4MT8A

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
100
structure length
100
Chain Sequence
b'ASHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ethylene response sensor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 45
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mt8A00
4MT8A 4BIZA 4Q20A 3P32A 3ZRWB 1IXMA 2LFSA 4FMTA 4JYCA 2FTKA 2WWWA 4GT1A 2C2AA 2P67A 2QM7A 4JAVA 4KP4A 3TK1A 3A0RA 3ZRWA 5B1NA 4BIUA 5C93A 4JASA 4U7NA 4JAUA 4FPPA 4LC1A 3ZRXA 4QPJA 3ZCCA 4U7OA 4ZKIA 2LFRA 4QPKA 3DGEA 3NXSA 1JOYA 3D36A 4GCZA 1F51A 4I5SA 3ZRVA 2QM8A 5B1OA 3MD0A 4MTXA 5IDJA 4JYBA
chains in the Genus database with same CATH superfamily
1XNQB 4EKWA 4HZ3A 3B4SA 1Y74A 3T4ZA 4LF8B 2EIKB 5LP6B 4J11A 1VQOV 1IZ3A 2ZR2A 2EILC 1BSMA 3MD0A 4X1IB 2A06H 2CTPA 2ZNIA 2KKWA 1I7FA 2YIBD 1GN6A 3E86A 3BVOA 2Q5ZA 3CCQV 3D3IA 3AG3B 5L3EA 2JJ2G 4ZI7B 1RM1B 2HJDA 3X2QB 1XNQO 1YJWV 2A9HA 1N34B 2R9IA 4J80A 5IYZA 1COWG 4LF8O 1N8RW 3OEHG 1I94B 1JOYA 4JAAA 4KFMA 4GX0A 4MW3A 1DF4A 1OCOB 2GUZA 4JI0B 3G4SV 2AHYA 2V7QG 1PKXA 4JAVA 1M1KW 2X6AA 1VQKV 3LDCA 5CBHA 5CB4A 3RYHB 2GTAA 1VF6C 4B7EA 1JR9A 1G6UA 1N34O 5CA1A 3FYEB 5CA0B 1Y66A 4TWKA 3EVKA 3JAKA 4JYCA 5KHGA 4JI7B 2ZE5A 4FFKA 2Y48A 4FFBA 5BMVB 1TUBB 1SQXH 4JI0O 1MA1A 4AQYB 5E79Z 4J7JA 1NTZH 3VQVA 5KA6A 1N36O 4K8XA 4GX2A 1GO3F 3HKEB 5IY5C 2W0FC 1SA0B 4JI2O 3WB0A 3CCEV 3UQ8A 2Q6AA 1R1BA 2RQ6A 4PA6A 3APOA 1MSDA 2JGDA 3EXAA 3SYPA 1HW7A 4LR3A 4FLVA 4JI7O 3OUSA 2QWNB 4IYIA 4JTCB 4AQYO 1FD9A 3DC6A 3T4DA 3DTUB 1KQSU 1SKVA 4LWSB 1L0NH 3E8BA 4O4IA 1B06A 5B1BC 2QE7G 1FXKA 2N04A 3JSLA 2F4VB 2A3QA 4LFCB 2IU3A 2GHYA 2DE0X 4CBCA 3I55V 4B3SB 3TCUA 3JD1A 4UV8A 3JASA 5LMNB 3L70H 1XDCA 1F23A 4B3RO 2PGGA 4JI8B 3ZRVA 4GKKB 2ITDC 5DECA 3IJ4A 3JALB 2F4VO 1R6TA 2PYJA 4LFCO 2BTOA 3CP1A 4PA3A 4B3TO 2NN4A 3CYOA 1NTKH 1AVMA 3AG1C 5JWPA 5LYJA 2WLIA 2ILMA 1UPGA 1AJNA 1HNWO 2R70A 4GX5A 1TAEA 1GN3A 3UKMA 1K5SA 4OX9B 3OTOO 2CTRA 4WCEV 4X8AA 4TQFA 1PD3A 4E2LA 3GWOA 1EN4A 1WN7A 2BOCC 1KECA 4YY3B 2F23A 3ABTA 2WLLA 2LJ2A 1NQTA 2A79B 3QO8A 2RMKB 4CC5A 3LSUA 4FLTA 2HKOA 1OCCC 2Q7EA 4TUYA 1VARA 2X7RB 2DN9A 4AILC 1PNKA 4MVUA 5IJ9B 2YEVB 5JVDA 1BCCH 3D3QA 1Z2GA 5FPOA 3CC4V 2P90A 1XNRB 1BE3H 3RYIA 4YY3O 4IYHA 4TV8B 2B5UA 2XHBA 2IJHA 4NKGB 1S77D 1Q6HA 2ZNJA 1BHAA 1V55B 1K9MW 2ZXWC 1VQ4V 1BGYH 1S72V 1K8AW 2Q0AA 3HKCA 4JI5B 4I0XB 1D5NA 3ZHTA 4IHJB 4ZHQB 1RM1C 1XILA 2WSSG 2DWEC 1N0JA 3TK1A 1MNGA 5LXTB 3SYQA 2R9AA 4PDMA 3QF7A 4JF3A 4JTAB 4WFEA 3E2EA 1WA8B 1XNRO 4U7NA 4FPPA 4I50A 4LCUC 3SJBC 4O4HB 3AG7A 1O9HA 5IDJA 2P22C 5KX5B 4DV1O 1RP3B 4JI5O 2F43G 1AI7A 1G8MA 4TV9A 2Q73A 2UUBB 2UXNA 1PP9H 2KG7B 4QPJA 3OW2U 3A2FA 4NTXA 2CE4A 5LOVA 4NXNB 1M56B 1P49A 2Y69C 3ABLB 1TGOA 4FM1A 4QJFB 3SYCA 4X64B 3ML0A 4LH6A 2FMLA 1S0VA 1IURA 3ABMC 3ZMUA 4BIUA 4FZ1A 2HLDG 4JAUA 5IYDO 3CS5A 3QG5A 3IFXA 3U11A 2UUBO 2HVKC 2YI8A 3SPHA 4DR1B 2KQXA 4QE9A 4BIOA 4QGPA 4FLYA 2JDIG 2K1EA 1LUWA 5EK0A 1SERA 1FXHA 4DXWA 1B6QA 1N33O 1VF5B 1P4RA 2DQ0A 1NVPB 2E75B 1K73W 5B66Z 1VF7A 4MVQA 1H8EG 4MVSA 4FZ0A 5CBGA 4GLXA 3H1KH 1K4DC 3T1HO 4DR1O 2B1IA 1AR4A 2EJ7A 1JA8A 2Q7HA 1DGSA 2PUSA 3WU2Z 1H38A 4J9ZB 1WJZA 1ENVA 3G67A 1Q6IA 1KD1W 1E1QG 2GUZB 4MTXA 5GTHZ 2AW9A 3E22A 1Q82W 5HFMA 4DV0B 2XAHA 3EHBB 2L35A 4K3AA 4P2ZA 5CB4B 2UXXA 2CTWA 3L75H 2QJ1A 4BWAA 3M8AA 1KU9A 3U10A 5CA1B 2ZM6B 1VQ6V 2UUCB 3MHSC 1QR9A 3JAKB 3CCUV 4F4LA 3N27A 1MG1A 4FFBB 4PDLA 3ABKC 5LA6B 4BW9A 3RWRD 1BT8A 3U0ZA 3G80A 2QM7A 4DV0O 3E89A 4JI1O 4O2BB 4B3MB 4DRXA 2E3CA 1VQPV 5J2UA 3QNEA 2OYQA 1XEQA 2UUCO 2ZE7A 4X65B 2JGDB 4D6TH 4O4JA 4UFZA 3JD4A 1K33A 2ZINA 1GMGA 3CCRV 4EFBA 2ETNA 2ADPA 4GX1A 4UVCA 4UCTA 4FLXA 3GB7C 3W7WA 5B1BB 4DV6B 1HNXO 1GAXA 3F5TA 2QKSA 4LFAB 2VQEO 4O4IB 1VIBA 4UUJC 4B3MO 1Y76A 3JD3A 3F7YC 4MVZA 1XUQA 5JQGA 2FL4A 5LGNA 2JJ1G 1IXMA 2JK5C 2F1MA 1FKAO 3CE2A 3JASB 4MVRA 3E8FA 1BHBA 2XTAA 2E5LB 1EN6A 2ZD9A 1SETA 4FLWA 4DV6O 4IGGA 1R6KA 4AHCA 3KCXA 4LFAO 1V9PA 1XOUA 2AXTZ 1ROPA 3A0HZ 4I5SA 3S3XA 4DV5O 3AG1B 2XAJA 4DR4B 4X1YB 4WFGA 1FPOA 4AI8A 5H5NA 4JI4B 4WFFA 3JD2A 3RW0A 5GONA 5LGTA 1ZL8A 3SGIA 1GM7A 2YIBA 2FKXA 3QO5A 5KHIA 5JCOA 3CB2A 1JFFA 5LYJB 4PV1B 1WLEA 2WLIB 4KL1A 2GTSA 5BZBA 4K0KO 3BPZA 3ASOC 2CH7A 4MSWC 5JCOC 4G2KA 1B04A 2WA4A 3OR7C 4R50A 4MVOA 5CMUA 1OCRC 1GN4A 4DR4O 4F6RA 1KBHA 4JI4O 5ITZA 3K03A 5KHHA 1GH6A 3ASNB 2EULA 4QPKA 1VQ7V 1YHQV 4TSFG 3ETDA 2D2CB 2WLLB 4PA9A 1OCCB 3F5WC 1Q6UA 4LBEC 2P6JA 3K5NA 3CSXA 1BZKA 4TUYB 3QVNA 3RN4A 3ZEDA 1YSCA 3ZRSA 1NI8A 1XL4A 5JVDB 2MW2B 4WBNA 2Z3YA 4RO2A 2JRIA 2ZXWB 4UCOA 3RYIB 4FLUA 1XL6A 5IYCO 3FB6C 5EBWC 1CP9A 2ATKC 2QSAA 1Q86W 3HKBA 4DK0A 4FK5C 5DM6V 2IH3C 5FPRA 5LGUA 4ZBMA 2WLKA 1GRJA 1AI6A 3K9SA 2UXDO 3H1LH 1NT2B 5H6RA 2B9ZA 1G1XB 4CS3A 5HFLA 4D7SA 1US6A 4H44B 2WWWA 2C2AA 1OJHA 1SQPH 1V54C 2A0LA 2YDEA 2L6LA 1QVGU 4I50B 1AILA 5KA5A 3UT5A 3TGUH 1N36B 1FJGB 4I55A 2R9RB 3C90A 3SR2C 3BA9A 4HAMA 2YC0A 4JZ2A 2VS0A 4IIJB 4J41A 4P9OA 4JI2B 2UXCB 4LF5O 5B3SC 2H3OA 1JJ2U 1DLBA 5GTIZ 4JI6B 1VQNV 4P30A 5FNVA 2PYLA 2Y69B 5K1PA 1WP7A 1HDJA 4L8JA 4PA7A 2HG5C 4H0LB 3QTCA 4DV7O 3ZJZA 5LOVB 1FJGO 3ABMB 5DEDA 1PM9A 3W7TA 2WPDG 2PY5A 2UXCO 1UJWB 1ZX3A 2EZPA 3L9DA 5JJNB 2FTKA 4JZGA 1HP8A 2AGAA 3K3WA 4JI6O 3K5LA 1NVPD 1AB3A 4B3RB 5IE9A 4ZKIA 3LDDA 1VQLV 3FAVA 