2EZPA

Solution nmr structure of ectodomain of siv gp41, models 1-10 of an ensemble of 40 simulated annealing structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
total genus 46
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezpA00
5CN0A 1Y4MA 1JPXA 2OT5A 3WFVA 4JGSA 1I5YA 3K9AA 1QR8A 2P6JA 5KA6A 4N23A 4E2LA 3MHSC 3P30A 3CP1A 4FJCC 1QCEA 5CMUA 1K34A 4JF3A 1F23A 1K33A 1MOFA 2EZPA 3GWOA 3CYOA 1MG1A 1EBOA 4N21A 1ENVA 2X7RB 4FIPC 3H01A 5HFLA 2M7WA 1I5XA 2EBOA 1DF4A 2EZOA 4JPRA 4G2KA 3MHHC 1QBZA 1JQ0A 5HFMA 5H9CA 3B77A 3B8MA 5KA5A 1DLBA 3B8NA 1SZTA 1QR9A 2MK3A 3M99B 2LP7A 1DF5A 4FK5C 1Y66A
chains in the Genus database with same CATH superfamily
2O57A 1N36B 2QDOA 1FXKA 1K92A 3BHPA 3UM7A 4CH6A 2LO1A 1GTOA 1K34A 4JI2O 1JX9A 1OCCB 1ENVA 3CPWU 2AHZA 3JD1A 4BR6A 1M1KW 2UXBB 2Q7GA 3CCMV 1ZTEA 4DR3O 5JJNB 4JI3B 4MTFA 1L0LH 3K5MA 2P6JA 3RVZA 3CB2A 2ZM6O 4FPPA 3JD4A 4L87A 1B6QA 4MSWC 3B40A 1A32A 3JYCA 1EM1A 2BOCC 3RYFB 2ETNA 4DV2O 4JI2B 2AW9A 3BY6A 5H9CA 3D36C 3CC4V 1WPXA 4GX1A 2IW5A 1PV0A 4XDLA 4D7SA 1N34O 2UXDO 5LP6B 1HR0B 4DR3B 2JJ1G 1PL4A 1WPBA 3RVYA 2E5LO 2NN4A 4H44B 4H0LB 2JGDB 5LP6A 1D2DA 2CDYA 2R70A 3B77A 1Y6XA 3OAAG 4G28B 2RCVA 3SPJA 4QJFB 2OCCC 4DV2B 2JGDA 2OT5A 4W4LA 3WB2A 1JA8A 4DR2O 4LNUB 3RYHB 2QKCA 4MTXA 4NKGB 5J2UB 5CA1B 3AG1B 2FL4A 4MVRA 3RYIA 3BEHA 1G1XB 4MVOA 5HFLA 5IWAO 4X66O 4B3MO 3ETEA 4LNUA 3RYHA 3C3SA 2E5LB 3ABKC 5J2UA 4YJ3A 5CA1A 1U97A 1PD3A 3ZJZA 1M93A 4NTYA 1P7GA 2A79B 2JEUA 2CH7B 5B1BB 1K4CC 4IHJB 3CCRV 2RDCA 2ZKOA 2RMKB 4CC5A 2ZDIA 2XASA 2EINC 2YXYA 2A9HA 3ML0A 1SQQH 2BSKB 3CC2V 1DF4A 4ABMA 3LNMB 5IWAB 1VF6C 4B3MB 5IDJA 1IBMO 2BSKA 4I5SA 3TXSA 3QTCA 3EVKA 1AI6A 1SQXH 2LQTA 5J2TB 3U11A 1IBLB 4BW5A 5IE9A 4I9QA 1IXBA 1Q43A 4DUZB 4QNHB 4X88A 2VQEB 3SYPA 3B09A 1GMGA 2LFRA 5J2TA 5ITZB 2EJ7A 1GM9A 2QWOB 4DR5B 4MW3A 1AP6A 1P84F 2YSUB 4ZBMA 5DECA 4K8ZA 5ITZA 5IYZA 2E75B 1JR9A 3ZRWB 2P22C 2EBOA 2EIMC 1XMQB 2W6IG 2R9IA 3MHHC 5KHKA 1LUWA 4DUYO 1DLBA 2EIJC 4WFEA 5H6RA 2ADPA 1THZA 3T1HO 3E86A 1ZLZA 3L70H 4WFAV 1J95A 4I0XB 3P30A 4UCSA 1GO3F 1WLEA 2A7WA 3BA8A 2HJDA 5FL7G 4H37A 1XL4A 2E76B 1S5HC 1ZSPA 1I94O 2LGQA 4NB5A 1VF7A 4X1IB 4I50B 1NVPB 4P2ZA 4BIOA 1T5EA 2YC0A 3ABMB 3FD9A 4JGSA 1FAFA 1BGYH 4FM1A 3G6BA 5DN6G 2JS5A 2KSDA 4Z1MG 1MOFA 3UO3A 3IJ4A 4I50A 2HLDG 1WAZA 1S0VA 1WB7A 2YIAA 2CTPA 3JAWB 3W7SA 3L75H 4F6RA 2DWEC 1FPOA 1AJQA 2Z5UA 1OCZB 2Q9LA 2UXNA 5JQGB 1OCOC 2WWWA 2EILB 3IFXA 3SPGA 1YITV 4ZOLA 5FPOA 3JAWA 1M56B 1YF2A 4BIZA 1FKAO 3L71H 5JQGA 4E4EA 1R3KC 2OTLV 4OPAA 4GZRB 2WLKA 1TUEB 4JI6O 1VARA 4Q20A 1FD9A 1K9MW 2Q7HA 3GB7C 2ADQB 3TXQA 1SERA 2CAZC 2NLJC 2PUSA 3BA9A 4JAUA 5LMNO 1IXMA 5B3SC 1S5JA 3ZS8C 1PKXA 4LFAO 3H9VA 1VEWA 3OE7G 2X0LA 3O9OA 4L8JA 4DRXA 2DYRC 1BS3A 2DW4A 4IT5A 2E74B 1VQ7V 5AG2A 4UCUA 2H94A 4UFZA 4MVZA 1BHBA 1H2NA 3FKSG 4LF6O 1CP9A 4NTWA 2F95B 3F7YC 2Q0OC 2YUAA 4X65O 4O4IB 2PI5A 3JD2A 4I4TA 4PD4F 3OD4A 3H1IH 3G6EV 1PPJH 2ZCEA 1QR8A 4QPJA 4J7KA 4FJCC 2YI9A 1B06A 5GONB 4O4IA 1SZXA 3A0RA 4BIUA 2M7WA 1H8HG 2PY5A 4UV9A 4BW9A 1F4MA 4LF6B 1ZAUA 4YIPA 3Q4HB 1R3JC 1L8DA 4H13B 5L3FA 3CCEV 1Y4MA 5IJ0B 1QHTA 2YDEA 1TUBB 2OCHA 3SJCC 4X64O 4PA6A 3ABLB 2FTKA 1MZEA 1LR1A 2OIGA 5H2FZ 2Y0IA 4NXNO 4HAMA 1YXBA 5B1AB 5IJ0A 1P49A 2FB5A 1FJGB 4PA9A 3AG7A 4NTXA 3MAQA 4R6ZA 4I55A 2ARHA 1SZTA 4WFGA 3TJTA 5JVDB 5E1AC 5CB4B 1KKDA 2IU0A 3CXCU 1VQ5V 5CMUA 3K3WA 2AXTZ 3VQYA 2HVJC 3CWBH 2AZ0A 2YICA 1GH6A 5JVDA 2ZXWC 3AEIA 5CB4A 3JALB 3AG3C 3U10A 5H5NA 3E2EA 1YEWA 3B2EE 3OTOB 4YXWG 3JALA 1SA0B 2DJVA 3APOA 1YJWV 4J7ZA 3J80N 3ZMUA 2ZE5A 4TV8B 2W0FC 1SQPH 2WLJA 3KCXA 3QO7A 3CMAV 3ZN1A 1SA0A 4DV7B 2JDIG 3BCCH 4TV8A 1RSOB 2ZD9A 1QLEC 1EZJA 1FFXB 2IH1C 4JI5O 2AGAA 4CZZA 4JI1B 4PELA 3P3PA 3C3TA 4U7NA 3ABTA 2IU3A 1NZ6A 1RSOA 2OCCB 3PJSK 2QGNA 2QJ1A 1FFXA 4P9OA 3AG4C 3CCLV 5A9GA 4GKKB 2VQFO 2QKAA 4HNAB 3DSQA 2IJHA 1OCRC 4TQFA 3CCQV 3HKCB 5JCOA 4B3SO 4FK5C 2B1IA 4J80A 3ZCCA 1K5SA 2ITCC 2B1GA 1EFRG 4HNAA 5LHIA 3G71V 3OGIB 3BPZA 3OEHG 4CS4A 1PP9H 1Z5VA 3JSLA 4FLZA 1JCHA 2DQ0A 3ETGA 3W7TA 1KQSU 1N0JA 4RQEA 2QM7A 2EINB 4LC1A 2VQFB 4YIOA 3E8BA 1FXHA 1GM8A 4JYBA 3RW0A 1F7YA 1IZ3A 1GRJA 2WLNA 5IY5C 3MHSC 4K0KO 2Q73A 3JARB 1K33A 5GTHZ 1VQ6V 4FIPC 3HB3B 4JZGA 4DV6O 2KB1A 2QM8A 2CUGA 2L6LA 5C8YB 3JARA 4J42A 4LR3A 1XNQO 4PDLA 4U7OA 1AILA 5LA6B 3CX5F 3T1YO 4JTAB 1FS0G 4GUNA 4GKJB 1HNXB 4K0KB 1Y67A 3JSNA 1XUQA 4DV3B 5LA6A 3K0GA 4FLXA 4LF5B 5KLVH 5L3BA 3AK3A 2F66C 1MA1A 4TOIA 1OV9A 2GDSA 4F4LA 5JH7A 2XAQA 3N2KB 5LHHA 4LF9O 3WB0A 4NR1A 1NVPD 4MT8A 1RM1C 1VF5B 1XNQB 5HFMA 4NVPA 3W7WA 1R73A 3UKMA 1IVSA 3RYCB 4DR4O 5KMGB 4R50A 4BWAA 3N27A 1XILA 4RO2A 3RN4A 3VBBA 1JJ2U 1H38A 2WLIB 4JZ2A 1K3EA 2PZSA 3SPCA 1NT2B 5KMGA 3ZHTA 5H6QA 2GSMB 4MTOA 2X7RB 4B3RB 3VQXA 1AR5A 3JATB 2WLIA 3ZIAG 2Y48A 4PDVA 1M90W 5FNVB 3OT7A 1DF5A 3CRCA 4BAYA 3J7AU 1HDJA 1K5QA 1XMOO 4N23A 4LFBO 3JATA 5EYPB 4TUYB 4FZ1A 1G8MA 1VQ8V 2IJKA 5FNVA 1G4YB 2RQ6A 2BTOA 3EFFK 2DE0X 1Q6IA 1W2BU 1VP7A 4ZHQB 5EYPA 3FB8C 4TUYA 2IM9A 4DV4O 4JYAO 3ZN0A 3OFNG 2A3QA 3RYFA 4ZHQA 4P30A 3CE2A 3S3WA 1BQ0A 1AI4A 4O4JB 1XMOB 1HW7A 4FFKA 2JEXA 4B7KA 2IJIA 2GV9A 2ZM6B 1QBZA 3ZHRA 2JK5C 2PF4E 2P90A 5LYJB 2H3OA 1SQGA 4O4JA 4K3AA 4RWUA 1YTFB 1TAEA 4KFMA 3K59A 1COWG 5L3CA 5LYJA 3SYOA 1N34B 2UXDB 3AG2C 1BCCH 3E8HA 