2EZPA

Solution nmr structure of ectodomain of siv gp41, models 1-10 of an ensemble of 40 simulated annealing structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords GP41
total genus 46
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezpA00
3P30A 1SZTA 5HFLA 1DF4A 5KA6A 2EBOA 1I5XA 1DF5A 1QBZA 2OT5A 2EZPA 4JGSA 4G2KA 1QCEA 4JF3A 1DLBA 2LP7A 4N23A 3CP1A 1JPXA 3MHHC 5CN0A 1K34A 3B77A 3B8MA 5CMUA 3MHSC 1MOFA 4N21A 3WFVA 2P6JA 4FK5C 5KA5A 3M99B 1K33A 1EBOA 1Y66A 2X7RB 1QR8A 3CYOA 3GWOA 2M7WA 1QR9A 1JQ0A 2MK3A 4FIPC 4E2LA 3K9AA 5H9CA 1I5YA 1F23A 5HFMA 2EZOA 4FJCC 1Y4MA 3H01A 3B8NA 1ENVA 1MG1A 4JPRA
chains in the Genus database with same CATH superfamily
1OCZC 2WA3A 1M5IA 1GH6A 3UO2A 5B1BC 1L1FA 1W0JG 1OJHA 3JAKA 1XNRO 3KKYA 3E8HA 2ADPA 5LGTA 1ZSPA 4BR6A 5IYBO 5DEDA 4FLWA 1WJZA 2XOKG 5B1AC 4DR4B 3C90A 2ITDC 1VF5B 4LF5O 4QE7A 2N04A 4GKJO 1YF2A 2Y0PA 3CD6V 1MNGA 2JJ1G 2Q6AA 4DR5O 2C2AA 2YSUB 1E1QG 3BCCH 4R8CA 1H2KA 1R3LC 2ZE7A 4N21A 4LH6A 5J2UB 2R9IA 1H2LA 3WG7B 4AHCA 1N4CA 5LMUB 3W7XA 4LF8B 4TV8B 1Y4MA 4E2LA 2X0LA 4YJ3B 3P30A 4NVPA 1K97A 3BAAA 5KA6A 5H6QA 2ZNIA 3ZMSA 4LF5B 2DW4A 1VQ9V 4H37A 1XMQO 4K8XA 1NTZH 1YZBA 2ZT9B 4LWSB 4X62O 2DQ3A 4QE9A 4TUYB 1AR4A 1TVKB 1PD3A 2BE3A 5JQGA 3LDCA 1T5EA 4D7SA 4CH5A 1XBLA 4HZ3A 1HR0O 5IYCO 2KSDA 1E1RG 2HEPA 1AR5A 4JV5O 2VS0A 3SJBC 2Q69A 4O4IB 2QJ1A 1XQ8A 2A9HA 3JARB 2X6BA 3LUTB 1N33O 3F5WC 5B5EZ 1OCOC 4NR1A 3K0GA 1OV9A 3TJTA 4B7KA 3QF7A 1K4DC 1N36B 1SA0B 4CC5A 3H01A 2Z5UA 4X66O 2NNUA 3SYCA 1O9GA 2EBOA 1Q43A 4MSWC 5EK0A 3A0BZ 3OW2U 4MW3A 4HYOA 4FM1A 4E4EA 1MA1A 1JCHA 3FB8C 1XMOO 1VF6A 1KQSU 2ZDIA 4BW5A 5CA0A 1K7DA 3RYIA 1FJGO 2XASA 5JCOA 3BRCA 1LUWA 1YSCA 1FXVA 1WPBA 4JYBA 2Z3YA 5EZYA 5IY5C 4ZHQA 4JPRA 1DF4A 4PA9A 4KUMA 4CBCA 4YHHO 1RM1C 1XL6A 1IZ3A 2JIZG 3FFQA 4L87A 4X1IA 2YIBA 4ZBMA 2ILMA 2IH3C 5JH7A 2PI5A 1D5AA 4DUYO 4NYKA 2UXBO 1B6QA 2LW1A 3QO8A 3IC7A 2P7TC 1M57B 3ABUA 1YJNV 2AHZA 1AI5A 5IYZB 3TXSA 2NN4A 4JASA 1GM9A 2JVDA 5B1OA 3BFRA 3E22B 3E8BA 5IJ0B 1XHZA 4QGPA 2JS5A 3ZHRA 2HJFC 1KC8W 4DR7B 1YHQV 3G80A 3VOUA 1Q82W 3ZBHA 4YHHB 1S76D 1YTFB 1S5HC 4UB6Z 1AJNA 1EN6A 2XT9A 1VQKV 2UUAO 2Q7HA 4PELA 5LGNA 4C7UA 3TXQA 1Y76B 4DV3B 3E35A 1I5XA 3CX5F 1GTOA 3LNMB 4O4LB 4NXMO 4O4JA 5L3DA 1M56C 1BGYH 4B3TO 2EIJC 3CRRA 2Y4TA 5A2QN 1PNLA 1BQZA 4DV7O 1ZL8B 3J80N 5L3EA 2NR5A 4FM2A 1AI6A 1DF5A 1URFA 1XMQB 4DV5B 2G38A 1K92A 4LF6B 1S3JA 1IDSA 3ETDA 4JYCA 4DW0A 1LR1A 5GONA 2QGNA 1WP8A 1Q8IA 2ODMA 2AGAA 1Z5WA 2FKXA 2XUMA 3RYCB 3OMIB 3HPLC 4WCEV 1P4RA 4JI1B 2W6IG 4JGSA 1GM8A 1NTMH 3AG4C 3FD9A 3HKBA 1KMIZ 3CWBH 1KYOF 1DTOA 2HHHB 3Q4HB 1HNWB 5LOVA 2QKSA 4AI8A 4JI3O 3WB0A 3DGEA 2YXYA 2EJRA 5IJ9A 1BHBA 1Y67A 2OYQA 3TK1A 4GX2A 2LW7A 2EIJB 3E89A 4WFHA 3ZRWB 4HBNA 1VQ5V 1K5SA 4IL6Z 2XAFA 3P3PA 2K1EA 1Y74B 2X6AA 4PDVA 4GKKB 1N0JA 1S77D 4NTWA 5F2VO 2QA4V 2EIMB 1TGOA 4GUNA 4U3JA 5L3CA 3QTCA 2D3OW 4MTFA 1HNWO 1Q6UA 1HNZB 1IXBA 4ZOLA 4TV9A 5FPRA 4DW1A 1NVPD 3ZMZA 3KCYA 3CJHA 3AG1C 1SS3A 1GAXA 1KBHA 1ORQC 4DR4O 1V55C 4OPAA 1D5NA 2HJDA 4JI1O 4O4JB 4HNAB 4LNUB 1EZJA 2IU3A 2OIEA 3TCUA 1BSMA 4X1YA 2DMXA 4MTGA 2PGGA 3FYEB 1RFYA 4J42A 1FXHA 2BSKA 4KFMA 5LBQA 4LWSA 2ZE8A 4JI3B 5LYJB 3HB3B 3X2QC 5KX5A 4XBFA 2UXCB 3AEIA 1YJ9V 3ZMTA 1JX9A 5IYDO 1AB3A 2BOCC 1Q7YW 3ABKC 4CS4A 3W7WA 4DV7B 2CH7A 4DR1O 2P22C 2OT5A 1WLEA 3L74H 4CH4A 3B40A 1FD9A 4LF7O 3OGIB 2IBZH 4TQFA 3ZX6A 3GB7C 4DV0O 2F95B 2YUAA 2XTAA 5EBLC 2VQEO 1U97A 2HP8A 4LBEC 1AJPA 2NLJC 5B1BB 1FXKA 2P06A 4FLVA 2WLLB 4X1KB 1XREA 4W4LA 1LNQA 5IJ0A 3CSXA 3B77A 3HKDB 4PHZA 4FK5C 4DR3B 4FFKA 2M7WA 2UUCB 1MSWD 2E76B 1F23A 4AQYO 5JJJB 1Y6XA 2YEVA 2QM7A 4FLUA 2ZD9A 3UT5B 5LGUA 3DC5A 1K34A 3CC4V 1YITV 2RCVA 4J80A 3FB7C 3UM7A 2RN9A 1CEZA 4U7OA 1GN6A 2E74B 3ZEDA 2ZQMA 4JI8B 4O4HA 2VWKA 4JI8O 1J95A 1VF7A 2WLMA 1XNRB 2Q0AA 4B3MO 1U96A 2HFEC 4PA6A 1NZ6A 3ZIAG 3WG7C 2R70A 4JI5B 5IT9N 1YXBA 4J11A 2GTSA 4KXRA 3A0RA 1SERA 1N32B 3L72H 2EZOA 2ZM6B 1JOYA 4X20A 3BVOA 1N32O 5H6RA 4I7ZB 4DR6O 5B3SB 1H2MA 2JS3A 1V9PA 2CTRA 3O9OA 3EVKA 4OXSA 4RAIA 2F66C 4GX0A 4J9ZB 3JATA 1M57C 1K5QA 4GZRB 3CHXA 1SQFA 4MT8A 3ZHSA 1KUQA 2M6YA 3UCSC 1F51A 4JI4B 1TUBB 2ADQB 4U3FH 2IJIA 1TAEA 3N27A 3OR7C 4JYYA 2WLNA 3QO5A 1KU9A 3CXHF 1SQBH 3T2MA 2E75B 1OCZB 4X65B 3A2FA 4LNUA 1NJIW 1ZX3A 3AK2A 1BS3A 2Q5ZA 5H2FZ 3LSSA 3PN1A 3FAVB 5KHJA 2P4KA 1GMGA 1N8RW 1N34B 5JQGB 1IBLB 1O9HA 1HR0B 5HFMA 5KAFZ 1JFFA 3ASOC 3AK1A 5IYZA 3EFFK 3ZN1A 4BAYA 3GWKC 3WU2Z 2KKWA 1XEQA 5J2UA 5CB4A 1HNXB 4RO2A 2DOSA 4PDRA 2YIDA 3AK3A 4HNAA 1YTFD 3U0ZA 5FNVA 5LP6C 1MZFA 4YJ3A 2CTWA 1VQPV 2ZR3A 5C93A 3B4SA 1XL4A 2LJ2A 2AHYA 2FL4A 3N2GB 3SPHA 2QKCA 4JI0B 1EZVH 3W7SA 1QBZA 1L8DA 1G1XB 4I9WA 2CDYA 4F6RB 1M93A 5K1XA 3QO7A 2FB5A 2EJ7A 4H33A 1OZ0A 1Z2GA 2VQFB 2ETNA 2YDEA 4DO2A 3L71H 4DR3O 1OCCC 4JI2O 4LFCB 4O4HB 1OCOB 4G28B 4CZZA 2YC0A 5HFLA 2HVKC 5IJ9B 4LF7B 2Q9LA 1PL0A 2ZDIC 1VF6C 2Q7GA 1M56B 2UUBO 1ZTEA 2PYLA 2EILC 4LR3A 3CRCA 3CCJV 4WFGA 1S0VA 3CRMA 4J7KA 4AILC 2QTOA 2OTJV 1E79G 4EB6A 3ZHTA 4NKGB 4DV1O 5JVDA 3CC2V 3KZIZ 2WSSG 3SYOA 4XDKA 3RN4A 3F7YC 4EFBA 2UU9B 5DECA 4J41A 4D6TH 4LCUC 2JEXA 4PJ0Z 1VQNV 5DM6V 1RSOB 2H8PC 3HKEB 3RYFA 2WLIA 3T1HB 3H1KH 1NVPB 2F23A 2JJ2G 1ZAUA 3SYQA 2QE7G 4PI0A 2BTOA 4G27B 1R6KA 5CB4B 4FVMA 2BTQA 2VQFO 1JA8A 4FZ1A 1QCEA 1OCCB 