2EZPA

Solution nmr structure of ectodomain of siv gp41, models 1-10 of an ensemble of 40 simulated annealing structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
total genus 46
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezpA00
1JPXA 1SZTA 1MG1A 4N23A 2M7WA 2OT5A 4FIPC 1K33A 1DF4A 5KA5A 3H01A 2EZOA 2P6JA 4E2LA 4FK5C 5CN0A 3WFVA 1ENVA 3B77A 1Y4MA 4JPRA 4N21A 4JF3A 2MK3A 5H9CA 4JGSA 2EBOA 2X7RB 5HFMA 3CYOA 1QCEA 1DLBA 1EBOA 1MOFA 3MHHC 3CP1A 1I5XA 1I5YA 5CMUA 3MHSC 1JQ0A 4FJCC 3GWOA 1F23A 3B8NA 2LP7A 5KA6A 2EZPA 1DF5A 1QBZA 3B8MA 1QR8A 3K9AA 1K34A 1Y66A 3M99B 3P30A 1QR9A 4G2KA 5HFLA
chains in the Genus database with same CATH superfamily
1F4NA 4X1YA 5KA5A 4PDMA 3JAKB 5L3GA 3FFQA 1Y4MA 2IBZH 3OEHG 4RWUA 5FNVB 2ZE7A 3CC7V 1H8HG 3G4SV 3ASNC 2ZIMA 1XI1A 2JRIA 3BCCH 1W0JG 2V1DA 1OCZB 3BA8A 4UFZA 1VQMV 3FB8C 1VARA 4FIPC 2DYSB 4I55B 2ZE6A 3H1KH 2QJ1A 5IY5C 3E89A 1NKDA 1AB3A 1SZXA 5CA0A 1J5EO 5FLXN 2AXTZ 2LW1A 4JZ2A 5JCOC 1XNRO 4EB6A 4JV5B 4JTDB 3L74H 4LF9B 1Y76A 3N2KB 2CGOA 4Q6GA 1MSWD 4DUYO 2L6LA 2QDOA 4LF8B 3A2FA 3D8CA 1HR0B 2Z3YA 1NVPB 2CE4A 2CTQA 1K4DC 2XASA 2VS0A 2DQ3A 2IW5A 3OUFA 4FLWA 1EN4A 4WBNA 3BPZA 3UKMA 1F4MA 3CD6V 2LP7A 4PA9A 5LYJA 1YJNV 4FVMA 2R70A 3HKBA 5KX5B 3K3WA 4X62O 1JR9A 5LA6B 5B1AC 4MS2A 4O4JA 4G28B 4NR1A 5CA1A 2DMXA 1BL8A 1RM1C 1BE3H 1IBLO 5BR8O 5B66Z 2Q69A 2XAGA 4RQEA 2R72A 1HP8A 4LR3A 3H1HH 1FFXB 4DV3B 3OE7G 2NLJC 3JCUZ 1HDJA 1JVMA 1YHQV 2EIKC 2QWOB 2YS8A 3AG7A 3JD4A 3G80A 4GT1A 2HHHB 4ZHQA 1TUEB 2C2AA 4NVPA 4QGPA 1FYJA 5JH7B 4AI8A 3ZRSA 4LF8O 2JS5A 1CP9A 3T4DA 3JATB 3A0RA 3T1HO 5B1BB 2BE3A 1I08A 3CJHA 1IX9A 1TA8A 3MHSC 1SERA 4MVOA 2W6IG 1QR8A 4B3MB 2XAQA 1U97A 1YVWA 4JI7O 2PZSA 1AROP 4YJ3A 2AZ0A 2KG7B 1ZSPA 1ROPA 2UXBB 4FLTA 1KUQA 4W4LA 2Q7GA 2VQFB 1EZVH 3B40A 1R1BA 2AZ2A 3D3IA 2E3CA 4DV6O 4KHPO 1M5IA 3EHBB 1GN4A 3P3PA 2IH3C 3UO2A 3FYEB 4G2KA 1B6QA 2QE7G 4X64O 2GTAA 1FKAO 1DF4A 1G8MA 4PV1B 2EJ7A 4JI5B 4FFBA 3RBZA 1WPBA 2AHYA 1K9MW 1H2SB 2R9IA 4UCRA 3ZEDA 2P4VA 2BOCC 4YXWG 4LF5O 1H2MA 3THOA 5TISZ 4MSWC 2ZT9B 5KHGA 1K34A 1Q82W 1SZTA 5EYPB 3D3QA 2OTJV 2CAZC 2YEVB 2H94A 5LMNB 4DUZB 2W0XA 3CRAA 1WB8A 4CZZA 5H6QA 3DC6A 4TV8B 3CC2V 3BA9A 5E1AC 1UFIA 2DWDC 1QQCA 1L0LH 4JTCB 1YSCA 2ZKOA 5CBGA 2JEXA 2LFSA 4K0KB 4B3TO 1K5SA 1OCOB 4E4EA 1F7YA 4LNUA 2JJ2G 3T1YB 4UXNA 3SYQA 4UCOA 1I94O 4HNAB 5BXZA 1KKDA 5IJ9B 3OMNB 1ZL8A 1WA8B 3UT5B 3VQVA 3UQ8A 2JGUA 2HEPA 2Y0IA 2PGGA 4UCUA 3W7WA 3LSQA 4GKJB 3HPLC 3CC4V 3E86A 1OCCB 4F6RB 3FB7C 3DSQA 3G6EV 3VBBA 3ZMSA 2B1GA 3JARB 3K08A 4GZRB 5H9CA 3OMIB 5HFMA 3E22A 4LFBB 1GMGA 2RJZA 1PNKA 5LXTA 1M9NA 1YF2A 3B4SA 2RN9A 2QKAA 1Q7YW 3ABUA 5KAFZ 4MT8A 4OPHA 4ZOLB 1BHAA 1K33A 2ZXWC 4AQYO 1M4UA 1MZFA 2DW4A 2ZD9A 4NKGB 2Q7EA 3RYFA 2CTWA 2DWEC 5LMNO 5CB4B 4JI8B 1E1RG 2HLDG 4OX9O 2YXYA 3ZMZA 3ZX6A 2DYRC 3B8NA 1HNWO 3X2QC 2OWOA 1PKXA 2DQ0A 2L35A 2R9RB 3TGUH 3QVNA 4JAUA 2ZDIA 4J41A 4C7UA 4PI2A 1XNQO 4YHHO 1RSOA 1M56B 2P5OA 4TOIA 4LF4O 1E79G 1JA8A 5IYCO 1XHZA 3T1YO 4TV9A 3HKDB 3HKEA 5AG2A 5KHIA 3A0HZ 4MTGA 1IBKB 2F4VO 5CBFA 4PELA 3STLC 1O9HA 1Q6IA 2QKCA 3ZHVA 4X65O 5CBHA 1L0NH 2Q0OC 3DTUB 3MAQA 1GKFA 1XL4A 2XAFA 4EFBA 3SPIA 3FKSG 4EKWA 2OYQA 4LFAB 3ABLB 4XDKA 1N0NA 1H2KA 4FJCC 3HR0A 4JYAO 1FS0G 2RQ6A 2HJFC 4MVZA 5JJJB 1VF5B 1AR1B 1Q6UA 2UUBO 2FTKA 1IDSA 3H1LH 1SQQH 5GONA 3CPWU 3APOA 1SKVA 1NT2B 2OCCB 2QWPB 4DR1O 4CH4A 1N34O 3CSXA 3E8HA 4P9OA 5LP6B 1GH6A 1FXKA 2WLIA 5J2TB 5EC2C 4X1IB 1L8DA 5K1XA 1BSMA 3OGCC 4I0XB 3JASB 4HZ3A 3JAKA 4WFGA 3BY6A 3CRRA 3M99B 1QR9A 1R6TA 3CCRV 1Z5VA 3RFRA 1VQ6V 5FNVA 1R3IC 1P49A 3SYPA 5DEDA 3U0ZA 2VWKA 3L70H 1MNGA 1H8EG 1PD3A 3FAVB 2CDYA 5A2QN 4X89A 3T2MA 4NXMB 2PYJA 4FM0A 5JJEB 2DJVA 3PN1A 4GKKO 4BAYA 1XQ8A 4I55A 4DV5B 1GTOA 1AJQA 1SETA 3CCQV 3BFRA 3F5TA 2IJKA 3B09A 3K5OA 4GX5A 3JALB 4PA4A 4P30A 3N2KA 3BVOA 4GX0A 4JZGA 2OIGA 1Q8IA 4X66O 1VIBA 1NJIW 2JVDA 1KBHA 1PV0A 4JI3O 5IWAB 3RWRD 2FMLA 3CE2A 4DV1B 2UU9B 1UPGA 2YDEA 3OD4A 3ABMB 4H37A 2DE0X 1K3EA 3ICXA 2YIBD 1S5JA 1K97A 4MW3A 3ZHQA 3ETQA 1XDCA 2HP8A 3CYOA 1NTKH 1H2LA 4UVAA 2B5UA 5IT9N 4JAVA 3RYCB 4LWSB 4D6TH 5KX5A 2FB5A 4H0LB 4P2ZA 5LA6A 5IE9A 3HKCB 4YJ2B 4U7NA 1IBMO 2DOSA 5IDJA 4B3RO 1OJHA 1XEQA 4I7ZB 5GTHZ 4X20B 3ABKC 1AJPA 2ZQMA 2Y69B 3QNEA 3BHPA 1SQXH 4PA3A 1FFXA 2ATKC 2CTPA 3ASOC 3CXCU 4R8CA 2HKOA 4YY3O 1FJGB 1N0JA 4HAMA 3G67A 1K4CC 1VQ7V 4I4TB 3HB3B 1N8RW 3N2GB 4NXNB 5JH7A 2IM9A 1VMGA 4PDVA 4Z2WA 1GN6A 2QWQB 4L87A 4DR4B 1ZAUA 3JATA 1ZLZA 5FL7G 1Z5WA 1HNXO 1XMOO 1NTZH 3H01A 2UUCO 4JI6B 1OHHG 4CH3A 1YTFD 3D36A 2EINC 4JYYA 4CH5A 1R6KA 2IJHA 2ZR2A 2Y4UA 2LW7A 4BIUA 1SQBH 2KG7A 2WA3A 4UV8A 4FLXA 1J95A 3CRCA 3F5WC 1GK9A 3OM3B 3TK1A 4BW9A 4ZKIA 2PI5A 1MZEA 1FXVA 1BHBA 1OZ0A 1LUVA 3ZS8C 4QJFB 3KCXA 2GDSA 2HG5C 4AHCA 4XDLA 3LSSA 2Q0AA 1FFTB 2QKSA 3K79A 4TWKA 3CCVV 4DR5B 1VF7A 3I55V 4O4LB 2RMKB 4DXWA 4DV2B 1NR7A 3C3SA 4NB5A 2M7WA 4JI1O 3J81N 2KSDA 2ODMA 1X59A 1AR5A 1IZ3A 5D5PA 1I5XA 5D5QA 2YEVA 1L1FA 1Q6HA 4FPPA 3ETGA 1SQPH 1NZ6A 1US6A 1YITV 5GW7A 4LF7B 5J2UB 2P6JA 3LNNA 4QPKA 4TV8A 5LBQA 2BOBC 1KU9A 1W59A 3JSNA 5LGTA 1TVKB 2QR4A 4LFCB 2YC0A 1O9GA 1PNLA 4JF3A 1YI2V 5EZYB 1UJWB 2WSSG 3VOUA 3CRMA 2EIJC 2Y0PA 2VWJA 1K73W 3RVZA 1MABG 4HNAA 1W0KG 3CCUV 4LF6B 3ETEA 5IJ9A 4R50A 2A06H 4PI0A 1WA8A 2EULA 2QWRB 3UT5A 