2EZPA

Solution nmr structure of ectodomain of siv gp41, models 1-10 of an ensemble of 40 simulated annealing structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
AQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41
publication title Three-dimensional solution structure of the 44 kDa ectodomain of SIV gp41.
pubmed doi rcsb
molecule tags Viral protein
total genus 46
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ezpA00
3CYOA 4FK5C 2EZPA 4N21A 1K33A 1I5XA 2EBOA 4G2KA 2M7WA 5CMUA 3WFVA 1QBZA 4FJCC 5CN0A 1MOFA 1DLBA 4E2LA 1SZTA 1EBOA 3CP1A 5KA5A 1ENVA 2P6JA 4JF3A 3K9AA 1JPXA 3B8MA 3M99B 5KA6A 3P30A 1K34A 4JGSA 2X7RB 4N23A 3GWOA 3MHSC 1Y66A 5H9CA 1Y4MA 1JQ0A 1QR9A 3MHHC 4JPRA 1QCEA 2LP7A 1F23A 2EZOA 1DF5A 3H01A 1DF4A 1MG1A 2MK3A 3B8NA 4FIPC 5HFLA 3B77A 1I5YA 5HFMA 2OT5A 1QR8A
chains in the Genus database with same CATH superfamily
1R3JC 1B6QA 4MW3A 1IBLB 3OUFA 1NTKH 5L3EA 4J9ZB 4UCTA 4DXWA 2QKCA 5EBWC 4JI7O 5B5EZ 3JAKA 1Y74B 1EFRG 4YY3O 2WLHA 1AR5A 3ASNC 2UU9O 2A7WA 1IBKO 4JI6O 4F6RA 5ITZA 3SPCA 3RWRD 1H38A 4U7OA 2BOCC 4DV6O 4H0LB 3CD6V 4XDKA 2UXCB 3L9DA 4I4TB 5KHGA 3E35A 1BS3A 1BE3H 4O4IA 5FNVA 4UB6Z 2Y4UA 5L3FA 5FLXN 1IBMB 1H2LA 4IL6Z 3JASB 2GTAA 3FAVB 3OTFA 2VWJA 2Q9LA 3T2MA 3WB0A 1N0NA 3WB2A 1IZ3A 1XREA 1VQOV 2UXNA 2HHHO 3M8AA 4I55B 5LP6A 3N27A 3C3TA 1JFFA 3TXSA 1AJNA 4YHHB 3K5MA 3Q4HA 2GUZA 3OTOB 4GCZA 2QR4A 1SZXA 4Z1MG 2UUCO 2WAMA 5IY5B 3G4SV 1OCZC 5TISZ 3ZJZA 4FZ1A 1PPJH 4J9YB 4NXMB 3ZMVA 2O57A 3OE7G 1NJIW 2YEVB 1Q82W 3AEIA 4WFGA 4UCSA 1PV0A 3OGCC 3OEEG 1VEWA 3CE2A 4PELA 2EZOA 5B1OA 2IH3C 4GZRB 4DR3B 2QDOA 3B77A 1QHTA 1WAZA 2EINB 1RP3B 4JI1O 4DV3O 4LP8A 5GTIZ 4NVPA 3W7WA 1LUWA 3OMNB 5IT9N 1P7GA 3WG7C 3RYCB 4TT3G 5B3SB 1I94B 4ZOLA 5KA6A 2VQEB 4R8CA 2B5UA 3K5LA 4LC1A 4N23A 2DYSB 5B1AB 1M57C 1OHHG 1WA8B 5LGNA 1NQTA 3T1YO 4DR4B 1XMQB 1DF4A 3OGIB 4LH7A 4DV4O 4PDVA 4JZGA 2EBOA 4K0KB 5JCOC 1EZJA 1QNMA 4GX1A 3K79A 2UXBO 3SPHA 2Q68A 3OAAG 3CSXA 4CH5A 3J80N 3I55V 4MS2A 2A9HA 2YI9A 2EIKC 2XHBA 4LBEC 4B3RB 2CTWA 1R73A 2X6BA 1SF9A 2UUAB 4LH6A 1OCOC 4RAIA 4XDJA 3JAWB 4IIJB 5E79Z 5LXTB 2OWOA 1FS0G 2KG7B 4DR5B 4BIUA 3RGBA 4PA3A 1U97A 4I50B 3A0RA 1WLEA 4AQYO 3OT7A 5CBGA 1OJHA 1PNLA 3HKBB 2LW1A 4OX9O 4TV9B 2QWPB 3K9SA 3RFRA 3CMAV 1IDSA 2ZINA 5KUKA 2X6CA 1N34B 3ETGA 4CS2A 4WFAV 2AHYA 5GONB 4UVBA 2AW9A 2YS8A 4X65O 2CGNA 1S0VA 3DXRB 2ZE7A 1HNZO 1MNGA 1COWG 3CB2A 2N05A 4LFCO 3K59A 3A8TA 1DK1A 1Q6IA 4UUJC 3GVMA 2ZDIC 2EULA 4WBNA 4MVQA 1K4CC 4J42A 1XBLA 4FLXA 4BR6A 1NKDA 3CPWU 4O2AB 1X59A 2EILC 5CMUA 3ZHUA 1CPYA 3IC7A 1PL0A 3NR7A 4UV9A 4JI2B 4LR3A 2UUCB 4J7JA 4LFAO 5D5PA 2GSMB 2YIBA 1AI6A 1AR4A 5LHIA 5LYJA 3H01A 1W2BU 1MG1A 3ASOC 5CA0A 3ZN1A 3AG2B 1I08A 4O4JB 3SYCA 4ZIBA 3RYCA 1GN3A 4K35A 2RJZA 4L87A 5BXZA 1JJ2U 1BQ0A 4PA4A 4LF8B 4UV8A 4LF5O 4TQFA 3D3QA 2RN9A 2L35A 4MVMA 4RWUA 1K92A 3FYIB 4X88A 3A2FA 5LGUA 3VOUA 4UVAA 3J7AU 1V9PA 2JVDA 1UJWB 5EK0A 1KQSU 4X1IB 4JV5B 2FYUH 4YIPA 4DV7B 5CN0A 3FB6C 4CS3A 1ENVA 4LNUA 4QPKA 4EFBA 1NH2D 1SC5B 3CCSV 4DR7B 2UXDO 1H2MA 4TSFG 1S76D 1P84F 1BHBA 3B8NA 4X9QA 3K04A 1OCRC 1SETA 4PA9A 5BR8B 2DMXA 1HNWO 4QE9A 4JTDB 5KLVH 3B09A 4KHPO 5JVDB 1FPOA 3AG7A 4PDLA 1Y67A 2PY5A 1LNQA 3E8HA 4X62B 5J9PC 3W7TA 1R3LC 3QVNA 1MZFA 1PM9A 2ODMA 3H9VA 5IJ0B 2QGNA 1ZLZA 1ZL8B 2BSKB 4OGQB 5EC2C 1BCCH 1H8HG 4D7TA 2X0LA 4X20A 1VQ7V 4F6EA 4IYHA 4GKJB 1YCIA 3G67A 1D5NA 2UXXA 1YZBA 4JYAO 2HEPA 4JI8O 4FK5C 1VQ8V 4OX9B 2FL4A 1T5EA 2IBZH 4B08A 2OCCC 2PUSA 3ZMUA 4P30A 1M90W 2HJDA 4JAUA 2AXTZ 1L1FA 5EZYA 3ABMB 1AI5A 3CMEV 1TVKB 4O4JA 3G6EV 3SJQC 4NR1A 4O2BB 2E74B 3MAQA 3N2GA 3CC4V 3T1HB 4TUYA 1CXZB 3SYQA 3VQWA 4QIWF 4X1YA 2KQXA 3VBBA 3HKCA 3PJSK 4U7NA 4MW8A 4LF6O 2IJHA 1M9NA 2IM9A 3JAKB 2EINC 4QNHB 2Q8VA 2ZE5A 3OW2U 3ZHSA 2X7RB 5ITZB 5IWAO 2XUMA 1HR0O 1H2NA 2V7QG 1N0JA 3E8BA 3U10A 3OEHG 5L3GA 3SYOA 5B1AC 1WPXA 2A79B 1HNXO 3FKSG 3EVKA 4H33A 3QO8A 3W7UA 4YJ2A 4O4IB 5FNVB 4LF9B 1MOFA 2H3OA 2HVKC 2ADQB 3UCSC 4LF7O 2AZ2A 3RBZA 1NT2B 1UFIA 3H1JH 2DJVA 4RQEA 4PA6A 1BMFG 5LP6B 1JFFB 4J11A 1GH6A 1URFA 5JVDA 4J41A 3LSUA 3Q4HB 2GUZB 4QPJA 1NR1A 3JCZA 3K5OA 4FM0A 4R50A 2YDEA 4JAVA 3F5TA 1WJZA 1YXBA 1XILA 4TOIA 2BE3A 1H2GA 2CTRA 1I5YA 1V55B 3BEHA 4G28B 4PV1B 2B1IA 4DV5O 2ZM6O 1RM1C 3UM7A 5IE9A 3W7XA 2H8PC 4E4EA 4JYYA 3P32A 2P6JA 1XNRO 3JD3A 5JH7A 2W6JG 1V54B 4JYBA 3KKYA 2YXHA 1GK9A 5A9GA 1J5EO 1FFXA 1CEZA 1E1RG 4FLWA 4YXWG 2VRZA 2ZT9B 1Q81W 3F7YC 4MSWC 4JI0O 3AK1A 2M6YA 1EN5A 4DV1O 3KZIZ 5EBLC 3HPLC 1OCCB 1FFTB 1H2KA 2IJIA 1ZAUA 5KHJA 5LOVB 3QF7A 1B04A 1JQ0A 5LMUO 4DK1A 3L72H 4GX0A 4HZ3A 2WLNA 2RCVA 4FM2A 2IW5A 3K0DA 2YI8A 4RO2A 1W0JG 1KECA 3LDDA 3ABLB 1EBOA 3ZBHA 2C2AA 1VQPV 1KKDA 1QU7A 4GX5A 1IVSA 2WLLA 1IX9A 1GN4A 1QLEB 1MZEA 2BTQA 1WP7A 2A06H 4JZ2A 4FLUA 4CC5A 3N2KA 2QA4V 5B1NA 1KB9F 4B3MB 4UFZA 4JI3O 1XMOB 1AROP 1P7BA 4PHZA 4PI0A 4X8AA 4CC6A 3IAYA 3APQA 2P5OA 1AP5A 1I0HA 3H1HH 1N36O 2FKXA 3LSQA 3D3IA 2VQFB 1NTMH 4F4LA 3SGIA 3BY6A 1SQVH 3ZHRA 2JGDA 3ZRSA 1HR0B 5JQGB 2R70A 1H2SB 3CCVV 1SQXH 1N33O 4NTXA 2F4VO 3JD2A 2JJ2G 4DRXA 3CX5F 3B40A 4GKKO 2Q0AA 4MVOA 2QE7G 3OR6C 4LCUC 4GX2A 2CE4A 4JTAB 4DR6O 4AHCA 5EYPA 2B1GA 4WF9V 2VS0A 2VWKA 4WBNB 4H37A 5LMNO 4H13B 3VQXA 4X1KA 3ZS8C 2F66C 3ABKB 2DWDC 3E8FA 3E22A 1R3IC 1U96A 4D7SA 1AB3A 1XDCA 2V4DA 4QJFB 3OUSA 3HR0A 