4LF7O 3T4ZA 3CJHB 4KHPO 1V54C 3E83A 4JYCA 4K8XA 2BTQB 1M5IA 3SJQC 1GN6A 2P7TC 1AJPA 2QKSA 5LOVB 4RUEA 3CJHA 4EFEA 3ASOC 1L0NH 3DTUB 4LH6A 4DR2B 1SESA 2CH7A 5LOVA 4WF9V 2F43G 4IHJA 2ZE6A 1EN4A 3ZHVA 3L72H 5CA0B 1MSWD 1M4UA 1MZFA 1H2GA 2IH3C 2XHBA 4X66B 1IURA 3IC7A 3CRAA 3TETA 3M7MX 2Y0PA 2ZNJA 1AROP 1R6NA 1Y74B 4AI8A 4DW1A 5GW7A 1AJNA 4IYIA 1VIBA 2BE3A 3K06A 1D5AA 3OR7C 1BT8A 1WP7A 4NXMO 4HZ3A 3MD0A 3TCUA 2JIZG 1XNRO 3BFRA 3JAKB 2EIKB 3K08A 1IBMB 4QE7A 4AQYO 4DR7O 4CH4A 3JAKA 4CBCA 5KHGA 4UCOA 2D2CB 3FAVB 3FYIB 3SPIA 3X2QC 1Q6HA 2YS8A 4MVQA 4DR1O 3ZRWA 3RFRA 4NXMB 3P32A 2RNBA 3FYEB 4Z1VA 3LDDA 5GTIZ 4JV5O 3I56V 2HP8A 2EZPA 2HEPA 3FAVA 3TGUH 2Y69C 4JAAA 3RBZA 1XNRB 2DYSC 2XAJA 4MW8A 4FLUA 1NR1A 3QF7A 1BSMA 4I0XA 4DXWA 4EKWA 1F4NA 4UV8A 1LNQA 4DUYB 1FXKC 4UUJC 3LSQA 3T1HB 2JVDA 4UB6Z 3WG7C 2OYQA 4DR1B 4X1IA 1EBOA 5KHHA 1UPGA 1V55B 3BVOA 3HKBB 3H1HH 4D7TA 2ITDC 3SGIA 2W6JG 1GN3A 4W4KA 4JV5B 5EBWC 1BHAA 4DR6O 4LF8O 2UUCO 4H33A 1I94B 3HKBA 3ZMTA 1OCCC 2VWKA 3ZX6A 4XDJA 2DQ3A 4P9PA 2MW2B 1G6UA 1US6A 1NJIW 4IIJB 4G2KA 1JQ0A 1E1QG 5LL6Y 1BQZA 3F5TA 5FPRA 4DR6B 1FYJA 4OX9O 4WCEV 2V7QG 3IGAC 4B08A 3FX7A 5CBFA 5CA3A 4DW0A 4PA3A 5LP6C 4HBNA 1DTOA 3CHXA 4KL1A 4U3FH 4KXRA 4LF4O 4JI6B 1BE3H 3AK2A 1N0NA 3KZIZ 5JJEB 5BR8O 1X4TA 1ZUQA 5JWPA 3DC6A 2RN9A 3SJBC 4OX9B 1AB3A 3CCVV 2P06A 4FM2A 5LMNB 2YXLA 1IX9A 4LFAB 3AG1C 4OGQB 2P4KA 2Y4TA 3OUFA 4LCUC 3M8AA 4LF4B 3B4SA 3OM3B 1J5EO 1KB9F 3TK1A 2ZDIC 4J9YB 2R72A 4O2BB 1VQMV 2EX3A 1VMGA 4AILC 1KP2A 5B1BC 1YI2V 3EHBB 3ZRVA 3CXHF 3E8FA 3FB5C 1VQPV 5GONA 1NH2B 4O2AB 3U0ZA 4O2BA 3APQA 4X65B 4JF3A 5B66Z 2GUZB 4FLYA 3Q4HA 1K4DC 1KECA 4O2AA 3N2GB 1M9NA 4JPRA 1TUBA 3ICXA 3ZBHA 2GUZA 1YVWA 5F2VO 5D5QA 3N2GA 3OMNB 4OXSA 4JI0O 4X62O 1TGOA 3OTFA 2GHYA 2GTAA 2PTMA 1XL6A 4JAVA 2V4DA 3K03A 2XUMA 4X64B 4JI7O 5BMVB 2JGUA 1XOUA 2LW1A 2ZQMA 4NXNB 2QEXV 4TT3G 1NTZH 5KHIA 4AHCA 5BMVA 2QR4A 4LWSB 3DXRB 1VQOV 4DV5O 3LSUA 3LUTB 3QO8A 4DO2A 4X62B 1M57C 1GKFA 1YTFD 3JASB 5EIBD 3ZRSA 2ZNIA 1JMKC 1SQFA 1I08A 4UCTA 1OZ0A 3D36A 4LWSA 3DXRA 1B3QA 4JI7B 3L74H 4YY3O 2EJRA 3VOUA 2Q68A 1N4CA 3JASA 2YI8A 3OW2U 3E22B 5E79Z 2CTWA 3JCZA 1VQ9V 1AP5A 4J10A 1W0KG 1H2MA 3ABMC 4DV5B 4WFFA 4FVMA 1O9HA 1KUQA 3E22A 4KP4A 1XQ8A 1Q8IA 3QG5A 3ABKB 1OHHG 4DK1A 5BZBA 4JI5B 1OCZC 3CEIA 5DM6V 3HKCA 3K57A 3JD3A 5IYDO 1SQVH 4R7CA 1M56C 1PM9A 1YSCA 4J9ZB 1K97A 5IYBO 1Q86W 3CSXA 1QR9A 1Z2GA 2ATKC 2JJ2G 4X1KB 1SF9A 5LBQA 2ZR3A 5B5EZ 3OMIB 3THOA 1K8AW 4B3SB 4CH3A 2XOKG 1YJ9V 1AR4A 4X1KA 5TISZ 3SR2C 2F93B 5IYCO 1KMIZ 5LMUO 4DV1O 1VF6A 3B8NA 3ABUA 2LP7A 1JPXA 4JYYA 1YDXA 4FM0A 2OWOA 2EULA 2PGGA 5KX5B 1MMMA 2K1EA 5C8YA 3HR0A 2DMXA 2XAFA 2YIBA 1VQLV 1CPYA 5IJ9B 4O4LB 1Q5OA 1AI5A 1SKVA 5KHJA 1K73W 1ZWIC 2EIMB 3T1CA 5LMUB 5K1PA 3KG2A 1R6TA 4GX2A 4DV6B 3K9SA 5IJ9A 2EIJB 2Q67A 3K5OA 4D6TH 3CYOA 1BL8A 3C90A 3RGBA 3N2KA 1N36O 1W0JG 2L35A 1VQNV 3LNNA 2QE7G 5LGUA 3T1YB 3PN1A 4EEQA 4RAIA 5L3DA 2E3CA 1KC8W 5J9PC 3RYCA 1H2LA 2HKOA 3FFQA 3K0DA 4N21A 3A0HZ 4JI3O 3K04A 4LF9B 1AR1B 4PI2A 3WG7B 3E8GA 2WLLB 4QGPA 2X6CA 3ABLC 2ZE8A 1EZVH 2LFSA 4RUFA 4FLTA 2Y4UA 1Q6UA 2B5UA 3EXAA 5B1AC 4IGGA 4E2LA 4DR4B 1OCOB 3IAYA 2WLLA 3G80A 3L73H 4GYCB 4UCRA 4UXNA 3ETDA 1MNGA 2WSSG 2F23A 2ILMA 1HR0O 1QVFU 2UU9O 2HJFC 2LGWA 1QQCA 4UVCA 2Q6AA 2UUAO 1RP3B 1GM7A 2VRZA 3K5LA 1I5YA 3A8TA 2X6AA 3SYQA 1JJOA 1DGSA 1NTKH 3SDLA 3D3IA 3ETQA 1Z5WA 4LFBB 1Q82W 3E89A 3JD0A 5DEDA 5B3SB 2Q7EA 1Q7YW 2W0XA 4PJ0Z 2UU9B 4EFBA 3CD6V 2B9ZA 4DV4B 1E79G 4JYAB 2UUAB 2DYRB 3H1JH 1O9GA 4J11A 2QTSA 1JOYA 4EB6B 1CXZB 1KU9A 2ZE7A 1GAXA 4PA7A 1F51A 1R3LC 3CMEV 4CS3A 1NQTA 5BY1A 2OTJV 3K79A 2QWNB 3OMAB 1P4RA 5KUKA 4EB6A 3RYIB 4U3JB 5A2QN 1XHZA 2UXCO 1WNSA 5JCOC 3JAMN 2QA4V 4PA4A 2R9AA 4IYHA 5LXTB 3AK1A 4YJ3B 4YHHO 1AI7A 4U3JA 1NH2D 3O65A 2BTQA 3ZHQA 3ZHSA 4GCZA 3ZRXA 1R3IC 5LXTA 4UCVA 3OUSA 2RJZA 3B8MA 4O4HB 4LF7B 1HNZO 3HKDB 2WA4A 4KHPB 1H8EG 1IDSA 1IBLO 4XBFA 3CC7V 2UXXA 2NR5A 1URFA 4DV0O 2Q0AA 2KQXA 2QWPB 4DUZO 2UXCB 4O4HA 2VQEO 1H2SB 5LGNA 3LDCA 2ZIOA 3UO2A 2HFEC 5CA0A 3HKDA 4LFCO 2CE4A 4YHHB 2G38A 5IT9N 4DR5O 2P5OA 5EC2C 3H1KH 1EN5A 1Y74A 4QIWF 1SS3A 5FLXN 3CCJV 3D3QA 4X1YB 4LBEC 4FLWA 2FMLA 4I9WA 1WA8B 3A2FA 2NNUA 1HNZB 4CC6A 3CP1A 1XMQO 2ZR2A 1S3JA 1LUVA 1XREA 3S3XA 2GTSA 1PNLA 3VQVA 4DV0B 4X1YA 1L1FA 1WJZA 1PNKA 1WA8A 2XTAA 1GN4A 4LFCB 5IYZB 2ZXWB 2P67A 3M99B 1WB8A 3AG3B 3A0BZ 3UQ8A 1CEZA 1ZX3A 2XNDG 2F1MA 3GVMA 4ZKIA 1QCEA 1YIJV 1F23A 1N8RW 2K9PA 3MDSA 3DC5A 4GT1A 2CTRA 4X9QA 2UUBO 4OPHA 2Q4PA 3ASNC 3WU2Z 1M57B 2FKXA 5BXZA 4LH7A 4AQYB 1HWYA 1EN6A 4DR7B 1GK9A 2JRIA 1S76D 5KA6A 1KBHA 2CTQA 3ZHUA 2GBOA 1QLEB 3JCUZ 1I0HA 4ZI7B 2KKWA 1GN2A 3QVNA 2QWQB 2KG7B 1NKDA 2XAHA 4LP8A 1VQKV 1RPRA 2WLHA 3AG4B 4ZI7A 1QVGU 2UUBB 3F5WC 4F6RB 2KG7A 1TVKB 3SJAC 1OCRB 3P3NA 4K35A 1Y76B 1VQ4V 1UJWB 2PI4A 2A06H 3I55V 3IC9A 4ZOLB 3UT5B 1TVKA 4TV9B 1Q3EA 5B1NA 3SPHA 2FYUH 2X6BA 3T4DA 1Y76A 4R8CA 4A5UB 3UT5A 2DOSA 3HPLC 4LF8B 4IIJA 4TV9A 2UUCB 4C7UA 4JI8O 4FLVA 5LHGA 2IBZH 3OR6C 5IY5B 2YIBD 3BRCA 2H8PC 2HG5C 2F4VO 5L3EA 2C2AA 4MS2A 1ROPA 2QTOA 2HR3A 2ODMA 4FMTA 2WA3A 5K1XA 1E1RG 4DRXB 3H1LH 1UFIA 3LDEA 1N32O 4ASUG 3NXSA 5JJJB 4MVUA 3T2MA 4J41A 1U96A 3R66A 5CBHA 2V1DA 4JI8B 1S77D 4B7EA 2HHHO 5EIBC 4Q6GA 5L3GA 2WPDG 3BAAA 4MTGA 5CBGA 3CRRA 4ZIBA 