3B2EE

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
PGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 67
sequence length 67
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3b2eE00
2CAZC 2JS5A 3QF7A 3CSXA 1SKVA 3ICXA 3SJAC 3QG5A 3THOA 3ZS8C 1NT2B 2P22C 2F66C 1X4TA 3SJBC 3SJCC 3B2EE
chains in the Genus database with same CATH superfamily
4E2LA 3SYAA 3C3SA 5KAIZ 2M6YA 4H37A 4PA3A 4IHJB 1BQ0A 1QBZA 4X66O 4FLUA 3KKYA 2A79B 5IY5B 4ZI7A 4X65B 1N34B 4PA7A 3CCJV 1CEZA 5L3DA 2QJ1A 4DR5B 4GKJO 4NXNO 1WLEA 1SA0B 4W4KA 1SESA 2EULA 1W0JG 4DUYO 1SQQH 2P67A 2NN4A 4YHHB 4LFBO 2OCCB 2JK5C 5EC1C 2ZNJA 2QR4A 4D7SA 3JALA 2QWPB 3WB1A 4JI0O 1MABG 3BPZA 4LF5B 3CCMV 2IW5A 1QLEC 1N33O 1G4YB 2UUBB 2P5OA 3OFNG 3LDDA 4ZHQA 2HLDG 2Q8VA 1MOFA 3CCEV 1MG1A 3L71H 3DC6A 1GN4A 4Z1MG 3UM7A 5IJ0B 1K4CC 2BOBC 5KHJA 3CC4V 2AZ0A 3VQWA 2IU0A 3HKDB 2ZM6O 1SKVA 5FNVB 3WG7C 2AHYA 4DUZB 1AB3A 3AK1A 1XMOO 1S0VA 1Y74A 4JI6B 1XL4A 2D2CB 2IJJA 2Y69B 4DV3O 5BMVB 2PI5A 1JQ0A 3ETQA 4P30A 1FYJA 2G38A 2DOSA 4EFEA 2CGOA 3QVNA 1K8AW 2Q73A 3RBZA 3E35A 2RMKB 3D8CA 4NYKA 2DYRB 2KKWA 1K34A 2HG5C 4YJ2B 5CBFA 3K58A 5D5QA 4MVUA 5B5EZ 3FX7A 3E8FA 4X65O 4IL6Z 1N34O 3RFRA 3RVYA 4KP4A 1VQ7V 4TT3G 4DR5O 3FB7C 1P49A 1TVKA 2ZQMA 1MMMA 4UCRA 5B66Z 3SGIA 3SDLA 4I50A 4O4HB 4YHHO 4F6EA 2WSSG 1NTKH 1H8HG 2UXDB 4FZ1A 1E79G 2Z0AA 3MDSA 4JYCA 3RYHA 4QGPA 3ZN1A 4LF5O 1GRJA 2BOCC 3G71V 2UUBO 5ITZA 4DR4B 4J9ZB 2JJ2G 3CD6V 2XHBA 2F43G 1HR0B 1WB8A 3SR2C 2Q4PA 4ZI7B 3KCXA 1XNQB 2Q9LA 4ZBMA 4RAIA 3W7TA 1GTOA 3ZMTA 3E83A 4JI8B 4DUZO 1RP3B 1J95A 1Q3EA 2DYSC 1ZWIC 3G4SV 4JI6O 3ML0A 4GYCB 4DV0B 5F2VO 2OIEA 1I7FA 2HR3A 3E8BA 3CRCA 5CMUA 1VQ4V 3P3PA 1FXKC 4GT1A 1H38A 3CCRV 4UCVA 1WPBA 3E8GA 4IYIA 1UPGA 2HVKC 4ZKIA 3ZHTA 2ZIMA 4ZHQB 1OZ0A 4QIWF 2QA4V 3U10A 3TGUH 4JI4B 2W6IG 3CP1A 3W7UA 2LP7A 1URFA 3D36A 2OT5A 3CXCU 3APOA 3OTFA 4PDLA 5EBMC 1WN7A 3I56V 5LYJA 2W6JG 2CTPA 4GLXA 3CPWU 1KD1W 1Y74B 1XDCA 4UVBA 4NB5A 5KHIA 2UXDO 1XEQA 2C2AA 4LH6A 4MVMA 3ZHUA 3RYFA 4JTAB 4DR2B 1XBLA 5EC2C 4LNUB 1NQTA 2JGDA 1OCOC 4DR4O 4R6ZA 3BRCA 2P4KA 1HR0O 4J80A 3AG1B 1AR1B 2IJKA 1K9MW 5KUMA 1P7BA 3KZIZ 1XNQO 2EIJB 1TAEA 2B9ZA 1AJQA 2CK3G 2QKSA 1SQBH 3RT3C 1I08A 1TVKB 4X88A 4JI8O 3HKCA 4TQDA 1ORQC 4I50B 5CA3A 1XHXA 4DV0O 3JAMN 1NU1H 1NS1A 1NH2B 4FZ0A 2XNDG 4GZRB 5B3SC 1W2BU 1R3LC 3X2QB 4JI5B 5LL6Y 3JD4A 3SJQC 3RYHB 1QVGU 2BTQA 2ZNIA 3LDEA 3ABLC 1SERA 5ITZB 2CH7A 4PJ0Z 3CX5F 3T1HB 4JI4O 1KP3A 2XAHA 1AI4A 2PUSA 3RYIB 2QWQB 1VARA 3M8AA 5IYZA 2WWWA 2YXHA 3H1HH 1EN6A 1YIJV 5IE9A 1K7DA 2ZE6A 3OR7C 1YHQV 1XREA 5FL7G 4BIUA 3BAAA 3WB0A 1PL0A 1M1KW 4DR2O 4BIZA 1MSDA 1PD3A 3AG7A 4X89A 2YSUB 2XAQA 2EIKC 1YJ9V 3OAAG 5IT9N 1XNRB 4JZ2A 3BY6A 1Q82W 4U7OA 3EVKA 3EHBB 2WAMA 2ZIOA 1R6NA 1O9HA 3CSXA 2VQEB 1NVPD 4RWUA 4MT8A 3LSSA 3AG2B 2EIMB 3LSQA 5IYDO 2RCVA 3OMIB 4FK5C 1H2SB 2QGNA 5LYJB 4I0XA 4K8ZA 4DK1A 2YI9A 3A2FA 1K73W 1SS3A 1ZX3A 2GTAA 1RPOA 4GCZA 4JI5O 2JEUA 2PTMA 1JCHA 1WB7A 4LF4O 1SETA 4I55A 1WPXA 5EBWC 1WP7A 4BIOA 1JPXA 1WP8A 5JCOA 2NNUA 4J9YB 4HBNA 3R65A 3N2GB 3QO7A 1GN3A 3T1HO 1WNSA 1M56C 4ZOLA 2LFRA 4MW8A 3HKBA 5LBQA 3OGIB 2EJ7A 4LF7B 1JMKC 2HVJC 4QNHB 1L0LH 1SQPH 2N04A 3FFQA 2WLKA 1FFXB 2V4DA 2OYQA 1Y4MA 1OCCC 4LR3A 4IT5A 4L8JA 4PV1B 3ZMSA 2EILB 3WFVA 1BCCH 1LNQA 3DTUB 1IURA 2YDEA 3B4SA 1AI7A 3OEHG 4KL1A 1XNRO 2JS5A 3MD0A 2DMXA 1NTZH 4JPRA 4BWAA 4QJFB 1H2GA 1F7YA 2BTQB 3QF7A 4RQEA 3JSLA 4G28B 2VQEO 2CH7B 2Q6AA 4B3MB 3W7SA 1JOYA 1OCRC 3E86A 1NJIW 1L8DA 2N05A 1KUQA 1JJOA 4G27B 3JYCA 1FXHA 4KFMA 2YICA 1G1XB 3HB3B 3JASA 2W0FC 1X4TA 3UT5A 2BE3A 4UCTA 3SPJA 4DO2A 1ZSPA 1QLEB 1F51A 3FYEB 3CRRA 3GWKC 2FMLA 5J2TA 1VF6C 3ZJZA 5IDJA 1PNMA 2EJRA 1B3QA 1GAXA 1GM9A 1BE3H 3CCVV 3CC2V 3FYIB 3JCZA 1RPRA 2LFSA 2RQ6A 1Q81W 4LF7O 2QTOA 1QQCA 3WG7B 2JVDA 3CE2A 2RJZA 3K5MA 4C7UA 1EBOA 1S72V 3L72H 1K5SA 5H2FZ 2XTAA 4I0XB 2AZ2A 5FLXN 4DV6B 4OPAA 1KC8W 1EN5A 1W0KG 5H5NA 5B1NA 3TETA 4CH5A 1Z5WA 3HKDA 4I55B 5FNVA 5HFMA 1FAFA 4IIJB 5EIBD 3MHHC 4GUNA 1LUVA 4YIOA 4B3MO 3SJAC 1DLBA 1FKAO 2UXNA 1OV9A 3HKBB 2PZSA 4DK0A 2YIBD 3AG4B 4JYAB 1QVFU 3T4ZA 5DECA 2Y4TA 4K3AA 4FLWA 2UXBB 3H9VA 1BGYH 3IC9A 3ZMVA 2YIAA 3N27A 3VBBA 4JI7B 3LDCA 1V55C 3ZHQA 3K59A 2CTWA 1MSWD 4BW5A 5B1BC 1Q8IA 1N32B 3ICXA 2WLJA 4XDKA 2OIGA 2DWDC 2DYSB 1AROP 3VOUA 2PYLA 1ZTEA 2QM8A 4AHCA 4I7ZB 3BA8A 3UQ8A 1VMGA 3NR7A 2ZE5A 1K3EA 4DV6O 2X6AA 4B3SB 3JASB 1QR8A 4RO2A 1FXKB 1Q7YW 3CJHA 3UT5B 2QDOA 3CC7V 2RN9A 3ETGA 3B09A 3T2MA 3P30A 3H1JH 2QTSA 4EB6B 5J2TB 4JTDB 2JGUA 4DR6B 1GM7A 2YXYA 4R50A 2HFEC 1OJHA 1LUWA 5IWAB 2DN9A 4CZZA 5BZBA 4JYAO 2CTQA 1IBLB 3L9DA 2YS8A 5LMUB 1AVMA 4W4LA 4J10A 2M7WA 2UXBO 5A9GA 4O4IA 1OCOB 4JI7O 2F1MA 3ZMUA 1I94B 4UV8A 