2LJ2A 3I56V 3B77A 3SJAC 4JTAB 1B3QA 1Q3EA 3MHHC 2ZDIC 4UB8Z 4J10A 1HW7A 4F6RA 3AG4C 3N27A 3JARA 4DR7B 4MVSA 3K9SA 4K8XA 4DW0A 4DR5O 4DV2O 5IJ0B 4DR6B 4DV7B 3CHXA 4N21A 2WLKA 1T5EA 4DR3B 1EBOA 2D3OW 4IYHA 1BGYH 3TCUA 5BY1A 4ZOLA 5LL6Y 1NS1A 4JV5O 4IIJB 2JS3A 1XMQB 1DF5A 1Q81W 1H2GA 4CS2A 3FB5C 1NI8A 1WPXA 1MA1A 5L3BA 4LF9O 4PA7A 1JFFB 3WG7C 5CB4A 1BQZA 1V54C 5J9PC 5IYBO 3FYIB 2BTOA 3AG2C 1HR0O 1SF9A 2PY5A 1M57C 2N74A 4O4HB 1AI7A 4DK1A 3OEEG 4G27B 2ZXWB 4TQFA 3HKDA 3M8AA 1FXKC 2E5LB 2B1IA 2JIZG 3E83A 1S5LZ 1VQKV 2WA4A 3KG2A 4LP8A 3ZHTA 1OCRB 2H3OA 1K7DA 4FZ1A 5JQGB 1E1QG 1CXZB 3T1CA 2W6JG 2EIMB 3S3XA 2LO1A 1WP8A 2F23A 4DRXB 4PHZA 1M90W 3MDSA 3CRQA 1OCZC 2YXLA 4B3SB 3TXQA 1WLEA 1PL0A 3ETDA 4TQDA 1ENVA 4JYCA 2ITCC 3EVKA 1H38A 3IFXA 4CS4A 1B04A 2DN9A 3JD1A 4DV3O 1S77D 1WNSA 2ZNJA 4GX1A 1Y74B 2KQXA 3RYHB 1N36B 5LP6A 2HHHO 3CMEV 4MW8A 5J2TA 3JYCA 5KLVH 4IYIA 5B1OA 1FXHA 4X1IA 4I0XA 3JASA 4JI4B 3JAWB 5KHHA 5KUKA 3J7AU 3OW2U 3K58A 3K57A 1BS3A 3RT3C 1YCIA 4KUMA 2YUAA 1P7BA 3FAVA 4FM1A 3L72H 2D2CB 2B9ZA 4O2AB 5CA3A 1Y76B 1SQFA 3Q4HB 4PDRA 4B3MO 4Q20A 1V9PA 3WB2A 3K5NA 1ZUQA 1KQSU 5CN0A 1N33B 4QIWF 3C90A 4JPRA 1MMMA 1YDXA 1K5QA 1G6UA 2A7WA 2UXBO 4CC6A 4H33A 2XTAA 2VQFO 3JALA 1VQLV 4U3JB 1THZA 2UXXA 2E75B 2YI9A 1NR1A 5LMUB 3P32A 3ZMVA 1R3LC 3SPJA 1SA0B 3E8FA 4O2BB 1M93A 5IYDO 4JI5O 1DTOA 2A79B 1NBMG 2JDIG 1NH2D 1XUQA 3RW0A 4IHJB 1WP7A 2UXCB 3ZMUA 4HBNA 3AK3A 1GM8A 4RUEA 5DECA 1I0HA 3DGEA 3GWKC 3RYCA 1VP7A 4Z1MG 5L3CA 2ADQB 2EILB 4DUZO 1CEZA 2ZINA 3OTFA 3CCLV 4K3AA 1DLBA 4J7ZA 5B1BC 3HKCA 3CEIA 5LHGA 4YJ2A 3RYIB 3D36C 3ZIAG 1AJNA 3K06A 2ZIOA 3E35A 3CCMV 4X20A 2LFRA 4K0KO 1VEWA 5B3SC 1QCEA 4YIOA 4BW5A 4GLXA 3B2EE 3CS5A 2ZM6B 2Y4TA 4I4TA 3K0GA 3N2GA 4KL1A 1KC8W 2P4KA 1TGOA 4JI0B 1YEWA 4O4IB 4GKJO 3E8BA 1NVPD 4XBFA 3SYCA 1RPRA 4JI2B 5CMUA 2HVKC 4K8ZA 2QM4A 4NTYA 3OTOB 2QSAA 1SESA 5C93A 4LFBO 2QA4V 1FPOA 1QLEB 2FKXA 4KXRA 1TAEA 2UXDB 4J42A 1HNZB 4GUNA 3UCSC 2UUAB 3OGIB 2Z5UA 2EBOA 4DV4B 3IJ4A 2JK5C 1Q43A 3AG1B 2HJDA 1NTMH 3AG3B 4JI8O 2WLLB 2X0LA 2CTRA 3ZBHA 4JAAA 2X6BA 4NYKA 1ORQC 3W7TA 1AP5A 2IU3A 1AI5A 2RCVA 4U3FH 2CGNA 4Z1VA 1YJWV 1OCOC 3SPGA 3SDLA 1EM1A 3WB0A 1V55B 4MVMA 2MK3A 4P9PA 1VF6A 4JGSA 1BZKA 1GO3F 4O4LA 4EEQA 4U7OA 1QHTA 3QG5A 4LH6A 3LDDA 1IBKO 1EFRG 1TUBB 3LUTB 1KMIZ 4N23A 3QO5A 1OCCC 5L3DA 1Q90D 4DR2B 1N32B 2AHZA 3OAAG 5B1NA 3STZC 2QTOA 2Q6AA 4K35A 1BMFG 1DGSA 2NNUA 4MTOA 1BQ0A 2BSKB 3ASNB 3W7XA 1IURA 1I5YA 2P67A 2H8PC 1JQ0A 4LH7A 5B5EZ 5J2UA 4LFAO 2V7QG 1KKCA 3VQXA 1TVKA 2GUZB 2ADPA 5IY5B 2ZNIA 1ZTEA 5EZYA 1VQPV 5C8YB 4UCSA 2FYUH 2A0LA 2AW9A 3BEHA 3W7UA 4DV4O 1SS3A 3L75H 4TUYB 3SYOA 2Q5ZA 3QF7A 4DW1A 3T4ZA 4WFEA 2ZE5A 1KD1W 4GYCB 2VQEB 3CCEV 1Q5OA 1GM7A 4FK5C 1NQTA 1M56C 1Q86W 1JCHA 2V4DA 3NXSA 1RPOA 1EN6A 2OCHA 1P7GA 2EZPA 4NXMO 5IJ0A 2N05A 2XUMA 2JGDB 4DV5O 1G4YB 1GN3A 2NR5A 3OFNG 2BTQB 5B1AB 4WFFA 1LNQA 1JX9A 3QO8A 4IIJA 1XL6A 2X7RB 3AG4B 1RM1B 1FAFA 3SJBC 1JFFA 3R65A 5KUMA 5ITZB 2WPDG 4FLVA 1M1KW 2A9HA 4BIOA 3PJSK 3ABLC 2F95B 3CB2A 4B7KA 3BRCA 1XHXA 2IJJA 4ABMA 5IWAO 1J5EB 1XNRB 5FPOA 4DV1O 3KCYA 5BZBA 3WFVA 2CUGA 4O4HA 2UU9O 2OCCC 2EIKB 4ZI7B 4GCZA 3ZCCA 1ZX3A 4DUYB 5LHHA 3W7SA 4L8JA 5LP6C 4MVUA 3SPCA 3APQA 3O65A 3GWOA 3SJCC 3CXHF 3AEIA 1QVGU 1QLNA 4D7SA 1GAXA 1Y66A 3OR7C 1VQ8V 5H6RA 4B08A 3SR2C 4WFBV 3JD0A 2IU0A 5JVDB 5JQGA 1DK1A 4DRXA 4JASA 1VQ4V 4J9YB 5L3FA 3UM7A 4A5UB 1PL4A 3P30A 4X62B 2JJ1G 4X1KB 3QTCA 4RUFA 1P84F 1SC5B 1U96A 2Q73A 3R66A 1FJGO 2K9PA 1Y74A 1IBLB 2XOKG 3SJQC 5BR8B 3L73H 3O9OA 3RYHA 5EYPA 4RQFA 5H2FZ 4IGGA 4ZIBA 1MSDA 4NXNO 4WCEV 1QNMA 1D5NA 4UVBA 3K5MA 2N04A 3CWBH 3SYAA 4OXSA 2CH7B 3JAWA 4DR4O 4ZBMA 5L3EA 3ABMC 3ZRWB 4I50B 4JI6O 3ZHRA 3K5LA 4O2AA 1KB9F 1D5AA 4QE9A 3L9DA 3Q4HA 1VQNV 1WJZA 3JD3A 4X9QA 3T1HB 1LR1A 1S3JA 1ZWIC 5KHKA 2YI8A 4QNHB 4U3JA 1W2BU 3FB6C 5EC1C 2LGQA 4JI7B 4FLUA 5LOVB 3NR7A 1JJ2U 4TSFG 2Y69C 4X88A 1SQVH 1JJOA 2P22C 4UCVA 1SA0A 4RAIA 4GX2A 4UCTA 1JMKC 4LCUC 1KYOF 4O2BA 2XAJA 4PA6A 3TXSA 4IHJA 4DV6B 1QU7A 2XT9A 4KHPB 1RFYA 3AK2A 3U10A 2A3QA 2Q68A 2GSMB 2OTLV 4X64B 3K0DA 3J80N 3A0BZ 2ZR3A 5BMVB 2WLMA 1VQOV 1BCCH 4W4KA 2GBOA 5KMGB 4H13B 3RYIA 4LF7O 4LF5B 4BIZA 4LFCO 2G38A 2Q7HA 1S76D 3U11A 1NU1H 1WB7A 2Z0AA 4I9QA 3I5DA 1GN2A 3IC7A 4MTFA 3M7MX 4NTWA 4ASUG 3DXRB 3CX5F 4LF6O 1HWYA 2LGWA 2DYRB 3GB7C 4PD4F 2LQTA 3X2QB 1COWG 3GVMA 3QO7A 5LGNA 5IYZB 4B3TB 4O4IA 1F51A 3EXAA 4KP4A 5EBMC 3P3NA 2ITDC 1VF6C 1QVFU 1I94B 3BAAA 2EZOA 3ZRVA 5DN6G 4DR7O 5B3SB 3IAYA 4YIPA 2DYSC 4X1YB 4H44B 4UVCA 4DR6O 4DV7O 2CK3G 1F23A 4DR3O 1XMQO 1LUWA 3LDCA 1R3KC 2UXNA 4J7KA 1YZBA 1WAZA 2WLLA 1URFA 2HVJC 3LDEA 3OT7A 3ZN1A 2Y48A 1D2DA 2F43G 5CA0B 4UV9A 4HYOA 3LSUA 4EB6B 5EK0A 4AQYB 3JSLA 3CMAV 4EFEA 3E8GA 3WU2Z 4IL6Z 2X6CA 2HR3A 4BR6A 4QE7A 4OX9B 1S0VA 2ZCEA 2E5LO 1N4CA 1HNWB 5K1PA 5EIBC 3RN4A 1TUBA 2P90A 3F7VC 1MOFA 4FLYA 4CH6A 1QBZA 5LHIA 1BT8A 1XNQB 4YHHB 2MW2B 1OV9A 4WBNB 1YTFB 3L71H 2BSKA 4FFKA 3OR6C 4LF4B 2QGNA 5LYJB 2F4VB 4X8AA 4BWAA 4B3SO 3ZRXA 3HKBB 4X65B 2Q67A 3KKYA 2GUZA 3CP1A 4J80A 1Y67A 2O57A 4NTXA 3CCSV 1YIJV 2QTSA 3B8MA 5JCOA 5C8YA 4DO2A 5FPRA 4O4JB 5CA1B 1MG1A 4FMTA 2F1MA 4D7TA 1GM9A 5EBLC 1N36O 2QEXV 2YIAA 4OPAA 2Q8VA 4MVQA 1Z2GA 4LWSA 4TUYA 1G1XB 4JYAB 3CCJV 2WWWA 4PDLA 2PTMA 2UUBB 4JI4O 4R7CA 1I7FA 