4MT8A

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
100
structure length
100
Chain Sequence
ASHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ethylene response sensor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 45
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mt8A00
1F51A 2LFRA 3NXSA 4U7OA 4GCZA 4GT1A 2C2AA 4JYBA 3P32A 3ZCCA 3ZRXA 3D36A 4I5SA 4FPPA 4MTXA 2QM8A 4LC1A 1JOYA 3A0RA 4Q20A 4QPJA 5IDJA 4KP4A 3ZRWA 2LFSA 3ZRVA 4JAVA 4JASA 4U7NA 3DGEA 2P67A 4JYCA 5B1NA 3TK1A 1IXMA 5B1OA 4ZKIA 2FTKA 4BIUA 2WWWA 4JAUA 2QM7A 4FMTA 4QPKA 3MD0A 5C93A 3ZRWB 4BIZA 4MT8A
chains in the Genus database with same CATH superfamily
3T1HB 4YJ3B 4GT1A 4UCSA 3D36A 3SR2C 3KG2A 1SKVA 2ZIMA 5IYCO 1B06A 1R73A 2ARHA 3IC9A 1NTMH 3JD0A 1N4CA 1PNMA 3HPLC 2EJ7A 3ZBHA 5LXTB 4UB8Z 4PI2A 2XASA 1V9PA 1KECA 3G6EV 5E1AC 1TUBA 4B3RO 1KKDA 5JWPA 5BXZA 5B3SB 2JDIG 4DR7B 3B77A 1L8DA 5LHIA 5KX5A 4YXWG 1FXKC 2E3CA 5H6QA 3OTOB 5CA0A 5L3BA 3APOA 1XL4A 4UFZA 3QG5A 4TWKA 2P06A 3T1YB 4EEQA 3OAAG 3ZHRA 3CPWU 5LMUO 1NBMG 4JI2B 3LNMB 3C3TA 1TVKB 4GZRB 4UV9A 2A7WA 2Y48A 4DR2B 3WB2A 5L3DA 4DV0O 1OCRC 1S5LZ 1DLBA 3OMNB 3I55V 3ETEA 1VF5B 5DN6G 1U97A 3LDCA 2HLDG 1N0JA 3K0GA 3JATA 2CUGA 2EIKC 4FLTA 4I4TA 2OYQA 1Z5VA 1Y76B 1MG1A 2P90A 5DEDA 4FLYA 2P4KA 1XNRO 4TUYB 2CK3G 3IGAC 2YICA 4X89A 4W4LA 2PF4E 4FFBB 4MTOA 3BHPA 3JD4A 4IT5A 1EN6A 2CAZC 1JJOA 3TXQA 4C7UA 1E79G 2YEVA 2YXLA 1DF5A 4PDLA 1BHAA 1CPYA 4GKKO 4DUZB 4DUYB 2RCVA 4WFGA 1SQGA 4CS3A 1WB7A 5EIBD 4QPJA 2AXTZ 5BR8B 1PV0A 3OT7A 1Q7YW 5B1NA 4EFEA 5ITZB 4DR4B 3LSQA 4OPHA 3NR7A 3D3IA 1WAZA 2DQ3A 4PELA 2G38A 4W4KA 2UUCB 4AI8A 3CMEV 4BWAA 1OV9A 1X4TA 5CBFA 1VF7A 2JJ2G 2ZD9A 4IYIA 5CN0A 2EZOA 4QIWF 4B7KA 1Y74B 1P49A 2FTKA 4UVCA 4JYAO 1VQLV 2BTQB 2HP8A 2EIJB 1COWG 3ZRXA 4EKWA 2ADQB 3UT5A 2PI4A 3ZEDA 5B1OA 4AQYO 5IY5B 4WFHA 4R7CA 4PI0A 3MHSC 1OZ0A 4FLVA 3RGBA 3CB2A 1GK9A 2KB1A 4GCZA 4JV5O 1BHBA 4PA3A 2Z5UA 4UXNA 3B09A 1QVFU 4FPPA 4I9WA 3I56V 2JEXA 3BVOA 3RYIA 5IWAO 3L75H 1QQCA 3E8GA 1JCHA 4TV9A 4X1YA 4O4HB 5FNVB 3CRCA 3SDLA 4UCTA 1IBLO 2HHHO 4PDRA 1EFRG 4I55A 5KUKA 2X7RB 2WLLA 1EZJA 4NTYA 4DV2B 3UQ8A 2QWOB 2VWJA 5KHKA 4EB6B 4FJCC 4HNAB 3ASOC 2IJKA 3RBZA 2K9PA 2A0LA 5J2UB 2OCHA 4NXMB 4X62B 1IBKB 2NLJC 2YI9A 2QSAA 1N34B 2LGWA 1JPXA 3K5MA 4ZI7A 3O65A 1PPJH 3FD9A 1FS0G 3JSLA 1X59A 3B8MA 4OXSA 4X1KA 1Q6HA 2ILMA 3G80A 3WG7C 2WLJA 3CCEV 1NU1H 2B9ZA 3TETA 3AK3A 5IYBO 2UUAB 2Q8VA 3RYHA 1R1BA 3SYCA 1JJ2U 1VP7A 4DV4O 2ZDIA 3G6BA 1SF9A 3JD2A 1SZTA 4KP4A 3BCCH 2WLMA 2GTAA 1GM9A 4FFKA 1NS1A 3CS5A 4AILC 3DSQA 1IVSA 3CCJV 3ZHSA 4NKGB 4LR3A 3SPHA 5KMGB 4B3RB 4JI8O 4D6TH 4RQEA 1XMOB 1J95A 1I5YA 5LBQA 3ETQA 3SPIA 4MW3A 1FXKB 4O4JA 2ZXWC 3HKDA 4K8ZA 3DTUB 2JS5A 2Q5ZA 2PY5A 4O2AA 5LMUB 2H94A 4ZIBA 2XAHA 4FMTA 4TV8B 1YVWA 2NN4A 1XBLA 5C93A 1M1KW 1I08A 1TUEB 3CC7V 2EULA 1AILA 1H2NA 3BABA 3BY6A 1ROPA 2W0FC 3W7SA 2LO1A 5EYPB 1K4CC 3JALA 3ZHVA 3SPJA 4DV0B 2CH7B 2F95B 4TT3G 1OCRB 4CC6A 1KP2A 2EILC 3IFXA 3JASB 4JZ2A 4B3SO 1GTOA 2EIKB 3E22A 4BR6A 5IYZB 3TGUH 4YY3O 1VQOV 1MMMA 5EBLC 1XNRB 3K9SA 1WJZA 1VF6C 3JCZA 4RWUA 1NH2D 4BAYA 1XEQA 2YXYA 4ZBMA 4B3MO 1H2MA 1XREA 2VQFO 3CMAV 3KCYA 3SYOA 2ZQMA 2DJVA 3ZRWB 4B3TO 4TOIA 1N33O 3K04A 3RN4A 1I5XA 2CTPA 5BZBA 1DTOA 5IJ0B 2QEXV 4JI3B 3H1HH 1I0HA 1N8RW 2WA3A 3M8AA 1NR7A 1QBZA 2BTOA 4NTXA 4X65O 3ZMSA 2KSDA 4B08A 2UU9O 4FLWA 3IJ4A 5IJ9B 3T4DA 4GKKB 3D36C 5HFLA 4MTFA 5B1AC 1HR0O 4MVZA 3K08A 5JJJB 2PI5A 1AJPA 2GUZB 4WF9V 4Z2WA 1SQQH 3SJAC 3IC7A 3K06A 3WFVA 1XHZA 2XAJA 2X6CA 1FFXA 1VQNV 2AZ2A 3SGIA 3L73H 2Q7EA 4IHJB 3ETDA 1D5AA 1S72V 4FIPC 2Z0AA 4JI0O 3E2EA 2RMKB 4I0XA 3ZCCA 1Z2GA 1LUWA 1CP9A 4L8JA 4UCUA 4LWSB 4O2BB 3RYCB 5K1PA 1FFTB 5JH7B 1WLEA 4JYAB 4G2KA 2WSSG 4TQDA 1K9MW 2WLHA 3THOA 3BPZA 2IW5A 1AJQA 1Q8IA 2YIDA 3SPCA 3T1CA 2Q4PA 4X66B 4K3AA 2BCCH 4IYHA 4JI4O 1UJWB 2KQXA 1XI1A 3AG3C 4JI5O 2X6BA 3K58A 4ABMA 1VEWA 2LFSA 4YHHO 3ZS8C 1Q90D 2Y4TA 1GO3F 1EBOA 4H44B 1URFA 2YUAA 3OGIB 4KFMA 5GTIZ 3N2KA 4QGPA 1PKXA 2R9AA 5L3EA 3E35A 4JV5B 1NTZH 2PTMA 1KP3A 4LCUC 1VIBA 4XDKA 5CA1B 4WFEA 1OCZC 2P22C 3E89A 1Y76A 3WU2Z 5IWAB 2QKAA 4I50B 4DR1O 5EBWC 5F2VO 1BQ0A 2UXDO 4DV3B 1ZTEA 4PA4A 2E5LO 1IBLB 2HHHB 3DXRB 1NH2B 3RVZA 2ZR3A 1JFFA 1OHHG 4F6RB 2CTRA 4JAAA 3F7VC 2N74A 3B8NA 5LOVB 3ASOB 1B04A 3JAWA 2XHBA 4DR3O 1Q43A 4BIUA 1KBHA 1HNXO 5H9CA 4BIOA 4DR5O 4GYCB 3ZHQA 1J5EO 4FM1A 1Q5OA 1FPOA 5EIBC 1HDJA 3U10A 1MSDA 1AP5A 3CD6V 2EX3A 2ZR2A 3HKCA 2L35A 4HAMA 1SS3A 5B1BC 2P7TC 3WG7B 4J9ZB 2E74B 3CXCU 2XT9A 1LR1A 3CSXA 2VQEO 4ASUG 4O4IA 1OCCC 2C2AA 1Q81W 3OD4A 5J2TA 1K7DA 1SQFA 2CGNA 1NT2B 4X20A 5LA6A 4DV4B 4DW1A 3ZMVA 1M5IA 4P30A 4WFBV 3OE7G 2QR4A 4LFAO 1OJHA 4ZOLB 5LYJA 4DYLA 3L71H 1BQZA 2EBOA 3N27A 4WCEV 3T2MA 4U7OA 3NXSA 5JQGA 3CCSV 3SJCC 2W0XA 1SA0B 1R3JC 3N2GB 3K5LA 5KAIZ 3MDSA 4UVAA 1BE3H 2NNUA 1YCIA 2DYRC 4X1IA 1MZFA 4FZ1A 1KD1W 2ZXWB 1K73W 1S5JA 1P7GA 2WAMA 1L0LH 2Q67A 1U96A 1AI6A 4JI7B 3STLC 2M6YA 4GX0A 4IIJB 1XL6A 2EILB 4NVPA 2FL4A 2M7WA 3CCRV 2PYLA 5BY1A 4U3JB 4YY3B 4P9OA 2XOKG 1AJNA 1R3LC 3ABKC 4CH5A 2CTWA 3W7XA 3EHBB 1S76D 3ZN1A 1I94O 2V7QG 2VQFB 1JX9A 2EIMC 3BRCA 3SYAA 5JVDA 1LUVA 3OTFA 4E2LA 4P9PA 4BW5A 3J81N 1H2KA 4B3TB 3CJHA 3PJSK 1N33B 3CXHF 2V1DA 4WBNA 4DRXA 1CEZA 4RQFA 3CRQA 4GX1A 2IJJA 