3OR6C 4JTCB 1UFIA 3ABMC 1IXBA 4DV7B 1N32O 1EM1A 1KECA 1X59A 2Q0OC 3AG3C 1U97A 4LNUA 4MS2A 1DGSA 4OGQB 1VQMV 2R9IA 1YTFB 5B3SB 4B3SO 5C93A 1R3IC 1H2NA 2HKOA 3KCYA 3ZRVA 3E2EA 4LP8A 1YF2A 2GUZA 1GO3F 3ABLB 4MTFA 2FKXA 1NH2D 4WFAV 1YITV 3KG2A 4LWSB 4QE9A 3CB2A 4UVAA 3ZIAG 4J7JA 5EK0A 4NTXA 3MHSC 4DR6O 3ASOC 2X0LA 4FM1A 5IWAO 2QM4A 5KHHA 3K04A 5C8YA 3W7WA 2A9HA 3OTOB 3CEIA 4RQFA 2JS3A 1SQVH 1Y76B 4MW3A 3GWOA 1IBLO 1G6UA 5LMUO 2ZCEA 3DXRB 1V9PA 4CH3A 4JAUA 4JI1B 3TK1A 4GX5A 4J41A 2EZOA 1J5EB 4LF8B 3RYIA 2EIKB 4UUJC 5JJEB 1VF6A 1I94O 3CJHB 4UCSA 2ZDIC 1VP7A 1AR4A 3SPCA 5JH7B 4DV1B 4B7KA 2CAZC 4MVRA 1CPYA 3PJSK 2GTSA 5LA6A 4DV7O 5CA1A 4DV5B 1PKXA 4PD4F 3STZC 1Q86W 2A06H 4U3JA 4XDLA 3U11A 1L0NH 3IC7A 2ZT9B 1AP5A 2FTKA 2ILMA 3FKSG 4H0LB 4L87A 3RVZA 2PI4A 1BSMA 5E1AC 2QWRB 4DYLA 4JASA 2RDCA 4O4IB 5IY5C 4AQYB 1XL6A 4UVCA 3J7AU 1OHHG 1U96A 1M56B 4AI8A 3OMAB 2PYJA 3RGBA 4OX9B 1M5IA 4O4LB 2GBOA 4NKGB 3OTOO 4O2BB 2OCCC 3QNEA 2CE4A 1HP8A 3RN4A 1OCCB 2LO1A 2P90A 1I5XA 5EYPB 2DWEC 3N2GA 4JI1O 3CWBH 1AP6A 2ADPA 1J5EO 4LF8O 2ZXWC 3R66A 2V1DA 3CMAV 1NI8A 2WLNA 2PF4E 4R7CA 1KYOF 2UU9B 4QPKA 2ZD9A 2GUZB 4DV1O 2HJFC 4FPPA 4JAVA 1FFXA 1AI6A 2Y0PA 2E3CA 1ZUQA 1FPOA 4FFBA 4DV5O 2UUCB 5KAFZ 3SYPA 1M9NA 1OCRB 4JZGA 1EN4A 3P3NA 2WLMA 2F23A 5CBHA 2R72A 1XHZA 4NTWA 5C8YB 3EFFK 3CCLV 4LFAB 4PDMA 3ZRXA 1HW7A 1LR1A 1GKFA 2L35A 3SYQA 1PNKA 1EZJA 1B04A 1FD9A 5GTIZ 4I9QA 2H8PC 2ITCC 3VQYA 5GONA 2WA4A 4AILC 4XBFA 4AQYO 3ETEA 2Z3YA 3L73H 1BQZA 3UCSC 2KG7A 3H1KH 3RWRD 4BR6A 1L1FA 3Q4HA 4OX9O 2JDIG 4D6TH 1DTOA 3B40A 2F93B 2P06A 5LA6B 5H9CA 3C3TA 5CA1B 3BVOA 4GX2A 3SJBC 4HAMA 3K5LA 2CUGA 3L75H 3BFRA 4U3JB 1BMFG 1F23A 1R6KA 2JIZG 4WF9V 1A32A 3STLC 4DV2B 1JX9A 1Q43A 5FPRA 1JVMA 1QU7A 3UKMA 3BABA 3JARB 1BL8A 2WLIB 2UXCB 3TJTA 3S3WA 2QWNB 4DV4B 1JJ2U 1KQSU 2UU9O 4PDRA 3ZCCA 2YEVA 4IYHA 1XMQB 4GX0A 4LH7A 2KSDA 2UUCO 4LBEC 1JFFA 3BEHA 2ARHA 3JATB 1I0HA 2YIDA 3E89A 2DQ0A 4HNAA 4LFAO 3IJ4A 5CN0A 1AI5A 1MNGA 4IIJA 2W0XA 2RNBA 1MZEA 2GSMB 2P7TC 1HNZB 5LGTA 1R6TA 1XUQA 2QWOB 1QCEA 2ZE7A 3VQVA 1OCZC 3WU2Z 3ZRWB 1HNXB 4MVOA 4H13B 2Q7GA 1GM8A 1GN2A 3JD2A 4DRXB 1IVSA 5H6QA 1S77D 4TUYB 5B1BB 4U7NA 2ATKC 4B7EA 4LCUC 4FFBB 3GB7C 4FIPC 5LP6C 2KB1A 2EX3A 5L3GA 1PNLA 5BY1A 3T1CA 3ZBHA 2A0LA 1EFRG 2IJHA 2LQTA 4DV2O 1P7GA 5TISZ 3A0RA 5K1PA 3K5OA 1VQKV 2BCCH 1IXMA 4Z2WA 2CTRA 1NKDA 2UXCO 1M90W 2ZDIA 1XILA 1VF7A 5JQGA 1BZKA 4DV4O 2QEXV 1F4NA 5GONB 1SC5B 4D7TA 1TUBA 1VIBA 2BTOA 1XMQO 3K06A 2KG7B 1PPJH 2F4VB 1IZ3A 3Q4HB 5L3EA 1TA8A 2QM7A 3CHXA 3G80A 3ASNC 1FXKA 1NBMG 4NR1A 2MW2B 3CRQA 5JVDA 4K35A 4BAYA 4EB6A 1XOUA 3IFXA 3OM3B 1R3JC 1BHAA 1ZLZA 1HNZO 1WA8A 1DF4A 5LGUA 4H44B 4IGGA 3K08A 1VQPV 1HNXO 4ICGA 4TV9A 3SJCC 2Q7HA 3LNNA 2F66C 2YEVB 2VWJA 4O4JA 4FMTA 2HP8A 2ZE8A 3PN1A 2E5LB 3AG3B 1JFFB 2YC0A 1Z5VA 2X6BA 3CYOA 1M57C 1YJNV 4WBNA 2P22C 3K3WA 4HNAB 1GN6A 2OWOA 5BXZA 1TUEB 1ENVA 4FLZA 1Q5OA 1Q6IA 2PGGA 1WJZA 2P4VA 4EFBA 4WFBV 3S3XA 5KUKA 1Q6HA 1E1QG 1YCIA 4JGSA 1AJPA 4DW1A 3B2EE 1YTFD 2YUAA 1RM1C 2KQXA 3ZX6A 4GKKB 4WFFA 2F4VO 3OD4A 3AG2C 3ASOB 4CBCA 2IH3C 4X1IA 2LGQA 4X64B 1R1BA 5KA6A 4QPJA 4YJ3B 3ABUA 5KX5A 5A2QN 3K0DA 2FL4A 4KUMA 4LWSA 3OGCC 1NR1A 4WFEA 2NLJC 1KMIZ 1AJNA 4PI2A 2B1IA 1KBHA 2JJ1G 4BW9A 1PV0A 3SPIA 2ZKOA 4J7KA 2DQ3A 3FD9A 4I9WA 2A7WA 5JQGB 2Q68A 2IH1C 4CS3A 4K8XA 1Y76A 4JAAA 3JAWA 3VQXA 5IYBO 2GV9A 3DXRA 4X9QA 1TUBB 3K0GA 1YSCA 2E75B 5K1XA 4X1YA 3G6EV 1SZTA 3HKEB 4CC6A 3B8MA 1NR7A 2XT9A 5LOVB 3APQA 3ZMZA 4MTXA 2EILC 5IJ9A 1PL4A 3OE7G 5JH7A 5JVDB 5CA0A 2R70A 4I4TA 2Y4UA 1EZVH 1RSOA 2MK3A 3JD3A 4UCUA 1WA8B 4R8CA 4FM0A 1P84F 1NT2B 5JWPA 1R73A 2FYUH 2Y0IA 4TV9B 4GKKO 1H2LA 1VQOV 3ABKC 4P9PA 3RYCB 2ZINA 4X64O 1TGOA 1ZL8B 3AK2A 4O4JB 3M7MX 3N2KA 3QTCA 4CH4A 3OEEG 1D5NA 3SPHA 3O9OA 3M99B 4JYYA 3CS5A 4UB8Z 3AK3A 4WBNB 5B1AC 4DR1B 4J7ZA 3T4DA 4X20B 4PDVA 2DW4A 3GVMA 2ZXWB 4O4LA 2Y48A 1CP9A 4ABMA 1H2MA 1YDXA 1B06A 4O2BA 1Q90D 3E22B 4CS4A 4EKWA 2AW9A 3OW2U 5EYPA 4J42A 4F6RB 3OT7A 1K97A 1JR9A 1Q6UA 4PI0A 5LP6A 2EINC 3CRMA 1XI1A 4X1IB 1HDJA 1BT8A 3BA9A 3ZS8C 3ZHVA 3A0BZ 2XUMA 4NXMB 4PA6A 3TXQA 3H01A 4PHZA 3K03A 4B3TB 5KX5B 4LF9B 1UJWB 2IM9A 2JRIA 1W59A 4U3FH 4Q20A 5JCOC 1VQ8V 1V54C 4NTYA 4FLTA 1NZ6A 2X6CA 3A0HZ 2HEPA 3RW0A 3JAWB 1Y67A 3I5DA 1IBMB 5J2UB 3AG4C 1CXZB 1IDSA 3K79A 4A5UB 4X1YB 3H1IH 2VWKA 4DXWA 4E4EA 4HYOA 4X1KB 3MAQA 2ITDC 2QKAA 5IJ9B 4F4LA 5LHHA 1YVWA 4DR1O 1HNWB 2IU3A 2CGNA 2K9PA 3JD1A 2E76B 2CDYA 3HR0A 5E79Z 4UCOA 5CA0B 5L3BA 2LJ2A 4I4TB 2Q5ZA 1KKCA 1RSOB 4LFCB 1GH6A 2F95B 2OTJV 1FS0G 1VF5B 5GTHZ 3ETDA 3BCCH 4H33A 1PP9H 1AILA 4MTOA 1SQGA 2YI8A 3DC5A 2HHHB 1YJWV 1AR5A 3H1LH 3FB6C 3JARA 3C90A 2XASA 4KHPB 1THZA 4NXMO 2WLIA 2XAJA 