1BT8A 5B3SC 2DYRC 2F93B 3ZRXA 4X62B 3BY6A 4X1YB 3CYOA 1N0NA 4PD4F 4K3AA 4TWKA 1MG1A 4LP8A 1VQ6V 2ZNJA 4P30A 3C3TA 3FKSG 1M9NA 5CA1B 2QSAA 5AG2A 4LF8O 2HR3A 5BR8B 5CA3A 3ICXA 1Q81W 2W6JG 2GUZB 1QLEC 4ZHQB 5BR8O 3IGAC 4UB8Z 5LXTA 3HKDA 2HHHO 1IBMO 2JGDA 4QIWF 1NI8A 4EEQA 4X65O 5H9CA 2Q0OC 3JATB 1HP8A 1AROP 4YIOA 3B8NA 1EN5A 3JD3A 5FNVB 2Q67A 4XDJA 4BIOA 3TETA 3ZRVA 3K79A 1N34O 5LHHA 2A0LA 2WLHA 1WB8A 2ZCEA 3J81N 4G2KA 3K5MA 1Q6IA 5GTHZ 3OTOB 4BWAA 3OEEG 5IWAO 2LGWA 1GO3F 4DR1B 2UXBB 1TA8A 4DV3O 4DR2B 3BABA 3CCEV 2RNBA 3S3XA 3CEIA 3E22A 2Q73A 4MVZA 3MHHC 2DQ0A 3WFVA 3T1YB 1WPXA 3FYIB 2VWJA 1TVKA 2CE4A 1I5YA 4DV6B 2OIGA 4GKKO 4WBNA 4B3SB 1WAZA 3OUSA 5EC2C 5EBWC 1COWG 5LMNB 1SQGA 5C8YB 4UCVA 4JI2B 5LHGA 3ABTA 3JSNA 2B9ZA 4I0XB 1US6A 1NBMG 3HKCA 3JAMN 1CP9A 5E1AC 2ZXWC 1F7YA 2A7WA 4ZOLB 4X9QA 1RM1B 4JAAA 2Q68A 4D7TA 1KD1W 3CCMV 1FJGB 4Z2WA 2JGDB 2P5OA 4UCTA 4NTYA 3MHSC 2QM4A 2ZIMA 1SA0A 3B2EE 3BA8A 4RUFA 3H1HH 3ETEA 3RT3C 3ZHQA 1VIBA 2AW9A 1NU1H 3EXAA 3E8GA 4I0XA 3JCZA 4JI5O 4PDLA 2YIAA 1P49A 1FFXB 2V4DA 5KHIA 4K8ZA 3E86A 4RUEA 2Y4UA 2DN9A 1QVFU 4JF3A 3OEHG 1D2DA 4JZ2A 4KHPB 3STLC 2IJJA 5BZBA 2EINB 4O2AB 3RYFB 3I55V 5KLVH 1FXKC 4LF4O 1ENVA 2EIKC 4TQDA 2JGUA 3IFXA 4J7ZA 3CMEV 4WFAV 1SZXA 2RQ6A 5GONB 3H9VA 3J7AU 3SJQC 5B66Z 4NB5A 4H13B 4CH3A 4JV5B 4UCRA 3F5TA 3K08A 4ZIBA 4X64O 4J10A 3EHBB 1ZLZA 3L9DA 2WAMA 3ZS8C 2DYRB 1Q90D 3P3NA 4EB6B 3CS5A 1VEWA 2WA4A 1GRJA 2GV9A 3JD0A 1GN4A 2QTSA 3Q4HA 5J9PC 2RDCA 4UXNA 3ZRWA 1AR1B 2DE0X 4MVRA 2YI9A 3G4SV 1IURA 3JASA 4FLTA 5D5PA 1SRYA 2LFSA 2XAJA 4ICGA 3K04A 3SDLA 1K73W 1AVMA 3OAAG 2XAGA 2CGOA 4K0KO 4W4KA 3D36C 4DV2B 2PZSA 2N05A 1RPOA 2LQTA 4QPKA 4UUJC 4OX9O 1VQMV 3T1YO 1V55B 4ZI7A 1BE3H 1WA8A 1J5EB 1DK1A 4RQEA 4YY3B 2UU9O 1OHHG 1M90W 1R3KC 3CCSV 1SZTA 3FB6C 3RW0A 5JJNB 4LFCO 2UUCO 2Y69C 5J2TB 1NT2B 3JAWB 1QU7A 5CN0A 3K58A 1FFXA 1NR7A 5KHHA 1QHTA 4I4TA 5IDJA 4O4LA 5LHIA 3STZC 4WFEA 1YIJV 3VQWA 2VQEB 4MW8A 2ZKOA 1BHAA 3DXRA 4UCSA 4B3RB 1XMOB 2EZPA 4JAUA 4B3RO 4IYHA 1NH2B 2EIMC 4FZ0A 5LP6A 3ZHUA 3M99B 1BL8A 3CCRV 1G4YB 4X66B 2IJHA 3UO3A 1IXMA 5L3BA 4DV1B 4Q6GA 1BQ0A 4Q20A 4UVCA 4WBNB 4JI0O 2OCCB 4LF9O 1VQ8V 1RPRA 3ASOB 5LA6A 4MVUA 5H5NA 3K03A 4JI6B 1DLBA 1WB7A 4OGQB 2IH1C 1JFFB 4H44B 3CCQV 1Q6HA 2ZIOA 3JCUZ 4R50A 3BA9A 1IVSA 3C3SA 3K9AA 3FB5C 3DC6A 2FTKA 1V54C 2A79B 3CE2A 3IAYA 4DK0A 2P67A 2WWWA 4YIPA 1IBLO 1I08A 3ZRSA 4CS2A 3N2KA 4DV4O 1GKFA 3OTFA 1FAFA 5EYPA 2FMLA 3ZMUA 1Y74A 4FJCC 5KUMA 3JALA 2CTQA 1NH2D 3JYCA 3ASNC 3MD0A 1AI7A 3OGCC 2CAZC 4FM0A 2B1IA 2DYSB 3LSUA 2OCHA 1AI4A 1MOFA 1H38A 1YCIA 1R3IC 4RQFA 1B06A 1X59A 1H2GA 2ARHA 1G8MA 1SQPH 4RWUA 1JJ2U 3BEHA 2PUSA 2AZ2A 4QNHB 4DV4B 1VARA 5KHGA 3JD1A 2KQXA 3LNNA 4KP4A 3E2EA 4I9QA 4FFBA 3LDEA 1AP6A 1L0LH 1NTKH 2GUZA 2LP7A 1WN7A 1ROPA 2FYUH 3K57A 1P7GA 4CH6A 1NR1A 1ZUQA 2BSKB 2BCCH 5B1AB 5DN6G 1AJQA 1WA8B 3QVNA 4R6ZA 3U10A 1VQLV 4JYAO 2X6CA 1XOUA 4UCOA 3S3WA 1K4CC 2EIKB 1YJWV 1QLNA 4PA7A 5E79Z 3DSQA 3IJ4A 3L70H 4GKJB 2P4VA 5LP6B 3BHPA 3NR7A 4IIJB 2K9PA 1RSOA 2OWOA 1QNMA 2HKOA 2XAHA 3OMNB 3H1JH 5TISZ 4J7JA 3K3WA 4QPJA 2B1GA 3ETGA 3P32A 3FX7A 5EYPB 4I4TB 4PV1B 4WFFA 1N33B 3B8MA 1V54B 2N74A 5LMNO 3U11A 1S5LZ 3OE7G 2YICA 3OD4A 3JAKB 1WNSA 3RBZA 5BMVA 1B3QA 5EIBC 4TOIA 3AG4B 3B09A 3ABLC 3G6EV 1R73A 2KG7A 4YJ2B 3OM3B 1VMGA 1W0KG 1PV0A 5JWPA 2IW5A 2JDIG 1K3EA 2LO1A 4I55B 1SC5B 4LFBB 3ABMC 4K35A 1HW7A 1PNMA 5KX5B 4LFAB 1FPOA 3THOA 2RMKB 1SESA 1NKDA 2D2CB 3R65A 3HKEA 1IBMB 1AP5A 4BIZA 1MABG 1NS1A 4K0KB 4DRXA 4LC1A 3AG2B 3RYHA 1JMKC 5FPOA 2YEVB 1R6TA 3IC9A 3RFRA 1YEWA 5JVDB 1YI2V 2F43G 2ATKC 2GSMB 1FS0G 4X20B 3MAQA 4DR2O 1VP7A 2IM9A 5GW7A 3G6BA 2E5LB 1PM9A 3WB1A 2CUGA 2Y69B 4NTXA 2HLDG 3BPZA 2AZ0A 2QWNB 3JALB 4GYCB 4LF9B 4B3MB 3L75H 3PJSK 3CCVV 3K59A 4P9PA 2GHYA 1KP2A 1Y76A 4UVAA 4J9YB 3D3IA 3TGUH 3VQXA 4DV6O 4H0LB 2L35A 5L3GA 5LOVB 3AG7A 3JARA 5CBGA 4YXWG 3CRQA 4IHJA 4IHJB 4DR5B 3SPCA 1ZWIC 4OPHA 3CRAA 3A8TA 1OCRB 3LDDA 3RVYA 1Q86W 3R66A 1F4MA 1P84F 4GX1A 3JD2A 3CCUV 1X4TA 3UQ8A 2Y48A 2LGQA 2EINC 2IJKA 1XDCA 2Z0AA 4MVQA 2V1DA 1R6NA 3RWRD 1G6UA 2B5UA 2WLKA 3ZMVA 1JJOA 4B3SO 4NXNB 3H1IH 4Z1VA 2GDSA 3SGIA 5BMVB 1VQ7V 3RGBA 1K9MW 3CXCU 1UFIA 1A32A 3KG2A 2XAQA 3X2QB 2R9AA 1F4NA 4U3JB 2ZM6O 3SPIA 2EX3A 1BZKA 4DRXB 4TSFG 1GK9A 5FLXN 1VQOV 1XUQA 4MTOA 4LF4B 1NQTA 4PI2A 1PNKA 4O2BB 2UXCO 4MVMA 2Q4PA 3VQYA 5ITZA 5EBMC 2OTLV 3UKMA 4HAMA 2UXNA 3W7TA 1W59A 3CC7V 4JI6O 3UT5A 5JH7B 5J2TA 1IBKO 4JTAB 1EM1A 2F4VO 3JD4A 2F1MA 1Z5VA 1I94O 3GVMA 2ZE6A 1SQQH 4P9OA 1KP3A 2H94A 4TV9B 3K5OA 4U7NA 5LL6Y 1BMFG 3AG1B 1MMMA 3DTUB 5CA0B 4ZI7B 1XILA 3D8CA 4GCZA 1QR9A 3SYAA 3OMAB 4FMTA 2DYSC 2UUBB 5EZYB 4ZKIA 1WP7A 4LFAO 2PYJA 3I56V 2ZR2A 4NXMB 2CGNA 3NXSA 5LXTB 4KL1A 4OX9B 4LH7A 3ZCCA 4DV2O 2QDOA 3F7VC 1JR9A 4LFBO 2OCCC 1KECA 2JK5C 3SR2C 3HKBB 4BIUA 5FL7G 3APQA 2EULA 4I50B 4JTDB 3N2KB 2PY5A 5KMGA 4F6EA 1LUVA 4IYIA 1Q5OA 4R7CA 5EC1C 3K5LA 1K8AW 2W0FC 4GT1A 5EIBD 3RYHB 1EN4A 3ABKB 4MS2A 2A06H 1Q3EA 2QR4A 5LYJA 3K06A 1SETA 2GBOA 2L6LA 1KB9F 4DUYB 4F6RA 1S5JA 1OCRC 2MW2B 1PPJH 2QKAA 2YXLA 5D5QA 2P6JA 5B1NA 5BXZA 1DGSA 1R3JC 1CPYA 2WLLA 4X1KA 4FIPC 1W2BU 1I94B 5KAIZ 2V7QG 1KKCA 4XDLA 4DR7O 3T1CA 1QLEB 2WLJA 3AG3C 4DYLA 1HNZO 4JZGA 4X1IB 3SJCC 2QEXV 1AILA 5LMUO 4X89A 4FLYA 1K33A 2YI8A 4X88A 