2UUBO 4ZHQB 1KMIZ 5EZYB 2A9HA 4NYKA 4X65B 2P67A 1DGSA 3LSUA 4CH4A 1K3EA 1QLNA 5CBGA 2LQTA 2Z3YA 1HR0B 4I9QA 3UCSC 2IU0A 4LF7O 2AZ0A 5B1AB 3ASNC 1M9NA 2LP7A 2ZT9B 3CYOA 2ZDIC 1PNLA 2MK3A 3L72H 1M4UA 3QTCA 1NQTA 1YIJV 3AG1C 3RT3C 5H2FZ 3LUTB 3FYIB 2Q9LA 4K0KO 2QM8A 1SETA 3L9DA 1HNZO 1FAFA 3JSNA 1YJWV 2RNBA 1TUBB 3AK2A 3CC2V 3CC4V 2ZCEA 1GRJA 4JI0B 5KX5B 4BIZA 3HKEA 2WLIA 4PHZA 5CA0B 1XMQB 4O4LA 5TISZ 4J7ZA 2UXCO 3OFNG 5A2QN 2DE0X 3TJTA 3VQVA 4K35A 3C3SA 3AG7A 5K1XA 1T5EA 1GN6A 2P6JA 2XTAA 4RAIA 1KC8W 3AG2C 2OIEA 1EZVH 1QCEA 3ICXA 3FB8C 3JAKB 2ZNIA 1MABG 1VQ7V 3HB3B 3JATB 4PV1B 3SJQC 5LL6Y 3A0RA 4J80A 4I4TB 4YHHB 3DC6A 1Q6IA 2Q6AA 3G4SV 2IJHA 4LNUA 3AG4C 1O9HA 4OX9O 3ZMZA 2XAFA 1BZKA 2Y4UA 1DK1A 3MD0A 4P2ZA 2R72A 1V55C 5HFMA 2JGUA 4GKJO 3VQXA 1H8HG 3CWBH 1AI4A 3RVYA 2ZM6O 4QJFB 1XHXA 1S0VA 2BSKA 1OCZB 4MTGA 2YS8A 3FAVA 4DR1B 4FM0A 3ZN0A 1AR4A 2QKSA 2Q7HA 2QWRB 1V54C 4R50A 2UXDB 1SERA 1Y6XA 3GWOA 4G28B 2E5LB 2OTLV 4DV5B 4XBFA 3CCVV 4X88A 5L3FA 3OR6C 3B40A 4QE9A 3FB6C 1FJGB 2W6IG 3OR7C 4FK5C 1NJIW 1OCOC 4DR3B 1HNXB 3OMIB 3L70H 4QPKA 3K9AA 3A2FA 1QLEC 1PD3A 1YEWA 1EN5A 4UUJC 1J5EB 2LFRA 3JCUZ 3UKMA 2YIBA 5LP6A 3AEIA 2GDSA 3Q4HA 3OM3B 1W0JG 2JK5C 2Q69A 3ZHUA 4JI6O 2D2CB 3MAQA 5CB4A 1YXBA 4HBNA 4MSWC 1BL8A 1XUQA 4U3FH 4AHCA 1ZL8A 1FXHA 1N36O 1K5QA 1FYJA 3M99B 1SZXA 2AGAA 4X9QA 1PL4A 2QJ1A 1PP9H 4KUMA 2VQEB 1H2GA 4IHJA 1OCCB 5KAFZ 1EM1A 2PGGA 3ZRSA 3JARA 3ABLC 2Q73A 2KG7A 3STZC 3ETGA 3ZIAG 1TGOA 4X8AA 2UXBO 2IM9A 4LFAB 4YIOA 4XDJA 3U0ZA 5AG2A 2B5UA 5KHIA 1XNQO 3M7MX 2RDCA 3T1YO 3RYCA 1I7FA 5GW7A 3R66A 1M90W 2WLKA 4MVUA 2QA4V 5KA5A 1D2DA 1O9GA 4WFFA 2ETNA 1XDCA 4FM2A 1FKAO 3SPGA 5C8YA 4Q20A 2OTJV 2DYRB 5IDJA 1Q6UA 2JJ1G 4MVQA 1VQPV 2ZE5A 2PYJA 1EN4A 2QE7G 2JGDA 3ABUA 3K03A 5IE9A 2EJRA 1YJNV 1JMKC 2DOSA 1H2LA 3K79A 1L0NH 3RYIB 4UCVA 1IDSA 4TV9B 4X1YB 1E1RG 4LH7A 4KHPO 2P5OA 5GONA 1QU7A 4WFAV 1YZBA 2V4DA 3GWKC 2DQ0A 2WLLB 1WA8A 1W59A 1YJ9V 5B66Z 2D3OW 3CCLV 3ABKB 3ZX6A 1I94B 3DXRA 1IBMO 2F66C 2OIGA 2ZIOA 4ZI7B 1K33A 4DV6O 3IAYA 1GM8A 2DMXA 2RQ6A 3RYFA 2R70A 4MT8A 4HZ3A 5D5PA 2Q7GA 3EFFK 2E76B 1RSOA 4X1KB 1R6TA 4JZGA 2H8PC 4LFBO 2UUBB 5BMVA 2JIZG 2OT5A 5BR8O 3OUSA 4GLXA 5LMNO 2AW9A 3P3PA 2WLNA 4YJ3A 2Q0AA 3VQWA 3RYHB 2A79B 4LF7B 1XILA 4LF8O 1VQ6V 5JCOA 1JQ0A 3ASNB 1IZ3A 4UCOA 4LF5O 3AG1B 1SQXH 4K0KB 4I5SA 3EVKA 5LXTA 1HNZB 3HKBB 1P84F 4PA6A 3R65A 1RPRA 3OGCC 1YTFD 3JD3A 2YC0A 2HVJC 4JGSA 1ZLZA 1THZA 4JI1O 2KKWA 3QO8A 4PA7A 4H33A 5LHGA 1QNMA 4O4JB 1R3IC 4ZOLA 3CRMA 4CH6A 2UXNA 2UXCB 3WB0A 4O2AB 4D7TA 2EZPA 4JF3A 4JAVA 1TVKA 4AQYB 4N21A 1AR1B 4OPAA 3JALB 4YJ2B 2N04A 3AG2B 3LNNA 4YIPA 2HKOA 1G1XB 1ZUQA 2AHYA 3A0HZ 1W2BU 1JR9A 4PJ0Z 1AROP 4LP8A 2RN9A 1IXBA 1ZSPA 4DW0A 3ZMUA 5DM6V 1BSMA 4OX9B 3E8HA 4TUYA 2HJFC 1Q82W 3QF7A 1V55B 4GKJB 1GM7A 5LGTA 2Y0PA 3W7UA 5DECA 1GAXA 1YITV 1VQ9V 4RUEA 1L1FA 5LGNA 3H1IH 4FFBA 3S3WA 3VBBA 2FB5A 4FLUA 3C90A 3K57A 4DO2A 2QWPB 2LJ2A 2RJZA 4CS4A 1K97A 3K0DA 4X64O 2CTQA 1TA8A 5KUMA 4X62O 1M93A 3H1KH 2HVKC 4LF6O 3I5DA 1N34O 2LW1A 3BAAA 1F4NA 2QGNA 3RW0A 4HYOA 4DR6O 1YF2A 1VQ5V 2B1GA 4JYCA 5FL7G 3FYEB 1OCOB 2IU3A 3SYQA 3ABMC 2ZE7A 3F5WC 1FFXB 1QLEB 2GBOA 2UUAO 1AI5A 5ITZA 1WB8A 1S5HC 4L87A 4GX2A 4J42A 4JI6B 2F4VO 4I0XB 1N36B 4EFBA 4Q6GA 2DYSC 4F4LA 1BT8A 2QTOA 2H3OA 1AR5A 1Y74A 4JI8B 1XMOO 3ABLB 1VQ8V 2UXBB 2K1EA 4LH6A 2QWQB 4GX5A 1XNQB 2BTQA 1YTFB 2F23A 3DC5A 4UVBA 2F1MA 3ML0A 1W0KG 1PNKA 3TCUA 1RPOA 1AVMA 4F6EA 4K8XA 3AK1A 5FPRA 1R3KC 3VQYA 1AB3A 5CBHA 1KKCA 1FD9A 3BA9A 3H1LH 1MOFA 3N2KB 2ODMA 2QWNB 2P4VA 3JAKA 1D5NA 1GN4A 2BOBC 1LNQA 4B3SB 5B5EZ 5IYDO 2JS3A 4KXRA 2Y0IA 2CE4A 4O4HA 5FNVA 3U11A 4KHPB 1CXZB 4NB5A 4B3MB 3W7WA 1DF4A 3H01A 4I7ZB 3G67A 1SESA 2ZINA 1JFFB 2X0LA 4PDMA 4EB6A 4HNAA 1GN2A 1UFIA 2UXXA 3CRAA 4PA9A 2HG5C 2HR3A 2R9IA 5J2UA 4NXNO 3JAWB 4JI3O 3QVNA 2QM4A 1IBMB 5EC1C 3ZRVA 4JASA 1SQPH 2HEPA 5KHGA 3ZHTA 3CRRA 4B7EA 1QVGU 2UU9B 2YDEA 2NR5A 5LP6C 1VARA 4H0LB 1WN7A 4DV6B 4J7KA 1JA8A 3PN1A 1HP8A 3A8TA 1NKDA 3H1JH 3O9OA 3HKCB 3B4SA 1NI8A 3J7AU 4LFBB 4PD4F 4UB6Z 5LMNB 1RM1C 1SQVH 1ZAUA 1BS3A 2IH3C 2ZE8A 2OCCC 4O4IB 4LF8B 2GV9A 2R9RB 5J2TB 4RUFA 4X20B 5LA6B 4DV1O 5L3GA 1XOUA 4LF5B 4R8CA 1F4MA 2IBZH 2DN9A 5LYJB 4CZZA 1HW7A 4LC1A 3W7TA 2QTSA 3RFRA 5KMGA 3X2QC 5KLVH 5JQGB 1WP8A 5E79Z 4JI1B 3F5TA 3H9VA 4X1IB 1KU9A 3G71V 1FXKA 2XUMA 3E86A 1M56C 1M57C 1ZWIC 1K92A 2W6JG 3CP1A 3OEHG 4X66O 2PZSA 4JI4B 4JI5B 3AG3B 4TV8A 4DXWA 4FLXA 4LFCO 2QKCA 1G8MA 4FZ0A 5EYPA 2CH7A 5L3CA 3ZMTA 3BFRA 1R6KA 1MNGA 3J80N 3FB7C 2A3QA 3LDDA 1F7YA 1VQ4V 4MVOA 3JASA 5JJNB 2L6LA 2CGOA 1GH6A 3S3XA 1MSWD 2XAGA 2ATKC 1FXVA 3RWRD 5IYZA 1QR8A 1BCCH 4D7SA 1N32O 3TK1A 3T4ZA 1RP3B 2DWEC 4CC5A 1K4DC 4JAUA 4LF4O 1H2SB 4DV3O 4MS2A 1KUQA 4DK0A 2VS0A 1S3JA 2LW7A 2YEVB 4BW9A 4H37A 3E83A 4JYBA 1YI2V 5JVDB 3D3QA 5GTHZ 4CBCA 4DV7O 1HNWO 3CE2A 3ZRWA 3CJHB 4XDLA 4WBNB 3A0BZ 4DRXB 5IJ0A 4X64B 4LF9O 2Y69C 2YIBD 1MA1A 2EINC 2XNDG 1IX9A 4DR5B 4LF6B 1VQMV 3T1HO 1Q86W 5IJ9A 2ADPA 4DR6B 1IURA 1E1QG 5JCOC 4U7NA 2GUZA 1ZX3A 2WA4A 1AI7A 4R6ZA 5B1BB 4CS2A 3ABMB 2XAQA 4CH3A 2F93B 2YXHA 3EXAA 3OMAB 3KKYA 2O57A 1Q3EA 1MZEA 1PL0A 2DW4A 3GVMA 2FMLA 3KCXA 3TXSA 5B3SC 1K34A 2YIAA 1NVPD 4DR7O 2F4VB 3OUFA 3K3WA 4FVMA 2ZE6A 3HKEB 2WLIB 3KZIZ 3ZJZA 4NR1A 1IXMA 3OTOO 