4JI4B 5C8YA 2Y0IA 5LYJB 5BZBA 3SYAA 2WLIA 5CA0B 1FXKA 3L75H 1Q8IA 4JGSA 3S3XA 4UCOA 4B3SO 5H9CA 1LR1A 2Q7EA 1N32B 1GM8A 4BW5A 5J2TA 5CB4A 1ZUQA 1TUEB 1F4NA 5LOVA 4DV0O 4X66O 4EEQA 2WA4A 2CGOA 2JK5C 4RUFA 2HKOA 3M99B 4G27B 1K97A 1BQZA 1Y76A 4I9WA 1XNQO 2QTOA 4X64O 3A0BZ 3CCRV 4J7KA 4MVUA 1WN7A 4LNUB 2PYLA 1GN6A 3RYIA 1DGSA 3K03A 5LHGA 2ITCC 3AG4B 2NNUA 1YEWA 1Z5VA 2W6IG 3OMAB 4FZ0A 5LMUB 2GV9A 2XOKG 2QM4A 3ABMC 2HLDG 1E1QG 1KMIZ 1Q6HA 1TAEA 3IJ4A 4KP4A 1GAXA 3SJAC 4FIPC 4XBFA 3T4ZA 1M5IA 4DR1O 4DUYO 1NU1H 1QLNA 1QBZA 4FJCC 2JGUA 4K8ZA 2LO1A 3ZHQA 4JI7B 3BFRA 4DR2O 3TETA 3AG3C 2FMLA 4KXRA 3D8CA 3E89A 4YY3B 3UQ8A 2UU9B 4JI6B 1IBKB 4QE7A 4X20B 3CEIA 5JQGA 5FL7G 1DTOA 2OYQA 2Q0OC 4DV6B 2EIMB 3L74H 4W4KA 4J10A 4JI5O 1Q90D 3BRCA 1WNSA 1XL4A 5KMGA 2KKWA 2AGAA 3VQVA 3K3WA 4NYKA 1N36B 5EBMC 4CZZA 4UB8Z 1XOUA 1D5AA 4CH6A 3JARA 1VQMV 3B4SA 4MTGA 4DV2O 2HHHB 2DE0X 4WFBV 1F7YA 1L0NH 3RYHA 4D6TH 5LP6C 4MVSA 2Z0AA 5KA5A 2NN4A 4TV8A 2F4VB 3SPGA 2UUBO 3EXAA 1MSDA 1MABG 3H1LH 4NXNO 1XQ8A 5EZYB 1E79G 2Y69B 1GN2A 5LHHA 3KG2A 4J7ZA 4ABMA 1KP2A 1KUQA 1WB7A 3N2GB 4TUYB 5AG2A 2XASA 5LMNB 4CH3A 3JSNA 2ZXWC 1JCHA 3CCEV 3RN4A 2CDYA 3ZRXA 2NLJC 3BHPA 4X1YB 5CBHA 2LFSA 5CA1A 3HKCB 3JSLA 1AP6A 3ASNB 1K73W 3VQYA 3H1IH 3JD1A 2E3CA 2P4KA 2IJJA 1V54C 4JI1B 3HKEA 4DV3B 3CXHF 4FM1A 1AJQA 4J80A 4B3TO 2Q4PA 2YIAA 3CHXA 5EIBC 1SQBH 3L73H 5BY1A 2ADPA 1YDXA 1FYJA 3T1YB 1K34A 1VP7A 3HB3B 2ZD9A 4Z1VA 2G38A 4YJ2B 2FTKA 2LP7A 4DV4B 4LF4O 4ZI7A 3ABTA 1NZ6A 2WLKA 4H44B 3OD4A 4O4LA 2LJ2A 1Z2GA 2RMKB 1K3EA 2XAJA 2UXBB 2JEUA 3FB8C 5L3DA 1QQCA 1BL8A 1CP9A 1OCZB 3BVOA 2E5LO 3HKDA 3THOA 1YJWV 5D5QA 1M1KW 3JCUZ 5KX5B 2WLJA 2EZPA 3SDLA 1A32A 5IYZB 2YC0A 1MMMA 4I9QA 1HW7A 1FJGO 2OTJV 2A0LA 1VQ9V 2ETNA 4JAAA 1SQFA 2ZE8A 2GDSA 4DUYB 1RSOA 2DWEC 5LA6A 3CCJV 5JH7B 3WG7B 4MTXA 4ZBMA 4AQYB 2Q73A 4N21A 4C7UA 1M57B 1HP8A 2XAFA 1FFXB 2YIBD 2IU3A 2Q7HA 3MHSC 1QVGU 5JJJB 2YXYA 4X65B 3IC9A 4ICGA 1HNZB 1YTFB 2YXLA 3S3WA 5BMVA 4LFCB 1TUBA 1ORQC 5IY5C 3T1CA 2XT9A 5IYCO 3DTUB 3EHBB 3L71H 2YIDA 3ZMTA 1F51A 2F23A 4HAMA 1IBLO 4JTCB 2X6AA 3SPJA 3I5DA 4MTOA 1M56B 2EIKB 2QWNB 3OM3B 2WLLB 3ABKC 1Q6UA 2BTQB 2P90A 1SZTA 3W7SA 4LFAB 4MVZA 5B1BB 1P49A 3LDEA 4QGPA 1THZA 1YI2V 3N2KB 5B3SC 3O65A 4P2ZA 1US6A 4HNAA 2DYSC 4LF5B 2JDIG 3E86A 1S5HC 5KAFZ 2LQTA 1IBMO 4BAYA 1JX9A 2F93B 2M7WA 3WFVA 4FLVA 3CP1A 5L3CA 3BPZA 4FLYA 4PA7A 1TGOA 4HBNA 2B9ZA 1PP9H 4YHHO 3OTOO 2JGDB 2YSUB 4JYCA 3CCQV 1S72V 4FLTA 1XUQA 1GMGA 2R9AA 3BA8A 4CBCA 4DRXB 4JF3A 3TGUH 4LWSA 1OZ0A 2JS3A 4NXMO 2UXDB 2WLMA 2ZNJA 5LBQA 5KX5A 2OCHA 3AG4C 3LNMB 1NTZH 4NB5A 5IYZA 3OMIB 1FD9A 4DW1A 5EYPB 2OIEA 3WU2Z 3RYFB 1G6UA 3UT5A 3L70H 4X1KB 4DR3O 2KSDA 2Q5ZA 1NVPB 1HNWB 3LSSA 3K0GA 4KHPB 3E22B 2E5LB 1GKFA 2PGGA 3CS5A 4I0XB 1I7FA 3ASOB 4UCRA 3IFXA 2DN9A 2XAHA 1I94O 2VQEO 5C8YB 1VF7A 3JALA 3STZC 4MTFA 2WLIB 2PF4E 1Q5OA 1FXKB 4TWKA 1L0LH 1IXBA 1VQ4V 2GBOA 4DK0A 5KUMA 1GM7A 3D36C 2ZIMA 1S5JA 4DUZO 4IYIA 2EIMC 5J2TB 1N8RW 5JCOA 4WCEV 1SRYA 1VIBA 2V1DA 5GTHZ 3AK2A 5CB4B 3NXSA 2ZR3A 4JYAB 2P7TC 3OFNG 2BOBC 2JIZG 2NR5A 3CRCA 5J2UB 1Q7YW 4JI8B 3QO5A 3RVZA 1XHZA 4BIOA 5B66Z 2K9PA 2HG5C 1W0KG 2Q69A 1Y76B 2QSAA 3FX7A 2QEXV 1K7DA 5DN6G 3FB7C 1IURA 3GB7C 1J95A 3E8GA 4O4HB 1YHQV 1OCRB 3ZRVA 3RYIB 5JJNB 3JD4A 2UUAO 2WPDG 2CH7A 4UXNA 5KHHA 1JOYA 3LNNA 1VARA 2Y69C 3AG2C 4DR5O 1YITV 3K5NA 1FAFA 4UCUA 4I5SA 4OXSA 2K1EA 4IHJA 2A3QA 3SJBC 1O9GA 5H2FZ 2E75B 3P3PA 3ZCCA 4WFHA 1KYOF 1N34O 4LF6B 1WPBA 1PL4A 4ZHQA 2MW2B 1NH2B 3AG1B 3K08A 2W0XA 5IWAB 3BABA 2YUAA 1KP3A 2CUGA 3CRQA 1QVFU 4Z2WA 1HNXB 1B3QA 1EZVH 2ZE6A 5KMGB 2ZDIA 5K1XA 2HFEC 2R9RB 3UO3A 2GTSA 3SR2C 2QM7A 1G4YB 4LF7B 1DLBA 3U0ZA 1F4MA 2OCCB 1FXVA 4A5UB 2DYRB 2L6LA 2ATKC 3RYFA 4KL1A 4JI2O 2EIJB 3JARB 3ZRWA 1Y4MA 3RYHB 1KBHA 4OPHA 2QKAA 3UKMA 4EB6A 3JATB 1JMKC 2P06A 4I0XA 3TCUA 4FFBB 4TV8B 1SESA 1XI1A 3AK3A 2KB1A 4G2KA 5F2VO 1R1BA 1YTFD 2QWRB 4LF8O 3SYPA 4KUMA 5CA3A 1KC8W 3FB5C 4FVMA 1Q43A 1KD1W 5FPOA 1AI7A 3CC2V 1R6KA 4CH4A 2ZM6B 4DV5B 4ZKIA 2QKSA 4Q6GA 2Z5UA 3B8MA 1X4TA 5CA1B 1XNRB 2P4VA 4PDRA 1I5XA 1SA0A 1S5LZ 1YVWA 2RQ6A 2RNBA 5J2UA 2R9IA 3P3NA 3HKEB 3LUTB 4JV5O 3ZHVA 4DV7O 1J5EB 1YSCA 5KHKA 1KKCA 5H5NA 1AI4A 2WSSG 1XHXA 2EX3A 5IJ9A 1AILA 4DO2A 4L8JA 4DR7O 4JI0B 4O4HA 2BCCH 2F95B 2FB5A 5HFMA 2QTSA 3G6BA 4DV1B 1P4RA 1VF5B 4DUZB 2JEXA 2HP8A 4ZI7B 5BR8O 3CJHA 1G8MA 1NS1A 1VF6C 3ZEDA 4O4LB 1WP8A 3ABUA 3X2QB 4K8XA 5E1AC 3K57A 3F7VC 5LL6Y 4X62O 1M56C 3KCYA 1MA1A 3HKDB 3BAAA 3DSQA 1PNMA 4DYLA 1Y74A 2CK3G 2JRIA 5H6QA 1NR7A 3RT3C 1YJ9V 2ZIOA 4LFBO 3OR7C 1EM1A 1JA8A 1RM1B 4JPRA 5B1BC 4GKJO 2PZSA 2RDCA 5H6RA 4I4TA 2AHZA 3H1KH 3BCCH 4I7ZB 2Q6AA 3KCXA 2ZKOA 4JI3B 2HVJC 5EC1C 1AVMA 2JJ1G 5CBFA 5KHIA 1RSOB 1NVPD 1JPXA 3QG5A 5LA6B 2P22C 3JASA 3FAVA 3GWOA 1F23A 4FLZA 4PJ0Z 1DF5A 4I55A 1MSWD 1BGYH 2ITDC 1K5QA 2LGQA 1Z5WA 3E83A 1RPRA 5EIBD 4OPAA 1W59A 1GM9A 1BZKA 3QNEA 4TQDA 1N33B 3JATA 1M93A 2Z3YA 4FFBA 4YIOA 1SQPH 2EJ7A 4P9OA 5BMVB 4GKKB 1ZX3A 1QCEA 4GT1A 1TUBB 4W4LA 1VQKV 1S77D 1K8AW 3T1HO 2DQ3A 2YEVA 2IU0A 4CS4A 4DR6B 2CTQA 3TK1A 4BIZA 1VQ5V 1D2DA 1H8EG 1V55C 3DC6A 2GHYA 3APOA 1JVMA 3MD0A 1N4CA 1HDJA 4XDLA 2BTOA 2N04A 1VMGA 3B2EE 3CRAA 1YF2A 2XAGA 4NTYA 4YJ3B 5IDJA 1WA8A 3ZN0A 1RFYA 3DGEA 1FXKC 2IJKA 4RQFA 5K1PA 4GYCB 4B3SB 4PD4F 4LF9O 2LFRA 4HNAB 1BT8A 1Y66A 