4LFBB 3ICXA 3W7XA 5JJEB 3L74H 3ETGA 1WNSA 4O4LA 1FFXB 3AG2C 4X20B 2F95B 4B3TB 1FXKC 4FLZA 1GK9A 1H2LA 1R3KC 1XBLA 1GTOA 3OAAG 3OT7A 3BHPA 5IJ0A 2X6BA 2CAZC 3STLC 5KUKA 3HKDA 1BQZA 1HNWB 2UU9B 4LFBO 1AJQA 1SQBH 2BCCH 1XMQO 1MABG 1H2KA 3K58A 1PV0A 2GV9A 1AI4A 4JTDB 3SDLA 2ADQB 5JH7B 2W6IG 4MVMA 4UB8Z 5K1XA 3OTOB 3R66A 4LP8A 3E22B 2WA3A 2YIAA 2EINC 3H1IH 3CXCU 4C7UA 2LW7A 2Q67A 2OWOA 5EIBC 4Q6GA 2YI9A 5IWAB 4DR7B 1F4NA 3SPCA 1SQFA 2UU9O 5KMGA 4GKJB 1IVSA 1AP5A 2Q0OC 2H8PC 3ABKB 3Q4HA 4MW8A 4Z1MG 3HB3B 1FXVA 1OHHG 2XNDG 1A32A 4JI3O 1NTMH 4X9QA 3G6BA 4LF6O 3ZX6A 3OUFA 2VWJA 3HR0A 3RVYA 4DRXB 2XAFA 1NZ6A 5J2UB 1PNMA 4I4TA 4ZOLA 1H2SB 4E4EA 5IWAO 3ASNC 2ZCEA 5J2TA 4DR7O 2EIJC 3CWBH 2G38A 4GKJO 5AG2A 4O4JB 3SJCC 4DR3B 2LFRA 4I9WA 1YTFB 4W4KA 3RYFA 4R7CA 1OZ0A 3BRCA 3B8NA 5KUMA 4YIOA 4RQEA 2RCVA 3ZMZA 5B1NA 4PA4A 4BR6A 2GDSA 1Y76B 3H01A 3ABUA 1AJPA 3K9AA 1SQQH 2HVJC 5JQGB 4DV3B 2RJZA 1URFA 4DV1B 2IJJA 4A5UB 4DR3O 2JEUA 1KB9F 2QDOA 3KG2A 3M7MX 3JD0A 1SRYA 3CRQA 3SPJA 1KP3A 2B1GA 4NTWA 4UVBA 1QQCA 4WFAV 4NTYA 4B08A 4UV9A 1M93A 1YIJV 1LNQA 2ARHA 5L3CA 4RUEA 3D8CA 2V1DA 4DV3O 5A9GA 5GONB 4PELA 1ZL8B 4UCSA 3ASOB 1SZXA 3FFQA 3OR6C 1JFFB 1H8HG 4OXSA 3K5MA 1Y67A 1NH2B 2CH7B 3JCZA 5CN0A 3ETEA 1OCRB 5B1AB 4G27B 4NXMB 5B1OA 3CC7V 1JX9A 5L3FA 4I7ZB 2BOBC 1L0LH 1CEZA 5L3DA 4F6RB 2M6YA 1N33B 3TXSA 5ITZB 4ZIBA 4ABMA 1AP6A 2FB5A 1YDXA 3FB7C 1I08A 2QTOA 2KSDA 2QKCA 3DXRA 3T1HB 2WAMA 1M57C 2VWKA 3E35A 4NXMO 4WFHA 1IX9A 1ZUQA 1Y74B 2Y0IA 3RYCA 1YJ9V 1Q7YW 1NU1H 4UCRA 2YIDA 3K5OA 3K57A 4WBNB 2JEXA 2JS5A 5A2QN 4EEQA 3FX7A 3CXHF 3LSSA 1JMKC 3WG7B 4LNUA 3A0BZ 4HBNA 1L1FA 3VQWA 1XMOB 1GN2A 1IBMB 2Q68A 3A8TA 4I9QA 3HKBB 4DV4O 1E79G 5LHHA 3JARA 2OCCC 4PDVA 2OIEA 2JIZG 2VQFO 5IYZB 4X88A 2W0XA 4EB6A 3J7AU 1W0JG 4FM2A 1VQ9V 1FS0G 5EBLC 1W2BU 3RGBA 1V54B 2DWDC 4H33A 2EX3A 1LR1A 3I5DA 1OCZC 4WF9V 3CCLV 2Y0PA 2DYSC 2EZOA 2QWQB 1ORQC 2LFSA 3UT5B 4FM0A 4JI1B 1K34A 1H2MA 4KP4A 5B3SB 1XMOO 1IBMO 3P30A 3A0RA 4R8CA 5C93A 2QWRB 4U3JA 1QLEB 4KXRA 1N4CA 1M9NA 2A7WA 3W7SA 5FNVB 2ZQMA 3FB5C 2E74B 4MT8A 1XHXA 3DSQA 5LMUB 4PI0A 2AHZA 1HNXB 2H94A 2Z5UA 3SJQC 1MZFA 2WLJA 2VQEB 1ZLZA 2QWOB 5J9PC 1W59A 1RFYA 2QM4A 4K35A 2GBOA 3ZIAG 4DK1A 4CH4A 3UM7A 3K59A 5IYBO 1Y4MA 3JSNA 5LMUO 1L8DA 3AG2B 3FAVB 1R6NA 3AG4C 3BA8A 2PF4E 1WP8A 1FXKB 4O4LB 4DV5B 3IAYA 4OPHA 5BY1A 2NNUA 3SYAA 4MTGA 5KAFZ 3IGAC 4YJ2A 1AROP 3BABA 1VQMV 1Q5OA 5L3GA 4DR2B 3ZRWA 4HNAA 3GWKC 3ZHVA 1CXZB 1AR1B 1MOFA 2O57A 3E8GA 3HKDB 4K0KB 4NB5A 4LF9O 4OPAA 3OMAB 5LHGA 4X89A 3G71V 3VQXA 1WB7A 3FD9A 1THZA 3CMAV 1HR0B 3BFRA 2EINB 4DW0A 4QNHB 4TOIA 3CRMA 3RT3C 2P7TC 1YEWA 5LXTA 4JV5B 4DR2O 1RSOA 3HPLC 5JJJB 4YJ3A 1WB8A 4UXNA 1Q8IA 4JYYA 4J9YB 2QM8A 3FB8C 4O4HA 1KUQA 2OCHA 5KMGB 3TETA 4XDLA 2QKAA 2Q69A 3Q4HB 2Q8VA 3MHHC 1EZJA 1HNZB 1HR0O 1MMMA 5B1AC 4Z1VA 4KHPO 3ZHQA 2JVDA 1YTFD 4LF7O 3JAWA 2QTSA 4JV5O 2CDYA 2EIJB 4J10A 4GYCB 2IU0A 4LF4B 4FJCC 4I4TB 2JS3A 3N2KA 1EM1A 5J2TB 4PD4F 1H2GA 3NR7A 2HFEC 1WPXA 2RNBA 3WB1A 3J81N 1NR1A 2LQTA 3OMNB 3LUTB 3RYFB 4YHHB 2UXDB 5FL7G 1HNZO 2IM9A 1SZTA 4JYAO 1J95A 4DR5O 4RQFA 1EN5A 1QBZA 4LF4O 5EC2C 2E76B 3SPGA 4J7ZA 3WG7C 2DW4A 4JASA 3HKCB 4LF5B 3FYIB 2YXHA 3AK3A 1VMGA 4YHHO 2DQ3A 5IT9N 1M4UA 4MTFA 3OEEG 1P7GA 2WLNA 2GSMB 4CS2A 3PJSK 2ZR3A 1QNMA 4DV7B 4J42A 1VP7A 2CGNA 1B3QA 2PZSA 1NH2D 2DMXA 5CA3A 1I0HA 1P7BA 2RN9A 4ICGA 2BSKA 5H2FZ 1XREA 4MS2A 5BXZA 4BW5A 2CK3G 5KLVH 1KP2A 4WFBV 4TV9B 2XUMA 1VF6A 3OGCC 1FYJA 1QLEC 1TVKA 5KHKA 2YICA 2X6CA 3T1CA 3N2GA 2ZIMA 3K06A 2Z0AA 3BCCH 2F66C 4FIPC 2CGOA 5KHJA 4QE7A 4TT3G 3BY6A 4Z2WA 5EZYA 1S3JA 2IW5A 1DF5A 3CRCA 3JAMN 2BTQA 2YXYA 3OMIB 1I94O 3ETQA 3ZHUA 2IH1C 3CCVV 3IC7A 1EFRG 3RVZA 5LA6A 3RFRA 1M57B 1S5JA 5EC1C 1VEWA 4B7KA 5B5EZ 3DXRB 3LNMB 2W6JG 3B09A 1GM8A 4O2BA 4LH7A 1K3EA 1YCIA 1N0NA 1I5XA 4BAYA 3NXSA 1XMQB 1SC5B 3RYCB 1AI5A 5LL6Y 5F2VO 2YXLA 1IXBA 1PPJH 2YS8A 1ZAUA 4CZZA 5GW7A 3OE7G 4DR6B 4LNUB 1EZVH 3ZCCA 2OCCB 2XAGA 2N05A 2WLMA 1VQ5V 2PI4A 3ZHSA 3JARB 3AEIA 4O2AA 2DYRC 5D5QA 1TUEB 3CJHA 1JCHA 4XDKA 1QU7A 4FMTA 1R3JC 3C3TA 4JGSA 3H1HH 4EB6B 4X1KA 2EIMC 2AZ2A 3MAQA 1OCZB 3ZS8C 2DYSB 4PDRA 3CCJV 1Q90D 4JI3B 4IL6Z 1K92A 3J80N 4DR6O 2HR3A 4LF6B 4UVAA 3O65A 5BR8B 3CRAA 2CUGA 3ZN0A 4U3JB 4X1YA 4U3FH 1K4CC 3ZBHA 4B3SO 5EYPA 4DUYB 1SESA 5LMNO 3CEIA 1P84F 3VOUA 2ZE8A 3L73H 4JI8O 1KKDA 2Y4TA 4GKKO 1IBLB 1K5QA 2P67A 5BR8O 1FFTB 1PL4A 4KUMA 5C8YA 5L3BA 3P3PA 2EBOA 1MSWD 1QVFU 3ZMSA 1Z5VA 1Q3EA 1Y6XA 3APQA 4DUYO 1XHZA 3O9OA 1GM9A 3AG4B 1U96A 2BE3A 3JATA 4K8ZA 2OTLV 4CH5A 4HYOA 1IBLO 1N32B 3S3WA 3CCMV 2M7WA 1E1RG 3CHXA 3L71H 3AK1A 4RAIA 3LDEA 5LP6A 1RPRA 4CC6A 3QO7A 4N23A 5LBQA 4OX9O 4YJ2B 2LP7A 1SQVH 3B40A 4PHZA 1S5LZ 4D7TA 1D2DA 2EIKC 3SPIA 5LP6C 5H6QA 1NBMG 3ZRWB 4HNAB 3RBZA 4X1IA 5EIBD 3VQYA 3JCUZ 2RDCA 3UO2A 1KYOF 3R65A 5FLXN 4CH3A 1JVMA 4NVPA 3MDSA 1SF9A 3ZRXA 4N21A 5EBMC 4U7OA 3SJAC 4ZI7A 1N32O 3B77A 1QLNA 2LO1A 1UFIA 3OD4A 1HWYA 3OFNG 2XAQA 3AG3C 3TXQA 2QEXV 1K7DA 2PTMA 5DN6G 3X2QC 2QR4A 2YUAA 5CBFA 3P32A 4ASUG 3WFVA 1RSOB 3W7UA 1RPOA 4JPRA 2R72A 4YJ3B 4CH6A 1X4TA 4GUNA 3RYHA 1OCOC 1BQ0A 4P9PA 1KMIZ 4IIJA 1O9GA 1H2NA 3ZMTA 2AZ0A 1JJOA 2UXBB 2OT5A 1YXBA 3E83A 2PI5A 1QR8A 3ZHRA 5CA0A 1KKCA 2IBZH 1F7YA 3H1JH 3JAWB 3TJTA 5BMVA 1TUBA 1WAZA 4W4LA 