3ZHSA 3LNMB 4DR1B 5HFLA 4WFAV 1N34B 4ICGA 1AI4A 4ZHQB 1FD9A 2IJIA 5LGUA 2RDCA 2F66C 3KZIZ 1SQGA 4DK0A 2QWNB 1N33O 3ABTA 2JGDA 4FLZA 1OCRC 3TJTA 2BTQA 2VRZA 3CJHB 2NN4A 2EIMC 4CS3A 4KFMA 1S5HC 2PYLA 4UB6Z 5ITZA 3JAMN 2E74B 3ABKB 5LMUO 4GKKB 4YJ3B 1YXBA 1AVMA 5EBWC 3ZJZA 3ZN0A 1XILA 3ASOB 4J11A 3ZHUA 1JOYA 2PF4E 1AR4A 2FL4A 2PUSA 4ZI7A 1XREA 2GHYA 1PP9H 2UXCO 5F2VO 2RNBA 5JWPA 2X6AA 1AP6A 1SRYA 4X66B 3A8TA 1XOUA 4JI3B 5EIBD 3OUSA 1P4RA 4FM2A 1R73A 4DV0B 4FFBB 5JVDA 4I9WA 3F7YC 1VQ5V 2KKWA 4PJ0Z 2EINB 3VQYA 4B7EA 4E2LA 2YXHA 1KECA 2WLHA 3H9VA 4J7JA 3ZMTA 2WAMA 4X1KA 5H5NA 2W0FC 3BABA 3S3WA 2XAHA 1K92A 1XBLA 1GRJA 4UUJC 1H2NA 3RGBA 4RO2A 3TETA 4TT3G 1IBMB 2ZM6O 4B3RB 4XDJA 3OMAB 2F93B 4F4LA 3JCZA 1WN7A 3FX7A 3VQWA 1RP3B 3H1IH 2ILMA 4JI0O 5A9GA 2YIDA 2XHBA 1R6NA 4LNUB 2YICA 1EN5A 2CH7A 1CPYA 1PNMA 4YY3B 2R9AA 1IXBA 1AILA 3ZRWA 4JI2O 3G71V 1ZL8B 4LBEC 4CC5A 5KHJA 4I50A 1KP2A 3OTOO 2OT5A 4MTXA 3UO3A 1S72V 2K1EA 5GTIZ 3MD0A 2UXDO 2P7TC 2ARHA 2OIEA 4MVRA 1HNZO 2AGAA 2GV9A 2EILC 2UUAO 5DM6V 4QPJA 3DC5A 4IT5A 1HNXB 1XMOB 4DV0O 2UUCB 1IXMA 3E22B 4FZ0A 2KB1A 5LXTB 5KAIZ 2XNDG 3C3TA 5LOVA 4F6EA 2QM7A 2M6YA 2EIJB 1VQ9V 2Q4PA 3RVYA 3RYFB 1X4TA 2IH1C 1KP3A 5E79Z 1YJ9V 2ETNA 2Q9LA 1N32O 4DR2O 2E76B 2GTSA 1R3JC 2EX3A 1RSOB 2PI4A 1AI6A 3ML0A 4J9ZB 3K03A 3H1JH 5BMVA 4TV9B 4JYBA 5JJNB 3HKEB 4JI1B 2WLNA 5KMGA 1PPJH 1B06A 1A32A 2JEUA 1QLEC 4WF9V 3K04A 3IGAC 3EFFK 1PM9A 3E2EA 1K8AW 3JD2A 4LC1A 2QM8A 5KA6A 3DXRA 4WFHA 3FD9A 3K9AA 3AG1C 3WG7B 1V54B 3AG3C 1JPXA 3IC9A 2YSUB 4R6ZA 2P06A 1Y6XA 3AG2B 4CBCA 3SPHA 1M57B 2VQEO 3AK1A 5IYZA 1EZJA 2EJRA 4I5SA 1NH2B 5GONB 4AILC 3WB1A 2BCCH 3G6BA 2ZE8A 1V55C 4OGQB 2YIBA 3K59A 1IVSA 2WLJA 3SGIA 4DYLA 2HFEC 1FXKB 2WLIB
chains in the Genus database with same CATH topology
1GM8A 1F4NA 3IC7A 4MTFA 5KA5A 4GX5A 4ASUG 4PDMA 4RUEA 4PA4A 4P30A 5L3GA 3DGEA 1Y4MA 4GX0A 1HWYA 4Z1MG 5L3CA 3OEHG 2EILB 1CEZA 2DYRB 3CCLV 1DLBA 3GB7C 3CC7V 1H8HG 1NJIW 3X2QB 3G4SV 3ASNC 5B1BC 5LHGA 1COWG 3QO7A 5LGNA 1W0JG 1F51A 1OCZB 2V1DA 4KP4A 5EBMC 3ZIAG 1AJNA 1VQMV 3FB8C 3K06A 2ITDC 1QVFU 4FIPC 2DYSB 3E35A 3ABMB 3CCMV 4H37A 2EZOA 1K3EA 3ZRVA 5DN6G 2LFRA 5B3SB 5IY5C 3E89A 1NKDA 1K97A 2DYSC 4MW3A 4JTDB 5B3SC 3CYOA 4UVCA 1QCEA 4UVAA 2B5UA 4BW5A 2CK3G 1F23A 4JAVA 1MSWD 4P2ZA 3K0GA 2Z3YA 1KC8W 3LDCA 1NVPB 1R3KC 2UXNA 4U7NA 3E8BA 1K4DC 5IDJA 1NVPD 2XASA 2DQ3A 2IW5A 3OUFA 2WLLA 2HVJC 4XBFA 3SYCA 3LDEA 3ABKC 1AJPA 2ZQMA 2Y69B 3QNEA 1RPRA 3UKMA 1F4MA 2Y48A 3ZN1A 5CMUA 2HVKC 3CD6V 2F43G 4PA3A 4UV9A 2LP7A 4HYOA 1SESA 5C93A 4PA9A 5EK0A 2QA4V 2ATKC 3CMAV 3CXCU 3ASOC 1QLEB 4R8CA 3E8GA 1YJNV 2HKOA 2X6CA 2HR3A 4HAMA 3K3WA 1K4CC 1VQ7V 4QE7A 3HB3B 1N8RW 1S0VA 5B1AC 2Z5UA 4MS2A 2EBOA 2P90A 3F7VC 4G28B 1MOFA 4PDVA 2JK5C 3AG1B 1BL8A 1RM1C 3AG3B 1QBZA 4L87A 5LHIA 2WLLB 2X0LA 2Q69A 2XAGA 4RQEA 5FL7G 3W7TA 2X6BA 1ORQC 1YTFB 3OR6C 2IU3A 3H01A 1OHHG 1AI5A 3D36A 1YTFD 2EINC 1YJWV 1OCOC 3SPGA 4X8AA 1R6KA 2IJHA 2ZR2A 1V55B 3OE7G 4MVMA 3ZRXA 2MK3A 2NLJC 4P9PA 4JGSA 1GO3F 1JVMA 4BIUA 1YHQV 2EIKC 2Q67A 4U7OA 3CP1A 3JD4A 3CCSV 3LDDA 1YIJV 3B8MA 4GT1A 4UV8A 4DO2A 1J95A 3F5WC 1GK9A 1TUEB 2C2AA 3OM3B 1EFRG 3TK1A 4ZKIA 3LUTB 1MG1A 4N23A 2PI5A 4FMTA 3ZRSA 1CP9A 3QO5A 1FXVA 3T4DA 1BHBA 1OCCC 5L3DA 1OZ0A 2AHZA 3OAAG 5B1NA 1GM9A 3A0RA 5EBLC 2QTOA 3STZC 2Q6AA 4QJFB 2QEXV 4MVQA 1BMFG 2NNUA 4MTOA 3ASNB 5B1BB 3W7XA 2HG5C 3CCJV 4XDLA 2WWWA 3LSSA 1I5YA 2P67A 3MHSC 2H8PC 1JQ0A 4PDLA 1SERA 1FFTB 4MVOA 2QKSA 2W6IG 2V7QG 1QR8A 3K79A 4R7CA 4TWKA 3CCVV 3LNMB 2XAQA 3I55V 5HFLA 4WFAV 1AROP 4DXWA 1NR7A 2M7WA 5IY5B 1AI4A 1VQPV 1ROPA 2IJIA 5LGUA 2A0LA 3ABTA 3D3IA 3BEHA 1I5XA 3W7UA 2YEVA 1OCRC 1L1FA 3EHBB 3SYOA 2IH3C 4FPPA 3ETGA 3FYEB 3T4ZA 4G2KA 1B6QA 2QE7G 4WFEA 1YITV 2EIMC 1KD1W 5GW7A 4KFMA 3CCEV 1DF4A 2P6JA 1GM7A 1S5HC 4QPKA 1G8MA 5LBQA 2BOBC 4FK5C 5LGTA 3RBZA 1NQTA 2AHYA 1M56C 3ABKB 1K9MW 1PNLA 4JF3A 1JCHA 1Q86W 2R9IA 3NXSA 1YI2V 5EBWC 1UJWB 1RPOA 2WSSG 3VOUA 2BOCC 3ZJZA 3ZN0A 4YXWG 4MSWC 2EIJC 3ASOB 2EZPA 1K73W 1JOYA 1K34A 3RVZA 1MABG 1Q82W 1SZTA 1W0KG 3CCUV 2GHYA 3ETEA 1G4YB 2OTJV 4R50A 2YEVB 3OFNG 2H94A 5B1AB 4WFFA 2X6AA 1LNQA 1SRYA 1JX9A 3I56V 3B77A 4CZZA 3QO8A 5H6QA 4JTAB 1XL6A 2X7RB 3AG4B 3OUSA 1P4RA 1RM1B 3CC2V 1R73A 3R65A 5E1AC 5KUMA 3MHHC 2WPDG 1M1KW 2ZDIC 2A9HA 2DWDC 3ABLC 3PJSK 3AG4C 4JTCB 1YSCA 5CBGA 2JEXA 2IJJA 4I9WA 2LFSA 3F7YC 1VQ5V 4MVSA 2EINB 1K5SA 1OCOB 2JJ2G 4E2LA 5BZBA 4UXNA 1KECA 3SYQA 3WFVA 2WLHA 2OCCC 2EIKB 4GCZA 2WLKA 4N21A 3ZMTA 1KKDA 3ZCCA 3OMNB 2WAMA 1EBOA 5LHHA 2W0FC 3W7SA 2D3OW 2XAHA 4MVUA 3SPCA 3TCUA 3GWOA 1K92A 3AEIA 1QVGU 1Q81W 1DF5A 4UUJC 1H2GA 1QLNA 3W7WA 1Y66A 3FB5C 1WPXA 3OR7C 4RO2A 3LSQA 1VQ8V 3TETA 4TT3G 5H6RA 5L3BA 4PA7A 3HPLC 3CC4V 3E86A 1OCCB 3OMAB 4XDJA 3WG7C 4F4LA 4WFBV 1V54C 3FB7C 5J9PC 3JD0A 5IYBO 3FYIB 3G6EV 3VBBA 2IU0A 3JCZA 3ZMSA 2B1GA 3K08A 3AG2C 5H9CA 1M57C 3OMIB 1R6NA 5HFMA 1GMGA 4JASA 1PNKA 1CPYA 1AI7A 4J9YB 5L3FA 1M9NA 1PNMA 3OEEG 3UM7A 1VQ4V 4G27B 3P30A 3ZRWA 2ZXWB 1Q7YW 3G71V 4LBEC 2JJ1G 3ABUA 1KP2A 4MT8A 2OT5A 1BHAA 1FXKC 1K33A 4MTXA 2ZXWC 1S72V 2DW4A 2B1IA 2JIZG 2ZD9A 3E83A 4RUFA 2K1EA 3MD0A 2DWEC 2P7TC 1VQKV 4MVRA 3KG2A 4LP8A 1E1RG 1OCRB 2XOKG 2HLDG 3SJQC 2EILC 3ZMZA 1K7DA 4RQFA 5DM6V 1E1QG 2DYRC 3B8NA 4QPJA 3T1CA 3X2QC 4WCEV 2W6JG 2EIMB 