3HR0A 4O4LB 1G6UA 2IJIA 4LWSA 1WPXA 2YSUB 3HKBA 3CCUV 4O2BA 3UT5B 5EK0A 4FLZA 2DYSB 3SJBC 3P30A 4UCRA 4JI2O 1KQSU 5JH7A 4KL1A 1NZ6A 3LDEA 1QHTA 5J9PC 2IH1C 4DR2O 1GMGA 2HJDA 3K5OA 4IL6Z 3P3NA 3QO7A 2VRZA 4ZKIA 1VMGA 1R6NA 2WWWA 1B3QA 2QM7A 3QO5A 1P7BA 4DK1A 4LNUB 4ICGA 4JI7O 4YJ2A 2DWDC 5IT9N 1N0NA 4NTWA 4GUNA 3UO3A 2A06H 1P4RA 2MW2B 1US6A 2B1IA 4J9YB 1HWYA 5CA1A 3OEEG 1GKFA 4I55B 4JTCB 1BGYH 2BSKB 4QE7A 3FAVB 4MW8A 1K5SA 4I50A 5H6RA 1QR9A 4G27B 1SQBH 4MVMA 4A5UB 4Z1MG 4OGQB 3DGEA 2EIMB 1RFYA 5JJEB 5CA3A 4F6RA 1NR1A 3FB5C 2ZKOA 2PUSA 4DUZO 2ZNJA 1ORQC 5D5QA 5LOVA 4DUYO 4Z1VA 2FKXA 4NXNB 3APQA 3QNEA 1KYOF 1JVMA 4N23A 5FLXN 4QNHB 3GB7C 3VOUA 2HFEC 3CEIA 4JPRA 3SYPA 3CCQV 1UPGA 4UV8A 3UO2A 3ABTA 5LP6B 4DR4O 3Q4HB 4J10A 1Y67A 5CB4B 1VQKV 1WNSA 1TAEA 4TQFA 5LGUA 1GN3A 2N05A 3FKSG 2UUCO 1WPBA 1ZL8B 2JRIA 3CX5F 2F43G 4J41A 4JTAB 4J11A 4RO2A 5KHHA 1RM1B 3OW2U 2OCCB 1PM9A 2BOCC 2LGQA 4DV1B 2JVDA 2ITCC 1K8AW 3JARB 1XQ8A 2KG7B 2ITDC 2OWOA 1BMFG 3JYCA 3L74H 1S77D 4J7JA 1NVPB 1B6QA 2EIJC 5H5NA 3HKDB 1XMQO 3E8FA 2GSMB 1WP7A 1Y4MA 3X2QB 3JAMN 3WB1A 2GHYA 2WPDG 5IY5C 1SA0A 3N2GA 3K5NA 1YDXA 3UM7A 4LBEC 5C8YB 3BEHA 2Q0OC 4H13B 3BA8A 1F51A 1M56B 1M57B 2YI8A 3B2EE 2JGDB 1AP6A 4TSFG 4MTXA 1Y66A 4LFCB 2AHZA 2E75B 3E22B 5CMUA 3FX7A 1ENVA 1H8EG 1NTKH 3D8CA 1YSCA 4IGGA 1G4YB 3AG4B 1F23A 2JEUA 5EC2C 4IIJA 5FPOA 1YHQV 4PDVA 5GONB 5LHHA 2X6AA 3K59A 2ZM6B 3P32A 1SRYA 5KA6A 1JOYA 1N32B 1H38A 4MVSA 1WA8B 4U3JA 3CHXA 4DV2O 2VWKA 1VF6A 4LF4B 1V54B 3LSSA 3JD1A 5A9GA 4NXMO 1A32A 1Z5WA 1SC5B 1IBKO 4DV5O 4MVRA 1KB9F 3FFQA 3E8BA 4DV7B 1FJGO 1HNWB 2QDOA 4JTDB 5EBMC 2GTSA 2Q68A 3RYFB 5KHJA 4JYYA 4LF9B 1RSOB 2FYUH 4E4EA 3CCMV 2CDYA 2Y69B 3MHHC 4ZHQA 5EZYA 3F7YC 5BMVB 2EINB 2BE3A
chains in the Genus database with same CATH topology
4UUJC 2PI5A 1AJPA 2LFRA 4GT1A 3UKMA 3AEIA 4WF9V 3D36A 3IC7A 3K06A 3WFVA 3OM3B 1W0JG 2JK5C 2Q69A 3KG2A 2XAJA 2X6CA 1RM1C 5IYCO 1R73A 4MSWC 1VQNV 1BL8A 2IH3C 3JD0A 1PNMA 2OCCC 3HPLC 1FXHA 2R9RB 3ETDA 1K5QA 4RUFA 1S72V 3M99B 4FIPC 5L3GA 2XASA 1KECA 3E2EA 4KUMA 4R8CA 3G6EV 1F4MA 1H2GA 5E1AC 1OCCB 1KKDA 3ZCCA 4CZZA 1CP9A 2JDIG 3ZRSA 3B77A 5B3SB 3ABLC 4LC1A 5LHIA 3STZC 3ETGA 3W7TA 3ZIAG 4YXWG 4X8AA 1FXKC 4XDJA 5H6QA 1FFTB 3X2QC 2B5UA 5L3BA 1XL4A 1WLEA 4TWKA 4G2KA 2WSSG 1K9MW 3CPWU 2WLHA 3OAAG 1NBMG 2IW5A 1AJQA 3G71V 5GW7A 1FXKA 3SPCA 3LNMB 1M90W 2WLKA 4MVUA 3T1CA 2QA4V 5KA5A 3E86A 1M56C 1M57C 1ZWIC 1K92A 2W6JG 3CP1A 3OEHG 1UJWB 3AG3C 4WFFA 2X6BA 4UV9A 3AG3B 2Y48A 3SPGA 4Q20A 5L3DA 1OCRC 2OTJV 4DXWA 2DYRB 5IDJA 1DLBA 2LFSA 3OMNB 2JJ1G 1VQPV 4MVQA 3I55V 3ETEA 1GO3F 5DN6G 1EBOA 1G8MA 3LDCA 3ABUA 2HLDG 2QE7G 3K03A 3K0GA 2EJRA 1YJNV 2EIKC 5L3CA 3ZMTA 4KFMA 1R6KA 3K79A 1PKXA 3FB7C 5L3EA 3E35A 3LDDA 1VQ4V 1MG1A 2P90A 4MVOA 1KP3A 1MSWD 4LCUC 2XAGA 4XDKA 2ATKC 4WFEA 2CK3G 1OCZC 1E1RG 3IGAC 1FXVA 3E89A 1QR8A 3TK1A 3T4ZA 5EBWC 2DWEC 4WFAV 4X89A 1K4DC 4JAUA 2DQ0A 2WLLB 4MS2A 4MTOA 4PA4A 1S3JA 1YJ9V 2YEVB 2D3OW 4H37A 3E83A 3CCLV 3JD4A 4JYBA 3ABKB 1YI2V 4CBCA 1NH2B 3RVZA 2ZR3A 1OHHG 1E79G 3ZRWA 2YEVA 3F7VC 4XDLA 1DF5A 4PDLA 3B8NA 1BHAA 1CPYA 3ASOB 1K33A 4BIUA 2Y69C 5H9CA 1GM8A 2EINC 2XNDG 4MT8A 4HZ3A 4WFGA 3EFFK 1VQMV 1Q86W 1E1QG 2H8PC 3CD6V 2JIZG 2OT5A 4QPJA 2ZR2A 3OUSA 4HAMA 1Q7YW 5B1NA 4U7NA 2WLNA 5B1BC 1AI7A 2A79B 2P7TC 4R6ZA 5B1BB 3WG7B 3LSQA 1VQ6V 3ABMB 2XAQA 1JQ0A 4J9ZB 3ASNB 3D3IA 2DQ3A 3OMAB 3CXCU 4PELA 4ASUG 2DW4A 1PL0A 1OCCC 2C2AA 3AG1B 1Q81W 3CMEV 1K7DA 5B3SC 1K34A 1NVPD 4I5SA 5CBFA 2JJ2G 3ZMVA 3OUFA 3K3WA 4P30A 2ZD9A 4WFBV 3OE7G 5CN0A 2WLIB 2EZOA 4PA6A 3ZJZA 1IXMA 4QIWF 3R65A 1RPRA 3OGCC 2FTKA 1YTFD 3JD3A 2HVJC 2IJIA 1WPXA 4JGSA 4UVCA 1THZA 2YSUB 1VQLV 3CCUV 2EBOA 3QO8A 4PA7A 5EK0A 4H33A 2DYSB 3P30A 4WCEV 3T2MA 5LHGA 1KQSU 4U7OA 1R3IC 3NXSA 3CCSV 2UXNA 2EIJB 1COWG 3ZRXA 3LDEA 1R3JC 5J9PC 4EKWA 4UVAA 2IH1C 2EZPA 2NNUA 2DYRC 1GMGA 2PI4A 4JF3A 4JAVA 1KD1W 2ZXWB 1K73W 3QO7A 5B1OA 5IY5B 4N21A 4ZKIA 1AR1B 4WFHA 4R7CA 3MHSC 1R6NA 2WWWA 1OZ0A 2QM7A 2WAMA 3QO5A 1P7BA 3AG2B 2HKOA 1GK9A 2KB1A 2AHYA 4GCZA 2Q67A 1W2BU 1BHBA 1AI6A 4PA3A 2Z5UA 4UXNA 3STLC 1QVFU 4FPPA 1AROP 2DWDC 4LP8A 4I9WA 3I56V 4GX0A 2JEXA 3ZMUA 5DM6V 1XL6A 2EILB 1P4RA 3E8GA 2B1IA 1JCHA 4J9YB 1HWYA 2M7WA 3E8HA 3OEEG 2HJFC 1GKFA 3CCRV 1Q82W 4JTCB 4QE7A 1V55B 1GM7A 5LGTA 4MW8A 3W7UA 4P9OA 1K5SA 2XOKG 1YITV 5H6RA 4PDRA 1AJNA 1R3LC 3ABKC 1QR9A 4RUEA 1EFRG 1VQ9V 5KUKA 2X7RB 4G27B 4MVMA 1L1FA 3W7XA 3EHBB 5LGNA 1S76D 4Z1MG 2WLLA 3ZN1A 1EZJA 3VBBA 2V7QG 4DO2A 3DGEA 1JX9A 2EIMC 4FJCC 3SYAA 1K97A 2EIMB 3ASOC 2IJKA 3RBZA 5CA3A 2A0LA 3K0DA 4E2LA 4P9PA 4BW5A 1NR1A 3FB5C 1ORQC 5KUMA 3PJSK 2NLJC 2V1DA 2HVKC 1JPXA 1CEZA 4RQFA 3QNEA 4GX1A 1F4NA 3RW0A 1JVMA 2IJJA 4HYOA 4N23A 1FS0G 2A9HA 4QNHB 3GB7C 3VOUA 1VQ5V 2B1GA 2HFEC 2P67A 4JPRA 4JYCA 3B8MA 3SYPA 5FL7G 4OXSA 3CCQV 3FYEB 1K3EA 1QLNA 1OCOB 2IU3A 5CBGA 4UV8A 3WG7C 3SYQA 3ABTA 2Z3YA 3ABMC 2WLJA 2IU0A 3CCEV 3TETA 3F5WC 5B1AB 3ASNC 1M9NA 2LP7A 3CYOA 2ZDIC 5IYBO 1PNLA 2MK3A 1VQKV 1QLEB 1AI5A 1NQTA 1S5HC 1YIJV 5LGUA 3AG1C 3FKSG 4L87A 4GX2A 3LUTB 3FYIB 3SYCA 1JJ2U 2F43G 2QM8A 1SETA 4JTAB 2ZDIA 3JD2A 4KP4A 1SZTA 4RO2A 1RM1B 3OW2U 2WLMA 1YJWV 1GM9A 2OCCB 2BOCC 3CC2V 2ITCC 1K8AW 3CC4V 2ITDC 2DYSC 1BMFG 3CCJV 3JYCA 4F4LA 4BIZA 3SPHA 1S77D 2WLIA 