC 3OAAG 5IY5B 4JI3B 5CBGA 1WB8A 2IJKA 1RM1B 1KBHA 5KHGA 3ZN1A 4I9WA 4H13B 3ASNC 2Z3YA 2KSDA 2PYJA 3K58A 1GKFA 1ZX3A 1COWG 3RFRA 1J5EO 3SGIA 1NTMH 4DV7B 2AZ0A 2ODMA 2JEUA 3CCMV 3H01A 1SQXH 3W7XA 4XDKA 1XMOO 1OCZC 3LSUA 3K59A 5CB4B 4RUEA 2MK3A 4BWAA 2PTMA 3L73H 3AG1B 3THOA 3SPHA 3OMNB 4LFAO 4IHJB 3CS5A 3ZX6A 4HYOA 3BA9A 4I0XA 2B1IA 4JI7B 3QF7A 1QR9A 3JALA 1GN4A 2XAQA 4UVAA 3LUTB 5B1AC 2RDCA 1DTOA 2A79B 2XHBA 3JARA 4JI6B 2Q4PA 3DSQA 4DV3O 2HJFC 4CC6A 2RJZA 3TXQA 2AHYA 4XDJA 3K0DA 1KC8W 5E79Z 2HFEC 4LFCO 3ASOC 4UCTA 3JAKB 1N0NA 1B6QA 2WLJA 3SYPA 3SPIA 1NI8A 4NXMO 1JFFB 5EBLC 4GX1A 4FJCC 3JASB 2DWEC 2OIGA 3I56V 2EILC 2F93B 1OCOC 3JAWA 1VF5B 4DO2A 3CCEV 5LGUA 2QWPB 2E5LB 3SJBC 3IC9A 3GVMA 4JI1B 4LWSA 1FFXA 1AI5A 4JYYA 2QKSA 4UCSA 2NLJC 4LH6A 1PPJH 1Q6HA 4B3MB 2UUAB 5LHIA 1VQ4V 4L87A 1YCIA 2EINC 4JTCB 2PY5A 1KU9A 3RYCB 4MVSA 2N05A 5JVDB 3JAMN 2UXBB 4FFBA 2ZKOA 3Q4HA 5DM6V 2RMKB 2EIKB 2R70A 2YIAA 4DR4O 5GW7A 2QWQB 4DR1B 4DV0B 1XMQO 1Q81W 2YDEA 1LNQA 2GHYA 1A32A 5ITZA 3FYEB 3ETEA 3WG7B 1PNMA 5EC1C 2IJIA 4OX9B 3VQXA 2ZDIC 4DV6O 1WB7A 1K4DC 2WLIB 4IL6Z 2KG7A 4J9YB 3S3WA 4CBCA 1SS3A 2OIEA 4B7KA 2GV9A 1VQ7V 3D3IA 4ZI7A 2ZCEA 4PDLA 3ZHSA 4DK0A 2CDYA 4LF7B 2ZM6O 4MT8A 4PA4A 4JI5O 2LGWA 1HNZB 4QIWF 2BOCC 2QWNB 3CC4V 4JYAB 4X20B 4DV2B 3N2GB 4LP8A 1DLBA 4ZBMA 3VBBA 1M9NA 4X64B 2Q7EA 1SETA 4NYKA 5A9GA 1M56C 3KZIZ 4B3SO 4O4IA 5LMNO 5IYZA 1SQVH 3MHSC 1NT2B 1KD1W 3H9VA 1IBLB 3B09A 3FAVA 5CB4A 5H6RA 4QE7A 4JI2B 2DN9A 4GKKO 2ZXWB 2YC0A 3BEHA 4PI2A 4FPPA 1N36B 2YEVA 4TUYB 3RT3C 2ZR2A 4IHJA 4ICGA 4JYCA 5F2VO 3VOUA 1VQMV 1OCRC 1DGSA 5J2TB 5B1NA 1N4CA 2QKAA 3T1YO 3P3PA 3TCUA 2FL4A 3EFFK 4PDMA 1AR1B 5FPRA 4X1IB 4K3AA 2WLNA 2FMLA 4J7JA 1K8AW 1TVKB 1HW7A 2BCCH 4RO2A 3ZMSA 2QA4V 4X66O 1M57C 2EZOA 3ZMTA 4UVBA 4GYCB 1QLEC 3JAKA 2IJJA 1JPXA 1TGOA 4WFEA 3GB7C 5B1BB 1TUBB 2ZIOA 3DTUB 3M99B 5K1XA 4X88A 4MTFA 1GTOA 4F6RB 5H9CA 1SESA 1F4NA 4ZHQB 1EFRG 1Q43A 3EVKA 3NXSA 1NKDA 3FD9A 5KX5B 1WN7A 4FLZA 3BCCH 1S3JA 3QTCA 1M90W 1VEWA 2Q68A 1RPOA 4MTXA 4YY3O 1J5EB 3RBZA 3CXHF 1V54B 3RW0A 2XAGA 3RN4A 1EM1A 2ZDIA 3AG7A 1WPXA 2XNDG 4MVOA 4DV7O 3G71V 1XMOB 5JJNB 2HEPA 4X1YB 1AVMA 3JD2A 4IIJB 1SRYA 2NNUA 4L8JA 1SQFA 5KMGB 4GZRB 4GX0A 2XASA 4YJ2B 4MS2A 1R3KC 2Z0AA 1D5AA 5B1BC 3H1LH 4LFAB 1BQ0A 5TISZ 5LA6B 4JYBA 3ZN0A 4MVRA 4AI8A 1R3JC 2M7WA 2Y69B 4O4LB 4OXSA 4CS3A 1PL4A 2R9RB 2UXXA 2CTPA 2QE7G 3K57A 4ABMA 3BAAA 4JI7O 3CMAV 4DV3B 5EK0A 2QJ1A 4TOIA 4JI6O 1Q90D 1XREA 4LFCB 2CH7A 2QTOA 2WLIA 2Q7HA 1GM8A 4TV8B 2LW7A 3STZC 2BTQB 3K9SA 3O9OA 1SA0B 2WPDG 2X6BA 5EIBC 1TUEB 3ETGA 3UO2A 2RCVA 1TA8A 2QM7A 2ARHA 3T4ZA 3ICXA 2X6CA 2ETNA 4GT1A 2QR4A 4X8AA 1MSWD 3B4SA 1PL0A 1TAEA 2HR3A 1KECA 2YI8A 4N21A 2DYRB 5LXTB 1IBMB 1HP8A 1BSMA 5L3EA 2OWOA 1KKDA 1K5SA 4E2LA 3TETA 3JD4A 5C93A 5LL6Y 5GONA 2DQ0A 2CTWA 3OMIB 1AP5A 4PI0A 4B3MO 2UUAO 1NS1A 3CRMA 3QVNA 1AB3A 3A0RA 4ZOLA 1ZTEA 3ZHTA 3ETDA 1GN3A 4I9QA 1AILA 2ZR3A 1QQCA 1PV0A 3OFNG 1ZAUA 3H1KH 1F23A 1XMQB 3K3WA 3LNNA 3FYIB 4I0XB 3P30A 1KP2A 4H0LB 4DR1O 2QDOA 2XAFA 3JALB 