3K5NA 3GWOA 3A0HZ 5KUKA 5CBFA 4I5SA 2BOBC 5K1PA 4IT5A 5BY1A 3FAVA 2Q7EA 1QVGU 2DJVA 4Z1MG 4BW9A 4WF9V 3QG5A 1N36O 2ITCC 4UV9A 2JRIA 2ZXWB 3ZHVA 4O2AA 4GLXA 2CK3G 4UFZA 4JAVA 5KMGB 1FKAO 4L8JA 5JCOC 4X8AA 4DXWA 1IBKB 4I50A 1RP3B 1H2NA 3CP1A 4GX5A 4I55A 3SPGA 3SPJA 5C8YA 1GN2A 4LF6O 4FFBB 4DV5O 3OT7A 4N23A 2UXDB 2EILB 4B08A 2GTAA 2O57A 1XNQB 1TUBA 1JQ0A 3T4ZA 1H8HG 3K0DA 4DV0B 2R9RB 3D3QA 4UV8A 2UUAB 5A9GA 2ZE5A 2LFRA 2E3CA 4FPPA 2JEUA 3APOA 1JPXA 3QNEA 3CCLV 3G67A 1HWYA 3ZN0A 3K9SA 3T4DA 4EKWA 4CS3A 4B3TB 3RVZA 3HKCB 3VQVA 3N2GA 1M1KW 1SQXH 4QJFB 1EFRG 2R72A 3CB2A 3RYCA 3AG2C 3LSQA 1HNXO 3O65A 3ML0A 1SF9A 3I5DA 5ITZB 4UVBA 4DUZO 1KKDA 4O2BA 1BCCH 2W0XA 3OFNG 4TUYA 3VBBA 4IGGA 1HDJA 2WPDG 2UXXA 3H1LH 2PF4E 1FXKB 5IWAB 1MZEA 2VRZA 4FLZA 4TV8A 3OUFA 1ZL8A 3M7MX 1IX9A 2WLIB 4FLXA 1UJWB 2H3OA 3HR0A 1QQCA 2QWQB 3OTOO 4JYAB 4WFBV 2CH7B 1H2SB 1Y66A 4DK1A 4PDMA 4F4LA 1S72V 3AG3B 1GM7A 3WB2A 2IU0A 4MTXA 1I7FA 3DXRB 4X64B 3RYIB 1THZA 1JVMA 2YIBD 5JJEB 1PKXA 3W7UA 3SYPA 1M4UA 2UXDO 4MVSA 4MVOA 1MSDA 4JI7B 1J5EO 2MK3A 4PA3A 2HG5C 5GTIZ 2Y0IA 3CJHB 1I0HA 3KCXA 5LA6B 3D36A 2BTQB 3ETQA 1YDXA 4KHPO 3MDSA 2E5LO 2HVJC 3M8AA 3JASB 4JTCB 2QM8A 4CC6A 4ABMA 1P7BA 3T1HO 4AQYB 1FFTB 2YS8A 2PTMA 2RJZA 2XHBA 1XNQO 4JI7O 1H8EG 2KG7B 4YJ2A 3CPWU 3ABMB 2CTPA 1B04A 2P90A 2YXHA 3OR6C 1FYJA 4UCUA 1SKVA 2DWEC 4JI4O 3L73H 2A3QA 1CXZB 1YVWA 2QWOB 4YY3O 5IY5B 4PA4A 4TT3G 2F4VB 1R1BA 1GN3A 2Q8VA 5CMUA 3ASNB 5KA5A 2PI4A 1EBOA 2X7RB 1QR8A 3CMAV 1PP9H 5IE9A 1XI1A 3E83A 4ASUG 1UPGA 1SQVH 2QWRB 3JAWA 3JSLA 3E8FA 3SJAC 3G71V 4P2ZA 5KHKA 2QWPB 1L0NH 4EFEA 3ZJZA 1VQ4V 2KB1A 3ABLB 1PL4A 4IIJA 4B7EA 1TUEB 4DR6B 4O4IA 5CA1A 5CBHA 2DWDC 1XHXA 4DUZB 2XNDG 5L3FA 2AXTZ 2ZINA 4A5UB 4NXNO
chains in the Genus database with same CATH topology
1OCZC 1J95A 1NQTA 1PNKA 2WLMA 5B1BC 1L1FA 1W0JG 3JD0A 4MVMA 2HFEC 5LGTA 3E8HA 4PA6A 5EBMC 5J9PC 3ZIAG 3WG7C 2OTLV 4UXNA 4HAMA 3UKMA 5IYBO 3ZRWA 2UXNA 1AR1B 3W7TA 3A0RA 2XOKG 4MVRA 1SERA 5B1AC 3CC7V 3G4SV 2ITDC 2EZOA 1JOYA 1SRYA 4JTAB 4QE7A 2LFSA 2XAJA 5H6RA 3K04A 3CD6V 1K73W 5B3SB 3JD4A 2JJ1G 2Q6AA 3OAAG 2XAGA 2C2AA 2YSUB 4OXSA 4RAIA 4P9OA 1E1QG 1KP3A 2H94A 4GX0A 4J9ZB 4U7NA 1M57C 1K5QA 1RPOA 4R8CA 4QPKA 1BMFG 4UUJC 1R3LC 3AG1B 4MT8A 4N21A 1VQMV 1F51A 1V55B 2R9IA 3DTUB 3WG7B 4GCZA 1QR9A 3W7XA 3SYAA 4RQEA 3OMAB 4FMTA 2IJIA 1OHHG 1M90W 1R3KC 2DYSC 1Y4MA 3OR7C 4E2LA 3CCSV 2X0LA 2WLNA 4ZKIA 3P30A 3QO5A 1K97A 1SZTA 3FB6C 3RW0A 5KA6A 5H6QA 3T2MA 1OCZB 3ZMSA 2DW4A 3I56V 2ZR2A 1VQ9V 4H37A 2Y69C 3NXSA 1NJIW 5CN0A 1N8RW 3LSSA 1GMGA 2DQ3A 4QE9A 1NR7A 1PD3A 3ZCCA 3F7VC 3LDCA 5IDJA 5HFMA 3ASOC 5LHIA 3EFFK 3ZN1A 2OCCC 4HZ3A 4WFEA 1KECA 3STZC 5IYCO 2JK5C 1YIJV 4BAYA 1E1RG 4MW8A 1BHAA 4BIUA 5FL7G 4RO2A 2Q69A 2EZPA 4JAUA 4JTDB 2A9HA 2X6BA 4PDRA 3LUTB 1NH2B 2EIMC 1YTFD 3F5WC 1VQPV 1OCOC 3K0GA 3M99B 2ZR3A 5C93A 1BL8A 1XL4A 3CCRV 1K4DC 4R7CA 2AHYA 1G4YB 5EC1C 2IJHA 1K8AW 2W0FC 4GT1A 1IXMA 3SPHA 5L3BA 3ABKB 4MS2A 3H01A 2Z5UA 2NNUA 4Q20A 4UVCA 3W7SA 2OCCB 3SYCA 3K06A 1VQ8V 1RPRA 2EBOA 1SETA 3ASOB 1QBZA 4MSWC 4MVUA 5EK0A 3K03A 4MW3A 3OW2U 4I9WA 1DLBA 4HYOA 2IH1C 1JCHA 3FB8C 1OCRC 3QO7A 2P6JA 1KQSU 5B1NA 2ZDIA 4H33A 4BW5A 1OZ0A 3CCQV 1R3JC 1CPYA 1K7DA 2WLLA 2XASA 4R50A 4DO2A 1OCCC 4FIPC 1W2BU 3K9AA 3FB5C 2FTKA 1OCOB 4G28B 1V54C 2V7QG 2A79B 4CZZA 1YSCA 1FXVA 5IY5C 4JYBA 2Z3YA 2P67A 4JPRA 2WWWA 4XDLA 5HFLA 3T1CA 1DF4A 2HVKC 1QLEB 4PA9A 4KUMA 2WLJA 3AG3C 4CBCA 1RM1C 1PL0A 1XL6A 2JIZG 4L87A 2QEXV 4ZBMA 2ZDIC 2IH3C 2PI5A 4X89A 3ZRSA 1M56B 1B6QA 1GKFA 2EILC 1K33A 3QO8A 3IC7A 4X88A 2P7TC 1M57B 3ABUA 3GWOA 1YJNV 5KUKA 2AHZA 3ZMUA 5CBFA 1AI5A 3CCJV 4I5SA 2BOBC 4FJCC 4JASA 5KUMA 1GM9A 4WFGA 1NH2D 3JYCA 1S0VA 3ASNC 3MD0A 1AI7A 3OGCC 1QVGU 2QTOA 5B1OA 2OTJV 3E8BA 2B1IA 2DYSB 1E79G 1KC8W 2HJFC 4Z1MG 1YHQV 1AI4A 3VOUA 1Q82W 4WF9V 1MOFA 1H38A 2ITCC 1R3IC 4UV9A 4RQFA 1YTFB 1S5HC 2ZXWB 3CC2V 1S76D 1H2GA 2WSSG 1AJNA 1G8MA 3SYOA 2CK3G 1JJ2U 4XDKA 3BEHA 4JAVA 1VQKV 3F7YC 4X8AA 4QNHB 4DXWA 4PELA 3CP1A 4GX5A 3JD1A 5LGNA 3SPGA 3SPJA 3E35A 4LCUC 2JEXA 4KP4A 3E2EA 1I5XA 1VQNV 5DM6V 2H8PC 3LDEA 1GTOA 3LNMB 2LP7A 4N23A 1ROPA 2WLIA 5L3DA 2EILB 1NR1A 1NVPB 1M56C 5B1AB 2EIJC 5DN6G 1AJQA 2JJ2G 1JQ0A 3T4ZA 1H8HG 3K0DA 4R6ZA 2R9RB 3SYQA 2QE7G 1PNLA 1VQLV 4UV8A 2X6CA 4G27B 1R6KA 2LFRA 1K4CC 2EIKB 5L3EA 1YJWV 4FPPA 1QLNA 1AI6A 1DF5A 2JEUA 4PA7A 1QCEA 1OCCB 1JPXA 5B3SC 3QNEA 1K92A 2DYRC 3CCLV 1S3JA 3ZRXA 3BY6A 1HWYA 3ETDA 4JYCA 3ZN0A 3T4DA 4EKWA 3CYOA 2HKOA 2XAHA 3RVZA 3OMNB 4TWKA 1M1KW 1MG1A 3K3WA 4QJFB 4LP8A 4QPJA 1EFRG 1VQ6V 2B1GA 4P30A 3FKSG 1M9NA 3OMIB 3ETGA 3HPLC 4WCEV 1P4RA 3AG2C 3P32A 3LSQA 2W6IG 4JGSA 2HR3A 1GM8A 4WFFA 5CA3A 1Q81W 2W6JG 3AG4C 3B8MA 1QLEC 1V54B 3IGAC 3ML0A 4QIWF 3OE7G 1DTOA 5H9CA 3RBZA 4UVBA 1KKDA 1AROP 2QKSA 3B8NA 3JD3A 2Q67A 3AG4B 4XDJA 3OFNG 3DGEA 3VBBA 3TETA 3ZRVA 2EJRA 3ABLC 3K79A 3G6EV 5LHHA 1R73A 2A0LA 2UXXA 2WPDG 2WLHA 3OM3B 1BHBA 1W0KG 2IW5A 4G2KA 2JDIG 3TK1A 1K3EA 4GX2A 3OEEG 1GO3F 3ABMC 2EIJB 3E89A 1FXKB 1PNMA 4WFHA 3ZRWB 1VQ5V 1K5SA 3CCEV 2XAFA 1SESA 2K1EA 1NKDA 2X6AA 3OUFA 4PDVA 3R65A 1S77D 2QA4V 2EIMB 2WLIB 5L3CA 4BIZA 1MABG 1UJWB 4MTFA 2D3OW 4MVZA 4LC1A 3AG2B 3MHHC 2DQ0A 2YEVB 3WFVA 4WFBV 1NVPD 1WPXA 3ZMZA 3FYIB 3AG1C 1Y66A 1ORQC 1YI2V 1V55C 4PDMA 2F43G 2ATKC 