2QTOA 1NVPB 1B6QA 2EIJC 3E8FA 4RQEA 3OFNG 1J95A 3ABLB 1VQ8V 2GSMB 1I5YA 2K1EA 5LBQA 3SPIA 4MW3A 1FXKB 4GX5A 1YTFB 1Y4MA 2ZXWC 3X2QB 2GHYA 3DTUB 2WPDG 5IY5C 2P6JA 4UVBA 2H94A 2XAHA 4RAIA 4FMTA 3ML0A 3UM7A 1W0KG 1PNKA 4LBEC 1RPOA 3AG2C 3TCUA 1KC8W 5C93A 3BEHA 1M1KW 1TUEB 1F51A 1M56B 1M57B 1QCEA 3CC7V 3FB8C 1R3KC 3BY6A 1MABG 1VQ7V 1ROPA 2W0FC 3HB3B 5CBHA 3W7SA 1K4CC 4TSFG 3SPJA 3SJQC 4MTXA 1Y66A 3A0RA 4TT3G 2AHZA 1OCRB 1MOFA 5CMUA 1ENVA 1H8EG 2Q6AA 1KP2A 3G4SV 2EILC 2IJHA 1YSCA 3AG4C 3IFXA 1G4YB 3ZMZA 2XAFA 3AG4B 1F23A 2BOBC 1LNQA 2JEUA 1GTOA 2EIKB 5EC2C 3MD0A 4P2ZA 1V55C 5HFMA 5IYDO 1YHQV 4PDVA 5LHHA 2X6AA 1VQOV 5EBLC 1H8HG 1AI4A 3P32A 3RVYA 4QJFB 3JCZA 1SRYA 5KA6A 1S0VA 1JOYA 1OCZB 4MTGA 1NH2D 4MVSA 1H38A 4BAYA 4ZBMA 3W7WA 1DF4A 3ZN0A 2QKSA 3H01A 3CMAV 3SYOA 1V54C 4R50A 1SESA 1SERA 1V54B 2ZQMA 3GWOA 3LSSA 3JD1A 4G28B 2X0LA 3ZRWB 2OTLV 4XBFA 4PDMA 3CCVV 4X88A 4MVRA 5L3FA 3K04A 2UXXA 1I5XA 5BZBA 3OR6C 4PA9A 1DTOA 2HG5C 2HR3A 2R9IA 2QEXV 3E8BA 4QE9A 3FB6C 2W6IG 3OR7C 4JTDB 5EBMC 1N8RW 5EC1C 3ZRVA 1NR7A 2Q68A 4JASA 1QBZA 4FK5C 1QVGU 1NJIW 1OCOC 3ZMSA 3T4DA 5HFLA 4MTFA 5B1AC 3CCMV 3OMIB 2Y69B 3MHHC 4MVZA 4QPKA 3F7YC 3K08A 3K9AA 1NKDA 1QLEC 2EINB 1PD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F51 A;  2LFR A;  3NXS A;  4U7O A;  4GCZ A;  4GT1 A;  2C2A A;  4JYB A;  3P32 A;  3ZCC A;  3ZRX A;  3D36 A;  4I5S A;  4FPP A;  4MTX A;  2QM8 A;  4LC1 A;  1JOY A;  3A0R A;  4Q20 A;  4QPJ A;  5IDJ A;  4KP4 A;  3ZRW A;  2LFS A;  3ZRV A;  4JAV A;  4JAS A;  4U7N A;  3DGE A;  2P67 A;  4JYC A;  5B1N A;  3TK1 A;  1IXM A;  5B1O A;  4ZKI A;  2FTK A;  4BIU A;  2WWW A;  4JAU A;  2QM7 A;  4FMT A;  4QPK A;  3MD0 A;  5C93 A;  3ZRW B;  4BIZ A;  4MT8 A; 
#chains in the Genus database with same CATH topology
 3T1H B;  4YJ3 B;  4GT1 A;  4UCS A;  3D36 A;  3SR2 C;  3KG2 A;  1SKV A;  2ZIM A;  5IYC O;  1B06 A;  1R73 A;  2ARH A;  3IC9 A;  1NTM H;  3JD0 A;  1N4C A;  1PNM A;  3HPL C;  2EJ7 A;  3ZBH A;  5LXT B;  4UB8 Z;  4PI2 A;  2XAS A;  1V9P A;  1KEC A;  3G6E V;  5E1A C;  1TUB A;  4B3R O;  1KKD A;  5JWP A;  5BXZ A;  5B3S B;  2JDI G;  4DR7 B;  3B77 A;  1L8D A;  5LHI A;  5KX5 A;  4YXW G;  1FXK C;  2E3C A;  5H6Q A;  3OTO B;  5CA0 A;  5L3B A;  3APO A;  1XL4 A;  4UFZ A;  3QG5 A;  4TWK A;  2P06 A;  3T1Y B;  4EEQ A;  3OAA G;  3ZHR A;  3CPW U;  5LMU O;  1NBM G;  4JI2 B;  3LNM B;  3C3T A;  1TVK B;  4GZR B;  4UV9 A;  2A7W A;  2Y48 A;  4DR2 B;  3WB2 A;  5L3D A;  4DV0 O;  1OCR C;  1S5L Z;  1DLB A;  3OMN B;  3I55 V;  3ETE A;  1VF5 B;  5DN6 G;  1U97 A;  3LDC A;  2HLD G;  1N0J A;  3K0G A;  3JAT A;  2CUG A;  2EIK C;  4FLT A;  4I4T A;  2OYQ A;  1Z5V A;  1Y76 B;  1MG1 A;  2P90 A;  5DED A;  4FLY A;  2P4K A;  1XNR O;  4TUY B;  2CK3 G;  3IGA C;  2YIC A;  4X89 A;  4W4L A;  2PF4 E;  4FFB B;  4MTO A;  3BHP A;  3JD4 A;  4IT5 A;  1EN6 A;  2CAZ C;  1JJO A;  3TXQ A;  4C7U A;  1E79 G;  2YEV A;  2YXL A;  1DF5 A;  4PDL A;  1BHA A;  1CPY A;  4GKK O;  4DUZ B;  4DUY B;  2RCV A;  4WFG A;  1SQG A;  4CS3 A;  1WB7 A;  5EIB D;  4QPJ A;  2AXT Z;  5BR8 B;  1PV0 A;  3OT7 A;  1Q7Y W;  5B1N A;  4EFE A;  5ITZ B;  4DR4 B;  3LSQ A;  4OPH A;  3NR7 A;  3D3I A;  1WAZ A;  2DQ3 A;  4PEL A;  2G38 A;  4W4K A;  2UUC B;  4AI8 A;  3CME V;  4BWA A;  1OV9 A;  1X4T A;  5CBF A;  1VF7 A;  2JJ2 G;  2ZD9 A;  4IYI A;  5CN0 A;  2EZO A;  4QIW F;  4B7K A;  1Y74 B;  1P49 A;  2FTK A;  4UVC A;  4JYA O;  1VQL V;  2BTQ B;  2HP8 A;  2EIJ B;  1COW G;  3ZRX A;  4EKW A;  2ADQ B;  3UT5 A;  2PI4 A;  3ZED A;  5B1O A;  4AQY O;  5IY5 B;  4WFH A;  4R7C A;  4PI0 A;  3MHS C;  1OZ0 A;  4FLV A;  3RGB A;  3CB2 A;  1GK9 A;  2KB1 A;  4GCZ A;  4JV5 O;  1BHB A;  4PA3 A;  2Z5U A;  4UXN A;  3B09 A;  1QVF U;  4FPP A;  4I9W A;  3I56 V;  2JEX A;  3BVO A;  3RYI A;  5IWA O;  3L75 H;  1QQC A;  3E8G A;  1JCH A;  4TV9 A;  4X1Y A;  4O4H B;  5FNV B;  3CRC A;  3SDL A;  4UCT A;  1IBL O;  2HHH O;  4PDR A;  1EFR G;  4I55 A;  5KUK A;  2X7R B;  2WLL A;  1EZJ A;  4NTY A;  4DV2 B;  3UQ8 A;  2QWO B;  2VWJ A;  5KHK A;  4EB6 B;  4FJC C;  4HNA B;  3ASO C;  2IJK A;  3RBZ A;  2K9P A;  2A0L A;  5J2U B;  2OCH A;  4NXM B;  4X62 B;  1IBK B;  2NLJ C;  2YI9 A;  2QSA A;  1N34 B;  2LGW A;  1JPX A;  3K5M A;  4ZI7 A;  3O65 A;  1PPJ H;  3FD9 A;  1FS0 G;  3JSL A;  1X59 A;  3B8M A;  4OXS A;  4X1K A;  1Q6H A;  2ILM A;  3G80 A;  3WG7 C;  2WLJ A;  3CCE V;  1NU1 H;  2B9Z A;  3TET A;  3AK3 A;  5IYB O;  2UUA B;  2Q8V A;  3RYH A;  1R1B A;  3SYC A;  1JJ2 U;  1VP7 A;  4DV4 O;  2ZDI A;  3G6B A;  1SF9 A;  3JD2 A;  1SZT A;  4KP4 A;  3BCC H;  2WLM A;  2GTA A;  1GM9 A;  4FFK A;  1NS1 A;  3CS5 A;  4AIL C;  3DSQ A;  1IVS A;  3CCJ V;  3ZHS A;  4NKG B;  4LR3 A;  3SPH A;  5KMG B;  4B3R B;  4JI8 O;  4D6T H;  4RQE A;  1XMO B;  1J95 A;  1I5Y A;  5LBQ A;  3ETQ A;  3SPI A;  4MW3 A;  1FXK B;  4O4J A;  2ZXW C;  3HKD A;  4K8Z A;  3DTU B;  2JS5 A;  2Q5Z A;  2PY5 A;  4O2A A;  5LMU B;  2H94 A;  4ZIB A;  2XAH A;  4FMT A;  4TV8 B;  1YVW A;  2NN4 A;  1XBL A;  5C93 A;  1M1K W;  1I08 A;  1TUE B;  3CC7 V;  2EUL A;  1AIL A;  1H2N A;  3BAB A;  3BY6 A;  1ROP A;  2W0F C;  3W7S A;  2LO1 A;  5EYP B;  1K4C C;  3JAL A;  3ZHV A;  3SPJ A;  4DV0 B;  2CH7 B;  2F95 B;  4TT3 G;  1OCR B;  4CC6 A;  1KP2 A;  2EIL C;  3IFX A;  