1QR9A 4R7CA 3CCLV 2Y48A 1OCCC 4PI2A 1NI8A 3CRMA 4DV0B 1EN6A 4X66B 1OV9A 1K33A 4X89A 3FFQA 2QM8A 5DEDA 1XNQB 2HJFC 3SJCC 4X64B 4RUEA 3ZIAG 1PNKA 5DECA 5FPRA 4ASUG 3ABLC 1K9MW 2CTPA 2PI4A 1IXMA 4LWSB 3T4DA 1QLEC 2WWWA 3ML0A 1SQQH 3O9OA 3M7MX 4GLXA 1K4DC 1L8DA 2QJ1A 3JAWA 3CCUV 4IIJA 4MVRA 3C90A 5LXTA 2KG7A 3JAMN 2JS5A 3PN1A 3UT5B 4UVCA 3E2EA 4I50A 1O9HA 3MHHC 4DR1B 4FMTA 2ILMA 3G80A 1YIJV 1SS3A 3HKBA 4GUNA 4TV9A 5LGTA 2P67A 1FXHA 2LW7A 4AILC 1VQNV 4LFBB 1SQGA 2Y0PA 3J81N 4DR2B 3JALB 4B7KA 3ZX6A 5KAIZ 1AR1B 2HR3A 3D36A 5GONA 5L3BA 1PKXA 3DXRA 3AG1C 1AJPA 4U3JB 1HWYA 4FPPA 1TA8A 1ZTEA 3UO2A 1SERA 3CC7V 1PD3A 1ZSPA 4NTWA 1KU9A 5C93A 2WA3A 4JI5B 3DC5A 2H94A 2Y4TA 3G71V 3TJTA 4PDMA 3U11A 4NKGB 2ZNIA 1VQLV 1GO3F 3EFFK 4O2AA 2DYRC 2Q67A 4DV2B 2EIJC 1Q86W 1QR8A 4R6ZA 4WFEA 1BSMA 3JYCA 4JASA 1LUVA 2D3OW 1GTOA 2CH7B 2UUBB 2EJRA 1S3JA 1OCOB 5JWPA 4NXNB 3JD0A 2DOSA 2PYJA 4B3MO 4YJ3A 3ETEA 2DW4A 3LDCA 4Q20A 2UXCO 3MDSA 1XMOO 3F5WC 4EFEA 4WFFA 3RVYA 3CXCU 2D2CB 2PTMA 4IHJB 1R6TA 3ZMSA 4UCVA 1Y6XA 3AG3B 1SKVA 4E2LA 2Q7GA 4EKWA 2ZR2A 3C3SA 2VQFO 3CRRA 3K9AA 3WB1A 5GW7A 4F6RB 2XTAA 4X1IA 4ZHQB 3ETQA 3FD9A 2YICA 1ZWIC 1NBMG 4B3TB 5HFLA 3IGAC 5JJEB 1XL6A 4MT8A 1FKAO 3GWKC 3RW0A 2XAQA 4B7EA 2AZ0A 3QO7A 1B06A 4FFKA 2QWQB 1YJNV 2ZQMA 3CCMV 4KFMA 4LF4B 4U3FH 2CAZC 4K3AA 3FYEB 3A0HZ 1VQ6V 3STLC 2R72A 2MK3A 1BHAA 2EILB 3CYOA 3BA9A 5IYBO 3X2QC 3ZRWB 5IYDO 4EB6B 2XNDG 1RPOA 4JI4O 1R6NA 3P30A 3QTCA 5IJ0A 3I56V 2BSKA 1ZL8A 2OIGA 2QWOB 4HYOA 3SPIA 3R65A 4AI8A 4IGGA 1R3KC 2DQ0A 2ZXWB 3CWBH 1N32O 4DR4O 1XMQO 2OTLV 1FJGB 1WB8A 4U3JA 3ETDA 2PI5A 1M4UA 3ICXA 5DM6V 2ARHA 3TXQA 4K0KO 3K06A 1SA0B 1XEQA 1K5SA 2IH1C 4P9PA 4ZOLB 3ZMZA 4BW9A 2F43G 2OT5A 2N74A 3R66A 2E76B 2LGWA 4DW0A 2W0FC 1GRJA 3K58A 1JR9A 3ZHTA 5IJ9B 2F1MA 4B3RO 1UPGA 4BWAA 5A2QN 1ROPA 1VF6A 1EN4A 1Q3EA 2ZCEA 1TVKA 1JJOA 4IT5A 4O2BA 3CJHB 1G1XB
chains in the Genus database with same CATH topology
1R3JC 3VBBA 1B6QA 1P4RA 3PJSK 4U7NA 4MW8A 2IJHA 2JEXA 1M9NA 4MW3A 2EINC 3OUFA 4QNHB 5L3EA 4J9ZB 1G8MA 1K34A 3OW2U 3HB3B 2X7RB 4DXWA 2ZD9A 5EBWC 2FTKA 2LP7A 3ABUA 2V7QG 3E8BA 3ABTA 3X2QB 3OEHG 2WLKA 5E1AC 1EFRG 3F7VC 1WPXA 2A79B 5B1AC 3SYOA 5L3GA 2WLHA 3ASNC 3FKSG 1M56C 4H33A 3QO8A 3W7UA 3SPCA 1H38A 1K3EA 2XAJA 1MOFA 4U7OA 2BOCC 1PNMA 3CD6V 2HVKC 4XDKA 2CK3G 2JEUA 3FB8C 5L3DA 5H6QA 1NR7A 1BL8A 1CP9A 1OCZB 3E35A 3RBZA 1YJ9V 3OR7C 1RM1B 4JPRA 1YJWV 5B1BC 5L3FA 1M1KW 4RQEA 4PA6A 1BMFG 5H6RA 2AHZA 2WLJA 2EZPA 2Q6AA 3T2MA 4QPJA 1VQOV 2HVJC 1NR1A 3JCZA 2UXNA 5EC1C 2JJ1G 5CBFA 1NVPD 1JPXA 2OTJV 2A0LA 4R50A 1VQ9V 4JAVA 1AJNA 3GWOA 4GCZA 1F23A 1DF5A 4Z1MG 1MSWD 2WAMA 1H2GA 5IY5B 2ITDC 2DWEC 3G4SV 1OCZC 3ZJZA 1K5QA 3CCJV 1I5YA 1V55B 3BEHA 4G28B 2B1IA 3WG7B 1RM1C 3E83A 4MTXA 4ZBMA 1RPRA 3UM7A 4N21A 4J9YB 1GM9A 3ZMVA 3W7XA 2H8PC 1M57B 2XAFA 3QNEA 3OE7G 2P6JA 3P32A 1NJIW 3JD3A 2Z3YA 2YEVB 1Q82W 2W6JG 1V54B 3AEIA 4JYBA 4WFGA 1GK9A 2IU3A 3OGCC 4P9OA 3MHSC 3OEEG 1QVGU 1QCEA 4GT1A 4PELA 2EZOA 5B1OA 1VQKV 2IH3C 1S77D 1K8AW 1CEZA 1E1RG 2DQ3A 2YEVA 3B77A 4YXWG 2IU0A 1Q81W 3F7YC 4MSWC 1YTFB 2EINB 4LP8A 3TK1A 1ORQC 4BIZA 5IY5C 3W7WA 3T1CA 5IYCO 1VQ5V 3DTUB 1H8EG 1V55C 3OMNB 3EHBB 5EBLC 3WG7C 2GHYA 3HPLC 4TT3G 5B3SB 1OCCB 3ZMTA 1FFTB 5KA6A 1F51A 4HAMA 4R8CA 1JVMA 2B5UA 2IJIA 4LC1A 4N23A 4JTCB 2DYSB 5B1AB 1M57C 2X6AA 3MD0A 1JQ0A 3SPJA 1OHHG 4MTOA 5LGNA 1M56B 1NQTA 2EIKB 4XDLA 4GX0A 1DF4A 2WLNA 4HZ3A 3OM3B 4PDVA 2WLLB 3ABKC 2IW5A 3K0DA 2XAGA 5IDJA 4RO2A 1W0JG 2P90A 2EBOA 3ZN0A 3DGEA 1FXKC 1KECA 2IJKA 1SZTA 4RQFA 3LDDA 3ABLB 1EBOA 3W7SA 1EZJA 2C2AA 1VQPV 1KKDA 4MVZA 4GX1A 5B1BB 4GX5A 3K79A 2WLLA 2LFRA 3LDEA 1THZA 1QLEB 1YI2V 1Y66A 1QR9A 4R7CA 3CCLV 2Y48A 3SPHA 2Q68A 5B3SC 3OAAG 1OCCC 4P2ZA 3I55V 2DYSC 4MS2A 2A9HA 2JDIG 3E86A 1S5HC 2EIKC 2QA4V 4LBEC 1K33A 4BAYA 1JX9A 2M7WA 3WFVA 4X89A 5B1NA 2QM8A 1R73A 3CP1A 2X6BA 5L3CA 2HJFC 4RUEA 3ZIAG 1AROP 1PNKA 1P7BA 4X8AA 4ASUG 4PA7A 3ABLC 1OCOC 4RAIA 4XDJA 1K9MW 2YSUB 2PI4A 1IXMA 1FS0G 4JYCA 1QLEC 3T4DA 2WWWA 3ML0A 3LSQA 4BIUA 3D3IA 3CCQV 1S72V 4PA3A 1K4DC 4F4LA 3A0RA 1GMGA 3BY6A 1WLEA 3CCUV 4MVRA 4CBCA 3ZRSA 5CBGA 4JF3A 1OZ0A 1PNLA 2WLMA 3CCVV 5LBQA 3CMAV 3AG4C 5KUKA 4UVCA 3E2EA 2X6CA 3LNMB 3MHHC 3OMIB 3ETGA 3JD2A 2JJ2G 4FMTA 1YIJV 4WFAV 2AHYA 5LGTA 2P67A 4MVOA 4UVBA 2QE7G 3OR6C 4LCUC 1NVPB 1S0VA 3LSSA 4GX2A 3K0GA 1FXHA 1VQNV 4JTAB 2B1GA 4WF9V 1COWG 1GKFA 4H37A 1AR1B 2HR3A 3D36A 3ASOB 5L3BA 1PKXA 3IFXA 2XAHA 3AG1C 4UUJC 1AJPA 4FPPA 1HWYA 2DWDC 3ABKB 3E8FA 2ZDIC 1SERA 3CC7V 1R3IC 3STZC 1PD3A 2WLIB 4MTFA 1K4CC 4MVQA 1FXKB 5C93A 1NKDA 4QJFB 2H94A 4TWKA 3CPWU 3OUSA 3G71V 2EILC 5CMUA 1VQ4V 1CPYA 3IC7A 1PL0A 4UV9A 4PDMA 5KUMA 5BZBA 1GM7A 3SYAA 2WLIA 1FXKA 1N8RW 2EIMC 4WCEV 1SRYA 2V1DA 1VQLV 3NXSA 2ZR3A 4JGSA 1GO3F 2GSMB 2P7TC 2BOBC 3EFFK 2JIZG 3OFNG 5H9CA 1AI6A 5LHIA 1GM8A 2DYRC 1Q7YW 2Q67A 3H01A 1W2BU 1MG1A 3ASOC 3ZN1A 4BW5A 3AG2B 2EIJC 1Q86W 3SYCA 3QO5A 3RVZA 1QR8A 2HG5C 1W0KG 2Q69A 4R6ZA 4WFEA 1TUEB 3JYCA 4L87A 1F4NA 1JJ2U 4JASA 2QEXV 1K7DA 4PA4A 4UV8A 5DN6G 2D3OW 1GTOA 3FB7C 3GB7C 1J95A 2EJRA 2JK5C 1S3JA 1OCOB 3E8GA 4RUFA 2HKOA 3JD0A 3M99B 4G27B 1K97A 1YHQV 4MVMA 1OCRB 3ZRVA 1K92A 4I9WA 3FYIB 3ETEA 2DW4A 3LDCA 3JD4A 4Q20A 4X88A 2QTOA 2WPDG 3CCRV 5LGUA 4UXNA 4MVUA 3VOUA 4UVAA 3F5WC 1JOYA 4WFFA 3RVYA 3CXCU 2Y69C 1UJWB 