2IJHA 3BPZA 3CPWU 3K9AA 4LR3A 3JARB 4UUJC 4DV6B 4G2KA 1I0HA 2ADPA 3ZJZA 5BR8B 2E75B 3BA8A 1IX9A 2YXLA 4LCUC 2W6IG 1KUQA 5HFLA 5B1OA 2F23A 4F6RA 4JI8B 2Y4UA 1P84F 4UCVA 1PNLA 3SYQA 3FKSG 2ZM6B 4JI5B 1M5IA 1E1QG 1U96A 4X89A 5CBFA 1G6UA 2DOSA 2YIDA 3X2QC 1YJWV 4LF7O 1K33A 1IURA 1HNZO 4GLXA 4ZIBA 1S5JA 3OD4A 3R66A 4JYAO 3E8BA 4LWSB 1WJZA 2QWOB 4X1YA 4K35A 4DRXA 3WFVA 1RP3B 4WFHA 4WFBV 5KMGA 3ABLC 2K1EA 4DUZO 1IBLO 4NXNO 3OTOB 4FLUA 4U7OA 2VWJA 1JR9A 2P22C 4HZ3A 3OUFA 4UV9A 1QNMA 2B5UA 3ABTA 4FFBB 1AJNA 3TGUH 4BAYA 3ZRSA 2QEXV 5IWAO 4I7ZB 1Y6XA 2YI9A 1O9GA 2Q7GA 3CCRV 4LF5O 3W7UA 4O2BA 4NVPA 2VQFB 5ITZB 2XOKG 1SZTA 2IM9A 4J7ZA 4YXWG 5IE9A 4QJFB 3UT5A 4YHHO 1XNQO 1U97A 1S76D 3HKBA 1AI4A 3HKEA 4R6ZA 3BABA 4KXRA 4Z1MG 2KG7B 1AI7A 3IJ4A 3HKCA 5JH7A 5IT9N 1BZKA 1ZSPA 4ZI7B 2NR5A 1KB9F 3O65A 1BMFG 3HKDA 4CZZA 1R73A 4YY3B 5LXTA 3E35A 2P90A 3FX7A 5B1AB 1K34A 2G38A 1HR0B 3ZMZA 3TJTA 1IXBA 3B40A 2QM8A 5KA5A 1FXHA 2ITCC 1YF2A 1GRJA 4O4IB 2Q69A 1THZA 3ASOB 5IYZB 1XQ8A 1ROPA 3CC2V 5LGTA 1K3EA 5B66Z 4J10A 3FAVB 2FB5A 3AG3C 2ILMA 2WAMA 1OV9A 4PA3A 4X65O 1MMMA 2JK5C 2EILB 1OCOB 2YEVB 2A06H 4F6EA 2P5OA 1R3LC 3BHPA 5H6QA 3SR2C 3CHXA 3ZHRA 2HVJC 4EKWA 5GTHZ 3SJCC 3G67A 2YXYA 4O4HA 4FLYA 3GWKC 2X7RB 4QGPA 1NVPD 4LF4B 3IC7A 2P06A 3H1IH 1ZUQA 1K4CC 1XL6A 1FXKB 5C8YA 4LH7A 2YS8A 1S5LZ 3APQA 3CCLV 4UB6Z 4JAVA 2AZ2A 2AXTZ 2EINB 2Q0OC 4NB5A 4YIOA 2E3CA 2Y4TA 1VQ9V 1VF7A 4H37A 4FLWA 5KUMA 2W0XA 2Y48A 4PA6A 1YVWA 3C3SA 1UJWB 1SKVA 2HHHO 4HAMA 4Q6GA 2R9AA 1H8EG 2RN9A 3KKYA 1IBMO 3ETQA 1VQ5V 4D7SA 3N2KB 4W4KA 3ZMVA 1D5NA 2W6JG 3CEIA 4HBNA 1RSOA 1FXKC 4LC1A 1VQKV 3MD0A 2IH1C 3D8CA 5EIBD 3DGEA 1SC5B 1R6TA 3ZCCA 4R7CA 2VRZA 5FPOA 1H2MA 4UFZA 5FNVA 1NR1A 1F51A 5BMVB 1Q6UA 1L0NH 1W0JG 2A3QA 3RYIB 4DV1O 3JATA 2P67A 1WP7A 1M56B 4FZ0A 3OW2U 3F5WC 1K97A 4CS2A 2CH7B 4KFMA 5BR8O 2EULA 4EFBA 1AI6A 2EIJC 2JGDB 3J7AU 3J81N 4FMTA 4B08A 4NR1A 1RPRA 1ZL8B 4JI8O 1Q82W 2D2CB 1QVGU 1OCRB 1JJ2U 4JTAB 1QU7A 2CK3G 1YIJV 4JAUA 3CCQV 3OGIB 1BT8A 3AEIA 5IJ0B 1YJ9V 3U11A 4UCRA 2ZIMA 5IDJA 1D2DA 4PJ0Z 1XI1A 2P7TC 5CA1A 3STLC 1M57B 4K0KO 2EJ7A 1QLEB 5GONB 1NH2B 4DYLA 2F66C 4DUZB 4NXNB 4JPRA 2QTSA 3ZS8C 2EBOA 4FLTA 2ZE5A 5EZYA 5IJ9A 4Z2WA 1FXVA 5JWPA 1YTFB 1R1BA 1JVMA 4WCEV 4GUNA 1YEWA 1WP8A 2ADQB 3OTOO 2HVKC 4ZOLB 2UXNA 1WLEA 1HNXO 1ORQC 5IWAB 2E76B 2UUCB 3RYFB 1PKXA 2JS5A 4DK1A 5H2FZ 2XAJA 4MVMA 4LF5B 1RFYA 3CJHA 5JCOC 1AP6A 4G27B 1Y76B 2LFSA 2AHZA 1YXBA 3RYHB 5IYBO 1M4UA 2VQFO 4YHHB 1XNQB 4JZGA 1NVPB 1J95A 4U3JA 1JX9A 4FM1A 4KUMA 2Q8VA 1FXKA 4TQDA 2YSUB
chains in the Genus database with same CATH topology
4PD4F 1KB9F 3H1KH 3L74H 3L71H 3L75H 1SQPH 1SQVH 1SQXH 3CXHF 3H1LH 1BGYH 2IBZH 5KLVH 3CWBH 4U3FH 1NTZH 1BCCH 1P84F 3TGUH 1EZVH 3CX5F 2FYUH 1L0LH 1PPJH 3L73H 3H1JH 1NTKH 4D6TH 2BCCH 3H1HH 1BE3H 1NTMH 1L0NH 3L70H 3BCCH 1NU1H 1KYOF 1SQBH 3H1IH 1SQQH 1PP9H 2A06H 3L72H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 F;  1KB9 F;  3H1K H;  3L74 H;  3L71 H;  3L75 H;  1SQP H;  1SQV H;  1SQX H;  3CXH F;  3H1L H;  1BGY H;  2IBZ H;  5KLV H;  3CWB H;  4U3F H;  1NTZ H;  1BCC H;  1P84 F;  3TGU H;  1EZV H;  3CX5 F;  2FYU H;  1L0L H;  1PPJ H;  3L73 H;  3H1J H;  1NTK H;  4D6T H;  2BCC H;  3H1H H;  1BE3 H;  1NTM H;  1L0N H;  3L70 H;  3BCC H;  1NU1 H;  1KYO F;  1SQB H;  3H1I H;  1SQQ H;  1PP9 H;  2A06 H;  3L72 H; 
