3B2EE

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
PGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 16
structure length 67
sequence length 67
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3b2eE00
2CAZC 1NT2B 2P22C 3CSXA 3ICXA 3SJCC 3SJBC 1SKVA 3THOA 3QF7A 2JS5A 1X4TA 2F66C 3QG5A 3SJAC 3B2EE 3ZS8C
chains in the Genus database with same CATH superfamily
1T5EA 2ZD9A 3UT5A 1F4NA 1H8HG 4QE7A 2Z3YA 2GUZA 1R3KC 3ZHSA 5J2TB 3D3IA 3DSQA 3H1KH 1M9NA 5EIBC 4I55A 4XDJA 1PPJH 1NS1A 2BE3A 5EZYA 2Q67A 3IFXA 2E75B 3JCUZ 2BOBC 2RQ6A 3C90A 2XAHA 4JI3O 2Q6AA 1SC5B 2QM7A 1MZFA 2N05A 3IAYA 2WLLA 4F6RA 3J7AU 2JS3A 4FMTA 4WBNB 3I55V 3SYCA 2VQEO 5JVDB 1QQCA 5LMNB 2A3QA 1H8EG 1GN3A 3RVZA 2OIGA 4NR1A 4XDKA 1X59A 3TCUA 1Q8IA 3S3WA 1TUBA 4P9PA 2UXXA 4PV1B 1E1RG 2HP8A 2LP7A 3FB8C 3JCZA 3K0GA 5KHGA 3FB5C 2EULA 4YJ3A 3AG1B 3CCLV 3B4SA 5BR8O 4G27B 2R72A 4U3JB 2ZXWC 1IBMB 4LF4O 2P90A 4GX1A 3B09A 2PYJA 1VQKV 4NXNB 3FFQA 4DV4O 5B1BC 3SPGA 1K7DA 3DXRB 3QO5A 1V54C 4QIWF 2FKXA 1AR5A 4AI8A 2NR5A 3ZCCA 5KMGB 1N34O 4K0KO 3W7XA 2Y69B 2CE4A 4R8CA 2Y4UA 3G6BA 1WNSA 2ZIOA 3DGEA 1TVKA 4NTXA 4L8JA 4JASA 1OCCC 1QCEA 1YEWA 5LA6A 3JAKA 2QA4V 2LGWA 1NH2D 3F7YC 4NKGB 3UT5B 1H2KA 4JI4B 1DLBA 3RWRD 1Q82W 5CA1A 4FLYA 2GUZB 5IE9A 4TUYA 3OGCC 3KCYA 3MDSA 2FMLA 2DWDC 1WLEA 4I55B 4WF9V 4DUZB 4PA6A 2ZM6O 5EZYB 3J80N 4YIOA 5L3DA 1QLEB 2HHHO 5JJNB 3ZHTA 2GTAA 2X6AA 2BOCC 1S0VA 3E8FA 3K08A 2AGAA 2PYLA 2Q8VA 3CC2V 1WA8A 4YY3O 5CBHA 4DV7O 2WLLB 1FJGB 1U96A 2BTOA 4ASUG 4F6RB 4MW8A 5LL6Y 1MA1A 3RW0A 2P7TC 1AJNA 4FLXA 4PA4A 2Q7GA 2JRIA 3M7MX 2DYSC 4D7SA 1AI5A 1TUBB 4XBFA 4BIOA 1OHHG 4PD4F 4DK1A 1KKDA 2ZE6A 3QTCA 2AXTZ 2GTSA 3U0ZA 4PA3A 1QU7A 1WPBA 1QLNA 4UXNA 1E79G 1F7YA 3SJCC 1GM7A 4X64O 2XAJA 1DK1A 2QKCA 3STZC 2YIBD 2QSAA 4LH7A 1SKVA 3IC7A 1M90W 1MSWD 4IGGA 1NQTA 1XMOB 2XAQA 3U11A 2IH3C 5HFMA 3K59A 2DYRC 5LMUO 1TVKB 4OPAA 1V9PA 5LA6B 3JAKB 4QPJA 4OPHA 1PD3A 1A32A 4CH5A 1SQFA 5CA1B 3OTOO 3ZIAG 3K9AA 4PDLA 2BTQA 2E74B 4TUYB 2YXLA 4KXRA 1HNWO 2UU9O 4JF3A 4YXWG 5IWAO 5JCOA 1FXVA 1Q43A 3JD4A 1QBZA 4CBCA 2PY5A 3OMNB 3E35A 5IDJA 1VQ5V 3AK2A 1BCCH 5KA6A 3H1LH 4E4EA 4X65O 3E2EA 2Z0AA 4H13B 1FFXA 1OJHA 1WA8B 2AHYA 2YIAA 3QNEA 2F43G 5E1AC 4DV5O 1MOFA 2LGQA 2UUBO 1M56B 1Y74A 3KZIZ 2HR3A 4JAVA 4NTWA 2OCCB 4F4LA 4MTGA 1NTKH 3LSQA 2ZCEA 1KECA 5BY1A 2LFSA 1DGSA 4K0KB 2WA3A 3ZHQA 4FJCC 1YSCA 5GONA 4X88A 4B08A 5L3FA 4LBEC 4CS3A 3QO8A 1IBLB 3VOUA 3CRAA 2KQXA 1Z5WA 4PHZA 5A9GA 4J42A 3ZHUA 1PNKA 3T1YB 1KP2A 3FD9A 4K8XA 3H1HH 2GSMB 3APOA 1J5EB 3CCMV 2ZM6B 2GDSA 4B3SO 1S5JA 1ZWIC 2HHHB 3IGAC 3ABTA 1PL0A 5AG2A 1M57C 4X1YA 1GRJA 3UQ8A 3K03A 4FLZA 2VS0A 2Z5UA 1IX9A 4DV7B 2LW1A 3SDLA 3AG4B 2Q68A 1N32O 4RQFA 1HNXO 1RSOA 4PDVA 1XMQO 2BCCH 4RUEA 1GN2A 3L72H 1CEZA 2ZINA 1YCIA 2B1IA 1OCOC 4YHHO 2WLKA 3W7SA 1M4UA 2ZR2A 4JYAB 1P4RA 4J41A 1ZTEA 1K9MW 1EN5A 4LF7B 3T1HB 4J11A 1HDJA 1NTMH 4RQEA 2W6IG 4J7JA 4OX9B 1OCRC 2A0LA 1FFXB 5B1NA 2EIJB 1BHBA 4X62B 1WJZA 1XNRB 1Y74B 2Q9LA 4BIUA 4DR2B 3CCJV 1G6UA 4DO2A 2EILC 1O9GA 4DV6O 3UM7A 2JGDA 3OD4A 3OFNG 4PI0A 1N8RW 2QJ1A 3N2KA 3M8AA 4JV5O 3DC6A 1JVMA 1IVSA 5GONB 3D36A 4H37A 1K4CC 3ZHRA 5LMNO 3AG3B 3JASA 1NR7A 1I7FA 3HKBA 5CN0A 3LDDA 4LP8A 3OTOB 2WPDG 2XAGA 1Y67A 2YDEA 4IHJA 4FLVA 5IWAB 5DECA 4ZI7A 4LFAO 1I5XA 4JYBA 2X7RB 4FK5C 2OTJV 2QKSA 3O65A 2CTRA 5LP6A 3CCEV 3B40A 1YTFB 2WLHA 4X65B 1YZBA 2GHYA 2B1GA 4FLTA 4UCRA 1Q90D 4NXNO 5FPOA 1IURA 1ZX3A 3ICXA 4X1YB 1YJ9V 2WSSG 4CS2A 1EZJA 2CTPA 2UXBB 4DV5B 2QTSA 2UUBB 4FIPC 1RSOB 1R6TA 2DQ0A 4GZRB 2IH1C 3FB6C 3R66A 4XDLA 3UKMA 4CC5A 2QKAA 1XQ8A 3ZJZA 2QR4A 1NJIW 1GTOA 1COWG 4JTCB 2YICA 1GN6A 3JAWA 1RPRA 2EJ7A 1NR1A 3LNNA 2LO1A 2VWKA 2LJ2A 4FZ1A 5CB4A 1L0LH 3IC9A 5K1PA 3TXSA 1NVPB 4DUZO 4NYKA 3ETGA 2AW9A 2EIKB 2H94A 2UUCO 1L1FA 4FVMA 3SYPA 3HR0A 1I94B 2EILB 2Y0PA 3I56V 1R3IC 3ABKB 4J7ZA 3UCSC 2XNDG 1H2GA 2JGDB 4B3SB 1OCZC 4GCZA 4BW9A 1S76D 2PGGA 2PTMA 3N2KB 4GKKB 1FJGO 2H8PC 4NXMO 1BSMA 4WCEV 4MSWC 3ZS8C 1M1KW 3JASB 4HNAA 4I9QA 4TWKA 3HKBB 3BHPA 2CTQA 1RPOA 1N32B 4GX2A 4UFZA 4RWUA 4JI2O 2CTWA 3WB2A 2KKWA 2MW2B 4IHJB 5EBLC 4KFMA 5JWPA 2EIMB 2WLNA 2RN9A 4ZI7B 3OMAB 4K8ZA 4UCOA 5LP6B 3P30A 1R3JC 1VQOV 3L74H 1MG1A 3L9DA 3X2QC 2UXDB 3R65A 1PP9H 2ARHA 2PZSA 4HYOA 3G80A 3NR7A 2YC0A 3H1JH 3OEEG 4WFBV 5LOVA 1YXBA 5ITZA 4JI1B 2QWQB 2HLDG 1JCHA 5J9PC 5GW7A 3JATA 1HWYA 1XMOO 2HG5C 2JGUA 4GX0A 3T4DA 3OEHG 2R70A 3QG5A 2V1DA 4DV6B 3CRCA 1YI2V 3ZN1A 1FXKC 4LF8B 1N33B 1FXHA 4P2ZA 1M5IA 4YJ2A 4JV5B 2ZDIC 1YITV 3ABLC 1QVFU 4X1IA 1YJNV 3RN4A 1SA0A 5CA3A 2DWEC 4LFCB 2OTLV 1D5AA 3JAWB 2Q7HA 1W59A 2Q4PA 4TOIA 4FLUA 5CB4B 2C2AA 3HKEA 1UFIA 4ZKIA 1EZVH 1VP7A 2JS5A 4JTAB 5F2VO 1YHQV 1XI1A 5EK0A 