4RUFA 2R9RB 4WFHA 4TOIA 4FM2A 5IYCO 3DSQA 3N2KB 1MA1A 3ZHRA 2OTLV 2Z5UA 4B3TO 3JALB 5AG2A 4LF9O 2D3OW 1N36B 5H6RA 2E74B 1P4RA 3CMEV 1SQXH 4UFZA 4DR3B 2GHYA 3UO2A 1OCZB 3JATA 2B5UA 5EZYA 1H8EG 4B08A 4FVMA 4KXRA 5LXTA 3IAYA 1Y66A 4P2ZA 1O9GA 1YXBA 3U0ZA 1IBMO 2QE7G 3THOA 4YY3B 3F5WC 2FB5A 2DE0X 1Y6XA 5LP6B 1N8RW 4HZ3A 3OUSA 2N74A 3ZRWA 1F4MA 2X7RB 1JA8A 3L74H 5CBGA 1IBKB 4DRXA 1N4CA 1HNWO 4NVPA 4TUYA 1VQNV 3LSUA 4TQFA 1D2DA 1KKDA 1M93A 1QR9A 4LFCO 1BS3A 4B3RB 5LGNA 1ZAUA 2H3OA 4TWKA 2Y69C 5DN6G 5EIBC 2WPDG 2VS0A 2XAFA 3JAKA 2HHHO 5EBLC 3G67A 3JSNA 2BSKA 2VQFB 3ASNB 2K1EA 4KHPO 2DYRC 1R3KC 2VRZA 4PELA 1N36O 3K57A 2Q0AA 3F7YC 4LF4B 4ASUG 2O57A 4LF6B 4DR3O 3BHPA 2NR5A 5LHGA 1K5QA 5KMGA 2L6LA 3B77A 1Z2GA 5KA5A 4CS2A 1XQ8A 4FFKA 4MTGA 4P9OA 1E1RG 3JCUZ 4EEQA 1T5EA 3D3QA 4FLXA 5HFLA 4YY3O 1H2KA 4I5SA 2ADQB 1VQLV 1SQFA 3F7VC 5KLVH 1IX9A 1M57B 1DF5A 2P6JA 3CCUV 2OCHA 5KHKA 1IBKO 5L3FA 1I5YA 2ZR2A 4DR7B 2Q69A 3J80N 3K9AA 3P32A 3QO8A 4MSWC 4UV9A 4YXWG 1WAZA 3E8HA 3TXSA 4XDJA 1KU9A 3G6BA 4B3RO 3K9SA 5LMNB 1RM1B 5EZYB 5JJJB 1QNMA 4N23A 3CCQV 5LXTB 3SPGA 2VQFO 3FAVA 1NTMH 4FLVA 3JD0A 2YXLA 4X8AA 4J11A 4K0KB 2AGAA 4OPHA 3ZEDA 5BR8B 1S3JA 2ODMA 1VEWA 3LUTB 2Q67A 4TV8A 3RYFB 3ZRSA 4CH6A 4ZIBA 1V55B 3EXAA 2ZR3A 4LF6O 1FFTB 3HPLC 4FLYA 2QSAA 2JGDB 1US6A 4X62B 4YIPA 3ZHSA 3B8NA 2V7QG 4Z1VA 1GMGA 3TCUA 4YJ3A 4DW0A 2A3QA 1D5AA 3CCSV 2R9AA 3AEIA 3W7XA 1FJGB 2LW7A 4MVZA 2WLHA 2AHZA 4JF3A 3D3IA 3QO5A 3HKCB 3JAKB 4JYBA 1SZXA 2BSKB 1RFYA 2WA3A 1S5HC 3SYOA 4JI3B 3AG1C 1M4UA 3LNMB 3ZN0A 2LW1A 3O65A 5CB4A 3J81N 3WB2A 4DR7O 2EIJC 5DEDA 2AXTZ 3OMNB 1MZFA 3CRAA 2WLLA 4GX1A 3HKEA 5KMGB 4JI2B 5LOVA 3I55V 5LMNO 4O2AA 1ROPA 1YI2V 2UXXA 3FB5C 5GW7A 3ABKB 3SYCA 5FPOA 3QG5A 4UXNA 1QHTA 3X2QC 1VQ9V 2QKCA 5IYZB 4JV5B 4IHJA 4K0KO 1K92A 5KHGA 1QLNA 5BR8O 3T1YB 1VQ6V 2GDSA 3OUFA 1S5JA 5B1AB 3CXHF 3FB8C 5D5PA 1SA0A 4G2KA 3ABMB 3RYCA 2ETNA 4X62O 1G8MA 2EBOA 5J9PC 2UUAB 1ZL8A 4WFGA 2Q7EA 1YZBA 4LC1A 2XAGA 4FJCC 3K5NA 4OXSA 1DK1A 1FJGO 2EINB 4X20A 2B1GA 4MVSA 1NVPB 5L3CA 2XOKG 1GK9A 4WCEV 3FAVB 4JI3O 2DJVA 4X66B 1S76D 1B6QA 1N0NA 3E22A 1N0JA 1K4DC 5IJ0A 4CC5A 4RUEA 3ABTA 1SF9A 3UO3A 4F6RA 4TV8B 5B1OA 4GKJB 3A8TA 4NXNB 1COWG 1HWYA 4MVQA 2EIMC 4DUYB 3D36C 1V54B 4JI2O 2JEXA 2PY5A 5BMVA 2H94A 4LFBB 1KP2A 4ZOLB 2HJDA 3L70H 1SRYA 1BHBA 4PA4A 4JI0B 4JV5O 1YEWA 3F5TA 2IBZH 5JJNB 1N33B 4YJ2A 1PM9A 1S5LZ 2YIBA 4N21A 3T1YO 4UB6Z 3IGAC 2LGWA 3NXSA 5CB4B 4QE7A 3DGEA 5LHIA 2UUAO 1FXVA 4O4HA 4Q6GA 5J2UA 2ZM6B 1KB9F 2E5LO 2WLLB 1VQ5V 4TSFG 1XMOB 2EZPA 1K33A 4X1KA 4PA9A 4DV3B 2IJIA 4O2AB 5DM6V
chains in the Genus database with same CATH topology
1JJOA 5IJ9B 1HNWB 3RWRD 4UCOA 5CA0B 4IHJB 2F93B 5LA6B 4FLUA 4I4TB 3JASA 5CA1B 4LFCB 1X4TA 2F95B 3SJBC 4ZI7A 3UT5A 4X65B 1N34B 4UCTA 3K5LA 4U3JB 2QJ1A 4DR5B 1SA0B 1SQGA 5J2TA 2YI8A 2HHHB 4DV2B 3JARA 1Q43A 5FPRA 4KHPB 3BABA 3JARB 4YHHB 2RQ6A 2ZNJA 4TOIA 2UXCB 4FM2A 3DSQA 3N2KB 4D7SA 3JALA 1QQCA 4DV4B 3WB1A 3JALB 1N36B 2JVDA 3BPZA 2RJZA 3K5MA 4LF5B 2UUBB 1XMQB 4UFZA 4LH7A 4DR3B 2P5OA 4ZHQA 1JFFA 3JATA 3JATB 5EZYA 4DV6B 4B08A 4FVMA 4HNAA 5IJ0B 4CH5A 5KHJA 5LXTA 3IAYA 3VQWA 1Z5WA 3HKDA 4I55B 4IIJA 5FNVA 1O9GA 3HKDB 3U0ZA 1SKVA 4IIJB 5FNVB 3THOA 4YY3B 4DUZB 5EIBD 5LP6B 1HNZB 3SJAC 4JI6B 5BMVB 3VQVA 3ETQA 1HNXB 3HKBB 1IBKB 4EFEA 4DRXA 2Q7GA 2PZSA 4DRXB 4NVPA 4TUYA 4DK0A 2YIBD 4TQFA 4TUYB 4JYAB 2KKWA 1M93A 4YJ2B 3K58A 5D5QA 4FFBB 4FLWA 4B3RB 2UXBB 5LP6C 3RFRA 2EX3A 1ZAUA 2YIAA 1P49A 1TVKA 4JI7B 4UCRA 5EIBC 3JAKA 3SGIA 4I50A 3JSNA 2VQFB 5K1PA 3K59A 3K5OA 4O4HB 1Q8IA 1N32B 3ICXA 1VF7A 5JQGA 2UXDB 5GONB 3RYHA 3K57A 2Q0AA 4D7TA 4LF4B 1TUBA 2BTOA 5ITZA 2PYLA 4AHCA 3BHPA 4LF6B 5KMGA 4DR4B 3BA8A 2F4VB 2XHBA 3UQ8A 1HR0B 1TA8A 3CHXA 4B3SB 3JASB 3SR2C 4CS2A 1XQ8A 4ZI7B 3UT5B 1XNQB 4EEQA 1T5EA 4FLXA 5JVDA 4EB6A 4JI8B 1Q3EA 4EB6B 5J2TB 1SQFA 2JGUA 4GYCB 4DV0B 4DR6B 5KHKA 1I7FA 4TV9A 3SJCC 5IWAB 4DR7B 2Q7HA 3LNNA 2F66C 2VWJA 4UCVA 1IBLB 1WPBA 4O4JA 5LMUB 1KU9A 3PN1A 2E5LB 2ZIMA 4ZHQB 1JFFB 1Z5VA 3U10A 5LMNB 4JI4B 5EZYB 5JJJB 4O4IA 2F1MA 4WBNA 2P22C 1I94B 4HNAB 3OTFA 5LXTB 1WN7A 2OWOA 4FLZA 5LYJA 4FLVA 1Q5OA 4GLXA 2YXLA 2PGGA 4EFBA 4DV7B 4K0KB 5KHIA 3ZEDA 5BR8B 4LH6A 3RYFA 4DR2B 4LNUA 4TV8A 3RYFB 4CH6A 3B2EE 4LNUB 4ZIBA 1DGSA 4GKKB 4FLYA 3BRCA 4X62B 4X1IA 4X64B 4YJ3A 4YJ3B 1D5AA 1TAEA 5KX5A 2R9AA 1FJGB 1TVKB 3HKCA 4TQDA 3HKCB 3CB2A 3JAKB 1KMIZ 4I50B 1XHXA 4PI2A 4BW9A 4JI3B 4FM1A 1M4UA 2QM4A 5JQGB 5KHHA 4JI5B 4CS3A 5C8YA 5CB4A 3WB2A 3OTOB 4K8XA 3RYHB 3JAWA 3VQXA 2BTQA 2ZNIA 2GV9A 1TUBB 5ITZB 1G6UA 3HKEA 2ZCEA 1V9PA 5K1XA 4X1YA 5KMGB 4CH3A 3HKEB 4JI1B 4CC6A 4JI2B 5LOVA 3T1HB 5LOVB 1J5EB 4O2AA 4LF8B 3RYIA 5JJEB 3RYIB 2PUSA 