4MT8A

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
100
structure length
100
Chain Sequence
ASHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ethylene response sensor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 45
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mt8A00
3ZRWB 1F51A 3ZCCA 4GT1A 3D36A 2WWWA 3NXSA 5IDJA 4BIUA 4JASA 2P67A 4JYBA 3DGEA 3ZRWA 4JAUA 4KP4A 1JOYA 3ZRXA 4FMTA 2QM7A 3P32A 4I5SA 4MT8A 3TK1A 4BIZA 3A0RA 3MD0A 4LC1A 2FTKA 3ZRVA 5C93A 2LFSA 2C2AA 4QPJA 4ZKIA 4JAVA 5B1OA 4U7NA 1IXMA 4Q20A 4QPKA 2LFRA 4JYCA 4FPPA 5B1NA 4MTXA 4GCZA 4U7OA 2QM8A
chains in the Genus database with same CATH superfamily
4ZOLA 4U3JB 5JCOC 3TETA 3CB2A 2HVKC 4EB6A 2LJ2A 5E1AC 3SJQC 3K59A 2XT9A 2BOBC 4LH7A 2WSSG 4MVSA 1P84F 1EBOA 3LNMB 4KFMA 5L3EA 4HNAA 1CP9A 1EFRG 5JH7A 4JAAA 2K9PA 2R9IA 1W59A 4H13B 4ZHQB 2QTSA 4MVOA 1AI6A 2ZQMA 3CE2A 3KCYA 1WN7A 4FFBB 4Z1VA 1HNZB 1GN6A 2Q9LA 2XAGA 1QQCA 2B1IA 2M6YA 1LNQA 4IHJA 4O2AA 1MA1A 3ZMZA 3LSUA 2OTJV 2Y4UA 4JAUA 2UXXA 1K92A 2F4VB 4IGGA 4P9OA 2EIMB 1KQSU 5KHJA 2BSKA 4DW0A 1KYOF 4NXNO 2QKAA 5KA6A 4YJ3A 2A3QA 2EZPA 3SJBC 4FIPC 1V54B 4PA7A 3D36A 4YIPA 4F6RA 3ZHRA 3AG3C 2YXHA 4K0KB 1DTOA 3ZN0A 1RFYA 5H9CA 5LYJA 3LSQA 5LGNA 5L3BA 2EULA 4E2LA 3AEIA 3JSNA 5A2QN 4QPJA 3BA8A 3N2GB 5IYBO 1OCRC 2W6IG 5IJ9A 2EJ7A 5EBWC 4WFAV 1XEQA 1RP3B 4RWUA 3ABMB 1Y4MA 1PNLA 2Q7EA 1FKAO 1NH2D 1YCIA 1LR1A 1NKDA 2Y69C 1KP3A 2NLJC 3CS5A 1THZA 3ZRSA 5LP6A 1NTKH 3ZHTA 4O4HB 2HVJC 3BHPA 3T1YO 4K35A 4MTGA 4FM2A 2ZR2A 4R8CA 4DXWA 2GV9A 1XL4A 3HKDA 4MS2A 3IC7A 1VQLV 4JTCB 2JEUA 5FNVB 1UJWB 1K33A 4FLWA 4X1IA 2DYRC 3D36C 3Q4HB 4G2KA 4B3RB 4FJCC 3EXAA 2V4DA 4UCOA 1JPXA 1R6NA 4H33A 4F4LA 5LA6A 4U3FH 2Q7HA 1VQ4V 4GKKO 2PYLA 4GX1A 3GWKC 5J2TA 4TOIA 4FVMA 5DEDA 3OTOB 2AGAA 1Z2GA 4N21A 1AI4A 3D3IA 5C93A 4HYOA 2ZR3A 1ZX3A 4N23A 2R9RB 1F51A 3E35A 4GKKB 5LP6C 3CEIA 1KKDA 2UXBO 3JATA 1BCCH 1FFXB 2P5OA 5AG2A 