1H38A 1JX9A 2EJRA 3WFVA 1KYOF 3RGBA 3WG7C 1ZL8A 3LSUA 2RCVA 4JI8B 4LFAB 2E76B 3OTFA 2VQFB 3VBBA 3ZMTA 4FM2A 1K5SA 2ZKOA 1R6NA 4TQFA 1BE3H 3I5DA 1CP9A 3L70H 4D7TA 3TGUH 2VRZA 4HNAB 3K58A 1YVWA 2R9IA 1I5YA 1NZ6A 3K57A 4JI0B 3OR7C 1BGYH 1V55B 2O57A 1RM1C 1N0NA 1RFYA 3THOA 3ZX6A 2N04A 1CPYA 3E22A 1Z5VA 3RYCA 1IBLO 2RJZA 4DR4O 2FL4A 2CDYA 4MVQA 5J2UA 3T1YO 1QNMA 4I4TA 4TV9A 3CXCU 5JJEB 1Z2GA 1FAFA 4G28B 3B2EE 5LOVB 5ITZB 5K1XA 2CH7A 1DF5A 2RDCA 4LR3A 1J5EO 5IJ0A 1ZUQA 3JATB 2UUCB 3JAMN 1G1XB 4GYCB 3JSNA 2DQ3A 3EFFK 1AP5A 1VF5B 4RAIA 1NU1H 3W7WA 4PA9A 4DW1A 4ICGA 4YJ2B 2PF4E 1N4CA 2ZIMA 4K3AA 4X1KA 1VF6C 4NXMB 1K33A 4X1IB 1SA0B 3E83A 3B77A 3D3QA 5EYPA 2ITCC 4JI5B 4CH6A 4Q6GA 1SF9A 1WAZA 4LF6O 3HKEB 1ENVA 4JYAO 4JI2B 4GKJB 1R73A 3SYQA 4LF7O 3T1HO 4NTYA 5D5PA 1EFRG 4NB5A 1ZL8B 1JJ2U 3SPIA 3SYAA 4YJ3B 1SESA 3H1IH 4OX9O 5KUKA 2ZXWB 1KP3A 2Q0OC 1CXZB 4DV2B 4X62O 4JAAA 1XNRO 4PA7A 4JI7B 3BFRA 1B04A 4DR2O 5B1BB 1Y76A 3CRQA 1YF2A 1JA8A 5C8YA 3OAAG 1UPGA 3LDCA 1V54B 2WLIA 2YSUB 2A06H 4HBNA 1Y66A 2OYQA 1H2LA 4B3MB 4PELA 1KU9A 5GTHZ 3QVNA 3ASOC 4JAUA 4DW0A 1X4TA 4W4LA 3SJAC 4R6ZA 4BR6A 2M6YA 3O9OA 1NTZH 1OCCB 3E22B 3RYCB 4B3RB 3HKDA 3EVKA 4HAMA 5EBMC 5LYJA 1TUEB 4FFKA 4LF5O 2H3OA 5IY5C 3K9SA 4H0LB 4PDRA 2AZ0A 4J80A 3JSLA 5J2UB 4I4TB 4N23A 4TV9B 1JR9A 2IU3A 2CH7B 3H9VA 2K9PA 4DV0B 5IJ0B 1XDCA 3BAAA 3WB0A 2FYUH 3CRRA 2EBOA 4ABMA 2ATKC 3MHSC 3OR6C 5IYZA 2KB1A 1FFTB 3K04A 2ADPA 1S72V 1WP8A 4DR6O 3ABMC 2V4DA 2K1EA 2Q69A 2UXBO 2Q0AA 3RYHA 4X1KB 1IBKB 1L0NH 3VQYA 3AG7A 3CCRV 2EINC 2XTAA 5EYPB 3A0BZ 1D2DA 1K8AW 2X6BA 5JJJB 4BWAA 2DYSB 3CE2A 4FZ0A 5LGTA 3BA8A 4JZGA 4DRXA 3SJQC 1BZKA 4I0XA 2XAFA 5BZBA 4LCUC 4U7OA 2XASA 1KMIZ 4E2LA 3TK1A 3F5WC 4P30A 1PKXA 1FKAO 1JOYA 2DE0X 1XL6A 3ZN0A 3G71V 4X9QA 4QE9A 4DR4B 2G38A 5LGUA 5FLXN 2P4KA 5LHHA 4H44B 1VQ4V 2NN4A 4A5UB 4DXWA 1I94O 1LUWA 4GT1A 1AJPA 5C8YB 4DV3O 4R50A 3SPCA 2WLIB 4FM1A 3P3PA 4B3TB 1H2SB 3CEIA 4ZHQA 1F4MA 4TSFG 4GKKO 5B5EZ 1PL4A 1SZXA 2DYRB 5KAFZ 4OXSA 3CX5F 4IYHA 2XHBA 3HKDB 5LYJB 4Z1MG 4ZBMA 1VQNV 2DOSA 1SERA 1BMFG 1W0KG 2BTQB 3FB7C 4MVOA 2QE7G 1VMGA 4LF6B 4I5SA 4O4IA 2E5LB 4TV8A 3CCUV 2RNBA 2L6LA 2UXDO 5IYZB 1YTFD 2LFRA 3UO3A 3OT7A 1SS3A 2Y4TA 4JI1O 3ASNC 3RYHB 5CBGA 3JD1A 1THZA 2HJDA 3G4SV 1BL8A 1K4DC 5KX5A 2W0XA 3KG2A 3PJSK 1MZEA 3HPLC 1K5QA 2P22C 3BEHA 1US6A 3W7TA 4B7EA 1Q86W 1URFA 3EXAA 1QHTA 1YDXA 4LF8O 4JI6B 3T4ZA 1N33O 3K5NA 4DRXB 5B3SC 4I0XB 3LDEA 1WP7A 3ZBHA 3AG2C 4P9OA 4QNHB 3K5LA 2DN9A 3G67A 1WN7A 4LFCO 5KHIA 1OZ0A 4LF5B 1HW7A 3KKYA 1SQBH 4LH6A 1ROPA 3ZRVA 1NVPD 2YIDA 4X66O 3ZRWA 2ZQMA 1N36B 5KUMA 4F6EA 4AQYB 3C3SA 4JI8O 4TQDA 1XREA 4CC6A 3CC7V 2JDIG 4MT8A 4UUJC 2VQFO 2A9HA 4PDMA 4ZHQB 4DV1O 1SQGA 5CMUA 1SZTA 1O9HA 1NBMG 4Z1VA 1M57B 4GLXA 3CPWU 1J95A 4DR6B 3OM3B 4JYYA 1K97A 1AP6A 2ETNA 3GWOA 4JI0O 1SQPH 2YI8A 5B66Z 1OCOB 2WLJA 5CA0A 1AR4A 1PNMA 1VQ7V 2X0LA 2JJ1G 1VIBA 4MTFA 2F93B 4LF9O 4O4IB 3Q4HA 3FYIB 3EHBB 3SPHA 4TV8B 2N74A 1ORQC 1SETA 1MNGA 5KHKA 2ZNIA 4L87A 4O4LA 1OCRB 2OIEA 3CJHA 3F7VC 4EEQA 3F5TA 2VWJA 3JD3A 3OE7G 1DTOA 5KHJA 1B06A 3PN1A 2PUSA 2WA4A 5KX5B 4RUFA 4DR5B 4BW5A 4DV3B 3CMEV 3JARA 1U97A 3B8NA 3K5OA 5L3EA 2A79B 2LW7A 2NNUA 5KA5A 2V7QG 5FPRA 1Y6XA 5DN6G 3SJBC 3AEIA 2ZR3A 3OGIB 4JI5O 1JFFA 2ODMA 3H01A 3BABA 4LWSA 3FKSG 4UCVA 3AG1C 3E8BA 1ZAUA 4DR7B 4GKJO 4I9WA 2QTOA 3ZRWB 1R1BA 4EFEA 4CH4A 2XT9A 2IJHA 1P7GA 4JYCA 5JQGA 4MVRA 4YIPA 1K73W 2JK5C 2OCHA 1MMMA 4DK0A 3CHXA 3DTUB 4WFEA 5BXZA 4DV2O 3CC4V 1G4YB 1PNLA 1H2MA 1IDSA 4JI7O 2QWRB 4J9YB 2F4VB 5LHIA 5LGNA 2Y69C 2ZNJA 3HB3B 3UO2A 3CYOA 3RYFA 4B7KA 3T2MA 4B3MO 4FM0A 2ADQB 1ZLZA 5CA0B 1FXKA 1WPXA 2ZT9B 2L35A 3ML0A 1WB8A 2IJIA 3Q4HB 2CAZC 2QM8A 1AI6A 4WFAV 5EC1C 2ZDIA 5FNVA 1VQLV 2OT5A 1YIJV 4B3RO 5H6QA 3ETEA 3AK1A 3SGIA 2JEXA 4MW3A 3BPZA 1KBHA 1QLEC 3TXQA 4LC1A 4O4LB 1NKDA 1M93A 2P4VA 1B3QA 3CJHB 3ZMZA 4BAYA 4KHPB 1P7BA 4LNUA 1VQMV 3MAQA 5EIBD 3E8HA 1VEWA 1EN6A 3LNMB 4DV0O 2KSDA 4X66B 3TJTA 4DR3B 4KUMA 3E8GA 4U7NA 3ZMVA 3GB7C 2ILMA 2YEVA 1KD1W 3JARB 2HKOA 1OCZB 1K34A 3OMIB 4DV1B 1HR0O 4UV8A 4Z2WA 2UUAO 5IYDO 4G2KA 1IBKO 2R9RB 1GKFA 2P67A 4TT3G 3K0DA 1JFFB 3A0RA 1AB3A 1S5LZ 4MTOA 1XNQB 4LWSB 1P84F 3T1CA 4FFBA 3FAVA 4NVPA 3BCCH 5CBFA 1JMKC 4LF9B 5JQGB 2DJVA 1ZSPA 4UV9A 3OUFA 4X20A 3VQVA 2Y0IA 1I08A 1LNQA 3MD0A 3X2QB 1OV9A 1Q6IA 2Q7EA 1GK9A 4X8AA 3KCXA 4DUYB 1Q3EA 2E3CA 1EN4A 2A7WA 2Q5ZA 3CS5A 2IJJA 4GX5A 3GVMA 3L73H 3RYFB 1MABG 4B3TO 2WAMA 3NXSA 4MTXA 2EX3A 1FS0G 1GMGA 4JPRA 1VQ9V 1FXKB 5FL7G 4EB6A 2UXCB 3CCVV 2IJKA 2YXHA 1HNZO 3ZHVA 5FNVB 2AZ2A 1VF6A 3ABLB 1HP8A 4ZOLA 2AHZA 3RBZA 3K5MA 2QWPB 2ZE8A 5L3GA 2YS8A 1TA8A 1Q6UA 3JALA 1Y4MA 4UVBA 4LNUB 1XUQA 2E5LO 5BMVA 1GO3F 1IZ3A 1KUQA 