#chains in the Genus database with same CATH topology
 1P7G A;  2PF4 E;  1ARO P;  1N0J A;  5CBH A;  1DF4 A;  2WLM A;  1IBK O;  4KHP B;  3P3N A;  2DE0 X;  2Q0A A;  2DYS C;  3QG5 A;  2V7Q G;  1K7D A;  3H1J H;  2VWK A;  3JD0 A;  3R65 A;  2GUZ A;  4DR7 B;  2WLK A;  4LF6 O;  3PN1 A;  2CTR A;  3AK2 A;  5CA0 B;  4IGG A;  3UM7 A;  3W7T A;  2UUB O;  3D3Q A;  4B3T O;  3N2K A;  1HR0 O;  2BSK A;  2Y0P A;  1YI2 V;  2OCC C;  1NJI W;  1R6N A;  2C2A A;  5D5Q A;  4MSW C;  4DRX B;  3E89 A;  1OCC C;  1FFT B;  3ZRV A;  1BHA A;  3LDC A;  4X65 B;  2JIZ G;  1MAB G;  2EX3 A;  2EIM C;  1MZE A;  5LHH A;  1Q6I A;  5BMV A;  1LR1 A;  1X4T A;  3RYI A;  2PYL A;  3LDE A;  1I7F A;  3KCX A;  3VQY A;  3ML0 A;  4O2B B;  1YIT V;  5L3D A;  2JGU A;  1ZLZ A;  2ZQM A;  5J9P C;  3UT5 B;  3OMA B;  4P9P A;  4LF4 O;  3HKB B;  3HKE B;  2AW9 A;  4WFG A;  2JGD A;  4D6T H;  1E79 G;  5E1A C;  3ZMU A;  2JDI G;  2QSA A;  1KYO F;  3HKC B;  2ZE8 A;  5JH7 B;  4DXW A;  3W7W A;  3CCS V;  4J41 A;  1ZL8 A;  3MDS A;  3L75 H;  4IT5 A;  3N27 A;  4EB6 A;  3CWB H;  4P30 A;  1MSD A;  3FFQ A;  3A0H Z;  3K5N A;  3HKD B;  4PV1 B;  2HHH B;  3K0G A;  2F1M A;  5JCO A;  3A0B Z;  4MW8 A;  5IJ0 A;  1WA8 B;  3CCV V;  4DR6 O;  4KL1 A;  2PGG A;  4PDV A;  3E83 A;  3ZBH A;  3EHB B;  4PDR A;  3K5M A;  4YIP A;  2P4V A;  4O2A B;  2F4V O;  4JGS A;  4BR6 A;  5J2U A;  1F4M A;  4UXN A;  4WFF A;  2ZT9 B;  3UKM A;  5B3S C;  2F43 G;  3FB8 C;  2HP8 A;  1H38 A;  4I50 A;  5JJE B;  5LHG A;  1Q5O A;  4DW1 A;  4P9O A;  3RYF A;  4FIP C;  5CMU A;  3X2Q B;  1Z5V A;  3CRC A;  1AR5 A;  4DV1 B;  1CP9 A;  2RNB A;  4PHZ A;  3CRA A;  1Y76 A;  1S77 D;  3RYH A;  3FB7 C;  5L3F A;  4RUF A;  1XL4 A;  2IU0 A;  4O4H B;  2F95 B;  2DWD C;  1WPB A;  4A5U B;  3L71 H;  3WU2 Z;  3ABL B;  5JQG B;  2LFR A;  3UO3 A;  2UXC O;  4FVM A;  5C8Y B;  2IBZ H;  1V55 C;  1FPO A;  4TQF A;  1XHZ A;  3K5O A;  2NN4 A;  2OT5 A;  4IYI A;  1M1K W;  4O4J B;  4HNA A;  4JV5 O;  3LSQ A;  2VQE O;  3SJQ C;  1BS3 A;  3DXR B;  2XAH A;  1FKA O;  4EEQ A;  2YIB D;  3SPJ A;  1XEQ A;  5CA0 A;  4UCO A;  3CP1 A;  4B7E A;  3BRC A;  3TXS A;  4K0K B;  3MHH C;  4I55 B;  2QKC A;  1VQP V;  2BOB C;  4UV8 A;  1EZV H;  1VAR A;  2KB1 A;  1H2S B;  1Q86 W;  1H2K A;  5EBM C;  3P32 A;  2YUA A;  1RSO B;  1I94 O;  2WWW A;  3K03 A;  3E22 B;  1P7B A;  1IVS A;  4LFB O;  3U10 A;  1G8M A;  2KQX A;  1HNX B;  2LJ2 A;  3ABU A;  5KLV H;  1W59 A;  1QLN A;  5L3B A;  1Z5W A;  3WB2 A;  4QE9 A;  4DW0 A;  2CUG A;  4J42 A;  3OUS A;  4LF8 O;  1JA8 A;  2BE3 A;  1OZ0 A;  2UUC O;  1NQT A;  4X1K A;  5FNV B;  1Y4M A;  3G6E V;  2LGQ A;  1JQ0 A;  3ZIA G;  1PP9 H;  3JYC A;  1S0V A;  3AG4 C;  3K06 A;  3JAT B;  3A8T A;  4FZ1 A;  4CH5 A;  5KHK A;  