3QO5A 2F4VB 4Z2WA 2Z3YA 4GX5A 1NS1A 1KKCA 3STZC 4I4TB 4PV1B 1MABG 3ZMSA 1N32B 5BR8B 3RWRD 2ZIMA 3WB1A 2Q5ZA 1FFTB 4FFBB 4HYOA 1AVMA 4TQDA 1RM1B 2MK3A 3KKYA 2HHHB 1FJGO 1D5NA 4FFBA 2OIEA 3UCSC 1Q81W 3G4SV 3CS5A 3GWKC 3LSSA 5EK0A 4X8AA 2VWJA 1RFYA 3CCSV 4NYKA 1SRYA 2QM4A 4QPKA 1J5EB 1QU7A 2D3OW 1JVMA 2VS0A 3OGCC 1XBLA 3K58A 1XDCA 4UB8Z 1DK1A 4I55B 4JTDB 2CGOA 1NU1H 4GX0A 3ZEDA 4QE9A 4PDRA 1SETA 2N05A 3OTOO 2DWDC 5EZYB 1Y66A 1YHQV 2EIKC 3F7VC 1OJHA 3I5DA 5C93A 5LGTA 1RPOA 4CS2A 4JI4O 1BZKA 4DV7O 4JI0B 2JS3A 1MG1A 1MSDA 5EZYA 3CRQA 2P4VA 4WFBV 4TSFG 3DGEA 3L9DA 2A0LA 1PNMA 3KCYA 4JI1O 3E35A 5KAIZ 2ZT9B 1S5LZ 1R6KA 3QNEA 4UVBA 1ZL8B 5EC1C 4XDKA 4GKKO 4WBNB 3NR7A 3RT3C 4MVSA 4PDMA 4B3TO 1KP3A 1R1BA 1IBKO 1K7DA 1ZL8A 2YEVB 4JI4B 1H2KA 2EZOA 2LJ2A 4WBNA 2LW7A 2WLMA 4CH5A 2QSAA 3AG2B 2YIDA 3FB6C 3SYAA 2AZ2A 4WFHA 1XHXA 5CN0A 1V54B 4JTCB 3WFVA 1V55C 2YEVA 1FXVA 1TA8A 4YJ2B 1PL0A 4F6EA 4YY3B 4GLXA 1KD1W 1I7FA 3W7XA 5KUMA 3H01A 4TWKA 3ASOB 4G27B 4B3TB 2EILC 1IBKB 4X20B 1HNWO 4YJ2A 2N74A 4J7JA 4RQFA 3SYCA 2PYLA 1X59A 1P7BA 4IL6Z 1XEQA 4X20A 2YXHA 3ZMZA 1XI1A 2M6YA 2DN9A 2WAMA 3FB7C 3ZMVA 1NBMG 1SQBH 1V9PA 2IJJA 2PYJA 3CRMA 2R9RB 1B04A 1JFFB 3VQWA 4DYLA 1HNWB 5B1OA 4GKJO 1HNXO 1HP8A 2CK3G 2XT9A 4DV3O 1JFFA 2N04A 1N33O 3R65A 4MVMA 4LF5O 4PI0A 1I5XA 3BABA 1WN7A 1NR7A 5KX5A 3G67A 1NI8A 3K5NA 1QLNA 3OEEG 5EBLC 1YCIA 3K9AA 4DV1B 2Z0AA 2BCCH 3STLC 1SC5B 4JASA 1YZBA 2QWRB 4O4LA 3CCUV 4KUMA 3X2QB 3GWOA 4FZ0A 5JH7B 4ICGA 4PHZA 5EBMC 1N33B 2AHYA 1YJNV 5KA5A 2Y69B 2Q69A 1Q90D 2HVKC 5KAFZ 2XAGA 2DYSB 4DK0A 3ASNB 3HKEB 4UVAA 4B3RO 3D8CA 1BMFG 1W59A 2CGNA 2UXBO 3W7UA 4X89A 1WP8A 1FXKB 1S72V 3HKEA 1NTMH 1ORQC 2BOBC 2ZINA 1QNMA 5D5PA 2Q8VA 3J81N 1KYOF 4I7ZB
chains in the Genus database with same CATH topology
4LBEC 4CZZA 4PELA 1FXKA 1K92A 4I9WA 3UM7A 4U7NA 3ABTA 1GTOA 2IU3A 2NNUA 3CP1A 2ZR2A 1S3JA 3PJSK 1K34A 2OCCB 1PNLA 4P9OA 3AG4C 3CCLV 1JX9A 1OCCB 1ENVA 1L1FA 3CPWU 3CCVV 1PNKA 2AHZA 3JD1A 1M1KW 2IJHA 3CCMV 1OCRC 3CCQV 2ZXWB 2P67A 3AG1C 3M99B 4FK5C 4MTFA 3AG3B 2B1IA 3ZCCA 3OUFA 1K5SA 2ITCC 2B1GA 2P6JA 1EFRG 4LCUC 3RVZA 5LHIA 3G71V 1CEZA 2XNDG 4FPPA 4ZKIA 1QCEA 3OEHG 3OM3B 3JD4A 1YIJV 1F23A 3TK1A 2ZDIC 4J9YB 1N8RW 1JCHA 2DQ0A 3ETGA 3W7TA 4L87A 1B6QA 4GT1A 4MSWC 1VQMV 1KQSU 3JYCA 4RQEA 2BOCC 1KP2A 5B1BC 1YI2V 3EHBB 2QM7A 3ZRVA 3BY6A 2EINB 5H9CA 3ASNC 1M57B 4LC1A 3E8FA 3FB5C 1VQPV 1NH2B 3E8BA 3CC4V 1WPXA 4GX1A 1FXHA 2IW5A 4XDLA 1GM8A 4JYBA 1HWYA 1GK9A 3RW0A 1S76D 5KA6A 2WLNA 5IY5C 3MHSC 2JJ1G 1QLEB 4JF3A 3RVYA 1K33A 1K4DC 1VQ6V 1KECA 4FIPC 1M9NA 3HB3B 1NKDA 4JPRA 2XAHA 4LP8A 1VQKV 1RPRA 2KB1A 3B77A 2QM8A 2WLHA 3AG4B 1QVGU 3OAAG 4G28B 3SPJA 4QJFB 2OCCC 3OMNB 4OXSA 2OT5A 3F5WC 4MTXA 1OCRB 2GHYA 4PDLA 4U7OA 3AG1B 1VQ4V 1XL6A 1UJWB 4JAVA 4MVRA 2PI4A 3BEHA 3I55V 4JTAB 3K03A 1FS0G 4MVOA 5HFLA 3ETEA 5B1NA 3SPHA 3ABKC 2ZQMA 3K0GA 2X6BA 3T4DA 1PD3A 4R8CA 3ZJZA 5L3BA 2A79B 2JEUA 5B1BB 2QEXV 4TT3G 5LHHA 4F4LA 1K4CC 2XAQA 3CCRV 3HPLC 2ZDIA 2XASA 1VQOV 3LUTB 2EINC 3QO8A 4DO2A 1M57C 1NVPD 5LHGA 2A9HA 4MT8A 1RM1C 3ML0A 3OR6C 1GKFA 5IY5B 1YTFD 3CC2V 1DF4A 2H8PC 3ZRSA 5HFMA 3W7WA 1R73A 2HG5C 5L3EA 1OZ0A 2C2AA 3D36A 4MS2A 1ROPA 3LNMB 3UKMA 2QTOA 4R50A 2HR3A 4FMTA 1E1RG 5IDJA 2EJRA 3VOUA 2Q68A 4RO2A 3VBBA 4I5SA 1JJ2U 1H38A 3LDEA 1AI6A 2WLIB 4ASUG 1K3EA 3SPCA 3OW2U 3NXSA 5H6QA 3JCZA 2GSMB 4MVUA 3T2MA 4MTOA 4BW5A 2X7RB 1VQ9V 1W0KG 5CBHA 2V1DA 4QNHB 1S77D 3ABMC 4X88A 4WFFA 3SYPA 2WLIA 3ZIAG 2Y48A 1GMGA 2LFRA 4PDVA 1M90W 4KP4A 5L3GA 1GM9A 1DF5A 2WPDG 4MTGA 5CBGA 4BAYA 4MW3A 3QO5A 2YSUB 1K5QA 3ABKB 4N23A 1OHHG 4ZBMA 2Z3YA 4GX5A 1G8MA 1VQ8V 3STZC 5BZBA 2IJKA 1G4YB 1OCZC 5DM6V 1MABG 3ZMSA 3EFFK 3JD3A 1W2BU 3ZRWB 5IYDO 2EBOA 2EIMC 2W6IG 2R9IA 3MHHC 1FFTB 3FB8C 4R7CA 1M56C 1YSCA 4J9ZB 1DLBA 1K97A 2EIJC 4HYOA 5IYBO 3ZN0A 1RM1B 1Q86W 1QR9A 3OFNG 2MK3A 4WFEA 5H6RA 1THZA 2ATKC 2JJ2G 5LBQA 3E86A 2ZR3A 4WFAV 1J95A 3OMIB 3P30A 4P30A 1K8AW 1GO3F 1WLEA 5FL7G 1Q81W 2XOKG 4H37A 3G4SV 1AI4A 1YJ9V 1XL4A 3LSSA 1S5HC 2JEXA 5EK0A 4X8AA 2IJIA 3CCSV 1SRYA 4QPKA 5IYCO 1QBZA 2JK5C 2P90A 2D3OW 3B8NA 1JVMA 1NVPB 3ABUA 2LP7A 4P2ZA 1JPXA 3ABMB 1YTFB 3OGCC 4JGSA 4KFMA 1COWG 5L3CA 5DN6G 4JTDB 3SYOA 4Z1MG 1MOFA 3AG2C 4GX0A 2K1EA 4QE9A 2HLDG 1SETA 3E8HA 4PDRA 1S0VA 3T4ZA 2XAFA 1VQLV 1CPYA 3W7SA 1V54C 2DWEC 1AI5A 1AJQA 2Z5UA 1OCZB 2UXNA 3E83A 4JYCA 1K73W 1OCOC 2DWDC 3SJQC 2P7TC 1ZWIC 2WWWA 1Y66A 1AJPA 2EILB 2EIMB 1YHQV 3T1CA 3IFXA 2QKSA 2EIKC 3F7VC 3SPGA 1YITV 5C93A 3KG2A 4RUEA 4GX2A 5LGTA 1M56B 1RPOA 3ASOC 4BIZA 3DTUB 2EIJB 2Q67A 1R3KC 2OTLV 3CYOA 1MG1A 1BL8A 2WLKA 1TUEB 4WFBV 4TSFG 1SESA 3DGEA 4WF9V 2A0LA 2F43G 1PNMA 1W0JG 4Q20A 3E35A 1VQNV 2QE7G 5LGUA 1K9MW 1MSWD 1R6KA 3QNEA 1H2GA 2IH3C 4RAIA 4UVBA 3GB7C 1SERA 3IC7A 5EC1C 3TETA 4XDKA 5L3DA 1KC8W 2NLJC 4JAUA 1AROP 1R6NA 5J9PC 4MVSA 4PDMA 1IXMA 5B3SC 1KP3A 1PKXA 2HKOA 3K0DA 1K7DA 5GW7A 1AJNA 3OE7G 4N21A 2X0LA 3K04A 3K06A 2YEVB 3OR7C 2EZOA 1AR1B 2WLMA 3WG7B 3E8GA 3AG2B 2WLLB 2DYRC 2DW4A 3FB6C 2X6CA 4HZ3A 3SYAA 3ABLC 4WFHA 1VQ7V 5CN0A 2LFSA 4RUFA 1V54B 3MD0A 4JTCB 3TCUA 3WFVA 1V55C 2JIZG 2YEVA 2B5UA 1FXVA 5B1AC 4E2LA 1OCOB 2H94A 1PL0A 2WLLA 4MVZA 1BHBA 2EIKB 3K08A 4UXNA 4QE7A 3FKSG 1KD1W 1CP9A 3ETDA 3W7XA 5KUMA 3H01A 4TWKA 3ASOB 4G27B 2EILC 2WSSG 3F7YC 1QVFU 