3WG7B 1BS3A 2YEVB 1M56C 2YIBA 4PI2A 3ZEDA 4MVMA 3CCQV 1KQSU 4QJFB 4JTDB 2OCCC 1R3LC 3E86A 2QWOB 5IYBO 3J81N 5JH7A 1TAEA 1S77D 1S3JA 3BRCA 4O2BA 2EZOA 4WFGA 1NH2B 4ZIBA 2HVJC 3CD6V 1AR1B 4JI6O 2IBZH 1AVMA 3FX7A 4R7CA 4D6TH 2JJ2G 4JZ2A 1RM1B 5GTIZ 3B8MA 4FFBB 3FAVB 3ZMUA 2BSKA 2B9ZA 1Q5OA 4KL1A 1GH6A 4X20B 3OUSA 3SR2C 3K06A 1VARA 1Q6HA 3VQXA 1VQ8V 1YJWV 3RT3C 1PM9A 4QPKA 4DR1O 5H5NA 2YI9A 4JI3B 4U3FH 2XUMA 1N36O 5DM6V 4AQYO 4O2AA 5KLVH 2CK3G 1UJWB 2VQEB 3AG4C 1I0HA 1EM1A 2W0FC 4O4HA 3ETQA 4AHCA 1K3EA 4EB6B 2UXNA 2IM9A 1GM8A 1B6QA 1HR0B 1GN4A 3QF7A 2UUAB 5JCOC 4ZOLB 2F23A 4UVAA 3N2GA 3JALB 5HFLA 1QR9A 5BR8B 5BMVB 3K3WA 4LF4B 2EIJC 2EZPA 4WFHA 4DV4B 4FPPA 3LUTB 2ITDC 5LHGA 2JVDA 3QO7A 2NLJC 3U10A 3APQA 5JH7B 1N34B 4K35A 2YXYA 2M7WA 4EKWA 2QEXV 4UCTA 3ABUA 4GUNA 1Y76B 4IIJA 4C7UA 5H9CA 2P06A 4O2BB 4DR5O 1FD9A 1AJQA 3ZRSA 3JD0A 3AG3C 3C3TA 3P32A 4J9ZB 1VF7A 1JPXA 3ASOB 2HJFC 3SYOA 2BSKB 3CB2A 5DEDA 4IL6Z 2Q73A 1L8DA 2IW5A 2MK3A 4PJ0Z 1XL4A 3CMAV 1HNZB 5IT9N 4JGSA 1BT8A 2QM4A 1JQ0A 4I50A 2P6JA 5IY5B 1XEQA 4QGPA 1W2BU 2HVKC 1Q81W 4DR7O 2RMKB 1SRYA 5IYCO 5B1AC 4Q20A 4O2AB 1VQ6V 3S3XA 2PI5A 1KKCA 4EFBA 4YY3B 2QGNA 3L71H 1BQZA 2QDOA 4MVZA 5B1OA 4O4HB 1PV0A 2JIZG 1QR8A 1XHXA 1F51A 2DW4A 2F4VO 2KG7A 2CGNA 3ABMB 2XOKG 4LFBO 2FB5A 4UB8Z 1IXBA 1K92A 3IJ4A 2CGOA 4OGQB 2EINB 2OWOA 3ZMSA 3N2GB 4CH3A 4UVCA 3K79A 4O4JA 2X6CA 3ZRXA 3RYIA 4BIZA 1QVGU 4J10A 3HKCA 2EIKC 4N21A 1IXMA 4X64B 4MVSA 1S5HC 4KHPO 2HFEC 3ABKC 4I7ZB 5H2FZ 2F1MA 1XOUA 4DR1B 5LXTA 1FPOA 4W4KA 5C93A 3RFRA 4DR3O 4IIJB 4DYLA 3BVOA 3W7UA 1AROP 3FYEB 1LR1A 5LMUB 3D36C 3CXHF 3M99B 1SQQH 1R6KA 2GBOA 5LBQA 5IJ9A 2F95B 3A2FA 1SQXH 2DMXA 4IYIA 1AI7A 4UB6Z 1RP3B 3G6EV 1KC8W 1N0JA 1HNWB 2UU9B 2WWWA 3RVYA 2EIMC 4X89A 4I50B 2LQTA 1XNQO 1H2NA 1GM9A 5H6RA 4J7KA 5LP6C 1IBMO 3WB1A 5B1AB 3SPJA 1W0JG 5J2TA 1D5NA 4UCUA 4MS2A 1BQ0A 2D2CB 1JJOA 2F66C 3JYCA 2GV9A 1AI4A 3GWKC 5D5QA 5EBWC 2ZE5A 3L75H 4AILC 4MVUA 1XBLA 2CUGA 2HEPA 2R9AA 2Y48A 5KHHA 1NT2B 3N27A 2KG7B 3P3NA 4DUYO 3ASNB 1GAXA 2IU0A 2B5UA 1AILA 1XHZA 1KB9F 1NI8A 2QWNB 4HZ3A 1DF4A 4WBNA 4JI4O 2W6JG 5JVDA 5KAIZ 3MHHC 3STLC 2UXCO 4O4JB 5B3SB 1TGOA 3OW2U 3WU2Z 1EBOA 4RO2A 1VQPV 1E1QG 3AK3A 4WFFA 3AG2B 3TETA 3RYIB 3HKCB 1MSDA 3DC5A 1FYJA 3LSSA 3CWBH 5E79Z 1WB7A 5TISZ 3CSXA 3VQWA 3E89A 2JEUA 3A8TA 3D8CA 4U3JA 5LXTB 3A0HZ 4KP4A 3JD2A 4H33A 5EC2C 4IT5A 1XILA 4CS4A 1F23A 2P5OA 1G8MA 2YUAA 1BHAA 1P49A 5A2QN 5L3CA 4FLWA 3DXRA 5IJ9B 1LUVA 5L3BA 2PI4A 2ZE7A 4UCSA 1HNXB 1XMQB 2WLMA 5KMGA 3BY6A 3CCSV 3CP1A 3BA9A 3CRMA 4YHHB 1V55C 2D3OW 4LFBB 4CZZA 3ETDA 2FTKA 1SQVH 1Q7YW
chains in the Genus database with same CATH topology
1T5EA 4DRXA 3UT5A 1KMIZ 3OTOB 4ZOLA 3K5MA 4IHJA 1TA8A 4FLVA 5J2TB 3JALA 3DSQA 5IWAB 4ZI7A 5EIBC 4LNUB 4I55A 5BMVA 4DR4B 5LP6A 5EZYA 4X65B 2RQ6A 2YIBA 4UCRA 4FLTA 5FPOA 4PI2A 3ZEDA 3ICXA 4X1YB 5C8YB 4CS2A 4FM1A 4B3TB 2UXBB 1H2SB 4DV5B 3IAYA 4ZHQA 2UUBB 5JH7A 4F6RA 4WBNB 1TAEA 5JVDB 1QQCA 3BRCA 5LMNB 4O2BA 4ZIBA 4CC5A 1XQ8A 2XHBA 3HKDB 5LYJB 1Q8IA 1TUBA 4FFBB 2BTQB 3JAWA 1Q5OA 5KHGA 4KL1A 4X20B 4LF6B 4YJ3A 3LNNA 4O4IA 2E5LB 2VWKA 3SR2C 4TV8A 5CB4A 5K1PA 3VQXA 2R72A 4U3JB 1IBMB 2YI9A 4JI3B 2PYJA 4NXNB 4FVMA 5IYZB 1I94B 3FFQA 4O2AA 4B3SB 4BW9A 2PGGA 2PTMA 3N2KB 3RYHB 4GKKB 2VQEB 5KMGB 4O4HA 5KX5A 3ETQA 4AHCA 3ZS8C 4EB6B 2P22C 1WNSA 3JASB 2ZIOA 2IM9A 4HNAA 3HKBB 3BHPA 4I9QA 1QHTA 1TVKA 4L8JA 1HR0B 5LA6A 1YEWA 4JI6B 3JAKA 1N32B 3K5NA 4DRXB 4UFZA 3QF7A 2UUAB 5JCOC 3UT5B 4JI4B 4ZOLB 3RWRD 3WB2A 5CA1A 4FLYA 3K5LA 2KKWA 4IHJB 1WN7A 3N2GA 3JALB 4TUYA 5KHIA 4ZI7B 4I55B 4K8ZA 5BR8B 5BMVB 4DUZB 4LF5B 4UCOA 5LP6B 1HW7A 4LF4B 5EZYB 4LH6A 2UXDB 5JJNB 2PZSA 1N36B 4AQYB 4DV4B 4TQDA 5LOVA 2PYLA 4CC6A 5ITZA 4JI1B 2JVDA 4ZHQB 1FJGB 3U10A 3JATA 1SQGA 5JH7B 1N34B 2BTOA 4F6RB 2JGUA 1O9HA 4UCTA 2R70A 4IIJA 3QG5A 4GLXA 4FLXA 4DV6B 4O2BB 2Q7GA 4DR6B 4LF8B 1N33B 3M7MX 1M5IA 4YJ2A 4D7SA 4JV5B 1TUBB 1VF7A 4X1IA 1SA0A 2YI8A 3CB2A 4LFCB 5CA0A 1D5AA 3JAWB 2Q7HA 1L8DA 4DK1A 2F93B 4O4IB 3QTCA 1HNZB 4TOIA 4FLUA 4TV8B 2QM4A 4I50A 3HKEA 5CB4B 3U0ZA 2JS5A 1WPBA 1XI1A 5KHKA 2ZNIA 3SJCC 3RGBA 4O4LA 4JI8B 4LFAB 4O2AB 3OTFA 2YIBD 4LH7A 2VQFB 1SKVA 4EFBA 4FM2A 4YY3B 4EEQA 2VWJA 4TQFA 5KHJA 1XMOB 3PN1A 2PUSA 4O4HB 5KX5B 4D7TA 1XHXA 3U11A 4DR5B 4DV3B 3K59A 4HNAB 3JARA 1TVKB 1V9PA 5LA6B 3K58A 3JAKB 3K5OA 3K57A 4JI0B 4CH5A 1SQFA 5CA1B 5FPRA 2OWOA 3N2GB 4CH3A 2BTQA 3SJBC 3THOA 4TUYB 2YXLA 1JFFA 3E22A 4O4JA 1Z5VA 3RYCA 5JCOA 1Q43A 3BABA 4UCVA 1ZAUA 2RJZA 4DR7B 3RYIA 2PY5A 3HKCA 5J2UA 4EFEA 4CH4A 4I4TA 4X64B 4TV9A 5JJEB 5JQGA 3B2EE 5LOVB 5ITZB 5K1XA 1FFXA 4LR3A 2YIAA 5IJ0A 2F1MA 4DK0A 4DR1B 3CHXA 3JATB 5LXTA 2UUCB 4GYCB 3RFRA 3JSNA 4IIJB 