2GUZB

Structure of the tim14-tim16 complex of the mitochondrial protein import motor
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title Structure and function of Tim14 and Tim16, the J and J-like components of the mitochondrial protein import motor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 65
sequence length 65
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2006-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2guzB00
3AG7A 2M6YA 1BQZA 3UCSC 2QSAA 1BQ0A 3APOA 1NZ6A 2GUZA 2CTPA 2DMXA 4J7ZA 2Y4TA 2CUGA 2CTQA 2CTWA 1N4CA 2DN9A 2QWOB 1XBLA 2EJ7A 2N04A 2GUZB 1GH6A 2LGWA 3UO2A 1FAFA 2LO1A 3BVOA 4IT5A 1WJZA 2CTRA 1FPOA 2L6LA 2OCHA 4RWUA 3APQA 3UO3A 1HDJA 2PF4E 2YUAA 1IURA 2Y4UA 2QWNB 2QWQB 2QWRB 2KQXA 2YS8A 4J80A 2N05A 2QWPB
chains in the Genus database with same CATH superfamily
4GX2A 2Y69B 4D6TH 2Q0AA 5KHHA 3T1YB 1EN4A 1HNWO 5A9GA 1Q5OA 1SS3A 1T5EA 3SPGA 1Q81W 3BAAA 4W4KA 3CPWU 2ITCC 5K1PA 2WAMA 4JYBA 1TVKA 3MAQA 4O4JB 1YXBA 1JQ0A 1JPXA 4I4TA 1DK1A 2E5LB 1XMOO 3MD0A 1I08A 2IH1C 1NZ6A 1MMMA 3DSQA 1Z2GA 3DTUB 3AG4B 3ZEDA 4X89A 1GN4A 4MVMA 2ZDIC 1XNQO 4MTFA 1G4YB 5EBLC 4IT5A 2XNDG 4PV1B 4OX9B 4JYAB 1FFXB 3MDSA 3RYCA 4TV9B 2A0LA 4J7KA 4I9WA 2ZT9B 1QR9A 3E2EA 1WN7A 3BEHA 4PDRA 5ITZA 3X2QC 3JD1A 4KHPO 1L8DA 2LJ2A 3LDEA 4J9YB 5LYJA 4K8XA 2RDCA 2EIJB 4LFCB 1YZBA 4JV5B 1R3LC 3APQA 2XOKG 3BRCA 3QVNA 3CCLV 2QWQB 4UCVA 3RYFB 4MW8A 3OEHG 5LMUB 1QHTA 1SQBH 2YI8A 5KAIZ 1K73W 1WAZA 4UVAA 3G80A 3BY6A 1IBKB 2P4KA 2PGGA 4FLTA 1Z5WA 2UXCB 1WB7A 2LP7A 3ZMUA 5LA6B 1CEZA 4MVOA 3K9AA 4MVRA 1M5IA 1PD3A 1VF6A 1GRJA 3A0HZ 4DV6B 5LP6A 1K34A 2WPDG 1NTMH 4DR4O 3P3NA 4B3TO 2N04A 3CP1A 4LF9B 1HR0O 1WJZA 3R65A 5HFLA 1EM1A 1TUBA 1D5AA 5JVDA 3R66A 4YJ3B 5IWAB 3OTOB 5LHIA 1QVFU 1N32O 4C7UA 2ZCEA 4EB6A 2P90A 1H8HG 2DQ0A 4R8CA 1NQTA 3AEIA 3UQ8A 4DR3B 2CTQA 3CRQA 2DN9A 3CCUV 4CH5A 1FJGB 1S77D 2XAHA 4PI2A 2GTSA 1SESA 3JASB 3OAAG 2Y0IA 1MZEA 5GW7A 3FFQA 4I7ZB 4GX5A 3CJHA 1VEWA 1B3QA 1JMKC 1R6KA 4KUMA 3LUTB 4LNUA 5BMVA 2BOBC 2ILMA 4UB8Z 1Q8IA 1KMIZ 4CC6A 1OCCB 2BTOA 4TWKA 4X65B 1FXVA 3BHPA 3ZMSA 5KX5A 2BSKA 2YIDA 5J9PC 2XUMA 1V54C 5JCOC 1XREA 4NB5A 4NVPA 5JH7B 4DV2B 3E22A 4J80A 3D3QA 4FK5C 4AHCA 1N36O 4DUYO 5CBFA 2ADQB 1KB9F 1S0VA 4UCUA 4HYOA 1I5YA 1Y76B 2UXNA 4MVSA 3RBZA 1YTFD 1F23A 4JI5O 1R6NA 2HP8A 2WLLB 3JALB 2GV9A 3AG7A 3GB7C 1TA8A 2Q73A 5CA0A 2B1IA 3K57A 1WA8A 2Q7HA 2ZR3A 3AG1B 1YIJV 1V55C 4DW0A 3F7YC 4X9QA 2XAQA 4LF7B 1NTKH 3ZRWA 3SJCC 4G28B 3BFRA 1B04A 2B1GA 1VQ5V 3HKEB 4X1KB 3QO5A 4DV0O 1R3JC 5LHHA 3K5LA 2Q0OC 2ZKOA 3OUFA 4J42A 1M1KW 1R3IC 3AK1A 4FM2A 1HP8A 3ZS8C 3M99B 4HBNA 3JATA 3T4DA 1SA0B 3K04A 3CC4V 2DJVA 3B40A 4AI8A 4MSWC 3SPHA 4K3AA 4YHHB 4DV3B 1VQ6V 1RSOB 1OCCC 4FPPA 3L74H 3HKBB 1HNZO 1B6QA 4UCRA 2YICA 4JI2B 2QE7G 1PM9A 1AI5A 2E76B 5EYPA 3T1YO 2DWEC 2Q9LA 4TOIA 1N8RW 3KZIZ 3B09A 1L0NH 5L3EA 4FVMA 1LUWA 1HNXB 2QA4V 2JK5C 4MTGA 2D2CB 3RT3C 3LSSA 3M8AA 2E5LO 2W6JG 3TETA 4CC5A 1FFTB 1RPRA 2CE4A 1H38A 2QM8A 1IVSA 3VBBA 1BQ0A 4DR7B 5D5PA 3G6BA 2AGAA 4YJ2A 5IJ0A 3UT5A 2GDSA 1AI7A 2QGNA 4PHZA 3I56V 3KG2A 2B5UA 2ZE5A 4GX1A 1VARA 4JPRA 2YC0A 4WBNB 1TUEB 3TGUH 2IJKA 3CRRA 3W7UA 2C2AA 1PL4A 2RQ6A 2JGUA 5LHGA 2MW2B 1JVMA 1XMOB 1SQQH 3E8HA 5EZYA 2D3OW 4EEQA 2UXXA 2XASA 3ABMB 2IU0A 2EBOA 4DW1A 4AILC 3CB2A 2OIEA 5TISZ 4AQYO 3L70H 1ZTEA 1YJNV 1Q86W 4GZRB 2YUAA 4UCSA 1J95A 3FKSG 5LMUO 2P7TC 4HAMA 5GTIZ 5J2TA 1URFA 4X66B 4CH6A 4X8AA 4JI0B 3SPIA 3FAVA 3K3WA 2QKCA 2UXCO 1F7YA 1MZFA 4O4IA 1BHAA 3BPZA 1BZKA 5KUKA 1MABG 3GVMA 3OFNG 1IXMA 4FJCC 5LBQA 1M4UA 4IL6Z 4H33A 4JYYA 3CMAV 2JVDA 1U97A 3SYAA 5GONA 1TVKB 2Q7EA 1MOFA 1QNMA 4I50A 4ZIBA 4I4TB 3VQVA 1SQVH 2Q7GA 3JARA 1XL4A 3WFVA 2Q68A 4D7SA 4LF9O 3AG3B 3SJQC 2KG7A 2HG5C 4KFMA 5AG2A 4FLXA 4NTWA 2JS5A 1LR1A 3OTOO 3T4ZA 2ZR2A 3AG2B 3KCXA 4WFBV 3CCSV 3JD0A 2AZ0A 2NLJC 3RYCB 1X59A 4DR3O 1XOUA 3WB0A 1FJGO 2O57A 1RPOA 3JD3A 5J2UA 3U10A 1LNQA 4Q20A 