2HJFC 4CBCA 2PI5A 4UVCA 2Q6AA 3JD2A 1GM7A 4RQFA 3FYIB 3SPIA 3X2QC 3SYCA 1I5YA 1P7BA 4MVQA 3G6EV 1QR8A 3ZRWA 2X6AA 4QPJA 3SYQA 3P32A 4FJCC 3FYEB 3D3IA 3LDDA 3I56V 3ZMZA 2EZPA 3A0RA 2WAMA 2Y69C 3FB7C 3RBZA 1NBMG 3ZMVA 1Q82W 4BIUA 2M7WA 2IJJA 2DYSC 1H8HG 2XAJA 4MW8A 3E89A 3JD0A 4UV9A 1NR1A 5B3SB 2R9RB 1F4MA 1Q7YW 1R3JC 4DXWA 5L3FA 3CCEV 1Y4MA 3CD6V 4EKWA 5B1OA 1F4NA 4UV8A 1E79G 1LNQA 1FXKC 4UUJC 2CK3G 2DYRB 4PA6A 3LSQA 3ABLB 1JOYA 2FTKA 3WG7C 3R65A 1EBOA 1V55B 4HAMA 1F51A 4MVMA 4PA7A 1R3LC 5B1AB 2ITDC 1I5XA 3CMEV 2W6JG 1NQTA 4PA9A 5EBWC 2OTJV 3K79A 1BHAA 1NR7A 3OMAB 1P4RA 4R6ZA 5KUKA 1SZTA 4WFGA 4H33A 1QLNA 3OEEG 5EBLC 5E1AC 3K9AA 3ZMTA 1OCCC 4PA4A 2QA4V 3STLC 4JASA 1KKDA 2IU0A 3CXCU 1VQ5V 5CMUA 3CCUV 1AI7A 4KUMA 3K3WA 3X2QB 1NH2D 3GWOA 2HVJC 4XDJA 2DQ3A 2ZXWC 4P9PA 5EBMC 3AEIA 4GCZA 3AG3C 1NJIW 3ZRXA 1R3IC 4G2KA 1JQ0A 2AHYA 3OUSA 3E2EA 3B8MA 1YJNV 1E1QG 5KA5A 2Y69B 2Q69A 2HVKC 2XAGA 1H8EG 2DYSB 4YXWG 4XBFA 2UXXA 3ASNB 3CC7V 4UVAA 1YJWV 4WCEV 2V7QG 3IGAC 3ZMUA 1BMFG 2W0FC 5LGNA 2WLJA 3LDCA 3QO7A 2HFEC 4X89A 3W7UA 3CMAV 3CCJV 5CBFA 3ZN1A 5CA3A 1FXKB 1S72V 4PA3A 1ORQC 2BOBC 1DTOA 5EC2C 2JDIG 4QIWF 2ZD9A 1QLEC 1EZJA 2IH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CN0 A;  1Y4M A;  1JPX A;  2OT5 A;  3WFV A;  4JGS A;  1I5Y A;  3K9A A;  1QR8 A;  2P6J A;  5KA6 A;  4N23 A;  4E2L A;  3MHS C;  3P30 A;  3CP1 A;  4FJC C;  1QCE A;  5CMU A;  1K34 A;  4JF3 A;  1F23 A;  1K33 A;  1MOF A;  2EZP A;  3GWO A;  3CYO A;  1MG1 A;  1EBO A;  4N21 A;  1ENV A;  2X7R B;  4FIP C;  3H01 A;  5HFL A;  2M7W A;  1I5X A;  2EBO A;  1DF4 A;  2EZO A;  4JPR A;  4G2K A;  3MHH C;  1QBZ A;  1JQ0 A;  5HFM A;  5H9C A;  3B77 A;  3B8M A;  5KA5 A;  1DLB A;  3B8N A;  1SZT A;  1QR9 A;  2MK3 A;  3M99 B;  2LP7 A;  1DF5 A;  4FK5 C;  1Y66 A; 
#chains in the Genus database with same CATH topology
 2O57 A;  1N36 B;  2QDO A;  1FXK A;  1K92 A;  3BHP A;  3UM7 A;  4CH6 A;  2LO1 A;  1GTO A;  1K34 A;  4JI2 O;  1JX9 A;  1OCC B;  1ENV A;  3CPW U;  2AHZ A;  3JD1 A;  4BR6 A;  1M1K W;  2UXB B;  2Q7G A;  3CCM V;  1ZTE A;  4DR3 O;  5JJN B;  4JI3 B;  4MTF A;  1L0L H;  3K5M A;  2P6J A;  3RVZ A;  3CB2 A;  2ZM6 O;  4FPP A;  3JD4 A;  4L87 A;  1B6Q A;  4MSW C;  3B40 A;  1A32 A;  3JYC A;  1EM1 A;  2BOC C;  3RYF B;  2ETN A;  4DV2 O;  4JI2 B;  2AW9 A;  3BY6 A;  5H9C A;  3D36 C;  3CC4 V;  1WPX A;  4GX1 A;  2IW5 A;  1PV0 A;  4XDL A;  4D7S A;  1N34 O;  2UXD O;  5LP6 B;  1HR0 B;  4DR3 B;  2JJ1 G;  1PL4 A;  1WPB A;  3RVY A;  2E5L O;  2NN4 A;  4H44 B;  4H0L B;  2JGD B;  5LP6 A;  1D2D A;  2CDY A;  2R70 A;  3B77 A;  1Y6X A;  3OAA G;  4G28 B;  2RCV A;  3SPJ A;  4QJF B;  2OCC C;  4DV2 B;  2JGD A;  2OT5 A;  4W4L A;  3WB2 A;  1JA8 A;  4DR2 O;  4LNU B;  3RYH B;  2QKC A;  4MTX A;  4NKG B;  5J2U B;  5CA1 B;  3AG1 B;  2FL4 A;  4MVR A;  3RYI A;  3BEH A;  1G1X B;  4MVO A;  5HFL A;  5IWA O;  4X66 O;  4B3M O;  3ETE A;  4LNU A;  3RYH A;  3C3S A;  2E5L B;  3ABK C;  5J2U A;  4YJ3 A;  5CA1 A;  1U97 A;  1PD3 A;  3ZJZ A;  1M93 A;  4NTY A;  1P7G A;  2A79 B;  2JEU A;  2CH7 B;  5B1B B;  1K4C C;  4IHJ B;  3CCR V;  2RDC A;  2ZKO A;  2RMK B;  4CC5 A;  2ZDI A;  2XAS A;  2EIN C;  2YXY A;  2A9H A;  3ML0 A;  1SQQ H;  2BSK B;  3CC2 V;  1DF4 A;  4ABM A;  3LNM B;  5IWA B;  1VF6 C;  4B3M B;  5IDJ A;  1IBM O;  2BSK A;  4I5S A;  3TXS A;  3QTC A;  3EVK A;  1AI6 A;  1SQX H;  2LQT A;  5J2T B;  3U11 A;  1IBL B;  4BW5 A;  5IE9 A;  4I9Q A;  1IXB A;  1Q43 A;  4DUZ B;  4QNH B;  4X88 A;  2VQE B;  3SYP A;  3B09 A;  1GMG A;  2LFR A;  5J2T A;  5ITZ B;  2EJ7 A;  1GM9 A;  2QWO B;  4DR5 B;  4MW3 A;  1AP6 A;  1P84 F;  2YSU B;  4ZBM A;  5DEC A;  4K8Z A;  5ITZ A;  5IYZ A;  2E75 B;  1JR9 A;  3ZRW B;  2P22 C;  2EBO A;  2EIM C;  1XMQ B;  2W6I G;  2R9I A;  3MHH C;  5KHK A;  1LUW A;  4DUY O;  1DLB A;  2EIJ C;  4WFE A;  5H6R A;  2ADP A;  1THZ A;  3T1H O;  3E86 A;  1ZLZ A;  3L70 H;  4WFA V;  1J95 A;  4I0X B;  3P30 A;  4UCS A;  1GO3 F;  1WLE A;  2A7W A;  3BA8 A;  2HJD A;  5FL7 G;  4H37 A;  1XL4 A;  2E76 B;  1S5H C;  1ZSP A;  1I94 O;  2LGQ A;  4NB5 A;  1VF7 A;  4X1I B;  4I50 B;  1NVP B;  4P2Z A;  4BIO A;  1T5E A;  2YC0 A;  3ABM B;  3FD9 A;  4JGS A;  1FAF A;  1BGY H;  4FM1 A;  3G6B A;  5DN6 G;  2JS5 A;  2KSD A;  4Z1M G;  1MOF A;  3UO3 A;  3IJ4 A;  4I50 A;  2HLD G;  1WAZ A;  1S0V A;  1WB7 A;  2YIA A;  2CTP A;  3JAW B;  3W7S A;  3L75 H;  4F6R A;  2DWE C;  1FPO A;  1AJQ A;  2Z5U A;  1OCZ B;  2Q9L A;  2UXN A;  5JQG B;  1OCO C;  2WWW A;  2EIL B;  3IFX A;  3SPG A;  1YIT V;  4ZOL A;  5FPO A;  3JAW A;  1M56 B;  1YF2 A;  4BIZ A;  1FKA O;  3L71 H;  5JQG A;  4E4E A;  1R3K C;  2OTL V;  4OPA A;  4GZR B;  2WLK A;  1TUE B;  4JI6 O;  1VAR A;  4Q20 A;  1FD9 A;  1K9M W;  2Q7H A;  3GB7 C;  2ADQ B;  3TXQ A;  1SER A;  2CAZ C;  2NLJ C;  2PUS A;  3BA9 A;  4JAU A;  5LMN O;  1IXM A;  5B3S C;  1S5J A;  3ZS8 C;  1PKX A;  4LFA O;  3H9V A;  1VEW A;  3OE7 G;  2X0L A;  3O9O A;  4L8J A;  4DRX A;  2DYR C;  1BS3 A;  2DW4 A;  4IT5 A;  2E74 B;  1VQ7 V;  5AG2 A;  4UCU A;  2H94 A;  4UFZ A;  4MVZ A;  1BHB A;  1H2N A;  3FKS G;  4LF6 O;  1CP9 A;  4NTW A;  2F95 B;  3F7Y C;  2Q0O C;  2YUA A;  4X65 O;  4O4I B;  2PI5 A;  3JD2 A;  4I4T A;  4PD4 F;  3OD4 A;  3H1I H;  3G6E V;  1PPJ H;  2ZCE A;  1QR8 A;  4QPJ A;  