3JAS B;  4JZ2 A;  4B3S O;  1GTO A;  2EIK B;  3E22 A;  4BR6 A;  5IYZ B;  3TGU H;  4YY3 O;  1VQO V;  1MMM A;  5EBL C;  1XNR B;  3K9S A;  1WJZ A;  1VF6 C;  3JCZ A;  4RWU A;  1NH2 D;  4BAY A;  1XEQ A;  2YXY A;  4ZBM A;  4B3M O;  1H2M A;  1XRE A;  2VQF O;  3CMA V;  3KCY A;  3SYO A;  2ZQM A;  2DJV A;  3ZRW B;  4B3T O;  4TOI A;  1N33 O;  3K04 A;  3RN4 A;  1I5X A;  2CTP A;  5BZB A;  1DTO A;  5IJ0 B;  2QEX V;  4JI3 B;  3H1H H;  1I0H A;  1N8R W;  2WA3 A;  3M8A A;  1NR7 A;  1QBZ A;  2BTO A;  4NTX A;  4X65 O;  3ZMS A;  2KSD A;  4B08 A;  2UU9 O;  4FLW A;  3IJ4 A;  5IJ9 B;  3T4D A;  4GKK B;  3D36 C;  5HFL A;  4MTF A;  5B1A C;  1HR0 O;  4MVZ A;  3K08 A;  5JJJ B;  2PI5 A;  1AJP A;  2GUZ B;  4WF9 V;  4Z2W A;  1SQQ H;  3SJA C;  3IC7 A;  3K06 A;  3WFV A;  1XHZ A;  2XAJ A;  2X6C A;  1FFX A;  1VQN V;  2AZ2 A;  3SGI A;  3L73 H;  2Q7E A;  4IHJ B;  3ETD A;  1D5A A;  1S72 V;  4FIP C;  2Z0A A;  4JI0 O;  3E2E A;  2RMK B;  4I0X A;  3ZCC A;  1Z2G A;  1LUW A;  1CP9 A;  4L8J A;  4UCU A;  4LWS B;  4O2B B;  3RYC B;  5K1P A;  1FFT B;  5JH7 B;  1WLE A;  4JYA B;  4G2K A;  2WSS G;  4TQD A;  1K9M W;  2WLH A;  3THO A;  3BPZ A;  2IW5 A;  1AJQ A;  1Q8I A;  2YID A;  3SPC A;  3T1C A;  2Q4P A;  4X66 B;  4K3A A;  2BCC H;  4IYH A;  4JI4 O;  1UJW B;  2KQX A;  1XI1 A;  3AG3 C;  4JI5 O;  2X6B A;  3K58 A;  4ABM A;  1VEW A;  2LFS A;  4YHH O;  3ZS8 C;  1Q90 D;  2Y4T A;  1GO3 F;  1EBO A;  4H44 B;  1URF A;  2YUA A;  3OGI B;  4KFM A;  5GTI Z;  3N2K A;  4QGP A;  1PKX A;  2R9A A;  5L3E A;  3E35 A;  4JV5 B;  1NTZ H;  2PTM A;  1KP3 A;  4LCU C;  1VIB A;  4XDK A;  5CA1 B;  4WFE A;  1OCZ C;  2P22 C;  3E89 A;  1Y76 A;  3WU2 Z;  5IWA B;  2QKA A;  4I50 B;  4DR1 O;  5EBW C;  5F2V O;  1BQ0 A;  2UXD O;  4DV3 B;  1ZTE A;  4PA4 A;  2E5L O;  1IBL B;  2HHH B;  3DXR B;  1NH2 B;  3RVZ A;  2ZR3 A;  1JFF A;  1OHH G;  4F6R B;  2CTR A;  4JAA A;  3F7V C;  2N74 A;  3B8N A;  5LOV B;  3ASO B;  1B04 A;  3JAW A;  2XHB A;  4DR3 O;  1Q43 A;  4BIU A;  1KBH A;  1HNX O;  5H9C A;  4BIO A;  4DR5 O;  4GYC B;  3ZHQ A;  1J5E O;  4FM1 A;  1Q5O A;  1FPO A;  5EIB C;  1HDJ A;  3U10 A;  1MSD A;  1AP5 A;  3CD6 V;  2EX3 A;  2ZR2 A;  3HKC A;  2L35 A;  4HAM A;  1SS3 A;  5B1B C;  2P7T C;  3WG7 B;  4J9Z B;  2E74 B;  3CXC U;  2XT9 A;  1LR1 A;  3CSX A;  2VQE O;  4ASU G;  4O4I A;  1OCC C;  2C2A A;  1Q81 W;  3OD4 A;  5J2T A;  1K7D A;  1SQF A;  2CGN A;  1NT2 B;  4X20 A;  5LA6 A;  4DV4 B;  4DW1 A;  3ZMV A;  1M5I A;  4P30 A;  4WFB V;  3OE7 G;  2QR4 A;  4LFA O;  1OJH A;  4ZOL B;  5LYJ A;  4DYL A;  3L71 H;  1BQZ A;  2EBO A;  3N27 A;  4WCE V;  3T2M A;  4U7O A;  3NXS A;  5JQG A;  3CCS V;  3SJC C;  2W0X A;  1SA0 B;  1R3J C;  3N2G B;  3K5L A;  5KAI Z;  3MDS A;  4UVA A;  1BE3 H;  2NNU A;  1YCI A;  2DYR C;  4X1I A;  1MZF A;  4FZ1 A;  1KD1 W;  2ZXW B;  1K73 W;  1S5J A;  1P7G A;  2WAM A;  1L0L H;  2Q67 A;  1U96 A;  1AI6 A;  4JI7 B;  3STL C;  2M6Y A;  4GX0 A;  4IIJ B;  1XL6 A;  2EIL B;  4NVP A;  2FL4 A;  2M7W A;  3CCR V;  2PYL A;  5BY1 A;  4U3J B;  4YY3 B;  4P9O A;  2XOK G;  1AJN A;  1R3L C;  3ABK C;  4CH5 A;  2CTW A;  3W7X A;  3EHB B;  1S76 D;  3ZN1 A;  1I94 O;  2V7Q G;  2VQF B;  1JX9 A;  2EIM C;  3BRC A;  3SYA A;  5JVD A;  1LUV A;  3OTF A;  4E2L A;  4P9P A;  4BW5 A;  3J81 N;  1H2K A;  4B3T B;  3CJH A;  3PJS K;  1N33 B;  3CXH F;  2V1D A;  4WBN A;  4DRX A;  1CEZ A;  4RQF A;  3CRQ A;  4GX1 A;  2IJJ A;  2UUB O;  4ZHQ B;  1KMI Z;  5EZY B;  2A9H A;  4NYK A;  4X65 B;  2P67 A;  1DGS A;  3LSU A;  4CH4 A;  1K3E A;  1QLN A;  5CBG A;  2LQT A;  2Z3Y A;  1HR0 B;  4I9Q A;  3UCS C;  2IU0 A;  4LF7 O;  2AZ0 A;  5B1A B;  3ASN C;  1M9N A;  2LP7 A;  2ZT9 B;  3CYO A;  2ZDI C;  1PNL A;  2MK3 A;  3L72 H;  1M4U A;  3QTC A;  1NQT A;  1YIJ V;  3AG1 C;  3RT3 C;  5H2F Z;  3LUT B;  3FYI B;  2Q9L A;  4K0K O;  2QM8 A;  1SET A;  3L9D A;  1HNZ O;  1FAF A;  3JSN A;  1YJW V;  2RNB A;  1TUB B;  3AK2 A;  3CC2 V;  3CC4 V;  2ZCE A;  1GRJ A;  4JI0 B;  5KX5 B;  4BIZ A;  3HKE A;  2WLI A;  4PHZ A;  5CA0 B;  1XMQ B;  4O4L A;  5TIS Z;  4J7Z A;  2UXC O;  3OFN G;  5A2Q N;  2DE0 X;  3TJT A;  3VQV A;  4K35 A;  3C3S A;  3AG7 A;  5K1X A;  1T5E A;  1GN6 A;  2P6J A;  2XTA A;  4RAI A;  1KC8 W;  3AG2 C;  2OIE A;  1EZV H;  1QCE A;  3ICX A;  3FB8 C;  3JAK B;  2ZNI A;  1MAB G;  1VQ7 V;  3HB3 B;  3JAT B;  4PV1 B;  3SJQ C;  5LL6 Y;  3A0R A;  4J80 A;  4I4T B;  4YHH B;  3DC6 A;  1Q6I A;  2Q6A A;  3G4S V;  2IJH A;  4LNU A;  3AG4 C;  1O9H A;  4OX9 O;  3ZMZ A;  2XAF A;  1BZK A;  2Y4U A;  1DK1 A;  3MD0 A;  4P2Z A;  2R72 A;  1V55 C;  5HFM A;  2JGU A;  4GKJ O;  3VQX A;  1H8H G;  3CWB H;  1AI4 A;  3RVY A;  2ZM6 O;  4QJF B;  1XHX A;  1S0V A;  2BSK A;  1OCZ B;  4MTG A;  2YS8 A;  3FAV A;  4DR1 B;  4FM0 A;  3ZN0 A;  1AR4 A;  2QKS A;  2Q7H A;  2QWR B;  1V54 C;  4R50 A;  2UXD B;  1SER A;  1Y6X A;  3GWO A;  4G28 B;  2E5L B;  2OTL V;  4DV5 B;  4XBF A;  3CCV V;  4X88 A;  5L3F A;  3OR6 C;  3B40 A;  4QE9 A;  3FB6 C;  1FJG B;  2W6I G;  3OR7 C;  4FK5 C;  1NJI W;  1OCO C;  4DR3 B;  1HNX B;  3OMI B;  3L70 H;  4QPK A;  3K9A A;  3A2F A;  1QLE C;  1PD3 A;  1YEW A;  1EN5 A;  4UUJ C;  1J5E B;  2LFR A;  3JCU Z;  3UKM A;  2YIB A;  5LP6 A;  3AEI A;  2GDS A;  3Q4H A;  3OM3 B;  1W0J G;  2JK5 C;  2Q69 A;  3ZHU A;  4JI6 O;  