2BE3A 1R3KC 5ITZB 2W0FC 1GN6A 3JD4A 2AW9A 4B3TB 1G8MA 4IGGA 2EILC 4E2LA 1SZXA 5LYJB 4GKJO 5K1XA 4WFHA 4UCOA 4J7JA 1JJ2U 3FD9A 3QTCA 2DYSC 3APOA 5H9CA 1SF9A 4X65O 3TXQA 2IJJA 3RW0A 5E1AC 4WFEA 3G6EV 4QIWF 1FXKA 2PUSA 4IHJA 2ZM6O 4DV2O 5LXTA 3C90A 5JQGA 1ZUQA 2ATKC 5IYBO 3B4SA 4ZHQA 2GBOA 2A3QA 5LP6B 1VQNV 1E1QG 4X62B 4FFKA 5D5QA 2CK3G 4RAIA 3OW2U 2VQEB 2H94A 3J7AU 2WLNA 4X64B 3L73H 1IURA 4FIPC 4LFBO 4UFZA 1RM1B 1QLEB 1TUBB 5JVDB 5JJNB 4LF7O 3P30A 1MG1A 4NTXA 5CA3A 2H8PC 2OTJV 4EB6B 2Q6AA 1US6A 2P06A 1HW7A 1K7DA 4JI7B 1IXBA 1DF4A 4QPJA 4JI5B 3WG7C 5KHKA 1OCOB 3EVKA 3ZHVA 4YHHO 3CJHB 1Y6XA 3SR2C 2R72A 1W0JG 3HPLC 3ASOB 4LNUB 5BMVB 3ZX6A 2JGDA 1KKCA 5HFMA 4JI2O 4LWSA 5IYDO 2CDYA 3CS5A 4BIUA 5KX5B 3LNMB 5BR8B 5EIBC 2BSKB 4Z1MG 3CWBH 1VF5B 2JIZG 3K06A 4DK0A 3CCQV 3EFFK 4P2ZA 3T1HB 1WNSA 1M56B 3ICXA 4MT8A 3E22B 1HNXO 2Q8VA 5IJ9A 1KYOF 5B3SB 3C3SA 1H2SB 2QWOB 3RN4A 3MHHC 2YEVA 4X20A 3K5OA 2CGNA 3CCMV 2EIKB 5GTHZ 1MA1A 3JAKA 1OCZB 3U11A 3OEEG 1M57B 1YTFB 1RM1C 5FLXN 3K9SA 4U3JA 3IGAC 3HKDA 1DGSA 1GMGA 2Y4TA 3F5TA 1OHHG 5CA0B 4PJ0Z 1WA8B 1FS0G 1ORQC 4OXSA 4JI8O 3ZRWB 2JJ2G 3EXAA 3GWKC 4LH7A 1ZX3A 3IC9A 3H1IH 1Q6IA 5EBWC 1P7GA 3CRAA 2QJ1A 3JSNA 3W7XA 3ZN0A 1PPJH 3S3WA 2QSAA 1OCOC 4JI4B 5H6RA 3ZN1A 4NXNO 3L72H 3QG5A 1K92A 3JATB 2Q67A 1AR1B 1BS3A 3ASOC 5BXZA 2WA3A 1ZAUA 3JYCA 4PA9A 4X88A 1S5JA 4YXWG 2K9PA 4X66O 1YF2A 2P5OA 4JI0O 4BIZA 1K33A 3ZIAG 4K0KB 1AB3A 3ETDA 5EYPB 1QU7A 4L8JA 5B3SC 3K58A 2X6AA 1FAFA 2A7WA 3EHBB 4TT3G 4U3FH 4FFBA 2PTMA 4P9OA 4E4EA 3L9DA 5L3GA 3OMAB 2EIKC 4AQYB 4TUYA 2Y69C 2E75B 4K35A 4JI1B 2QKAA 1YJ9V 5B5EZ 4GKKO 4ZKIA 3DXRA 2Q4PA 4YJ2B 5IJ0B 4MS2A 3UT5B 4L87A 4LBEC 1TGOA 4DRXA 4FM1A 2A79B 4LF8O 1BQZA 4BIOA 2ZQMA 1XEQA 1EZVH 3AG4C 4QPKA 2Z0AA 1GK9A 4I55A 2Y48A 4BW5A 4MTXA 4GT1A 2W0XA 5EZYB 3ZRXA 2VRZA 1H2KA 2ARHA 4I5SA 1H2MA 3OTFA 4EFEA 3DC5A 1AILA 1XHZA 3SGIA 2ETNA 2XAGA 2CTPA 1NU1H 5J2TB 1GM9A 2Q69A 1O9GA 2EINB 1YJWV 2WLIB 3FAVB 3WU2Z 5CMUA 1KQSU 3ML0A 5CN0A 4JTCB 3K03A 4O4IB 2EIJC 2ZE8A 5KA6A 4FLYA 2XAFA 1SQGA 2EX3A 1KUQA 2N74A 2QWRB 3K5MA 5LL6Y 4QE7A 4GKJB 3IC7A 4X62O 5GONB 4XDJA 4X1YA 3ABUA 2X6BA 4I50B 2VQEO 4JZ2A 4K8ZA 3ZHTA 4X64O 3JARB 1S3JA 1HWYA 3ZRSA 5FPOA 2KG7B 1VIBA 5CA1B 1JX9A 1Q82W 4WFFA 2ZM6B 5CB4A 1NR7A 2ZDIA 3ZJZA 3E35A 3TK1A 2FB5A 1AR4A 2CUGA 1YSCA 3E8BA 4UV8A 5J2UB 4WFAV 2ZXWB 1XI1A 4U7NA 4JI7O 1W0KG 1VQ4V 1R6TA 2UU9B 2X6CA 2UXDO 1MNGA 3VOUA 3ZBHA 4N23A 3FYEB 1V9PA 4LFBB 5IE9A 1K4DC 2GHYA 2OCCB 1NJIW 3D3IA 5JJEB 2P67A 2LFSA 4TV8A 2QKSA 2XHBA 3CXCU 2F4VO 5BR8O 1J5EB 1N33B 3D36A 4WCEV 3E8GA 1AJPA 5DM6V 3T1HO 2YDEA 1FXKB 4IHJB 4JAVA 4YIOA 5LXTB 4JASA 2HKOA 4G27B 5C8YA 5JQGB 1UFIA 4FM0A 1A32A 3B77A 1GM8A 4ZHQB 1AJQA 5H5NA 4RQEA 2OCHA 4A5UB 1AP5A 2IH3C 1L1FA 5DEDA 4JYCA 4JI6O 2ZD9A 2B9ZA 4I0XA 4MW3A 2ZE6A 3HB3B 4D7TA 1NH2D 4R6ZA 5IT9N 2ADPA 1CXZB 4BR6A 2HVKC 3VQWA 1MSWD 4EKWA 1GN2A 3OMIB 2OYQA 2PF4E 1QBZA 1DF5A 1ENVA 2DYRB 4JI4O 1JCHA 1AI6A 1SC5B 3F5WC 1ZWIC 1PNKA 2QR4A 5EC1C 3AG1C 1SETA 4H0LB 3H1JH 3K59A 5KLVH 5LMNB 1N0NA 1FKAO 1I94B 5LGTA 1ZLZA 4JI8B 1GN3A 2HFEC 4Q6GA 2JGDB 2A9HA 3SJBC 1E1RG 2XT9A 1MSDA 1Q90D 2QWNB 4K0KO 2P6JA 4LWSB 4XDKA 1PNMA 1S72V 3SDLA 2VWJA 3ASNB 2LQTA 2CGOA 1COWG 4O2AA 1KKDA 4NXNB 3E86A 5JCOA 3HKCA 5IJ9B 3L75H 1JFFA 3J80N 5LGUA 2IM9A 2L6LA 1YCIA 2YEVB 3OGCC 4X20B 1Y66A 1YEWA 5L3DA 2G38A 3CSXA 4CH3A 1IBMO 3JAKB 4JI1O 3ABTA 3TJTA 3PN1A 3P32A 5H2FZ 4U3JB 3HKDB 3ABLB 5DECA 1XNRB 4YJ3A 3FB6C 3U0ZA 2AHYA 1E79G 1TAEA 1RFYA 3K0GA 1KD1W 3TXSA 2EIMB 5EK0A 4J41A 1K3EA 2AXTZ 4J7ZA 4W4LA 2YIAA 3N2GA 3ETQA 4GKKB 3QO8A 1BGYH 1YITV 3CCJV 1SQPH 4JZGA 2AZ2A 4DUZO 3I55V 1UPGA 3F7VC 1F4MA 4IYHA 4FLZA 4LF8B 4DV4B 2YXHA 3H1KH 3I5DA 1DTOA 3NR7A 1P49A 4CS2A 3ABMC 1M90W 2FL4A 2FYUH 2CTRA 4QJFB 4FFBB 3G67A 3CCVV 4LH6A 4YIPA 4EFBA 1DLBA 3W7TA 3P3PA 4LCUC 4U7OA 4PELA 1P84F 4JAUA 4TUYB 4DV1O 1K8AW 1XBLA 1YVWA 1XUQA 3ABLC 4LF4O 1NKDA 2LO1A 4DR1O 