4J7K A;  4FJC C;  2YI9 A;  1B06 A;  5GON B;  4O4I A;  1SZX A;  3A0R A;  4BIU A;  2M7W A;  1H8H G;  2PY5 A;  4UV9 A;  4BW9 A;  1F4M A;  4LF6 B;  1ZAU A;  4YIP A;  3Q4H B;  1R3J C;  1L8D A;  4H13 B;  5L3F A;  3CCE V;  1Y4M A;  5IJ0 B;  1QHT A;  2YDE A;  1TUB B;  2OCH A;  3SJC C;  4X64 O;  4PA6 A;  3ABL B;  2FTK A;  1MZE A;  1LR1 A;  2OIG A;  5H2F Z;  2Y0I A;  4NXN O;  4HAM A;  1YXB A;  5B1A B;  5IJ0 A;  1P49 A;  2FB5 A;  1FJG B;  4PA9 A;  3AG7 A;  4NTX A;  3MAQ A;  4R6Z A;  4I55 A;  2ARH A;  1SZT A;  4WFG A;  3TJT A;  5JVD B;  5E1A C;  5CB4 B;  1KKD A;  2IU0 A;  3CXC U;  1VQ5 V;  5CMU A;  3K3W A;  2AXT Z;  3VQY A;  2HVJ C;  3CWB H;  2AZ0 A;  2YIC A;  1GH6 A;  5JVD A;  2ZXW C;  3AEI A;  5CB4 A;  3JAL B;  3AG3 C;  3U10 A;  5H5N A;  3E2E A;  1YEW A;  3B2E E;  3OTO B;  4YXW G;  3JAL A;  1SA0 B;  2DJV A;  3APO A;  1YJW V;  4J7Z A;  3J80 N;  3ZMU A;  2ZE5 A;  4TV8 B;  2W0F C;  1SQP H;  2WLJ A;  3KCX A;  3QO7 A;  3CMA V;  3ZN1 A;  1SA0 A;  4DV7 B;  2JDI G;  3BCC H;  4TV8 A;  1RSO B;  2ZD9 A;  1QLE C;  1EZJ A;  1FFX B;  2IH1 C;  4JI5 O;  2AGA A;  4CZZ A;  4JI1 B;  4PEL A;  3P3P A;  3C3T A;  4U7N A;  3ABT A;  2IU3 A;  1NZ6 A;  1RSO A;  2OCC B;  3PJS K;  2QGN A;  2QJ1 A;  1FFX A;  4P9O A;  3AG4 C;  3CCL V;  5A9G A;  4GKK B;  2VQF O;  2QKA A;  4HNA B;  3DSQ A;  2IJH A;  1OCR C;  4TQF A;  3CCQ V;  3HKC B;  5JCO A;  4B3S O;  4FK5 C;  2B1I A;  4J80 A;  3ZCC A;  1K5S A;  2ITC C;  2B1G A;  1EFR G;  4HNA A;  5LHI A;  3G71 V;  3OGI B;  3BPZ A;  3OEH G;  4CS4 A;  1PP9 H;  1Z5V A;  3JSL A;  4FLZ A;  1JCH A;  2DQ0 A;  3ETG A;  3W7T A;  1KQS U;  1N0J A;  4RQE A;  2QM7 A;  2EIN B;  4LC1 A;  2VQF B;  4YIO A;  3E8B A;  1FXH A;  1GM8 A;  4JYB A;  3RW0 A;  1F7Y A;  1IZ3 A;  1GRJ A;  2WLN A;  5IY5 C;  3MHS C;  4K0K O;  2Q73 A;  3JAR B;  1K33 A;  5GTH Z;  1VQ6 V;  4FIP C;  3HB3 B;  4JZG A;  4DV6 O;  2KB1 A;  2QM8 A;  2CUG A;  2L6L A;  5C8Y B;  3JAR A;  4J42 A;  4LR3 A;  1XNQ O;  4PDL A;  4U7O A;  1AIL A;  5LA6 B;  3CX5 F;  3T1Y O;  4JTA B;  1FS0 G;  4GUN A;  4GKJ B;  1HNX B;  4K0K B;  1Y67 A;  3JSN A;  1XUQ A;  4DV3 B;  5LA6 A;  3K0G A;  4FLX A;  4LF5 B;  5KLV H;  5L3B A;  3AK3 A;  2F66 C;  1MA1 A;  4TOI A;  1OV9 A;  2GDS A;  4F4L A;  5JH7 A;  2XAQ A;  3N2K B;  5LHH A;  4LF9 O;  3WB0 A;  4NR1 A;  1NVP D;  4MT8 A;  1RM1 C;  1VF5 B;  1XNQ B;  5HFM A;  4NVP A;  3W7W A;  1R73 A;  3UKM A;  1IVS A;  3RYC B;  4DR4 O;  5KMG B;  4R50 A;  4BWA A;  3N27 A;  1XIL A;  4RO2 A;  3RN4 A;  3VBB A;  1JJ2 U;  1H38 A;  2WLI B;  4JZ2 A;  1K3E A;  2PZS A;  3SPC A;  1NT2 B;  5KMG A;  3ZHT A;  5H6Q A;  2GSM B;  4MTO A;  2X7R B;  4B3R B;  3VQX A;  1AR5 A;  3JAT B;  2WLI A;  3ZIA G;  2Y48 A;  4PDV A;  1M90 W;  5FNV B;  3OT7 A;  1DF5 A;  3CRC A;  4BAY A;  3J7A U;  1HDJ A;  1K5Q A;  1XMO O;  4N23 A;  4LFB O;  3JAT A;  5EYP B;  4TUY B;  4FZ1 A;  1G8M A;  1VQ8 V;  2IJK A;  5FNV A;  1G4Y B;  2RQ6 A;  2BTO A;  3EFF K;  2DE0 X;  1Q6I A;  1W2B U;  1VP7 A;  4ZHQ B;  5EYP A;  3FB8 C;  4TUY A;  2IM9 A;  4DV4 O;  4JYA O;  3ZN0 A;  3OFN G;  2A3Q A;  3RYF A;  4ZHQ A;  4P30 A;  3CE2 A;  3S3W A;  1BQ0 A;  1AI4 A;  4O4J B;  1XMO B;  1HW7 A;  4FFK A;  2JEX A;  4B7K A;  2IJI A;  2GV9 A;  2ZM6 B;  1QBZ A;  3ZHR A;  2JK5 C;  2PF4 E;  2P90 A;  5LYJ B;  2H3O A;  1SQG A;  4O4J A;  4K3A A;  4RWU A;  1YTF B;  1TAE A;  4KFM A;  3K59 A;  1COW G;  5L3C A;  5LYJ A;  3SYO A;  1N34 B;  2UXD B;  3AG2 C;  1BCC H;  3E8H A;  4LF7 O;  3T4Z A;  3CJH B;  4KHP O;  1V54 C;  3E83 A;  4JYC A;  4K8X A;  2BTQ B;  1M5I A;  3SJQ C;  1GN6 A;  2P7T C;  1AJP A;  2QKS A;  5LOV B;  4RUE A;  3CJH A;  4EFE A;  3ASO C;  1L0N H;  3DTU B;  4LH6 A;  4DR2 B;  1SES A;  2CH7 A;  5LOV A;  4WF9 V;  2F43 G;  4IHJ A;  2ZE6 A;  1EN4 A;  3ZHV A;  3L72 H;  5CA0 B;  1MSW D;  1M4U A;  1MZF A;  1H2G A;  2IH3 C;  2XHB A;  4X66 B;  1IUR A;  3IC7 A;  3CRA A;  3TET A;  3M7M X;  2Y0P A;  2ZNJ A;  1ARO P;  1R6N A;  1Y74 B;  4AI8 A;  4DW1 A;  5GW7 A;  1AJN A;  4IYI A;  1VIB A;  2BE3 A;  3K06 A;  1D5A A;  3OR7 C;  1BT8 A;  1WP7 A;  4NXM O;  4HZ3 A;  3MD0 A;  3TCU A;  2JIZ G;  1XNR O;  3BFR A;  3JAK B;  2EIK B;  3K08 A;  1IBM B;  4QE7 A;  4AQY O;  4DR7 O;  4CH4 A;  3JAK A;  4CBC A;  5KHG A;  4UCO A;  2D2C B;  3FAV B;  3FYI B;  3SPI A;  3X2Q C;  1Q6H A;  2YS8 A;  4MVQ A;  4DR1 O;  3ZRW A;  3RFR A;  4NXM B;  3P32 A;  2RNB A;  3FYE B;  4Z1V A;  3LDD A;  5GTI Z;  4JV5 O;  3I56 V;  2HP8 A;  2EZP A;  2HEP A;  3FAV A;  3TGU H;  2Y69 C;  4JAA A;  3RBZ A;  1XNR B;  2DYS C;  2XAJ A;  4MW8 A;  4FLU A;  1NR1 A;  3QF7 A;  1BSM A;  4I0X A;  4DXW A;  4EKW A;  1F4N A;  4UV8 A;  1LNQ A;  4DUY B;  1FXK C;  4UUJ C;  3LSQ A;  3T1H B;  2JVD A;  4UB6 Z;  3WG7 C;  2OYQ A;  4DR1 B;  4X1I A;  1EBO A;  5KHH A;  1UPG A;  1V55 B;  3BVO A;  3HKB B;  3H1H H;  4D7T A;  2ITD C;  3SGI A;  2W6J G;  1GN3 A;  4W4K A;  4JV5 B;  5EBW C;  1BHA A;  4DR6 O;  4LF8 O;  2UUC O;  4H33 A;  1I94 B;  3HKB A;  3ZMT A;  1OCC C;  2VWK A;  3ZX6 A;  4XDJ A;  2DQ3 A;  4P9P A;  2MW2 B;  1G6U A;  1US6 A;  1NJI W;  4IIJ B;  4G2K A;  1JQ0 A;  1E1Q G;  5LL6 Y;  1BQZ A;  3F5T A;  5FPR A;  4DR6 B;  1FYJ A;  4OX9 O;  4WCE V;  2V7Q G;  3IGA C;  4B08 A;  3FX7 A;  5CBF A;  5CA3 A;  4DW0 A;  4PA3 A;  5LP6 C;  4HBN A;  1DTO