5IJ9A 5JH7A 4UCSA 5FPOA 5IYZA 3QG5A 1QHTA 5JH7B 4DV1B 5IYZB 4JV5B 5JVDB 2CAZC 5CA0A 4IHJA 5LA6A 2R70A 4I4TA 5CA1A 1RSOA 4DV5B 4UCUA 5KHGA 3BAAA 3WB0A 3T1YB 4FM0A 1NT2B 4U3JA 1S5JA 5D5PA 4TV9B 1SA0A 3U11A 1XNRB 3RYCA 3RYCB 2ZINA 2UUAB 2Q7EA 1TGOA 2ZIOA 4O4JB 3CSXA 1O9HA 3M7MX 2VQEB 3K5NA 3N2KA 3QTCA 4CH4A 4O4IB 4AQYB 4X20A 4WBNB 4DR1B 4X20B 1H2SB 2PYJA 5LYJB 4K8ZA 3RGBA 4O4LA 4OX9B 4DK1A 2YI9A 1M5IA 3A2FA 4O4LB 4X66B 3E22A 4O2BA 2PTMA 5IJ0A 3E22B 4O2BB 4CC5A 4CS4A 4I55A 4F6RA 4TV8B 4GKJB 4NXNB 5EYPA 5JCOA 4F6RB 5EYPB 3N2GA 4PI0A 5LP6A 4HBNA 4DUYB 3N2GB 1XI1A 4X1IB 1WNSA 2PY5A 5BMVA 3BA9A 4NXMB 4ZOLA 3ZS8C 4LFBB 3HKBA 4ZOLB 4PHZA 4LF7B 1JMKC 2UU9B 4B3TB 5KX5B 4JI0B 4LF9B 3FFQA 1FFXA 2IM9A 1YEWA 5JJNB 1N33B 4YJ2A 1FFXB 2E3CA 2V4DA 4FFBA 2OYQA 4LR3A 2UUCB 2YIBA 4L8JA 5JCOC 2R72A 4FLTA 1XHZA 4KL1A 5C8YB 5CB4B 4LFAB 2JS5A 2HEPA 4BWAA 1HW7A 4O4HA 4Q6GA 3JAWB 5J2UA 2BTQB 2ZM6B 1IBMB 3QF7A 5J2UB 1B04A 3JSLA 1XMOB 4X1YB 4B3MB 4I9QA 2VWKA 4X1KA 3VQYA 5GONA 4DV3B 4O2AB 4AILC 4X1KB 3MAQA 1L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAZ C;  2JS5 A;  3QF7 A;  3CSX A;  1SKV A;  3ICX A;  3SJA C;  3QG5 A;  3THO A;  3ZS8 C;  1NT2 B;  2P22 C;  2F66 C;  1X4T A;  3SJB C;  3SJC C;  3B2E E; 
#chains in the Genus database with same CATH topology
 4E2L A;  3SYA A;  3C3S A;  5KAI Z;  2M6Y A;  4H37 A;  4PA3 A;  4IHJ B;  1BQ0 A;  1QBZ A;  4X66 O;  4FLU A;  3KKY A;  2A79 B;  5IY5 B;  4ZI7 A;  4X65 B;  1N34 B;  4PA7 A;  3CCJ V;  1CEZ A;  5L3D A;  2QJ1 A;  4DR5 B;  4GKJ O;  4NXN O;  1WLE A;  1SA0 B;  4W4K A;  1SES A;  2EUL A;  1W0J G;  4DUY O;  1SQQ H;  2P67 A;  2NN4 A;  4YHH B;  4LFB O;  2OCC B;  2JK5 C;  5EC1 C;  2ZNJ A;  2QR4 A;  4D7S A;  3JAL A;  2QWP B;  3WB1 A;  4JI0 O;  1MAB G;  3BPZ A;  4LF5 B;  3CCM V;  2IW5 A;  1QLE C;  1N33 O;  1G4Y B;  2UUB B;  2P5O A;  3OFN G;  3LDD A;  4ZHQ A;  2HLD G;  2Q8V A;  1MOF A;  3CCE V;  1MG1 A;  3L71 H;  3DC6 A;  1GN4 A;  4Z1M G;  3UM7 A;  5IJ0 B;  1K4C C;  2BOB C;  5KHJ A;  3CC4 V;  2AZ0 A;  3VQW A;  2IU0 A;  3HKD B;  2ZM6 O;  1SKV A;  5FNV B;  3WG7 C;  2AHY A;  4DUZ B;  1AB3 A;  3AK1 A;  1XMO O;  1S0V A;  1Y74 A;  4JI6 B;  1XL4 A;  2D2C B;  2IJJ A;  2Y69 B;  4DV3 O;  5BMV B;  2PI5 A;  1JQ0 A;  3ETQ A;  4P30 A;  1FYJ A;  2G38 A;  2DOS A;  4EFE A;  2CGO A;  3QVN A;  1K8A W;  2Q73 A;  3RBZ A;  3E35 A;  2RMK B;  3D8C A;  4NYK A;  2DYR B;  2KKW A;  1K34 A;  2HG5 C;  4YJ2 B;  5CBF A;  3K58 A;  5D5Q A;  4MVU A;  5B5E Z;  3FX7 A;  3E8F A;  4X65 O;  4IL6 Z;  1N34 O;  3RFR A;  3RVY A;  4KP4 A;  1VQ7 V;  4TT3 G;  4DR5 O;  3FB7 C;  1P49 A;  1TVK A;  2ZQM A;  1MMM A;  4UCR A;  5B66 Z;  3SGI A;  3SDL A;  4I50 A;  4O4H B;  4YHH O;  4F6E A;  2WSS G;  1NTK H;  1H8H G;  2UXD B;  4FZ1 A;  1E79 G;  2Z0A A;  3MDS A;  4JYC A;  3RYH A;  4QGP A;  3ZN1 A;  4LF5 O;  1GRJ A;  2BOC C;  3G71 V;  2UUB O;  5ITZ A;  4DR4 B;  4J9Z B;  2JJ2 G;  3CD6 V;  2XHB A;  2F43 G;  1HR0 B;  1WB8 A;  3SR2 C;  2Q4P A;  4ZI7 B;  3KCX A;  1XNQ B;  2Q9L A;  4ZBM A;  4RAI A;  3W7T A;  1GTO A;  3ZMT A;  3E83 A;  4JI8 B;  4DUZ O;  1RP3 B;  1J95 A;  1Q3E A;  2DYS C;  1ZWI C;  3G4S V;  4JI6 O;  3ML0 A;  4GYC B;  4DV0 B;  5F2V O;  2OIE A;  1I7F A;  2HR3 A;  3E8B A;  3CRC A;  5CMU A;  1VQ4 V;  3P3P A;  1FXK C;  4GT1 A;  1H38 A;  3CCR V;  4UCV A;  1WPB A;  3E8G A;  4IYI A;  1UPG A;  2HVK C;  4ZKI A;  3ZHT A;  2ZIM A;  4ZHQ B;  1OZ0 A;  4QIW F;  2QA4 V;  3U10 A;  3TGU H;  4JI4 B;  2W6I G;  3CP1 A;  3W7U A;  2LP7 A;  1URF A;  3D36 A;  2OT5 A;  3CXC U;  3APO A;  3OTF A;  4PDL A;  5EBM C;  1WN7 A;  3I56 V;  5LYJ A;  2W6J G;  2CTP A;  4GLX A;  3CPW U;  1KD1 W;  1Y74 B;  1XDC A;  4UVB A;  4NB5 A;  5KHI A;  2UXD O;  1XEQ A;  2C2A A;  4LH6 A;  4MVM A;  3ZHU A;  3RYF A;  4JTA B;  4DR2 B;  1XBL A;  5EC2 C;  4LNU B;  1NQT A;  2JGD A;  1OCO C;  4DR4 O;  4R6Z A;  3BRC A;  2P4K A;  1HR0 O;  4J80 A;  3AG1 B;  1AR1 B;  2IJK A;  1K9M W;  5KUM A;  1P7B A;  3KZI Z;  1XNQ O;  2EIJ B;  1TAE A;  2B9Z A;  1AJQ A;  2CK3 G;  2QKS A;  1SQB H;  3RT3 C;  1I08 A;  1TVK B;  4X88 A;  4JI8 O;  3HKC A;  4TQD A;  1ORQ C;  4I50 B;  5CA3 A;  1XHX A;  4DV0 O;  3JAM N;  1NU1 H;  1NS1 A;  1NH2 B;  4FZ0 A;  2XND G;  4GZR B;  5B3S C;  1W2B U;  1R3L C;  3X2Q B;  4JI5 B;  5LL6 Y;  3JD4 A;  3SJQ C;  3RYH B;  1QVG U;  2BTQ A;  2ZNI A;  3LDE A;  3ABL C;  1SER A;  5ITZ B;  2CH7 A;  4PJ0 Z;  3CX5 F;  3T1H B;  4JI4 O;  1KP3 A;  2XAH A;  1AI4 A;  2PUS A;  3RYI B;  2QWQ B;  1VAR A;  3M8A A;  5IYZ A;  2WWW A;  2YXH A;  3H1H H;  1EN6 A;  1YIJ V;  5IE9 A;  1K7D A;  2ZE6 A;  3OR7 C;  1YHQ V;  1XRE A;  5FL7 G;  4BIU A;  3BAA A;  3WB0 A;  1PL0 A;  1M1K W;  4DR2 O;  4BIZ A;  1MSD A;  1PD3 A;  3AG7 A;  4X89 A;  2YSU B;  2XAQ A;  2EIK C;  1YJ9 V;  3OAA G;  5IT9 N;  1XNR B;  4JZ2 A;  3BY6 A;  1Q82 W;  4U7O A;  3EVK A;  3EHB B;  2WAM A;  2ZIO A;  1R6N A;  1O9H A;  3CSX A;  2VQE B;  1NVP D;  4RWU A;  4MT8 A;  3LSS A;  3AG2 B;  2EIM B;  3LSQ A;  5IYD O;  2RCV A;  3OMI B;  4FK5 C;  1H2S B;  2QGN A;  5LYJ B;  4I0X A;  4K8Z A;  4DK1 A;  2YI9 A;  3A2F A;  1K73 W;  1SS3 A;  1ZX3 A;  2GTA A;  1RPO A;  4GCZ A;  4JI5 O;  2JEU A;  2PTM A;  1JCH A;  1WB7 A;  4LF4 O;  1SET A;  4I55 A;  1WPX A;  5EBW C;  1WP7 A;  4BIO A;  1JPX A;  1WP8 A;  5JCO A;  2NNU A;  4J9Y B;  4HBN A;  3R65 A;  3N2G B;  3QO7 A;  1GN3 A;  3T1H O;  1WNS A;  1M56 C;  4ZOL A;  2LFR A;  4MW8 A;  3HKB A;  5LBQ A;  3OGI B;  2EJ7 A;  4LF7 B;  1JMK C;  2HVJ C;  4QNH B;  1L0L H;  1SQP H;  2N04 A;  3FFQ A;  2WLK A;  1FFX B;  2V4D A;  2OYQ A;  1Y4M A;  1OCC C;  4LR3 A;  4IT5 A;  4L8J A;  4PV1 B;  3ZMS A;  2EIL B;  3WFV A;  1BCC H;  1LNQ A;  3DTU B;  1IUR A;  2YDE A;  3B4S A;  1AI7 A;  3OEH G;  4KL1 A;  1XNR O;  2JS5 A;  3MD0 A;  2DMX A;  1NTZ H;  4JPR A;  4BWA A;  4QJF B;  1H2G A;  1F7Y A;  2BTQ B;  3QF7 A;  4RQE A;  3JSL A;  4G28 B;  2VQE O;  2CH7 B;  2Q6A A;  4B3M B;  3W7S A;  1JOY A;  1OCR C;  3E86 A;  1NJI W;  1L8D A;  2N05 A;  1KUQ A;  1JJO A;  4G27 B;  3JYC A;  1FXH A;  4KFM A;  2YIC A;  1G1X B;  3HB3 B;  3JAS A;  2W0F C;  1X4T A;  3UT5 A;  2BE3 A;  4UCT A;  3SPJ A;  4DO2 A;  1ZSP A;  1QLE B;  1F51 A;  3FYE B;  3CRR A;  3GWK C;  2FML A;  5J2T A;  1VF6 C;  3ZJZ A;  5IDJ A;  1PNM A;  2EJR A;  1B3Q A;  1GAX A;  1GM9 A;  1BE3 H;  3CCV V;  3CC2 V;  3FYI B;  3JCZ A;  1RPR A;  2LFS A;  2RQ6 A;  1Q81 W;  4LF7 O;  2QTO A;  1QQC A;  3WG7 B;  2JVD A;  3CE2 A;  2RJZ A;  3K5M A;  4C7U A;  1EBO A;  1S72 V;  3L72 H;  1K5S A;  5H2F Z;  2XTA A;  4I0X B;  2AZ2 A;  5FLX N;  4DV6 B;  4OPA A;  1KC8 W;  1EN5 A;  1W0K G;  5H5N A;  5B1N A;  3TET A;  4CH5 A;  1Z5W A;  3HKD A;  4I55 B;  5FNV A;  5HFM A;  1FAF A;  4IIJ B;  5EIB D;  3MHH C;  4GUN A;  1LUV A;  4YIO A;  4B3M O;  3SJA C;  1DLB A;  1FKA O;  2UXN A;  1OV9 A;  3HKB B;  2PZS A;  4DK0 A;  2YIB D;  3AG4 B;  4JYA B;  1QVF U;  3T4Z A;  5DEC A;  2Y4T A;  4K3A A;  4FLW A;  2UXB B;  3H9V A;  1BGY H;  3IC9 A;  3ZMV A;  2YIA A;  3N27 A;  3VBB A;  4JI7 B;  3LDC A;  1V55 C;  3ZHQ A;  3K59 A;  2CTW A;  1MSW D;  4BW5 A;  5B1B C;  1Q8I A;  1N32 B;  3ICX A;  2WLJ A;  4XDK A;  2OIG A;  2DWD C;  2DYS B;  1ARO P;  3VOU A;  2PYL A;  1ZTE A;  2QM8 A;  4AHC A;  4I7Z B;  3BA8 A;  3UQ8 A;  1VMG A;  3NR7 A;  2ZE5 A;  1K3E A;  4DV6 O;  2X6A A;  4B3S B;  3JAS B;  1QR8 A;  4RO2 A;  1FXK B;  1Q7Y W;  3CJH A;  3UT5 B;  2QDO A;  3CC7 V;  2RN9 A;  3ETG A;  3B09 A;  3T2M A;  3P30 A;  3H1J H;  2QTS A;  4EB6 B;  5J2T B;  4JTD B;  2JGU A;  4DR6 B;  1GM7 A;  2YXY A;  4R50 A;  2HFE C;  1OJH A;  1LUW A;  5IWA B;  2DN9 A;  4CZZ A;  5BZB A;  4JYA O;  2CTQ A;  1IBL B;  3L9D A;  2YS8 A;  5LMU B;  1AVM A;  4W4L A;  4J10 A;  2M7W A;  2UXB O;  5A9G A;  4O4I A;  1OCO B;  4JI7 O;  2F1M A;  3ZMU A;  1I94 B;  4UV8 A;  3OR6 C;  4JTC B;  1UFI A;  3ABM C;  1IXB A;  4DV7 B;  1N32 O;  1EM1 A;  1KEC A;  1X59 A;  2Q0O C;  3AG3 C;  1U97 A;  4LNU A;  4MS2 A;  1DGS A;  4OGQ B;  1VQM V;  2R9I A;  1YTF B;  5B3S B;  4B3S O;  5C93 A;  1R3I C;  1H2N A;  2HKO A;  3KCY A;  3ZRV A;  3E2E A;  4LP8 A;  1YF2 A;  2GUZ A;  1GO3 F;  3ABL B;  4MTF A;  2FKX A;  1NH2 D;  4WFA V;  1YIT V;  3KG2 A;  4LWS B;  4QE9 A;  3CB2 A;  4UVA A;  3ZIA G;  4J7J A;  5EK0 A;  4NTX A;  3MHS C;  4DR6 O;  3ASO C;  2X0L A;  4FM1 A;  5IWA O;  2QM4 A;  5KHH A;  3K04 A;  5C8Y A;  3W7W A;  2A9H A;  3OTO B;  3CEI A;  4RQF A;  2JS3 A;  1SQV H;  1Y76 B;  4MW3 A;  3GWO A;  1IBL O;  1G6U A;  5LMU O;  2ZCE A;  3DXR B;  1V9P A;  4CH3 A;  4JAU A;  4JI1 B;  3TK1 A;  4GX5 A;  4J41 A;  2EZO A;  1J5E B;  4LF8 B;  3RYI A;  2EIK B;  4UUJ C;  5JJE B;  1VF6 A;  1I94 O;  3CJH B;  4UCS A;  2ZDI C;  1VP7 A;  1AR4 A;  3SPC A;  5JH7 B;  4DV1 B;  4B7K A;  2CAZ C;  4MVR A;  1CPY A;  3PJS K;  2GTS A;  5LA6 A;  4DV7 O;  5CA1 A;  4DV5 B;  1PKX A;  4PD4 F;  3STZ C;  1Q86 W;  2A06 H;  4U3J A;  4XDL A;  3U11 A;  1L0N H;  3IC7 A;  2ZT9 B;  1AP5 A;  2FTK A;  2ILM A;  3FKS G;  4H0L B;  4L87 A;  3RVZ A;  2PI4 A;  1BSM A;  5E1A C;  2QWR B;  4DYL A;  4JAS A;  2RDC A;  4O4I B;  5IY5 C;  4AQY B;  1XL6 A;  4UVC A;  3J7A U;  1OHH G;  1U96 A;  1M56 B;  4AI8 A;  3OMA B;  2PYJ A;  3RGB A;  4OX9 B;  1M5I A;  4O4L B;  2GBO A;  4NKG B;  3OTO O;  4O2B B;  2OCC C;  3QNE A;  2CE4 A;  1HP8 A;  3RN4 A;  1OCC B;  2LO1 A;  2P90 A;  1I5X A;  5EYP B;  2DWE C;  3N2G A;  4JI1 O;  3CWB H;  1AP6 A;  2ADP A;  1J5E