1IXMA 4UVBA 1PKXA 1M90W 2DQ0A 2R9RB 2KB1A 3SYAA 1OCZC 4JAUA 4OXSA 2ZDIA 4ZBMA 1WLEA 1PL0A 1M56B 2XNDG 5L3EA 3ETDA 3ABMC 3ZRWB 1ENVA 1E79G 2QM7A 5IYCO 4JYCA 2ITCC 1H38A 3IFXA 4MTGA 3JD1A 2EIJB 1VQ9V 5CBFA 1S77D 3RVYA 4PELA 3STLC 4QE9A 1VQNV 2IH1C 1KP3A 3JD3A 1YJ9V 4GX1A 5CBHA 3CMEV 4MW8A 3JYCA 3DTUB 1S3JA 1ZWIC 5B1OA 1FXHA 1GKFA 1XL4A 2XAFA 3SPIA 3FKSG 4QNHB 4EKWA 5KUKA 3ABLB 1R3JC 4XDKA 1W2BU 3FB6C 2PI4A 5EC1C 1AI6A 3OW2U 3ML0A 4J9ZB 3K03A 4FJCC 1JJ2U 4KUMA 4TSFG 1FS0G 2Y69C 2HJFC 4JYBA 4MVZA 1P7BA 2WLNA 1AR1B 4X88A 5CA3A 2FTKA 4RAIA 4GX2A 3CPWU 3CCQV 4LCUC 2OCCB 2JEUA 1QLEC 4PDRA 4WF9V 4Q20A 3K04A 3IGAC 1KQSU 5CN0A 2XAJA 3EFFK 4QIWF 4PA6A 4JPRA 3E8HA 3E2EA 4P9OA 1K5QA 1FXKA 2WLIA 1K8AW 3JD2A 5EC2C 4H33A 2Q68A 4LC1A 2GSMB 2OTLV 2QM8A 3OGCC 5KA6A 4HZ3A 4WFHA 1VQLV 3BY6A 3K9AA 4WFGA 3K0DA 3AG1C 1THZA 3M99B 3WG7B 1QR9A 2ZR3A 1V54B 3CCRV 3AG3C 1JPXA 1VQ6V 2YSUB 2UXXA 4R6ZA 1R3IC 3SYPA 1NR1A 3AG2B 4CBCA 3P32A 3ZMVA 2WLMA 1VQOV 1R3LC 1H8EG 1PD3A 3SPHA 3SPJA 1M57B 4X89A 1EZJA 2EJRA 4I5SA 3T2MA 4BIZA 1NH2B 3E8FA 5IYDO 1V55C 1DTOA 2A79B 1NBMG 2JDIG 1NH2D 4BAYA 1S76D 3RW0A 1GTOA 2WLJA 1AJQA 1SETA 3ZMUA 2HFEC 1FXKB 2WLIB 2IJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JPX A;  1SZT A;  1MG1 A;  4N23 A;  2M7W A;  2OT5 A;  4FIP C;  1K33 A;  1DF4 A;  5KA5 A;  3H01 A;  2EZO A;  2P6J A;  4E2L A;  4FK5 C;  5CN0 A;  3WFV A;  1ENV A;  3B77 A;  1Y4M A;  4JPR A;  4N21 A;  4JF3 A;  2MK3 A;  5H9C A;  4JGS A;  2EBO A;  2X7R B;  5HFM A;  3CYO A;  1QCE A;  1DLB A;  1EBO A;  1MOF A;  3MHH C;  3CP1 A;  1I5X A;  1I5Y A;  5CMU A;  3MHS C;  1JQ0 A;  4FJC C;  3GWO A;  1F23 A;  3B8N A;  2LP7 A;  5KA6 A;  2EZP A;  1DF5 A;  1QBZ A;  3B8M A;  1QR8 A;  3K9A A;  1K34 A;  1Y66 A;  3M99 B;  3P30 A;  1QR9 A;  4G2K A;  5HFL A; 
#chains in the Genus database with same CATH topology
 1F4N A;  4X1Y A;  5KA5 A;  4PDM A;  3JAK B;  5L3G A;  3FFQ A;  1Y4M A;  2IBZ H;  3OEH G;  4RWU A;  5FNV B;  2ZE7 A;  3CC7 V;  1H8H G;  3G4S V;  3ASN C;  2ZIM A;  1XI1 A;  2JRI A;  3BCC H;  1W0J G;  2V1D A;  1OCZ B;  3BA8 A;  4UFZ A;  1VQM V;  3FB8 C;  1VAR A;  4FIP C;  2DYS B;  4I55 B;  2ZE6 A;  3H1K H;  2QJ1 A;  5IY5 C;  3E89 A;  1NKD A;  1AB3 A;  1SZX A;  5CA0 A;  1J5E O;  5FLX N;  2AXT Z;  2LW1 A;  4JZ2 A;  5JCO C;  1XNR O;  4EB6 A;  4JV5 B;  4JTD B;  3L74 H;  4LF9 B;  1Y76 A;  3N2K B;  2CGO A;  4Q6G A;  1MSW D;  4DUY O;  2L6L A;  2QDO A;  4LF8 B;  3A2F A;  3D8C A;  1HR0 B;  2Z3Y A;  1NVP B;  2CE4 A;  2CTQ A;  1K4D C;  2XAS A;  2VS0 A;  2DQ3 A;  2IW5 A;  3OUF A;  4FLW A;  1EN4 A;  4WBN A;  3BPZ A;  3UKM A;  1F4M A;  3CD6 V;  2LP7 A;  4PA9 A;  5LYJ A;  1YJN V;  4FVM A;  2R70 A;  3HKB A;  5KX5 B;  3K3W A;  4X62 O;  1JR9 A;  5LA6 B;  5B1A C;  4MS2 A;  4O4J A;  4G28 B;  4NR1 A;  5CA1 A;  2DMX A;  1BL8 A;  1RM1 C;  1BE3 H;  1IBL O;  5BR8 O;  5B66 Z;  2Q69 A;  2XAG A;  4RQE A;  2R72 A;  1HP8 A;  4LR3 A;  3H1H H;  1FFX B;  4DV3 B;  3OE7 G;  2NLJ C;  3JCU Z;  1HDJ A;  1JVM A;  1YHQ V;  2EIK C;  2QWO B;  2YS8 A;  3AG7 A;  3JD4 A;  3G80 A;  4GT1 A;  2HHH B;  4ZHQ A;  1TUE B;  2C2A A;  4NVP A;  4QGP A;  1FYJ A;  5JH7 B;  4AI8 A;  3ZRS A;  4LF8 O;  2JS5 A;  1CP9 A;  3T4D A;  3JAT B;  3A0R A;  3T1H O;  5B1B B;  2BE3 A;  1I08 A;  3CJH A;  1IX9 A;  1TA8 A;  3MHS C;  1SER A;  4MVO A;  2W6I G;  1QR8 A;  4B3M B;  2XAQ A;  1U97 A;  1YVW A;  4JI7 O;  2PZS A;  1ARO P;  4YJ3 A;  2AZ0 A;  2KG7 B;  1ZSP A;  1ROP A;  2UXB B;  4FLT A;  1KUQ A;  4W4L A;  2Q7G A;  2VQF B;  1EZV H;  3B40 A;  1R1B A;  2AZ2 A;  3D3I A;  2E3C A;  4DV6 O;  4KHP O;  1M5I A;  3EHB B;  1GN4 A;  3P3P A;  2IH3 C;  3UO2 A;  3FYE B;  4G2K A;  1B6Q A;  2QE7 G;  4X64 O;  2GTA A;  1FKA O;  1DF4 A;  1G8M A;  4PV1 B;  2EJ7 A;  4JI5 B;  4FFB A;  3RBZ A;  1WPB A;  2AHY A;  1K9M W;  1H2S B;  2R9I A;  4UCR A;  3ZED A;  2P4V A;  2BOC C;  4YXW G;  4LF5 O;  1H2M A;  3THO A;  5TIS Z;  4MSW C;  2ZT9 B;  5KHG A;  1K34 A;  1Q82 W;  1SZT A;  5EYP B;  3D3Q A;  2OTJ V;  2CAZ C;  2YEV B;  2H94 A;  5LMN B;  4DUZ B;  2W0X A;  3CRA A;  1WB8 A;  4CZZ A;  5H6Q A;  3DC6 A;  4TV8 B;  3CC2 V;  3BA9 A;  5E1A C;  1UFI A;  2DWD C;  1QQC A;  1L0L H;  4JTC B;  1YSC A;  2ZKO A;  5CBG A;  2JEX A;  2LFS A;  4K0K B;  4B3T O;  1K5S A;  1OCO B;  4E4E A;  1F7Y A;  4LNU A;  2JJ2 G;  3T1Y B;  4UXN A;  3SYQ A;  4UCO A;  1I94 O;  4HNA B;  5BXZ A;  1KKD A;  5IJ9 B;  3OMN B;  1ZL8 A;  1WA8 B;  3UT5 B;  3VQV A;  3UQ8 A;  2JGU A;  2HEP A;  2Y0I A;  2PGG A;  4UCU A;  3W7W A;  3LSQ A;  4GKJ B;  3HPL C;  3CC4 V;  3E86 A;  1OCC B;  4F6R B;  3FB7 C;  3DSQ A;  3G6E V;  3VBB A;  3ZMS A;  2B1G A;  3JAR B;  3K08 A;  4GZR B;  5H9C A;  3OMI B;  5HFM A;  3E22 A;  4LFB B;  1GMG A;  2RJZ A;  1PNK A;  5LXT A;  1M9N A;  1YF2 A;  3B4S A;  2RN9 A;  2QKA A;  1Q7Y W;  3ABU A;  5KAF Z;  4MT8 A;  4OPH A;  4ZOL B;  1BHA A;  1K33 A;  2ZXW C;  4AQY O;  1M4U A;  1MZF A;  2DW4 A;  2ZD9 A;  4NKG B;  2Q7E A;  3RYF A;  2CTW A;  2DWE C;  5LMN O;  5CB4 B;  4JI8 B;  1E1R G;  2HLD G;  4OX9 O;  2YXY A;  3ZMZ A;  3ZX6 A;  2DYR C;  3B8N A;  1HNW O;  3X2Q C;  2OWO A;  1PKX A;  2DQ0 A;  2L35 A;  2R9R B;  3TGU H;  3QVN A;  4JAU A;  2ZDI A;  4J41 A;  4C7U A;  4PI2 A;  1XNQ O;  4YHH O;  1RSO A;  1M56 B;  2P5O A;  4TOI A;  