5B1BB 1VQ7V 3DXRB 3CYOA 4CS4A 1VF7A 4CZZA 2EIMC 5LOVA 4DRXB 3CC7V 3AK3A 3K79A 4OPAA 1AP6A 1IBLB 2UXBO 3AG3C 1N34B 2UU9O 1WP7A 5JWPA 4F6RA 4I55B 5KAFZ 2UUCB 4O4HA 3JSLA 3AG2C 2PI4A 1FYJA 1SRYA 4CH4A 1R73A 3H01A 3OE7G 5KHIA 1J5EO 1N33O 3QNEA 1PV0A 3BABA 1NS1A 2P22C 3H1HH 3OUSA 1ZSPA 3IAYA 1SERA 3D8CA 1GKFA 3ABKB 2X7RB 4FLVA 1D5NA 2UXDB 2ZINA 1JJOA 3DC6A 3A2FA 4ZOLA 4UVCA 4JTAB 2CTWA 3ZMVA 2HHHB 1XMQO 4B3RO 2QM7A 5BZBA 4X1YB 2ITDC 5IYZA 1K5QA 3N2KA 1GTOA 4Z1VA 1P7BA 3THOA 2FTKA 2M7WA 1YI2V 4NXMO 4DR6B 4LFAO 1PKXA 3J81N 2F4VB 1KECA 2JEXA 4MVUA 3ZHSA 1S76D 4G2KA 4B3MB 4HNAA 3FYIB 3ZMTA 1VF6C 1L0LH 5CB4B 3A0RA 4JTDB 2OT5A 5LP6C 3SYQA 3JCZA 3Q4HA 1IZ3A 1NTZH 4PA3A 3ZHRA 3S3XA 2R9IA 3E83A 3TCUA 1AJNA 3STLC 2PYLA 5F2VO 1QLEC 4JI6B 4RUFA 3X2QB 4N21A 5LMNO 1IX9A 2H3OA 1I94O 1NI8A 1EN6A 2AHZA 4QGPA 3C3TA 3BVOA 4JGSA 3B2EE 4DYLA 4TV8B 1WLEA 2CAZC 4DR5B 2BCCH 2JJ1G 1VQ8V 3SYOA 3L71H 4HZ3A 4FLUA 1M93A 3K0DA 1BL8A 2ZIOA 5KMGA 2E74B 3FB7C 2DQ3A 5C8YB 2IBZH 1Q3EA 2W6IG 3GWOA 4LF5B 4UUJC 4PI0A 3B8MA 1HDJA 2Y0PA 3OR7C 2IJIA 4MVQA 2EZOA 3VQXA 4RO2A 4PD4F 4UCTA 4NTYA 3AK2A 3UCSC 4B7KA 4I0XB 1M56C 4B3SO 3N27A 2BTQA 1XNRO 4BWAA 2V1DA 1NH2B 2WLJA 3ETGA 1P4RA 4ABMA 1I5XA 3KCYA 3DGEA 3OGIB 1YDXA 4OGQB 2ODMA 3ZCCA 1OCZC 2F95B 1M57C 3JAMN 1QCEA 3RYHA 2R9AA 1BHBA 2DMXA 4FZ0A 1IBMB 1K97A 3RVZA 4CBCA 1CPYA 3KKYA 1XL6A 2IJHA 3CXHF 4O2BA 2ZNJA 1AROP 2PY5A 4WF9V 1OV9A 1Y74A 3O65A 1Q6UA 4DV5B 1ZL8A 1EZJA 2GSMB 1LUVA 1RP3B 3D36C 1BT8A 3FX7A 4DV4O 5LGNA 4IIJA 4MTOA 5B1NA 3ZHUA 2LW7A 1GM7A 2LGWA 2K1EA 5EIBD 3UO2A 1W2BU 1NR1A 1OZ0A 3H1LH 4PDVA 4O2AB 1R1BA 1NVPD 3IJ4A 3ZHQA 3K08A 1V54B 3CEIA 3HKCB 1OJHA 1JFFB 2DWDC 1AVMA 2IW5A 4O4LA 1GO3F 1H2NA 1H2LA 2GTAA 3BCCH 4DUZB 1M9NA 2JS3A 3G4SV 1KC8W 2QEXV 2UUBB 2Z5UA 5FNVA 2NNUA 4ZI7A 5L3BA 1S5LZ 4H37A 3RYIA 3A8TA 4RWUA 3STZC 3WB1A 1Y4MA 3E89A 2CH7A 5IY5B 2YS8A 4JI3B 4Z2WA 3B8NA 1WB8A 1B06A 1V55B 2VS0A 2VWKA 2F1MA 1IBLO 2NR5A 5H6QA 1N34O 4LF6B 2OIGA 1GH6A 2YIBD 5EBMC 2YIBA 2UUCO 4DV1B 4BW9A 2HR3A 2PYJA 4J10A 3LDDA 3N2GB 4LF4B 5JJJB 2HJFC 1BE3H 4DR1B 3NXSA 4TQFA 3QF7A 2KB1A 3JAWA 5FPRA 3QO7A 4J9ZB 3ETEA 2RJZA 2GUZA 4X1IA 5KUMA 2QTSA 3SPJA 3RGBA 1Q43A 1PP9H 2UXBB 1WPXA 1N0JA 2UUAO 3JD2A 4GX0A 4PDMA 2YXYA 4NKGB 4ASUG 4RQFA 4ZBMA 3UKMA 2HEPA 2JRIA 4DXWA 2HHHO 4P30A 2E3CA 4GUNA 4FMTA 2EINC 2EJ7A 1SQXH 1SZTA 2FMLA 4OPHA 1GAXA 2KSDA 2LGQA 2V7QG 4F4LA 4DR6O 5CBHA 1FPOA 2LFRA 2PZSA 4GCZA 3OT7A 1JR9A 3CMEV 4UVBA 4DK1A 4B3MO 3W7WA 5IY5C 1G6UA 3BA8A 5B1OA 1VQKV 1XDCA 4TQDA 5LOVB 1PL0A 3CHXA 2YI9A 4O4JA 1THZA 1Q6HA 1XMQB 4B3RB 1F4NA 3ZMZA 3T1CA 3CRCA 2A06H 4GLXA 4F6RB 1FD9A 4PDLA 5BY1A 4XBFA 4NXMB 4O4HB 4LFAB 3IFXA 1KP3A 4TSFG 1U96A 4FLWA 5CBGA 2HVJC 3SJAC 3LNNA 4DV7B 1FFXA 4DR5O 2VQFB 4H44B 4TV9A 2ZXWC 3CC2V 5B1AB 5KHGA 4QNHB 2F66C 1BCCH 4BAYA 2F43G 4UV9A 4YY3B 5L3FA 2OCCC 3FB5C 4DR2B 1IDSA 1VQLV 4P9PA 4LF5O 4ZOLB 4ICGA 2QM4A 2JDIG 3RFRA 1H2GA 1QR8A 3LSQA 5C93A 1AR5A 1CP9A 3RYFA 2DE0X 2ZE7A 1VQOV 3O9OA 5IYZB 3N2KB 1G1XB 2XTAA 1FXKC 1QQCA 3UM7A 1EN5A 5LA6A 2BOCC 1KP2A 2RCVA 4HNAB 1VP7A 4OX9O 4JYAO 1HNWB 4MVZA 2YXLA 1JOYA 3A0BZ 3M7MX 3Q4HB 2R70A 2M6YA 3CX5F 3T2MA 1H8EG 2DOSA 2WWWA 4LFCO 1VQMV 4JV5O 2L35A 1K5SA 2HJDA 4B3SB 2EJRA 5FL7G 1XNQB 5DN6G 2EILB 5B1AC 1Y67A 4DV5O 4LR3A 3CCEV 4JAAA 2DYRC 1VQ9V 2DYSB 2WLIA 1IBKO 5IDJA 1WP8A 2DW4A 1WPBA 4H13B 4J11A 1PNLA 4WFGA 1BSMA 3JASA 4B7EA 1AI4A 4KHPB 5KMGB 3CRMA 3UO3A 4DV6O 1EBOA 4R7CA 3W7SA 3JCUZ 2UUBO 4RUEA 3ASNC 2WLMA 4KXRA 3SPCA 5CA1A 1W59A 2BTQB 5IWAO 4CS3A 5JH7A 4PA7A 1FXHA 3OM3B 1F51A 4JI3O 4PA4A 2Y4UA 1KBHA 3H9VA 4B08A 1XILA 2V4DA 2MK3A 4LF6O 2WSSG 3SYPA 3OMNB 2X0LA 3BA9A 2F23A 1XQ8A 1Y76A 4KP4A 1XHXA 3RYHB 1K9MW 1I7FA 1K4CC 4DR4B 2KKWA 3FB8C 2WLLA 3JALA 4NR1A 1NBMG 1EFRG 5E79Z 2IU3A 2R9RB 1JA8A 3OD4A 1HR0B 3CE2A 5L3CA 4O2BB 2KQXA 3WG7B 1Y74B 1D2DA 1ZL8B 1S5HC 1N32B 2F93B 3HKEA 4NYKA 4XDLA 4X1KA 3RWRD 2P4VA 2Q5ZA 2XAJA 4IIJB 