1SF9 A;  3K5L A;  3RVZ A;  4LF9 B;  2X6A A;  1SQG A;  4AHC A;  4JF3 A;  2IU3 A;  5LYJ A;  4H44 B;  5CA3 A;  4DR2 O;  3AG3 B;  1W2B U;  2AGA A;  1IBK B;  2YIC A;  4DV4 O;  1I08 A;  2LO1 A;  3A2F A;  3CCJ V;  1H2N A;  1AJP A;  1HNW B;  2X0L A;  4MVQ A;  4KHP O;  3E86 A;  1CPY A;  3SYC A;  2WLL A;  1EN4 A;  2HKO A;  1AJQ A;  4LF6 B;  2OTJ V;  4MTO A;  4FLX A;  2UXD B;  2ITD C;  1GH6 A;  5LP6 C;  3CX5 F;  3M8A A;  4DR7 O;  1WA8 A;  2UUB B;  2RQ6 A;  4B3T B;  3AK3 A;  1G4Y B;  1VMG A;  2K9P A;  4OPH A;  3AK1 A;  1MA1 A;  4UCU A;  4TSF G;  4O2A A;  5CA1 B;  2GDS A;  2JS3 A;  1N32 O;  4GKJ B;  1NH2 D;  4DV5 O;  5A2Q N;  2H3O A;  5EZY B;  5IJ9 B;  3E8G A;  1YTF D;  3ABM C;  1B3Q A;  5EBW C;  2Q73 A;  2M6Y A;  3L74 H;  1CEZ A;  1IXM A;  2KKW A;  5KA6 A;  4YJ3 B;  3TK1 A;  4UVC A;  3BVO A;  3SYA A;  3M7M X;  1YDX A;  4U7N A;  4WFA V;  2H8P C;  3CJH B;  2OTL V;  1GM9 A;  3IGA C;  1FYJ A;  5IYD O;  1BE3 H;  5IY5 C;  1GAX A;  1Y74 B;  4U3J B;  1RM1 C;  5CN0 A;  5JQG A;  3OTF A;  4RAI A;  5BY1 A;  1JMK C;  4D7T A;  3OR7 C;  4GCZ A;  5DED A;  3T1C A;  3E8F A;  3JD1 A;  3ZHU A;  4AQY O;  3BY6 A;  1XDC A;  5EYP B;  4O4J A;  1YZB A;  1QBZ A;  1BL8 A;  1QVF U;  3DXR A;  3SJA C;  1BHB A;  1VQN V;  4PA9 A;  2V4D A;  2CTQ A;  2GUZ B;  3FB5 C;  4J7K A;  4DR6 B;  4G28 B;  3CME V;  4W4L A;  3JSL A;  3OM3 B;  4WF9 V;  2ZNI A;  2ATK C;  4I55 A;  4EFE A;  4U3F H;  1FJG O;  3AG1 C;  2F4V B;  5FLX N;  1L0L H;  3SYO A;  2XT9 A;  3C3T A;  1XHX A;  2BSK B;  4TT3 G;  4MW3 A;  2PZS A;  1GK9 A;  1ENV A;  1NBM G;  3I5D A;  1NU1 H;  2W0F C;  4CH3 A;  2EIJ B;  3RVY A;  3JSN A;  3E22 A;  2MW2 B;  2HG5 C;  4XDL A;  4OGQ B;  3FB6 C;  4C7U A;  3VQV A;  2DQ3 A;  2CGN A;  3LSS A;  1VQO V;  3APO A;  5LP6 A;  4J9Z B;  1VQ6 V;  3B8N A;  4NKG B;  2LQT A;  1LUV A;  1I5Y A;  1UFI A;  2B1G A;  1FS0 G;  3LDD A;  1WAZ A;  3SPG A;  2UXC B;  1GMG A;  2HLD G;  2QGN A;  2JJ2 G;  4JTD B;  2UU9 B;  1EBO A;  2OYQ A;  4LNU B;  1SQB H;  1UPG A;  5LOV B;  2WSS G;  4JV5 B;  3T1H B;  2VQE B;  1BGY H;  1Y66 A;  2N04 A;  3VQW A;  2E74 B;  4F4L A;  1R3I C;  4EB6 B;  1NTZ H;  1EN6 A;  3ZRW A;  1JCH A;  3K79 A;  4N23 A;  4AIL C;  4DR5 B;  4LBE C;  1NTK H;  2DW4 A;  3F7Y C;  4GX2 A;  1FAF A;  4IYH A;  1N34 O;  1OJH A;  1VQ8 V;  3OE7 G;  1XNR O;  4DUY B;  3ZHV A;  1QHT A;  3OT7 A;  1N33 B;  2EIK C;  5L3G A;  4JI4 O;  3ZED A;  1I94 B;  3CSX A;  2WLH A;  4I4T B;  5EC2 C;  5J2U B;  4LFB B;  5LMU O;  2DYS B;  4JI0 O;  2B9Z A;  2GTS A;  3WG7 C;  4ASU G;  2YXH A;  2ZE6 A;  3JD3 A;  4I50 B;  4LF8 B;  3CC7 V;  4YJ3 A;  2PI4 A;  3MAQ A;  1T5E A;  2QWR B;  1IDS A;  1I5X A;  3OGC C;  2PUS A;  1LUW A;  3B8M A;  1BCC H;  3ZRX A;  1G1X B;  2EZP A;  2L6L A;  2ZIN A;  2Q6A A;  1YJN V;  5K1P A;  2OCC B;  1XOU A;  3B77 A;  1Y74 A;  4DR2 B;  1Q8I A;  4LF9 O;  3U0Z A;  3KG2 A;  4QPK A;  1S72 V;  3CCU V;  1O9H A;  2BTO A;  3D36 C;  3HR0 A;  4DV4 B;  3C90 A;  1OCC B;  1R6K A;  4X62 O;  4FM0 A;  5EYP A;  1KMI Z;  2EIM B;  4DR3 O;  2P6J A;  