2F4VB 5LMUB 2ZNJA 2ZCEA 5IJ9A 2F95B 3A2FA 4YJ2B 3RYFA 2ZIMA 1DGSA 4FM0A 4X1KA 4NXMB 4K0KB 4X1IB 1SA0B 5GONA 5CA0B 5EYPA 1HNWB 2UU9B 4JI5B 4B08A 4CH6A 4Q6GA 4CS3A 2CAZC 1IBLB 4I50B 3HKEB 4PHZA 1Z5WA 5FNVA 4JI2B 4GKJB 5LP6C 3SGIA 3WB1A 3T1YB 3BPZA 5D5PA 4O4LB 5J2TA 4K8XA 1M93A 4YJ3B 4UCUA 4KHPB 1JJOA 2F66C 4LNUA 1J5EB 3MAQA 5EIBD 2ZM6B 2GV9A 1S5JA 5D5QA 4X66B 4DV2B 2HHHB 4DR3B 4AILC 4JI7B 1B04A 2HEPA 2R9AA 5KHHA 1NT2B 4X1YA 5C8YA 3UQ8A 3JARB 4FLZA 4DV1B 4HBNA 4DV7B 1XHZA 2OYQA 4B3MB 1KU9A 1RSOA 4WBNA 5JVDA 1X4TA 2ZINA 3SJAC 1JFFB 3E22B 4O4JB 1M4UA 3RYCB 1TGOA 4B3RB 3HKDA 1XNQB 4JYAB 5LYJA 3RYIB 4LF7B 3T1HB 3HKCB 3JSLA 4FFBA 5J2UB 4NVPA 4I4TB 4TV9B 1JMKC 4LF9B 5JQGB 4OX9B 3CSXA 4X20A 3VQWA 3VQVA 1FFXB 4DV0B 5IJ0B 4U3JA 4X62B 3BAAA 5LXTB 3WB0A 2Q7EA 1XNRB 4DR2B 4CS4A 5IYZA 1G6UA 2P5OA 4DUYB 1Q3EA 2E3CA 1O9GA 1P49A 4PI0A 4FLWA 5IJ9B 2V4DA 2QJ1A 3RYFB 3N2KA 4UCSA 1HNXB 2Q0AA 3RYHA 4X1KB 1XMQB 1IBKB 2EX3A 5KMGA 3VQYA 5GONB 3BA9A 5EYPB 4YHHB 4EB6A 2UXCB 3JASA 4LFBB 1I7FA 3HKBA 4BWAA 5JJJB 3BA8A 5FNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAZ C;  1NT2 B;  2P22 C;  3CSX A;  3ICX A;  3SJC C;  3SJB C;  1SKV A;  3THO A;  3QF7 A;  2JS5 A;  1X4T A;  2F66 C;  3QG5 A;  3SJA C;  3B2E E;  3ZS8 C; 
#chains in the Genus database with same CATH topology
 1T5E A;  2ZD9 A;  3UT5 A;  1F4N A;  1H8H G;  4QE7 A;  2Z3Y A;  2GUZ A;  1R3K C;  3ZHS A;  5J2T B;  3D3I A;  3DSQ A;  3H1K H;  1M9N A;  5EIB C;  4I55 A;  4XDJ A;  1PPJ H;  1NS1 A;  2BE3 A;  5EZY A;  2Q67 A;  3IFX A;  2E75 B;  3JCU Z;  2BOB C;  2RQ6 A;  3C90 A;  2XAH A;  4JI3 O;  2Q6A A;  1SC5 B;  2QM7 A;  1MZF A;  2N05 A;  3IAY A;  2WLL A;  4F6R A;  3J7A U;  2JS3 A;  4FMT A;  4WBN B;  3I55 V;  3SYC A;  2VQE O;  5JVD B;  1QQC A;  5LMN B;  2A3Q A;  1H8E G;  1GN3 A;  3RVZ A;  2OIG A;  4NR1 A;  4XDK A;  1X59 A;  3TCU A;  1Q8I A;  3S3W A;  1TUB A;  4P9P A;  2UXX A;  4PV1 B;  1E1R G;  2HP8 A;  2LP7 A;  3FB8 C;  3JCZ A;  3K0G A;  5KHG A;  3FB5 C;  2EUL A;  4YJ3 A;  3AG1 B;  3CCL V;  3B4S A;  5BR8 O;  4G27 B;  2R72 A;  4U3J B;  2ZXW C;  1IBM B;  4LF4 O;  2P90 A;  4GX1 A;  3B09 A;  2PYJ A;  1VQK V;  4NXN B;  3FFQ A;  4DV4 O;  5B1B C;  3SPG A;  1K7D A;  3DXR B;  3QO5 A;  1V54 C;  4QIW F;  2FKX A;  1AR5 A;  4AI8 A;  2NR5 A;  3ZCC A;  5KMG B;  1N34 O;  4K0K O;  3W7X A;  2Y69 B;  2CE4 A;  4R8C A;  2Y4U A;  3G6B A;  1WNS A;  2ZIO A;  3DGE A;  1TVK A;  4NTX A;  4L8J A;  4JAS A;  1OCC C;  1QCE A;  1YEW A;  5LA6 A;  3JAK A;  2QA4 V;  2LGW A;  1NH2 D;  3F7Y C;  4NKG B;  3UT5 B;  1H2K A;  4JI4 B;  1DLB A;  3RWR D;  1Q82 W;  5CA1 A;  4FLY A;  2GUZ B;  5IE9 A;  4TUY A;  3OGC C;  3KCY A;  3MDS A;  2FML A;  2DWD C;  1WLE A;  4I55 B;  4WF9 V;  4DUZ B;  4PA6 A;  2ZM6 O;  5EZY B;  3J80 N;  4YIO A;  5L3D A;  1QLE B;  2HHH O;  5JJN B;  3ZHT A;  2GTA A;  2X6A A;  2BOC C;  1S0V A;  3E8F A;  3K08 A;  2AGA A;  2PYL A;  2Q8V A;  3CC2 V;  1WA8 A;  4YY3 O;  5CBH A;  4DV7 O;  2WLL B;  1FJG B;  1U96 A;  2BTO A;  4ASU G;  4F6R B;  4MW8 A;  5LL6 Y;  1MA1 A;  3RW0 A;  2P7T C;  1AJN A;  4FLX A;  4PA4 A;  2Q7G A;  2JRI A;  3M7M X;  2DYS C;  4D7S A;  1AI5 A;  1TUB B;  4XBF A;  4BIO A;  1OHH G;  4PD4 F;  4DK1 A;  1KKD A;  2ZE6 A;  3QTC A;  2AXT Z;  2GTS A;  3U0Z A;  4PA3 A;  1QU7 A;  1WPB A;  1QLN A;  4UXN A;  1E79 G;  1F7Y A;  3SJC C;  1GM7 A;  4X64 O;  2XAJ A;  1DK1 A;  2QKC A;  3STZ C;  2YIB D;  2QSA A;  4LH7 A;  1SKV A;  3IC7 A;  1M90 W;  1MSW D;  4IGG A;  1NQT A;  1XMO B;  2XAQ A;  3U11 A;  2IH3 C;  5HFM A;  3K59 A;  2DYR C;  5LMU O;  1TVK B;  4OPA A;  1V9P A;  5LA6 B;  3JAK B;  4QPJ A;  4OPH A;  1PD3 A;  1A32 A;  4CH5 A;  1SQF A;  5CA1 B;  3OTO O;  3ZIA G;  3K9A A;  4PDL A;  2BTQ A;  2E74 B;  4TUY B;  2YXL A;  4KXR A;  1HNW O;  2UU9 O;  4JF3 A;  4YXW G;  5IWA O;  5JCO A;  1FXV A;  1Q43 A;  3JD4 A;  1QBZ A;  4CBC A;  2PY5 A;  3OMN B;  3E35 A;  5IDJ A;  1VQ5 V;  3AK2 A;  1BCC H;  5KA6 A;  3H1L H;  4E4E A;  4X65 O;  3E2E A;  2Z0A A;  4H13 B;  1FFX A;  1OJH A;  1WA8 B;  2AHY A;  2YIA A;  3QNE A;  2F43 G;  5E1A C;  4DV5 O;  1MOF A;  2LGQ A;  2UUB O;  1M56 B;  1Y74 A;  3KZI Z;  2HR3 A;  4JAV A;  4NTW A;  2OCC B;  4F4L A;  4MTG A;  1NTK H;  3LSQ A;  2ZCE A;  1KEC A;  5BY1 A;  2LFS A;  1DGS A;  4K0K B;  2WA3 A;  3ZHQ A;  4FJC C;  1YSC A;  5GON A;  4X88 A;  4B08 A;  5L3F A;  4LBE C;  4CS3 A;  3QO8 A;  1IBL B;  3VOU A;  3CRA A;  2KQX A;  1Z5W A;  4PHZ A;  5A9G A;  4J42 A;  3ZHU A;  1PNK A;  3T1Y B;  1KP2 A;  3FD9 A;  4K8X A;  3H1H H;  2GSM B;  3APO A;  1J5E B;  3CCM V;  2ZM6 B;  2GDS A;  4B3S O;  1S5J A;  1ZWI C;  2HHH B;  3IGA C;  3ABT A;  1PL0 A;  5AG2 A;  1M57 C;  4X1Y A;  1GRJ A;  3UQ8 