1XDCA 3K3WA 4KP4A 1LUWA 2P4VA 2DJVA 3AG1C 1Q43A 4JI1B 2Q67A 3FFQA 5BR8O 4Q6GA 3HR0A 5L3GA 4DV3O 5IDJA 1GTOA 3SPIA 2YICA 2H3OA 1WPXA 2QM4A 3CXHF 2UXBB 2EX3A 2PI4A 4RUFA 5BXZA 1M57C 4MTFA 1PM9A 4LWSA 2UUAB 3ZN1A 4LFCB 5LMNO 4IYIA 1QHTA 1QBZA 4O4LA 2IH3C 4CS4A 5CA0B 2PTMA 1VQKV 1IBMB 1JFFB 5BR8B 2EIKB 3T4ZA 2Q5ZA 1W0KG 4LR3A 3E2EA 4DR1B 3ZRWA 1JMKC 1TUEB 5LMUO 4GX5A 2NR5A 1FJGO 4JI2B 4AQYB 1K5SA 3A0RA 1JR9A 1ZLZA 1VQ6V 1Y76B 2IM9A 2ITCC 3X2QC 2CTWA 4UVBA 4UVCA 4JYCA 2QWPB 5DECA 4WBNB 5LMNB 4CS3A 2P4KA 1CPYA 4BIUA 1WPBA 4JASA 1CXZB 1H8HG 3CRMA 5LMUB 3UO3A 2JS5A 4ZKIA 1AP5A 4QPKA 2IBZH 3QNEA 4LH6A 2BCCH 1VF7A 1VP7A 4X64B 2QTOA 1K5QA 5B1AB 4TV8A 4I50B 2IJJA 4WFEA 1K97A 4NKGB 4XBFA 1T5EA 3A2FA 3L75H 4X1YA 1B6QA 2GUZA 3ZRXA 2ATKC 3JYCA 3OUSA 1JCHA 3OMNB 3L71H 2OIGA 1L1FA 4TV9A 4FPPA 1L8DA 4GT1A 2FMLA 3TCUA 1FFTB 3QVNA 2WLJA 1JJ2U 2ZE8A 5JQGB 4KUMA 3ZHVA 2YIBA 4P9PA 5EBLC 3EHBB 4LF9B 1XQ8A 1K7DA 3LUTB 2DE0X 2DMXA 5IYCO 3M7MX 4OPHA 3ZCCA 1RM1B 3SYCA 1HNXO 3E89A 3D3QA 3ETEA 3RYFB 3JD2A 4LF8B 1SQVH 3CCLV 1SC5B 1Y74A 4NB5A 1VQMV 1J95A 5CA1A 4B08A 1GAXA 1D2DA 1WLEA 4B3MB 1TVKA 2HJDA 1A32A 3JSLA 1VQOV 3K9AA 2OWOA 3I55V 3B2EE 4R7CA 5JVDA 1S77D 5ITZB 2YI8A 4K8XA 2ZT9B 1Q82W 2IJIA 3ZHUA 1VF6A 5IY5B 1S76D 3FB8C 5JJNB 1H38A 1S0VA 2B9ZA 2GSMB 3QO8A 1XNQO 3B4SA 2CH7B 2Q69A 1TUBB 1MABG 1QLNA 5EK0A 3L70H 4I9WA 2QEXV 2EBOA 4TWKA 4G27B 4O4IB 1YTFB 4D6TH 3RYCB 4DV0O 2EINB 2QDOA 3H1JH 1R3LC 4JI3O 2V7QG 3RYHA 4DV4B 4JTDB 4MSWC 4RUEA 4PA3A 1BSMA 3WB2A 3HKEA 2YIDA 1XNQB 1GH6A 1BHBA 1ENVA 3HKCB 4YY3O 2HHHB 3BFRA 4LF5B 1COWG 3AK1A 1VIBA 1OCZB 1B3QA 2JJ2G 1ZUQA 3A0BZ 2RN9A 3STZC 1FS0G 2RDCA 5IJ0B 1L0LH 4YHHO 1ZL8A 4RO2A 4P2ZA 4MVQA 1VF6C 1IVSA 1J5EO 4DV0B 1Y66A 3IAYA 3CRQA 4JI3B 2OTLV 2L6LA 4FLXA 1DGSA 4MVZA 3AG2B 4YY3B 2E3CA 2W0FC 4DV7B 3K5MA 1QVGU 1BMFG 5B5EZ 4DK0A 5C8YB 3K9SA 3B77A 2ADQB 3O9OA 5E79Z 3JALA 5LGUA 4DUYB 4X65B 2QWNB 4D7SA 2LW7A 2EIJB 