2R72 A;  5D5P A;  5IYC O;  1HNW O;  3JCU Z;  4HNA B;  2H94 A;  1K5Q A;  1SQQ H;  2YIB A;  1PNK A;  3CB2 A;  3ZHQ A;  2UXD O;  4B3R O;  4BW5 A;  2OCH A;  3E2E A;  1JFF A;  2ZXW C;  1ZWI C;  1Q7Y W;  2CGO A;  3JAS A;  4R8C A;  2Q5Z A;  2FTK A;  4I5S A;  2FYU H;  1DF5 A;  2R9I A;  1N32 B;  1X59 A;  4FM2 A;  1L1F A;  4DV5 B;  4JI3 O;  2WA3 A;  1M93 A;  3B2E E;  3L9D A;  3PJS K;  2JJ1 G;  3ABK B;  1F7Y A;  4GKJ O;  3CRR A;  3UQ8 A;  3G80 A;  1VIB A;  4FK5 C;  1KQS U;  4XBF A;  5BZB A;  4WBN B;  1KKC A;  3HB3 B;  3WB1 A;  3SPC A;  3G4S V;  1BQZ A;  4X1K B;  2FKX A;  3HPL C;  1VF6 C;  1K92 A;  3RYC A;  5FL7 G;  3K04 A;  5JVD A;  1H2L A;  1AR4 A;  1XUQ A;  3CE2 A;  2PI5 A;  2LP7 A;  2LW1 A;  4X9Q A;  4BIU A;  3IAY A;  2ZNJ A;  4J80 A;  1GN6 A;  4MTG A;  5LYJ B;  1WNS A;  2Q67 A;  4LNU A;  4AQY B;  3ABK C;  1KP3 A;  3F7V C;  5B3S B;  5JJJ B;  5LOV A;  1GN2 A;  3F5T A;  1V54 C;  4PD4 F;  1MNG A;  5KHH A;  1NZ6 A;  2DMX A;  2A9H A;  1P4R A;  3E8H A;  2WA4 A;  1QCE A;  5KUK A;  4CH6 A;  3EXA A;  2WLL B;  2V1D A;  2EJR A;  2A7W A;  3CD6 V;  2GBO A;  5LBQ A;  4NXM B;  1HWY A;  3DC6 A;  1DK1 A;  1FJG B;  5BXZ A;  2JRI A;  4TV9 B;  3BFR A;  3OEE G;  2DJV A;  5B5E Z;  3SDL A;  3I55 V;  2XUM A;  4RQE A;  3QO5 A;  4K8Z A;  3T4D A;  2Y69 C;  5L3C A;  2VS0 A;  3D36 A;  2D3O W;  4I4T A;  1V55 B;  5KHI A;  3JCZ A;  2ZE7 A;  4X20 A;  3N2G A;  1MZF A;  1H2G A;  4H33 A;  2E5L O;  4CC5 A;  3KCY A;  1VQL V;  4RWU A;  1GO3 F;  3QNE A;  4JI1 O;  1Z2G A;  3W7S A;  4JAS A;  3WB0 A;  3S3X A;  4Z1V A;  1B04 A;  1P49 A;  5GTI Z;  3OEH G;  4OPA A;  4CS4 A;  4PA7 A;  4TUY A;  2N74 A;  3UCS C;  4JAA A;  3DC5 A;  2P4K A;  5HFM A;  4DR4 B;  5J2T A;  2UXB O;  3QO8 A;  4R50 A;  1URF A;  1K9M W;  2DYR C;  2O57 A;  4K8X A;  1US6 A;  4P2Z A;  1EZJ A;  4X1I A;  4DV0 O;  2UU9 O;  3CRQ A;  4CH4 A;  4FLV A;  2GSM B;  1QR8 A;  1TVK A;  4MVU A;  4PEL A;  1S5H C;  3T2M A;  3T1H O;  1YHQ V;  1L8D A;  4OX9 O;  1GM7 A;  4BW9 A;  1VF6 A;  1CXZ B;  5KAI Z;  1N34 B;  4JZ2 A;  1TUB A;  3AG4 B;  4DR5 O;  1OHH G;  1XNR B;  4NTX A;  2IW5 A;  5AG2 A;  4Q20 A;  4ZKI A;  4ZHQ A;  1N8R W;  2XTA A;  1H8H G;  4QNH B;  4JI4 B;  5KX5 A;  5KAF Z;  2CE4 A;  2JVD A;  2Q9L A;  3JAW B;  4DUY O;  3AG2 B;  3CXC U;  5LMU B;  3L72 H;  1N33 O;  3GWO A;  4JI0 B;  1E1R G;  2L35 A;  2ZD9 A;  3J80 N;  1SQP H;  3RGB A;  4BIO A;  1FD9 A;  3CYO A;  5KHJ A;  1EN5 A;  2GTA A;  5H5N A;  4B3S B;  4WBN A;  2Y0I A;  4GX5 A;  5LMN B;  4DV2 O;  1FFX B;  1V9P A;  1XIL A;  1VP7 A;  1MOF A;  4X64 O;  3K08 A;  4IIJ A;  2Z5U A;  1YSC A;  5LP6 B;  4KP4 A;  4GKK B;  4UB8 Z;  5DEC A;  4BIZ A;  1NR7 A;  2QM4 A;  4YJ2 A;  3OR6 C;  1XBL A;  4RQF A;  1W0K G;  4NTY A;  1JOY A;  1MG1 A;  1K73 W;  4JI2 O;  5LA6 A;  1IZ3 A;  2JEX A;  5LGN A;  1N36 O;  4O4L A;  3T1Y B;  5DN6 G;  4MVZ A;  1HDJ A;  3Q4H B;  2IH3 C;  3ASN B;  4X62 B;  1PM9 A;  3AG2 C;  1SZX A;  1JJO A;  4J11 A;  4NTW A;  3H1H H;  3LNM B;  3L70 H;  3RWR D;  4QPJ A;  1B06 A;  3ABM B;  4DR3 B;  4X66 