5EK0A 1KQSU 3K03A 3ZMSA 5LHGA 3AG2C 3AG3B 2ITCC 2NNUA 3AG4B 3FB6C 5CN0A 4E2LA 4EKWA 2W6IG 2ZR2A 3OMAB 1YITV 1ENVA 4QPKA 3K9AA 2XOKG 4I5SA 3ABMC 4OXSA 2HLDG 2K1EA 1E1QG 1NH2D 5GW7A 3CCSV 3ZCCA 4TSFG 1S76D 1ZWIC 4WFHA 4KP4A 1BHBA 1NBMG 3B8NA 4FIPC 4XBFA 3K04A 5HFLA 1OCRC 1SETA 3T4ZA 3IGAC 4PA9A 1XL6A 4MT8A 1QLNA 3RW0A 1QBZA 2XAQA 4FJCC 1NH2B 3AG1B 3K08A 3QO7A 4QE9A 4JTDB 1YJNV 2ZQMA 3CCMV 4KFMA 1KP3A 3TETA 3FYEB 3AG3C 1VQ6V 4PDLA 1QVFU 3STLC 1LNQA 3E89A 3E8HA 2MK3A 5J9PC 1BHAA 2EILB 2ZDIA 4QE7A 3W7TA 1R3LC 2HFEC 5FL7G 1DTOA 2R9RB 3CYOA 5EC2C 2EIMB 5IYBO 3X2QC 2QM7A 3ZRWB 1G4YB 5IYDO 1DLBA 1F4MA 1XL4A 2OCCB 1H8HG 1FXVA 2XNDG 1RPOA 2X0LA 1VQ7V 2DYRB 2ATKC 1R6NA 3P30A 3I56V 3K3WA 2EIJB 4HYOA 3SPIA 3R65A 3ZRWA 1Y4MA 2UXXA 5EBMC 4CZZA 3UKMA 1R3KC 3TCUA 2DQ0A 2ZXWB 1SESA 1VQMV 4MTGA 4FK5C 1VQ8V 2OTLV 4WFBV 2KB1A 4G2KA 3ETDA 1YTFD 4MVSA 5KA5A 2PI5A 5DM6V 3SYPA 3SPGA 4KUMA 5CA3A 1MABG 1KC8W 3FB5C 3K06A 2OCCC 1KD1W 1AI7A 1E79G 2Y69B 3CC2V 3ZMUA 1R6KA 4ZKIA 1K5SA 4P30A 2QKSA 2IH1C 5LHHA 4P9PA 3KG2A 2Z5UA 3ZMZA 1KP2A 2F43G 2OT5A 3B8MA 1M90W 4JAUA 4PDRA 2W0FC 1L1FA 1I5XA 2XASA 3ABMB 1AI5A 3CMEV 2ZXWC 1JCHA 2R9IA 3LUTB 3CCEV 3G6EV 3ZRXA 2NLJC 1YSCA 3SJQC 5CBHA 1AI4A 2LFSA 1ROPA 3CC4V 2WSSG 3ASNB 1K73W 3JD1A 2IJJA 1V54C 4DO2A 3SYQA 1AJQA 4QIWF 5HFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYO A;  4FK5 C;  2EZP A;  4N21 A;  1K33 A;  1I5X A;  2EBO A;  4G2K A;  2M7W A;  5CMU A;  3WFV A;  1QBZ A;  4FJC C;  5CN0 A;  1MOF A;  1DLB A;  4E2L A;  1SZT A;  1EBO A;  3CP1 A;  5KA5 A;  1ENV A;  2P6J A;  4JF3 A;  3K9A A;  1JPX A;  3B8M A;  3M99 B;  5KA6 A;  3P30 A;  1K34 A;  4JGS A;  2X7R B;  4N23 A;  3GWO A;  3MHS C;  1Y66 A;  5H9C A;  1Y4M A;  1JQ0 A;  1QR9 A;  3MHH C;  4JPR A;  1QCE A;  2LP7 A;  1F23 A;  2EZO A;  1DF5 A;  3H01 A;  1DF4 A;  1MG1 A;  2MK3 A;  3B8N A;  4FIP C;  5HFL A;  3B77 A;  1I5Y A;  5HFM A;  2OT5 A;  1QR8 A; 
#chains in the Genus database with same CATH topology
 1R3J C;  1B6Q A;  4MW3 A;  1IBL B;  3OUF A;  1NTK H;  5L3E A;  4J9Z B;  4UCT A;  4DXW A;  2QKC A;  5EBW C;  4JI7 O;  5B5E Z;  3JAK A;  1Y74 B;  1EFR G;  4YY3 O;  2WLH A;  1AR5 A;  3ASN C;  2UU9 O;  2A7W A;  1IBK O;  4JI6 O;  4F6R A;  5ITZ A;  3SPC A;  3RWR D;  1H38 A;  4U7O A;  2BOC C;  4DV6 O;  4H0L B;  3CD6 V;  4XDK A;  2UXC B;  3L9D A;  4I4T B;  5KHG A;  3E35 A;  1BS3 A;  1BE3 H;  4O4I A;  5FNV A;  4UB6 Z;  2Y4U A;  5L3F A;  5FLX N;  1IBM B;  1H2L A;  4IL6 Z;  3JAS B;  2GTA A;  3FAV B;  3OTF A;  2VWJ A;  2Q9L A;  3T2M A;  3WB0 A;  1N0N A;  3WB2 A;  1IZ3 A;  1XRE A;  1VQO V;  2UXN A;  2HHH O;  3M8A A;  4I55 B;  5LP6 A;  3N27 A;  3C3T A;  1JFF A;  3TXS A;  1AJN A;  4YHH B;  3K5M A;  3Q4H A;  2GUZ A;  3OTO B;  4GCZ A;  2QR4 A;  1SZX A;  4Z1M G;  2UUC O;  2WAM A;  5IY5 B;  3G4S V;  1OCZ C;  5TIS Z;  3ZJZ A;  4FZ1 A;  1PPJ H;  4J9Y B;  4NXM B;  3ZMV A;  2O57 A;  3OE7 G;  1NJI W;  2YEV B;  1Q82 W;  3AEI A;  4WFG A;  4UCS A;  1PV0 A;  3OGC C;  3OEE G;  1VEW A;  3CE2 A;  4PEL A;  2EZO A;  5B1O A;  2IH3 C;  4GZR B;  4DR3 B;  2QDO A;  3B77 A;  1QHT A;  1WAZ A;  2EIN B;  1RP3 B;  4JI1 O;  4DV3 O;  4LP8 A;  5GTI Z;  4NVP A;  3W7W A;  1LUW A;  3OMN B;  5IT9 N;  1P7G A;  3WG7 C;  3RYC B;  4TT3 G;  5B3S B;  1I94 B;  4ZOL A;  5KA6 A;  2VQE B;  4R8C A;  2B5U A;  3K5L A;  4LC1 A;  4N23 A;  2DYS B;  5B1A B;  1M57 C;  1OHH G;  1WA8 B;  5LGN A;  1NQT A;  3T1Y O;  4DR4 B;  1XMQ B;  1DF4 A;  3OGI B;  4LH7 A;  4DV4 O;  4PDV A;  4JZG A;  2EBO A;  4K0K B;  5JCO C;  1EZJ A;  1QNM A;  4GX1 A;  3K79 A;  2UXB O;  3SPH A;  2Q68 A;  3OAA G;  3CSX A;  4CH5 A;  3J80 N;  3I55 V;  4MS2 A;  2A9H A;  2YI9 A;  2EIK C;  2XHB A;  4LBE C;  4B3R B;  2CTW A;  1R73 A;  2X6B A;  1SF9 A;  2UUA B;  4LH6 A;  1OCO C;  4RAI A;  4XDJ A;  3JAW B;  4IIJ B;  5E79 Z;  5LXT B;  2OWO A;  1FS0 G;  2KG7 B;  4DR5 B;  4BIU A;  3RGB A;  4PA3 A;  1U97 A;  4I50 B;  3A0R A;  1WLE A;  4AQY O;  3OT7 A;  5CBG A;  1OJH A;  1PNL A;  3HKB B;  2LW1 A;  4OX9 O;  4TV9 B;  2QWP B;  3K9S A;  3RFR A;  3CMA V;  1IDS A;  2ZIN A;  5KUK A;  2X6C A;  1N34 B;  3ETG A;  4CS2 A;  4WFA V;  2AHY A;  5GON B;  4UVB A;  2AW9 A;  2YS8 A;  4X65 O;  2CGN A;  1S0V A;  3DXR B;  2ZE7 A;  1HNZ O;  1MNG A;  1COW G;  3CB2 A;  2N05 A;  4LFC O;  3K59 A;  3A8T A;  1DK1 A;  1Q6I A;  4UUJ C;  3GVM A;  2ZDI C;  2EUL A;  4WBN A;  4MVQ A;  1K4C C;  4J42 A;  1XBL A;  4FLX A;  4BR6 A;  1NKD A;  3CPW U;  4O2A B;  1X59 A;  2EIL C;  5CMU A;  3ZHU A;  1CPY A;  3IC7 A;  1PL0 A;  3NR7 A;  4UV9 A;  4JI2 B;  4LR3 A;  2UUC B;  4J7J A;  4LFA O;  5D5P A;  2GSM B;  2YIB A;  1AI6 A;  1AR4 A;  5LHI A;  5LYJ A;  3H01 A;  1W2B U;  1MG1 A;  3ASO C;  5CA0 A;  3ZN1 A;  3AG2 B;  1I08 A;  4O4J B;  3SYC A;  4ZIB A;  3RYC A;  1GN3 A;  4K35 A;  2RJZ A;  4L87 A;  5BXZ A;  1JJ2 U;  1BQ0 A;  4PA4 A;  4LF8 B;  4UV8 A;  4LF5 O;  4TQF A;  3D3Q A;  2RN9 A;  2L35 A;  4MVM A;  4RWU A;  1K92 A;  3FYI B;  4X88 A;  3A2F A;  5LGU A;  3VOU A;  4UVA A;  3J7A U;  1V9P A;  2JVD A;  1UJW B;  5EK0 A;  1KQS U;  4X1I B;  4JV5 B;  2FYU H;  4YIP A;  4DV7 B;  5CN0 A;  3FB6 C;  4CS3 A;  1ENV A;  4LNU A;  4QPK A;  4EFB A;  1NH2 D;  1SC5 B;  3CCS V;  4DR7 B;  2UXD O;  1H2M A;  4TSF G;  1S76 D;  1P84 F;  1BHB A;  3B8N A;  4X9Q A;  3K04 A;  