A;  3K03 A;  4FLZ A;  2VS0 A;  2Z5U A;  1IX9 A;  4DV7 B;  2LW1 A;  3SDL A;  3AG4 B;  2Q68 A;  1N32 O;  4RQF A;  1HNX O;  1RSO A;  4PDV A;  1XMQ O;  2BCC H;  4RUE A;  1GN2 A;  3L72 H;  1CEZ A;  2ZIN A;  1YCI A;  2B1I A;  1OCO C;  4YHH O;  2WLK A;  3W7S A;  1M4U A;  2ZR2 A;  4JYA B;  1P4R A;  4J41 A;  1ZTE A;  1K9M W;  1EN5 A;  4LF7 B;  3T1H B;  4J11 A;  1HDJ A;  1NTM H;  4RQE A;  2W6I G;  4J7J A;  4OX9 B;  1OCR C;  2A0L A;  1FFX B;  5B1N A;  2EIJ B;  1BHB A;  4X62 B;  1WJZ A;  1XNR B;  1Y74 B;  2Q9L A;  4BIU A;  4DR2 B;  3CCJ V;  1G6U A;  4DO2 A;  2EIL C;  1O9G A;  4DV6 O;  3UM7 A;  2JGD A;  3OD4 A;  3OFN G;  4PI0 A;  1N8R W;  2QJ1 A;  3N2K A;  3M8A A;  4JV5 O;  3DC6 A;  1JVM A;  1IVS A;  5GON B;  3D36 A;  4H37 A;  1K4C C;  3ZHR A;  5LMN O;  3AG3 B;  3JAS A;  1NR7 A;  1I7F A;  3HKB A;  5CN0 A;  3LDD A;  4LP8 A;  3OTO B;  2WPD G;  2XAG A;  1Y67 A;  2YDE A;  4IHJ A;  4FLV A;  5IWA B;  5DEC A;  4ZI7 A;  4LFA O;  1I5X A;  4JYB A;  2X7R B;  4FK5 C;  2OTJ V;  2QKS A;  3O65 A;  2CTR A;  5LP6 A;  3CCE V;  3B40 A;  1YTF B;  2WLH A;  4X65 B;  1YZB A;  2GHY A;  2B1G A;  4FLT A;  4UCR A;  1Q90 D;  4NXN O;  5FPO A;  1IUR A;  1ZX3 A;  3ICX A;  4X1Y B;  1YJ9 V;  2WSS G;  4CS2 A;  1EZJ A;  2CTP A;  2UXB B;  4DV5 B;  2QTS A;  2UUB B;  4FIP C;  1RSO B;  1R6T A;  2DQ0 A;  4GZR B;  2IH1 C;  3FB6 C;  3R66 A;  4XDL A;  3UKM A;  4CC5 A;  2QKA A;  1XQ8 A;  3ZJZ A;  2QR4 A;  1NJI W;  1GTO A;  1COW G;  4JTC B;  2YIC A;  1GN6 A;  3JAW A;  1RPR A;  2EJ7 A;  1NR1 A;  3LNN A;  2LO1 A;  2VWK A;  2LJ2 A;  4FZ1 A;  5CB4 A;  1L0L H;  3IC9 A;  5K1P A;  3TXS A;  1NVP B;  4DUZ O;  4NYK A;  3ETG A;  2AW9 A;  2EIK B;  2H94 A;  2UUC O;  1L1F A;  4FVM A;  3SYP A;  3HR0 A;  1I94 B;  2EIL B;  2Y0P A;  3I56 V;  1R3I C;  3ABK B;  4J7Z A;  3UCS C;  2XND G;  1H2G A;  2JGD B;  4B3S B;  1OCZ C;  4GCZ A;  4BW9 A;  1S76 D;  2PGG A;  2PTM A;  3N2K B;  4GKK B;  1FJG O;  2H8P C;  4NXM O;  1BSM A;  4WCE V;  4MSW C;  3ZS8 C;  1M1K W;  3JAS B;  4HNA A;  4I9Q A;  4TWK A;  3HKB B;  3BHP A;  2CTQ A;  1RPO A;  1N32 B;  4GX2 A;  4UFZ A;  4RWU A;  4JI2 O;  2CTW A;  3WB2 A;  2KKW A;  2MW2 B;  4IHJ B;  5EBL C;  4KFM A;  5JWP A;  2EIM B;  2WLN A;  2RN9 A;  4ZI7 B;  3OMA B;  4K8Z A;  4UCO A;  5LP6 B;  3P30 A;  1R3J C;  1VQO V;  3L74 H;  1MG1 A;  3L9D A;  3X2Q C;  2UXD B;  3R65 A;  1PP9 H;  2ARH A;  2PZS A;  4HYO A;  3G80 A;  3NR7 A;  2YC0 A;  3H1J H;  3OEE G;  4WFB V;  5LOV A;  1YXB A;  5ITZ A;  4JI1 B;  2QWQ B;  2HLD G;  1JCH A;  5J9P C;  5GW7 A;  3JAT A;  1HWY A;  1XMO O;  2HG5 C;  2JGU A;  4GX0 A;  3T4D A;  3OEH G;  2R70 A;  3QG5 A;  2V1D A;  4DV6 B;  3CRC A;  1YI2 V;  3ZN1 A;  1FXK C;  4LF8 B;  1N33 B;  1FXH A;  4P2Z A;  1M5I A;  4YJ2 A;  4JV5 B;  2ZDI C;  1YIT V;  3ABL C;  1QVF U;  4X1I A;  1YJN V;  3RN4 A;  1SA0 A;  5CA3 A;  2DWE C;  4LFC B;  2OTL V;  1D5A A;  3JAW B;  2Q7H A;  1W59 A;  2Q4P A;  4TOI A;  4FLU A;  5CB4 B;  2C2A A;  3HKE A;  1UFI A;  4ZKI A;  1EZV H;  1VP7 A;  2JS5 A;  4JTA B;  5F2V O;  1YHQ V;  1XI1 A;  5EK0 A;  1H38 A;  1JX9 A;  2EJR A;  3WFV A;  1KYO F;  3RGB A;  3WG7 C;  1ZL8 A;  3LSU A;  2RCV A;  4JI8 B;  4LFA B;  2E76 B;  3OTF A;  2VQF B;  3VBB A;  3ZMT A;  4FM2 A;  1K5S A;  2ZKO A;  1R6N A;  4TQF A;  1BE3 H;  3I5D A;  1CP9 A;  3L70 H;  4D7T A;  3TGU H;  2VRZ A;  4HNA B;  3K58 A;  1YVW A;  2R9I A;  1I5Y A;  1NZ6 A;  3K57 A;  4JI0 B;  3OR7 C;  1BGY H;  1V55 B;  2O57 A;  1RM1 C;  1N0N A;  1RFY A;  3THO A;  3ZX6 A;  2N04 A;  1CPY A;  3E22 A;  1Z5V A;  3RYC A;  1IBL O;  2RJZ A;  4DR4 O;  2FL4 A;  2CDY A;  4MVQ A;  5J2U A;  3T1Y O;  1QNM A;  4I4T A;  4TV9 A;  3CXC U;  5JJE B;  1Z2G A;  1FAF A;  4G28 B;  3B2E E;  5LOV B;  5ITZ B;  5K1X A;  2CH7 A;  1DF5 A;  2RDC A;  4LR3 A;  1J5E O;  5IJ0 A;  1ZUQ A;  3JAT B;  2UUC B;  3JAM N;  1G1X B;  4GYC B;  3JSN A;  2DQ3 A;  3EFF K;  1AP5 A;  1VF5 B;  4RAI A;  1NU1 H;  3W7W A;  4PA9 A;  4DW1 A;  4ICG A;  4YJ2 B;  2PF4 E;  1N4C A;  2ZIM A;  4K3A A;  4X1K A;  1VF6 C;  4NXM B;  1K33 A;  4X1I B;  1SA0 B;  3E83 A;  3B77 A;  3D3Q A;  5EYP A;  2ITC C;  4JI5 B;  4CH6 A;  4Q6G A;  1SF9 A;  1WAZ A;  4LF6 O;  3HKE B;  1ENV A;  4JYA O;  4JI2 B;  4GKJ B;  1R73 A;  3SYQ A;  4LF7 O;  3T1H O;  4NTY A;  5D5P A;  1EFR G;  4NB5 A;  1ZL8 B;  1JJ2 U;  3SPI A;  3SYA A;  4YJ3 B;  1SES A;  3H1I H;  4OX9 O;  5KUK A;  2ZXW B;  1KP3 A;  2Q0O C;  1CXZ B;  4DV2 B;  4X62 O;  4JAA A;  1XNR O;  4PA7 A;  4JI7 B;  3BFR A;  1B04 A;  4DR2 O;  5B1B B;  1Y76 A;  3CRQ A;  1YF2 A;  1JA8 A;  5C8Y A;  3OAA G;  1UPG A;  3LDC A;  1V54 B;  2WLI A;  2YSU B;  2A06 H;  4HBN A;  1Y66 A;  2OYQ A;  1H2L A;  4B3M B;  4PEL A;  1KU9 A;  