B;  2HJD A;  3IFX A;  3QO7 A;  4B3R B;  4TV8 A;  1OCZ B;  4FFK A;  2BTQ A;  1PD3 A;  1SA0 A;  3NR7 A;  3ZRW B;  3G6B A;  4TV9 A;  1SER A;  2A0L A;  1Q3E A;  4E4E A;  4TWK A;  1Y67 A;  2CAZ C;  3OAA G;  5IY5 B;  4JI3 B;  5CBG A;  1WB8 A;  2IJK A;  1RM1 B;  1KBH A;  5KHG A;  3ZN1 A;  4I9W A;  4H13 B;  3ASN C;  2Z3Y A;  2KSD A;  2PYJ A;  3K58 A;  1GKF A;  1ZX3 A;  1COW G;  3RFR A;  1J5E O;  3SGI A;  1NTM H;  4DV7 B;  2AZ0 A;  2ODM A;  2JEU A;  3CCM V;  3H01 A;  1SQX H;  3W7X A;  4XDK A;  1XMO O;  1OCZ C;  3LSU A;  3K59 A;  5CB4 B;  4RUE A;  2MK3 A;  4BWA A;  2PTM A;  3L73 H;  3AG1 B;  3THO A;  3SPH A;  3OMN B;  4LFA O;  4IHJ B;  3CS5 A;  3ZX6 A;  4HYO A;  3BA9 A;  4I0X A;  2B1I A;  4JI7 B;  3QF7 A;  1QR9 A;  3JAL A;  1GN4 A;  2XAQ A;  4UVA A;  3LUT B;  5B1A C;  2RDC A;  1DTO A;  2A79 B;  2XHB A;  3JAR A;  4JI6 B;  2Q4P A;  3DSQ A;  4DV3 O;  2HJF C;  4CC6 A;  2RJZ A;  3TXQ A;  2AHY A;  4XDJ A;  3K0D A;  1KC8 W;  5E79 Z;  2HFE C;  4LFC O;  3ASO C;  4UCT A;  3JAK B;  1N0N A;  1B6Q A;  2WLJ A;  3SYP A;  3SPI A;  1NI8 A;  4NXM O;  1JFF B;  5EBL C;  4GX1 A;  4FJC C;  3JAS B;  2DWE C;  2OIG A;  3I56 V;  2EIL C;  2F93 B;  1OCO C;  3JAW A;  1VF5 B;  4DO2 A;  3CCE V;  5LGU A;  2QWP B;  2E5L B;  3SJB C;  3IC9 A;  3GVM A;  4JI1 B;  4LWS A;  1FFX A;  1AI5 A;  4JYY A;  2QKS A;  4UCS A;  2NLJ C;  4LH6 A;  1PPJ H;  1Q6H A;  4B3M B;  2UUA B;  5LHI A;  1VQ4 V;  4L87 A;  1YCI A;  2EIN C;  4JTC B;  2PY5 A;  1KU9 A;  3RYC B;  4MVS A;  2N05 A;  5JVD B;  3JAM N;  2UXB B;  4FFB A;  2ZKO A;  3Q4H A;  5DM6 V;  2RMK B;  2EIK B;  2R70 A;  2YIA A;  4DR4 O;  5GW7 A;  2QWQ B;  4DR1 B;  4DV0 B;  1XMQ O;  1Q81 W;  2YDE A;  1LNQ A;  2GHY A;  1A32 A;  5ITZ A;  3FYE B;  3ETE A;  3WG7 B;  1PNM A;  5EC1 C;  2IJI A;  4OX9 B;  3VQX A;  2ZDI C;  4DV6 O;  1WB7 A;  1K4D C;  2WLI B;  4IL6 Z;  2KG7 A;  4J9Y B;  3S3W A;  4CBC A;  1SS3 A;  2OIE A;  4B7K A;  2GV9 A;  1VQ7 V;  3D3I A;  4ZI7 A;  2ZCE A;  4PDL A;  3ZHS A;  4DK0 A;  2CDY A;  4LF7 B;  2ZM6 O;  4MT8 A;  4PA4 A;  4JI5 O;  2LGW A;  1HNZ B;  4QIW F;  2BOC C;  2QWN B;  3CC4 V;  4JYA B;  4X20 B;  4DV2 B;  3N2G B;  4LP8 A;  1DLB A;  4ZBM A;  3VBB A;  1M9N A;  4X64 B;  2Q7E A;  1SET A;  4NYK A;  5A9G A;  1M56 C;  3KZI Z;  4B3S O;  4O4I A;  5LMN O;  5IYZ A;  1SQV H;  3MHS C;  1NT2 B;  1KD1 W;  3H9V A;  1IBL B;  3B09 A;  3FAV A;  5CB4 A;  5H6R A;  4QE7 A;  4JI2 B;  2DN9 A;  4GKK O;  2ZXW B;  2YC0 A;  3BEH A;  4PI2 A;  4FPP A;  1N36 B;  2YEV A;  4TUY B;  3RT3 C;  2ZR2 A;  4IHJ A;  4ICG A;  4JYC A;  5F2V O;  3VOU A;  1VQM V;  1OCR C;  1DGS A;  5J2T B;  5B1N A;  1N4C A;  2QKA A;  3T1Y O;  3P3P A;  3TCU A;  2FL4 A;  3EFF K;  4PDM A;  1AR1 B;  5FPR A;  4X1I B;  4K3A A;  2WLN A;  2FML A;  4J7J A;  1K8A W;  1TVK B;  1HW7 A;  2BCC H;  4RO2 A;  3ZMS A;  2QA4 V;  4X66 O;  1M57 C;  2EZO A;  3ZMT A;  4UVB A;  4GYC B;  1QLE C;  3JAK A;  2IJJ A;  1JPX A;  1TGO A;  4WFE A;  3GB7 C;  5B1B B;  1TUB B;  2ZIO A;  3DTU B;  3M99 B;  5K1X A;  4X88 A;  4MTF A;  1GTO