A;  3CHX A;  4KL1 A;  4U3F H;  4KXR A;  4LF4 O;  4JI6 B;  1BE3 H;  3AK2 A;  1N0N A;  3KZI Z;  5JJE B;  5BR8 O;  1X4T A;  1ZUQ A;  5JWP A;  3DC6 A;  2RN9 A;  3SJB C;  4OX9 B;  1AB3 A;  3CCV V;  2P06 A;  4FM2 A;  5LMN B;  2YXL A;  1IX9 A;  4LFA B;  3AG1 C;  4OGQ B;  2P4K A;  2Y4T A;  3OUF A;  4LCU C;  3M8A A;  4LF4 B;  3B4S A;  3OM3 B;  1J5E O;  1KB9 F;  3TK1 A;  2ZDI C;  4J9Y B;  2R72 A;  4O2B B;  1VQM V;  2EX3 A;  1VMG A;  4AIL C;  1KP2 A;  5B1B C;  1YI2 V;  3EHB B;  3ZRV A;  3CXH F;  3E8F A;  3FB5 C;  1VQP V;  5GON A;  1NH2 B;  4O2A B;  3U0Z A;  4O2B A;  3APQ A;  4X65 B;  4JF3 A;  5B66 Z;  2GUZ B;  4FLY A;  3Q4H A;  1K4D C;  1KEC A;  4O2A A;  3N2G B;  1M9N A;  4JPR A;  1TUB A;  3ICX A;  3ZBH A;  2GUZ A;  1YVW A;  5F2V O;  5D5Q A;  3N2G A;  3OMN B;  4OXS A;  4JI0 O;  4X62 O;  1TGO A;  3OTF A;  2GHY A;  2GTA A;  2PTM A;  1XL6 A;  4JAV A;  2V4D A;  3K03 A;  2XUM A;  4X64 B;  4JI7 O;  5BMV B;  2JGU A;  1XOU A;  2LW1 A;  2ZQM A;  4NXN B;  2QEX V;  4TT3 G;  1NTZ H;  5KHI A;  4AHC A;  5BMV A;  2QR4 A;  4LWS B;  3DXR B;  1VQO V;  4DV5 O;  3LSU A;  3LUT B;  3QO8 A;  4DO2 A;  4X62 B;  1M57 C;  1GKF A;  1YTF D;  3JAS B;  5EIB D;  3ZRS A;  2ZNI A;  1JMK C;  1SQF A;  1I08 A;  4UCT A;  1OZ0 A;  3D36 A;  4LWS A;  3DXR A;  1B3Q A;  4JI7 B;  3L74 H;  4YY3 O;  2EJR A;  3VOU A;  2Q68 A;  1N4C A;  3JAS A;  2YI8 A;  3OW2 U;  3E22 B;  5E79 Z;  2CTW A;  3JCZ A;  1VQ9 V;  1AP5 A;  4J10 A;  1W0K G;  1H2M A;  3ABM C;  4DV5 B;  4WFF A;  4FVM A;  1O9H A;  1KUQ A;  3E22 A;  4KP4 A;  1XQ8 A;  1Q8I A;  3QG5 A;  3ABK B;  1OHH G;  4DK1 A;  5BZB A;  4JI5 B;  1OCZ C;  3CEI A;  5DM6 V;  3HKC A;  3K57 A;  3JD3 A;  5IYD O;  1SQV H;  4R7C A;  1M56 C;  1PM9 A;  1YSC A;  4J9Z B;  1K97 A;  5IYB O;  1Q86 W;  3CSX A;  1QR9 A;  1Z2G A;  2ATK C;  2JJ2 G;  4X1K B;  1SF9 A;  5LBQ A;  2ZR3 A;  5B5E Z;  3OMI B;  3THO A;  1K8A W;  4B3S B;  4CH3 A;  2XOK G;  1YJ9 V;  1AR4 A;  4X1K A;  5TIS Z;  3SR2 C;  2F93 B;  5IYC O;  1KMI Z;  5LMU O;  4DV1 O;  1VF6 A;  3B8N A;  3ABU A;  2LP7 A;  1JPX A;  4JYY A;  1YDX A;  4FM0 A;  2OWO A;  2EUL A;  2PGG A;  5KX5 B;  1MMM A;  2K1E A;  5C8Y A;  3HR0 A;  2DMX A;  2XAF A;  2YIB A;  1VQL V;  1CPY A;  5IJ9 B;  4O4L B;  1Q5O A;  1AI5 A;  1SKV A;  5KHJ A;  1K73 W;  1ZWI C;  2EIM B;  3T1C A;  5LMU B;  5K1P A;  3KG2 A;  1R6T A;  4GX2 A;  4DV6 B;  3K9S A;  5IJ9 A;  2EIJ B;  2Q67 A;  3K5O A;  4D6T H;  3CYO A;  1BL8 A;  3C90 A;  3RGB A;  3N2K A;  1N36 O;  1W0J G;  2L35 A;  1VQN V;  3LNN A;  2QE7 G;  5LGU A;  3T1Y B;  3PN1 A;  4EEQ A;  4RAI A;  5L3D A;  2E3C A;  1KC8 W;  5J9P C;  3RYC A;  1H2L A;  2HKO A;  3FFQ A;  3K0D A;  4N21 A;  3A0H Z;  4JI3 O;  3K04 A;  4LF9 B;  1AR1 B;  4PI2 A;  3WG7 B;  3E8G A;  2WLL B;  4QGP A;  2X6C A;  3ABL C;  2ZE8 A;  1EZV H;  2LFS A;  4RUF A;  4FLT A;  2Y4U A;  1Q6U A;  2B5U A;  3EXA A;  5B1A C;  4IGG A;  4E2L A;  4DR4 B;  1OCO B;  3IAY A;  2WLL A;  3G80 A;  3L73 H;  4GYC B;  4UCR A;  4UXN A;  3ETD A;  1MNG A;  2WSS G;  2F23 A;  2ILM A;  1HR0 O;  1QVF U;  2UU9 O;  2HJF C;  2LGW A;  1QQC A;  4UVC A;  2Q6A A;  2UUA O;  1RP3 B;  1GM7 A;  2VRZ A;  3K5L A;  1I5Y A;  3A8T A;  2X6A A;  3SYQ A;  1JJO A;  1DGS A;  1NTK H;  3SDL A;  3D3I A;  3ETQ A;  1Z5W A;  4LFB B;  1Q82 W;  3E89 A;  3JD0 A;  5DED A;  5B3S B;  2Q7E A;  1Q7Y W;  2W0X A;  4PJ0 Z;  2UU9 B;  4EFB A;  3CD6 V;  2B9Z A;  4DV4 B;  1E79 G;  4JYA B;  2UUA B;  2DYR B;  3H1J H;  1O9G A;  4J11 A;  2QTS A;  1JOY A;  4EB6 B;  1CXZ B;  1KU9 A;  2ZE7 A;  1GAX A;  4PA7 A;  1F51 A;  1R3L C;  3CME V;  4CS3 A;  1NQT A;  5BY1 A;  2OTJ V;  3K79 A;  2QWN B;  3OMA B;  1P4R A;  5KUK A;  4EB6 A;  3RYI B;  4U3J B;  5A2Q N;  1XHZ A;  2UXC O;  1WNS A;  5JCO C;  3JAM N;  2QA4 V;  4PA4 A;  2R9A A;  4IYH A;  5LXT B;  3AK1 A;  4YJ3 B;  4YHH O;  1AI7 A;  4U3J A;  1NH2 D;  3O65 A;  2BTQ A;  3ZHQ A;  3ZHS A;  4GCZ A;  3ZRX A;  1R3I C;  5LXT A;  4UCV A;  3OUS A;  2RJZ A;  3B8M A;  4O4H B;  4LF7 B;  1HNZ O;  3HKD B;  2WA4 A;  4KHP B;  1H8E G;  1IDS A;  1IBL O;  4XBF A;  3CC7 V;  2UXX A;  2NR5 A;  1URF A;  4DV0 O;  2Q0A A;  2KQX A;  2QWP B;  4DUZ O;  2UXC B;  4O4H A;  2VQE O;  1H2S B;  5LGN A;  3LDC A;  2ZIO A;  3UO2 A;  2HFE C;  5CA0 A;  3HKD A;  4LFC O;  2CE4 A;  4YHH B;  2G38 A;  5IT9 N;  4DR5 O;  2P5O A;  5EC2 C;  3H1K H;  1EN5 A;  1Y74 A;  4QIW F;  1SS3 A;  5FLX N;  3CCJ V;  3D3Q A;  4X1Y B;  4LBE C;  4FLW A;  2FML A;  4I9W A;  1WA8 B;  3A2F A;  2NNU A;  1HNZ B;  4CC6 A;  3CP1 A;  1XMQ O;  2ZR2 A;  1S3J A;  1LUV A;  1XRE A;  3S3X A;  2GTS A;  1PNL A;  3VQV A;  4DV0 B;  4X1Y A;  1L1F A;  1WJZ A;  1PNK A;  1WA8 A;  2XTA A;  1GN4 A;  4LFC B;  5IYZ B;  2ZXW B;  2P67 A;  3M99 B;  1WB8 A;  3AG3 B;  3A0B Z;  3UQ8 A;  1CEZ A;  1ZX3 A;  2XND G;  2F1M A;  3GVM A;  4ZKI A;  1QCE A;  1YIJ V;  1F23 A;  1N8R W;  2K9P A;  3MDS A;  3DC5 A;  4GT1 A;  2CTR A;  4X9Q A;  2UUB O;  4OPH A;  2Q4P A;  3ASN C;  3WU2 Z;  1M57 B;  2FKX A;  5BXZ A;  4LH7 A;  4AQY B;  1HWY A;  1EN6 A;  4DR7 B;  1GK9 A;  2JRI A;  1S76 D;  5KA6 A;  1KBH A;  2CTQ A;  3ZHU A;  2GBO A;  1QLE B;  3JCU Z;  1I0H A;  4ZI7 B;  2KKW A;  1GN2 A;  3QVN A;  2QWQ B;  2KG7 B;  1NKD A;  2XAH A;  4LP8 A;  1VQK V;  1RPR A;  2WLH A;  3AG4 B;  4ZI7 A;  1QVG U;  