2D2C B;  3MAQ A;  5CB4 A;  1YXB A;  4HBN A;  4MSW C;  1BL8 A;  1XUQ A;  4U3F H;  4AHC A;  1ZL8 A;  1FXH A;  1N36 O;  1K5Q A;  1FYJ A;  3M99 B;  1SZX A;  2AGA A;  4X9Q A;  1PL4 A;  2QJ1 A;  1PP9 H;  4KUM A;  2VQE B;  1H2G A;  4IHJ A;  1OCC B;  5KAF Z;  1EM1 A;  2PGG A;  3ZRS A;  3JAR A;  3ABL C;  2Q73 A;  2KG7 A;  3STZ C;  3ETG A;  3ZIA G;  1TGO A;  4X8A A;  2UXB O;  2IM9 A;  4LFA B;  4YIO A;  4XDJ A;  3U0Z A;  5AG2 A;  2B5U A;  5KHI A;  1XNQ O;  3M7M X;  2RDC A;  3T1Y O;  3RYC A;  1I7F A;  5GW7 A;  3R66 A;  1M90 W;  2WLK A;  4MVU A;  2QA4 V;  5KA5 A;  1D2D A;  1O9G A;  4WFF A;  2ETN A;  1XDC A;  4FM2 A;  1FKA O;  3SPG A;  5C8Y A;  4Q20 A;  2OTJ V;  2DYR B;  5IDJ A;  1Q6U A;  2JJ1 G;  4MVQ A;  1VQP V;  2ZE5 A;  2PYJ A;  1EN4 A;  2QE7 G;  2JGD A;  3ABU A;  3K03 A;  5IE9 A;  2EJR A;  1YJN V;  1JMK C;  2DOS A;  1H2L A;  3K79 A;  1L0N H;  3RYI B;  4UCV A;  1IDS A;  4TV9 B;  4X1Y B;  1E1R G;  4LH7 A;  4KHP O;  2P5O A;  5GON A;  1QU7 A;  4WFA V;  1YZB A;  2V4D A;  3GWK C;  2DQ0 A;  2WLL B;  1WA8 A;  1W59 A;  1YJ9 V;  5B66 Z;  2D3O W;  3CCL V;  3ABK B;  3ZX6 A;  1I94 B;  3DXR A;  1IBM O;  2F66 C;  2OIG A;  2ZIO A;  4ZI7 B;  1K33 A;  4DV6 O;  3IAY A;  1GM8 A;  2DMX A;  2RQ6 A;  3RYF A;  2R70 A;  4MT8 A;  4HZ3 A;  5D5P A;  2Q7G A;  3EFF K;  2E76 B;  1RSO A;  4X1K B;  1R6T A;  4JZG A;  2H8P C;  4LFB O;  2UUB B;  5BMV A;  2JIZ G;  2OT5 A;  5BR8 O;  3OUS A;  4GLX A;  5LMN O;  2AW9 A;  3P3P A;  2WLN A;  4YJ3 A;  2Q0A A;  3VQW A;  3RYH B;  2A79 B;  4LF7 B;  1XIL A;  4LF8 O;  1VQ6 V;  5JCO A;  1JQ0 A;  3ASN B;  1IZ3 A;  4UCO A;  4LF5 O;  3AG1 B;  1SQX H;  4K0K B;  4I5S A;  3EVK A;  5LXT A;  1HNZ B;  3HKB B;  1P84 F;  4PA6 A;  3R65 A;  1RPR A;  3OGC C;  1YTF D;  3JD3 A;  2YC0 A;  2HVJ C;  4JGS A;  1ZLZ A;  1THZ A;  4JI1 O;  2KKW A;  3QO8 A;  4PA7 A;  4H33 A;  5LHG A;  1QNM A;  4O4J B;  1R3I C;  4ZOL A;  3CRM A;  4CH6 A;  2UXN A;  2UXC B;  3WB0 A;  4O2A B;  4D7T A;  2EZP A;  4JF3 A;  4JAV A;  1TVK A;  4AQY B;  4N21 A;  1AR1 B;  4OPA A;  3JAL B;  4YJ2 B;  2N04 A;  3AG2 B;  3LNN A;  4YIP A;  2HKO A;  1G1X B;  1ZUQ A;  2AHY A;  3A0H Z;  1W2B U;  1JR9 A;  4PJ0 Z;  1ARO P;  4LP8 A;  2RN9 A;  1IXB A;  1ZSP A;  4DW0 A;  3ZMU A;  5DM6 V;  1BSM A;  4OX9 B;  3E8H A;  4TUY A;  2HJF C;  1Q82 W;  3QF7 A;  1V55 B;  4GKJ B;  1GM7 A;  5LGT A;  2Y0P A;  3W7U A;  5DEC A;  1GAX A;  1YIT V;  1VQ9 V;  4RUE A;  1L1F A;  5LGN A;  3H1I H;  4FFB A;  3S3W A;  3VBB A;  2FB5 A;  4FLU A;  3C90 A;  3K57 A;  4DO2 A;  2QWP B;  2LJ2 A;  2RJZ A;  4CS4 A;  1K97 A;  3K0D A;  4X64 O;  2CTQ A;  1TA8 A;  5KUM A;  4X62 O;  1M93 A;  3H1K H;  2HVK C;  4LF6 O;  3I5D A;  1N34 O;  2LW1 A;  3BAA A;  1F4N A;  2QGN A;  3RW0 A;  4HYO A;  4DR6 O;  1YF2 A;  1VQ5 V;  2B1G A;  4JYC A;  5FL7 G;  3FYE B;  1OCO B;  2IU3 A;  3SYQ A;  3ABM C;  2ZE7 A;  3F5W C;  1FFX B;  1QLE B;  2GBO A;  2UUA O;  1AI5 A;  5ITZ A;  1WB8 A;  1S5H C;  4L87 A;  4GX2 A;  4J42 A;  4JI6 B;  2F4V O;  4I0X B;  1N36 B;  4EFB A;  4Q6G A;  2DYS C;  4F4L A;  1BT8 A;  2QTO A;  2H3O A;  1AR5 A;  1Y74 A;  4JI8 B;  1XMO O;  3ABL B;  1VQ8 V;  2UXB B;  2K1E A;  4LH6 A;  2QWQ B;  4GX5 A;  1XNQ B;  2BTQ A;  1YTF B;  2F23 A;  3DC5 A;  4UVB A;  2F1M A;  3ML0 A;  1W0K G;  1PNK A;  3TCU A;  1RPO A;  1AVM A;  4F6E A;  4K8X A;  3AK1 A;  5FPR A;  1R3K C;  3VQY A;  1AB3 A;  5CBH A;  1KKC A;  1FD9 A;  3BA9 A;  3H1L H;  1MOF A;  3N2K B;  2ODM A;  2QWN B;  2P4V A;  3JAK A;  1D5N A;  1GN4 A;  2BOB C;  1LNQ A;  4B3S B;  5B5E Z;  5IYD O;  2JS3 A;  4KXR A;  2Y0I A;  2CE4 A;  4O4H A;  5FNV A;  3U11 A;  4KHP B;  1CXZ B;  4NB5 A;  4B3M B;  3W7W A;  1DF4 A;  3H01 A;  4I7Z B;  3G67 A;  1SES A;  2ZIN A;  1JFF B;  2X0L A;  4PDM A;  4EB6 A;  4HNA A;  1GN2 A;  1UFI A;  2UXX A;  3CRA A;  4PA9 A;  2HG5 C;  2HR3 A;  2R9I A;  5J2U A;  4NXN O;  3JAW B;  4JI3 O;  3QVN A;  2QM4 A;  1IBM B;  5EC1 C;  3ZRV A;  4JAS A;  1SQP H;  2HEP A;  5KHG A;  3ZHT A;  3CRR A;  4B7E A;  1QVG U;  2UU9 B;  2YDE A;  2NR5 A;  5LP6 C;  1VAR A;  4H0L B;  1WN7 A;  4DV6 B;  4J7K A;  1JA8 A;  3PN1 A;  1HP8 A;  3A8T A;  1NKD A;  3H1J H;  3O9O A;  3HKC B;  3B4S A;  1NI8 A;  3J7A U;  4LFB B;  4PD4 F;  4UB6 Z;  5LMN B;  1RM1 C;  1SQV H;  1ZAU A;  1BS3 A;  2IH3 C;  2ZE8 A;  2OCC C;  4O4I B;  4LF8 B;  2GV9 A;  2R9R B;  5J2T B;  4RUF A;  4X20 B;  5LA6 B;  4DV1 O;  5L3G A;  1XOU A;  4LF5 B;  4R8C A;  1F4M A;  2IBZ H;  2DN9 A;  5LYJ B;  4CZZ A;  1HW7 A;  4LC1 A;  3W7T A;  2QTS A;  3RFR A;  5KMG A;  3X2Q C;  5KLV H;  5JQG B;  1WP8 A;  5E79 Z;  4JI1 B;  3F5T A;  3H9V A;  4X1I B;  1KU9 A;  3G71 V;  1FXK A;  2XUM A;  3E86 A;  1M56 C;  1M57 C;  1ZWI C;  1K92 A;  2W6J G;  3CP1 A;  3OEH G;  4X66 O;  2PZS A;  4JI4 B;  4JI5 B;  3AG3 B;  4TV8 A;  4DXW A;  4FLX A;  4LFC O;  2QKC A;  1G8M A;  4FZ0 A;  5EYP A;  2CH7 A;  5L3C A;  3ZMT A;  3BFR A;  1R6K A;  1MNG A;  3J80 N;  3FB7 C;  2A3Q A;  3LDD A;  1F7Y A;  1VQ4 V;  4MVO A;  3JAS A;  5JJN B;  2L6L A;  2CGO A;  1GH6 A;  3S3X A;  1MSW D;  2XAG A;  2ATK C;  1FXV A;  3RWR D;  5IYZ A;  1QR8 A;  1BCC H;  4D7S A;  1N32 O;  3TK1 A;  3T4Z A;  1RP3 B;  2DWE C;  4CC5 A;  1K4D C;  4JAU A;  4LF4 O;  1H2S B;  4DV3 O;  4MS2 A;  1KUQ A;  4DK0 A;  2VS0 A;  1S3J A;  