2GSMB 3AG3B 1FS0G 4F4LA 1S72V 1I5YA 1GM7A 2IU0A 1EZJA 2IU3A 5GW7A 3TCUA 4MTXA 3OUSA 5EC2C 5EBWC 1COWG 1THZA 1JVMA 2Y69B 4MTGA 1PKXA 3W7UA 3SYPA 3FYEB 5LHGA 3ABTA 2HLDG 1FXHA 4KFMA 5LBQA 1NBMG 4MVSA 4MVOA 1CP9A 5E1AC 3HB3B 3X2QC 4XBFA 2ZXWC 2MK3A 3AEIA 3PJSK 1RM1B 1YJ9V 3ZMTA 4PA3A 1JX9A 5IYDO 2HG5C 3CCVV 2BOCC 1Q7YW 4P9PA 2GHYA 1KP2A 3ABKC 2Q68A 4UVAA 4J9YB 3W7WA 1KD1W 3CCMV 3D3IA 3D36A 2OT5A 5L3GA 1WLEA 5CBGA 2HVJC 4JTCB 2QM8A 3MHSC 4YXWG 1P7BA 1FFTB 3SPCA 1ZWIC 4RUFA 3ETEA 1OCRB 1H8EG 3GB7C 3CPWU 3LDDA 3ABMB 3RVYA 1Q86W 2P90A 1F4MA 5EBLC 3E8GA 3JCZA 4PDLA 4GX1A 3OR6C 3JD2A 4LBEC 1AJPA 2DWEC 2NLJC 5B1BB 3CCUV 1FXKA 3E86A 4RUEA 2WLLB 2Y48A 1QVFU 5IY5B 4JF3A 4PA4A 3OEHG 2EINC 2IJKA 1LNQA 4TT3G 3B77A 5CMUA 4MVQA 3ASNB 2V1DA 1R6NA 3STLC 2IJJA 4FK5C 2B5UA 2WLKA 5KA5A 3ZMVA 2PI4A 1EBOA 2X7RB 1QR8A 5BZBA 3CMAV 2M7WA 2EINB 1MSWD 3E83A 1F23A 3I55V 1FXKC 1ENVA 2EIKC 4ASUG 1VQ7V 2YEVA 3E8FA 3IFXA 3CMEV 1K9MW 2QM7A 3G71V 4P2ZA 2ZD9A 3CXCU 3ZJZA 4WFAV 1VQ4V 2KB1A 2XAQA 3KG2A 3ABLB 5LGUA 3X2QB 3SJQC 1F4NA 1K34A 3CC4V 1YITV 3FB7C 3SPIA 3K08A 1TUEB 3UM7A 1CEZA 4U7OA 3EHBB 4TSFG 5CBHA 2WAMA 2DWDC 2ZQMA 2XNDG 1GK9A 2DYRB 5L3FA 1VQOV 4MTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P30 A;  1SZT A;  5HFL A;  1DF4 A;  5KA6 A;  2EBO A;  1I5X A;  1DF5 A;  1QBZ A;  2OT5 A;  2EZP A;  4JGS A;  4G2K A;  1QCE A;  4JF3 A;  1DLB A;  2LP7 A;  4N23 A;  3CP1 A;  1JPX A;  3MHH C;  5CN0 A;  1K34 A;  3B77 A;  3B8M A;  5CMU A;  3MHS C;  1MOF A;  4N21 A;  3WFV A;  2P6J A;  4FK5 C;  5KA5 A;  3M99 B;  1K33 A;  1EBO A;  1Y66 A;  2X7R B;  1QR8 A;  3CYO A;  3GWO A;  2M7W A;  1QR9 A;  1JQ0 A;  2MK3 A;  4FIP C;  4E2L A;  3K9A A;  5H9C A;  1I5Y A;  1F23 A;  5HFM A;  2EZO A;  4FJC C;  1Y4M A;  3H01 A;  3B8N A;  1ENV A;  1MG1 A;  4JPR A; 
#chains in the Genus database with same CATH topology
 1OCZ C;  2WA3 A;  1M5I A;  1GH6 A;  3UO2 A;  5B1B C;  1L1F A;  1W0J G;  1OJH A;  3JAK A;  1XNR O;  3KKY A;  3E8H A;  2ADP A;  5LGT A;  1ZSP A;  4BR6 A;  5IYB O;  5DED A;  4FLW A;  1WJZ A;  2XOK G;  5B1A C;  4DR4 B;  3C90 A;  2ITD C;  1VF5 B;  4LF5 O;  4QE7 A;  2N04 A;  4GKJ O;  1YF2 A;  2Y0P A;  3CD6 V;  1MNG A;  2JJ1 G;  2Q6A A;  4DR5 O;  2C2A A;  2YSU B;  1E1Q G;  3BCC H;  4R8C A;  1H2K A;  1R3L C;  2ZE7 A;  4N21 A;  4LH6 A;  5J2U B;  2R9I A;  1H2L A;  3WG7 B;  4AHC A;  1N4C A;  5LMU B;  3W7X A;  4LF8 B;  4TV8 B;  1Y4M A;  4E2L A;  2X0L A;  4YJ3 B;  3P30 A;  4NVP A;  1K97 A;  3BAA A;  5KA6 A;  5H6Q A;  2ZNI A;  3ZMS A;  4LF5 B;  2DW4 A;  1VQ9 V;  4H37 A;  1XMQ O;  4K8X A;  1NTZ H;  1YZB A;  2ZT9 B;  4LWS B;  4X62 O;  2DQ3 A;  4QE9 A;  4TUY B;  1AR4 A;  1TVK B;  1PD3 A;  2BE3 A;  5JQG A;  3LDC A;  1T5E A;  4D7S A;  4CH5 A;  1XBL A;  4HZ3 A;  1HR0 O;  5IYC O;  2KSD A;  1E1R G;  2HEP A;  1AR5 A;  4JV5 O;  2VS0 A;  3SJB C;  2Q69 A;  4O4I B;  2QJ1 A;  1XQ8 A;  2A9H A;  3JAR B;  2X6B A;  3LUT B;  1N33 O;  3F5W C;  5B5E Z;  1OCO C;  4NR1 A;  3K0G A;  1OV9 A;  3TJT A;  4B7K A;  3QF7 A;  1K4D C;  1N36 B;  1SA0 B;  4CC5 A;  3H01 A;  2Z5U A;  4X66 O;  2NNU A;  3SYC A;  1O9G A;  2EBO A;  1Q43 A;  4MSW C;  5EK0 A;  3A0B Z;  3OW2 U;  4MW3 A;  4HYO A;  4FM1 A;  4E4E A;  1MA1 A;  1JCH A;  3FB8 C;  1XMO O;  1VF6 A;  1KQS U;  2ZDI A;  4BW5 A;  5CA0 A;  1K7D A;  3RYI A;  1FJG O;  2XAS A;  5JCO A;  3BRC A;  1LUW A;  1YSC A;  1FXV A;  1WPB A;  4JYB A;  2Z3Y A;  5EZY A;  5IY5 C;  4ZHQ A;  4JPR A;  1DF4 A;  4PA9 A;  4KUM A;  4CBC A;  4YHH O;  1RM1 C;  1XL6 A;  1IZ3 A;  2JIZ G;  3FFQ A;  4L87 A;  4X1I A;  2YIB A;  4ZBM A;  2ILM A;  2IH3 C;  5JH7 A;  2PI5 A;  1D5A A;  4DUY O;  4NYK A;  2UXB O;  1B6Q A;  2LW1 A;  3QO8 A;  3IC7 A;  2P7T C;  1M57 B;  3ABU A;  1YJN V;  2AHZ A;  1AI5 A;  5IYZ B;  3TXS A;  2NN4 A;  4JAS A;  1GM9 A;  2JVD A;  5B1O A;  3BFR A;  3E22 B;  3E8B A;  5IJ0 B;  1XHZ A;  4QGP A;  2JS5 A;  3ZHR A;  2HJF C;  1KC8 W;  4DR7 B;  1YHQ V;  3G80 A;  3VOU A;  1Q82 W;  3ZBH A;  4YHH B;  1S76 D;  1YTF B;  1S5H C;  4UB6 Z;  1AJN A;  1EN6 A;  2XT9 A;  1VQK V;  2UUA O;  2Q7H A;  4PEL A;  5LGN A;  4C7U A;  3TXQ A;  1Y76 B;  4DV3 B;  3E35 A;  1I5X A;  3CX5 F;  1GTO A;  3LNM B;  4O4L B;  4NXM O;  4O4J A;  5L3D A;  1M56 C;  1BGY H;  4B3T O;  2EIJ C;  3CRR A;  2Y4T A;  5A2Q N;  1PNL A;  1BQZ A;  4DV7 O;  1ZL8 B;  3J80 N;  5L3E A;  2NR5 A;  4FM2 A;  1AI6 A;  1DF5 A;  1URF A;  1XMQ B;  4DV5 B;  2G38 A;  1K92 A;  4LF6 B;  1S3J A;  1IDS A;  3ETD A;  4JYC A;  4DW0 A;  1LR1 A;  5GON A;  2QGN A;  1WP8 A;  1Q8I A;  2ODM A;  2AGA A;  1Z5W A;  2FKX A;  2XUM A;  3RYC B;  3OMI B;  3HPL C;  4WCE V;  1P4R A;  4JI1 B;  2W6I G;  4JGS A;  1GM8 A;  1NTM H;  3AG4 C;  3FD9 A;  3HKB A;  1KMI Z;  3CWB H;  1KYO F;  1DTO A;  2HHH B;  3Q4H B;  1HNW B;  5LOV A;  2QKS A;  4AI8 A;  4JI3 O;  3WB0 A;  3DGE A;  2YXY A;  2EJR A;  5IJ9 A;  1BHB A;  1Y67 A;  2OYQ A;  3TK1 A;  4GX2 A;  2LW7 A;  2EIJ B;  3E89 A;  4WFH A;  3ZRW B;  4HBN A;  1VQ5 V;  1K5S A;  4IL6 Z;  2XAF A;  3P3P A;  2K1E A;  1Y74 B;  2X6A A;  4PDV A;  4GKK B;  1N0J A;  1S77 D;  4NTW A;  5F2V O;  2QA4 V;  2EIM B;  1TGO A;  4GUN A;  4U3J A;  5L3C A;  3QTC A;  2D3O W;  4MTF A;  1HNW O;  1Q6U A;  1HNZ B;  1IXB A;  4ZOL A;  4TV9 A;  5FPR A;  4DW1 A;  1NVP D;  3ZMZ A;  3KCY