4LF4 O;  1E79 G;  1JA8 A;  5IYC O;  1XHZ A;  3T1Y O;  4TV9 A;  3HKD B;  3HKE A;  5AG2 A;  5KHI A;  3A0H Z;  4MTG A;  1IBK B;  2F4V O;  5CBF A;  4PEL A;  3STL C;  1O9H A;  1Q6I A;  2QKC A;  3ZHV A;  4X65 O;  5CBH A;  1L0N H;  2Q0O C;  3DTU B;  3MAQ A;  1GKF A;  1XL4 A;  2XAF A;  4EFB A;  3SPI A;  3FKS G;  4EKW A;  2OYQ A;  4LFA B;  3ABL B;  4XDK A;  1N0N A;  1H2K A;  4FJC C;  3HR0 A;  4JYA O;  1FS0 G;  2RQ6 A;  2HJF C;  4MVZ A;  5JJJ B;  1VF5 B;  1AR1 B;  1Q6U A;  2UUB O;  2FTK A;  1IDS A;  3H1L H;  1SQQ H;  5GON A;  3CPW U;  3APO A;  1SKV A;  1NT2 B;  2OCC B;  2QWP B;  4DR1 O;  4CH4 A;  1N34 O;  3CSX A;  3E8H A;  4P9O A;  5LP6 B;  1GH6 A;  1FXK A;  2WLI A;  5J2T B;  5EC2 C;  4X1I B;  1L8D A;  5K1X A;  1BSM A;  3OGC C;  4I0X B;  3JAS B;  4HZ3 A;  3JAK A;  4WFG A;  3BY6 A;  3CRR A;  3M99 B;  1QR9 A;  1R6T A;  3CCR V;  1Z5V A;  3RFR A;  1VQ6 V;  5FNV A;  1R3I C;  1P49 A;  3SYP A;  5DED A;  3U0Z A;  2VWK A;  3L70 H;  1MNG A;  1H8E G;  1PD3 A;  3FAV B;  2CDY A;  5A2Q N;  4X89 A;  3T2M A;  4NXM B;  2PYJ A;  4FM0 A;  5JJE B;  2DJV A;  3PN1 A;  4GKK O;  4BAY A;  1XQ8 A;  4I55 A;  4DV5 B;  1GTO A;  1AJQ A;  1SET A;  3CCQ V;  3BFR A;  3F5T A;  2IJK A;  3B09 A;  3K5O A;  4GX5 A;  3JAL B;  4PA4 A;  4P30 A;  3N2K A;  3BVO A;  4GX0 A;  4JZG A;  2OIG A;  1Q8I A;  4X66 O;  1VIB A;  1NJI W;  2JVD A;  1KBH A;  1PV0 A;  4JI3 O;  5IWA B;  3RWR D;  2FML A;  3CE2 A;  4DV1 B;  2UU9 B;  1UPG A;  2YDE A;  3OD4 A;  3ABM B;  4H37 A;  2DE0 X;  1K3E A;  3ICX A;  2YIB D;  1S5J A;  1K97 A;  4MW3 A;  3ZHQ A;  3ETQ A;  1XDC A;  2HP8 A;  3CYO A;  1NTK H;  1H2L A;  4UVA A;  2B5U A;  5IT9 N;  4JAV A;  3RYC B;  4LWS B;  4D6T H;  5KX5 A;  2FB5 A;  4H0L B;  4P2Z A;  5LA6 A;  5IE9 A;  3HKC B;  4YJ2 B;  4U7N A;  1IBM O;  2DOS A;  5IDJ A;  4B3R O;  1OJH A;  1XEQ A;  4I7Z B;  5GTH Z;  4X20 B;  3ABK C;  1AJP A;  2ZQM A;  2Y69 B;  3QNE A;  3BHP A;  1SQX H;  4PA3 A;  1FFX A;  2ATK C;  2CTP A;  3ASO C;  3CXC U;  4R8C A;  2HKO A;  4YY3 O;  1FJG B;  1N0J A;  4HAM A;  3G67 A;  1K4C C;  1VQ7 V;  4I4T B;  3HB3 B;  1N8R W;  3N2G B;  4NXN B;  5JH7 A;  2IM9 A;  1VMG A;  4PDV A;  4Z2W A;  1GN6 A;  2QWQ B;  4L87 A;  4DR4 B;  1ZAU A;  3JAT A;  1ZLZ A;  5FL7 G;  1Z5W A;  1HNX O;  1XMO O;  1NTZ H;  3H01 A;  2UUC O;  4JI6 B;  1OHH G;  4CH3 A;  1YTF D;  3D36 A;  2EIN C;  4JYY A;  4CH5 A;  1R6K A;  2IJH A;  2ZR2 A;  2Y4U A;  2LW7 A;  4BIU A;  1SQB H;  2KG7 A;  2WA3 A;  4UV8 A;  4FLX A;  1J95 A;  3CRC A;  3F5W C;  1GK9 A;  3OM3 B;  3TK1 A;  4BW9 A;  4ZKI A;  2PI5 A;  1MZE A;  1FXV A;  1BHB A;  1OZ0 A;  1LUV A;  3ZS8 C;  4QJF B;  3KCX A;  2GDS A;  2HG5 C;  4AHC A;  4XDL A;  3LSS A;  2Q0A A;  1FFT B;  2QKS A;  3K79 A;  4TWK A;  3CCV V;  4DR5 B;  1VF7 A;  3I55 V;  4O4L B;  2RMK B;  4DXW A;  4DV2 B;  1NR7 A;  3C3S A;  4NB5 A;  2M7W A;  4JI1 O;  3J81 N;  2KSD A;  2ODM A;  1X59 A;  1AR5 A;  1IZ3 A;  5D5P A;  1I5X A;  5D5Q A;  2YEV A;  1L1F A;  1Q6H A;  4FPP A;  3ETG A;  1SQP H;  1NZ6 A;  1US6 A;  1YIT V;  5GW7 A;  4LF7 B;  5J2U B;  2P6J A;  3LNN A;  4QPK A;  4TV8 A;  5LBQ A;  2BOB C;  1KU9 A;  1W59 A;  3JSN A;  5LGT A;  1TVK B;  2QR4 A;  4LFC B;  2YC0 A;  1O9G A;  1PNL A;  4JF3 A;  1YI2 V;  5EZY B;  1UJW B;  2WSS G;  3VOU A;  3CRM A;  2EIJ C;  2Y0P A;  2VWJ A;  1K73 W;  3RVZ A;  1MAB G;  4HNA A;  1W0K G;  3CCU V;  4LF6 B;  3ETE A;  5IJ9 A;  4R50 A;  2A06 H;  4PI0 A;  1WA8 A;  2EUL A;  2QWR B;  3UT5 A;  2LJ2 A;  3I56 V;  3B77 A;  3SJA C;  4JTA B;  1B3Q A;  1Q3E A;  3MHH C;  2ZDI C;  4UB8 Z;  4J10 A;  1HW7 A;  4F6R A;  3AG4 C;  3N27 A;  3JAR A;  4DR7 B;  4MVS A;  3K9S A;  4K8X A;  4DW0 A;  4DR5 O;  4DV2 O;  5IJ0 B;  4DR6 B;  4DV7 B;  3CHX A;  4N21 A;  2WLK A;  1T5E A;  4DR3 B;  1EBO A;  2D3O W;  4IYH A;  1BGY H;  3TCU A;  5BY1 A;  4ZOL A;  5LL6 Y;  1NS1 A;  4JV5 O;  4IIJ B;  2JS3 A;  1XMQ B;  1DF5 A;  1Q81 W;  1H2G A;  4CS2 A;  3FB5 C;  1NI8 A;  1WPX A;  1MA1 A;  5L3B A;  4LF9 O;  4PA7 A;  1JFF B;  3WG7 C;  5CB4 A;  1BQZ A;  1V54 C;  5J9P C;  5IYB O;  3FYI B;  2BTO A;  3AG2 C;  1HR0 O;  1SF9 A;  2PY5 A;  1M57 C;  2N74 A;  4O4H B;  1AI7 A;  4DK1 A;  3OEE G;  4G27 B;  2ZXW B;  4TQF A;  3HKD A;  3M8A A;  1FXK C;  2E5L B;  2B1I A;  2JIZ G;  3E83 A;  1S5L Z;  1VQK V;  2WA4 A;  3KG2 A;  4LP8 A;  3ZHT A;  1OCR B;  2H3O A;  1K7D A;  4FZ1 A;  5JQG B;  1E1Q G;  1CXZ B;  3T1C A;  2W6J G;  2EIM B;  3S3X A;  2LO1 A;  1WP8 A;  2F23 A;  4DRX B;  4PHZ A;  1M90 W;  3MDS A;  3CRQ A;  1OCZ C;  2YXL A;  4B3S B;  3TXQ A;  1WLE A;  1PL0 A;  3ETD A;  4TQD A;  1ENV A;  4JYC A;  2ITC C;  3EVK A;  1H38 A;  3IFX A;  4CS4 A;  1B04 A;  2DN9 A;  3JD1 A;  4DV3 O;  1S77 D;  1WNS A;  2ZNJ A;  4GX1 A;  1Y74 B;  2KQX A;  3RYH B;  1N36 B;  5LP6 A;  2HHH O;  3CME V;  4MW8 A;  5J2T A;  3JYC A;  5KLV H;  4IYI A;  5B1O A;  1FXH A;  4X1I A;  4I0X A;  3JAS A;  4JI4 B;  3JAW B;  5KHH A;  5KUK A;  3J7A U;  3OW2 U;  3K58 A;  3K57 A;  1BS3 A;  3RT3 C;  1YCI A;  4KUM A;  2YUA A;  1P7B A;  3FAV A;  4FM1 A;  3L72 H;  2D2C B;  2B9Z A;  4O2A B;  5CA3 A;  1Y76 B;  1SQF A;  3Q4H B;  4PDR A;  4B3M O;  4Q20 A;  1V9P A;  3WB2 A;  3K5N A;  1ZUQ A;  1KQS U;  5CN0 A;  1N33 B;  4QIW F;  3C90 A;  4JPR A;  1MMM A;  1YDX A;  1K5Q A;  1G6U A;  2A7W A;  2UXB