5GTH Z;  3QVN A;  3ASO C;  4JAU A;  4DW0 A;  1X4T A;  4W4L A;  3SJA C;  4R6Z A;  4BR6 A;  2M6Y A;  3O9O A;  1NTZ H;  1OCC B;  3E22 B;  3RYC B;  4B3R B;  3HKD A;  3EVK A;  4HAM A;  5EBM C;  5LYJ A;  1TUE B;  4FFK A;  4LF5 O;  2H3O A;  5IY5 C;  3K9S A;  4H0L B;  4PDR A;  2AZ0 A;  4J80 A;  3JSL A;  5J2U B;  4I4T B;  4N23 A;  4TV9 B;  1JR9 A;  2IU3 A;  2CH7 B;  3H9V A;  2K9P A;  4DV0 B;  5IJ0 B;  1XDC A;  3BAA A;  3WB0 A;  2FYU H;  3CRR A;  2EBO A;  4ABM A;  2ATK C;  3MHS C;  3OR6 C;  5IYZ A;  2KB1 A;  1FFT B;  3K04 A;  2ADP A;  1S72 V;  1WP8 A;  4DR6 O;  3ABM C;  2V4D A;  2K1E A;  2Q69 A;  2UXB O;  2Q0A A;  3RYH A;  4X1K B;  1IBK B;  1L0N H;  3VQY A;  3AG7 A;  3CCR V;  2EIN C;  2XTA A;  5EYP B;  3A0B Z;  1D2D A;  1K8A W;  2X6B A;  5JJJ B;  4BWA A;  2DYS B;  3CE2 A;  4FZ0 A;  5LGT A;  3BA8 A;  4JZG A;  4DRX A;  3SJQ C;  1BZK A;  4I0X A;  2XAF A;  5BZB A;  4LCU C;  4U7O A;  2XAS A;  1KMI Z;  4E2L A;  3TK1 A;  3F5W C;  4P30 A;  1PKX A;  1FKA O;  1JOY A;  2DE0 X;  1XL6 A;  3ZN0 A;  3G71 V;  4X9Q A;  4QE9 A;  4DR4 B;  2G38 A;  5LGU A;  5FLX N;  2P4K A;  5LHH A;  4H44 B;  1VQ4 V;  2NN4 A;  4A5U B;  4DXW A;  1I94 O;  1LUW A;  4GT1 A;  1AJP A;  5C8Y B;  4DV3 O;  4R50 A;  3SPC A;  2WLI B;  4FM1 A;  3P3P A;  4B3T B;  1H2S B;  3CEI A;  4ZHQ A;  1F4M A;  4TSF G;  4GKK O;  5B5E Z;  1PL4 A;  1SZX A;  2DYR B;  5KAF Z;  4OXS A;  3CX5 F;  4IYH A;  2XHB A;  3HKD B;  5LYJ B;  4Z1M G;  4ZBM A;  1VQN V;  2DOS A;  1SER A;  1BMF G;  1W0K G;  2BTQ B;  3FB7 C;  4MVO A;  2QE7 G;  1VMG A;  4LF6 B;  4I5S A;  4O4I A;  2E5L B;  4TV8 A;  3CCU V;  2RNB A;  2L6L A;  2UXD O;  5IYZ B;  1YTF D;  2LFR A;  3UO3 A;  3OT7 A;  1SS3 A;  2Y4T A;  4JI1 O;  3ASN C;  3RYH B;  5CBG A;  3JD1 A;  1THZ A;  2HJD A;  3G4S V;  1BL8 A;  1K4D C;  5KX5 A;  2W0X A;  3KG2 A;  3PJS K;  1MZE A;  3HPL C;  1K5Q A;  2P22 C;  3BEH A;  1US6 A;  3W7T A;  4B7E A;  1Q86 W;  1URF A;  3EXA A;  1QHT A;  1YDX A;  4LF8 O;  4JI6 B;  3T4Z A;  1N33 O;  3K5N A;  4DRX B;  5B3S C;  4I0X B;  3LDE A;  1WP7 A;  3ZBH A;  3AG2 C;  4P9O A;  4QNH B;  3K5L A;  2DN9 A;  3G67 A;  1WN7 A;  4LFC O;  5KHI A;  1OZ0 A;  4LF5 B;  1HW7 A;  3KKY A;  1SQB H;  4LH6 A;  1ROP A;  3ZRV A;  1NVP D;  2YID A;  4X66 O;  3ZRW A;  2ZQM A;  1N36 B;  5KUM A;  4F6E A;  4AQY B;  3C3S A;  4JI8 O;  4TQD A;  1XRE A;  4CC6 A;  3CC7 V;  2JDI G;  4MT8 A;  4UUJ C;  2VQF O;  2A9H A;  4PDM A;  4ZHQ B;  4DV1 O;  1SQG A;  5CMU A;  1SZT A;  1O9H A;  1NBM G;  4Z1V A;  1M57 B;  4GLX A;  3CPW U;  1J95 A;  4DR6 B;  3OM3 B;  4JYY A;  1K97 A;  1AP6 A;  2ETN A;  3GWO A;  4JI0 O;  1SQP H;  2YI8 A;  5B66 Z;  1OCO B;  2WLJ A;  5CA0 A;  1AR4 A;  1PNM A;  1VQ7 V;  2X0L A;  2JJ1 G;  1VIB A;  4MTF A;  2F93 B;  4LF9 O;  4O4I B;  3Q4H A;  3FYI B;  3EHB B;  3SPH A;  4TV8 B;  2N74 A;  1ORQ C;  1SET A;  1MNG A;  5KHK A;  2ZNI A;  4L87 A;  4O4L A;  1OCR B;  2OIE A;  3CJH A;  3F7V C;  4EEQ A;  3F5T A;  2VWJ A;  3JD3 A;  3OE7 G;  1DTO A;  5KHJ A;  1B06 A;  3PN1 A;  2PUS A;  2WA4 A;  5KX5 B;  4RUF A;  4DR5 B;  4BW5 A;  4DV3 B;  3CME V;  3JAR A;  1U97 A;  3B8N A;  3K5O A;  5L3E A;  2A79 B;  2LW7 A;  2NNU A;  5KA5 A;  2V7Q G;  5FPR A;  1Y6X A;  5DN6 G;  3SJB C;  3AEI A;  2ZR3 A;  3OGI B;  4JI5 O;  1JFF A;  2ODM A;  3H01 A;  3BAB A;  4LWS A;  3FKS G;  4UCV A;  3AG1 C;  3E8B A;  1ZAU A;  4DR7 B;  4GKJ O;  4I9W A;  2QTO A;  3ZRW B;  1R1B A;  4EFE A;  4CH4 A;  2XT9 A;  2IJH A;  1P7G A;  4JYC A;  5JQG A;  4MVR A;  4YIP A;  1K73 W;  2JK5 C;  2OCH A;  1MMM A;  4DK0 A;  3CHX A;  3DTU B;  4WFE A;  5BXZ A;  4DV2 O;  3CC4 V;  1G4Y B;  1PNL A;  1H2M A;  1IDS A;  4JI7 O;  2QWR B;  4J9Y B;  2F4V B;  5LHI A;  5LGN A;  2Y69 C;  2ZNJ A;  3HB3 B;  3UO2 A;  3CYO A;  3RYF A;  4B7K A;  3T2M A;  4B3M O;  4FM0 A;  2ADQ B;  1ZLZ A;  5CA0 B;  1FXK A;  1WPX A;  2ZT9 B;  2L35 A;  3ML0 A;  1WB8 A;  2IJI A;  3Q4H B;  2CAZ C;  2QM8 A;  1AI6 A;  4WFA V;  5EC1 C;  2ZDI A;  5FNV A;  1VQL V;  2OT5 A;  1YIJ V;  4B3R O;  5H6Q A;  3ETE A;  3AK1 A;  3SGI A;  2JEX A;  4MW3 A;  3BPZ A;  1KBH A;  1QLE C;  3TXQ A;  4LC1 A;  4O4L B;  1NKD A;  1M93 A;  2P4V A;  1B3Q A;  3CJH B;  3ZMZ A;  4BAY A;  4KHP B;  1P7B A;  4LNU A;  1VQM V;  3MAQ A;  5EIB D;  3E8H A;  1VEW A;  1EN6 A;  3LNM B;  4DV0 O;  2KSD A;  4X66 B;  3TJT A;  4DR3 B;  4KUM A;  3E8G A;  4U7N A;  3ZMV A;  3GB7 C;  2ILM A;  2YEV A;  1KD1 W;  3JAR B;  2HKO A;  1OCZ B;  1K34 A;  3OMI B;  4DV1 B;  1HR0 O;  4UV8 A;  4Z2W A;  2UUA O;  5IYD O;  4G2K A;  1IBK O;  2R9R B;  1GKF A;  2P67 A;  4TT3 G;  3K0D A;  1JFF B;  3A0R A;  1AB3 A;  1S5L Z;  4MTO A;  1XNQ B;  4LWS B;  1P84 F;  3T1C A;  4FFB A;  3FAV A;  4NVP A;  3BCC