A;  3CJH A;  3AG1 C;  1SS3 A;  1GAX A;  1KBH A;  1ORQ C;  4DR4 O;  1V55 C;  4OPA A;  1D5N A;  2HJD A;  4JI1 O;  4O4J B;  4HNA B;  4LNU B;  1EZJ A;  2IU3 A;  2OIE A;  3TCU A;  1BSM A;  4X1Y A;  2DMX A;  4MTG A;  2PGG A;  3FYE B;  1RFY A;  4J42 A;  1FXH A;  2BSK A;  4KFM A;  5LBQ A;  4LWS A;  2ZE8 A;  4JI3 B;  5LYJ B;  3HB3 B;  3X2Q C;  5KX5 A;  4XBF A;  2UXC B;  3AEI A;  1YJ9 V;  3ZMT A;  1JX9 A;  5IYD O;  1AB3 A;  2BOC C;  1Q7Y W;  3ABK C;  4CS4 A;  3W7W A;  4DV7 B;  2CH7 A;  4DR1 O;  2P22 C;  2OT5 A;  1WLE A;  3L74 H;  4CH4 A;  3B40 A;  1FD9 A;  4LF7 O;  3OGI B;  2IBZ H;  4TQF A;  3ZX6 A;  3GB7 C;  4DV0 O;  2F95 B;  2YUA A;  2XTA A;  5EBL C;  2VQE O;  1U97 A;  2HP8 A;  4LBE C;  1AJP A;  2NLJ C;  5B1B B;  1FXK A;  2P06 A;  4FLV A;  2WLL B;  4X1K B;  1XRE A;  4W4L A;  1LNQ A;  5IJ0 A;  3CSX A;  3B77 A;  3HKD B;  4PHZ A;  4FK5 C;  4DR3 B;  4FFK A;  2M7W A;  2UUC B;  1MSW D;  2E76 B;  1F23 A;  4AQY O;  5JJJ B;  1Y6X A;  2YEV A;  2QM7 A;  4FLU A;  2ZD9 A;  3UT5 B;  5LGU A;  3DC5 A;  1K34 A;  3CC4 V;  1YIT V;  2RCV A;  4J80 A;  3FB7 C;  3UM7 A;  2RN9 A;  1CEZ A;  4U7O A;  1GN6 A;  2E74 B;  3ZED A;  2ZQM A;  4JI8 B;  4O4H A;  2VWK A;  4JI8 O;  1J95 A;  1VF7 A;  2WLM A;  1XNR B;  2Q0A A;  4B3M O;  1U96 A;  2HFE C;  4PA6 A;  1NZ6 A;  3ZIA G;  3WG7 C;  2R70 A;  4JI5 B;  5IT9 N;  1YXB A;  4J11 A;  2GTS A;  4KXR A;  3A0R A;  1SER A;  1N32 B;  3L72 H;  2EZO A;  2ZM6 B;  1JOY A;  4X20 A;  3BVO A;  1N32 O;  5H6R A;  4I7Z B;  4DR6 O;  5B3S B;  1H2M A;  2JS3 A;  1V9P A;  2CTR A;  3O9O A;  3EVK A;  4OXS A;  4RAI A;  2F66 C;  4GX0 A;  4J9Z B;  3JAT A;  1M57 C;  1K5Q A;  4GZR B;  3CHX A;  1SQF A;  4MT8 A;  3ZHS A;  1KUQ A;  2M6Y A;  3UCS C;  1F51 A;  4JI4 B;  1TUB B;  2ADQ B;  4U3F H;  2IJI A;  1TAE A;  3N27 A;  3OR7 C;  4JYY A;  2WLN A;  3QO5 A;  1KU9 A;  3CXH F;  1SQB H;  3T2M A;  2E75 B;  1OCZ B;  4X65 B;  3A2F A;  4LNU A;  1NJI W;  1ZX3 A;  3AK2 A;  1BS3 A;  2Q5Z A;  5H2F Z;  3LSS A;  3PN1 A;  3FAV B;  5KHJ A;  2P4K A;  1GMG A;  1N8R W;  1N34 B;  5JQG B;  1IBL B;  1O9H A;  1HR0 B;  5HFM A;  5KAF Z;  1JFF A;  3ASO C;  3AK1 A;  5IYZ A;  3EFF K;  3ZN1 A;  4BAY A;  3GWK C;  3WU2 Z;  2KKW A;  1XEQ A;  5J2U A;  5CB4 A;  1HNX B;  4RO2 A;  2DOS A;  4PDR A;  2YID A;  3AK3 A;  4HNA A;  1YTF D;  3U0Z A;  5FNV A;  5LP6 C;  1MZF A;  4YJ3 A;  2CTW A;  1VQP V;  2ZR3 A;  5C93 A;  3B4S A;  1XL4 A;  2LJ2 A;  2AHY A;  2FL4 A;  3N2G B;  3SPH A;  2QKC A;  4JI0 B;  1EZV H;  3W7S A;  1QBZ A;  1L8D A;  1G1X B;  4I9W A;  2CDY A;  4F6R B;  1M93 A;  5K1X A;  3QO7 A;  2FB5 A;  2EJ7 A;  4H33 A;  1OZ0 A;  1Z2G A;  2VQF B;  2ETN A;  2YDE A;  4DO2 A;  3L71 H;  4DR3 O;  1OCC C;  4JI2 O;  4LFC B;  4O4H B;  1OCO B;  4G28 B;  4CZZ A;  2YC0 A;  5HFL A;  2HVK C;  5IJ9 B;  4LF7 B;  2Q9L A;  1PL0 A;  2ZDI C;  1VF6 C;  2Q7G A;  1M56 B;  2UUB O;  1ZTE A;  2PYL A;  2EIL C;  4LR3 A;  3CRC A;  3CCJ V;  4WFG A;  1S0V A;  3CRM A;  4J7K A;  4AIL C;  2QTO A;  2OTJ V;  1E79 G;  4EB6 A;  3ZHT A;  4NKG B;  4DV1 O;  5JVD A;  3CC2 V;  3KZI Z;  2WSS G;  3SYO A;  4XDK A;  3RN4 A;  3F7Y C;  4EFB A;  2UU9 B;  5DEC A;  4J41 A;  4D6T H;  4LCU C;  2JEX A;  4PJ0 Z;  1VQN V;  5DM6 V;  1RSO B;  2H8P C;  3HKE B;  3RYF A;  2WLI A;  3T1H B;  3H1K H;  1NVP B;  2F23 A;  2JJ2 G;  1ZAU A;  3SYQ A;  2QE7 G;  4PI0 A;  2BTO A;  4G27 B;  1R6K A;  5CB4 B;  4FVM A;  2BTQ A;  2VQF O;  1JA8 A;  4FZ1 A;  1QCE A;  1OCC B;  1BT8 A;  5B3S C;  2DYR C;  2F93 B;  3ZRX A;  4X62 B;  3BY6 A;  4X1Y B;  3CYO A;  1N0N A;  4PD4 F;  4K3A A;  4TWK A;  1MG1 A;  4LP8 A;  1VQ6 V;  2ZNJ A;  4P30 A;  3C3T A;  3FKS G;  1M9N A;  5CA1 B;  2QSA A;  5AG2 A;  4LF8 O;  2HR3 A;  5BR8 B;  5CA3 A;  3ICX A;  1Q81 W;  2W6J G;  2GUZ B;  1QLE C;  4ZHQ B;  5BR8 O;  3IGA C;  4UB8 Z;  5LXT A;  3HKD A;  2HHH O;  1IBM O;  2JGD A;  4QIW F;  1NI8 A;  4EEQ A;  4X65 O;  5H9C A;  2Q0O C;  3JAT B;  1HP8 A;  1ARO P;  4YIO A;  3B8N A;  1EN5 A;  3JD3 A;  5FNV B;  2Q67 A;  4XDJ A;  4BIO A;  3TET A;  3ZRV A;  3K79 A;  1N34 O;  5LHH A;  2A0L A;  2WLH A;  1WB8 A;  2ZCE A;  3J81 N;  4G2K A;  3K5M A;  1Q6I A;  5GTH Z;  3OTO B;  4BWA A;  3OEE G;  5IWA O;  2LGW A;  1GO3 F;  4DR1 B;  2UXB B;  1TA8 A;  4DV3 O;  4DR2 B;  3BAB A;  3CCE V;  2RNB A;  3S3X A;  3CEI A;  3E22 A;  2Q73 A;  4MVZ A;  3MHH C;  2DQ0 A;  3WFV A;  3T1Y B;  1WPX A;  3FYI B;  2VWJ A;  1TVK A;  2CE4 A;  1I5Y A;  4DV6 B;  2OIG A;  4GKK O;  4WBN A;  4B3S B;  1WAZ A;  3OUS A;  5EC2 C;  5EBW C;  1COW G;  5LMN B;  1SQG A;  5C8Y B;  4UCV A;  4JI2 B;  5LHG A;  3ABT A;  3JSN A;  2B9Z A;  4I0X B;  1US6 A;  1NBM G;  3HKC A;  3JAM N;  1CP9 A;  5E1A C;  2ZXW C;  1F7Y A;  2A7W A;  4ZOL B;  4X9Q A;  1RM1 B;  4JAA A;  2Q68 A;  4D7T A;  1KD1 W;  3CCM V;  1FJG B;  4Z2W A;  2JGD B;  2P5O A;  4UCT A;  4NTY A;  3MHS C;  2QM4 A;  2ZIM A;  1SA0 A;  3B2E E;  3BA8 A;  4RUF A;  3H1H H;  3ETE A;  3RT3 C;  3ZHQ A;  1VIB A;  2AW9 A;  1NU1 H;  3EXA A;  3E8G A;  4I0X A;  3JCZ A;  4JI5 O;  4PDL A;  2YIA A;  1P49 A;  1FFX B;  2V4D A;  5KHI A;  4K8Z A;  3E86 A;  4RUE A;  2Y4U A;  2DN9 A;  1QVF U;  4JF3 A;  3OEH G;  1D2D A;  4JZ2 A;  4KHP B;  3STL C;  2IJJ A;  5BZB A;  2EIN B;  4O2A B;  3RYF B;  3I55 V;  5KLV H;  1FXK C;  4LF4 O;  1ENV A;  