1SQXH 4OX9B 3T2MA 4PDVA 3CXCU 1SS3A 1BL8A 2Q7GA 3HKBB 5KMGB 5FL7G 3ZMVA 4GX2A 2ZM6O 2VQEO 3B8NA 1F23A 3F5WC 2FTKA 4RQEA 3QO5A 5B66Z 3ICXA 3TXQA 4Z2WA 1W0JG 2PUSA 2DWDC 3CCMV 4TUYB 4OPAA 2ZNJA 1BQZA 2W0XA 1NR7A 1N36O 4X62O 3ZEDA 4JI6O 2Q4PA 4JV5B 2XAFA 1OCOC 1DK1A 3QG5A 2HR3A 3FB5C 5CB4A 4QE9A 1NT2B 1WP8A 2ZM6B 2VQEB 1VMGA 1AJPA 4H44B 1SETA 1RPOA 1TAEA 1K73W 3P3PA 3VOUA 2QM8A 3D8CA 3CX5F 3JAWB 1WA8B 5EZYB 1Q6UA 1N36B 2JJ1G 4PV1B 4JI6B 3W7SA 2ILMA 3DXRA 4J7ZA 4PDLA 1H2LA 2ZINA 2PY5A 2DN9A 2UUBO 5BMVA 2LFRA 3ZMSA 3P3NA 4JI5O 2IJKA 4JI0O 1R6TA 1EM1A 3RFRA 3W7UA 2ETNA 1V55C 2WLLB 5K1PA 1RSOA 3J7AU 5KHKA 5KUKA 1HP8A 3DTUB 4UFZA 3ETDA 3TGUH 4YIOA 5GTHZ 1N33O 3BVOA 2YDEA 2BTQB 4WFHA 3BRCA 3EFFK 2KKWA 2QKSA 3CMEV 2YS8A 1GO3F 5KA5A 3GWOA 4I9QA 5KLVH 2ZDIC 3FAVB 3AG3B 4UB8Z 2GTSA 4LFBO 1OCCC 1FYJA 1VQ7V 4UCSA 1YI2V 3UKMA 3VQWA 3BEHA 4X1KA 1YIJV 4NXMO 2ZNIA 4TQDA 4YJ2B 2MW2B 4ZOLB 1PD3A 1I94O 2CGOA 4EB6B 2X0LA 2ZE6A 1VF5B 4WCEV 1XILA 1OCRB 3H1HH 3E83A 5KAIZ 2OT5A 3BY6A 3KZIZ 5EIBD 5H5NA 1G6UA 2CGNA 2YC0A 4FLTA 4CH6A 5LHHA 2RNBA 5CBFA 5IYZA 4HNAB 4XDLA 4JPRA 4JYBA 5JH7B 4ABMA 4PI2A 3OR7C 4LFBB 1YVWA 3F5TA 2Y69B 1QLEB 3FB7C 5FLXN 1HR0O 4RQFA 4IHJB 4O2AB 5LOVA 3G4SV 2AXTZ 3ZS8C 4NXNB 1Y6XA 5JWPA 3ASNC 2P6JA 2FKXA 4UVAA 2BSKB 3OAAG 5KUMA 3OTFA 4YJ3B 2A9HA 3DSQA 4I4TA 2XNDG 5TISZ 2Y0PA 2FYUH 1NQTA 2DYRB 3BCCH 4GZRB 3JD3A 1O9HA 5CN0A 1PL4A 4F6RB 4QGPA 2QWRB 4O4JA 4I7ZB 1PNMA 1AR4A 4JI4O 4X88A 3H9VA 5LYJB 5IT9N 2WA3A 1CEZA 2Q0AA 3HPLC 4CZZA 4WFFA 5IJ9B 3LDDA 3MD0A 1ZSPA 3EVKA 1YZBA 3VQXA 4DR4O 2GBOA 3M8AA 1XNRO 1FXKA 4UXNA 3T1YB 2Q0OC 1YEWA 4UV9A 4JI4B 4NYKA 5LP6B 4IL6Z 2CTPA 3MDSA 4FLUA 1SA0A 2IU3A 2DW4A 3CD6V 2KB1A 4UUJC 2ZXWB 3E8FA 3HKDB 4PELA 2A79B 3AG1B 2QWQB 4DR7O 1VQ9V 1PPJH 2Q73A 1SQFA 1Y67A 3JCUZ 4X1IB 1XMOO 4DR4B 3AG4C 4LF7O 2ADPA 1ROPA 5LA6B 4GYCB 1HWYA 4IIJA 2PYJA 2OCHA 3OUFA 5J2TB 4DRXA 4DR2O 2C2AA 1M57B 2ZKOA 3JD4A 4NR1A 