4F6EA 1Q7YW 2YSUB 1VQPV 1SA0A 4LC1A 4GYCB 3VQYA 1NVPB 4I9QA 4UXNA 1RSOA 2LW1A 4O4LB 2HLDG 1QVGU 2PI5A 1QLNA 5KA5A 3HKBA 4FZ1A 5EC2C 5FNVB 2ZIMA 4ZI7B 3MHSC 3CCRV 4UB6Z 4LP8A 3RVYA 3RYIB 1UJWB 5IYCO 1BMFG 1OCRB 3LSUA 1VMGA 1SQFA 2UUAB 2ZNIA 2CH7B 1N36B 4DUYB 2RMKB 1N4CA 2WA4A 2QTOA 1YHQV 3WB2A 3CD6V 3G71V 5B1BC 1KU9A 1ROPA 5B66Z 2NN4A 1X4TA 2RNBA 2QDOA 3SYCA 2Z3YA 2OWOA 4DO2A 4DV3O 3JAWB 2JEUA 4DV7O 4KL1A 4JF3A 2FKXA 2EULA 2VQFO 1NT2B 2GUZB 4WBNA 4X1IB 4QE9A 4R50A 3HR0A 2WLKA 1I0HA 3ZRVA 2WLHA 3K5NA 4DV0B 2N05A 4PA6A 2OTLV 4YY3O 3PJSK 2EZPA 4DR2O 1Z5VA 3LDCA 4IYIA 3E8FA 5KHJA 3OR6C 5A2QN 1O9HA 1HNZB 4DR7O 1OCRC 2RN9A 1SKVA 3ABKC 2QWPB
chains in the Genus database with same CATH topology
3AG7A 2M6YA 1BQZA 3UCSC 2QSAA 1BQ0A 3APOA 1NZ6A 2GUZA 2CTPA 2DMXA 4J7ZA 2Y4TA 2CUGA 2CTQA 2CTWA 1N4CA 2DN9A 2QWOB 1XBLA 2EJ7A 2N04A 2GUZB 1GH6A 2LGWA 3UO2A 1FAFA 2LO1A 3BVOA 4IT5A 1WJZA 2CTRA 1FPOA 2L6LA 2OCHA 4RWUA 3APQA 3UO3A 1HDJA 2PF4E 2YUAA 1IURA 2Y4UA 2QWNB 2QWQB 2QWRB 2KQXA 2YS8A 4J80A 2N05A 2QWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG7 A;  2M6Y A;  1BQZ A;  3UCS C;  2QSA A;  1BQ0 A;  3APO A;  1NZ6 A;  2GUZ A;  2CTP A;  2DMX A;  4J7Z A;  2Y4T A;  2CUG A;  2CTQ A;  2CTW A;  1N4C A;  2DN9 A;  2QWO B;  1XBL A;  2EJ7 A;  2N04 A;  2GUZ B;  1GH6 A;  2LGW A;  3UO2 A;  1FAF A;  2LO1 A;  3BVO A;  4IT5 A;  1WJZ A;  2CTR A;  1FPO A;  2L6L A;  2OCH A;  4RWU A;  3APQ A;  3UO3 A;  1HDJ A;  2PF4 E;  2YUA A;  1IUR A;  2Y4U A;  2QWN B;  2QWQ B;  2QWR B;  2KQX A;  2YS8 A;  4J80 A;  2N05 A;  2QWP B; 
#chains in the Genus database with same CATH topology
 4GX2 A;  2Y69 B;  4D6T H;  2Q0A A;  5KHH A;  3T1Y B;  1EN4 A;  1HNW O;  5A9G A;  1Q5O A;  1SS3 A;  1T5E A;  3SPG A;  1Q81 W;  3BAA A;  4W4K A;  3CPW U;  2ITC C;  5K1P A;  2WAM A;  4JYB A;  1TVK A;  3MAQ A;  4O4J B;  1YXB A;  1JQ0 A;  1JPX A;  4I4T A;  1DK1 A;  2E5L B;  1XMO O;  3MD0 A;  1I08 A;  2IH1 C;  1NZ6 A;  1MMM A;  3DSQ A;  1Z2G A;  3DTU B;  3AG4 B;  3ZED A;  4X89 A;  1GN4 A;  4MVM A;  2ZDI C;  1XNQ O;  4MTF A;  1G4Y B;  5EBL C;  4IT5 A;  2XND G;  4PV1 B;  4OX9 B;  4JYA B;  1FFX B;  3MDS A;  3RYC A;  4TV9 B;  2A0L A;  4J7K A;  4I9W A;  2ZT9 B;  1QR9 A;  3E2E A;  1WN7 A;  3BEH A;  4PDR A;  5ITZ A;  3X2Q C;  3JD1 A;  4KHP O;  1L8D A;  2LJ2 A;  3LDE A;  4J9Y B;  5LYJ A;  4K8X A;  2RDC A;  2EIJ B;  4LFC B;  1YZB A;  4JV5 B;  1R3L C;  3APQ A;  2XOK G;  3BRC A;  3QVN A;  3CCL V;  2QWQ B;  4UCV A;  3RYF B;  4MW8 A;  3OEH G;  5LMU B;  1QHT A;  1SQB H;  2YI8 A;  5KAI Z;  1K73 W;  1WAZ A;  4UVA A;  3G80 A;  3BY6 A;  1IBK B;  2P4K A;  2PGG A;  4FLT A;  1Z5W A;  2UXC B;  1WB7 A;  2LP7 A;  3ZMU A;  5LA6 B;  1CEZ A;  4MVO A;  3K9A A;  4MVR A;  1M5I A;  1PD3 A;  1VF6 A;  1GRJ A;  3A0H Z;  4DV6 B;  5LP6 A;  1K34 A;  2WPD G;  1NTM H;  4DR4 O;  3P3N A;  4B3T O;  2N04 A;  3CP1 A;  4LF9 B;  1HR0 O;  1WJZ A;  3R65 A;  5HFL A;  1EM1 A;  1TUB A;  1D5A A;  5JVD A;  3R66 A;  4YJ3 B;  5IWA B;  3OTO B;  5LHI A;  1QVF U;  1N32 O;  4C7U A;  2ZCE A;  4EB6 A;  2P90 A;  1H8H G;  2DQ0 A;  4R8C A;  1NQT A;  3AEI A;  3UQ8 A;  4DR3 B;  2CTQ A;  3CRQ A;  2DN9 A;  3CCU V;  4CH5 A;  1FJG B;  1S77 D;  2XAH A;  4PI2 A;  2GTS A;  1SES A;  3JAS B;  3OAA G;  2Y0I A;  1MZE A;  5GW7 A;  3FFQ A;  4I7Z B;  4GX5 A;  3CJH A;  1VEW A;  1B3Q A;  1JMK C;  1R6K A;  4KUM A;  3LUT B;  4LNU A;  5BMV A;  2BOB C;  2ILM A;  4UB8 Z;  1Q8I A;  1KMI Z;  4CC6 A;  1OCC B;  2BTO A;  4TWK A;  4X65 B;  1FXV A;  3BHP A;  3ZMS A;  5KX5 A;  2BSK A;  2YID A;  5J9P C;  2XUM A;  1V54 C;  5JCO C;  1XRE A;  4NB5 A;  4NVP A;  5JH7 B;  4DV2 B;  3E22 A;  4J80 A;  3D3Q A;  4FK5 C;  4AHC A;  1N36 O;  4DUY O;  5CBF A;  2ADQ B;  1KB9 F;  1S0V A;  4UCU A;  4HYO A;  1I5Y A;  1Y76 B;  2UXN A;  4MVS A;  3RBZ A;  1YTF D;  1F23 A;  4JI5 O;  1R6N A;  2HP8 A;  2WLL B;  3JAL B;  2GV9 A;  3AG7 A;  3GB7 C;  1TA8 A;  