O;  4LF8 O;  2ZXW C;  3R66 A;  2V1D A;  3CMA V;  1NI8 A;  2WLN A;  2PF4 E;  4R7C A;  1KYO F;  2UU9 B;  4QPK A;  2ZD9 A;  2GUZ B;  4DV1 O;  2HJF C;  4FPP A;  4JAV A;  1FFX A;  1AI6 A;  2Y0P A;  2E3C A;  1ZUQ A;  1FPO A;  4FFB A;  4DV5 O;  2UUC B;  5KAF Z;  3SYP A;  1M9N A;  1OCR B;  4JZG A;  1EN4 A;  3P3N A;  2WLM A;  2F23 A;  5CBH A;  2R72 A;  1XHZ A;  4NTW A;  5C8Y B;  3EFF K;  3CCL V;  4LFA B;  4PDM A;  3ZRX A;  1HW7 A;  1LR1 A;  1GKF A;  2L35 A;  3SYQ A;  1PNK A;  1EZJ A;  1B04 A;  1FD9 A;  5GTI Z;  4I9Q A;  2H8P C;  2ITC C;  3VQY A;  5GON A;  2WA4 A;  4AIL C;  4XBF A;  4AQY O;  3ETE A;  2Z3Y A;  3L73 H;  1BQZ A;  3UCS C;  2KG7 A;  3H1K H;  3RWR D;  4BR6 A;  1L1F A;  3Q4H A;  4OX9 O;  2JDI G;  4D6T H;  1DTO A;  3B40 A;  2F93 B;  2P06 A;  5LA6 B;  5H9C A;  3C3T A;  5CA1 B;  3BVO A;  4GX2 A;  3SJB C;  4HAM A;  3K5L A;  2CUG A;  3L75 H;  3BFR A;  4U3J B;  1BMF G;  1F23 A;  1R6K A;  2JIZ G;  4WF9 V;  1A32 A;  3STL C;  4DV2 B;  1JX9 A;  1Q43 A;  5FPR A;  1JVM A;  1QU7 A;  3UKM A;  3BAB A;  3JAR B;  1BL8 A;  2WLI B;  2UXC B;  3TJT A;  3S3W A;  2QWN B;  4DV4 B;  1JJ2 U;  1KQS U;  2UU9 O;  4PDR A;  3ZCC A;  2YEV A;  4IYH A;  1XMQ B;  4GX0 A;  4LH7 A;  2KSD A;  2UUC O;  4LBE C;  1JFF A;  3BEH A;  2ARH A;  3JAT B;  1I0H A;  2YID A;  3E89 A;  2DQ0 A;  4HNA A;  4LFA O;  3IJ4 A;  5CN0 A;  1AI5 A;  1MNG A;  4IIJ A;  2W0X A;  2RNB A;  1MZE A;  2GSM B;  2P7T C;  1HNZ B;  5LGT A;  1R6T A;  1XUQ A;  2QWO B;  1QCE A;  2ZE7 A;  3VQV A;  1OCZ C;  3WU2 Z;  3ZRW B;  1HNX B;  4MVO A;  4H13 B;  2Q7G A;  1GM8 A;  1GN2 A;  3JD2 A;  4DRX B;  1IVS A;  5H6Q A;  1S77 D;  4TUY B;  5B1B B;  4U7N A;  2ATK C;  4B7E A;  4LCU C;  4FFB B;  3GB7 C;  4FIP C;  5LP6 C;  2KB1 A;  2EX3 A;  5L3G A;  1PNL A;  5BY1 A;  3T1C A;  3ZBH A;  2A0L A;  1EFR G;  2IJH A;  2LQT A;  4DV2 O;  1P7G A;  5TIS Z;  3A0R A;  5K1P A;  3K5O A;  1VQK V;  2BCC H;  1IXM A;  4Z2W A;  2CTR A;  1NKD A;  2UXC O;  1M90 W;  2ZDI A;  1XIL A;  1VF7 A;  5JQG A;  1BZK A;  4DV4 O;  2QEX V;  1F4N A;  5GON B;  1SC5 B;  4D7T A;  1TUB A;  1VIB A;  2BTO A;  1XMQ O;  3K06 A;  2KG7 B;  1PPJ H;  2F4V B;  1IZ3 A;  3Q4H B;  5L3E A;  1TA8 A;  2QM7 A;  3CHX A;  3G80 A;  3ASN C;  1FXK A;  1NBM G;  4NR1 A;  2MW2 B;  3CRQ A;  5JVD A;  4K35 A;  4BAY A;  4EB6 A;  1XOU A;  3IFX A;  3OM3 B;  1R3J C;  1BHA A;  1ZLZ A;  1HNZ O;  1WA8 A;  1DF4 A;  5LGU A;  4H44 B;  4IGG A;  3K08 A;  1VQP V;  1HNX O;  4ICG A;  4TV9 A;  3SJC C;  2Q7H A;  3LNN A;  2F66 C;  2YEV B;  2VWJ A;  4O4J A;  4FMT A;  2HP8 A;  2ZE8 A;  3PN1 A;  2E5L B;  3AG3 B;  1JFF B;  2YC0 A;  1Z5V A;  2X6B A;  3CYO A;  1M57 C;  1YJN V;  4WBN A;  2P22 C;  3K3W A;  4HNA B;  1GN6 A;  2OWO A;  5BXZ A;  1TUE B;  1ENV A;  4FLZ A;  1Q5O A;  1Q6I A;  2PGG A;  1WJZ A;  2P4V A;  4EFB A;  4WFB V;  3S3X A;  5KUK A;  1Q6H A;  1E1Q G;  1YCI A;  4JGS A;  1AJP A;  4DW1 A;  3B2E E;  1YTF D;  2YUA A;  1RM1 C;  2KQX A;  3ZX6 A;  4GKK B;  4WFF A;  2F4V O;  3OD4 A;  3AG2 C;  3ASO B;  4CBC A;  2IH3 C;  4X1I A;  2LGQ A;  4X64 B;  1R1B A;  5KA6 A;  4QPJ A;  4YJ3 B;  3ABU A;  5KX5 A;  5A2Q N;  3K0D A;  2FL4 A;  4KUM A;  4LWS A;  3OGC C;  1NR1 A;  4WFE A;  2NLJ C;  1KMI Z;  1AJN A;  4PI2 A;  2B1I A;  1KBH A;  2JJ1 G;  4BW9 A;  1PV0 A;  3SPI A;  2ZKO A;  4J7K A;  2DQ3 A;  3FD9 A;  4I9W A;  2A7W A;  5JQG B;  2Q68 A;  2IH1 C;  4CS3 A;  4K8X A;  1Y76 A;  4JAA A;  3JAW A;  3VQX A;  5IYB O;  2GV9 A;  3DXR A;  4X9Q A;  1TUB B;  3K0G A;  1YSC A;  2E75 B;  5K1X A;  4X1Y A;  3G6E V;  1SZT A;  3HKE B;  4CC6 A;  3B8M A;  1NR7 A;  2XT9 A;  5LOV B;  3APQ A;  3ZMZ A;  4MTX A;  2EIL C;  5IJ9 A;  1PL4 A;  3OE7 G;  5JH7 A;  5JVD B;  5CA0 A;  2R70 A;  4I4T A;  2Y4U A;  1EZV H;  1RSO A;  2MK3 A;  3JD3 A;  4UCU A;  1WA8 B;  4R8C A;  4FM0 A;  1P84 F;  1NT2 B;  5JWP A;  1R73 A;  2FYU H;  2Y0I A;  4TV9 B;  4GKK O;  1H2L A;  1VQO V;  3ABK C;  4P9P A;  3RYC B;  2ZIN A;  4X64 O;  1TGO A;  1ZL8 B;  3AK2 A;  4O4J B;  3M7M X;  3N2K A;  3QTC A;  4CH4 A;  3OEE G;  1D5N A;  3SPH A;  3O9O A;  3M99 B;  4JYY A;  3CS5 A;  4UB8 Z;  3AK3 A;  4WBN B;  5B1A C;  4DR1 B;  4J7Z A;  3T4D A;  4X20 B;  4PDV A;  2DW4 A;  3GVM A;  2ZXW B;  4O4L A;  2Y48 A;  1CP9 A;  4ABM A;  1H2M A;  1YDX A;  1B06 A;  4O2B A;  1Q90 D;  3E22 B;  4CS4 A;  4EKW A;  2AW9 A;  3OW2 U;  5EYP A;  4J42 A;  4F6R B;  3OT7 A;  1K97 A;  1JR9 A;  1Q6U A;  4PI0 A;  5LP6 A;  2EIN C;  3CRM A;  1XI1 A;  4X1I B;  1HDJ A;  1BT8 A;  3BA9 A;  3ZS8 C;  3ZHV A;  3A0B Z;  2XUM A;  4NXM B;  4PA6 A;  3TXQ A;  3H01 A;  4PHZ A;  3K03 A;  4B3T B;  5KX5 B;  4LF9 B;  1UJW B;  2IM9 A;  2JRI A;  1W59 A;  4U3F H;  4Q20 A;  5JCO C;  1VQ8 V;  