4PI2A 1EBOA 1IBKB 1WPBA 1M5IA 3ZN1A 4F6EA 1PL0A 1S5HC 3N2KB 2ZIOA 2ZE6A 2FYUH 4DV4B 1ZSPA 4DW1A 1K97A 3HKEA 1SA0A 1GKFA 3GVMA 2VQFB 2F93B 2HP8A 2DOSA 1DTOA 3CPWU 3K08A 2UXBO 2ZKOA 2X0LA 3KCYA 2JGUA 2OIGA 2XT9A 1SQGA 1YI2V 2ITCC 2V4DA 1YVWA 2ZT9B 3KKYA 1IBKO 4NXNO 2QGNA 4LWSA 2WLHA 1QHTA 1J5EB 2LGWA 2LW1A 2EILB 4X64O 3T2MA 2P4VA 1FFXA 2K9PA 1XQ8A 3B2EE 2VRZA 2MK3A 4X20A 3KZIZ 4PJ0Z 1Q43A 1ZWIC 1VQ8V 2N74A 3K0GA 1D5AA 1R3LC 1QCEA 3L72H 1W0KG 2KB1A 2IJIA 4X66B 4G28B 3VBBA 3IC9A 2UUAB 3LSQA 1ZTEA 4CS4A 3E8HA 2EJRA 4I55B 4J7KA 4DYLA 3CRRA 1J5EO 2BSKB 3JALA 4XDJA 4MTOA 4DV2B 4DUZB 5JH7A 4OGQB 3JYCA 2LGQA 1TVKB 1NS1A 3UCSC 3N2GB 2DJVA 1NJIW 4GT1A 4H13B 5EZYB 3OTFA 4X66O 2XASA 3K04A 2UUAO 2BTQB 2ZDIA 1CPYA 5D5PA 1YF2A 4DV2O 2ZDIC 4DUZO 3C3SA 4JYBA 4YIPA 3FKSG 2NR5A 2P4KA 4EFEA 2Q4PA 2HHHB 1S76D 2QA4V 5IY5B 3SYOA 4X62B 2IJKA 3CMEV 3CC2V 1JQ0A 3THOA 5LHIA 4LF9B 4IT5A 4L87A 5KAIZ 3K0DA 4GZRB 2ZM6O 1FAFA 3DGEA 1YITV 1KC8W 3EFFK 3D36A 4Q20A 2D3OW 1DK1A 3D36C 2P5OA 3I56V 5IJ9A 4H37A 2YEVA 2DYRB 4RUFA 3DC5A 5H9CA 2HHHO 2HEPA 2NLJC 4DO2A 5IJ0B 2YSUB 4X62O 3BAAA 1SS3A 1Q81W 4TV8A 3F7VC 4O2AB 2EIMB 1IDSA 1U97A 3STZC 3CJHB 1AR5A 1R3IC 3T1YB 3M99B 4GCZA 1XI1A 2Y4UA 4X1KB 1OV9A 3UO3A 4I0XA 4X65O 4FVMA 1V55C 4IHJA 4ZHQA 3B8MA 2Q7GA 4KHPB 1PNLA 2P06A 1NKDA 4LF7B 3PN1A 3G6EV 2Q9LA 3OGIB 2HJFC 1JPXA 1WA8A 3ZMVA 4NYKA 3OM3B 2CTQA 4QIWF 3H9VA 3CX5F 4BIZA 3T1YO 4RWUA 5KX5A 4XBFA 1YZBA 3LNNA 5EYPB 1YJNV 2QWPB 3WB2A 4JYAB 2E5LO 3P3NA 3BEHA 4TQDA 3CCSV 4DR5B 1I5YA 1T5EA 1F4MA 3AK2A 2KG7A 1F51A 1BMFG 1MZEA 1X59A 5TISZ 5C8YB 1M90W 4UCVA 4UB6Z 4ZOLB 2XOKG 1LUVA 4NR1A 4YXWG 1BS3A 5E1AC 1BL8A 1M56C 3K79A 3ABLC 4R6ZA 4LC1A 4UCUA 1NR7A 1G4YB 1Z5WA 3CD6V 1TA8A 2OTJV 1R73A 3JATB 2ODMA
chains in the Genus database with same CATH topology
1JCHA 4XDKA 4FMTA 1R3JC 4PELA 2QM7A 4EKWA 4JGSA 3ASOB 3E89A 4HZ3A 2EIMC 3OR6C 1OCZB 3T4ZA 1H8HG 2EIKB 2DYSB 4OXSA 4PDRA 3CCJV 1VQOV 2ZR2A 1NH2B 1VQPV 3QNEA 1K92A 3JCZA 5CN0A 3ETEA 2HR3A 1OCRB 5B1AB 4G27B 2EILC 5B1OA 3MD0A 4UVAA 3JD4A 1K33A 3CC7V 1GMGA 1JX9A 5L3FA 3CCRV 2BOBC 4GX1A 4UVCA 1CEZA 3E86A 5L3DA 3GB7C 3W7WA 5B1BB 3CCQV 3ZN0A 3D3IA 3AG3B 5L3EA 2JJ2G 1RM1B 2QKSA 3X2QB 1YJWV 2A9HA 1TUEB 1K4CC 2R9IA 3FB7C 1COWG 4UUJC 1SESA 1N8RW 2QTOA 3OEHG 3JD3A 3VOUA 2WAMA 1JOYA 4KFMA 3F7YC 4MVZA 1M57C 4GX0A 4MW3A 5LGNA 1DF4A 1OCOB 3E35A 2JJ1G 3G4SV 2AHYA 1IXMA 2JK5C 4WFHA 1KKDA 1K5QA 2P67A 2V7QG 1PKXA 4JAVA 4MVRA 2X6AA 1YJ9V 1M1KW 1VQKV 3LDCA 1FFTB 5L3BA 3E8FA 4KUMA 1Q7YW 5CBHA 1BHBA 2EBOA 2ZD9A 1MSWD 1SETA 1QVFU 3ZMSA 1R6KA 2JEXA 3LSSA 3FYEB 3WG7B 1ROPA 4I5SA 1L1FA 1Y66A 4TWKA 1GM9A 3AG4B 3AG1B 2Q68A 4JYCA 2XAJA 1E79G 5LHHA 4WFGA 2Y48A 2OCCC 4PDVA 2JIZG 2OTLV 4WFFA 3JD2A 3RW0A 4HYOA 5LGTA 4X88A 1GM7A 3QO5A 1W0JG 1VQ9V 3CCMV 2M7WA 1E1RG 1FS0G 5EBLC 5KA6A 1W2BU 4GX2A 1V54B 1WLEA 2DWDC 4RAIA 1GO3F 2WLIB 3LDEA 4H33A 1RPRA 3QO7A 5BZBA 4N23A 5LBQA 3ASOC 5IY5C 2W0FC 2LP7A 4MSWC 4G2KA 1OCZC 4WF9V 3CCEV 2EIKC 3CCLV 2DYSC 2EZOA 3SPIA 2Q6AA 5H6QA 1ORQC 1NBMG 3ZRWB 2LFSA 3OR7C 4PA6A 3RBZA 4R50A 4MVOA 1K34A 5CMUA 4KP4A 3SYPA 5B3SB 4PDLA 3P30A 3A0RA 3R65A 1OCRC 4R8CA 3OUSA 5C93A 1JVMA 3ZRXA 4N21A 4JTCB 1QLEB 4U7OA 5EBMC 3K03A 3T4DA 1KQSU 3DTUB 3B77A 3ASNB 1M9NA 4QPKA 1QLNA 1VQ7V 1YHQV 4TSFG 3W7SA 3E8BA 3ETDA 5B1BC 2QE7G 1HWYA 2ZQMA 3OFNG 2XAQA 2WLLB 3AG3C 3FB5C 1FXKA 1K7DA 4PA9A 2QEXV 5DN6G 3X2QC 5CBFA 4MT8A 1OCCB 3P32A 3F5WC 2IU3A 2AHZA 2GHYA 2H94A 2Z5UA 4LBEC 2P6JA 3SJQC 4ASUG 4CBCA 3WFVA 3I55V 2WLJA 3TCUA 3W7UA 1RPOA 3JD1A 4JPRA 5J9PC 4UV8A 1OCOC 1YSCA 3ZRSA 4P9PA 1F23A 1XL4A 3ZRVA 2Z3YA 4RO2A 3ZIAG 3ZMTA 2ITDC 2ZXWB 3UM7A 2OT5A 1XL6A 5IYCO 3E83A 5IYBO 3FB6C 2PI5A 1QR8A 5EBWC 1Y4MA 1CP9A 2ATKC 1Q86W 3CP1A 4FK5C 5DM6V 3AG2B 4PA3A 1R6NA 2IH3C 3AG4C 3CYOA 3AG1C 1EBOA 5LGUA 4ZBMA 2WLKA 1AI6A 3ZN1A 1FXKB 1PL0A 1S5HC 2NNUA 5H6RA 2WLIA 3SYAA 1K97A 4MTGA 5HFLA 3IGAC 2WWWA 1AJNA 1GKFA 1AROP 2C2AA 1VQMV 1DTOA 1V54C 2A0LA 3K08A 3CPWU 5L3GA 3ZRWA 1QVGU 5KA5A 4GX5A 2R9RB 2X0LA 1AR1B 3UKMA 1MOFA 3E8GA 4HAMA 1K5SA 4P9OA 1YI2V 4WCEV 3OMAB 5LHGA 2ITCC 4X89A 4X8AA 3G71V 5B3SC 1JJ2U 1DLBA 1PD3A 4E2LA 3GWOA 2BOCC 2WLHA 1KECA 4P30A 1VQNV 1THZA 3CMAV 3ABTA 2WLLA 2EILB 2Y69B 2EINB 3T2MA 4QNHB 1NQTA 2A79B 2MK3A 4PA7A 3QO8A 2HG5C 2P7TC 3ZJZA 2HKOA 1ZWIC 1VQ8V 1OCCC 3HPLC 3ABMB 3K0GA 4UXNA 1R3LC 1QCEA 2X7RB 4J9YB 2QM8A 3W7TA 3FB8C 1W0KG 2KB1A 1PNKA 4MVUA 2WPDG 1UJWB 2YEVB 3TETA 4XDLA 2IJIA 2EZPA 2Q69A 4G28B 3VBBA 2FTKA 3CC4V 3LSQA 2P90A 3K3WA 3E8HA 2EJRA 3MHHC 1EZJA 2B5UA 2IJHA 1S77D 1NVPD 4XDJA 5B1AC 1BHAA 1V55B 1K9MW 2ZXWC 4MTOA 4ZKIA 1VQ4V 1YTFD 1S72V 1K8AW 3LDDA 1VQLV 3JYCA 2EIJB 2IU0A 3W7XA 3ETGA 1RM1C 4FJCC 3AG2C 2WSSG 1NJIW 2DWEC 4GT1A 3TK1A 1H2GA 3SYQA 4PDMA 1FXKC 2XASA 2HFEC 3K04A 1GK9A 1WPXA 1R3KC 4JF3A 4JTAB 4WFEA 3E2EA 1GTOA 4U7NA 1NR1A 3OMNB 3LUTB 2ZDIA 3OAAG 4FPPA 1CPYA 5FL7G 4LCUC 2X6BA 1SZTA 3STLC 1J95A 5KUKA 2ZDIC 5IDJA 4RQFA 4JYBA 1QBZA 3FKSG 1AJQA 2F43G 1MABG 1AI7A 1S76D 2QA4V 5IY5B 3SYOA 1G8MA 2IJKA 5EC2C 1AI4A 4JTDB 3CMEV 3CC2V 3SPGA 1JQ0A 3WG7C 2DW4A 4JASA 5LHIA 2W6IG 4MVMA 4L87A 2UXNA 4QPJA 3FYIB 3K0DA 4LP8A 3OW2U 3DGEA 1YITV 1KC8W 3EFFK 1M56B 3D36A 2Y69C 2EINC 2DQ3A 3CXCU 3ABLB 2Q67A 4MTFA 3OEEG 2WLNA 4QJFB 4Q20A 2D3OW 3SYCA 2GSMB 3ML0A 