O;  4CC6 A;  4H33 A;  2XTA A;  2VQF O;  3JAL A;  1VQL V;  4U3J B;  1THZ A;  2UXX A;  2E75 B;  2YI9 A;  1NR1 A;  5LMU B;  3P32 A;  3ZMV A;  1R3L C;  3SPJ A;  1SA0 B;  3E8F A;  4O2B B;  1M93 A;  5IYD O;  4JI5 O;  1DTO A;  2A79 B;  1NBM G;  2JDI G;  1NH2 D;  1XUQ A;  3RW0 A;  4IHJ B;  1WP7 A;  2UXC B;  3ZMU A;  4HBN A;  3AK3 A;  1GM8 A;  4RUE A;  5DEC A;  1I0H A;  3DGE A;  3GWK C;  3RYC A;  1VP7 A;  4Z1M G;  5L3C A;  2ADQ B;  2EIL B;  4DUZ O;  1CEZ A;  2ZIN A;  3OTF A;  3CCL V;  4K3A A;  1DLB A;  4J7Z A;  5B1B C;  3HKC A;  3CEI A;  5LHG A;  4YJ2 A;  3RYI B;  3D36 C;  3ZIA G;  1AJN A;  3K06 A;  2ZIO A;  3E35 A;  3CCM V;  4X20 A;  2LFR A;  4K0K O;  1VEW A;  5B3S C;  1QCE A;  4YIO A;  4BW5 A;  4GLX A;  3B2E E;  3CS5 A;  2ZM6 B;  2Y4T A;  4I4T A;  3K0G A;  3N2G A;  4KL1 A;  1KC8 W;  2P4K A;  1TGO A;  4JI0 B;  1YEW A;  4O4I B;  4GKJ O;  3E8B A;  1NVP D;  4XBF A;  3SYC A;  1RPR A;  4JI2 B;  5CMU A;  2HVK C;  4K8Z A;  2QM4 A;  4NTY A;  3OTO B;  2QSA A;  1SES A;  5C93 A;  4LFB O;  2QA4 V;  1FPO A;  1QLE B;  2FKX A;  4KXR A;  1TAE A;  2UXD B;  4J42 A;  1HNZ B;  4GUN A;  3UCS C;  2UUA B;  3OGI B;  2Z5U A;  2EBO A;  4DV4 B;  3IJ4 A;  2JK5 C;  1Q43 A;  3AG1 B;  2HJD A;  1NTM H;  3AG3 B;  4JI8 O;  2WLL B;  2X0L A;  2CTR A;  3ZBH A;  4JAA A;  2X6B A;  4NYK A;  1ORQ C;  3W7T A;  1AP5 A;  2IU3 A;  1AI5 A;  2RCV A;  4U3F H;  2CGN A;  4Z1V A;  1YJW V;  1OCO C;  3SPG A;  3SDL A;  1EM1 A;  3WB0 A;  1V55 B;  4MVM A;  2MK3 A;  4P9P A;  1VF6 A;  4JGS A;  1BZK A;  1GO3 F;  4O4L A;  4EEQ A;  4U7O A;  1QHT A;  3QG5 A;  4LH6 A;  3LDD A;  1IBK O;  1EFR G;  1TUB B;  3LUT B;  1KMI Z;  4N23 A;  3QO5 A;  1OCC C;  5L3D A;  1Q90 D;  4DR2 B;  1N32 B;  2AHZ A;  3OAA G;  5B1N A;  3STZ C;  2QTO A;  2Q6A A;  4K35 A;  1BMF G;  1DGS A;  2NNU A;  4MTO A;  1BQ0 A;  2BSK B;  3ASN B;  3W7X A;  1IUR A;  1I5Y A;  2P67 A;  2H8P C;  1JQ0 A;  4LH7 A;  5B5E Z;  5J2U A;  4LFA O;  2V7Q G;  1KKC A;  3VQX A;  1TVK A;  2GUZ B;  2ADP A;  5IY5 B;  2ZNI A;  1ZTE A;  5EZY A;  1VQP V;  5C8Y B;  4UCS A;  2FYU H;  2A0L A;  2AW9 A;  3BEH A;  3W7U A;  4DV4 O;  1SS3 A;  3L75 H;  4TUY B;  3SYO A;  2Q5Z A;  3QF7 A;  4DW1 A;  3T4Z A;  4WFE A;  2ZE5 A;  1KD1 W;  4GYC B;  2VQE B;  3CCE V;  1Q5O A;  1GM7 A;  4FK5 C;  1NQT A;  1M56 C;  1Q86 W;  1JCH A;  2V4D A;  3NXS A;  1RPO A;  1EN6 A;  2OCH A;  1P7G A;  2EZP A;  4NXM O;  5IJ0 A;  2N05 A;  2XUM A;  2JGD B;  4DV5 O;  1G4Y B;  1GN3 A;  2NR5 A;  3OFN G;  2BTQ B;  5B1A B;  4WFF A;  1LNQ A;  1JX9 A;  3QO8 A;  4IIJ A;  1XL6 A;  2X7R B;  3AG4 B;  1RM1 B;  1FAF A;  3SJB C;  1JFF A;  3R65 A;  5KUM A;  5ITZ B;  2WPD G;  4FLV A;  1M1K W;  2A9H A;  4BIO A;  3PJS K;  3ABL C;  2F95 B;  3CB2 A;  4B7K A;  3BRC A;  1XHX A;  2IJJ A;  4ABM A;  5IWA O;  1J5E B;  1XNR B;  5FPO A;  4DV1 O;  3KCY A;  5BZB A;  3WFV A;  2CUG A;  4O4H A;  2UU9 O;  2OCC C;  2EIK B;  4ZI7 B;  4GCZ A;  3ZCC A;  1ZX3 A;  4DUY B;  5LHH A;  3W7S A;  4L8J A;  5LP6 C;  4MVU A;  3SPC A;  3APQ A;  3O65 A;  3GWO A;  3SJC C;  3CXH F;  3AEI A;  1QVG U;  1QLN A;  4D7S A;  1GAX A;  1Y66 A;  3OR7 C;  1VQ8 V;  5H6R A;  4B08 A;  3SR2 C;  4WFB V;  3JD0 A;  2IU0 A;  5JVD B;  5JQG A;  1DK1 A;  4DRX A;  4JAS A;  1VQ4 V;  4J9Y B;  5L3F A;  3UM7 A;  4A5U B;  1PL4 A;  3P30 A;  4X62 B;  2JJ1 G;  4X1K B;  3QTC A;  4RUF A;  1P84 F;  1SC5 B;  1U96 A;  2Q73 A;  3R66 A;  1FJG O;  2K9P A;  1Y74 A;  1IBL B;  2XOK G;  3SJQ C;  5BR8 B;  3L73 H;  3O9O A;  3RYH A;  5EYP A;  4RQF A;  5H2F Z;  4IGG A;  4ZIB A;  1MSD A;  4NXN O;  4WCE V;  1QNM A;  1D5N A;  4UVB A;  3K5M A;  2N04 A;  3CWB H;  3SYA A;  4OXS A;  2CH7 B;  3JAW A;  4DR4 O;  4ZBM A;  5L3E A;  3ABM C;  3ZRW B;  4I50 B;  4JI6 O;  3ZHR A;  3K5L A;  4O2A A;  1KB9 F;  1D5A A;  4QE9 A;  3L9D A;  3Q4H A;  1VQN V;  1WJZ A;  3JD3 A;  4X9Q A;  3T1H B;  1LR1 A;  1S3J A;  1ZWI C;  5KHK A;  2YI8 A;  4QNH B;  4U3J A;  1W2B U;  3FB6 C;  5EC1 C;  2LGQ A;  4JI7 B;  4FLU A;  5LOV B;  3NR7 A;  1JJ2 U;  4TSF G;  2Y69 C;  4X88 A;  1SQV H;  1JJO A;  2P22 C;  4UCV A;  1SA0 A;  4RAI A;  4GX2 A;  4UCT A;  1JMK C;  4LCU C;  1KYO F;  4O2B A;  2XAJ A;  4PA6 A;  3TXS A;  4IHJ A;  4DV6 B;  1QU7 A;  2XT9 A;  4KHP B;  1RFY A;  3AK2 A;  3U10 A;  2A3Q A;  2Q68 A;  2GSM B;  2OTL V;  4X64 B;  3K0D A;  3J80 N;  3A0B Z;  2ZR3 A;  5BMV B;  2WLM A;  1VQO V;  1BCC H;  4W4K A;  2GBO A;  5KMG B;  4H13 B;  3RYI A;  4LF7 O;  4LF5 B;  4BIZ A;  4LFC O;  2G38 A;  2Q7H A;  1S76 D;  3U11 A;  1NU1 H;  1WB7 A;  2Z0A A;  4I9Q A;  3I5D A;  1GN2 A;  3IC7 A;  4MTF A;  3M7M X;  4NTW A;  4ASU G;  3DXR B;  3CX5 F;  4LF6 O;  1HWY A;  2LGW A;  2DYR B;  3GB7 C;  4PD4 F;  2LQT A;  3X2Q B;  1COW G;  3GVM A;  3QO7 A;  5LGN A;  5IYZ B;  4B3T B;  4O4I A;  1F51 A;  3EXA A;  4KP4 A;  5EBM C;  3P3N A;  2ITD C;  1VF6 C;  1QVF U;  1I94 B;  3BAA A;  2EZO A;  3ZRV A;  5DN6 G;  4DR7 O;  5B3S B;  3IAY A;  4YIP A;  2DYS C;  4X1Y B;  4H44 B;  4UVC A;  4DR6 O;  4DV7 O;  2CK3 G;  1F23 A;  4DR3 O;  1XMQ O;  1LUW A;  3LDC A;  1R3K C;  2UXN A;  4J7K A;  1YZB A;  1WAZ A;  2WLL A;  1URF A;  2HVJ C;  3LDE A;  3OT7 A;  3ZN1 A;  2Y48 A;  1D2D A;  2F43 G;  5CA0 B;  4UV9 A;  4HYO A;  3LSU A;  4EB6 B;  5EK0 A;  4AQY B;  3JSL A;  3CMA V;  4EFE A;  3E8G A;  