2Q73 A;  5CA0 A;  2B1I A;  3K57 A;  1WA8 A;  2Q7H A;  2ZR3 A;  3AG1 B;  1YIJ V;  1V55 C;  4DW0 A;  3F7Y C;  4X9Q A;  2XAQ A;  4LF7 B;  1NTK H;  3ZRW A;  3SJC C;  4G28 B;  3BFR A;  1B04 A;  2B1G A;  1VQ5 V;  3HKE B;  4X1K B;  3QO5 A;  4DV0 O;  1R3J C;  5LHH A;  3K5L A;  2Q0O C;  2ZKO A;  3OUF A;  4J42 A;  1M1K W;  1R3I C;  3AK1 A;  4FM2 A;  1HP8 A;  3ZS8 C;  3M99 B;  4HBN A;  3JAT A;  3T4D A;  1SA0 B;  3K04 A;  3CC4 V;  2DJV A;  3B40 A;  4AI8 A;  4MSW C;  3SPH A;  4K3A A;  4YHH B;  4DV3 B;  1VQ6 V;  1RSO B;  1OCC C;  4FPP A;  3L74 H;  3HKB B;  1HNZ O;  1B6Q A;  4UCR A;  2YIC A;  4JI2 B;  2QE7 G;  1PM9 A;  1AI5 A;  2E76 B;  5EYP A;  3T1Y O;  2DWE C;  2Q9L A;  4TOI A;  1N8R W;  3KZI Z;  3B09 A;  1L0N H;  5L3E A;  4FVM A;  1LUW A;  1HNX B;  2QA4 V;  2JK5 C;  4MTG A;  2D2C B;  3RT3 C;  3LSS A;  3M8A A;  2E5L O;  2W6J G;  3TET A;  4CC5 A;  1FFT B;  1RPR A;  2CE4 A;  1H38 A;  2QM8 A;  1IVS A;  3VBB A;  1BQ0 A;  4DR7 B;  5D5P A;  3G6B A;  2AGA A;  4YJ2 A;  5IJ0 A;  3UT5 A;  2GDS A;  1AI7 A;  2QGN A;  4PHZ A;  3I56 V;  3KG2 A;  2B5U A;  2ZE5 A;  4GX1 A;  1VAR A;  4JPR A;  2YC0 A;  4WBN B;  1TUE B;  3TGU H;  2IJK A;  3CRR A;  3W7U A;  2C2A A;  1PL4 A;  2RQ6 A;  2JGU A;  5LHG A;  2MW2 B;  1JVM A;  1XMO B;  1SQQ H;  3E8H A;  5EZY A;  2D3O W;  4EEQ A;  2UXX A;  2XAS A;  3ABM B;  2IU0 A;  2EBO A;  4DW1 A;  4AIL C;  3CB2 A;  2OIE A;  5TIS Z;  4AQY O;  3L70 H;  1ZTE A;  1YJN V;  1Q86 W;  4GZR B;  2YUA A;  4UCS A;  1J95 A;  3FKS G;  5LMU O;  2P7T C;  4HAM A;  5GTI Z;  5J2T A;  1URF A;  4X66 B;  4CH6 A;  4X8A A;  4JI0 B;  3SPI A;  3FAV A;  3K3W A;  2QKC A;  2UXC O;  1F7Y A;  1MZF A;  4O4I A;  1BHA A;  3BPZ A;  1BZK A;  5KUK A;  1MAB G;  3GVM A;  3OFN G;  1IXM A;  4FJC C;  5LBQ A;  1M4U A;  4IL6 Z;  4H33 A;  4JYY A;  3CMA V;  2JVD A;  1U97 A;  3SYA A;  5GON A;  1TVK B;  2Q7E A;  1MOF A;  1QNM A;  4I50 A;  4ZIB A;  4I4T B;  3VQV A;  1SQV H;  2Q7G A;  3JAR A;  1XL4 A;  3WFV A;  2Q68 A;  4D7S A;  4LF9 O;  3AG3 B;  3SJQ C;  2KG7 A;  2HG5 C;  4KFM A;  5AG2 A;  4FLX A;  4NTW A;  2JS5 A;  1LR1 A;  3OTO O;  3T4Z A;  2ZR2 A;  3AG2 B;  3KCX A;  4WFB V;  3CCS V;  3JD0 A;  2AZ0 A;  2NLJ C;  3RYC B;  1X59 A;  4DR3 O;  1XOU A;  3WB0 A;  1FJG O;  2O57 A;  1RPO A;  3JD3 A;  5J2U A;  3U10 A;  1LNQ A;  4Q20 A;  2BE3 A;  1R3K C;  5ITZ B;  2W0F C;  1GN6 A;  3JD4 A;  2AW9 A;  4B3T B;  1G8M A;  4IGG A;  2EIL C;  4E2L A;  1SZX A;  5LYJ B;  4GKJ O;  5K1X A;  4WFH A;  4UCO A;  4J7J A;  1JJ2 U;  3FD9 A;  3QTC A;  2DYS C;  3APO A;  5H9C A;  1SF9 A;  4X65 O;  3TXQ A;  2IJJ A;  3RW0 A;  5E1A C;  4WFE A;  3G6E V;  4QIW F;  1FXK A;  2PUS A;  4IHJ A;  2ZM6 O;  4DV2 O;  5LXT A;  3C90 A;  5JQG A;  1ZUQ A;  2ATK C;  5IYB O;  3B4S A;  4ZHQ A;  2GBO A;  2A3Q A;  5LP6 B;  1VQN V;  1E1Q G;  4X62 B;  4FFK A;  5D5Q A;  2CK3 G;  4RAI A;  3OW2 U;  2VQE B;  2H94 A;  3J7A U;  2WLN A;  4X64 B;  3L73 H;  1IUR A;  4FIP C;  4LFB O;  4UFZ A;  1RM1 B;  1QLE B;  1TUB B;  5JVD B;  5JJN B;  4LF7 O;  3P30 A;  1MG1 A;  4NTX A;  5CA3 A;  2H8P C;  2OTJ V;  4EB6 B;  2Q6A A;  1US6 A;  2P06 A;  1HW7 A;  1K7D A;  4JI7 B;  1IXB A;  1DF4 A;  4QPJ A;  4JI5 B;  3WG7 C;  5KHK A;  1OCO B;  3EVK A;  3ZHV A;  4YHH O;  3CJH B;  1Y6X A;  3SR2 C;  2R72 A;  1W0J G;  3HPL C;  3ASO B;  4LNU B;  5BMV B;  3ZX6 A;  2JGD A;  1KKC A;  5HFM A;  4JI2 O;  4LWS A;  5IYD O;  2CDY A;  3CS5 A;  4BIU A;  5KX5 B;  3LNM B;  5BR8 B;  5EIB C;  2BSK B;  4Z1M G;  3CWB H;  1VF5 B;  2JIZ G;  3K06 A;  4DK0 A;  3CCQ V;  3EFF K;  4P2Z A;  3T1H B;  1WNS A;  1M56 B;  3ICX A;  4MT8 A;  3E22 B;  1HNX O;  2Q8V A;  5IJ9 A;  1KYO F;  5B3S B;  3C3S A;  1H2S B;  2QWO B;  3RN4 A;  3MHH C;  2YEV A;  4X20 A;  3K5O A;  2CGN A;  3CCM V;  2EIK B;  5GTH Z;  1MA1 A;  3JAK A;  1OCZ B;  3U11 A;  3OEE G;  1M57 B;  1YTF B;  1RM1 C;  5FLX N;  3K9S A;  4U3J A;  3IGA C;  3HKD A;  1DGS A;  1GMG A;  2Y4T A;  