5DM6V 2QA4V 4Q20A 1D5AA 1GRJA 1JVMA 4EEQA 3UQ8A 3CJHA 1I7FA 5H2FZ 1NR1A 1BZKA 4DR7B 4UCRA 1NTMH 3SDLA 1H2NA 2H8PC 3ZMTA 1M56C 2A06H 1FXKC 2R72A 4AILC 3VQYA 1EZJA 3G6BA 3JATB 4J41A 3GB7C 1QCEA 3OD4A 4GCZA 3PN1A 3ABTA 2VS0A 4DUZO 3OEHG 2G38A 1VQ5V 3SJCC 4CS2A 2CTQA 4P30A 2KSDA 1HNWO 3J81N 3OT7A 2H94A 4DV3B 3THOA 4I55A 2PI5A 1IX9A 2B1GA 5CBGA 5EYPA 3H1LH 4YXWG 3G80A 4W4KA 4MTXA 2QKCA 2KG7A 1V9PA 1K3EA 1NZ6A 4R6ZA 1MG1A 3CCRV 3IC9A 3S3XA 4LWSB 4B3TO 1QR9A 4DUZB 4BW9A 1Z5VA 3VQVA 4O4LB 1EN6A 1B04A 3CYOA 3NR7A 3WG7B 1GMGA 5LBQA 3JAKA 3ZJZA 1FJGB 3W7WA 4DR5O 2WPDG 3LDEA 1S5JA 3E22A 3ZRWB 1JQ0A 3JARA 4GUNA 1NS1A 2AW9A 1SESA 2LGQA 4FZ0A 1KU9A 3OEEG 4DK1A 2XASA 1MNGA 4K3AA 3VBBA 3OE7G 4PJ0Z 2AHZA 4B3TB 1F4NA 3SPCA 4JZGA 1M9NA 4MW3A 2YUAA 4U7NA 4U7OA 5LXTA 1HW7A 1XBLA 1WP7A 5LHIA 3SPJA 1BE3H 4DV2O 4KHPO 2XTAA 4L87A 1NTZH 1OV9A 1GM7A 1P49A 5K1XA 1M5IA 1VQNV 4TV8B 4JYAO 2DQ3A 2D2CB 2WA4A 4X1YB 5JJEB 2GUZB 3CRAA 2IJHA 4TV9B 2P06A 4DV2B 4KHPB 1BT8A 1YDXA 5EBMC 1SQQH 3N2KA 4ZI7A 2YIAA 3C90A 4JYAB 5B1BC 1SQGA 1URFA 3E8BA 3ABKC 1G4YB 2WLIA 3R66A 4I0XA 2CDYA 4TSFG 1H8EG 1HNXB 5GONA 3K57A 2Q6AA 2AZ2A 2GTAA 4DR3O 5B1OA 3FD9A 3IJ4A 3C3TA 1E1QG 5D5QA 1QNMA 3T1HO 1Y74B 3CPWU 4BW5A 4X8AA 4GX0A 5J2UA 4JZ2A 1KP2A 1VEWA 4X20A 1XMQO 3W7XA 5CA1B 3UT5A 2BTOA 4LF4O 1K34A 3UM7A 1TVKB 5CA3A 3CRCA 3CCUV 1I5YA 2ARHA 1Q3EA 3JD0A 1BGYH 4DV5O 3RYIA 1QR8A 2PZSA 5JVDB 3APQA 1IDSA 4UCVA 3U11A 5KAFZ 3JASA 4FM1A 2QM7A 5KHIA 4O2BA 4WF9V 1B06A 4B7EA 2RMKB 3WFVA 1Q8IA 2EILB 1FXVA 2E75B 4LF4B 2N05A 1SQPH 2F43G 1S72V 1M93A 2E5LO 4B3SO 1N4CA 1UFIA 1WB7A 2WLKA 4J42A 4WFBV 2IH1C 1SERA 1Q86W 5DN6G 2X7RB 1PKXA 3FYEB 4QJFB 4DW1A 4HBNA 3UCSC 5CMUA 3TXSA 5GW7A 2N74A 3K79A 4ICGA 1IZ3A 4QIWF 2UU9O 2JGDA 2V1DA 2IW5A 3RYHB 1AR5A 2ZD9A 3FB6C 2DYSB 1PV0A 2E5LB 5KX5A 5A9GA 3JD1A 3HKEB 3LNNA 2HP8A 4DO2A 3C3SA 1ZTEA 2YEVA 4KXRA 4YHHB 3L9DA 1Z5WA 1YTFD 4LFAO 3U10A 1OCZC 3BA9A 