2UUB B;  3F5W C;  4F6R B;  2KG7 A;  1TVK B;  3SJA C;  1OCR B;  3P3N A;  4K35 A;  1Y76 B;  1VQ4 V;  1UJW B;  2PI4 A;  2A06 H;  3I55 V;  3IC9 A;  4ZOL B;  3UT5 B;  1TVK A;  4TV9 B;  1Q3E A;  5B1N A;  3SPH A;  2FYU H;  2X6B A;  3T4D A;  1Y76 A;  4R8C A;  4A5U B;  3UT5 A;  2DOS A;  3HPL C;  4LF8 B;  4IIJ A;  4TV9 A;  2UUC B;  4C7U A;  4JI8 O;  4FLV A;  5LHG A;  2IBZ H;  3OR6 C;  5IY5 B;  2YIB D;  3BRC A;  2H8P C;  2HG5 C;  2F4V O;  5L3E A;  2C2A A;  4MS2 A;  1ROP A;  2QTO A;  2HR3 A;  2ODM A;  4FMT A;  2WA3 A;  5K1X A;  1E1R G;  4DRX B;  3H1L H;  1UFI A;  3LDE A;  1N32 O;  4ASU G;  3NXS A;  5JJJ B;  4MVU A;  3T2M A;  4J41 A;  1U96 A;  3R66 A;  5CBH A;  2V1D A;  4JI8 B;  1S77 D;  4B7E A;  2HHH O;  5EIB C;  4Q6G A;  5L3G A;  2WPD G;  3BAA A;  4MTG A;  5CBG A;  3CRR A;  4ZIB A;  3QO5 A;  2F4V B;  4Z2W A;  2Z3Y A;  4GX5 A;  1NS1 A;  1KKC A;  3STZ C;  4I4T B;  4PV1 B;  1MAB G;  3ZMS A;  1N32 B;  5BR8 B;  3RWR D;  2ZIM A;  3WB1 A;  2Q5Z A;  1FFT B;  4FFB B;  4HYO A;  1AVM A;  4TQD A;  1RM1 B;  2MK3 A;  3KKY A;  2HHH B;  1FJG O;  1D5N A;  4FFB A;  2OIE A;  3UCS C;  1Q81 W;  3G4S V;  3CS5 A;  3GWK C;  3LSS A;  5EK0 A;  4X8A A;  2VWJ A;  1RFY A;  3CCS V;  4NYK A;  1SRY A;  2QM4 A;  4QPK A;  1J5E B;  1QU7 A;  2D3O W;  1JVM A;  2VS0 A;  3OGC C;  1XBL A;  3K58 A;  1XDC A;  4UB8 Z;  1DK1 A;  4I55 B;  4JTD B;  2CGO A;  1NU1 H;  4GX0 A;  3ZED A;  4QE9 A;  4PDR A;  1SET A;  2N05 A;  3OTO O;  2DWD C;  5EZY B;  1Y66 A;  1YHQ V;  2EIK C;  3F7V C;  1OJH A;  3I5D A;  5C93 A;  5LGT A;  1RPO A;  4CS2 A;  4JI4 O;  1BZK A;  4DV7 O;  4JI0 B;  2JS3 A;  1MG1 A;  1MSD A;  5EZY A;  3CRQ A;  2P4V A;  4WFB V;  4TSF G;  3DGE A;  3L9D A;  2A0L A;  1PNM A;  3KCY A;  4JI1 O;  3E35 A;  5KAI Z;  2ZT9 B;  1S5L Z;  1R6K A;  3QNE A;  4UVB A;  1ZL8 B;  5EC1 C;  4XDK A;  4GKK O;  4WBN B;  3NR7 A;  3RT3 C;  4MVS A;  4PDM A;  4B3T O;  1KP3 A;  1R1B A;  1IBK O;  1K7D A;  1ZL8 A;  2YEV B;  4JI4 B;  1H2K A;  2EZO A;  2LJ2 A;  4WBN A;  2LW7 A;  2WLM A;  4CH5 A;  2QSA A;  3AG2 B;  2YID A;  3FB6 C;  3SYA A;  2AZ2 A;  4WFH A;  1XHX A;  5CN0 A;  1V54 B;  4JTC B;  3WFV A;  1V55 C;  2YEV A;  1FXV A;  1TA8 A;  4YJ2 B;  1PL0 A;  4F6E A;  4YY3 B;  4GLX A;  1KD1 W;  1I7F A;  3W7X A;  5KUM A;  3H01 A;  4TWK A;  3ASO B;  4G27 B;  4B3T B;  2EIL C;  1IBK B;  4X20 B;  1HNW O;  4YJ2 A;  2N74 A;  4J7J A;  4RQF A;  3SYC A;  2PYL A;  1X59 A;  1P7B A;  4IL6 Z;  1XEQ A;  4X20 A;  2YXH A;  3ZMZ A;  1XI1 A;  2M6Y A;  2DN9 A;  2WAM A;  3FB7 C;  3ZMV A;  1NBM G;  1SQB H;  1V9P A;  2IJJ A;  2PYJ A;  3CRM A;  2R9R B;  1B04 A;  1JFF B;  3VQW A;  4DYL A;  1HNW B;  5B1O A;  4GKJ O;  1HNX O;  1HP8 A;  2CK3 G;  2XT9 A;  4DV3 O;  1JFF A;  2N04 A;  1N33 O;  3R65 A;  4MVM A;  4LF5 O;  4PI0 A;  1I5X A;  3BAB A;  1WN7 A;  1NR7 A;  5KX5 A;  3G67 A;  1NI8 A;  3K5N A;  1QLN A;  3OEE G;  5EBL C;  1YCI A;  3K9A A;  4DV1 B;  2Z0A A;  2BCC H;  3STL C;  1SC5 B;  4JAS A;  1YZB A;  2QWR B;  4O4L A;  3CCU V;  4KUM A;  3X2Q B;  3GWO A;  4FZ0 A;  5JH7 B;  4ICG A;  4PHZ A;  5EBM C;  1N33 B;  2AHY A;  1YJN V;  5KA5 A;  2Y69 B;  2Q69 A;  1Q90 D;  2HVK C;  5KAF Z;  2XAG A;  2DYS B;  4DK0 A;  3ASN B;  3HKE B;  4UVA A;  4B3R O;  3D8C A;  1BMF G;  1W59 A;  2CGN A;  2UXB O;  3W7U A;  4X89 A;  1WP8 A;  1FXK B;  1S72 V;  3HKE A;  1NTM H;  1ORQ C;  2BOB C;  2ZIN A;  1QNM A;  5D5P A;  2Q8V A;  3J81 N;  1KYO F;  4I7Z B; 
#chains in the Genus database with same CATH homology
 4LBE C;  4CZZ A;  4PEL A;  1FXK A;  1K92 A;  4I9W A;  3UM7 A;  4U7N A;  3ABT A;  1GTO A;  2IU3 A;  2NNU A;  3CP1 A;  2ZR2 A;  1S3J A;  3PJS K;  1K34 A;  2OCC B;  1PNL A;  4P9O A;  3AG4 C;  3CCL V;  1JX9 A;  1OCC B;  1ENV A;  1L1F A;  3CPW U;  3CCV V;  1PNK A;  2AHZ A;  3JD1 A;  1M1K W;  2IJH A;  3CCM V;  1OCR C;  3CCQ V;  2ZXW B;  2P67 A;  3AG1 C;  3M99 B;  4FK5 C;  4MTF A;  3AG3 B;  2B1I A;  3ZCC A;  3OUF A;  1K5S A;  2ITC C;  2B1G A;  2P6J A;  1EFR G;  4LCU C;  3RVZ A;  5LHI A;  3G71 V;  1CEZ A;  2XND G;  4FPP A;  4ZKI A;  1QCE A;  3OEH G;  3OM3 B;  3JD4 A;  1YIJ V;  1F23 A;  3TK1 A;  2ZDI C;  4J9Y B;  1N8R W;  1JCH A;  2DQ0 A;  3ETG A;  3W7T A;  4L87 A;  1B6Q A;  4GT1 A;  4MSW C;  1VQM V;  1KQS U;  3JYC A;  4RQE A;  2BOC C;  1KP2 A;  5B1B C;  1YI2 V;  3EHB B;  2QM7 A;  3ZRV A;  3BY6 A;  2EIN B;  5H9C A;  3ASN C;  1M57 B;  4LC1 A;  3E8F A;  3FB5 C;  1VQP V;  1NH2 B;  3E8B A;  3CC4 V;  1WPX A;  4GX1 A;  1FXH A;  2IW5 A;  4XDL A;  1GM8 A;  4JYB A;  1HWY A;  1GK9 A;  3RW0 A;  1S76 D;  5KA6 A;  2WLN A;  5IY5 C;  3MHS C;  2JJ1 G;  1QLE B;  4JF3 A;  3RVY A;  1K33 A;  1K4D C;  1VQ6 V;  1KEC A;  4FIP C;  1M9N A;  3HB3 B;  1NKD A;  4JPR A;  2XAH A;  4LP8 A;  1VQK V;  1RPR A;  2KB1 A;  3B77 A;  2QM8 A;  2WLH A;  3AG4 B;  1QVG U;  3OAA G;  4G28 B;  3SPJ A;  4QJF B;  2OCC C;  3OMN B;  4OXS A;  2OT5 A;  3F5W C;  4MTX A;  1OCR B;  2GHY A;  4PDL A;  4U7O A;  3AG1 B;  1VQ4 V;  1XL6 A;  1UJW B;  4JAV A;  4MVR A;  2PI4 A;  3BEH A;  3I55 V;  4JTA B;  3K03 A;  1FS0 G;  4MVO A;  5HFL A;  3ETE A;  5B1N A;  3SPH A;  3ABK C;  2ZQM A;  3K0G A;  2X6B A;  3T4D A;  1PD3 A;  4R8C A;  3ZJZ A;  5L3B A;  2A79 B;  2JEU A;  5B1B B;  2QEX V;  4TT3 G;  5LHH A;  4F4L A;  1K4C C;  2XAQ A;  3CCR V;  