3F5T A;  1OHH G;  5CA0 B;  4PJ0 Z;  1WA8 B;  1FS0 G;  1ORQ C;  4OXS A;  4JI8 O;  3ZRW B;  2JJ2 G;  3EXA A;  3GWK C;  4LH7 A;  1ZX3 A;  3IC9 A;  3H1I H;  1Q6I A;  5EBW C;  1P7G A;  3CRA A;  2QJ1 A;  3JSN A;  3W7X A;  3ZN0 A;  1PPJ H;  3S3W A;  2QSA A;  1OCO C;  4JI4 B;  5H6R A;  3ZN1 A;  4NXN O;  3L72 H;  3QG5 A;  1K92 A;  3JAT B;  2Q67 A;  1AR1 B;  1BS3 A;  3ASO C;  5BXZ A;  2WA3 A;  1ZAU A;  3JYC A;  4PA9 A;  4X88 A;  1S5J A;  4YXW G;  2K9P A;  4X66 O;  1YF2 A;  2P5O A;  4JI0 O;  4BIZ A;  1K33 A;  3ZIA G;  4K0K B;  1AB3 A;  3ETD A;  5EYP B;  1QU7 A;  4L8J A;  5B3S C;  3K58 A;  2X6A A;  1FAF A;  2A7W A;  3EHB B;  4TT3 G;  4U3F H;  4FFB A;  2PTM A;  4P9O A;  4E4E A;  3L9D A;  5L3G A;  3OMA B;  2EIK C;  4AQY B;  4TUY A;  2Y69 C;  2E75 B;  4K35 A;  4JI1 B;  2QKA A;  1YJ9 V;  5B5E Z;  4GKK O;  4ZKI A;  3DXR A;  2Q4P A;  4YJ2 B;  5IJ0 B;  4MS2 A;  3UT5 B;  4L87 A;  4LBE C;  1TGO A;  4DRX A;  4FM1 A;  2A79 B;  4LF8 O;  1BQZ A;  4BIO A;  2ZQM A;  1XEQ A;  1EZV H;  3AG4 C;  4QPK A;  2Z0A A;  1GK9 A;  4I55 A;  2Y48 A;  4BW5 A;  4MTX A;  4GT1 A;  2W0X A;  5EZY B;  3ZRX A;  2VRZ A;  1H2K A;  2ARH A;  4I5S A;  1H2M A;  3OTF A;  4EFE A;  3DC5 A;  1AIL A;  1XHZ A;  3SGI A;  2ETN A;  2XAG A;  2CTP A;  1NU1 H;  5J2T B;  1GM9 A;  2Q69 A;  1O9G A;  2EIN B;  1YJW V;  2WLI B;  3FAV B;  3WU2 Z;  5CMU A;  1KQS U;  3ML0 A;  5CN0 A;  4JTC B;  3K03 A;  4O4I B;  2EIJ C;  2ZE8 A;  5KA6 A;  4FLY A;  2XAF A;  1SQG A;  2EX3 A;  1KUQ A;  2N74 A;  2QWR B;  3K5M A;  5LL6 Y;  4QE7 A;  4GKJ B;  3IC7 A;  4X62 O;  5GON B;  4XDJ A;  4X1Y A;  3ABU A;  2X6B A;  4I50 B;  2VQE O;  4JZ2 A;  4K8Z A;  3ZHT A;  4X64 O;  3JAR B;  1S3J A;  1HWY A;  3ZRS A;  5FPO A;  2KG7 B;  1VIB A;  5CA1 B;  1JX9 A;  1Q82 W;  4WFF A;  2ZM6 B;  5CB4 A;  1NR7 A;  2ZDI A;  3ZJZ A;  3E35 A;  3TK1 A;  2FB5 A;  1AR4 A;  2CUG A;  1YSC A;  3E8B A;  4UV8 A;  5J2U B;  4WFA V;  2ZXW B;  1XI1 A;  4U7N A;  4JI7 O;  1W0K G;  1VQ4 V;  1R6T A;  2UU9 B;  2X6C A;  2UXD O;  1MNG A;  3VOU A;  3ZBH A;  4N23 A;  3FYE B;  1V9P A;  4LFB B;  5IE9 A;  1K4D C;  2GHY A;  2OCC B;  1NJI W;  3D3I A;  5JJE B;  2P67 A;  2LFS A;  4TV8 A;  2QKS A;  2XHB A;  3CXC U;  2F4V O;  5BR8 O;  1J5E B;  1N33 B;  3D36 A;  4WCE V;  3E8G A;  1AJP A;  5DM6 V;  3T1H O;  2YDE A;  1FXK B;  4IHJ B;  4JAV A;  4YIO A;  5LXT B;  4JAS A;  2HKO A;  4G27 B;  5C8Y A;  5JQG B;  1UFI A;  4FM0 A;  1A32 A;  3B77 A;  1GM8 A;  4ZHQ B;  1AJQ A;  5H5N A;  4RQE A;  2OCH A;  4A5U B;  1AP5 A;  2IH3 C;  1L1F A;  5DED A;  4JYC A;  4JI6 O;  2ZD9 A;  2B9Z A;  4I0X A;  4MW3 A;  2ZE6 A;  3HB3 B;  4D7T A;  1NH2 D;  4R6Z A;  5IT9 N;  2ADP A;  1CXZ B;  4BR6 A;  2HVK C;  3VQW A;  1MSW D;  4EKW A;  1GN2 A;  3OMI B;  2OYQ A;  2PF4 E;  1QBZ A;  1DF5 A;  1ENV A;  2DYR B;  4JI4 O;  1JCH A;  1AI6 A;  1SC5 B;  3F5W C;  1ZWI C;  1PNK A;  2QR4 A;  5EC1 C;  3AG1 C;  1SET A;  4H0L B;  3H1J H;  3K59 A;  5KLV H;  5LMN B;  1N0N A;  1FKA O;  1I94 B;  5LGT A;  1ZLZ A;  4JI8 B;  1GN3 A;  2HFE C;  4Q6G A;  2JGD B;  2A9H A;  3SJB C;  1E1R G;  2XT9 A;  1MSD A;  1Q90 D;  2QWN B;  4K0K O;  2P6J A;  4LWS B;  4XDK A;  1PNM A;  1S72 V;  3SDL A;  2VWJ A;  3ASN B;  2LQT A;  2CGO A;  1COW G;  4O2A A;  1KKD A;  4NXN B;  3E86 A;  5JCO A;  3HKC A;  5IJ9 B;  3L75 H;  1JFF A;  3J80 N;  5LGU A;  2IM9 A;  2L6L A;  1YCI A;  2YEV B;  3OGC C;  4X20 B;  1Y66 A;  1YEW A;  5L3D A;  2G38 A;  3CSX A;  4CH3 A;  1IBM O;  3JAK B;  4JI1 O;  3ABT A;  3TJT A;  3PN1 A;  3P32 A;  5H2F Z;  4U3J B;  3HKD B;  3ABL B;  5DEC A;  1XNR B;  4YJ3 A;  3FB6 C;  3U0Z A;  2AHY A;  1E79 G;  1TAE A;  1RFY A;  3K0G A;  1KD1 W;  3TXS A;  2EIM B;  5EK0 A;  4J41 A;  1K3E A;  2AXT Z;  4J7Z A;  4W4L A;  2YIA A;  3N2G A;  3ETQ A;  4GKK B;  3QO8 A;  1BGY H;  1YIT V;  3CCJ V;  1SQP H;  4JZG A;  2AZ2 A;  4DUZ O;  3I55 V;  1UPG A;  3F7V C;  1F4M A;  4IYH A;  4FLZ A;  4LF8 B;  4DV4 B;  