1V54 C;  4NTY A;  4FLT A;  1NZ6 A;  2X6C A;  3A0H Z;  2HEP A;  3RW0 A;  3JAW B;  1Y67 A;  3I5D A;  1IBM B;  5J2U B;  3AG4 C;  1CXZ B;  1IDS A;  3K79 A;  4A5U B;  4X1Y B;  3H1I H;  2VWK A;  4DXW A;  4E4E A;  4HYO A;  4X1K B;  3MAQ A;  2ITD C;  2QKA A;  5IJ9 B;  4F4L A;  5LHH A;  1YVW A;  4DR1 O;  1HNW B;  2IU3 A;  2CGN A;  2K9P A;  3JD1 A;  2E76 B;  2CDY A;  3HR0 A;  5E79 Z;  4UCO A;  5CA0 B;  5L3B A;  2LJ2 A;  4I4T B;  2Q5Z A;  1KKC A;  1RSO B;  4LFC B;  1GH6 A;  2F95 B;  2OTJ V;  1FS0 G;  1VF5 B;  5GTH Z;  3ETD A;  3BCC H;  4H33 A;  1PP9 H;  1AIL A;  4MTO A;  1SQG A;  2YI8 A;  3DC5 A;  2HHH B;  1YJW V;  1AR5 A;  3H1L H;  3FB6 C;  3JAR A;  3C90 A;  2XAS A;  4KHP B;  1THZ A;  4NXM O;  2WLI A;  2XAJ A;  4RUF A;  2R9R B;  4WFH A;  4TOI A;  4FM2 A;  5IYC O;  3DSQ A;  3N2K B;  1MA1 A;  3ZHR A;  2OTL V;  2Z5U A;  4B3T O;  3JAL B;  5AG2 A;  4LF9 O;  2D3O W;  1N36 B;  5H6R A;  2E74 B;  1P4R A;  3CME V;  1SQX H;  4UFZ A;  4DR3 B;  2GHY A;  3UO2 A;  1OCZ B;  3JAT A;  2B5U A;  5EZY A;  1H8E G;  4B08 A;  4FVM A;  4KXR A;  5LXT A;  3IAY A;  1Y66 A;  4P2Z A;  1O9G A;  1YXB A;  3U0Z A;  1IBM O;  2QE7 G;  3THO A;  4YY3 B;  3F5W C;  2FB5 A;  2DE0 X;  1Y6X A;  5LP6 B;  1N8R W;  4HZ3 A;  3OUS A;  2N74 A;  3ZRW A;  1F4M A;  2X7R B;  1JA8 A;  3L74 H;  5CBG A;  1IBK B;  4DRX A;  1N4C A;  1HNW O;  4NVP A;  4TUY A;  1VQN V;  3LSU A;  4TQF A;  1D2D A;  1KKD A;  1M93 A;  1QR9 A;  4LFC O;  1BS3 A;  4B3R B;  5LGN A;  1ZAU A;  2H3O A;  4TWK A;  2Y69 C;  5DN6 G;  5EIB C;  2WPD G;  2VS0 A;  2XAF A;  3JAK A;  2HHH O;  5EBL C;  3G67 A;  3JSN A;  2BSK A;  2VQF B;  3ASN B;  2K1E A;  4KHP O;  2DYR C;  1R3K C;  2VRZ A;  4PEL A;  1N36 O;  3K57 A;  2Q0A A;  3F7Y C;  4LF4 B;  4ASU G;  2O57 A;  4LF6 B;  4DR3 O;  3BHP A;  2NR5 A;  5LHG A;  1K5Q A;  5KMG A;  2L6L A;  3B77 A;  1Z2G A;  5KA5 A;  4CS2 A;  1XQ8 A;  4FFK A;  4MTG A;  4P9O A;  1E1R G;  3JCU Z;  4EEQ A;  1T5E A;  3D3Q A;  4FLX A;  5HFL A;  4YY3 O;  1H2K A;  4I5S A;  2ADQ B;  1VQL V;  1SQF A;  3F7V C;  5KLV H;  1IX9 A;  1M57 B;  1DF5 A;  2P6J A;  3CCU V;  2OCH A;  5KHK A;  1IBK O;  5L3F A;  1I5Y A;  2ZR2 A;  4DR7 B;  2Q69 A;  3J80 N;  3K9A A;  3P32 A;  3QO8 A;  4MSW C;  4UV9 A;  4YXW G;  1WAZ A;  3E8H A;  3TXS A;  4XDJ A;  1KU9 A;  3G6B A;  4B3R O;  3K9S A;  5LMN B;  1RM1 B;  5EZY B;  5JJJ B;  1QNM A;  4N23 A;  3CCQ V;  5LXT B;  3SPG A;  2VQF O;  3FAV A;  1NTM H;  4FLV A;  3JD0 A;  2YXL A;  4X8A A;  4J11 A;  4K0K B;  2AGA A;  4OPH A;  3ZED A;  5BR8 B;  1S3J A;  2ODM A;  1VEW A;  3LUT B;  2Q67 A;  4TV8 A;  3RYF B;  3ZRS A;  4CH6 A;  4ZIB A;  1V55 B;  3EXA A;  2ZR3 A;  4LF6 O;  1FFT B;  3HPL C;  4FLY A;  2QSA A;  2JGD B;  1US6 A;  4X62 B;  4YIP A;  3ZHS A;  3B8N A;  2V7Q G;  4Z1V A;  1GMG A;  3TCU A;  4YJ3 A;  4DW0 A;  2A3Q A;  1D5A A;  3CCS V;  2R9A A;  3AEI A;  3W7X A;  1FJG B;  2LW7 A;  4MVZ A;  2WLH A;  2AHZ A;  4JF3 A;  3D3I A;  3QO5 A;  3HKC B;  3JAK B;  4JYB A;  1SZX A;  2BSK B;  1RFY A;  2WA3 A;  1S5H C;  3SYO A;  4JI3 B;  3AG1 C;  1M4U A;  3LNM B;  3ZN0 A;  2LW1 A;  3O65 A;  5CB4 A;  3J81 N;  3WB2 A;  4DR7 O;  2EIJ C;  5DED A;  2AXT Z;  3OMN B;  1MZF A;  3CRA A;  2WLL A;  4GX1 A;  3HKE A;  5KMG B;  4JI2 B;  5LOV A;  3I55 V;  5LMN O;  4O2A A;  1ROP A;  1YI2 V;  2UXX A;  3FB5 C;  5GW7 A;  3ABK B;  3SYC A;  5FPO A;  3QG5 A;  4UXN A;  1QHT A;  3X2Q C;  1VQ9 V;  2QKC A;  5IYZ B;  4JV5 B;  4IHJ A;  4K0K O;  1K92 A;  5KHG A;  1QLN A;  5BR8 O;  3T1Y B;  1VQ6 V;  2GDS A;  3OUF A;  1S5J A;  5B1A B;  3CXH F;  3FB8 C;  5D5P A;  1SA0 A;  4G2K A;  3ABM B;  3RYC A;  2ETN A;  4X62 O;  1G8M A;  2EBO A;  5J9P C;  2UUA B;  1ZL8 A;  4WFG A;  2Q7E A;  1YZB A;  4LC1 A;  2XAG A;  4FJC C;  3K5N A;  4OXS A;  1DK1 A;  1FJG O;  2EIN B;  4X20 A;  2B1G A;  4MVS A;  1NVP B;  5L3C A;  2XOK G;  1GK9 A;  4WCE V;  3FAV B;  4JI3 O;  2DJV A;  4X66 B;  1S76 D;  1B6Q A;  1N0N A;  3E22 A;  1N0J A;  1K4D C;  5IJ0 A;  4CC5 A;  4RUE A;  3ABT A;  1SF9 A;  3UO3 A;  4F6R A;  4TV8 B;  5B1O A;  4GKJ B;  3A8T A;  4NXN B;  1COW G;  1HWY A;  4MVQ A;  2EIM C;  4DUY B;  3D36 C;  1V54 B;  4JI2 O;  2JEX A;  2PY5 A;  5BMV A;  2H94 A;  4LFB B;  1KP2 A;  4ZOL B;  2HJD A;  3L70 H;  1SRY A;  1BHB A;  4PA4 A;  4JI0 B;  4JV5 O;  1YEW A;  3F5T A;  2IBZ H;  5JJN B;  1N33 B;  4YJ2 A;  1PM9 A;  1S5L Z;  2YIB A;  4N21 A;  3T1Y O;  4UB6 Z;  3IGA C;  2LGW A;  3NXS A;  5CB4 B;  4QE7 A;  3DGE A;  5LHI A;  2UUA O;  1FXV A;  4O4H A;  4Q6G A;  5J2U A;  2ZM6 B;  1KB9 F;  2E5L O;  2WLL B;  1VQ5 V;  4TSF G;  1XMO B;  2EZP A;  1K33 A;  4X1K A;  4PA9 A;  4DV3 B;  2IJI A;  4O2A B;  5DM6 V; 
#chains in the Genus database with same CATH homology