2LW7 A;  2YEV B;  4BW9 A;  4H37 A;  3E83 A;  4JYB A;  1YI2 V;  5JVD B;  3D3Q A;  5GTH Z;  4CBC A;  4DV7 O;  1HNW O;  3CE2 A;  3ZRW A;  3CJH B;  4XDL A;  4WBN B;  3A0B Z;  4DRX B;  5IJ0 A;  4X64 B;  4LF9 O;  2Y69 C;  2YIB D;  1MA1 A;  2EIN C;  2XND G;  1IX9 A;  4DR5 B;  4LF6 B;  1VQM V;  3T1H O;  1Q86 W;  5IJ9 A;  2ADP A;  4DR6 B;  1IUR A;  1E1Q G;  5JCO C;  4U7N A;  2GUZ A;  1ZX3 A;  2WA4 A;  1AI7 A;  4R6Z A;  5B1B B;  4CS2 A;  3ABM B;  2XAQ A;  4CH3 A;  2F93 B;  2YXH A;  3EXA A;  3OMA B;  3KKY A;  2O57 A;  1Q3E A;  1MZE A;  1PL0 A;  2DW4 A;  3GVM A;  2FML A;  3KCX A;  3TXS A;  5B3S C;  1K34 A;  2YIA A;  1NVP D;  4DR7 O;  2F4V B;  3OUF A;  3K3W A;  4FVM A;  2ZE6 A;  3HKE B;  2WLI B;  3KZI Z;  3ZJZ A;  4NR1 A;  1IXM A;  3OTO O;  3HR0 A;  4O4L B;  1G6U A;  2IJI A;  4LWS A;  1WPX A;  2YSU B;  3HKB A;  3CCU V;  4O2B A;  3UT5 B;  5EK0 A;  4FLZ A;  2DYS B;  3SJB C;  3P30 A;  4UCR A;  4JI2 O;  1KQS U;  5JH7 A;  4KL1 A;  1NZ6 A;  3LDE A;  1QHT A;  5J9P C;  2IH1 C;  4DR2 O;  1GMG A;  2HJD A;  3K5O A;  4IL6 Z;  3P3N A;  3QO7 A;  2VRZ A;  4ZKI A;  1VMG A;  1R6N A;  2WWW A;  1B3Q A;  2QM7 A;  3QO5 A;  1P7B A;  4DK1 A;  4LNU B;  4ICG A;  4JI7 O;  4YJ2 A;  2DWD C;  5IT9 N;  1N0N A;  4NTW A;  4GUN A;  3UO3 A;  2A06 H;  1P4R A;  2MW2 B;  1US6 A;  2B1I A;  4J9Y B;  1HWY A;  5CA1 A;  3OEE G;  1GKF A;  4I55 B;  4JTC B;  1BGY H;  2BSK B;  4QE7 A;  3FAV B;  4MW8 A;  1K5S A;  4I50 A;  5H6R A;  1QR9 A;  4G27 B;  1SQB H;  4MVM A;  4A5U B;  4Z1M G;  4OGQ B;  3DGE A;  2EIM B;  1RFY A;  5JJE B;  5CA3 A;  4F6R A;  1NR1 A;  3FB5 C;  2ZKO A;  2PUS A;  4DUZ O;  2ZNJ A;  1ORQ C;  5D5Q A;  5LOV A;  4DUY O;  4Z1V A;  2FKX A;  4NXN B;  3APQ A;  3QNE A;  1KYO F;  1JVM A;  4N23 A;  5FLX N;  4QNH B;  3GB7 C;  3VOU A;  2HFE C;  3CEI A;  4JPR A;  3SYP A;  3CCQ V;  1UPG A;  4UV8 A;  3UO2 A;  3ABT A;  5LP6 B;  4DR4 O;  3Q4H B;  4J10 A;  1Y67 A;  5CB4 B;  1VQK V;  1WNS A;  1TAE A;  4TQF A;  5LGU A;  1GN3 A;  2N05 A;  3FKS G;  2UUC O;  1WPB A;  1ZL8 B;  2JRI A;  3CX5 F;  2F43 G;  4J41 A;  4JTA B;  4J11 A;  4RO2 A;  5KHH A;  1RM1 B;  3OW2 U;  2OCC B;  1PM9 A;  2BOC C;  2LGQ A;  4DV1 B;  2JVD A;  2ITC C;  1K8A W;  3JAR B;  1XQ8 A;  2KG7 B;  2ITD C;  2OWO A;  1BMF G;  3JYC A;  3L74 H;  1S77 D;  4J7J A;  1NVP B;  1B6Q A;  2EIJ C;  5H5N A;  3HKD B;  1XMQ O;  3E8F A;  2GSM B;  1WP7 A;  1Y4M A;  3X2Q B;  3JAM N;  3WB1 A;  2GHY A;  2WPD G;  5IY5 C;  1SA0 A;  3N2G A;  3K5N A;  1YDX A;  3UM7 A;  4LBE C;  5C8Y B;  3BEH A;  2Q0O C;  4H13 B;  3BA8 A;  1F51 A;  1M56 B;  1M57 B;  2YI8 A;  3B2E E;  2JGD B;  1AP6 A;  4TSF G;  4MTX A;  1Y66 A;  4LFC B;  2AHZ A;  2E75 B;  3E22 B;  5CMU A;  3FX7 A;  1ENV A;  1H8E G;  1NTK H;  3D8C A;  1YSC A;  4IGG A;  1G4Y B;  3AG4 B;  1F23 A;  2JEU A;  5EC2 C;  4IIJ A;  5FPO A;  1YHQ V;  4PDV A;  5GON B;  5LHH A;  2X6A A;  3K59 A;  2ZM6 B;  3P32 A;  1SRY A;  5KA6 A;  1JOY A;  1N32 B;  1H38 A;  4MVS A;  1WA8 B;  4U3J A;  3CHX A;  4DV2 O;  2VWK A;  1VF6 A;  4LF4 B;  1V54 B;  3LSS A;  3JD1 A;  5A9G A;  4NXM O;  1A32 A;  1Z5W A;  1SC5 B;  1IBK O;  4DV5 O;  4MVR A;  1KB9 F;  3FFQ A;  3E8B A;  4DV7 B;  1FJG O;  1HNW B;  2QDO A;  4JTD B;  5EBM C;  2GTS A;  2Q68 A;  3RYF B;  5KHJ A;  4JYY A;  4LF9 B;  1RSO B;  2FYU H;  4E4E A;  3CCM V;  2CDY A;  2Y69 B;  3MHH C;  4ZHQ A;  5EZY A;  3F7Y C;  5BMV B;  2EIN B;  2BE3 A; 
#chains in the Genus database with same CATH homology
 4UUJ C;  2PI5 A;  1AJP A;  2LFR A;  4GT1 A;  3UKM A;  3AEI A;  4WF9 V;  3D36 A;  3IC7 A;  3K06 A;  3WFV A;  3OM3 B;  1W0J G;  2JK5 C;  2Q69 A;  3KG2 A;  2XAJ A;  2X6C A;  1RM1 C;  5IYC O;  1R73 A;  4MSW C;  1VQN V;  1BL8 A;  2IH3 C;  3JD0 A;  1PNM A;  2OCC C;  3HPL C;  1FXH A;  2R9R B;  3ETD A;  1K5Q A;  4RUF A;  1S72 V;  3M99 B;  4FIP C;  5L3G A;  2XAS A;  1KEC A;  3E2E A;  4KUM A;  4R8C A;  3G6E V;  1F4M A;  1H2G A;  5E1A C;  1OCC B;  1KKD A;  3ZCC A;  4CZZ A;  1CP9 A;  2JDI G;  3ZRS A;  3B77 A;  5B3S B;  3ABL C;  4LC1 A;  5LHI A;  3STZ C;  3ETG A;  3W7T A;  3ZIA G;  4YXW G;  4X8A A;  1FXK C;  4XDJ A;  5H6Q A;  1FFT B;  3X2Q C;  2B5U A;  5L3B A;  1XL4 A;  1WLE A;  4TWK A;  4G2K A;  2WSS G;  1K9M W;  3CPW U;  2WLH A;  3OAA G;  1NBM G;  2IW5 A;  1AJQ A;  3G71 V;  5GW7 A;  1FXK A;  3SPC A;  3LNM B;  1M90 W;  2WLK A;  4MVU A;  3T1C A;  2QA4 V;  5KA5 A;  3E86 A;  1M56 C;  1M57 C;  1ZWI C;  1K92 A;  2W6J G;  3CP1 A;  3OEH G;  1UJW B;  3AG3 C;  4WFF A;  2X6B A;  4UV9 A;  3AG3 B;  2Y48 A;  3SPG A;  4Q20 A;  5L3D A;  1OCR C;  2OTJ V;  4DXW A;  2DYR B;  5IDJ A;  1DLB A;  2LFS A;  3OMN B;  2JJ1 G;  1VQP V;  4MVQ A;  3I55 V;  3ETE A;  1GO3 F;  5DN6 G;  1EBO A;  1G8M A;  3LDC A;  3ABU A;  2HLD G;  2QE7 G;  3K03 A;  3K0G A;  2EJR A;  1YJN V;  2EIK C;  5L3C A;  3ZMT A;  4KFM A;  1R6K A;  3K79 A;  1PKX A;  3FB7 C;  5L3E A;  3E35 A;  3LDD A;  1VQ4 V;  1MG1 A;  2P90 A;  4MVO A;  1KP3 A;  1MSW D;  4LCU C;  2XAG A;  4XDK A;  2ATK C;  4WFE A;  2CK3 G;  1OCZ C;  1E1R G;  3IGA C;  1FXV A;  3E89 A;  1QR8 A;  3TK1 A;  3T4Z A;  5EBW C;  2DWE C;  4WFA V;  4X89 A;  1K4D C;  4JAU A;  2DQ0 A;  2WLL B;  4MS2 A;  4MTO A;  4PA4 A;  1S3J A;  1YJ9 V;  2YEV B;  2D3O W;  4H37 A;  3E83 A;  3CCL V;  3JD4 A;  4JYB