1S0VA 3PJSK 2ZR3A 1F4NA 3I56V 3SPCA 3ABMC 4H37A 2YEVA 2DYRB 4RUFA 5H9CA 3ZMUA 3ABKB 2H8PC 2NLJC 4BIUA 4DO2A 1NH2D 5CA3A 2YSUB 1P7BA 2HLDG 4JAUA 5IYDO 4MW8A 4Z1MG 1Q81W 3HB3B 3IFXA 3F7VC 1FXVA 2EIMB 3STZC 1OHHG 2XNDG 4MS2A 2HVKC 4BW5A 1R3IC 3SPHA 3M99B 2CK3G 4GCZA 1KP2A 4WFBV 4QE9A 3OUFA 2JDIG 2K1EA 1V55C 3OGCC 3RVYA 5EK0A 1SERA 1FXHA 1QLEC 2XAFA 2X6CA 3T1CA 1PNMA 4DXWA 3B8MA 1B6QA 3ASNC 1PNLA 3K06A 1P4RA 2EIJC 4FIPC 2DQ0A 1NKDA 4QE7A 4TT3G 3BY6A 1NVPB 3G6EV 1K73W 2LFRA 1S3JA 2HJFC 2IW5A 1DF5A 1JPXA 4I9WA 1YTFB 4MVQA 1H8EG 4MVSA 3OMIB 4R7CA 3ZMVA 1OZ0A 5CBGA 3OM3B 1K4DC 4QIWF 4BIZA 3B8NA 5KUMA 2IH1C 2B1IA 3CCVV 3IC7A 1EFRG 4RQEA 3RVZA 1M57B 4XBFA 1YJNV 3ZMZA 5EC1C 5B1NA 4PA4A 1H38A 3H01A 3ABUA 4J9ZB 3LNMB 1ENVA 2W6JG 1GM8A 1AJPA 3K9AA 1K3EA 2HVJC 1I5XA 3BEHA 3CCSV 4BAYA 1I5YA 1KD1W 1E1QG 1F4MA 3NXSA 2IJJA 1F51A 1BMFG 4MTXA 1Q82W 2JEUA 5HFMA 1AI5A 2XAHA 3KG2A 3JD0A 3EHBB 1SRYA 1M90W 4P2ZA 3SPJA 1KP3A 2B1GA 2UXXA 4UVBA 2XOKG 4YXWG 5E1AC 4WFAV 1BL8A 1M56C 3K79A 4CZZA 1VQ6V 5GW7A 3ABLC 3OE7G 4UV9A 4R6ZA 1YIJV 4LC1A 1LNQA 3ZCCA 1NR7A 1G4YB 3MHSC 5L3CA 2OCCB 2XAGA 1VQ5V 2WLMA 1QR9A 2PI4A 3CD6V 4RUEA 2OTJV 3CCUV 4F4LA 1R73A 1MG1A 3AEIA 2DYRC 2V1DA 3ABKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT8 A;  4BIZ A;  4Q20 A;  3P32 A;  3ZRW B;  1IXM A;  2LFS A;  4FMT A;  4JYC A;  2FTK A;  2WWW A;  4GT1 A;  2C2A A;  2P67 A;  2QM7 A;  4JAV A;  4KP4 A;  3TK1 A;  3A0R A;  3ZRW A;  5B1N A;  4BIU A;  5C93 A;  4JAS A;  4U7N A;  4JAU A;  4FPP A;  4LC1 A;  3ZRX A;  4QPJ A;  3ZCC A;  4U7O A;  4ZKI A;  2LFR A;  4QPK A;  3DGE A;  3NXS A;  1JOY A;  3D36 A;  4GCZ A;  1F51 A;  4I5S A;  3ZRV A;  2QM8 A;  5B1O A;  3MD0 A;  4MTX A;  5IDJ A;  4JYB A; 
#chains in the Genus database with same CATH topology
 1XNQ B;  4EKW A;  4HZ3 A;  3B4S A;  1Y74 A;  3T4Z A;  4LF8 B;  2EIK B;  5LP6 B;  4J11 A;  1VQO V;  1IZ3 A;  2ZR2 A;  2EIL C;  1BSM A;  3MD0 A;  4X1I B;  2A06 H;  2CTP A;  2ZNI A;  2KKW A;  1I7F A;  2YIB D;  1GN6 A;  3E86 A;  3BVO A;  2Q5Z A;  3CCQ V;  3D3I A;  3AG3 B;  5L3E A;  2JJ2 G;  4ZI7 B;  1RM1 B;  2HJD A;  3X2Q B;  1XNQ O;  1YJW V;  2A9H A;  1N34 B;  2R9I A;  4J80 A;  5IYZ A;  1COW G;  4LF8 O;  1N8R W;  3OEH G;  1I94 B;  1JOY A;  4JAA A;  4KFM A;  4GX0 A;  4MW3 A;  1DF4 A;  1OCO B;  2GUZ A;  4JI0 B;  3G4S V;  2AHY A;  2V7Q G;  1PKX A;  4JAV A;  1M1K W;  2X6A A;  1VQK V;  3LDC A;  5CBH A;  5CB4 A;  3RYH B;  2GTA A;  1VF6 C;  4B7E A;  1JR9 A;  1G6U A;  1N34 O;  5CA1 A;  3FYE B;  5CA0 B;  1Y66 A;  4TWK A;  3EVK A;  3JAK A;  4JYC A;  5KHG A;  4JI7 B;  2ZE5 A;  4FFK A;  2Y48 A;  4FFB A;  5BMV B;  1TUB B;  1SQX H;  4JI0 O;  1MA1 A;  4AQY B;  5E79 Z;  4J7J A;  1NTZ H;  3VQV A;  5KA6 A;  1N36 O;  4K8X A;  4GX2 A;  1GO3 F;  3HKE B;  5IY5 C;  2W0F C;  1SA0 B;  4JI2 O;  3WB0 A;  3CCE V;  3UQ8 A;  2Q6A A;  1R1B A;  2RQ6 A;  4PA6 A;  3APO A;  1MSD A;  2JGD A;  3EXA A;  3SYP A;  1HW7 A;  4LR3 A;  4FLV A;  4JI7 O;  3OUS A;  2QWN B;  4IYI A;  4JTC B;  4AQY O;  1FD9 A;  3DC6 A;  3T4D A;  3DTU B;  1KQS U;  1SKV A;  4LWS B;  1L0N H;  3E8B A;  4O4I A;  1B06 A;  5B1B C;  2QE7 G;  1FXK A;  2N04 A;  3JSL A;  2F4V B;  2A3Q A;  4LFC B;  2IU3 A;  2GHY A;  2DE0 X;  4CBC A;  3I55 V;  4B3S B;  3TCU A;  3JD1 A;  4UV8 A;  3JAS A;  5LMN B;  3L70 H;  1XDC A;  1F23 A;  4B3R O;  2PGG A;  4JI8 B;  3ZRV A;  4GKK B;  2ITD C;  5DEC A;  3IJ4 A;  3JAL B;  2F4V O;  1R6T A;  2PYJ A;  4LFC O;  2BTO A;  3CP1 A;  4PA3 A;  4B3T O;  2NN4 A;  3CYO A;  1NTK H;  1AVM A;  3AG1 C;  5JWP A;  5LYJ A;  2WLI A;  2ILM A;  1UPG A;  1AJN A;  1HNW O;  2R70 A;  4GX5 A;  1TAE A;  1GN3 A;  3UKM A;  1K5S A;  4OX9 B;  3OTO O;  2CTR A;  4WCE V;  4X8A A;  4TQF A;  1PD3 A;  4E2L A;  3GWO A;  1EN4 A;  1WN7 A;  2BOC C;  1KEC A;  4YY3 B;  2F23 A;  3ABT A;  2WLL A;  2LJ2 A;  1NQT A;  2A79 B;  3QO8 A;  2RMK B;  4CC5 A;  3LSU A;  4FLT A;  2HKO A;  1OCC C;  2Q7E A;  4TUY A;  1VAR A;  2X7R B;  2DN9 A;  4AIL C;  1PNK A;  4MVU A;  5IJ9 B;  2YEV B;  5JVD A;  1BCC H;  3D3Q A;  1Z2G A;  5FPO A;  3CC4 V;  2P90 A;  1XNR B;  1BE3 H;  3RYI A;  4YY3 O;  4IYH A;  4TV8 B;  2B5U A;  2XHB A;  2IJH A;  4NKG B;  1S77 D;  1Q6H A;  2ZNJ A;  1BHA A;  1V55 B;  1K9M W;  2ZXW C;  1VQ4 V;  1BGY H;  1S72 V;  1K8A W;  2Q0A A;  3HKC A;  4JI5 B;  4I0X B;  1D5N A;  3ZHT A;  4IHJ B;  4ZHQ B;  1RM1 C;  1XIL A;  2WSS G;  2DWE C;  1N0J A;  3TK1 A;  1MNG A;  5LXT B;  3SYQ A;  2R9A A;  4PDM A;  3QF7 A;  4JF3 A;  4JTA B;  4WFE A;  3E2E A;  1WA8 B;  1XNR O;  4U7N A;  4FPP A;  4I50 A;  4LCU C;  3SJB C;  4O4H B;  3AG7 A;  1O9H A;  5IDJ A;  2P22 C;  5KX5 B;  4DV1 O;  1RP3 B;  4JI5 O;  2F43 G;  1AI7 A;  1G8M A;  4TV9 A;  2Q73 A;  2UUB B;  2UXN A;  1PP9 H;  2KG7 B;  4QPJ A;  3OW2 U;  3A2F A;  4NTX A;  2CE4 A;  5LOV A;  4NXN B;  1M56 B;  1P49 A;  2Y69 C;  3ABL B;  1TGO A;  4FM1 A;  4QJF B;  3SYC A;  4X64 B;  3ML0 A;  4LH6 A;  2FML A;  1S0V A;  1IUR A;  3ABM C;  3ZMU A;  4BIU A;  4FZ1 A;  2HLD G;  4JAU A;  5IYD O;  3CS5 A;  3QG5 A;  3IFX A;  3U11 A;  2UUB O;  2HVK C;  2YI8 A;  3SPH A;  4DR1 B;  2KQX A;  4QE9 A;  4BIO A;  4QGP A;  4FLY A;  2JDI G;  2K1E A;  1LUW A;  5EK0 A;  1SER A;  1FXH A;  4DXW A;  1B6Q A;  1N33 O;  1VF5 B;  1P4R A;  2DQ0 A;  