 1JJO A;  5IJ9 B;  1HNW B;  3RWR D;  4UCO A;  5CA0 B;  4IHJ B;  2F93 B;  5LA6 B;  4FLU A;  4I4T B;  3JAS A;  5CA1 B;  4LFC B;  1X4T A;  2F95 B;  3SJB C;  4ZI7 A;  3UT5 A;  4X65 B;  1N34 B;  4UCT A;  3K5L A;  4U3J B;  2QJ1 A;  4DR5 B;  1SA0 B;  1SQG A;  5J2T A;  2YI8 A;  2HHH B;  4DV2 B;  3JAR A;  1Q43 A;  5FPR A;  4KHP B;  3BAB A;  3JAR B;  4YHH B;  2RQ6 A;  2ZNJ A;  4TOI A;  2UXC B;  4FM2 A;  3DSQ A;  3N2K B;  4D7S A;  3JAL A;  1QQC A;  4DV4 B;  3WB1 A;  3JAL B;  1N36 B;  2JVD A;  3BPZ A;  2RJZ A;  3K5M A;  4LF5 B;  2UUB B;  1XMQ B;  4UFZ A;  4LH7 A;  4DR3 B;  2P5O A;  4ZHQ A;  1JFF A;  3JAT A;  3JAT B;  5EZY A;  4DV6 B;  4B08 A;  4FVM A;  4HNA A;  5IJ0 B;  4CH5 A;  5KHJ A;  5LXT A;  3IAY A;  3VQW A;  1Z5W A;  3HKD A;  4I55 B;  4IIJ A;  5FNV A;  1O9G A;  3HKD B;  3U0Z A;  1SKV A;  4IIJ B;  5FNV B;  3THO A;  4YY3 B;  4DUZ B;  5EIB D;  5LP6 B;  1HNZ B;  3SJA C;  4JI6 B;  5BMV B;  3VQV A;  3ETQ A;  1HNX B;  3HKB B;  1IBK B;  4EFE A;  4DRX A;  2Q7G A;  2PZS A;  4DRX B;  4NVP A;  4TUY A;  4DK0 A;  2YIB D;  4TQF A;  4TUY B;  4JYA B;  2KKW A;  1M93 A;  4YJ2 B;  3K58 A;  5D5Q A;  4FFB B;  4FLW A;  4B3R B;  2UXB B;  5LP6 C;  3RFR A;  2EX3 A;  1ZAU A;  2YIA A;  1P49 A;  1TVK A;  4JI7 B;  4UCR A;  5EIB C;  3JAK A;  3SGI A;  4I50 A;  3JSN A;  2VQF B;  5K1P A;  3K59 A;  3K5O A;  4O4H B;  1Q8I A;  1N32 B;  3ICX A;  1VF7 A;  5JQG A;  2UXD B;  5GON B;  3RYH A;  3K57 A;  2Q0A A;  4D7T A;  4LF4 B;  1TUB A;  2BTO A;  5ITZ A;  2PYL A;  4AHC A;  3BHP A;  4LF6 B;  5KMG A;  4DR4 B;  3BA8 A;  2F4V B;  2XHB A;  3UQ8 A;  1HR0 B;  1TA8 A;  3CHX A;  4B3S B;  3JAS B;  3SR2 C;  4CS2 A;  1XQ8 A;  4ZI7 B;  3UT5 B;  1XNQ B;  4EEQ A;  1T5E A;  4FLX A;  5JVD A;  4EB6 A;  4JI8 B;  1Q3E A;  4EB6 B;  5J2T B;  1SQF A;  2JGU A;  4GYC B;  4DV0 B;  4DR6 B;  5KHK A;  1I7F A;  4TV9 A;  3SJC C;  5IWA B;  4DR7 B;  2Q7H A;  3LNN A;  2F66 C;  2VWJ A;  4UCV A;  1IBL B;  1WPB A;  4O4J A;  5LMU B;  1KU9 A;  3PN1 A;  2E5L B;  2ZIM A;  4ZHQ B;  1JFF B;  1Z5V A;  3U10 A;  5LMN B;  4JI4 B;  5EZY B;  5JJJ B;  4O4I A;  2F1M A;  4WBN A;  2P22 C;  1I94 B;  4HNA B;  3OTF A;  5LXT B;  1WN7 A;  2OWO A;  4FLZ A;  5LYJ A;  4FLV A;  1Q5O A;  4GLX A;  2YXL A;  2PGG A;  4EFB A;  4DV7 B;  4K0K B;  5KHI A;  3ZED A;  5BR8 B;  4LH6 A;  3RYF A;  4DR2 B;  4LNU A;  4TV8 A;  3RYF B;  4CH6 A;  3B2E E;  4LNU B;  4ZIB A;  1DGS A;  4GKK B;  4FLY A;  3BRC A;  4X62 B;  4X1I A;  4X64 B;  4YJ3 A;  4YJ3 B;  1D5A A;  1TAE A;  5KX5 A;  2R9A A;  1FJG B;  1TVK B;  3HKC A;  4TQD A;  3HKC B;  3CB2 A;  3JAK B;  1KMI Z;  4I50 B;  1XHX A;  4PI2 A;  4BW9 A;  4JI3 B;  4FM1 A;  1M4U A;  2QM4 A;  5JQG B;  5KHH A;  4JI5 B;  4CS3 A;  5C8Y A;  5CB4 A;  3WB2 A;  3OTO B;  4K8X A;  3RYH B;  3JAW A;  3VQX A;  2BTQ A;  2ZNI A;  2GV9 A;  1TUB B;  5ITZ B;  1G6U A;  3HKE A;  2ZCE A;  1V9P A;  5K1X A;  4X1Y A;  5KMG B;  4CH3 A;  3HKE B;  4JI1 B;  4CC6 A;  4JI2 B;  5LOV A;  3T1H B;  5LOV B;  1J5E B;  4O2A A;  4LF8 B;  3RYI A;  5JJE B;  3RYI B;  2PUS A;  5IJ9 A;  5JH7 A;  4UCS A;  5FPO A;  5IYZ A;  3QG5 A;  1QHT A;  5JH7 B;  4DV1 B;  5IYZ B;  4JV5 B;  5JVD B;  2CAZ C;  5CA0 A;  4IHJ A;  5LA6 A;  2R70 A;  4I4T A;  5CA1 A;  1RSO A;  4DV5 B;  4UCU A;  5KHG A;  3BAA A;  3WB0 A;  3T1Y B;  4FM0 A;  1NT2 B;  4U3J A;  1S5J A;  5D5P A;  4TV9 B;  1SA0 A;  3U11 A;  1XNR B;  3RYC A;  3RYC B;  2ZIN A;  2UUA B;  2Q7E A;  1TGO A;  2ZIO A;  4O4J B;  3CSX A;  1O9H A;  3M7M X;  2VQE B;  3K5N A;  3N2K A;  3QTC A;  4CH4 A;  4O4I B;  4AQY B;  4X20 A;  4WBN B;  4DR1 B;  4X20 B;  1H2S B;  2PYJ A;  5LYJ B;  4K8Z A;  3RGB A;  4O4L A;  4OX9 B;  4DK1 A;  2YI9 A;  1M5I A;  3A2F A;  4O4L B;  4X66 B;  3E22 A;  4O2B A;  2PTM A;  5IJ0 A;  3E22 B;  4O2B B;  4CC5 A;  4CS4 A;  4I55 A;  4F6R A;  4TV8 B;  4GKJ B;  4NXN B;  5EYP A;  5JCO A;  4F6R B;  5EYP B;  3N2G A;  4PI0 A;  5LP6 A;  4HBN A;  4DUY B;  3N2G B;  1XI1 A;  4X1I B;  1WNS A;  2PY5 A;  5BMV A;  3BA9 A;  4NXM B;  4ZOL A;  3ZS8 C;  4LFB B;  3HKB A;  4ZOL B;  4PHZ A;  4LF7 B;  1JMK C;  2UU9 B;  4B3T B;  5KX5 B;  4JI0 B;  4LF9 B;  3FFQ A;  1FFX A;  2IM9 A;  1YEW A;  5JJN B;  1N33 B;  4YJ2 A;  1FFX B;  2E3C A;  2V4D A;  4FFB A;  2OYQ A;  4LR3 A;  2UUC B;  2YIB A;  4L8J A;  5JCO C;  2R72 A;  4FLT A;  1XHZ A;  4KL1 A;  5C8Y B;  5CB4 B;  4LFA B;  2JS5 A;  2HEP A;  4BWA A;  1HW7 A;  4O4H A;  4Q6G A;  3JAW B;  5J2U A;  2BTQ B;  2ZM6 B;  1IBM B;  3QF7 A;  5J2U B;  1B04 A;  3JSL A;  1XMO B;  4X1Y B;  4B3M B;  4I9Q A;  2VWK A;  4X1K A;  3VQY A;  5GON A;  4DV3 B;  4O2A B;  4AIL C;  4X1K B;  3MAQ A;  1L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...