1OCR C;  1SET A;  4PA9 A;  5BR8 B;  2DMX A;  1HNW O;  4QE9 A;  4JTD B;  5KLV H;  3B09 A;  4KHP O;  5JVD B;  1FPO A;  3AG7 A;  4PDL A;  1Y67 A;  2PY5 A;  1LNQ A;  3E8H A;  4X62 B;  5J9P C;  3W7T A;  1R3L C;  3QVN A;  1MZF A;  1PM9 A;  2ODM A;  3H9V A;  5IJ0 B;  2QGN A;  1ZLZ A;  1ZL8 B;  2BSK B;  4OGQ B;  5EC2 C;  1BCC H;  1H8H G;  4D7T A;  2X0L A;  4X20 A;  1VQ7 V;  4F6E A;  4IYH A;  4GKJ B;  1YCI A;  3G67 A;  1D5N A;  2UXX A;  1YZB A;  4JYA O;  2HEP A;  4JI8 O;  4FK5 C;  1VQ8 V;  4OX9 B;  2FL4 A;  1T5E A;  2IBZ H;  4B08 A;  2OCC C;  2PUS A;  3ZMU A;  4P30 A;  1M90 W;  2HJD A;  4JAU A;  2AXT Z;  1L1F A;  5EZY A;  3ABM B;  1AI5 A;  3CME V;  1TVK B;  4O4J A;  3G6E V;  3SJQ C;  4NR1 A;  4O2B B;  2E74 B;  3MAQ A;  3N2G A;  3CC4 V;  3T1H B;  4TUY A;  1CXZ B;  3SYQ A;  3VQW A;  4QIW F;  4X1Y A;  2KQX A;  3VBB A;  3HKC A;  3PJS K;  4U7N A;  4MW8 A;  4LF6 O;  2IJH A;  1M9N A;  2IM9 A;  3JAK B;  2EIN C;  4QNH B;  2Q8V A;  2ZE5 A;  3OW2 U;  3ZHS A;  2X7R B;  5ITZ B;  5IWA O;  2XUM A;  1HR0 O;  1H2N A;  2V7Q G;  1N0J A;  3E8B A;  3U10 A;  3OEH G;  5L3G A;  3SYO A;  5B1A C;  1WPX A;  2A79 B;  1HNX O;  3FKS G;  3EVK A;  4H33 A;  3QO8 A;  3W7U A;  4YJ2 A;  4O4I B;  5FNV B;  4LF9 B;  1MOF A;  2H3O A;  2HVK C;  2ADQ B;  3UCS C;  4LF7 O;  2AZ2 A;  3RBZ A;  1NT2 B;  1UFI A;  3H1J H;  2DJV A;  4RQE A;  4PA6 A;  1BMF G;  5LP6 B;  1JFF B;  4J11 A;  1GH6 A;  1URF A;  5JVD A;  4J41 A;  3LSU A;  3Q4H B;  2GUZ B;  4QPJ A;  1NR1 A;  3JCZ A;  3K5O A;  4FM0 A;  4R50 A;  2YDE A;  4JAV A;  3F5T A;  1WJZ A;  1YXB A;  1XIL A;  4TOI A;  2BE3 A;  1H2G A;  2CTR A;  1I5Y A;  1V55 B;  3BEH A;  4G28 B;  4PV1 B;  2B1I A;  4DV5 O;  2ZM6 O;  1RM1 C;  3UM7 A;  5IE9 A;  3W7X A;  2H8P C;  4E4E A;  4JYY A;  3P32 A;  2P6J A;  1XNR O;  3JD3 A;  5JH7 A;  2W6J G;  1V54 B;  4JYB A;  3KKY A;  2YXH A;  1GK9 A;  5A9G A;  1J5E O;  1FFX A;  1CEZ A;  1E1R G;  4FLW A;  4YXW G;  2VRZ A;  2ZT9 B;  1Q81 W;  3F7Y C;  4MSW C;  4JI0 O;  3AK1 A;  2M6Y A;  1EN5 A;  4DV1 O;  3KZI Z;  5EBL C;  3HPL C;  1OCC B;  1FFT B;  1H2K A;  2IJI A;  1ZAU A;  5KHJ A;  5LOV B;  3QF7 A;  1B04 A;  1JQ0 A;  5LMU O;  4DK1 A;  3L72 H;  4GX0 A;  4HZ3 A;  2WLN A;  2RCV A;  4FM2 A;  2IW5 A;  3K0D A;  2YI8 A;  4RO2 A;  1W0J G;  1KEC A;  3LDD A;  3ABL B;  1EBO A;  3ZBH A;  2C2A A;  1VQP V;  1KKD A;  1QU7 A;  4GX5 A;  1IVS A;  2WLL A;  1IX9 A;  1GN4 A;  1QLE B;  1MZE A;  2BTQ A;  1WP7 A;  2A06 H;  4JZ2 A;  4FLU A;  4CC5 A;  3N2K A;  2QA4 V;  5B1N A;  1KB9 F;  4B3M B;  4UFZ A;  4JI3 O;  1XMO B;  1ARO P;  1P7B A;  4PHZ A;  4PI0 A;  4X8A A;  4CC6 A;  3IAY A;  3APQ A;  2P5O A;  1AP5 A;  1I0H A;  3H1H H;  1N36 O;  2FKX A;  3LSQ A;  3D3I A;  2VQF B;  1NTM H;  4F4L A;  3SGI A;  3BY6 A;  1SQV H;  3ZHR A;  2JGD A;  3ZRS A;  1HR0 B;  5JQG B;  2R70 A;  1H2S B;  3CCV V;  1SQX H;  1N33 O;  4NTX A;  2F4V O;  3JD2 A;  2JJ2 G;  4DRX A;  3CX5 F;  3B40 A;  4GKK O;  2Q0A A;  4MVO A;  2QE7 G;  3OR6 C;  4LCU C;  4GX2 A;  2CE4 A;  4JTA B;  4DR6 O;  4AHC A;  5EYP A;  2B1G A;  4WF9 V;  2VS0 A;  2VWK A;  4WBN B;  4H37 A;  5LMN O;  4H13 B;  3VQX A;  4X1K A;  3ZS8 C;  2F66 C;  3ABK B;  2DWD C;  3E8F A;  3E22 A;  1R3I C;  1U96 A;  4D7S A;  1AB3 A;  1XDC A;  2V4D A;  4QJF B;  3OUS A;  3HR0 A;  4JI4 B;  5C8Y A;  2Y0I A;  5LYJ B;  5BZB A;  3SYA A;  2WLI A;  5CA0 B;  1FXK A;  3L75 H;  1Q8I A;  4JGS A;  3S3X A;  4UCO A;  4B3S O;  5H9C A;  1LR1 A;  2Q7E A;  1N32 B;  1GM8 A;  4BW5 A;  5J2T A;  5CB4 A;  1ZUQ A;  1TUE B;  1F4N A;  5LOV A;  4DV0 O;  4X66 O;  4EEQ A;  2WA4 A;  2CGO A;  2JK5 C;  4RUF A;  2HKO A;  3M99 B;  4G27 B;  1K97 A;  1BQZ A;  1Y76 A;  4I9W A;  1XNQ O;  2QTO A;  4X64 O;  3A0B Z;  3CCR V;  4J7K A;  4MVU A;  1WN7 A;  4LNU B;  2PYL A;  1GN6 A;  3RYI A;  1DGS A;  3K03 A;  5LHG A;  2ITC C;  3AG4 B;  2NNU A;  1YEW A;  1Z5V A;  2W6I G;  3OMA B;  4FZ0 A;  5LMU B;  2GV9 A;  2XOK G;  2QM4 A;  3ABM C;  2HLD G;  1E1Q G;  1KMI Z;  1Q6H A;  1TAE A;  3IJ4 A;  4KP4 A;  1GAX A;  3SJA C;  4FIP C;  4XBF A;  3T4Z A;  1M5I A;  4DR1 O;  4DUY O;  1NU1 H;  1QLN A;  1QBZ A;  4FJC C;  2JGU A;  4K8Z A;  2LO1 A;  3ZHQ A;  4JI7 B;  3BFR A;  4DR2 O;  3TET A;  3AG3 C;  2FML A;  4KXR A;  3D8C A;  3E89 A;  4YY3 B;  3UQ8 A;  2UU9 B;  4JI6 B;  1IBK B;  4QE7 A;  4X20 B;  3CEI A;  5JQG A;  5FL7 G;  1DTO A;  2OYQ A;  2Q0O C;  4DV6 B;  2EIM B;  3L74 H;  4W4K A;  4J10 A;  4JI5 O;  1Q90 D;  3BRC A;  1WNS A;  1XL4 A;  5KMG A;  2KKW A;  2AGA A;  3VQV A;  3K3W A;  4NYK A;  1N36 B;  5EBM C;  4CZZ A;  4UB8 Z;  1XOU A;  1D5A A;  4CH6 A;  3JAR A;  1VQM V;  3B4S A;  4MTG A;  4DV2 O;  2HHH B;  2DE0 X;  4WFB V;  1F7Y A;  1L0N H;  3RYH A;  4D6T H;  5LP6 C;  4MVS A;  2Z0A A;  5KA5 A;  2NN4 A;  4TV8 A;  2F4V B;  3SPG A;  2UUB O;  3EXA A;  1MSD A;  1MAB G;  3H1L H;  4NXN O;  1XQ8 A;  5EZY B;  1E79 G;  2Y69 B;  1GN2 A;  5LHH A;  3KG2 A;  4J7Z A;  4ABM A;  1KP2 A;  1KUQ A;  1WB7 A;  3N2G B;  4TUY B;  5AG2 A;  2XAS A;  5LMN B;  4CH3 A;  3JSN A;  2ZXW C;  1JCH A;  3CCE V;  3RN4 A;  2CDY A;  3ZRX A;  2NLJ C;  3BHP A;  4X1Y B;  5CBH A;  2LFS A;  5CA1 A;  3HKC B;  3JSL A;  1AP6 A;  3ASN B;  1K73 W;  3VQY A;  3H1I H;  3JD1 A;  2E3C A;  2P4K A;  2IJJ A;  1V54 C;  4JI1 B;  3HKE A;  4DV3 B;  3CXH F;  4FM1 A;  1AJQ A;  4J80 