3WU2 Z;  4IL6 Z;  2X6C A;  2HR3 A;  4BR6 A;  4QE7 A;  4OX9 B;  1S0V A;  2ZCE A;  2E5L O;  1N4C A;  1HNW B;  5K1P A;  5EIB C;  3RN4 A;  1TUB A;  2P90 A;  3F7V C;  1MOF A;  4FLY A;  4CH6 A;  1QBZ A;  5LHI A;  1BT8 A;  1XNQ B;  4YHH B;  2MW2 B;  1OV9 A;  4WBN B;  1YTF B;  3L71 H;  2BSK A;  4FFK A;  3OR6 C;  4LF4 B;  2QGN A;  5LYJ B;  2F4V B;  4X8A A;  4BWA A;  4B3S O;  3ZRX A;  3HKB B;  4X65 B;  2Q67 A;  3KKY A;  2GUZ A;  3CP1 A;  4J80 A;  1Y67 A;  2O57 A;  4NTX A;  3CCS V;  1YIJ V;  2QTS A;  3B8M A;  5JCO A;  5C8Y A;  4DO2 A;  5FPR A;  4O4J B;  5CA1 B;  1MG1 A;  4FMT A;  2F1M A;  4D7T A;  1GM9 A;  5EBL C;  1N36 O;  2QEX V;  2YIA A;  4OPA A;  2Q8V A;  4MVQ A;  1Z2G A;  4LWS A;  4TUY A;  1G1X B;  4JYA B;  3CCJ V;  2WWW A;  4PDL A;  2PTM A;  2UUB B;  4JI4 O;  4R7C A;  1I7F A;  3ZHS A;  3LNM B;  4DR1 B;  5HFL A;  4WFA V;  1N34 B;  4ICG A;  1AI4 A;  4ZHQ B;  1FD9 A;  2IJI A;  5LGU A;  2RDC A;  2F66 C;  3KZI Z;  1SQG A;  4DK0 A;  2QWN B;  1N33 O;  3ABT A;  2JGD A;  4FLZ A;  1OCR C;  3TJT A;  2BTQ A;  2VRZ A;  3CJH B;  2NN4 A;  2EIM C;  4CS3 A;  4KFM A;  1S5H C;  2PYL A;  4UB6 Z;  5ITZ A;  3JAM N;  2E74 B;  3ABK B;  5LMU O;  4GKK B;  4YJ3 B;  1YXB A;  1AVM A;  5EBW C;  3ZJZ A;  3ZN0 A;  1XIL A;  3ASO B;  4J11 A;  3ZHU A;  1JOY A;  2PF4 E;  1AR4 A;  2FL4 A;  2PUS A;  4ZI7 A;  1XRE A;  2GHY A;  1PP9 H;  2UXC O;  5F2V O;  2RNB A;  5JWP A;  2X6A A;  1AP6 A;  1SRY A;  4X66 B;  3A8T A;  1XOU A;  4JI3 B;  5EIB D;  3OUS A;  1P4R A;  4FM2 A;  1R73 A;  4DV0 B;  4FFB B;  5JVD A;  4I9W A;  3F7Y C;  1VQ5 V;  2KKW A;  4PJ0 Z;  2EIN B;  3VQY A;  4B7E A;  4E2L A;  2YXH A;  1KEC A;  2WLH A;  3H9V A;  4J7J A;  3ZMT A;  2WAM A;  4X1K A;  5H5N A;  2W0F C;  3BAB A;  3S3W A;  2XAH A;  1K92 A;  1XBL A;  1GRJ A;  4UUJ C;  1H2N A;  3RGB A;  4RO2 A;  3TET A;  4TT3 G;  1IBM B;  2ZM6 O;  4B3R B;  4XDJ A;  3OMA B;  2F93 B;  4F4L A;  3JCZ A;  1WN7 A;  3FX7 A;  3VQW A;  1RP3 B;  3H1I H;  2ILM A;  4JI0 O;  5A9G A;  2YID A;  2XHB A;  1R6N A;  4LNU B;  2YIC A;  1EN5 A;  2CH7 A;  1CPY A;  1PNM A;  4YY3 B;  2R9A A;  1IXB A;  1AIL A;  3ZRW A;  4JI2 O;  3G71 V;  1ZL8 B;  4LBE C;  4CC5 A;  5KHJ A;  4I50 A;  1KP2 A;  3OTO O;  2OT5 A;  4MTX A;  3UO3 A;  1S72 V;  2K1E A;  5GTI Z;  3MD0 A;  2UXD O;  2P7T C;  2ARH A;  2OIE A;  4MVR A;  1HNZ O;  2AGA A;  2GV9 A;  2EIL C;  2UUA O;  5DM6 V;  4QPJ A;  3DC5 A;  4IT5 A;  1HNX B;  1XMO B;  4DV0 O;  2UUC B;  1IXM A;  3E22 B;  4FZ0 A;  2KB1 A;  5LXT B;  5KAI Z;  2XND G;  3C3T A;  5LOV A;  4F6E A;  2QM7 A;  2M6Y A;  2EIJ B;  1VQ9 V;  2Q4P A;  3RVY A;  3RYF B;  1X4T A;  2IH1 C;  1KP3 A;  5E79 Z;  1YJ9 V;  2ETN A;  2Q9L A;  1N32 O;  4DR2 O;  2E76 B;  2GTS A;  1R3J C;  2EX3 A;  1RSO B;  2PI4 A;  1AI6 A;  3ML0 A;  4J9Z B;  3K03 A;  3H1J H;  5BMV A;  4TV9 B;  4JYB A;  5JJN B;  3HKE B;  4JI1 B;  2WLN A;  5KMG A;  1PPJ H;  1B06 A;  1A32 A;  2JEU A;  1QLE C;  4WF9 V;  3K04 A;  3IGA C;  3EFF K;  1PM9 A;  3E2E A;  1K8A W;  3JD2 A;  4LC1 A;  2QM8 A;  5KA6 A;  3DXR A;  4WFH A;  3FD9 A;  3K9A A;  3AG1 C;  3WG7 B;  1V54 B;  3AG3 C;  1JPX A;  3IC9 A;  2YSU B;  4R6Z A;  2P06 A;  1Y6X A;  3AG2 B;  4CBC A;  3SPH A;  1M57 B;  2VQE O;  3AK1 A;  5IYZ A;  1EZJ A;  2EJR A;  4I5S A;  1NH2 B;  5GON B;  4AIL C;  3WB1 A;  2BCC H;  3G6B A;  2ZE8 A;  1V55 C;  4OGQ B;  2YIB A;  3K59 A;  1IVS A;  2WLJ A;  3SGI A;  4DYL A;  2HFE C;  1FXK B;  2WLI B; 
#chains in the Genus database with same CATH homology
 1GM8 A;  1F4N A;  3IC7 A;  4MTF A;  5KA5 A;  4GX5 A;  4ASU G;  4PDM A;  4RUE A;  4PA4 A;  4P30 A;  5L3G A;  3DGE A;  1Y4M A;  4GX0 A;  1HWY A;  4Z1M G;  5L3C A;  3OEH G;  2EIL B;  1CEZ A;  2DYR B;  3CCL V;  1DLB A;  3GB7 C;  3CC7 V;  1H8H G;  1NJI W;  3X2Q B;  3G4S V;  3ASN C;  5B1B C;  5LHG A;  1COW G;  3QO7 A;  5LGN A;  1W0J G;  1F51 A;  1OCZ B;  2V1D A;  4KP4 A;  5EBM C;  3ZIA G;  1AJN A;  1VQM V;  3FB8 C;  3K06 A;  2ITD C;  1QVF U;  4FIP C;  2DYS B;  3E35 A;  3ABM B;  3CCM V;  4H37 A;  2EZO A;  1K3E A;  3ZRV A;  5DN6 G;  2LFR A;  5B3S B;  5IY5 C;  3E89 A;  1NKD A;  1K97 A;  2DYS C;  4MW3 A;  4JTD B;  5B3S C;  3CYO A;  4UVC A;  1QCE A;  4UVA A;  2B5U A;  4BW5 A;  2CK3 G;  1F23 A;  4JAV A;  1MSW D;  4P2Z A;  3K0G A;  2Z3Y A;  1KC8 W;  3LDC A;  1NVP B;  1R3K C;  2UXN A;  4U7N A;  3E8B A;  1K4D C;  5IDJ A;  1NVP D;  2XAS A;  2DQ3 A;  2IW5 A;  3OUF A;  2WLL A;  2HVJ C;  4XBF A;  3SYC A;  3LDE A;  3ABK C;  1AJP A;  2ZQM A;  2Y69 B;  3QNE A;  1RPR A;  3UKM A;  1F4M A;  2Y48 A;  3ZN1 A;  5CMU A;  2HVK C;  3CD6 V;  2F43 G;  4PA3 A;  4UV9 A;  2LP7 A;  4HYO A;  1SES A;  5C93 A;  4PA9 A;  5EK0 A;  2QA4 V;  2ATK C;  3CMA V;  3CXC U;  3ASO C;  1QLE B;  4R8C A;  3E8G A;  1YJN V;  2HKO A;  2X6C A;  2HR3 A;  4HAM A;  3K3W A;  1K4C C;  1VQ7 V;  4QE7 A;  3HB3 B;  1N8R W;  1S0V A;  5B1A C;  2Z5U A;  4MS2 A;  2EBO A;  2P90 A;  3F7V C;  4G28 B;  1MOF A;  4PDV A;  2JK5 C;  3AG1 B;  1BL8 A;  1RM1 C;  3AG3 B;  1QBZ A;  4L87 A;  5LHI A;  2WLL B;  2X0L A;  2Q69 A;  2XAG A;  4RQE A;  5FL7 G;  3W7T A;  2X6B A;  1ORQ C;  1YTF B;  3OR6 C;  2IU3 A;  3H01 A;  1OHH G;  1AI5 A;  3D36 A;  1YTF D;  2EIN C;  1YJW V;  1OCO C;  3SPG A;  4X8A A;  1R6K A;  2IJH A;  2ZR2 A;  1V55 B;  3OE7 G;  4MVM A;  