2EIK C;  4TQD A;  2JGU A;  3IFX A;  4J7Z A;  3CME V;  4WFA V;  1SZX A;  2RQ6 A;  5GON B;  3H9V A;  3J7A U;  3SJQ C;  5B66 Z;  4NB5 A;  4H13 B;  4CH3 A;  4JV5 B;  4UCR A;  3F5T A;  3K08 A;  4ZIB A;  4X64 O;  4J10 A;  3EHB B;  1ZLZ A;  3L9D A;  2WAM A;  3ZS8 C;  2DYR B;  1Q90 D;  3P3N A;  4EB6 B;  3CS5 A;  1VEW A;  2WA4 A;  1GRJ A;  2GV9 A;  3JD0 A;  1GN4 A;  2QTS A;  3Q4H A;  5J9P C;  2RDC A;  4UXN A;  3ZRW A;  1AR1 B;  2DE0 X;  4MVR A;  2YI9 A;  3G4S V;  1IUR A;  3JAS A;  4FLT A;  5D5P A;  1SRY A;  2LFS A;  2XAJ A;  4ICG A;  3K04 A;  3SDL A;  1K73 W;  1AVM A;  3OAA G;  2XAG A;  2CGO A;  4K0K O;  4W4K A;  3D36 C;  4DV2 B;  2PZS A;  2N05 A;  1RPO A;  2LQT A;  4QPK A;  4UUJ C;  4OX9 O;  1VQM V;  3T1Y O;  1V55 B;  4ZI7 A;  1BE3 H;  1WA8 A;  1J5E B;  1DK1 A;  4RQE A;  4YY3 B;  2UU9 O;  1OHH G;  1M90 W;  1R3K C;  3CCS V;  1SZT A;  3FB6 C;  3RW0 A;  5JJN B;  4LFC O;  2UUC O;  2Y69 C;  5J2T B;  1NT2 B;  3JAW B;  1QU7 A;  5CN0 A;  3K58 A;  1FFX A;  1NR7 A;  5KHH A;  1QHT A;  4I4T A;  5IDJ A;  4O4L A;  5LHI A;  3STZ C;  4WFE A;  1YIJ V;  3VQW A;  2VQE B;  4MW8 A;  2ZKO A;  1BHA A;  3DXR A;  4UCS A;  4B3R B;  1XMO B;  2EZP A;  4JAU A;  4B3R O;  4IYH A;  1NH2 B;  2EIM C;  4FZ0 A;  5LP6 A;  3ZHU A;  3M99 B;  1BL8 A;  3CCR V;  1G4Y B;  4X66 B;  2IJH A;  3UO3 A;  1IXM A;  5L3B A;  4DV1 B;  4Q6G A;  1BQ0 A;  4Q20 A;  4UVC A;  4WBN B;  4JI0 O;  2OCC B;  4LF9 O;  1VQ8 V;  1RPR A;  3ASO B;  5LA6 A;  4MVU A;  5H5N A;  3K03 A;  4JI6 B;  1DLB A;  1WB7 A;  4OGQ B;  2IH1 C;  1JFF B;  4H44 B;  3CCQ V;  1Q6H A;  2ZIO A;  3JCU Z;  4R50 A;  3BA9 A;  1IVS A;  3C3S A;  3K9A A;  3FB5 C;  3DC6 A;  2FTK A;  1V54 C;  2A79 B;  3CE2 A;  3IAY A;  4DK0 A;  2P67 A;  2WWW A;  4YIP A;  1IBL O;  1I08 A;  3ZRS A;  4CS2 A;  3N2K A;  4DV4 O;  1GKF A;  3OTF A;  1FAF A;  5EYP A;  2FML A;  3ZMU A;  1Y74 A;  4FJC C;  5KUM A;  3JAL A;  2CTQ A;  1NH2 D;  3JYC A;  3ASN C;  3MD0 A;  1AI7 A;  3OGC C;  2CAZ C;  4FM0 A;  2B1I A;  2DYS B;  3LSU A;  2OCH A;  1AI4 A;  1MOF A;  1H38 A;  1YCI A;  1R3I C;  4RQF A;  1B06 A;  1X59 A;  1H2G A;  2ARH A;  1G8M A;  1SQP H;  4RWU A;  1JJ2 U;  3BEH A;  2PUS A;  2AZ2 A;  4QNH B;  4DV4 B;  1VAR A;  5KHG A;  3JD1 A;  2KQX A;  3LNN A;  4KP4 A;  3E2E A;  4I9Q A;  4FFB A;  3LDE A;  1AP6 A;  1L0L H;  1NTK H;  2GUZ A;  2LP7 A;  1WN7 A;  1ROP A;  2FYU H;  3K57 A;  1P7G A;  4CH6 A;  1NR1 A;  1ZUQ A;  2BSK B;  2BCC H;  5B1A B;  5DN6 G;  1AJQ A;  1WA8 B;  3QVN A;  4R6Z A;  3U10 A;  1VQL V;  4JYA O;  2X6C A;  1XOU A;  4UCO A;  3S3W A;  1K4C C;  2EIK B;  1YJW V;  1QLN A;  4PA7 A;  5E79 Z;  3DSQ A;  3IJ4 A;  3L70 H;  4GKJ B;  2P4V A;  5LP6 B;  3BHP A;  3NR7 A;  4IIJ B;  2K9P A;  1RSO A;  2OWO A;  1QNM A;  2HKO A;  2XAH A;  3OMN B;  3H1J H;  5TIS Z;  4J7J A;  3K3W A;  4QPJ A;  2B1G A;  3ETG A;  3P32 A;  3FX7 A;  5EYP B;  4I4T B;  4PV1 B;  4WFF A;  1N33 B;  3B8M A;  1V54 B;  2N74 A;  5LMN O;  3U11 A;  1S5L Z;  3OE7 G;  2YIC A;  3OD4 A;  3JAK B;  1WNS A;  3RBZ A;  5BMV A;  1B3Q A;  5EIB C;  4TOI A;  3AG4 B;  3B09 A;  3ABL C;  3G6E V;  1R73 A;  2KG7 A;  4YJ2 B;  3OM3 B;  1VMG A;  1W0K G;  1PV0 A;  5JWP A;  2IW5 A;  2JDI G;  1K3E A;  2LO1 A;  4I55 B;  1SC5 B;  4LFB B;  3ABM C;  4K35 A;  1HW7 A;  1PNM A;  5KX5 B;  4LFA B;  1FPO A;  3THO A;  2RMK B;  1SES A;  1NKD A;  2D2C B;  3R65 A;  3HKE A;  1IBM B;  1AP5 A;  4BIZ A;  1MAB G;  1NS1 A;  4K0K B;  4DRX A;  4LC1 A;  3AG2 B;  3RYH A;  1JMK C;  5FPO A;  2YEV B;  1R6T A;  3IC9 A;  3RFR A;  1YEW A;  5JVD B;  1YI2 V;  2F43 G;  2ATK C;  2GSM B;  1FS0 G;  4X20 B;  3MAQ A;  4DR2 O;  1VP7 A;  2IM9 A;  5GW7 A;  3G6B A;  2E5L B;  1PM9 A;  3WB1 A;  2CUG A;  2Y69 B;  4NTX A;  2HLD G;  3BPZ A;  2AZ0 A;  2QWN B;  3JAL B;  4GYC B;  4LF9 B;  4B3M B;  3L75 H;  3PJS K;  3CCV V;  3K59 A;  4P9P A;  2GHY A;  1KP2 A;  1Y76 A;  4UVA A;  4J9Y B;  3D3I A;  3TGU H;  3VQX A;  4DV6 O;  4H0L B;  2L35 A;  5L3G A;  5LOV B;  3AG7 A;  3JAR A;  5CBG A;  4YXW G;  3CRQ A;  4IHJ A;  4IHJ B;  4DR5 B;  3SPC A;  1ZWI C;  4OPH A;  3CRA A;  3A8T A;  1OCR B;  3LDD A;  3RVY A;  1Q86 W;  3R66 A;  1F4M A;  1P84 F;  4GX1 A;  3JD2 A;  3CCU V;  1X4T A;  3UQ8 A;  2Y48 A;  2LGQ A;  2EIN C;  2IJK A;  1XDC A;  2Z0A A;  4MVQ A;  2V1D A;  1R6N A;  3RWR D;  1G6U A;  2B5U A;  2WLK A;  3ZMV A;  1JJO A;  4B3S O;  4NXN B;  3H1I H;  4Z1V A;  2GDS A;  3SGI A;  5BMV B;  1VQ7 V;  3RGB A;  1K9M W;  3CXC U;  1UFI A;  1A32 A;  3KG2 A;  2XAQ A;  3X2Q B;  2R9A A;  1F4N A;  4U3J B;  2ZM6 O;  3SPI A;  2EX3 A;  1BZK A;  4DRX B;  4TSF G;  1GK9 A;  5FLX N;  1VQO V;  1XUQ A;  4MTO A;  4LF4 B;  1NQT A;  4PI2 A;  1PNK A;  4O2B B;  2UXC O;  4MVM A;  2Q4P A;  3VQY A;  5ITZ A;  5EBM C;  2OTL V;  3UKM A;  4HAM A;  2UXN A;  3W7T A;  1W59 A;  3CC7 V;  4JI6 O;  3UT5 A;  5JH7 B;  5J2T A;  1IBK O;  4JTA B;  1EM1 A;  2F4V O;  3JD4 A;  2F1M A;  1Z5V A;  1I94 O;  3GVM A;  2ZE6 A;  1SQQ H;  4P9O A;  1KP3 A;  2H94 A;  4TV9 B;  3K5O A;  4U7N A;  5LL6 Y;  1BMF G;  3AG1 B;  1MMM A;  3DTU B;  5CA0 B;  4ZI7 B;  1XIL A;  3D8C A;  4GCZ A;  1QR9 A;  3SYA A;  3OMA B;  4FMT A;  2DYS C;  2UUB B;  5EZY B;  4ZKI A;  1WP7 A;  4LFA O;  2PYJ A;  3I56 V;  2ZR2 A;  4NXM B;  2CGN A;  3NXS A;  5LXT B;  4KL1 A;  4OX9 B;  4LH7 A;  3ZCC A;  4DV2 O;  2QDO A;  3F7V C;  1JR9 A;  4LFB O;  2OCC C;  1KEC A;  2JK5 C;  3SR2 C;  3HKB B;  4BIU A;  5FL7 G;  3APQ A;  2EUL A;  4I50 B;  4JTD B;  3N2K B;  2PY5 A;  5KMG A;  4F6E A;  1LUV A;  4IYI A;  1Q5O A;  4R7C A;  5EC1 C;  3K5L A;  1K8A W;  2W0F C;  4GT1 A;  5EIB D;  3RYH B;  1EN4 A;  3ABK B;  4MS2 A;  2A06 H;  1Q3E A;  2QR4 A;  5LYJ A;  3K06 A;  1SET A;  2GBO A;  2L6L A;  1KB9 F;  4DUY B;  4F6R A;  1S5J A;  1OCR C;  2MW2 B;  1PPJ H;  2QKA A;  2YXL A;  5D5Q A;  2P6J A;  5B1N A;  5BXZ A;  1DGS A;  1R3J C;  1CPY A;  2WLL A;  4X1K A;  4FIP C;  1W2B U;  1I94 B;  5KAI Z;  2V7Q G;  1KKC A;  4XDL A;  4DR7 O;  3T1C A;  1QLE B;  2WLJ A;  3AG3 C;  4DYL A;  1HNZ O;  4JZG A;  4X1I B;  3SJC C;  2QEX V;  1AIL A;  5LMU O;  4X89 A;  4FLY A;  1K33 A;  2YI8 A;  4X88 A;  3K5N A;  3GWO A;  3A0H Z;  5KUK A;  5CBF A;  4I5S A;  2BOB C;  5K1P A;  4IT5 A;  5BY1 A;  3FAV A;  2Q7E A;  1QVG U;  2DJV A;  4Z1M G;  4BW9 A;  4WF9 V;  3QG5 A;  1N36 O;  2ITC C;  4UV9 A;  2JRI A;  2ZXW B;  3ZHV A;  4O2A A;  4GLX A;  2CK3 G;  4UFZ A;  4JAV A;  5KMG B;  1FKA O;  4L8J A;  5JCO C;  4X8A A;  4DXW A;  1IBK B;  4I50 A;  1RP3 B;  1H2N A;  3CP1 A;  4GX5 A;  4I55 A;  3SPG A;  3SPJ A;  5C8Y A;  1GN2 A;  4LF6 O;  4FFB B;  4DV5 O;  3OT7 A;  4N23 A;  2UXD B;  2EIL B;  4B08 A;  2GTA A;  2O57 A;  1XNQ B;  1TUB A;  1JQ0 A;  3T4Z A;  1H8H G;  3K0D A;  4DV0 B;  2R9R B;  3D3Q A;  4UV8 A;  2UUA B;  5A9G A;  2ZE5 A;  2LFR A;  2E3C A;  4FPP A;  2JEU A;  3APO A;  1JPX A;  3QNE A;  3CCL V;  3G67 A;  1HWY A;  3ZN0 A;  3K9S A;  3T4D A;  4EKW A;  4CS3 A;  4B3T B;  3RVZ A;  3HKC B;  3VQV A;  3N2G A;  1M1K W;  1SQX H;  4QJF B;  1EFR G;  2R72 A;  3CB2 A;  3RYC A;  3AG2 C;  3LSQ A;  1HNX O;  3O65 A;  3ML0 A;  1SF9 A;  3I5D A;  5ITZ B;  4UVB A;  4DUZ O;  1KKD A;  4O2B A;  1BCC H;  2W0X A;  3OFN G;  4TUY A;  3VBB A;  4IGG A;  1HDJ A;  2WPD G;  2UXX A;  3H1L H;  2PF4 E;  1FXK B;  5IWA B;  1MZE A;  2VRZ A;  4FLZ A;  4TV8 A;  3OUF A;  1ZL8 A;  3M7M X;  1IX9 A;  2WLI B;  4FLX A;  1UJW B;  2H3O A;  3HR0 A;  1QQC A;  2QWQ B;  3OTO O;  4JYA B;  4WFB V;  2CH7 B;  1H2S B;  1Y66 A;  4DK1 A;  4PDM A;  4F4L A;  1S72 V;  3AG3 B;  1GM7 A;  3WB2 A;  2IU0 A;  4MTX A;  1I7F A;  3DXR B;  4X64 B;  3RYI B;  1THZ A;  1JVM A;  2YIB D;  5JJE B;  1PKX A;  3W7U A;  3SYP A;  1M4U A;  2UXD O;  4MVS A;  4MVO A;  1MSD A;  4JI7 B;  1J5E O;  2MK3 A;  4PA3 A;  2HG5 C;  5GTI Z;  2Y0I A;  3CJH B;  1I0H A;  3KCX A;  5LA6 B;  3D36 A;  2BTQ B;  3ETQ A;  1YDX A;  4KHP O;  3MDS A;  2E5L O;  2HVJ C;  3M8A A;  3JAS B;  4JTC B;  2QM8 A;  4CC6 A;  4ABM A;  1P7B A;  3T1H O;  4AQY B;  1FFT B;  2YS8 A;  2PTM A;  2RJZ A;  2XHB A;  1XNQ O;  4JI7 O;  1H8E G;  2KG7 B;  4YJ2 A;  3CPW U;  3ABM B;  2CTP A;  1B04 A;  2P90 A;  2YXH A;  3OR6 C;  1FYJ A;  4UCU A;  1SKV A;  2DWE C;  4JI4 O;  3L73 H;  2A3Q A;  1CXZ B;  1YVW A;  2QWO B;  4YY3 O;  5IY5 B;  4PA4 A;  4TT3 G;  2F4V B;  1R1B A;  1GN3 A;  2Q8V A;  5CMU A;  3ASN B;  5KA5 A;  2PI4 A;  1EBO A;  2X7R B;  1QR8 A;  3CMA V;  1PP9 H;  5IE9 A;  1XI1 A;  3E83 A;  4ASU G;  1UPG A;  1SQV H;  2QWR B;  3JAW A;  3JSL A;  3E8F A;  3SJA C;  3G71 V;  4P2Z A;  5KHK A;  2QWP B;  1L0N H;  4EFE A;  3ZJZ A;  1VQ4 V;  2KB1 A;  3ABL B;  1PL4 A;  4IIJ A;  4B7E A;  1TUE B;  4DR6 B;  4O4I A;  5CA1 A;  5CBH A;  2DWD C;  1XHX A;  4DUZ B;  2XND G;  5L3F A;  2AXT Z;  2ZIN A;  4A5U B;  4NXN O; 
#chains in the Genus database with same CATH homology
 1OCZ C;  1J95 A;  1NQT A;  1PNK A;  2WLM A;  5B1B C;  1L1F A;  1W0J G;  3JD0 A;  4MVM A;  2HFE C;  5LGT A;  3E8H A;  4PA6 A;  5EBM C;  5J9P C;  3ZIA G;  3WG7 C;  2OTL V;  4UXN A;  4HAM A;  3UKM A;  5IYB O;  3ZRW A;  2UXN A;  1AR1 B;  3W7T A;  3A0R A;  2XOK G;  4MVR A;  1SER A;  5B1A C;  3CC7 V;  3G4S V;  2ITD C;  2EZO A;  1JOY A;  1SRY A;  4JTA B;  4QE7 A;  2LFS A;  2XAJ A;  5H6R A;  3K04 A;  3CD6 V;  1K73 W;  5B3S B;  3JD4 A;  2JJ1 G;  2Q6A A;  3OAA G;  2XAG A;  2C2A A;  2YSU B;  4OXS A;  4RAI A;  4P9O A;  1E1Q G;  1KP3 A;  2H94 A;  4GX0 A;  4J9Z B;  4U7N A;  1M57 C;  1K5Q A;  1RPO A;  4R8C A;  4QPK A;  1BMF G;  4UUJ C;  1R3L C;  3AG1 B;  4MT8 A;  4N21 A;  1VQM V;  1F51 A;  1V55 B;  2R9I A;  3DTU B;  3WG7 B;  4GCZ A;  1QR9 A;  3W7X A;  3SYA A;  4RQE A;  3OMA B;  4FMT A;  2IJI A;  1OHH G;  1M90 W;  1R3K C;  2DYS C;  1Y4M A;  3OR7 C;  4E2L A;  3CCS V;  2X0L A;  2WLN A;  4ZKI A;  3P30 A;  3QO5 A;  1K97 A;  1SZT A;  3FB6 C;  3RW0 A;  5KA6 A;  5H6Q A;  3T2M A;  1OCZ B;  3ZMS A;  2DW4 A;  3I56 V;  2ZR2 A;  1VQ9 V;  4H37 A;  2Y69 C;  3NXS A;  1NJI W;  5CN0 A;  1N8R W;  3LSS A;  1GMG A;  2DQ3 A;  4QE9 A;  1NR7 A;  1PD3 A;  3ZCC A;  3F7V C;  3LDC A;  5IDJ A;  5HFM A;  3ASO C;  5LHI A;  3EFF K;  3ZN1 A;  2OCC C;  4HZ3 A;  4WFE A;  1KEC A;  3STZ C;  5IYC O;  2JK5 C;  1YIJ V;  4BAY A;  1E1R G;  4MW8 A;  1BHA A;  4BIU A;  5FL7 G;  4RO2 A;  2Q69 A;  2EZP A;  4JAU A;  4JTD B;  2A9H A;  2X6B A;  4PDR A;  3LUT B;  1NH2 B;  2EIM C;  1YTF D;  3F5W C;  1VQP V;  1OCO C;  3K0G A;  3M99 B;  2ZR3 A;  5C93 A;  1BL8 A;  1XL4 A;  3CCR V;  1K4D C;  4R7C A;  2AHY A;  1G4Y B;  5EC1 C;  2IJH A;  1K8A W;  2W0F C;  4GT1 A;  1IXM A;  3SPH A;  5L3B A;  3ABK B;  4MS2 A;  3H01 A;  2Z5U A;  2NNU A;  