A;  3ABK B;  1YI2 V;  4CBC A;  1NH2 B;  3RVZ A;  2ZR3 A;  1OHH G;  1E79 G;  3ZRW A;  2YEV A;  3F7V C;  4XDL A;  1DF5 A;  4PDL A;  3B8N A;  1BHA A;  1CPY A;  3ASO B;  1K33 A;  4BIU A;  2Y69 C;  5H9C A;  1GM8 A;  2EIN C;  2XND G;  4MT8 A;  4HZ3 A;  4WFG A;  3EFF K;  1VQM V;  1Q86 W;  1E1Q G;  2H8P C;  3CD6 V;  2JIZ G;  2OT5 A;  4QPJ A;  2ZR2 A;  3OUS A;  4HAM A;  1Q7Y W;  5B1N A;  4U7N A;  2WLN A;  5B1B C;  1AI7 A;  2A79 B;  2P7T C;  4R6Z A;  5B1B B;  3WG7 B;  3LSQ A;  1VQ6 V;  3ABM B;  2XAQ A;  1JQ0 A;  4J9Z B;  3ASN B;  3D3I A;  2DQ3 A;  3OMA B;  3CXC U;  4PEL A;  4ASU G;  2DW4 A;  1PL0 A;  1OCC C;  2C2A A;  3AG1 B;  1Q81 W;  3CME V;  1K7D A;  5B3S C;  1K34 A;  1NVP D;  4I5S A;  5CBF A;  2JJ2 G;  3ZMV A;  3OUF A;  3K3W A;  4P30 A;  2ZD9 A;  4WFB V;  3OE7 G;  5CN0 A;  2WLI B;  2EZO A;  4PA6 A;  3ZJZ A;  1IXM A;  4QIW F;  3R65 A;  1RPR A;  3OGC C;  2FTK A;  1YTF D;  3JD3 A;  2HVJ C;  2IJI A;  1WPX A;  4JGS A;  4UVC A;  1THZ A;  2YSU B;  1VQL V;  3CCU V;  2EBO A;  3QO8 A;  4PA7 A;  5EK0 A;  4H33 A;  2DYS B;  3P30 A;  4WCE V;  3T2M A;  5LHG A;  1KQS U;  4U7O A;  1R3I C;  3NXS A;  3CCS V;  2UXN A;  2EIJ B;  1COW G;  3ZRX A;  3LDE A;  1R3J C;  5J9P C;  4EKW A;  4UVA A;  2IH1 C;  2EZP A;  2NNU A;  2DYR C;  1GMG A;  2PI4 A;  4JF3 A;  4JAV A;  1KD1 W;  2ZXW B;  1K73 W;  3QO7 A;  5B1O A;  5IY5 B;  4N21 A;  4ZKI A;  1AR1 B;  4WFH A;  4R7C A;  3MHS C;  1R6N A;  2WWW A;  1OZ0 A;  2QM7 A;  2WAM A;  3QO5 A;  1P7B A;  3AG2 B;  2HKO A;  1GK9 A;  2KB1 A;  2AHY A;  4GCZ A;  2Q67 A;  1W2B U;  1BHB A;  1AI6 A;  4PA3 A;  2Z5U A;  4UXN A;  3STL C;  1QVF U;  4FPP A;  1ARO P;  2DWD C;  4LP8 A;  4I9W A;  3I56 V;  4GX0 A;  2JEX A;  3ZMU A;  5DM6 V;  1XL6 A;  2EIL B;  1P4R A;  3E8G A;  2B1I A;  1JCH A;  4J9Y B;  1HWY A;  2M7W A;  3E8H A;  3OEE G;  2HJF C;  1GKF A;  3CCR V;  1Q82 W;  4JTC B;  4QE7 A;  1V55 B;  1GM7 A;  5LGT A;  4MW8 A;  3W7U A;  4P9O A;  1K5S A;  2XOK G;  1YIT V;  5H6R A;  4PDR A;  1AJN A;  1R3L C;  3ABK C;  1QR9 A;  4RUE A;  1EFR G;  1VQ9 V;  5KUK A;  2X7R B;  4G27 B;  4MVM A;  1L1F A;  3W7X A;  3EHB B;  5LGN A;  1S76 D;  4Z1M G;  2WLL A;  3ZN1 A;  1EZJ A;  3VBB A;  2V7Q G;  4DO2 A;  3DGE A;  1JX9 A;  2EIM C;  4FJC C;  3SYA A;  1K97 A;  2EIM B;  3ASO C;  2IJK A;  3RBZ A;  5CA3 A;  2A0L A;  3K0D A;  4E2L A;  4P9P A;  4BW5 A;  1NR1 A;  3FB5 C;  1ORQ C;  5KUM A;  3PJS K;  2NLJ C;  2V1D A;  2HVK C;  1JPX A;  1CEZ A;  4RQF A;  3QNE A;  4GX1 A;  1F4N A;  3RW0 A;  1JVM A;  2IJJ A;  4HYO A;  4N23 A;  1FS0 G;  2A9H A;  4QNH B;  3GB7 C;  3VOU A;  1VQ5 V;  2B1G A;  2HFE C;  2P67 A;  4JPR A;  4JYC A;  3B8M A;  3SYP A;  5FL7 G;  4OXS A;  3CCQ V;  3FYE B;  1K3E A;  1QLN A;  1OCO B;  2IU3 A;  5CBG A;  4UV8 A;  3WG7 C;  3SYQ A;  3ABT A;  2Z3Y A;  3ABM C;  2WLJ A;  2IU0 A;  3CCE V;  3TET A;  3F5W C;  5B1A B;  3ASN C;  1M9N A;  2LP7 A;  3CYO A;  2ZDI C;  5IYB O;  1PNL A;  2MK3 A;  1VQK V;  1QLE B;  1AI5 A;  1NQT A;  1S5H C;  1YIJ V;  5LGU A;  3AG1 C;  3FKS G;  4L87 A;  4GX2 A;  3LUT B;  3FYI B;  3SYC A;  1JJ2 U;  2F43 G;  2QM8 A;  1SET A;  4JTA B;  2ZDI A;  3JD2 A;  4KP4 A;  1SZT A;  4RO2 A;  1RM1 B;  3OW2 U;  2WLM A;  1YJW V;  1GM9 A;  2OCC B;  2BOC C;  3CC2 V;  2ITC C;  1K8A W;  3CC4 V;  2ITD C;  2DYS C;  1BMF G;  3CCJ V;  3JYC A;  4F4L A;  4BIZ A;  3SPH A;  1S77 D;  2WLI A;  2QTO A;  1NVP B;  1B6Q A;  2EIJ C;  3E8F A;  4RQE A;  3OFN G;  1J95 A;  3ABL B;  1VQ8 V;  2GSM B;  1I5Y A;  2K1E A;  5LBQ A;  3SPI A;  4MW3 A;  1FXK B;  4GX5 A;  1YTF B;  1Y4M A;  2ZXW C;  3X2Q B;  2GHY A;  3DTU B;  2WPD G;  5IY5 C;  2P6J A;  4UVB A;  2H94 A;  2XAH A;  4RAI A;  4FMT A;  3ML0 A;  3UM7 A;  1W0K G;  1PNK A;  4LBE C;  1RPO A;  3AG2 C;  3TCU A;  1KC8 W;  5C93 A;  3BEH A;  1M1K W;  1TUE B;  1F51 A;  1M56 B;  1M57 B;  1QCE A;  3CC7 V;  3FB8 C;  1R3K C;  3BY6 A;  1MAB G;  1VQ7 V;  1ROP A;  2W0F C;  3HB3 B;  5CBH A;  3W7S A;  1K4C C;  4TSF G;  3SPJ A;  3SJQ C;  4MTX A;  1Y66 A;  3A0R A;  4TT3 G;  2AHZ A;  1OCR B;  1MOF A;  5CMU A;  1ENV A;  1H8E G;  2Q6A A;  1KP2 A;  3G4S V;  2EIL C;  2IJH A;  1YSC A;  3AG4 C;  3IFX A;  1G4Y B;  3ZMZ A;  2XAF A;  3AG4 B;  1F23 A;  2BOB C;  1LNQ A;  2JEU A;  1GTO A;  2EIK B;  5EC2 C;  3MD0 A;  4P2Z A;  1V55 C;  5HFM A;  5IYD O;  1YHQ V;  4PDV A;  5LHH A;  2X6A A;  1VQO V;  5EBL C;  1H8H G;  1AI4 A;  3P32 A;  3RVY A;  4QJF B;  3JCZ A;  1SRY A;  5KA6 A;  1S0V A;  1JOY A;  1OCZ B;  4MTG A;  1NH2 D;  4MVS A;  1H38 A;  4BAY A;  4ZBM A;  3W7W A;  1DF4 A;  3ZN0 A;  2QKS A;  3H01 A;  3CMA V;  3SYO A;  1V54 C;  4R50 A;  1SES A;  1SER A;  1V54 B;  2ZQM A;  3GWO A;  3LSS A;  3JD1 A;  4G28 B;  2X0L A;  3ZRW B;  2OTL V;  4XBF A;  4PDM A;  3CCV V;  4X88 A;  4MVR A;  5L3F A;  3K04 A;  2UXX A;  1I5X A;  5BZB A;  3OR6 C;  4PA9 A;  1DTO A;  2HG5 C;  2HR3 A;  2R9I A;  2QEX V;  3E8B A;  4QE9 A;  3FB6 C;  2W6I G;  3OR7 C;  4JTD B;  5EBM C;  1N8R W;  5EC1 C;  3ZRV A;  1NR7 A;  2Q68 A;  4JAS A;  1QBZ A;  4FK5 C;  1QVG U;  1NJI W;  1OCO C;  3ZMS A;  3T4D A;  5HFL A;  4MTF A;  5B1A C;  3CCM V;  3OMI B;  2Y69 B;  3MHH C;  4MVZ A;  4QPK A;  3F7Y C;  3K08 A;  3K9A A;  1NKD A;  1QLE C;  2EIN B;  1PD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...