2YXH A;  3H1K H;  3I5D A;  1DTO A;  3NR7 A;  1P49 A;  4CS2 A;  3ABM C;  1M90 W;  2FL4 A;  2FYU H;  2CTR A;  4QJF B;  4FFB B;  3G67 A;  3CCV V;  4LH6 A;  4YIP A;  4EFB A;  1DLB A;  3W7T A;  3P3P A;  4LCU C;  4U7O A;  4PEL A;  1P84 F;  4JAU A;  4TUY B;  4DV1 O;  1K8A W;  1XBL A;  1YVW A;  1XUQ A;  3ABL C;  4LF4 O;  1NKD A;  2LO1 A;  4DR1 O;  5B1B B;  1VQ7 V;  3DXR B;  3CYO A;  4CS4 A;  1VF7 A;  4CZZ A;  2EIM C;  5LOV A;  4DRX B;  3CC7 V;  3AK3 A;  3K79 A;  4OPA A;  1AP6 A;  1IBL B;  2UXB O;  3AG3 C;  1N34 B;  2UU9 O;  1WP7 A;  5JWP A;  4F6R A;  4I55 B;  5KAF Z;  2UUC B;  4O4H A;  3JSL A;  3AG2 C;  2PI4 A;  1FYJ A;  1SRY A;  4CH4 A;  1R73 A;  3H01 A;  3OE7 G;  5KHI A;  1J5E O;  1N33 O;  3QNE A;  1PV0 A;  3BAB A;  1NS1 A;  2P22 C;  3H1H H;  3OUS A;  1ZSP A;  3IAY A;  1SER A;  3D8C A;  1GKF A;  3ABK B;  2X7R B;  4FLV A;  1D5N A;  2UXD B;  2ZIN A;  1JJO A;  3DC6 A;  3A2F A;  4ZOL A;  4UVC A;  4JTA B;  2CTW A;  3ZMV A;  2HHH B;  1XMQ O;  4B3R O;  2QM7 A;  5BZB A;  4X1Y B;  2ITD C;  5IYZ A;  1K5Q A;  3N2K A;  1GTO A;  4Z1V A;  1P7B A;  3THO A;  2FTK A;  2M7W A;  1YI2 V;  4NXM O;  4DR6 B;  4LFA O;  1PKX A;  3J81 N;  2F4V B;  1KEC A;  2JEX A;  4MVU A;  3ZHS A;  1S76 D;  4G2K A;  4B3M B;  4HNA A;  3FYI B;  3ZMT A;  1VF6 C;  1L0L H;  5CB4 B;  3A0R A;  4JTD B;  2OT5 A;  5LP6 C;  3SYQ A;  3JCZ A;  3Q4H A;  1IZ3 A;  1NTZ H;  4PA3 A;  3ZHR A;  3S3X A;  2R9I A;  3E83 A;  3TCU A;  1AJN A;  3STL C;  2PYL A;  5F2V O;  1QLE C;  4JI6 B;  4RUF A;  3X2Q B;  4N21 A;  5LMN O;  1IX9 A;  2H3O A;  1I94 O;  1NI8 A;  1EN6 A;  2AHZ A;  4QGP A;  3C3T A;  3BVO A;  4JGS A;  3B2E E;  4DYL A;  4TV8 B;  1WLE A;  2CAZ C;  4DR5 B;  2BCC H;  2JJ1 G;  1VQ8 V;  3SYO A;  3L71 H;  4HZ3 A;  4FLU A;  1M93 A;  3K0D A;  1BL8 A;  2ZIO A;  5KMG A;  2E74 B;  3FB7 C;  2DQ3 A;  5C8Y B;  2IBZ H;  1Q3E A;  2W6I G;  3GWO A;  4LF5 B;  4UUJ C;  4PI0 A;  3B8M A;  1HDJ A;  2Y0P A;  3OR7 C;  2IJI A;  4MVQ A;  2EZO A;  3VQX A;  4RO2 A;  4PD4 F;  4UCT A;  4NTY A;  3AK2 A;  3UCS C;  4B7K A;  4I0X B;  1M56 C;  4B3S O;  3N27 A;  2BTQ A;  1XNR O;  4BWA A;  2V1D A;  1NH2 B;  2WLJ A;  3ETG A;  1P4R A;  4ABM A;  1I5X A;  3KCY A;  3DGE A;  3OGI B;  1YDX A;  4OGQ B;  2ODM A;  3ZCC A;  1OCZ C;  2F95 B;  1M57 C;  3JAM N;  1QCE A;  3RYH A;  2R9A A;  1BHB A;  2DMX A;  4FZ0 A;  1IBM B;  1K97 A;  3RVZ A;  4CBC A;  1CPY A;  3KKY A;  1XL6 A;  2IJH A;  3CXH F;  4O2B A;  2ZNJ A;  1ARO P;  2PY5 A;  4WF9 V;  1OV9 A;  1Y74 A;  3O65 A;  1Q6U A;  4DV5 B;  1ZL8 A;  1EZJ A;  2GSM B;  1LUV A;  1RP3 B;  3D36 C;  1BT8 A;  3FX7 A;  4DV4 O;  5LGN A;  4IIJ A;  4MTO A;  5B1N A;  3ZHU A;  2LW7 A;  1GM7 A;  2LGW A;  2K1E A;  5EIB D;  3UO2 A;  1W2B U;  1NR1 A;  1OZ0 A;  3H1L H;  4PDV A;  4O2A B;  1R1B A;  1NVP D;  3IJ4 A;  3ZHQ A;  3K08 A;  1V54 B;  3CEI A;  3HKC B;  1OJH A;  1JFF B;  2DWD C;  1AVM A;  2IW5 A;  4O4L A;  1GO3 F;  1H2N A;  1H2L A;  2GTA A;  3BCC H;  4DUZ B;  1M9N A;  2JS3 A;  3G4S V;  1KC8 W;  2QEX V;  2UUB B;  2Z5U A;  5FNV A;  2NNU A;  4ZI7 A;  5L3B A;  1S5L Z;  4H37 A;  3RYI A;  3A8T A;  4RWU A;  3STZ C;  3WB1 A;  1Y4M A;  3E89 A;  2CH7 A;  5IY5 B;  2YS8 A;  4JI3 B;  4Z2W A;  3B8N A;  1WB8 A;  1B06 A;  1V55 B;  2VS0 A;  2VWK A;  2F1M A;  1IBL O;  2NR5 A;  5H6Q A;  1N34 O;  4LF6 B;  2OIG A;  1GH6 A;  2YIB D;  5EBM C;  2YIB A;  2UUC O;  4DV1 B;  4BW9 A;  2HR3 A;  2PYJ A;  4J10 A;  3LDD A;  3N2G B;  4LF4 B;  5JJJ B;  2HJF C;  1BE3 H;  4DR1 B;  3NXS A;  4TQF A;  3QF7 A;  2KB1 A;  3JAW A;  5FPR A;  3QO7 A;  4J9Z B;  3ETE A;  2RJZ A;  2GUZ A;  4X1I A;  5KUM A;  2QTS A;  3SPJ A;  3RGB A;  1Q43 A;  1PP9 H;  2UXB B;  1WPX A;  1N0J A;  2UUA O;  3JD2 A;  4GX0 A;  4PDM A;  2YXY A;  4NKG B;  4ASU G;  4RQF A;  4ZBM A;  3UKM A;  2HEP A;  2JRI A;  4DXW A;  2HHH O;  4P30 A;  2E3C A;  4GUN A;  4FMT A;  2EIN C;  2EJ7 A;  1SQX H;  1SZT A;  2FML A;  4OPH A;  1GAX A;  