A;  4F6R B;  5H9C A;  1SES A;  1F4N A;  4ZHQ B;  1EFR G;  1Q43 A;  3EVK A;  3NXS A;  1NKD A;  3FD9 A;  5KX5 B;  1WN7 A;  4FLZ A;  3BCC H;  1S3J A;  3QTC A;  1M90 W;  1VEW A;  2Q68 A;  1RPO A;  4MTX A;  4YY3 O;  1J5E B;  3RBZ A;  3CXH F;  1V54 B;  3RW0 A;  2XAG A;  3RN4 A;  1EM1 A;  2ZDI A;  3AG7 A;  1WPX A;  2XND G;  4MVO A;  4DV7 O;  3G71 V;  1XMO B;  5JJN B;  2HEP A;  4X1Y B;  1AVM A;  3JD2 A;  4IIJ B;  1SRY A;  2NNU A;  4L8J A;  1SQF A;  5KMG B;  4GZR B;  4GX0 A;  2XAS A;  4YJ2 B;  4MS2 A;  1R3K C;  2Z0A A;  1D5A A;  5B1B C;  3H1L H;  4LFA B;  1BQ0 A;  5TIS Z;  5LA6 B;  4JYB A;  3ZN0 A;  4MVR A;  4AI8 A;  1R3J C;  2M7W A;  2Y69 B;  4O4L B;  4OXS A;  4CS3 A;  1PL4 A;  2R9R B;  2UXX A;  2CTP A;  2QE7 G;  3K57 A;  4ABM A;  3BAA A;  4JI7 O;  3CMA V;  4DV3 B;  5EK0 A;  2QJ1 A;  4TOI A;  4JI6 O;  1Q90 D;  1XRE A;  4LFC B;  2CH7 A;  2QTO A;  2WLI A;  2Q7H A;  1GM8 A;  4TV8 B;  2LW7 A;  3STZ C;  2BTQ B;  3K9S A;  3O9O A;  1SA0 B;  2WPD G;  2X6B A;  5EIB C;  1TUE B;  3ETG A;  3UO2 A;  2RCV A;  1TA8 A;  2QM7 A;  2ARH A;  3T4Z A;  3ICX A;  2X6C A;  2ETN A;  4GT1 A;  2QR4 A;  4X8A A;  1MSW D;  3B4S A;  1PL0 A;  1TAE A;  2HR3 A;  1KEC A;  2YI8 A;  4N21 A;  2DYR B;  5LXT B;  1IBM B;  1HP8 A;  1BSM A;  5L3E A;  2OWO A;  1KKD A;  1K5S A;  4E2L A;  3TET A;  3JD4 A;  5C93 A;  5LL6 Y;  5GON A;  2DQ0 A;  2CTW A;  3OMI B;  1AP5 A;  4PI0 A;  4B3M O;  2UUA O;  1NS1 A;  3CRM A;  3QVN A;  1AB3 A;  3A0R A;  4ZOL A;  1ZTE A;  3ZHT A;  3ETD A;  1GN3 A;  4I9Q A;  1AIL A;  2ZR3 A;  1QQC A;  1PV0 A;  3OFN G;  1ZAU A;  3H1K H;  1F23 A;  1XMQ B;  3K3W A;  3LNN A;  3FYI B;  4I0X B;  3P30 A;  1KP2 A;  4H0L B;  4DR1 O;  2QDO A;  2XAF A;  3JAL B;  2IJH A;  3BPZ A;  3CPW U;  3K9A A;  4LR3 A;  3JAR B;  4UUJ C;  4DV6 B;  4G2K A;  1I0H A;  2ADP A;  3ZJZ A;  5BR8 B;  2E75 B;  3BA8 A;  1IX9 A;  2YXL A;  4LCU C;  2W6I G;  1KUQ A;  5HFL A;  5B1O A;  2F23 A;  4F6R A;  4JI8 B;  2Y4U A;  1P84 F;  4UCV A;  1PNL A;  3SYQ A;  3FKS G;  2ZM6 B;  4JI5 B;  1M5I A;  1E1Q G;  1U96 A;  4X89 A;  5CBF A;  1G6U A;  2DOS A;  2YID A;  3X2Q C;  1YJW V;  4LF7 O;  1K33 A;  1IUR A;  1HNZ O;  4GLX A;  4ZIB A;  1S5J A;  3OD4 A;  3R66 A;  4JYA O;  3E8B A;  4LWS B;  1WJZ A;  2QWO B;  4X1Y A;  4K35 A;  4DRX A;  3WFV A;  1RP3 B;  4WFH A;  4WFB V;  5KMG A;  3ABL C;  2K1E A;  4DUZ O;  1IBL O;  4NXN O;  3OTO B;  4FLU A;  4U7O A;  2VWJ A;  1JR9 A;  2P22 C;  4HZ3 A;  3OUF A;  4UV9 A;  1QNM A;  2B5U A;  3ABT A;  4FFB B;  1AJN A;  3TGU H;  4BAY A;  3ZRS A;  2QEX V;  5IWA O;  4I7Z B;  1Y6X A;  2YI9 A;  1O9G A;  2Q7G A;  3CCR V;  4LF5 O;  3W7U A;  4O2B A;  4NVP A;  2VQF B;  5ITZ B;  2XOK G;  1SZT A;  2IM9 A;  4J7Z A;  4YXW G;  5IE9 A;  4QJF B;  3UT5 A;  4YHH O;  1XNQ O;  1U97 A;  1S76 D;  3HKB A;  1AI4 A;  3HKE A;  4R6Z A;  3BAB A;  4KXR A;  4Z1M G;  2KG7 B;  1AI7 A;  3IJ4 A;  3HKC A;  5JH7 A;  5IT9 N;  1BZK A;  1ZSP A;  4ZI7 B;  2NR5 A;  1KB9 F;  3O65 A;  1BMF G;  3HKD A;  4CZZ A;  1R73 A;  4YY3 B;  5LXT A;  3E35 A;  2P90 