A;  4B3T O;  2Q4P A;  2YIA A;  3CHX A;  5EIB C;  1SQB H;  3L73 H;  5BY1 A;  2ADP A;  1YDX A;  1FYJ A;  3T1Y B;  1K34 A;  1VP7 A;  3HB3 B;  2ZD9 A;  4Z1V A;  2G38 A;  4YJ2 B;  2FTK A;  2LP7 A;  4DV4 B;  4LF4 O;  4ZI7 A;  3ABT A;  1NZ6 A;  2WLK A;  4H44 B;  3OD4 A;  4O4L A;  2LJ2 A;  1Z2G A;  2RMK B;  1K3E A;  2XAJ A;  2UXB B;  2JEU A;  3FB8 C;  5L3D A;  1QQC A;  1BL8 A;  1CP9 A;  1OCZ B;  3BVO A;  2E5L O;  3HKD A;  3THO A;  1YJW V;  5D5Q A;  1M1K W;  3JCU Z;  5KX5 B;  2WLJ A;  2EZP A;  3SDL A;  1A32 A;  5IYZ B;  2YC0 A;  1MMM A;  4I9Q A;  1HW7 A;  1FJG O;  2OTJ V;  2A0L A;  1VQ9 V;  2ETN A;  4JAA A;  1SQF A;  2ZE8 A;  2GDS A;  4DUY B;  1RSO A;  2DWE C;  5LA6 A;  3CCJ V;  5JH7 B;  3WG7 B;  4MTX A;  4ZBM A;  4AQY B;  2Q73 A;  4N21 A;  4C7U A;  1M57 B;  1HP8 A;  2XAF A;  1FFX B;  2YIB D;  2IU3 A;  2Q7H A;  3MHS C;  1QVG U;  5JJJ B;  2YXY A;  4X65 B;  3IC9 A;  4ICG A;  1HNZ B;  1YTF B;  2YXL A;  3S3W A;  5BMV A;  4LFC B;  1TUB A;  1ORQ C;  5IY5 C;  3T1C A;  2XT9 A;  5IYC O;  3DTU B;  3EHB B;  3L71 H;  2YID A;  3ZMT A;  1F51 A;  2F23 A;  4HAM A;  1IBL O;  4JTC B;  2X6A A;  3SPJ A;  3I5D A;  4MTO A;  1M56 B;  2EIK B;  2QWN B;  3OM3 B;  2WLL B;  3ABK C;  1Q6U A;  2BTQ B;  2P90 A;  1SZT A;  3W7S A;  4LFA B;  4MVZ A;  5B1B B;  1P49 A;  3LDE A;  4QGP A;  1THZ A;  1YI2 V;  3N2K B;  5B3S C;  3O65 A;  4P2Z A;  1US6 A;  4HNA A;  2DYS C;  4LF5 B;  2JDI G;  3E86 A;  1S5H C;  5KAF Z;  2LQT A;  1IBM O;  4BAY A;  1JX9 A;  2F93 B;  2M7W A;  3WFV A;  4FLV A;  3CP1 A;  5L3C A;  3BPZ A;  4FLY A;  4PA7 A;  1TGO A;  4HBN A;  2B9Z A;  1PP9 H;  4YHH O;  3OTO O;  2JGD B;  2YSU B;  4JYC A;  3CCQ V;  1S72 V;  4FLT A;  1XUQ A;  1GMG A;  2R9A A;  3BA8 A;  4CBC A;  4DRX B;  4JF3 A;  3TGU H;  4LWS A;  1OZ0 A;  2JS3 A;  4NXM O;  2UXD B;  2WLM A;  2ZNJ A;  5LBQ A;  5KX5 A;  2OCH A;  3AG4 C;  3LNM B;  1NTZ H;  4NB5 A;  5IYZ A;  3OMI B;  1FD9 A;  4DW1 A;  5EYP B;  2OIE A;  3WU2 Z;  3RYF B;  1G6U A;  3UT5 A;  3L70 H;  4X1K B;  4DR3 O;  2KSD A;  2Q5Z A;  1NVP B;  1HNW B;  3LSS A;  3K0G A;  4KHP B;  3E22 B;  2E5L B;  1GKF A;  2PGG A;  3CS5 A;  4I0X B;  1I7F A;  3ASO B;  4UCR A;  3IFX A;  2DN9 A;  2XAH A;  1I94 O;  2VQE O;  5C8Y B;  1VF7 A;  3JAL A;  3STZ C;  4MTF A;  2WLI B;  2PF4 E;  1Q5O A;  1FXK B;  4TWK A;  1L0L H;  1IXB A;  1VQ4 V;  2GBO A;  4DK0 A;  5KUM A;  1GM7 A;  3D36 C;  2ZIM A;  1S5J A;  4DUZ O;  4IYI A;  2EIM C;  5J2T B;  1N8R W;  5JCO A;  4WCE V;  1SRY A;  1VIB A;  2V1D A;  5GTH Z;  3AK2 A;  5CB4 B;  3NXS A;  2ZR3 A;  4JYA B;  2P7T C;  3OFN G;  2BOB C;  2JIZ G;  2NR5 A;  3CRC A;  5J2U B;  1Q7Y W;  4JI8 B;  3QO5 A;  3RVZ A;  1XHZ A;  4BIO A;  5B66 Z;  2K9P A;  2HG5 C;  1W0K G;  2Q69 A;  1Y76 B;  2QSA A;  3FX7 A;  2QEX V;  1K7D A;  5DN6 G;  3FB7 C;  1IUR A;  3GB7 C;  1J95 A;  3E8G A;  4O4H B;  1YHQ V;  1OCR B;  3ZRV A;  3RYI B;  5JJN B;  3JD4 A;  2UUA O;  2WPD G;  2CH7 A;  4UXN A;  5KHH A;  1JOY A;  3LNN A;  1VAR A;  2Y69 C;  3AG2 C;  4DR5 O;  1YIT V;  3K5N A;  1FAF A;  4UCU A;  4I5S A;  4OXS A;  2K1E A;  4IHJ A;  2A3Q A;  3SJB C;  1O9G A;  5H2F Z;  2E75 B;  3P3P A;  3ZCC A;  4WFH A;  1KYO F;  1N34 O;  4LF6 B;  1WPB A;  1PL4 A;  4ZHQ A;  2MW2 B;  1NH2 B;  3AG1 B;  3K08 A;  2W0X A;  5IWA B;  3BAB A;  2YUA A;  1KP3 A;  2CUG A;  3CRQ A;  1QVF U;  4Z2W A;  1HNX B;  1B3Q A;  1EZV H;  2ZE6 A;  5KMG B;  2ZDI A;  5K1X A;  2HFE C;  2R9R B;  3UO3 A;  2GTS A;  3SR2 C;  2QM7 A;  1G4Y B;  4LF7 B;  1DLB A;  3U0Z A;  1F4M A;  2OCC B;  1FXV A;  4A5U B;  2DYR B;  2L6L A;  2ATK C;  3RYF A;  4KL1 A;  4JI2 O;  2EIJ B;  3JAR B;  3ZRW A;  1Y4M A;  3RYH B;  1KBH A;  4OPH A;  2QKA A;  3UKM A;  4EB6 A;  3JAT B;  1JMK C;  2P06 A;  4I0X A;  3TCU A;  4FFB B;  4TV8 B;  1SES A;  1XI1 A;  3AK3 A;  2KB1 A;  4G2K A;  5F2V O;  1R1B A;  1YTF D;  2QWR B;  4LF8 O;  3SYP A;  4KUM A;  5CA3 A;  1KC8 W;  3FB5 C;  4FVM A;  1Q43 A;  1KD1 W;  5FPO A;  1AI7 A;  3CC2 V;  1R6K A;  4CH4 A;  2ZM6 B;  4DV5 B;  4ZKI A;  2QKS A;  4Q6G A;  2Z5U A;  3B8M A;  1X4T A;  5CA1 B;  1XNR B;  2P4V A;  4PDR A;  1I5X A;  1SA0 A;  1S5L Z;  1YVW A;  2RQ6 A;  2RNB A;  5J2U A;  2R9I A;  3P3N A;  3HKE B;  3LUT B;  4JV5 O;  3ZHV A;  4DV7 O;  1J5E B;  1YSC A;  5KHK A;  1KKC A;  5H5N A;  1AI4 A;  2WSS G;  1XHX A;  2EX3 A;  5IJ9 A;  1AIL A;  4DO2 A;  4L8J A;  4DR7 O;  4JI0 B;  4O4H A;  2BCC H;  2F95 B;  2FB5 A;  5HFM A;  2QTS A;  3G6B A;  4DV1 B;  1P4R A;  1VF5 B;  4DUZ B;  2JEX A;  2HP8 A;  4ZI7 B;  5BR8 O;  3CJH A;  1G8M A;  1NS1 A;  1VF6 C;  3ZED A;  4O4L B;  1WP8 A;  3ABU A;  3X2Q B;  4K8X A;  5E1A C;  3K57 A;  3F7V C;  5LL6 Y;  4X62 O;  1M56 C;  3KCY A;  1MA1 A;  3HKD B;  3BAA A;  3DSQ A;  1PNM A;  4DYL A;  1Y74 A;  2CK3 G;  2JRI A;  5H6Q A;  1NR7 A;  3RT3 C;  1YJ9 V;  2ZIO A;  4LFB O;  3OR7 C;  1EM1 A;  1JA8 A;  1RM1 B;  4JPR A;  5B1B C;  4GKJ O;  2PZS A;  2RDC A;  5H6R A;  4I4T A;  2AHZ A;  3H1K H;  3BCC H;  4I7Z B;  2Q6A A;  3KCX A;  2ZKO A;  4JI3 B;  2HVJ C;  5EC1 C;  1AVM A;  2JJ1 G;  5CBF A;  5KHI A;  1RSO B;  1NVP D;  1JPX A;  3QG5 A;  5LA6 B;  2P22 C;  3JAS A;  3FAV A;  3GWO A;  1F23 A;  4FLZ A;  4PJ0 Z;  1DF5 A;  4I55 A;  1MSW D;  1BGY H;  2ITD C;  1K5Q A;  2LGQ A;  1Z5W A;  3E83 A;  1RPR A;  5EIB D;  4OPA A;  1W59 A;  1GM9 A;  1BZK