4Q20 A;  4UVC A;  3W7S A;  2OCC B;  3SYC A;  3K06 A;  1VQ8 V;  1RPR A;  2EBO A;  1SET A;  3ASO B;  1QBZ A;  4MSW C;  4MVU A;  5EK0 A;  3K03 A;  4MW3 A;  3OW2 U;  4I9W A;  1DLB A;  4HYO A;  2IH1 C;  1JCH A;  3FB8 C;  1OCR C;  3QO7 A;  2P6J A;  1KQS U;  5B1N A;  2ZDI A;  4H33 A;  4BW5 A;  1OZ0 A;  3CCQ V;  1R3J C;  1CPY A;  1K7D A;  2WLL A;  2XAS A;  4R50 A;  4DO2 A;  1OCC C;  4FIP C;  1W2B U;  3K9A A;  3FB5 C;  2FTK A;  1OCO B;  4G28 B;  1V54 C;  2V7Q G;  2A79 B;  4CZZ A;  1YSC A;  1FXV A;  5IY5 C;  4JYB A;  2Z3Y A;  2P67 A;  4JPR A;  2WWW A;  4XDL A;  5HFL A;  3T1C A;  1DF4 A;  2HVK C;  1QLE B;  4PA9 A;  4KUM A;  2WLJ A;  3AG3 C;  4CBC A;  1RM1 C;  1PL0 A;  1XL6 A;  2JIZ G;  4L87 A;  2QEX V;  4ZBM A;  2ZDI C;  2IH3 C;  2PI5 A;  4X89 A;  3ZRS A;  1M56 B;  1B6Q A;  1GKF A;  2EIL C;  1K33 A;  3QO8 A;  3IC7 A;  4X88 A;  2P7T C;  1M57 B;  3ABU A;  3GWO A;  1YJN V;  5KUK A;  2AHZ A;  3ZMU A;  5CBF A;  1AI5 A;  3CCJ V;  4I5S A;  2BOB C;  4FJC C;  4JAS A;  5KUM A;  1GM9 A;  4WFG A;  1NH2 D;  3JYC A;  1S0V A;  3ASN C;  3MD0 A;  1AI7 A;  3OGC C;  1QVG U;  2QTO A;  5B1O A;  2OTJ V;  3E8B A;  2B1I A;  2DYS B;  1E79 G;  1KC8 W;  2HJF C;  4Z1M G;  1YHQ V;  1AI4 A;  3VOU A;  1Q82 W;  4WF9 V;  1MOF A;  1H38 A;  2ITC C;  1R3I C;  4UV9 A;  4RQF A;  1YTF B;  1S5H C;  2ZXW B;  3CC2 V;  1S76 D;  1H2G A;  2WSS G;  1AJN A;  1G8M A;  3SYO A;  2CK3 G;  1JJ2 U;  4XDK A;  3BEH A;  4JAV A;  1VQK V;  3F7Y C;  4X8A A;  4QNH B;  4DXW A;  4PEL A;  3CP1 A;  4GX5 A;  3JD1 A;  5LGN A;  3SPG A;  3SPJ A;  3E35 A;  4LCU C;  2JEX A;  4KP4 A;  3E2E A;  1I5X A;  1VQN V;  5DM6 V;  2H8P C;  3LDE A;  1GTO A;  3LNM B;  2LP7 A;  4N23 A;  1ROP A;  2WLI A;  5L3D A;  2EIL B;  1NR1 A;  1NVP B;  1M56 C;  5B1A B;  2EIJ C;  5DN6 G;  1AJQ A;  2JJ2 G;  1JQ0 A;  3T4Z A;  1H8H G;  3K0D A;  4R6Z A;  2R9R B;  3SYQ A;  2QE7 G;  1PNL A;  1VQL V;  4UV8 A;  2X6C A;  4G27 B;  1R6K A;  2LFR A;  1K4C C;  2EIK B;  5L3E A;  1YJW V;  4FPP A;  1QLN A;  1AI6 A;  1DF5 A;  2JEU A;  4PA7 A;  1QCE A;  1OCC B;  1JPX A;  5B3S C;  3QNE A;  1K92 A;  2DYR C;  3CCL V;  1S3J A;  3ZRX A;  3BY6 A;  1HWY A;  3ETD A;  4JYC A;  3ZN0 A;  3T4D A;  4EKW A;  3CYO A;  2HKO A;  2XAH A;  3RVZ A;  3OMN B;  4TWK A;  1M1K W;  1MG1 A;  3K3W A;  4QJF B;  4LP8 A;  4QPJ A;  1EFR G;  1VQ6 V;  2B1G A;  4P30 A;  3FKS G;  1M9N A;  3OMI B;  3ETG A;  3HPL C;  4WCE V;  1P4R A;  3AG2 C;  3P32 A;  3LSQ A;  2W6I G;  4JGS A;  2HR3 A;  1GM8 A;  4WFF A;  5CA3 A;  1Q81 W;  2W6J G;  3AG4 C;  3B8M A;  1QLE C;  1V54 B;  3IGA C;  3ML0 A;  4QIW F;  3OE7 G;  1DTO A;  5H9C A;  3RBZ A;  4UVB A;  1KKD A;  1ARO P;  2QKS A;  3B8N A;  3JD3 A;  2Q67 A;  3AG4 B;  4XDJ A;  3OFN G;  3DGE A;  3VBB A;  3TET A;  3ZRV A;  2EJR A;  3ABL C;  3K79 A;  3G6E V;  5LHH A;  1R73 A;  2A0L A;  2UXX A;  2WPD G;  2WLH A;  3OM3 B;  1BHB A;  1W0K G;  2IW5 A;  4G2K A;  2JDI G;  3TK1 A;  1K3E A;  4GX2 A;  3OEE G;  1GO3 F;  3ABM C;  2EIJ B;  3E89 A;  1FXK B;  1PNM A;  4WFH A;  3ZRW B;  1VQ5 V;  1K5S A;  3CCE V;  2XAF A;  1SES A;  2K1E A;  1NKD A;  2X6A A;  3OUF A;  4PDV A;  3R65 A;  1S77 D;  2QA4 V;  2EIM B;  2WLI B;  5L3C A;  4BIZ A;  1MAB G;  1UJW B;  4MTF A;  2D3O W;  4MVZ A;  4LC1 A;  3AG2 B;  3MHH C;  2DQ0 A;  2YEV B;  3WFV A;  4WFB V;  1NVP D;  1WPX A;  3ZMZ A;  3FYI B;  3AG1 C;  1Y66 A;  1ORQ C;  1YI2 V;  1V55 C;  4PDM A;  2F43 G;  2ATK C;  2GSM B;  3AG3 B;  1FS0 G;  4F4L A;  1S72 V;  1I5Y A;  1GM7 A;  2IU0 A;  1EZJ A;  2IU3 A;  5GW7 A;  3TCU A;  4MTX A;  3OUS A;  5EC2 C;  5EBW C;  1COW G;  1THZ A;  1JVM A;  2Y69 B;  4MTG A;  1PKX A;  3W7U A;  3SYP A;  3FYE B;  5LHG A;  3ABT A;  2HLD G;  1FXH A;  4KFM A;  5LBQ A;  1NBM G;  4MVS A;  4MVO A;  1CP9 A;  5E1A C;  3HB3 B;  3X2Q C;  4XBF A;  2ZXW C;  2MK3 A;  3AEI A;  3PJS K;  1RM1 B;  1YJ9 V;  3ZMT A;  4PA3 A;  1JX9 A;  5IYD O;  2HG5 C;  3CCV V;  2BOC C;  1Q7Y W;  4P9P A;  2GHY A;  1KP2 A;  3ABK C;  2Q68 A;  4UVA A;  4J9Y B;  3W7W A;  1KD1 W;  3CCM V;  3D3I A;  3D36 A;  2OT5 A;  5L3G A;  1WLE A;  5CBG A;  2HVJ C;  4JTC B;  2QM8 A;  3MHS C;  4YXW G;  1P7B A;  1FFT B;  3SPC A;  1ZWI C;  4RUF A;  3ETE A;  1OCR B;  1H8E G;  3GB7 C;  3CPW U;  3LDD A;  3ABM B;  3RVY A;  1Q86 W;  2P90 A;  1F4M A;  5EBL C;  3E8G A;  3JCZ A;  4PDL A;  4GX1 A;  3OR6 C;  3JD2 A;  4LBE C;  1AJP A;  2DWE C;  2NLJ C;  5B1B B;  3CCU V;  1FXK A;  3E86 A;  4RUE A;  2WLL B;  2Y48 A;  1QVF U;  5IY5 B;  4JF3 A;  4PA4 A;  3OEH G;  2EIN C;  2IJK A;  1LNQ A;  4TT3 G;  3B77 A;  5CMU A;  4MVQ A;  3ASN B;  2V1D A;  1R6N A;  3STL C;  2IJJ A;  4FK5 C;  2B5U A;  2WLK A;  5KA5 A;  3ZMV A;  2PI4 A;  1EBO A;  2X7R B;  1QR8 A;  5BZB A;  3CMA V;  2M7W A;  2EIN B;  1MSW D;  3E83 A;  1F23 A;  3I55 V;  1FXK C;  1ENV A;  2EIK C;  4ASU G;  1VQ7 V;  2YEV A;  3E8F A;  3IFX A;  3CME V;  1K9M W;  2QM7 A;  3G71 V;  4P2Z A;  2ZD9 A;  3CXC U;  3ZJZ A;  4WFA V;  1VQ4 V;  2KB1 A;  2XAQ A;  3KG2 A;  3ABL B;  5LGU A;  3X2Q B;  3SJQ C;  1F4N A;  1K34 A;  3CC4 V;  1YIT V;  3FB7 C;  3SPI A;  3K08 A;  1TUE B;  3UM7 A;  1CEZ A;  4U7O A;  3EHB B;  4TSF G;  5CBH A;  2WAM A;  2DWD C;  2ZQM A;  2XND G;  1GK9 A;  2DYR B;  5L3F A;  1VQO V;  4MTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...