1NVP B;  2E75 B;  1K73 W;  5B66 Z;  1VF7 A;  4MVQ A;  1H8E G;  4MVS A;  4FZ0 A;  5CBG A;  4GLX A;  3H1K H;  1K4D C;  3T1H O;  4DR1 O;  2B1I A;  1AR4 A;  2EJ7 A;  1JA8 A;  2Q7H A;  1DGS A;  2PUS A;  3WU2 Z;  1H38 A;  4J9Z B;  1WJZ A;  1ENV A;  3G67 A;  1Q6I A;  1KD1 W;  1E1Q G;  2GUZ B;  4MTX A;  5GTH Z;  2AW9 A;  3E22 A;  1Q82 W;  5HFM A;  4DV0 B;  2XAH A;  3EHB B;  2L35 A;  4K3A A;  4P2Z A;  5CB4 B;  2UXX A;  2CTW A;  3L75 H;  2QJ1 A;  4BWA A;  3M8A A;  1KU9 A;  3U10 A;  5CA1 B;  2ZM6 B;  1VQ6 V;  2UUC B;  3MHS C;  1QR9 A;  3JAK B;  3CCU V;  4F4L A;  3N27 A;  1MG1 A;  4FFB B;  4PDL A;  3ABK C;  5LA6 B;  4BW9 A;  3RWR D;  1BT8 A;  3U0Z A;  3G80 A;  2QM7 A;  4DV0 O;  3E89 A;  4JI1 O;  4O2B B;  4B3M B;  4DRX A;  2E3C A;  1VQP V;  5J2U A;  3QNE A;  2OYQ A;  1XEQ A;  2UUC O;  2ZE7 A;  4X65 B;  2JGD B;  4D6T H;  4O4J A;  4UFZ A;  3JD4 A;  1K33 A;  2ZIN A;  1GMG A;  3CCR V;  4EFB A;  2ETN A;  2ADP A;  4GX1 A;  4UVC A;  4UCT A;  4FLX A;  3GB7 C;  3W7W A;  5B1B B;  4DV6 B;  1HNX O;  1GAX A;  3F5T A;  2QKS A;  4LFA B;  2VQE O;  4O4I B;  1VIB A;  4UUJ C;  4B3M O;  1Y76 A;  3JD3 A;  3F7Y C;  4MVZ A;  1XUQ A;  5JQG A;  2FL4 A;  5LGN A;  2JJ1 G;  1IXM A;  2JK5 C;  2F1M A;  1FKA O;  3CE2 A;  3JAS B;  4MVR A;  3E8F A;  1BHB A;  2XTA A;  2E5L B;  1EN6 A;  2ZD9 A;  1SET A;  4FLW A;  4DV6 O;  4IGG A;  1R6K A;  4AHC A;  3KCX A;  4LFA O;  1V9P A;  1XOU A;  2AXT Z;  1ROP A;  3A0H Z;  4I5S A;  3S3X A;  4DV5 O;  3AG1 B;  2XAJ A;  4DR4 B;  4X1Y B;  4WFG A;  1FPO A;  4AI8 A;  5H5N A;  4JI4 B;  4WFF A;  3JD2 A;  3RW0 A;  5GON A;  5LGT A;  1ZL8 A;  3SGI A;  1GM7 A;  2YIB A;  2FKX A;  3QO5 A;  5KHI A;  5JCO A;  3CB2 A;  1JFF A;  5LYJ B;  4PV1 B;  1WLE A;  2WLI B;  4KL1 A;  2GTS A;  5BZB A;  4K0K O;  3BPZ A;  3ASO C;  2CH7 A;  4MSW C;  5JCO C;  4G2K A;  1B04 A;  2WA4 A;  3OR7 C;  4R50 A;  4MVO A;  5CMU A;  1OCR C;  1GN4 A;  4DR4 O;  4F6R A;  1KBH A;  4JI4 O;  5ITZ A;  3K03 A;  5KHH A;  1GH6 A;  3ASN B;  2EUL A;  4QPK A;  1VQ7 V;  1YHQ V;  4TSF G;  3ETD A;  2D2C B;  2WLL B;  4PA9 A;  1OCC B;  3F5W C;  1Q6U A;  4LBE C;  2P6J A;  3K5N A;  3CSX A;  1BZK A;  4TUY B;  3QVN A;  3RN4 A;  3ZED A;  1YSC A;  3ZRS A;  1NI8 A;  1XL4 A;  5JVD B;  2MW2 B;  4WBN A;  2Z3Y A;  4RO2 A;  2JRI A;  2ZXW B;  4UCO A;  3RYI B;  4FLU A;  1XL6 A;  5IYC O;  3FB6 C;  5EBW C;  1CP9 A;  2ATK C;  2QSA A;  1Q86 W;  3HKB A;  4DK0 A;  4FK5 C;  5DM6 V;  2IH3 C;  5FPR A;  5LGU A;  4ZBM A;  2WLK A;  1GRJ A;  1AI6 A;  3K9S A;  2UXD O;  3H1L H;  1NT2 B;  5H6R A;  2B9Z A;  1G1X B;  4CS3 A;  5HFL A;  4D7S A;  1US6 A;  4H44 B;  2WWW A;  2C2A A;  1OJH A;  1SQP H;  1V54 C;  2A0L A;  2YDE A;  2L6L A;  1QVG U;  4I50 B;  1AIL A;  5KA5 A;  3UT5 A;  3TGU H;  1N36 B;  1FJG B;  4I55 A;  2R9R B;  3C90 A;  3SR2 C;  3BA9 A;  4HAM A;  2YC0 A;  4JZ2 A;  2VS0 A;  4IIJ B;  4J41 A;  4P9O A;  4JI2 B;  2UXC B;  4LF5 O;  5B3S C;  2H3O A;  1JJ2 U;  1DLB A;  5GTI Z;  4JI6 B;  1VQN V;  4P30 A;  5FNV A;  2PYL A;  2Y69 B;  5K1P A;  1WP7 A;  1HDJ A;  4L8J A;  4PA7 A;  2HG5 C;  4H0L B;  3QTC A;  4DV7 O;  3ZJZ A;  5LOV B;  1FJG O;  3ABM B;  5DED A;  1PM9 A;  3W7T A;  2WPD G;  2PY5 A;  2UXC O;  1UJW B;  1ZX3 A;  2EZP A;  3L9D A;  5JJN B;  2FTK A;  4JZG A;  1HP8 A;  2AGA A;  3K3W A;  4JI6 O;  3K5L A;  1NVP D;  1AB3 A;  4B3R B;  5IE9 A;  4ZKI A;  3LDD A;  1VQL V;  3FAV A;  4LFB B;  3ICX A;  3W7X A;  5JJE B;  3L74 H;  3ETG A;  1WNS A;  4O4L A;  1FFX B;  3AG2 C;  4X20 B;  2F95 B;  4B3T B;  1FXK C;  4FLZ A;  1GK9 A;  1H2L A;  1R3K C;  1XBL A;  1GTO A;  3OAA G;  3OT7 A;  3BHP A;  5IJ0 A;  2X6B A;  2CAZ C;  3STL C;  5KUK A;  3HKD A;  1BQZ A;  1HNW B;  2UU9 B;  4LFB O;  1AJQ A;  1SQB H;  2BCC H;  1XMQ O;  1MAB G;  1H2K A;  3K58 A;  1PV0 A;  2GV9 A;  1AI4 A;  4JTD B;  3SDL A;  2ADQ B;  5JH7 B;  2W6I G;  4MVM A;  4UB8 Z;  5K1X A;  3OTO B;  3R66 A;  4LP8 A;  3E22 B;  2WA3 A;  2YIA A;  2EIN C;  3H1I H;  3CXC U;  4C7U A;  2LW7 A;  2Q67 A;  2OWO A;  5EIB C;  4Q6G A;  2YI9 A;  5IWA B;  4DR7 B;  1F4N A;  3SPC A;  1SQF A;  2UU9 O;  5KMG A;  4GKJ B;  1IVS A;  1AP5 A;  2Q0O C;  2H8P C;  3ABK B;  3Q4H A;  4MW8 A;  4Z1M G;  3HB3 B;  1FXV A;  1OHH G;  2XND G;  1A32 A;  4JI3 O;  1NTM H;  4X9Q A;  3G6B A;  4LF6 O;  3ZX6 A;  3OUF A;  2VWJ A;  3HR0 A;  3RVY A;  4DRX B;  2XAF A;  1NZ6 A;  5J2U B;  1PNM A;  4I4T A;  4ZOL A;  1H2S B;  4E4E A;  5IWA O;  3ASN C;  2ZCE A;  5J2T A;  4DR7 O;  2EIJ C;  3CWB H;  2G38 A;  4GKJ O;  5AG2 A;  4O4J B;  3SJC C;  4DR3 B;  2LFR A;  4I9W A;  1YTF B;  4W4K A;  3RYF A;  4R7C A;  1OZ0 A;  3BRC A;  3B8N A;  5KUM A;  4YIO A;  4RQE A;  2RCV A;  3ZMZ A;  5B1N A;  4PA4 A;  4BR6 A;  2GDS A;  1Y76 B;  3H01 A;  3ABU A;  1AJP A;  3K9A A;  1SQQ H;  2HVJ C;  5JQG B;  4DV3 B;  2RJZ A;  1URF A;  4DV1 B;  2IJJ A;  4A5U B;  4DR3 O;  2JEU A;  1KB9 F;  2QDO A;  3KG2 A;  3M7M X;  3JD0 A;  1SRY A;  3CRQ A;  3SPJ A;  1KP3 A;  2B1G A;  4NTW A;  4UVB A;  1QQC A;  4WFA V;  4NTY A;  4B08 A;  4UV9 A;  1M93 A;  1YIJ V;  1LNQ A;  2ARH A;  5L3C A;  4RUE A;  3D8C A;  2V1D A;  4DV3 O;  5A9G A;  5GON B;  4PEL A;  1ZL8 B;  4UCS A;  3ASO B;  1SZX A;  3FFQ A;  3OR6 C;  1JFF B;  1H8H G;  4OXS A;  3K5M A;  1Y67 A;  1NH2 B;  2CH7 B;  3JCZ A;  