H;  5CBF A;  1JMK C;  4LF9 B;  5JQG B;  2DJV A;  1ZSP A;  4UV9 A;  3OUF A;  4X20 A;  3VQV A;  2Y0I A;  1I08 A;  1LNQ A;  3MD0 A;  3X2Q B;  1OV9 A;  1Q6I A;  2Q7E A;  1GK9 A;  4X8A A;  3KCX A;  4DUY B;  1Q3E A;  2E3C A;  1EN4 A;  2A7W A;  2Q5Z A;  3CS5 A;  2IJJ A;  4GX5 A;  3GVM A;  3L73 H;  3RYF B;  1MAB G;  4B3T O;  2WAM A;  3NXS A;  4MTX A;  2EX3 A;  1FS0 G;  1GMG A;  4JPR A;  1VQ9 V;  1FXK B;  5FL7 G;  4EB6 A;  2UXC B;  3CCV V;  2IJK A;  2YXH A;  1HNZ O;  3ZHV A;  5FNV B;  2AZ2 A;  1VF6 A;  3ABL B;  1HP8 A;  4ZOL A;  2AHZ A;  3RBZ A;  3K5M A;  2QWP B;  2ZE8 A;  5L3G A;  2YS8 A;  1TA8 A;  1Q6U A;  3JAL A;  1Y4M A;  4UVB A;  4LNU B;  1XUQ A;  2E5L O;  5BMV A;  1GO3 F;  1IZ3 A;  1KUQ A;  3WG7 B;  1BS3 A;  2YEV B;  1M56 C;  2YIB A;  4PI2 A;  3ZED A;  4MVM A;  3CCQ V;  1KQS U;  4QJF B;  4JTD B;  2OCC C;  1R3L C;  3E86 A;  2QWO B;  5IYB O;  3J81 N;  5JH7 A;  1TAE A;  1S77 D;  1S3J A;  3BRC A;  4O2B A;  2EZO A;  4WFG A;  1NH2 B;  4ZIB A;  2HVJ C;  3CD6 V;  1AR1 B;  4JI6 O;  2IBZ H;  1AVM A;  3FX7 A;  4R7C A;  4D6T H;  2JJ2 G;  4JZ2 A;  1RM1 B;  5GTI Z;  3B8M A;  4FFB B;  3FAV B;  3ZMU A;  2BSK A;  2B9Z A;  1Q5O A;  4KL1 A;  1GH6 A;  4X20 B;  3OUS A;  3SR2 C;  3K06 A;  1VAR A;  1Q6H A;  3VQX A;  1VQ8 V;  1YJW V;  3RT3 C;  1PM9 A;  4QPK A;  4DR1 O;  5H5N A;  2YI9 A;  4JI3 B;  4U3F H;  2XUM A;  1N36 O;  5DM6 V;  4AQY O;  4O2A A;  5KLV H;  2CK3 G;  1UJW B;  2VQE B;  3AG4 C;  1I0H A;  1EM1 A;  2W0F C;  4O4H A;  3ETQ A;  4AHC A;  1K3E A;  4EB6 B;  2UXN A;  2IM9 A;  1GM8 A;  1B6Q A;  1HR0 B;  1GN4 A;  3QF7 A;  2UUA B;  5JCO C;  4ZOL B;  2F23 A;  4UVA A;  3N2G A;  3JAL B;  5HFL A;  1QR9 A;  5BR8 B;  5BMV B;  3K3W A;  4LF4 B;  2EIJ C;  2EZP A;  4WFH A;  4DV4 B;  4FPP A;  3LUT B;  2ITD C;  5LHG A;  2JVD A;  3QO7 A;  2NLJ C;  3U10 A;  3APQ A;  5JH7 B;  1N34 B;  4K35 A;  2YXY A;  2M7W A;  4EKW A;  2QEX V;  4UCT A;  3ABU A;  4GUN A;  1Y76 B;  4IIJ A;  4C7U A;  5H9C A;  2P06 A;  4O2B B;  4DR5 O;  1FD9 A;  1AJQ A;  3ZRS A;  3JD0 A;  3AG3 C;  3C3T A;  3P32 A;  4J9Z B;  1VF7 A;  1JPX A;  3ASO B;  2HJF C;  3SYO A;  2BSK B;  3CB2 A;  5DED A;  4IL6 Z;  2Q73 A;  1L8D A;  2IW5 A;  2MK3 A;  4PJ0 Z;  1XL4 A;  3CMA V;  1HNZ B;  5IT9 N;  4JGS A;  1BT8 A;  2QM4 A;  1JQ0 A;  4I50 A;  2P6J A;  5IY5 B;  1XEQ A;  4QGP A;  1W2B U;  2HVK C;  1Q81 W;  4DR7 O;  2RMK B;  1SRY A;  5IYC O;  5B1A C;  4Q20 A;  4O2A B;  1VQ6 V;  3S3X A;  2PI5 A;  1KKC A;  4EFB A;  4YY3 B;  2QGN A;  3L71 H;  1BQZ A;  2QDO A;  4MVZ A;  5B1O A;  4O4H B;  1PV0 A;  2JIZ G;  1QR8 A;  1XHX A;  1F51 A;  2DW4 A;  2F4V O;  2KG7 A;  2CGN A;  3ABM B;  2XOK G;  4LFB O;  2FB5 A;  4UB8 Z;  1IXB A;  1K92 A;  3IJ4 A;  2CGO A;  4OGQ B;  2EIN B;  2OWO A;  3ZMS A;  3N2G B;  4CH3 A;  4UVC A;  3K79 A;  4O4J A;  2X6C A;  3ZRX A;  3RYI A;  4BIZ A;  1QVG U;  4J10 A;  3HKC A;  2EIK C;  4N21 A;  1IXM A;  4X64 B;  4MVS A;  1S5H C;  4KHP O;  2HFE C;  3ABK C;  4I7Z B;  5H2F Z;  2F1M A;  1XOU A;  4DR1 B;  5LXT A;  1FPO A;  4W4K A;  5C93 A;  3RFR A;  4DR3 O;  4IIJ B;  4DYL A;  3BVO A;  3W7U A;  1ARO P;  3FYE B;  1LR1 A;  5LMU B;  3D36 C;  3CXH F;  3M99 B;  1SQQ H;  1R6K A;  2GBO A;  5LBQ A;  5IJ9 A;  2F95 B;  3A2F A;  1SQX H;  2DMX A;  4IYI A;  1AI7 A;  4UB6 Z;  1RP3 B;  3G6E V;  1KC8 W;  1N0J A;  1HNW B;  2UU9 B;  2WWW A;  3RVY A;  2EIM C;  4X89 A;  4I50 B;  2LQT A;  1XNQ O;  1H2N A;  1GM9 A;  5H6R A;  4J7K A;  5LP6 C;  1IBM O;  3WB1 A;  5B1A B;  3SPJ A;  1W0J G;  5J2T A;  1D5N A;  4UCU A;  4MS2 A;  1BQ0 A;  2D2C B;  1JJO A;  2F66 C;  3JYC A;  2GV9 A;  1AI4 A;  3GWK C;  5D5Q A;  5EBW C;  2ZE5 A;  3L75 H;  4AIL C;  4MVU A;  1XBL A;  2CUG A;  2HEP A;  2R9A A;  2Y48 A;  5KHH A;  1NT2 B;  3N27 A;  2KG7 B;  3P3N A;  4DUY O;  3ASN B;  1GAX A;  2IU0 A;  2B5U A;  1AIL A;  1XHZ A;  1KB9 F;  1NI8 A;  2QWN B;  4HZ3 A;  1DF4 A;  4WBN A;  4JI4 O;  2W6J G;  5JVD A;  5KAI Z;  3MHH C;  3STL C;  2UXC O;  4O4J B;  5B3S B;  1TGO A;  3OW2 U;  3WU2 Z;  1EBO A;  4RO2 A;  1VQP V;  1E1Q G;  3AK3 A;  4WFF A;  3AG2 B;  3TET A;  3RYI B;  3HKC B;  1MSD A;  3DC5 A;  1FYJ A;  3LSS A;  3CWB H;  5E79 Z;  1WB7 A;  5TIS Z;  3CSX A;  3VQW A;  3E89 A;  2JEU A;  3A8T A;  3D8C A;  4U3J A;  5LXT B;  3A0H Z;  4KP4 A;  3JD2 A;  4H33 A;  5EC2 C;  4IT5 A;  1XIL A;  4CS4 A;  1F23 A;  2P5O A;  1G8M A;  2YUA A;  1BHA A;  1P49 A;  5A2Q N;  5L3C A;  4FLW A;  3DXR A;  5IJ9 B;  1LUV A;  5L3B A;  2PI4 A;  2ZE7 A;  4UCS A;  1HNX B;  1XMQ B;  2WLM A;  5KMG A;  3BY6 A;  3CCS V;  3CP1 A;  3BA9 A;  3CRM A;  4YHH B;  1V55 C;  2D3O W;  4LFB B;  4CZZ A;  3ETD A;  2FTK A;  1SQV H;  1Q7Y W; 
#chains in the Genus database with same CATH homology