A;  3QNE A;  4TQD A;  1N33 B;  3JAT A;  1M93 A;  2Z3Y A;  4FFB A;  4YIO A;  1SQP H;  2EJ7 A;  4P9O A;  5BMV B;  4GKK B;  1ZX3 A;  1QCE A;  4GT1 A;  1TUB B;  4W4L A;  1VQK V;  1S77 D;  1K8A W;  3T1H O;  2DQ3 A;  2YEV A;  2IU0 A;  4CS4 A;  4DR6 B;  2CTQ A;  3TK1 A;  4BIZ A;  1VQ5 V;  1D2D A;  1H8E G;  1V55 C;  3DC6 A;  2GHY A;  3APO A;  1JVM A;  3MD0 A;  1N4C A;  1HDJ A;  4XDL A;  2BTO A;  2N04 A;  1VMG A;  3B2E E;  3CRA A;  1YF2 A;  2XAG A;  4NTY A;  4YJ3 B;  5IDJ A;  1WA8 A;  3ZN0 A;  1RFY A;  3DGE A;  1FXK C;  2IJK A;  4RQF A;  5K1P A;  4GYC B;  4B3S B;  4PD4 F;  4LF9 O;  2LFR A;  4HNA B;  1BT8 A;  1Y66 A;  1QR9 A;  4R7C A;  3CCL V;  2Y48 A;  1OCC C;  4PI2 A;  1NI8 A;  3CRM A;  4DV0 B;  1EN6 A;  4X66 B;  1OV9 A;  1K33 A;  4X89 A;  3FFQ A;  2QM8 A;  5DED A;  1XNQ B;  2HJF C;  3SJC C;  4X64 B;  4RUE A;  3ZIA G;  1PNK A;  5DEC A;  5FPR A;  4ASU G;  3ABL C;  1K9M W;  2CTP A;  2PI4 A;  1IXM A;  4LWS B;  3T4D A;  1QLE C;  2WWW A;  3ML0 A;  1SQQ H;  3O9O A;  3M7M X;  4GLX A;  1K4D C;  1L8D A;  2QJ1 A;  3JAW A;  3CCU V;  4IIJ A;  4MVR A;  3C90 A;  5LXT A;  2KG7 A;  3JAM N;  2JS5 A;  3PN1 A;  3UT5 B;  4UVC A;  3E2E A;  4I50 A;  1O9H A;  3MHH C;  4DR1 B;  4FMT A;  2ILM A;  3G80 A;  1YIJ V;  1SS3 A;  3HKB A;  4GUN A;  4TV9 A;  5LGT A;  2P67 A;  1FXH A;  2LW7 A;  4AIL C;  1VQN V;  4LFB B;  1SQG A;  2Y0P A;  3J81 N;  4DR2 B;  3JAL B;  4B7K A;  3ZX6 A;  5KAI Z;  1AR1 B;  2HR3 A;  3D36 A;  5GON A;  5L3B A;  1PKX A;  3DXR A;  3AG1 C;  1AJP A;  4U3J B;  1HWY A;  4FPP A;  1TA8 A;  1ZTE A;  3UO2 A;  1SER A;  3CC7 V;  1PD3 A;  1ZSP A;  4NTW A;  1KU9 A;  5C93 A;  2WA3 A;  4JI5 B;  3DC5 A;  2H94 A;  2Y4T A;  3G71 V;  3TJT A;  4PDM A;  3U11 A;  4NKG B;  2ZNI A;  1VQL V;  1GO3 F;  3EFF K;  4O2A A;  2DYR C;  2Q67 A;  4DV2 B;  2EIJ C;  1Q86 W;  1QR8 A;  4R6Z A;  4WFE A;  1BSM A;  3JYC A;  4JAS A;  1LUV A;  2D3O W;  1GTO A;  2CH7 B;  2UUB B;  2EJR A;  1S3J A;  1OCO B;  5JWP A;  4NXN B;  3JD0 A;  2DOS A;  2PYJ A;  4B3M O;  4YJ3 A;  3ETE A;  2DW4 A;  3LDC A;  4Q20 A;  2UXC O;  3MDS A;  1XMO O;  3F5W C;  4EFE A;  4WFF A;  3RVY A;  3CXC U;  2D2C B;  2PTM A;  4IHJ B;  1R6T A;  3ZMS A;  4UCV A;  1Y6X A;  3AG3 B;  1SKV A;  4E2L A;  2Q7G A;  4EKW A;  2ZR2 A;  3C3S A;  2VQF O;  3CRR A;  3K9A A;  3WB1 A;  5GW7 A;  4F6R B;  2XTA A;  4X1I A;  4ZHQ B;  3ETQ A;  3FD9 A;  2YIC A;  1ZWI C;  1NBM G;  4B3T B;  5HFL A;  3IGA C;  5JJE B;  1XL6 A;  4MT8 A;  1FKA O;  3GWK C;  3RW0 A;  2XAQ A;  4B7E A;  2AZ0 A;  3QO7 A;  1B06 A;  4FFK A;  2QWQ B;  1YJN V;  2ZQM A;  3CCM V;  4KFM A;  4LF4 B;  4U3F H;  2CAZ C;  4K3A A;  3FYE B;  3A0H Z;  1VQ6 V;  3STL C;  2R72 A;  2MK3 A;  1BHA A;  2EIL B;  3CYO A;  3BA9 A;  5IYB O;  3X2Q C;  3ZRW B;  5IYD O;  4EB6 B;  2XND G;  1RPO A;  4JI4 O;  1R6N A;  3P30 A;  3QTC A;  5IJ0 A;  3I56 V;  2BSK A;  1ZL8 A;  2OIG A;  2QWO B;  4HYO A;  3SPI A;  3R65 A;  4AI8 A;  4IGG A;  1R3K C;  2DQ0 A;  2ZXW B;  3CWB H;  1N32 O;  4DR4 O;  1XMQ O;  2OTL V;  1FJG B;  1WB8 A;  4U3J A;  3ETD A;  2PI5 A;  1M4U A;  3ICX A;  5DM6 V;  2ARH A;  3TXQ A;  4K0K O;  3K06 A;  1SA0 B;  1XEQ A;  1K5S A;  2IH1 C;  4P9P A;  4ZOL B;  3ZMZ A;  4BW9 A;  2F43 G;  2OT5 A;  2N74 A;  3R66 A;  2E76 B;  2LGW A;  4DW0 A;  2W0F C;  1GRJ A;  3K58 A;  1JR9 A;  3ZHT A;  5IJ9 B;  2F1M A;  4B3R O;  1UPG A;  4BWA A;  5A2Q N;  1ROP A;  1VF6 A;  1EN4 A;  1Q3E A;  2ZCE A;  1TVK A;  1JJO A;  4IT5 A;  4O2B A;  3CJH B;  1G1X B; 
#chains in the Genus database with same CATH homology
 1R3J C;  3VBB A;  1B6Q A;  1P4R A;  3PJS K;  4U7N A;  4MW8 A;  2IJH A;  2JEX A;  1M9N A;  4MW3 A;  2EIN C;  3OUF A;  4QNH B;  5L3E A;  4J9Z B;  1G8M A;  1K34 A;  3OW2 U;  3HB3 B;  2X7R B;  4DXW A;  2ZD9 A;  5EBW C;  2FTK A;  2LP7 A;  3ABU A;  2V7Q G;  3E8B A;  3ABT A;  3X2Q B;  3OEH G;  2WLK A;  5E1A C;  1EFR G;  3F7V C;  1WPX A;  2A79 B;  5B1A C;  3SYO A;  5L3G A;  2WLH A;  3ASN C;  3FKS G;  1M56 C;  4H33 A;  3QO8 A;  3W7U A;  3SPC A;  1H38 A;  1K3E A;  2XAJ A;  1MOF A;  4U7O A;  2BOC C;  1PNM A;  3CD6 V;  2HVK C;  4XDK A;  2CK3 G;  2JEU A;  3FB8 C;  5L3D A;  5H6Q A;  1NR7 A;  1BL8 A;  1CP9 A;  1OCZ B;  3E35 A;  3RBZ A;  1YJ9 V;  3OR7 C;  1RM1 B;  4JPR A;  1YJW V;  5B1B C;  5L3F A;  1M1K W;  4RQE A;  4PA6 A;  1BMF G;  5H6R A;  2AHZ A;  2WLJ A;  2EZP A;  2Q6A A;  3T2M A;  4QPJ A;  1VQO V;  2HVJ C;  1NR1 A;  3JCZ A;  2UXN A;  5EC1 C;  2JJ1 G;  5CBF A;  1NVP D;  1JPX A;  2OTJ V;  2A0L A;  4R50 A;  1VQ9 V;  4JAV A;  1AJN A;  3GWO A;  4GCZ A;  1F23 A;  1DF5 A;  4Z1M G;  1MSW D;  2WAM A;  1H2G A;  5IY5 B;  2ITD C;  2DWE C;  3G4S V;  1OCZ C;  3ZJZ A;  1K5Q A;  3CCJ V;  1I5Y A;  1V55 B;  3BEH A;  4G28 B;  2B1I A;  3WG7 B;  1RM1 C;  3E83 A;  4MTX A;  4ZBM A;  1RPR A;  3UM7 A;  4N21 A;  4J9Y B;  1GM9 A;  3ZMV A;  3W7X A;  2H8P C;  1M57 B;  2XAF A;  3QNE A;  3OE7 G;  2P6J A;  3P32 A;  1NJI W;  3JD3 A;  2Z3Y A;  2YEV B;  1Q82 W;  2W6J G;  1V54 B;  3AEI A;  4JYB A;  4WFG A;  1GK9 A;  2IU3 A;  3OGC C;  4P9O A;  3MHS C;  3OEE G;  1QVG U;  1QCE A;  4GT1 A;  4PEL A;  2EZO A;  5B1O A;  1VQK V;  2IH3 C;  1S77 D;  1K8A W;  1CEZ A;  1E1R G;  2DQ3 A;  2YEV A;  3B77 A;  4YXW G;  2IU0 A;  1Q81 W;  3F7Y C;  4MSW C;  1YTF B;  2EIN B;  4LP8 A;  3TK1 A;  1ORQ C;  4BIZ A;  5IY5 C;  3W7W A;  3T1C A;  5IYC O;  1VQ5 V;  3DTU B;  1H8E G;  1V55 C;  3OMN B;  3EHB B;  5EBL C;  3WG7 C;  2GHY A;  3HPL C;  4TT3 G;  5B3S B;  1OCC B;  3ZMT A;  1FFT B;  5KA6 A;  1F51 A;  4HAM A;  4R8C A;  1JVM A;  2B5U A;  2IJI A;  4LC1 A;  4N23 A;  4JTC B;  2DYS B;  5B1A B;  1M57 C;  2X6A A;  3MD0 A;  1JQ0 A;  3SPJ A;  1OHH G;  4MTO A;  5LGN A;  1M56 B;  1NQT A;  2EIK B;  4XDL A;  4GX0 A;  1DF4 A;  2WLN A;  4HZ3 A;  3OM3 B;  4PDV A;  2WLL B;  3ABK C;  2IW5 A;  3K0D A;  2XAG A;  5IDJ A;  4RO2 A;  1W0J G;  2P90 A;  2EBO A;  3ZN0 A;  3DGE A;  1FXK C;  1KEC A;  2IJK A;  1SZT A;  4RQF A;  3LDD A;  3ABL B;  1EBO A;  3W7S A;  1EZJ A;  2C2A A;  1VQP V;  1KKD A;  4MVZ A;  4GX1 A;  5B1B B;  4GX5 A;  3K79 A;  2WLL A;  2LFR A;  3LDE A;  1THZ A;  1QLE B;  1YI2 V;  1Y66 A;  1QR9 A;  4R7C A;  3CCL V;  2Y48 A;  3SPH A;  2Q68 A;  5B3S C;  3OAA G;  1OCC C;  4P2Z A;  3I55 V;  2DYS C;  4MS2 A;  2A9H A;  2JDI G;  3E86 A;  1S5H C;  2EIK C;  2QA4 V;  4LBE C;  1K33 A;  4BAY A;  1JX9 A;  2M7W A;  3WFV A;  4X89 A;  5B1N A;  2QM8 A;  1R73 A;  3CP1 A;  2X6B A;  5L3C A;  2HJF C;  4RUE A;  3ZIA G;  1ARO P;  1PNK A;  1P7B A;  4X8A A;  4ASU G;  4PA7 A;  3ABL C;  1OCO C;  4RAI A;  4XDJ A;  1K9M W;  2YSU B;  2PI4 A;  1IXM A;  1FS0 G;  4JYC A;  1QLE C;  3T4D A;  2WWW A;  3ML0 A;  3LSQ A;  4BIU A;  3D3I A;  3CCQ V;  1S72 V;  4PA3 A;  1K4D C;  4F4L A;  3A0R A;  1GMG A;  3BY6 A;  1WLE A;  3CCU V;  4MVR A;  4CBC A;  3ZRS A;  5CBG A;  4JF3 A;  1OZ0 A;  1PNL A;  2WLM A;  3CCV V;  5LBQ A;  3CMA V;  3AG4 C;  5KUK A;  4UVC A;  3E2E A;  2X6C A;  3LNM B;  3MHH C;  3OMI B;  3ETG A;  3JD2 A;  2JJ2 G;  4FMT A;  1YIJ V;  4WFA V;  2AHY A;  5LGT A;  2P67 A;  4MVO A;  4UVB A;  2QE7 G;  3OR6 C;  4LCU C;  1NVP B;  1S0V A;  3LSS A;  4GX2 A;  3K0G A;  1FXH A;  1VQN V;  4JTA B;  2B1G A;  4WF9 V;  1COW G;  1GKF A;  4H37 A;  1AR1 B;  2HR3 A;  3D36 A;  3ASO B;  5L3B A;  1PKX A;  3IFX A;  2XAH A;  3AG1 C;  4UUJ C;  1AJP A;  4FPP A;  1HWY A;  2DWD C;  3ABK B;  3E8F A;  2ZDI C;  1SER A;  3CC7 V;  1R3I C;  3STZ C;  1PD3 A;  2WLI B;  4MTF A;  1K4C C;  4MVQ A;  1FXK B;  5C93 A;  1NKD A;  4QJF B;  2H94 A;  4TWK A;  3CPW U;  3OUS A;  3G71 V;  2EIL C;  5CMU A;  1VQ4 V;  1CPY A;  3IC7 A;  1PL0 A;  4UV9 A;  4PDM A;  5KUM A;  5BZB A;  1GM7 A;  3SYA A;  2WLI A;  1FXK A;  1N8R W;  2EIM C;  4WCE V;  1SRY A;  2V1D A;  1VQL V;  3NXS A;  2ZR3 A;  4JGS A;  1GO3 F;  2GSM B;  2P7T C;  2BOB C;  3EFF K;  2JIZ G;  3OFN G;  5H9C A;  1AI6 A;  5LHI A;  1GM8 A;  2DYR C;  1Q7Y W;  2Q67 A;  3H01 A;  1W2B U;  1MG1 A;  3ASO C;  3ZN1 A;  4BW5 A;  3AG2 B;  2EIJ C;  1Q86 W;  3SYC A;  3QO5 A;  3RVZ A;  1QR8 A;  2HG5 C;  1W0K G;  2Q69 A;  4R6Z A;  4WFE A;  1TUE B;  3JYC A;  4L87 A;  1F4N A;  1JJ2 U;  4JAS A;  2QEX V;  1K7D A;  4PA4 A;  4UV8 A;  5DN6 G;  2D3O W;  1GTO A;  3FB7 C;  3GB7 C;  1J95 A;  2EJR A;  2JK5 C;  1S3J A;  1OCO B;  3E8G A;  4RUF A;  2HKO A;  3JD0 A;  3M99 B;  4G27 B;  1K97 A;  1YHQ V;  4MVM A;  1OCR B;  3ZRV A;  1K92 A;  4I9W A;  3FYI B;  3ETE A;  2DW4 A;  3LDC A;  3JD4 A;  4Q20 A;  4X88 A;  2QTO A;  2WPD G;  3CCR V;  5LGU A;  4UXN A;  4MVU A;  3VOU A;  4UVA A;  3F5W C;  1JOY A;  4WFF A;  3RVY A;  3CXC U;  2Y69 C;  1UJW B;  5EK0 A;  1KQS U;  3K03 A;  3ZMS A;  5LHG A;  3AG2 C;  3AG3 B;  2ITC C;  2NNU A;  3AG4 B;  3FB6 C;  5CN0 A;  4E2L A;  4EKW A;  2W6I G;  2ZR2 A;  3OMA B;  1YIT V;  1ENV A;  4QPK A;  3K9A A;  2XOK G;  4I5S A;  3ABM C;  4OXS A;  2HLD G;  2K1E A;  1E1Q G;  1NH2 D;  5GW7 A;  3CCS V;  3ZCC A;  4TSF G;  1S76 D;  1ZWI C;  4WFH A;  4KP4 A;  1BHB A;  1NBM G;  3B8N A;  4FIP C;  4XBF A;  3K04 A;  5HFL A;  1OCR C;  1SET A;  3T4Z A;  3IGA C;  4PA9 A;  1XL6 A;  4MT8 A;  1QLN A;  3RW0 A;  1QBZ A;  2XAQ A;  4FJC C;  1NH2 B;  3AG1 B;  3K08 A;  3QO7 A;  4QE9 A;  4JTD B;  1YJN V;  2ZQM A;  3CCM V;  4KFM A;  1KP3 A;  3TET A;  3FYE B;  3AG3 C;  1VQ6 V;  4PDL A;  1QVF U;  3STL C;  1LNQ A;  3E89 A;  3E8H A;  2MK3 A;  5J9P C;  1BHA A;  2EIL B;  2ZDI A;  4QE7 A;  3W7T A;  1R3L C;  2HFE C;  5FL7 G;  1DTO A;  2R9R B;  3CYO A;  5EC2 C;  2EIM B;  5IYB O;  3X2Q C;  2QM7 A;  3ZRW B;  1G4Y B;  5IYD O;  1DLB A;  1F4M A;  1XL4 A;  2OCC B;  1H8H G;  1FXV A;  2XND G;  1RPO A;  2X0L A;  1VQ7 V;  2DYR B;  2ATK C;  1R6N A;  3P30 A;  3I56 V;  3K3W A;  2EIJ B;  4HYO A;  3SPI A;  3R65 A;  3ZRW A;  1Y4M A;  2UXX A;  5EBM C;  4CZZ A;  3UKM A;  1R3K C;  3TCU A;  2DQ0 A;  2ZXW B;  1SES A;  1VQM V;  4MTG A;  4FK5 C;  1VQ8 V;  2OTL V;  4WFB V;  2KB1 A;  4G2K A;  3ETD A;  1YTF D;  4MVS A;  5KA5 A;  2PI5 A;  5DM6 V;  3SYP A;  3SPG A;  4KUM A;  5CA3 A;  1MAB G;  1KC8 W;  3FB5 C;  3K06 A;  2OCC C;  1KD1 W;  1AI7 A;  1E79 G;  2Y69 B;  3CC2 V;  3ZMU A;  1R6K A;  4ZKI A;  1K5S A;  4P30 A;  2QKS A;  2IH1 C;  5LHH A;  4P9P A;  3KG2 A;  2Z5U A;  3ZMZ A;  1KP2 A;  2F43 G;  2OT5 A;  3B8M A;  1M90 W;  4JAU A;  4PDR A;  2W0F C;  1L1F A;  1I5X A;  2XAS A;  3ABM B;  1AI5 A;  3CME V;  2ZXW C;  1JCH A;  2R9I A;  3LUT B;  3CCE V;  3G6E V;  3ZRX A;  2NLJ C;  1YSC A;  3SJQ C;  5CBH A;  1AI4 A;  2LFS A;  1ROP A;  3CC4 V;  2WSS G;  3ASN B;  1K73 W;  3JD1 A;  2IJJ A;  1V54 C;  4DO2 A;  3SYQ A;  1AJQ A;  4QIW F;  5HFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...