5CN0 A;  3ETE A;  1OCR B;  5B1A B;  4G27 B;  4NXM B;  5B1O A;  3CC7 V;  1JX9 A;  5L3F A;  4I7Z B;  2BOB C;  1L0L H;  1CEZ A;  5L3D A;  4F6R B;  2M6Y A;  1N33 B;  3TXS A;  5ITZ B;  4ZIB A;  4ABM A;  1AP6 A;  2FB5 A;  1YDX A;  3FB7 C;  1I08 A;  2QTO A;  2KSD A;  2QKC A;  3DXR A;  3T1H B;  2WAM A;  1M57 C;  2VWK A;  3E35 A;  4NXM O;  4WFH A;  1IX9 A;  1ZUQ A;  1Y74 B;  2Y0I A;  3RYC A;  1YJ9 V;  1Q7Y W;  1NU1 H;  4UCR A;  2YID A;  3K5O A;  3K57 A;  4WBN B;  2JEX A;  2JS5 A;  5A2Q N;  4EEQ A;  3FX7 A;  3CXH F;  3LSS A;  1JMK C;  3WG7 B;  4LNU A;  3A0B Z;  4HBN A;  1L1F A;  3VQW A;  1XMO B;  1GN2 A;  1IBM B;  2Q68 A;  3A8T A;  4I9Q A;  3HKB B;  4DV4 O;  1E79 G;  5LHH A;  3JAR A;  2OCC C;  4PDV A;  2OIE A;  2JIZ G;  2VQF O;  5IYZ B;  4X88 A;  2W0X A;  4EB6 A;  3J7A U;  1W0J G;  4FM2 A;  1VQ9 V;  1FS0 G;  5EBL C;  1W2B U;  3RGB A;  1V54 B;  2DWD C;  4H33 A;  2EX3 A;  1LR1 A;  3I5D A;  1OCZ C;  4WF9 V;  3CCL V;  2Y0P A;  2DYS C;  2EZO A;  2QWQ B;  1ORQ C;  2LFS A;  3UT5 B;  4FM0 A;  4JI1 B;  1K34 A;  1H2M A;  4KP4 A;  5B3S B;  1XMO O;  1IBM O;  3P30 A;  3A0R A;  4R8C A;  5C93 A;  2QWR B;  4U3J A;  1QLE B;  4KXR A;  1N4C A;  1M9N A;  2A7W A;  3W7S A;  5FNV B;  2ZQM A;  3FB5 C;  2E74 B;  4MT8 A;  1XHX A;  3DSQ A;  5LMU B;  4PI0 A;  2AHZ A;  1HNX B;  2H94 A;  2Z5U A;  3SJQ C;  1MZF A;  2WLJ A;  2VQE B;  1ZLZ A;  2QWO B;  5J9P C;  1W59 A;  1RFY A;  2QM4 A;  4K35 A;  2GBO A;  3ZIA G;  4DK1 A;  4CH4 A;  3UM7 A;  3K59 A;  5IYB O;  1Y4M A;  3JSN A;  5LMU O;  1L8D A;  3AG2 B;  3FAV B;  1R6N A;  3AG4 C;  3BA8 A;  2PF4 E;  1WP8 A;  1FXK B;  4O4L B;  4DV5 B;  3IAY A;  4OPH A;  5BY1 A;  2NNU A;  3SYA A;  4MTG A;  5KAF Z;  3IGA C;  4YJ2 A;  1ARO P;  3BAB A;  1VQM V;  1Q5O A;  5L3G A;  4DR2 B;  3ZRW A;  4HNA A;  3GWK C;  3ZHV A;  1CXZ B;  1AR1 B;  1MOF A;  2O57 A;  3E8G A;  3HKD B;  4K0K B;  4NB5 A;  4LF9 O;  4OPA A;  3OMA B;  5LHG A;  4X89 A;  3G71 V;  3VQX A;  1WB7 A;  3FD9 A;  1THZ A;  3CMA V;  1HR0 B;  3BFR A;  2EIN B;  4DW0 A;  4QNH B;  4TOI A;  3CRM A;  3RT3 C;  2P7T C;  1YEW A;  5LXT A;  4JV5 B;  4DR2 O;  1RSO A;  3HPL C;  5JJJ B;  4YJ3 A;  1WB8 A;  4UXN A;  1Q8I A;  4JYY A;  4J9Y B;  2QM8 A;  3FB8 C;  4O4H A;  1KUQ A;  2OCH A;  5KMG B;  3TET A;  4XDL A;  2QKA A;  2Q69 A;  3Q4H B;  2Q8V A;  3MHH C;  1EZJ A;  1HNZ B;  1HR0 O;  1MMM A;  5B1A C;  4Z1V A;  4KHP O;  3ZHQ A;  2JVD A;  1YTF D;  4LF7 O;  3JAW A;  2QTS A;  4JV5 O;  2CDY A;  2EIJ B;  4J10 A;  4GYC B;  2IU0 A;  4LF4 B;  4FJC C;  4I4T B;  2JS3 A;  3N2K A;  1EM1 A;  5J2T B;  4PD4 F;  1H2G A;  3NR7 A;  2HFE C;  1WPX A;  2RNB A;  3WB1 A;  3J81 N;  1NR1 A;  2LQT A;  3OMN B;  3LUT B;  3RYF B;  4YHH B;  2UXD B;  5FL7 G;  1HNZ O;  2IM9 A;  1SZT A;  4JYA O;  1J95 A;  4DR5 O;  4RQF A;  1EN5 A;  1QBZ A;  4LF4 O;  5EC2 C;  2E76 B;  3SPG A;  4J7Z A;  3WG7 C;  2DW4 A;  4JAS A;  3HKC B;  4LF5 B;  3FYI B;  2YXH A;  3AK3 A;  1VMG A;  4YHH O;  2DQ3 A;  5IT9 N;  1M4U A;  4MTF A;  3OEE G;  1P7G A;  2WLN A;  2GSM B;  4CS2 A;  3PJS K;  2ZR3 A;  1QNM A;  4DV7 B;  4J42 A;  1VP7 A;  2CGN A;  1B3Q A;  2PZS A;  1NH2 D;  2DMX A;  5CA3 A;  1I0H A;  1P7B A;  2RN9 A;  4ICG A;  2BSK A;  5H2F Z;  1XRE A;  4MS2 A;  5BXZ A;  4BW5 A;  2CK3 G;  5KLV H;  1KP2 A;  4WFB V;  4TV9 B;  2XUM A;  1VF6 A;  3OGC C;  1FYJ A;  1QLE C;  1TVK A;  5KHK A;  2YIC A;  2X6C A;  3T1C A;  3N2G A;  2ZIM A;  3K06 A;  2Z0A A;  3BCC H;  2F66 C;  4FIP C;  2CGO A;  5KHJ A;  4QE7 A;  4TT3 G;  3BY6 A;  4Z2W A;  5EZY A;  1S3J A;  2IW5 A;  1DF5 A;  3CRC A;  3JAM N;  2BTQ A;  2YXY A;  3OMI B;  1I94 O;  3ETQ A;  3ZHU A;  2IH1 C;  3CCV V;  3IC7 A;  1EFR G;  3RVZ A;  5LA6 A;  3RFR A;  1M57 B;  1S5J A;  5EC1 C;  1VEW A;  4B7K A;  5B5E Z;  3DXR B;  3LNM B;  2W6J G;  3B09 A;  1GM8 A;  4O2B A;  4LH7 A;  1K3E A;  1YCI A;  1N0N A;  1I5X A;  4BAY A;  3NXS A;  1XMQ B;  1SC5 B;  3RYC B;  1AI5 A;  5LL6 Y;  5F2V O;  2YXL A;  1IXB A;  1PPJ H;  2YS8 A;  1ZAU A;  4CZZ A;  5GW7 A;  3OE7 G;  4DR6 B;  4LNU B;  1EZV H;  3ZCC A;  2OCC B;  2XAG A;  2N05 A;  2WLM A;  1VQ5 V;  2PI4 A;  3ZHS A;  3JAR B;  3AEI A;  4O2A A;  2DYR C;  5D5Q A;  1TUE B;  3CJH A;  1JCH A;  4XDK A;  1QU7 A;  4FMT A;  1R3J C;  3C3T A;  4JGS A;  3H1H H;  4EB6 B;  4X1K A;  2EIM C;  2AZ2 A;  3MAQ A;  1OCZ B;  3ZS8 C;  2DYS B;  4PDR A;  3CCJ V;  1Q90 D;  4JI3 B;  4IL6 Z;  1K92 A;  3J80 N;  4DR6 O;  2HR3 A;  4LF6 B;  4UVA A;  3O65 A;  5BR8 B;  3CRA A;  2CUG A;  3ZN0 A;  4U3J B;  4X1Y A;  4U3F H;  1K4C C;  3ZBH A;  4B3S O;  5EYP A;  4DUY B;  1SES A;  5LMN O;  3CEI A;  1P84 F;  3VOU A;  2ZE8 A;  3L73 H;  4JI8 O;  1KKD A;  2Y4T A;  4GKK O;  1IBL B;  1K5Q A;  2P67 A;  5BR8 O;  1FFT B;  1PL4 A;  4KUM A;  5C8Y A;  5L3B A;  3P3P A;  2EBO A;  1MSW D;  1QVF U;  3ZMS A;  1Z5V A;  1Q3E A;  1Y6X A;  3APQ A;  4DUY O;  1XHZ A;  3O9O A;  1GM9 A;  3AG4 B;  1U96 A;  2BE3 A;  3JAT A;  4K8Z A;  2OTL V;  4CH5 A;  4HYO A;  1IBL O;  1N32 B;  3S3W A;  3CCM V;  2M7W A;  1E1R G;  3CHX A;  3L71 H;  3AK1 A;  4RAI A;  3LDE A;  5LP6 A;  1RPR A;  4CC6 A;  3QO7 A;  4N23 A;  5LBQ A;  4OX9 O;  4YJ2 B;  2LP7 A;  1SQV H;  3B40 A;  4PHZ A;  1S5L Z;  4D7T A;  1D2D A;  2EIK C;  3SPI A;  5LP6 C;  5H6Q A;  1NBM G;  3ZRW B;  4HNA B;  