 1T5E A;  4DRX A;  3UT5 A;  1KMI Z;  3OTO B;  4ZOL A;  3K5M A;  4IHJ A;  1TA8 A;  4FLV A;  5J2T B;  3JAL A;  3DSQ A;  5IWA B;  4ZI7 A;  5EIB C;  4LNU B;  4I55 A;  5BMV A;  4DR4 B;  5LP6 A;  5EZY A;  4X65 B;  2RQ6 A;  2YIB A;  4UCR A;  4FLT A;  5FPO A;  4PI2 A;  3ZED A;  3ICX A;  4X1Y B;  5C8Y B;  4CS2 A;  4FM1 A;  4B3T B;  2UXB B;  1H2S B;  4DV5 B;  3IAY A;  4ZHQ A;  2UUB B;  5JH7 A;  4F6R A;  4WBN B;  1TAE A;  5JVD B;  1QQC A;  3BRC A;  5LMN B;  4O2B A;  4ZIB A;  4CC5 A;  1XQ8 A;  2XHB A;  3HKD B;  5LYJ B;  1Q8I A;  1TUB A;  4FFB B;  2BTQ B;  3JAW A;  1Q5O A;  5KHG A;  4KL1 A;  4X20 B;  4LF6 B;  4YJ3 A;  3LNN A;  4O4I A;  2E5L B;  2VWK A;  3SR2 C;  4TV8 A;  5CB4 A;  5K1P A;  3VQX A;  2R72 A;  4U3J B;  1IBM B;  2YI9 A;  4JI3 B;  2PYJ A;  4NXN B;  4FVM A;  5IYZ B;  1I94 B;  3FFQ A;  4O2A A;  4B3S B;  4BW9 A;  2PGG A;  2PTM A;  3N2K B;  3RYH B;  4GKK B;  2VQE B;  5KMG B;  4O4H A;  5KX5 A;  3ETQ A;  4AHC A;  3ZS8 C;  4EB6 B;  2P22 C;  1WNS A;  3JAS B;  2ZIO A;  2IM9 A;  4HNA A;  3HKB B;  3BHP A;  4I9Q A;  1QHT A;  1TVK A;  4L8J A;  1HR0 B;  5LA6 A;  1YEW A;  4JI6 B;  3JAK A;  1N32 B;  3K5N A;  4DRX B;  4UFZ A;  3QF7 A;  2UUA B;  5JCO C;  3UT5 B;  4JI4 B;  4ZOL B;  3RWR D;  3WB2 A;  5CA1 A;  4FLY A;  3K5L A;  2KKW A;  4IHJ B;  1WN7 A;  3N2G A;  3JAL B;  4TUY A;  5KHI A;  4ZI7 B;  4I55 B;  4K8Z A;  5BR8 B;  5BMV B;  4DUZ B;  4LF5 B;  4UCO A;  5LP6 B;  1HW7 A;  4LF4 B;  5EZY B;  4LH6 A;  2UXD B;  5JJN B;  2PZS A;  1N36 B;  4AQY B;  4DV4 B;  4TQD A;  5LOV A;  2PYL A;  4CC6 A;  5ITZ A;  4JI1 B;  2JVD A;  4ZHQ B;  1FJG B;  3U10 A;  3JAT A;  1SQG A;  5JH7 B;  1N34 B;  2BTO A;  4F6R B;  2JGU A;  1O9H A;  4UCT A;  2R70 A;  4IIJ A;  3QG5 A;  4GLX A;  4FLX A;  4DV6 B;  4O2B B;  2Q7G A;  4DR6 B;  4LF8 B;  1N33 B;  3M7M X;  1M5I A;  4YJ2 A;  4D7S A;  4JV5 B;  1TUB B;  1VF7 A;  4X1I A;  1SA0 A;  2YI8 A;  3CB2 A;  4LFC B;  5CA0 A;  1D5A A;  3JAW B;  2Q7H A;  1L8D A;  4DK1 A;  2F93 B;  4O4I B;  3QTC A;  1HNZ B;  4TOI A;  4FLU A;  4TV8 B;  2QM4 A;  4I50 A;  3HKE A;  5CB4 B;  3U0Z A;  2JS5 A;  1WPB A;  1XI1 A;  5KHK A;  2ZNI A;  3SJC C;  3RGB A;  4O4L A;  4JI8 B;  4LFA B;  4O2A B;  3OTF A;  2YIB D;  4LH7 A;  2VQF B;  1SKV A;  4EFB A;  4FM2 A;  4YY3 B;  4EEQ A;  2VWJ A;  4TQF A;  5KHJ A;  1XMO B;  3PN1 A;  2PUS A;  4O4H B;  5KX5 B;  4D7T A;  1XHX A;  3U11 A;  4DR5 B;  4DV3 B;  3K59 A;  4HNA B;  3JAR A;  1TVK B;  1V9P A;  5LA6 B;  3K58 A;  3JAK B;  3K5O A;  3K57 A;  4JI0 B;  4CH5 A;  1SQF A;  5CA1 B;  5FPR A;  2OWO A;  3N2G B;  4CH3 A;  2BTQ A;  3SJB C;  3THO A;  4TUY B;  2YXL A;  1JFF A;  3E22 A;  4O4J A;  1Z5V A;  3RYC A;  5JCO A;  1Q43 A;  3BAB A;  4UCV A;  1ZAU A;  2RJZ A;  4DR7 B;  3RYI A;  2PY5 A;  3HKC A;  5J2U A;  4EFE A;  4CH4 A;  4I4T A;  4X64 B;  4TV9 A;  5JJE B;  5JQG A;  3B2E E;  5LOV B;  5ITZ B;  5K1X A;  1FFX A;  4LR3 A;  2YIA A;  5IJ0 A;  2F1M A;  4DK0 A;  4DR1 B;  3CHX A;  3JAT B;  5LXT A;  2UUC B;  4GYC B;  3RFR A;  3JSN A;  4IIJ B;  2F4V B;  5LMU B;  2ZNJ A;  2ZCE A;  5IJ9 A;  2F95 B;  3A2F A;  4YJ2 B;  3RYF A;  2ZIM A;  1DGS A;  4FM0 A;  4X1K A;  4NXM B;  4K0K B;  4X1I B;  1SA0 B;  5GON A;  5CA0 B;  5EYP A;  1HNW B;  2UU9 B;  4JI5 B;  4B08 A;  4CH6 A;  4Q6G A;  4CS3 A;  2CAZ C;  1IBL B;  4I50 B;  3HKE B;  4PHZ A;  1Z5W A;  5FNV A;  4JI2 B;  4GKJ B;  5LP6 C;  3SGI A;  3WB1 A;  3T1Y B;  3BPZ A;  5D5P A;  4O4L B;  5J2T A;  4K8X A;  1M93 A;  4YJ3 B;  4UCU A;  4KHP B;  1JJO A;  2F66 C;  4LNU A;  1J5E B;  3MAQ A;  5EIB D;  2ZM6 B;  2GV9 A;  1S5J A;  5D5Q A;  4X66 B;  4DV2 B;  2HHH B;  4DR3 B;  4AIL C;  4JI7 B;  1B04 A;  2HEP A;  2R9A A;  5KHH A;  1NT2 B;  4X1Y A;  5C8Y A;  3UQ8 A;  3JAR B;  4FLZ A;  4DV1 B;  4HBN A;  4DV7 B;  1XHZ A;  2OYQ A;  4B3M B;  1KU9 A;  1RSO A;  4WBN A;  5JVD A;  1X4T A;  2ZIN A;  3SJA C;  1JFF B;  3E22 B;  4O4J B;  1M4U A;  3RYC B;  1TGO A;  4B3R B;  3HKD A;  1XNQ B;  4JYA B;  5LYJ A;  3RYI B;  4LF7 B;  3T1H B;  3HKC B;  3JSL A;  4FFB A;  5J2U B;  4NVP A;  4I4T B;  4TV9 B;  1JMK C;  4LF9 B;  5JQG B;  4OX9 B;  3CSX A;  4X20 A;  3VQW A;  3VQV A;  1FFX B;  4DV0 B;  5IJ0 B;  4U3J A;  4X62 B;  3BAA A;  5LXT B;  3WB0 A;  2Q7E A;  1XNR B;  4DR2 B;  4CS4 A;  5IYZ A;  1G6U A;  2P5O A;  4DUY B;  1Q3E A;  2E3C A;  1O9G A;  1P49 A;  4PI0 A;  4FLW A;  5IJ9 B;  2V4D A;  2QJ1 A;  3RYF B;  3N2K A;  4UCS A;  1HNX B;  2Q0A A;  3RYH A;  4X1K B;  1XMQ B;  1IBK B;  2EX3 A;  5KMG A;  3VQY A;  5GON B;  3BA9 A;  5EYP B;  4YHH B;  4EB6 A;  2UXC B;  3JAS A;  4LFB B;  1I7F A;  3HKB A;  4BWA A;  5JJJ B;  3BA8 A;  5FNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...