3HPL C;  2ZDI A;  2XAS A;  1VQO V;  3LUT B;  2EIN C;  3QO8 A;  4DO2 A;  1M57 C;  1NVP D;  5LHG A;  2A9H A;  4MT8 A;  1RM1 C;  3ML0 A;  3OR6 C;  1GKF A;  5IY5 B;  1YTF D;  3CC2 V;  1DF4 A;  2H8P C;  3ZRS A;  5HFM A;  3W7W A;  1R73 A;  2HG5 C;  5L3E A;  1OZ0 A;  2C2A A;  3D36 A;  4MS2 A;  1ROP A;  3LNM B;  3UKM A;  2QTO A;  4R50 A;  2HR3 A;  4FMT A;  1E1R G;  5IDJ A;  2EJR A;  3VOU A;  2Q68 A;  4RO2 A;  3VBB A;  4I5S A;  1JJ2 U;  1H38 A;  3LDE A;  1AI6 A;  2WLI B;  4ASU G;  1K3E A;  3SPC A;  3OW2 U;  3NXS A;  5H6Q A;  3JCZ A;  2GSM B;  4MVU A;  3T2M A;  4MTO A;  4BW5 A;  2X7R B;  1VQ9 V;  1W0K G;  5CBH A;  2V1D A;  4QNH B;  1S77 D;  3ABM C;  4X88 A;  4WFF A;  3SYP A;  2WLI A;  3ZIA G;  2Y48 A;  1GMG A;  2LFR A;  4PDV A;  1M90 W;  4KP4 A;  5L3G A;  1GM9 A;  1DF5 A;  2WPD G;  4MTG A;  5CBG A;  4BAY A;  4MW3 A;  3QO5 A;  2YSU B;  1K5Q A;  3ABK B;  4N23 A;  1OHH G;  4ZBM A;  2Z3Y A;  4GX5 A;  1G8M A;  1VQ8 V;  3STZ C;  5BZB A;  2IJK A;  1G4Y B;  1OCZ C;  5DM6 V;  1MAB G;  3ZMS A;  3EFF K;  3JD3 A;  1W2B U;  3ZRW B;  5IYD O;  2EBO A;  2EIM C;  2W6I G;  2R9I A;  3MHH C;  1FFT B;  3FB8 C;  4R7C A;  1M56 C;  1YSC A;  4J9Z B;  1DLB A;  1K97 A;  2EIJ C;  4HYO A;  5IYB O;  3ZN0 A;  1RM1 B;  1Q86 W;  1QR9 A;  3OFN G;  2MK3 A;  4WFE A;  5H6R A;  1THZ A;  2ATK C;  2JJ2 G;  5LBQ A;  3E86 A;  2ZR3 A;  4WFA V;  1J95 A;  3OMI B;  3P30 A;  4P30 A;  1K8A W;  1GO3 F;  1WLE A;  5FL7 G;  1Q81 W;  2XOK G;  4H37 A;  3G4S V;  1AI4 A;  1YJ9 V;  1XL4 A;  3LSS A;  1S5H C;  2JEX A;  5EK0 A;  4X8A A;  2IJI A;  3CCS V;  1SRY A;  4QPK A;  5IYC O;  1QBZ A;  2JK5 C;  2P90 A;  2D3O W;  3B8N A;  1JVM A;  1NVP B;  3ABU A;  2LP7 A;  4P2Z A;  1JPX A;  3ABM B;  1YTF B;  3OGC C;  4JGS A;  4KFM A;  1COW G;  5L3C A;  5DN6 G;  4JTD B;  3SYO A;  4Z1M G;  1MOF A;  3AG2 C;  4GX0 A;  2K1E A;  4QE9 A;  2HLD G;  1SET A;  3E8H A;  4PDR A;  1S0V A;  3T4Z A;  2XAF A;  1VQL V;  1CPY A;  3W7S A;  1V54 C;  2DWE C;  1AI5 A;  1AJQ A;  2Z5U A;  1OCZ B;  2UXN A;  3E83 A;  4JYC A;  1K73 W;  1OCO C;  2DWD C;  3SJQ C;  2P7T C;  1ZWI C;  2WWW A;  1Y66 A;  1AJP A;  2EIL B;  2EIM B;  1YHQ V;  3T1C A;  3IFX A;  2QKS A;  2EIK C;  3F7V C;  3SPG A;  1YIT V;  5C93 A;  3KG2 A;  4RUE A;  4GX2 A;  5LGT A;  1M56 B;  1RPO A;  3ASO C;  4BIZ A;  3DTU B;  2EIJ B;  2Q67 A;  1R3K C;  2OTL V;  3CYO A;  1MG1 A;  1BL8 A;  2WLK A;  1TUE B;  4WFB V;  4TSF G;  1SES A;  3DGE A;  4WF9 V;  2A0L A;  2F43 G;  1PNM A;  1W0J G;  4Q20 A;  3E35 A;  1VQN V;  2QE7 G;  5LGU A;  1K9M W;  1MSW D;  1R6K A;  3QNE A;  1H2G A;  2IH3 C;  4RAI A;  4UVB A;  3GB7 C;  1SER A;  3IC7 A;  5EC1 C;  3TET A;  4XDK A;  5L3D A;  1KC8 W;  2NLJ C;  4JAU A;  1ARO P;  1R6N A;  5J9P C;  4MVS A;  4PDM A;  1IXM A;  5B3S C;  1KP3 A;  1PKX A;  2HKO A;  3K0D A;  1K7D A;  5GW7 A;  1AJN A;  3OE7 G;  4N21 A;  2X0L A;  3K04 A;  3K06 A;  2YEV B;  3OR7 C;  2EZO A;  1AR1 B;  2WLM A;  3WG7 B;  3E8G A;  3AG2 B;  2WLL B;  2DYR C;  2DW4 A;  3FB6 C;  2X6C A;  4HZ3 A;  3SYA A;  3ABL C;  4WFH A;  1VQ7 V;  5CN0 A;  2LFS A;  4RUF A;  1V54 B;  3MD0 A;  4JTC B;  3TCU A;  3WFV A;  1V55 C;  2JIZ G;  2YEV A;  2B5U A;  1FXV A;  5B1A C;  4E2L A;  1OCO B;  2H94 A;  1PL0 A;  2WLL A;  4MVZ A;  1BHB A;  2EIK B;  3K08 A;  4UXN A;  4QE7 A;  3FKS G;  1KD1 W;  1CP9 A;  3ETD A;  3W7X A;  5KUM A;  3H01 A;  4TWK A;  3ASO B;  4G27 B;  2EIL C;  2WSS G;  3F7Y C;  1QVF U;  2HJF C;  4CBC A;  2PI5 A;  4UVC A;  2Q6A A;  3JD2 A;  1GM7 A;  4RQF A;  3FYI B;  3SPI A;  3X2Q C;  3SYC A;  1I5Y A;  1P7B A;  4MVQ A;  3G6E V;  1QR8 A;  3ZRW A;  2X6A A;  4QPJ A;  3SYQ A;  3P32 A;  4FJC C;  3FYE B;  3D3I A;  3LDD A;  3I56 V;  3ZMZ A;  2EZP A;  3A0R A;  2WAM A;  2Y69 C;  3FB7 C;  3RBZ A;  1NBM G;  3ZMV A;  1Q82 W;  4BIU A;  2M7W A;  2IJJ A;  2DYS C;  1H8H G;  2XAJ A;  4MW8 A;  3E89 A;  3JD0 A;  4UV9 A;  1NR1 A;  5B3S B;  2R9R B;  1F4M A;  1Q7Y W;  1R3J C;  4DXW A;  5L3F A;  3CCE V;  1Y4M A;  3CD6 V;  4EKW A;  5B1O A;  1F4N A;  4UV8 A;  1E79 G;  1LNQ A;  1FXK C;  4UUJ C;  2CK3 G;  2DYR B;  4PA6 A;  3LSQ A;  3ABL B;  1JOY A;  2FTK A;  3WG7 C;  3R65 A;  1EBO A;  1V55 B;  4HAM A;  1F51 A;  4MVM A;  4PA7 A;  1R3L C;  5B1A B;  2ITD C;  1I5X A;  3CME V;  2W6J G;  1NQT A;  4PA9 A;  5EBW C;  2OTJ V;  3K79 A;  1BHA A;  1NR7 A;  3OMA B;  1P4R A;  4R6Z A;  5KUK A;  1SZT A;  4WFG A;  4H33 A;  1QLN A;  3OEE G;  5EBL C;  5E1A C;  3K9A A;  3ZMT A;  1OCC C;  4PA4 A;  2QA4 V;  3STL C;  4JAS A;  1KKD A;  2IU0 A;  3CXC U;  1VQ5 V;  5CMU A;  3CCU V;  1AI7 A;  4KUM A;  3K3W A;  3X2Q B;  1NH2 D;  3GWO A;  2HVJ C;  4XDJ A;  2DQ3 A;  2ZXW C;  4P9P A;  5EBM C;  3AEI A;  4GCZ A;  3AG3 C;  1NJI W;  3ZRX A;  1R3I C;  4G2K A;  1JQ0 A;  2AHY A;  3OUS A;  3E2E A;  3B8M A;  1YJN V;  1E1Q G;  5KA5 A;  2Y69 B;  2Q69 A;  2HVK C;  2XAG A;  1H8E G;  2DYS B;  4YXW G;  4XBF A;  2UXX A;  3ASN B;  3CC7 V;  4UVA A;  1YJW V;  4WCE V;  2V7Q G;  3IGA C;  3ZMU A;  1BMF G;  2W0F C;  5LGN A;  2WLJ A;  3LDC A;  3QO7 A;  2HFE C;  4X89 A;  3W7U A;  3CMA V;  3CCJ V;  5CBF A;  3ZN1 A;  5CA3 A;  1FXK B;  1S72 V;  4PA3 A;  1ORQ C;  2BOB C;  1DTO A;  5EC2 C;  2JDI G;  4QIW F;  2ZD9 A;  1QLE C;  1EZJ A;  2IH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...