3RBZ A;  4X1I A;  5EIB D;  3VQY A;  3JCU Z;  2RDC A;  3UO2 A;  1KYO F;  3R65 A;  5FLX N;  4CH3 A;  1JVM A;  4NVP A;  3MDS A;  1SF9 A;  3ZRX A;  4N21 A;  5EBM C;  4U7O A;  3SJA C;  4ZI7 A;  1N32 O;  3B77 A;  1QLN A;  2LO1 A;  1UFI A;  3OD4 A;  1HWY A;  3OFN G;  2XAQ A;  3AG3 C;  3TXQ A;  2QEX V;  1K7D A;  2PTM A;  5DN6 G;  3X2Q C;  2QR4 A;  2YUA A;  5CBF A;  3P32 A;  4ASU G;  3WFV A;  1RSO B;  3W7U A;  1RPO A;  4JPR A;  2R72 A;  4YJ3 B;  4CH6 A;  1X4T A;  4GUN A;  3RYH A;  1OCO C;  1BQ0 A;  4P9P A;  1KMI Z;  4IIJ A;  1O9G A;  1H2N A;  3ZMT A;  2AZ0 A;  1JJO A;  2UXB B;  2OT5 A;  1YXB A;  3E83 A;  2PI5 A;  1QR8 A;  3ZHR A;  5CA0 A;  1KKC A;  2IBZ H;  1F7Y A;  3H1J H;  3JAW B;  3TJT A;  5BMV A;  1TUB A;  1WAZ A;  4W4L A;  4PI2 A;  1EBO A;  1IBK B;  1WPB A;  1M5I A;  3ZN1 A;  4F6E A;  1PL0 A;  1S5H C;  3N2K B;  2ZIO A;  2ZE6 A;  2FYU H;  4DV4 B;  1ZSP A;  4DW1 A;  1K97 A;  3HKE A;  1SA0 A;  1GKF A;  3GVM A;  2VQF B;  2F93 B;  2HP8 A;  2DOS A;  1DTO A;  3CPW U;  3K08 A;  2UXB O;  2ZKO A;  2X0L A;  3KCY A;  2JGU A;  2OIG A;  2XT9 A;  1SQG A;  1YI2 V;  2ITC C;  2V4D A;  1YVW A;  2ZT9 B;  3KKY A;  1IBK O;  4NXN O;  2QGN A;  4LWS A;  2WLH A;  1QHT A;  1J5E B;  2LGW A;  2LW1 A;  2EIL B;  4X64 O;  3T2M A;  2P4V A;  1FFX A;  2K9P A;  1XQ8 A;  3B2E E;  2VRZ A;  2MK3 A;  4X20 A;  3KZI Z;  4PJ0 Z;  1Q43 A;  1ZWI C;  1VQ8 V;  2N74 A;  3K0G A;  1D5A A;  1R3L C;  1QCE A;  3L72 H;  1W0K G;  2KB1 A;  2IJI A;  4X66 B;  4G28 B;  3VBB A;  3IC9 A;  2UUA B;  3LSQ A;  1ZTE A;  4CS4 A;  3E8H A;  2EJR A;  4I55 B;  4J7K A;  4DYL A;  3CRR A;  1J5E O;  2BSK B;  3JAL A;  4XDJ A;  4MTO A;  4DV2 B;  4DUZ B;  5JH7 A;  4OGQ B;  3JYC A;  2LGQ A;  1TVK B;  1NS1 A;  3UCS C;  3N2G B;  2DJV A;  1NJI W;  4GT1 A;  4H13 B;  5EZY B;  3OTF A;  4X66 O;  2XAS A;  3K04 A;  2UUA O;  2BTQ B;  2ZDI A;  1CPY A;  5D5P A;  1YF2 A;  4DV2 O;  2ZDI C;  4DUZ O;  3C3S A;  4JYB A;  4YIP A;  3FKS G;  2NR5 A;  2P4K A;  4EFE A;  2Q4P A;  2HHH B;  1S76 D;  2QA4 V;  5IY5 B;  3SYO A;  4X62 B;  2IJK A;  3CME V;  3CC2 V;  1JQ0 A;  3THO A;  5LHI A;  4LF9 B;  4IT5 A;  4L87 A;  5KAI Z;  3K0D A;  4GZR B;  2ZM6 O;  1FAF A;  3DGE A;  1YIT V;  1KC8 W;  3EFF K;  3D36 A;  4Q20 A;  2D3O W;  1DK1 A;  3D36 C;  2P5O A;  3I56 V;  5IJ9 A;  4H37 A;  2YEV A;  2DYR B;  4RUF A;  3DC5 A;  5H9C A;  2HHH O;  2HEP A;  2NLJ C;  4DO2 A;  5IJ0 B;  2YSU B;  4X62 O;  3BAA A;  1SS3 A;  1Q81 W;  4TV8 A;  3F7V C;  4O2A B;  2EIM B;  1IDS A;  1U97 A;  3STZ C;  3CJH B;  1AR5 A;  1R3I C;  3T1Y B;  3M99 B;  4GCZ A;  1XI1 A;  2Y4U A;  4X1K B;  1OV9 A;  3UO3 A;  4I0X A;  4X65 O;  4FVM A;  1V55 C;  4IHJ A;  4ZHQ A;  3B8M A;  2Q7G A;  4KHP B;  1PNL A;  2P06 A;  1NKD A;  4LF7 B;  3PN1 A;  3G6E V;  2Q9L A;  3OGI B;  2HJF C;  1JPX A;  1WA8 A;  3ZMV A;  4NYK A;  3OM3 B;  2CTQ A;  4QIW F;  3H9V A;  3CX5 F;  4BIZ A;  3T1Y O;  4RWU A;  5KX5 A;  4XBF A;  1YZB A;  3LNN A;  5EYP B;  1YJN V;  2QWP B;  3WB2 A;  4JYA B;  2E5L O;  3P3N A;  3BEH A;  4TQD A;  3CCS V;  4DR5 B;  1I5Y A;  1T5E A;  1F4M A;  3AK2 A;  2KG7 A;  1F51 A;  1BMF G;  1MZE A;  1X59 A;  5TIS Z;  5C8Y B;  1M90 W;  4UCV A;  4UB6 Z;  4ZOL B;  2XOK G;  1LUV A;  4NR1 A;  4YXW G;  1BS3 A;  5E1A C;  1BL8 A;  1M56 C;  3K79 A;  3ABL C;  4R6Z A;  4LC1 A;  4UCU A;  1NR7 A;  1G4Y B;  1Z5W A;  3CD6 V;  1TA8 A;  2OTJ V;  1R73 A;  3JAT B;  2ODM A; 
#chains in the Genus database with same CATH homology
 1JCH A;  4XDK A;  4FMT A;  1R3J C;  4PEL A;  2QM7 A;  4EKW A;  4JGS A;  3ASO B;  3E89 A;  4HZ3 A;  2EIM C;  3OR6 C;  1OCZ B;  3T4Z A;  1H8H G;  2EIK B;  2DYS B;  4OXS A;  4PDR A;  3CCJ V;  1VQO V;  2ZR2 A;  1NH2 B;  1VQP V;  3QNE A;  1K92 A;  3JCZ A;  5CN0 A;  3ETE A;  2HR3 A;  1OCR B;  5B1A B;  4G27 B;  2EIL C;  5B1O A;  3MD0 A;  4UVA A;  3JD4 A;  1K33 A;  3CC7 V;  1GMG A;  1JX9 A;  5L3F A;  3CCR V;  2BOB C;  4GX1 A;  4UVC A;  1CEZ A;  3E86 A;  5L3D A;  3GB7 C;  3W7W A;  5B1B B;  3CCQ V;  3ZN0 A;  3D3I A;  3AG3 B;  5L3E A;  2JJ2 G;  1RM1 B;  2QKS A;  3X2Q B;  1YJW V;  2A9H A;  1TUE B;  1K4C C;  2R9I A;  3FB7 C;  1COW G;  4UUJ C;  1SES A;  1N8R W;  2QTO A;  3OEH G;  3JD3 A;  3VOU A;  2WAM A;  1JOY A;  4KFM A;  3F7Y C;  4MVZ A;  1M57 C;  4GX0 A;  4MW3 A;  5LGN A;  1DF4 A;  1OCO B;  3E35 A;  2JJ1 G;  3G4S V;  2AHY A;  1IXM A;  2JK5 C;  4WFH A;  1KKD A;  1K5Q A;  2P67 A;  2V7Q G;  1PKX A;  4JAV A;  4MVR A;  2X6A A;  1YJ9 V;  1M1K W;  1VQK V;  3LDC A;  1FFT B;  5L3B A;  3E8F A;  4KUM A;  1Q7Y W;  5CBH A;  1BHB A;  2EBO A;  2ZD9 A;  1MSW D;  1SET A;  1QVF U;  3ZMS A;  1R6K A;  2JEX A;  3LSS A;  3FYE B;  3WG7 B;  1ROP A;  4I5S A;  1L1F A;  1Y66 A;  4TWK A;  1GM9 A;  3AG4 B;  3AG1 B;  2Q68 A;  4JYC A;  2XAJ A;  1E79 G;  5LHH A;  4WFG A;  2Y48 A;  2OCC C;  4PDV A;  2JIZ G;  2OTL V;  4WFF A;  3JD2 A;  3RW0 A;  4HYO A;  5LGT A;  4X88 A;  1GM7 A;  3QO5 A;  1W0J G;  1VQ9 V;  3CCM V;  2M7W A;  1E1R G;  1FS0 G;  5EBL C;  5KA6 A;  1W2B U;  4GX2 A;  1V54 B;  1WLE A;  2DWD C;  4RAI A;  1GO3 F;  2WLI B;  3LDE A;  4H33 A;  1RPR A;  3QO7 A;  5BZB A;  4N23 A;  5LBQ A;  3ASO C;  5IY5 C;  2W0F C;  2LP7 A;  4MSW C;  4G2K A;  1OCZ C;  4WF9 V;  3CCE V;  2EIK C;  3CCL V;  2DYS C;  2EZO A;  3SPI A;  2Q6A