2KSD A;  2LGQ A;  2V7Q G;  4F4L A;  4DR6 O;  5CBH A;  1FPO A;  2LFR A;  2PZS A;  4GCZ A;  3OT7 A;  1JR9 A;  3CME V;  4UVB A;  4DK1 A;  4B3M O;  3W7W A;  5IY5 C;  1G6U A;  3BA8 A;  5B1O A;  1VQK V;  1XDC A;  4TQD A;  5LOV B;  1PL0 A;  3CHX A;  2YI9 A;  4O4J A;  1THZ A;  1Q6H A;  1XMQ B;  4B3R B;  1F4N A;  3ZMZ A;  3T1C A;  3CRC A;  2A06 H;  4GLX A;  4F6R B;  1FD9 A;  4PDL A;  5BY1 A;  4XBF A;  4NXM B;  4O4H B;  4LFA B;  3IFX A;  1KP3 A;  4TSF G;  1U96 A;  4FLW A;  5CBG A;  2HVJ C;  3SJA C;  3LNN A;  4DV7 B;  1FFX A;  4DR5 O;  2VQF B;  4H44 B;  4TV9 A;  2ZXW C;  3CC2 V;  5B1A B;  5KHG A;  4QNH B;  2F66 C;  1BCC H;  4BAY A;  2F43 G;  4UV9 A;  4YY3 B;  5L3F A;  2OCC C;  3FB5 C;  4DR2 B;  1IDS A;  1VQL V;  4P9P A;  4LF5 O;  4ZOL B;  4ICG A;  2QM4 A;  2JDI G;  3RFR A;  1H2G A;  1QR8 A;  3LSQ A;  5C93 A;  1AR5 A;  1CP9 A;  3RYF A;  2DE0 X;  2ZE7 A;  1VQO V;  3O9O A;  5IYZ B;  3N2K B;  1G1X B;  2XTA A;  1FXK C;  1QQC A;  3UM7 A;  1EN5 A;  5LA6 A;  2BOC C;  1KP2 A;  2RCV A;  4HNA B;  1VP7 A;  4OX9 O;  4JYA O;  1HNW B;  4MVZ A;  2YXL A;  1JOY A;  3A0B Z;  3M7M X;  3Q4H B;  2R70 A;  2M6Y A;  3CX5 F;  3T2M A;  1H8E G;  2DOS A;  2WWW A;  4LFC O;  1VQM V;  4JV5 O;  2L35 A;  1K5S A;  2HJD A;  4B3S B;  2EJR A;  5FL7 G;  1XNQ B;  5DN6 G;  2EIL B;  5B1A C;  1Y67 A;  4DV5 O;  4LR3 A;  3CCE V;  4JAA A;  2DYR C;  1VQ9 V;  2DYS B;  2WLI A;  1IBK O;  5IDJ A;  1WP8 A;  2DW4 A;  1WPB A;  4H13 B;  4J11 A;  1PNL A;  4WFG A;  1BSM A;  3JAS A;  4B7E A;  1AI4 A;  4KHP B;  5KMG B;  3CRM A;  3UO3 A;  4DV6 O;  1EBO A;  4R7C A;  3W7S A;  3JCU Z;  2UUB O;  4RUE A;  3ASN C;  2WLM A;  4KXR A;  3SPC A;  5CA1 A;  1W59 A;  2BTQ B;  5IWA O;  4CS3 A;  5JH7 A;  4PA7 A;  1FXH A;  3OM3 B;  1F51 A;  4JI3 O;  4PA4 A;  2Y4U A;  1KBH A;  3H9V A;  4B08 A;  1XIL A;  2V4D A;  2MK3 A;  4LF6 O;  2WSS G;  3SYP A;  3OMN B;  2X0L A;  3BA9 A;  2F23 A;  1XQ8 A;  1Y76 A;  4KP4 A;  1XHX A;  3RYH B;  1K9M W;  1I7F A;  1K4C C;  4DR4 B;  2KKW A;  3FB8 C;  2WLL A;  3JAL A;  4NR1 A;  1NBM G;  1EFR G;  5E79 Z;  2IU3 A;  2R9R B;  1JA8 A;  3OD4 A;  1HR0 B;  3CE2 A;  5L3C A;  4O2B B;  2KQX A;  3WG7 B;  1Y74 B;  1D2D A;  1ZL8 B;  1S5H C;  1N32 B;  2F93 B;  3HKE A;  4NYK A;  4XDL A;  4X1K A;  3RWR D;  2P4V A;  2Q5Z A;  2XAJ A;  4IIJ B;  4F6E A;  1Q7Y W;  2YSU B;  1VQP V;  1SA0 A;  4LC1 A;  4GYC B;  3VQY A;  1NVP B;  4I9Q A;  4UXN A;  1RSO A;  2LW1 A;  4O4L B;  2HLD G;  1QVG U;  2PI5 A;  1QLN A;  5KA5 A;  3HKB A;  4FZ1 A;  5EC2 C;  5FNV B;  2ZIM A;  4ZI7 B;  3MHS C;  3CCR V;  4UB6 Z;  4LP8 A;  3RVY A;  3RYI B;  1UJW B;  5IYC O;  1BMF G;  1OCR B;  3LSU A;  1VMG A;  1SQF A;  2UUA B;  2ZNI A;  2CH7 B;  1N36 B;  4DUY B;  2RMK B;  1N4C A;  2WA4 A;  2QTO A;  1YHQ V;  3WB2 A;  3CD6 V;  3G71 V;  5B1B C;  1KU9 A;  1ROP A;  5B66 Z;  2NN4 A;  1X4T A;  2RNB A;  2QDO A;  3SYC A;  2Z3Y A;  2OWO A;  4DO2 A;  4DV3 O;  3JAW B;  2JEU A;  4DV7 O;  4KL1 A;  4JF3 A;  2FKX A;  2EUL A;  2VQF O;  1NT2 B;  2GUZ B;  4WBN A;  4X1I B;  4QE9 A;  4R50 A;  3HR0 A;  2WLK A;  1I0H A;  3ZRV A;  2WLH A;  3K5N A;  4DV0 B;  2N05 A;  4PA6 A;  2OTL V;  4YY3 O;  3PJS K;  2EZP A;  4DR2 O;  1Z5V A;  3LDC A;  4IYI A;  3E8F A;  5KHJ A;  3OR6 C;  5A2Q N;  1O9H A;  1HNZ B;  4DR7 O;  1OCR C;  2RN9 A;  1SKV A;  3ABK C;  2QWP B; 
#chains in the Genus database with same CATH homology
 3AG7 A;  2M6Y A;  1BQZ A;  3UCS C;  2QSA A;  1BQ0 A;  3APO A;  1NZ6 A;  2GUZ A;  2CTP A;  2DMX A;  4J7Z A;  2Y4T A;  2CUG A;  2CTQ A;  2CTW A;  1N4C A;  2DN9 A;  2QWO B;  1XBL A;  2EJ7 A;  2N04 A;  2GUZ B;  1GH6 A;  2LGW A;  3UO2 A;  1FAF A;  2LO1 A;  3BVO A;  4IT5 A;  1WJZ A;  2CTR A;  1FPO A;  2L6L A;  2OCH A;  4RWU A;  3APQ A;  3UO3 A;  1HDJ A;  2PF4 E;  2YUA A;  1IUR A;  2Y4U A;  2QWN B;  2QWQ B;  2QWR B;  2KQX A;  2YS8 A;  4J80 A;  2N05 A;  2QWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...