3ZRX A;  2MK3 A;  2NLJ C;  4P9P A;  4JGS A;  1GO3 F;  1JVM A;  4BIU A;  1YHQ V;  2EIK C;  2Q67 A;  4U7O A;  3CP1 A;  3JD4 A;  3CCS V;  3LDD A;  1YIJ V;  3B8M A;  4GT1 A;  4UV8 A;  4DO2 A;  1J95 A;  3F5W C;  1GK9 A;  1TUE B;  2C2A A;  3OM3 B;  1EFR G;  3TK1 A;  4ZKI A;  3LUT B;  1MG1 A;  4N23 A;  2PI5 A;  4FMT A;  3ZRS A;  1CP9 A;  3QO5 A;  1FXV A;  3T4D A;  1BHB A;  1OCC C;  5L3D A;  1OZ0 A;  2AHZ A;  3OAA G;  5B1N A;  1GM9 A;  3A0R A;  5EBL C;  2QTO A;  3STZ C;  2Q6A A;  4QJF B;  2QEX V;  4MVQ A;  1BMF G;  2NNU A;  4MTO A;  3ASN B;  5B1B B;  3W7X A;  2HG5 C;  3CCJ V;  4XDL A;  2WWW A;  3LSS A;  1I5Y A;  2P67 A;  3MHS C;  2H8P C;  1JQ0 A;  4PDL A;  1SER A;  1FFT B;  4MVO A;  2QKS A;  2W6I G;  2V7Q G;  1QR8 A;  3K79 A;  4R7C A;  4TWK A;  3CCV V;  3LNM B;  2XAQ A;  3I55 V;  5HFL A;  4WFA V;  1ARO P;  4DXW A;  1NR7 A;  2M7W A;  5IY5 B;  1AI4 A;  1VQP V;  1ROP A;  2IJI A;  5LGU A;  2A0L A;  3ABT A;  3D3I A;  3BEH A;  1I5X A;  3W7U A;  2YEV A;  1OCR C;  1L1F A;  3EHB B;  3SYO A;  2IH3 C;  4FPP A;  3ETG A;  3FYE B;  3T4Z A;  4G2K A;  1B6Q A;  2QE7 G;  4WFE A;  1YIT V;  2EIM C;  1KD1 W;  5GW7 A;  4KFM A;  3CCE V;  1DF4 A;  2P6J A;  1GM7 A;  1S5H C;  4QPK A;  1G8M A;  5LBQ A;  2BOB C;  4FK5 C;  5LGT A;  3RBZ A;  1NQT A;  2AHY A;  1M56 C;  3ABK B;  1K9M W;  1PNL A;  4JF3 A;  1JCH A;  1Q86 W;  2R9I A;  3NXS A;  1YI2 V;  5EBW C;  1UJW B;  1RPO A;  2WSS G;  3VOU A;  2BOC C;  3ZJZ A;  3ZN0 A;  4YXW G;  4MSW C;  2EIJ C;  3ASO B;  2EZP A;  1K73 W;  1JOY A;  1K34 A;  3RVZ A;  1MAB G;  1Q82 W;  1SZT A;  1W0K G;  3CCU V;  2GHY A;  3ETE A;  1G4Y B;  2OTJ V;  4R50 A;  2YEV B;  3OFN G;  2H94 A;  5B1A B;  4WFF A;  2X6A A;  1LNQ A;  1SRY A;  1JX9 A;  3I56 V;  3B77 A;  4CZZ A;  3QO8 A;  5H6Q A;  4JTA B;  1XL6 A;  2X7R B;  3AG4 B;  3OUS A;  1P4R A;  1RM1 B;  3CC2 V;  1R73 A;  3R65 A;  5E1A C;  5KUM A;  3MHH C;  2WPD G;  1M1K W;  2ZDI C;  2A9H A;  2DWD C;  3ABL C;  3PJS K;  3AG4 C;  4JTC B;  1YSC A;  5CBG A;  2JEX A;  2IJJ A;  4I9W A;  2LFS A;  3F7Y C;  1VQ5 V;  4MVS A;  2EIN B;  1K5S A;  1OCO B;  2JJ2 G;  4E2L A;  5BZB A;  4UXN A;  1KEC A;  3SYQ A;  3WFV A;  2WLH A;  2OCC C;  2EIK B;  4GCZ A;  2WLK A;  4N21 A;  3ZMT A;  1KKD A;  3ZCC A;  3OMN B;  2WAM A;  1EBO A;  5LHH A;  2W0F C;  3W7S A;  2D3O W;  2XAH A;  4MVU A;  3SPC A;  3TCU A;  3GWO A;  1K92 A;  3AEI A;  1QVG U;  1Q81 W;  1DF5 A;  4UUJ C;  1H2G A;  1QLN A;  3W7W A;  1Y66 A;  3FB5 C;  1WPX A;  3OR7 C;  4RO2 A;  3LSQ A;  1VQ8 V;  3TET A;  4TT3 G;  5H6R A;  5L3B A;  4PA7 A;  3HPL C;  3CC4 V;  3E86 A;  1OCC B;  3OMA B;  4XDJ A;  3WG7 C;  4F4L A;  4WFB V;  1V54 C;  3FB7 C;  5J9P C;  3JD0 A;  5IYB O;  3FYI B;  3G6E V;  3VBB A;  2IU0 A;  3JCZ A;  3ZMS A;  2B1G A;  3K08 A;  3AG2 C;  5H9C A;  1M57 C;  3OMI B;  1R6N A;  5HFM A;  1GMG A;  4JAS A;  1PNK A;  1CPY A;  1AI7 A;  4J9Y B;  5L3F A;  1M9N A;  1PNM A;  3OEE G;  3UM7 A;  1VQ4 V;  4G27 B;  3P30 A;  3ZRW A;  2ZXW B;  1Q7Y W;  3G71 V;  4LBE C;  2JJ1 G;  3ABU A;  1KP2 A;  4MT8 A;  2OT5 A;  1BHA A;  1FXK C;  1K33 A;  4MTX A;  2ZXW C;  1S72 V;  2DW4 A;  2B1I A;  2JIZ G;  2ZD9 A;  3E83 A;  4RUF A;  2K1E A;  3MD0 A;  2DWE C;  2P7T C;  1VQK V;  4MVR A;  3KG2 A;  4LP8 A;  1E1R G;  1OCR B;  2XOK G;  2HLD G;  3SJQ C;  2EIL C;  3ZMZ A;  1K7D A;  4RQF A;  5DM6 V;  1E1Q G;  2DYR C;  3B8N A;  4QPJ A;  3T1C A;  3X2Q C;  4WCE V;  2W6J G;  2EIM B;  1IXM A;  4UVB A;  1PKX A;  1M90 W;  2DQ0 A;  2R9R B;  2KB1 A;  3SYA A;  1OCZ C;  4JAU A;  4OXS A;  2ZDI A;  4ZBM A;  1WLE A;  1PL0 A;  1M56 B;  2XND G;  5L3E A;  3ETD A;  3ABM C;  3ZRW B;  1ENV A;  1E79 G;  2QM7 A;  5IYC O;  4JYC A;  2ITC C;  1H38 A;  3IFX A;  4MTG A;  3JD1 A;  2EIJ B;  1VQ9 V;  5CBF A;  1S77 D;  3RVY A;  4PEL A;  3STL C;  4QE9 A;  1VQN V;  2IH1 C;  1KP3 A;  3JD3 A;  1YJ9 V;  4GX1 A;  5CBH A;  3CME V;  4MW8 A;  3JYC A;  3DTU B;  1S3J A;  1ZWI C;  5B1O A;  1FXH A;  1GKF A;  1XL4 A;  2XAF A;  3SPI A;  3FKS G;  4QNH B;  4EKW A;  5KUK A;  3ABL B;  1R3J C;  4XDK A;  1W2B U;  3FB6 C;  2PI4 A;  5EC1 C;  1AI6 A;  3OW2 U;  3ML0 A;  4J9Z B;  3K03 A;  4FJC C;  1JJ2 U;  4KUM A;  4TSF G;  1FS0 G;  2Y69 C;  2HJF C;  4JYB A;  4MVZ A;  1P7B A;  2WLN A;  1AR1 B;  4X88 A;  5CA3 A;  2FTK A;  4RAI A;  4GX2 A;  3CPW U;  3CCQ V;  4LCU C;  2OCC B;  2JEU A;  1QLE C;  4PDR A;  4WF9 V;  4Q20 A;  3K04 A;  3IGA C;  1KQS U;  5CN0 A;  2XAJ A;  3EFF K;  4QIW F;  4PA6 A;  4JPR A;  3E8H A;  3E2E A;  4P9O A;  1K5Q A;  1FXK A;  2WLI A;  1K8A W;  3JD2 A;  5EC2 C;  4H33 A;  2Q68 A;  4LC1 A;  2GSM B;  2OTL V;  2QM8 A;  3OGC C;  5KA6 A;  4HZ3 A;  4WFH A;  1VQL V;  3BY6 A;  3K9A A;  4WFG A;  3K0D A;  3AG1 C;  1THZ A;  3M99 B;  3WG7 B;  1QR9 A;  2ZR3 A;  1V54 B;  3CCR V;  3AG3 C;  1JPX A;  1VQ6 V;  2YSU B;  2UXX A;  4R6Z A;  1R3I C;  3SYP A;  1NR1 A;  3AG2 B;  4CBC A;  3P32 A;  3ZMV A;  2WLM A;  1VQO V;  1R3L C;  1H8E G;  1PD3 A;  3SPH A;  3SPJ A;  1M57 B;  4X89 A;  1EZJ A;  2EJR A;  4I5S A;  3T2M A;  4BIZ A;  1NH2 B;  3E8F A;  5IYD O;  1V55 C;  1DTO A;  2A79 B;  1NBM G;  2JDI G;  1NH2 D;  4BAY A;  1S76 D;  3RW0 A;  1GTO A;  2WLJ A;  1AJQ A;  1SET A;  3ZMU A;  2HFE C;  1FXK B;  2WLI B;  2IJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...