A;  3FX7 A;  5B1A B;  1K34 A;  2G38 A;  1HR0 B;  3ZMZ A;  3TJT A;  1IXB A;  3B40 A;  2QM8 A;  5KA5 A;  1FXH A;  2ITC C;  1YF2 A;  1GRJ A;  4O4I B;  2Q69 A;  1THZ A;  3ASO B;  5IYZ B;  1XQ8 A;  1ROP A;  3CC2 V;  5LGT A;  1K3E A;  5B66 Z;  4J10 A;  3FAV B;  2FB5 A;  3AG3 C;  2ILM A;  2WAM A;  1OV9 A;  4PA3 A;  4X65 O;  1MMM A;  2JK5 C;  2EIL B;  1OCO B;  2YEV B;  2A06 H;  4F6E A;  2P5O A;  1R3L C;  3BHP A;  5H6Q A;  3SR2 C;  3CHX A;  3ZHR A;  2HVJ C;  4EKW A;  5GTH Z;  3SJC C;  3G67 A;  2YXY A;  4O4H A;  4FLY A;  3GWK C;  2X7R B;  4QGP A;  1NVP D;  4LF4 B;  3IC7 A;  2P06 A;  3H1I H;  1ZUQ A;  1K4C C;  1XL6 A;  1FXK B;  5C8Y A;  4LH7 A;  2YS8 A;  1S5L Z;  3APQ A;  3CCL V;  4UB6 Z;  4JAV A;  2AZ2 A;  2AXT Z;  2EIN B;  2Q0O C;  4NB5 A;  4YIO A;  2E3C A;  2Y4T A;  1VQ9 V;  1VF7 A;  4H37 A;  4FLW A;  5KUM A;  2W0X A;  2Y48 A;  4PA6 A;  1YVW A;  3C3S A;  1UJW B;  1SKV A;  2HHH O;  4HAM A;  4Q6G A;  2R9A A;  1H8E G;  2RN9 A;  3KKY A;  1IBM O;  3ETQ A;  1VQ5 V;  4D7S A;  3N2K B;  4W4K A;  3ZMV A;  1D5N A;  2W6J G;  3CEI A;  4HBN A;  1RSO A;  1FXK C;  4LC1 A;  1VQK V;  3MD0 A;  2IH1 C;  3D8C A;  5EIB D;  3DGE A;  1SC5 B;  1R6T A;  3ZCC A;  4R7C A;  2VRZ A;  5FPO A;  1H2M A;  4UFZ A;  5FNV A;  1NR1 A;  1F51 A;  5BMV B;  1Q6U A;  1L0N H;  1W0J G;  2A3Q A;  3RYI B;  4DV1 O;  3JAT A;  2P67 A;  1WP7 A;  1M56 B;  4FZ0 A;  3OW2 U;  3F5W C;  1K97 A;  4CS2 A;  2CH7 B;  4KFM A;  5BR8 O;  2EUL A;  4EFB A;  1AI6 A;  2EIJ C;  2JGD B;  3J7A U;  3J81 N;  4FMT A;  4B08 A;  4NR1 A;  1RPR A;  1ZL8 B;  4JI8 O;  1Q82 W;  2D2C B;  1QVG U;  1OCR B;  1JJ2 U;  4JTA B;  1QU7 A;  2CK3 G;  1YIJ V;  4JAU A;  3CCQ V;  3OGI B;  1BT8 A;  3AEI A;  5IJ0 B;  1YJ9 V;  3U11 A;  4UCR A;  2ZIM A;  5IDJ A;  1D2D A;  4PJ0 Z;  1XI1 A;  2P7T C;  5CA1 A;  3STL C;  1M57 B;  4K0K O;  2EJ7 A;  1QLE B;  5GON B;  1NH2 B;  4DYL A;  2F66 C;  4DUZ B;  4NXN B;  4JPR A;  2QTS A;  3ZS8 C;  2EBO A;  4FLT A;  2ZE5 A;  5EZY A;  5IJ9 A;  4Z2W A;  1FXV A;  5JWP A;  1YTF B;  1R1B A;  1JVM A;  4WCE V;  4GUN A;  1YEW A;  1WP8 A;  2ADQ B;  3OTO O;  2HVK C;  4ZOL B;  2UXN A;  1WLE A;  1HNX O;  1ORQ C;  5IWA B;  2E76 B;  2UUC B;  3RYF B;  1PKX A;  2JS5 A;  4DK1 A;  5H2F Z;  2XAJ A;  4MVM A;  4LF5 B;  1RFY A;  3CJH A;  5JCO C;  1AP6 A;  4G27 B;  1Y76 B;  2LFS A;  2AHZ A;  1YXB A;  3RYH B;  5IYB O;  1M4U A;  2VQF O;  4YHH B;  1XNQ B;  4JZG A;  1NVP B;  1J95 A;  4U3J A;  1JX9 A;  4FM1 A;  4KUM A;  2Q8V A;  1FXK A;  4TQD A;  2YSU B; 
#chains in the Genus database with same CATH homology
 4PD4 F;  1KB9 F;  3H1K H;  3L74 H;  3L71 H;  3L75 H;  1SQP H;  1SQV H;  1SQX H;  3CXH F;  3H1L H;  1BGY H;  2IBZ H;  5KLV H;  3CWB H;  4U3F H;  1NTZ H;  1BCC H;  1P84 F;  3TGU H;  1EZV H;  3CX5 F;  2FYU H;  1L0L H;  1PPJ H;  3L73 H;  3H1J H;  1NTK H;  4D6T H;  2BCC H;  3H1H H;  1BE3 H;  1NTM H;  1L0N H;  3L70 H;  3BCC H;  1NU1 H;  1KYO F;  1SQB H;  3H1I H;  1SQQ H;  1PP9 H;  2A06 H;  3L72 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...