A;  5H6Q A;  1ORQ C;  1NBM G;  3ZRW B;  2LFS A;  3OR7 C;  4PA6 A;  3RBZ A;  4R50 A;  4MVO A;  1K34 A;  5CMU A;  4KP4 A;  3SYP A;  5B3S B;  4PDL A;  3P30 A;  3A0R A;  3R65 A;  1OCR C;  4R8C A;  3OUS A;  5C93 A;  1JVM A;  3ZRX A;  4N21 A;  4JTC B;  1QLE B;  4U7O A;  5EBM C;  3K03 A;  3T4D A;  1KQS U;  3DTU B;  3B77 A;  3ASN B;  1M9N A;  4QPK A;  1QLN A;  1VQ7 V;  1YHQ V;  4TSF G;  3W7S A;  3E8B A;  3ETD A;  5B1B C;  2QE7 G;  1HWY A;  2ZQM A;  3OFN G;  2XAQ A;  2WLL B;  3AG3 C;  3FB5 C;  1FXK A;  1K7D A;  4PA9 A;  2QEX V;  5DN6 G;  3X2Q C;  5CBF A;  4MT8 A;  1OCC B;  3P32 A;  3F5W C;  2IU3 A;  2AHZ A;  2GHY A;  2H94 A;  2Z5U A;  4LBE C;  2P6J A;  3SJQ C;  4ASU G;  4CBC A;  3WFV A;  3I55 V;  2WLJ A;  3TCU A;  3W7U A;  1RPO A;  3JD1 A;  4JPR A;  5J9P C;  4UV8 A;  1OCO C;  1YSC A;  3ZRS A;  4P9P A;  1F23 A;  1XL4 A;  3ZRV A;  2Z3Y A;  4RO2 A;  3ZIA G;  3ZMT A;  2ITD C;  2ZXW B;  3UM7 A;  2OT5 A;  1XL6 A;  5IYC O;  3E83 A;  5IYB O;  3FB6 C;  2PI5 A;  1QR8 A;  5EBW C;  1Y4M A;  1CP9 A;  2ATK C;  1Q86 W;  3CP1 A;  4FK5 C;  5DM6 V;  3AG2 B;  4PA3 A;  1R6N A;  2IH3 C;  3AG4 C;  3CYO A;  3AG1 C;  1EBO A;  5LGU A;  4ZBM A;  2WLK A;  1AI6 A;  3ZN1 A;  1FXK B;  1PL0 A;  1S5H C;  2NNU A;  5H6R A;  2WLI A;  3SYA A;  1K97 A;  4MTG A;  5HFL A;  3IGA C;  2WWW A;  1AJN A;  1GKF A;  1ARO P;  2C2A A;  1VQM V;  1DTO A;  1V54 C;  2A0L A;  3K08 A;  3CPW U;  5L3G A;  3ZRW A;  1QVG U;  5KA5 A;  4GX5 A;  2R9R B;  2X0L A;  1AR1 B;  3UKM A;  1MOF A;  3E8G A;  4HAM A;  1K5S A;  4P9O A;  1YI2 V;  4WCE V;  3OMA B;  5LHG A;  2ITC C;  4X89 A;  4X8A A;  3G71 V;  5B3S C;  1JJ2 U;  1DLB A;  1PD3 A;  4E2L A;  3GWO A;  2BOC C;  2WLH A;  1KEC A;  4P30 A;  1VQN V;  1THZ A;  3CMA V;  3ABT A;  2WLL A;  2EIL B;  2Y69 B;  2EIN B;  3T2M A;  4QNH B;  1NQT A;  2A79 B;  2MK3 A;  4PA7 A;  3QO8 A;  2HG5 C;  2P7T C;  3ZJZ A;  2HKO A;  1ZWI C;  1VQ8 V;  1OCC C;  3HPL C;  3ABM B;  3K0G A;  4UXN A;  1R3L C;  1QCE A;  2X7R B;  4J9Y B;  2QM8 A;  3W7T A;  3FB8 C;  1W0K G;  2KB1 A;  1PNK A;  4MVU A;  2WPD G;  1UJW B;  2YEV B;  3TET A;  4XDL A;  2IJI A;  2EZP A;  2Q69 A;  4G28 B;  3VBB A;  2FTK A;  3CC4 V;  3LSQ A;  2P90 A;  3K3W A;  3E8H A;  2EJR A;  3MHH C;  1EZJ A;  2B5U A;  2IJH A;  1S77 D;  1NVP D;  4XDJ A;  5B1A C;  1BHA A;  1V55 B;  1K9M W;  2ZXW C;  4MTO A;  4ZKI A;  1VQ4 V;  1YTF D;  1S72 V;  1K8A W;  3LDD A;  1VQL V;  3JYC A;  2EIJ B;  2IU0 A;  3W7X A;  3ETG A;  1RM1 C;  4FJC C;  3AG2 C;  2WSS G;  1NJI W;  2DWE C;  4GT1 A;  3TK1 A;  1H2G A;  3SYQ A;  4PDM A;  1FXK C;  2XAS A;  2HFE C;  3K04 A;  1GK9 A;  1WPX A;  1R3K C;  4JF3 A;  4JTA B;  4WFE A;  3E2E A;  1GTO A;  4U7N A;  1NR1 A;  3OMN B;  3LUT B;  2ZDI A;  3OAA G;  4FPP A;  1CPY A;  5FL7 G;  4LCU C;  2X6B A;  1SZT A;  3STL C;  1J95 A;  5KUK A;  2ZDI C;  5IDJ A;  4RQF A;  4JYB A;  1QBZ A;  3FKS G;  1AJQ A;  2F43 G;  1MAB G;  1AI7 A;  1S76 D;  2QA4 V;  5IY5 B;  3SYO A;  1G8M A;  2IJK A;  5EC2 C;  1AI4 A;  4JTD B;  3CME V;  3CC2 V;  3SPG A;  1JQ0 A;  3WG7 C;  2DW4 A;  4JAS A;  5LHI A;  2W6I G;  4MVM A;  4L87 A;  2UXN A;  4QPJ A;  3FYI B;  3K0D A;  4LP8 A;  3OW2 U;  3DGE A;  1YIT V;  1KC8 W;  3EFF K;  1M56 B;  3D36 A;  2Y69 C;  2EIN C;  2DQ3 A;  3CXC U;  3ABL B;  2Q67 A;  4MTF A;  3OEE G;  2WLN A;  4QJF B;  4Q20 A;  2D3O W;  3SYC A;  2GSM B;  3ML0 A;  1S0V A;  3PJS K;  2ZR3 A;  1F4N A;  3I56 V;  3SPC A;  3ABM C;  4H37 A;  2YEV A;  2DYR B;  4RUF A;  5H9C A;  3ZMU A;  3ABK B;  2H8P C;  2NLJ C;  4BIU A;  4DO2 A;  1NH2 D;  5CA3 A;  2YSU B;  1P7B A;  2HLD G;  4JAU A;  5IYD O;  4MW8 A;  4Z1M G;  1Q81 W;  3HB3 B;  3IFX A;  3F7V C;  1FXV A;  2EIM B;  3STZ C;  1OHH G;  2XND G;  4MS2 A;  2HVK C;  4BW5 A;  1R3I C;  3SPH A;  3M99 B;  2CK3 G;  4GCZ A;  1KP2 A;  4WFB V;  4QE9 A;  3OUF A;  2JDI G;  2K1E A;  1V55 C;  3OGC C;  3RVY A;  5EK0 A;  1SER A;  1FXH A;  1QLE C;  2XAF A;  2X6C A;  3T1C A;  1PNM A;  4DXW A;  3B8M A;  1B6Q A;  3ASN C;  1PNL A;  3K06 A;  1P4R A;  2EIJ C;  4FIP C;  2DQ0 A;  1NKD A;  4QE7 A;  4TT3 G;  3BY6 A;  1NVP B;  3G6E V;  1K73 W;  2LFR A;  1S3J A;  2HJF C;  2IW5 A;  1DF5 A;  1JPX A;  4I9W A;  1YTF B;  4MVQ A;  1H8E G;  4MVS A;  3OMI B;  4R7C A;  3ZMV A;  1OZ0 A;  5CBG A;  3OM3 B;  1K4D C;  4QIW F;  4BIZ A;  3B8N A;  5KUM A;  2IH1 C;  2B1I A;  3CCV V;  3IC7 A;  1EFR G;  4RQE A;  3RVZ A;  1M57 B;  4XBF A;  1YJN V;  3ZMZ A;  5EC1 C;  5B1N A;  4PA4 A;  1H38 A;  3H01 A;  3ABU A;  4J9Z B;  3LNM B;  1ENV A;  2W6J G;  1GM8 A;  1AJP A;  3K9A A;  1K3E A;  2HVJ C;  1I5X A;  3BEH A;  3CCS V;  4BAY A;  1I5Y A;  1KD1 W;  1E1Q G;  1F4M A;  3NXS A;  2IJJ A;  1F51 A;  1BMF G;  4MTX A;  1Q82 W;  2JEU A;  5HFM A;  1AI5 A;  2XAH A;  3KG2 A;  3JD0 A;  3EHB B;  1SRY A;  1M90 W;  4P2Z A;  3SPJ A;  1KP3 A;  2B1G A;  2UXX A;  4UVB A;  2XOK G;  4YXW G;  5E1A C;  4WFA V;  1BL8 A;  1M56 C;  3K79 A;  4CZZ A;  1VQ6 V;  5GW7 A;  3ABL C;  3OE7 G;  4UV9 A;  4R6Z A;  1YIJ V;  4LC1 A;  1LNQ A;  3ZCC A;  1NR7 A;  1G4Y B;  3MHS C;  5L3C A;  2OCC B;  2XAG A;  1VQ5 V;  2WLM A;  1QR9 A;  2PI4 A;  3CD6 V;  4RUE A;  2OTJ V;  3CCU V;  4F4L A;  1R73 A;  1MG1 A;  3AEI A;  2DYR C;  2V1D A;  3ABK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...