1YJ9V 1ZL8B 1J5EB 2HJFC 4UB6Z 1NVPB 2M7WA 2JRIA 1YHQV 3TJTA 3ASOC 1WAZA 2A7WA 3OMAB 2HFEC 4GLXA 2FL4A 3O65A 3FKSG 1MSDA 1GM8A 3B09A 2HEPA 4PA4A 1HDJA 1OCOB 1VARA 3ML0A 5L3DA 3AK3A 4LNUA 2W6JG 1N32O 4LFAB 3ZIAG 3N27A 4PD4F 1ORQC 1AI7A 3J80N 4JI7O 3JALB 1X59A 3CCQV 2OCCC 4J9YB 3MAQA 4OXSA 1Q6IA 1H2MA 3I5DA 4LCUC 1IURA 2ZCEA 2ZDIA 1LUVA 4F6EA 3K58A 2L35A 4HAMA 3K08A 1NVPD 1R3IC 2YXLA 4R50A 4NTYA 1EZVH 4DV6O 1V55B 4TT3G 4U3JA 1KB9F 3ETQA 4X62B 5J9PC 1G8MA 2CK3G 1P7GA 3G6EV 4NTWA 1FPOA 1PL0A 4GKJO 5CB4B 4ZHQA 3ABLC 3A8TA 1GKFA 4QNHB 4FFBA 3ZHSA 3TK1A 4MT8A 1OCCB 3CCSV 2YI9A 4DV6B 1MOFA 1O9GA 1F4MA 1SRYA 2CE4A 1NJIW 1HNZO 3CCVV 2UUBB 5L3CA 3F7VC 3F7YC 3QF7A 2F95B 4CH5A 3DXRB 3H1KH 4JI5B 4JI0B 2F4VO 1E1RG 1N0JA 4GKJB 5BMVB 3STLC 4BWAA 3L73H 3RVZA 5B3SC 3OR6C 4MTOA 1AJQA 5KHGA 5EIBC 5KHHA 4CC5A 3K0GA 1RPRA 2LP7A 1EN5A 3H01A 1Q5OA 1YJWV 2QSAA 4MVUA 4K0KO 1AB3A 5JJJB 1N33B 1RSOB 3SPHA 4LBEC 4FLYA 3N2GA 1NH2B 3ASNB 3U0ZA 1MZEA 4EFEA 1FAFA 1GK9A 5EC1C 4BAYA 4FLVA 5IYDO 4FFKA 3E86A 2ZE5A 2YSUB 1IBKO 3WB0A 4NXMB 4W4LA 4XDKA 4H37A 1N8RW 1KC8W 1I94B 4O4HA 4X1KB 3S3WA 1WJZA 3K5NA 5BZBA 3R65A 2HKOA 5HFMA 2XUMA 2P7TC 5LGTA 2EIMC 4D7TA 1M90W 2JIZG 2EZOA 1V54C 2WLNA 5FNVA 5IYZB 1X4TA 2UXDO 2BE3A 3Q4HA 1IBKB 2JDIG 1HR0B 2F66C 1PNKA 2R9AA 3T4DA 2CAZC 4B3RO 3FYIB 2X6AA 4ZBMA 3OW2U 3QO7A 4J9ZB 2VQFO 1KECA 1QLEC 2CTRA 4I5SA 1KD1W 5LOVB 2AHYA 3IFXA 1GM9A 3A0HZ 3G67A 2IU0A 1XL6A 1MZFA 1SQBH 3JAMN 3OTOO 3ABMC 4I4TB 2JS3A 1U97A 2UXDB 1VQ8V 4PHZA 1N34O 2DQ0A 3AG4B 4A5UB 1SZTA 4O4JB 4CBCA 1KMIZ 1FFXA 2VQFB 4DR6O 2GDSA 2XAHA 2OYQA 2PF4E 2DWEC 2R70A 3E8GA 2F93B 3M99B 3B8MA 1XNRB 4IT5A 1QU7A 3CCJV 5FPRA 4JI1O 1N34B 1M56B 2N04A 2P22C 3T1CA 1FXKB 2EJRA 4TQFA 2NNUA 2UXCO 1MMMA 4UCTA 3SYOA 1XI1A 1UPGA 4DR6B 1SA0B 4PDMA 3K03A 1ZWIC 1K4CC 4LP8A 2D3OW 5CA0A 3APOA 4JI8O 1XMOB 2UUAO 2LW1A 2RJZA 4LFCO 1JFFA 2K1EA 2ZXWC 4LF7B 1SKVA 4K8ZA 1L0NH 3UO2A 3DC5A 3OMIB 2KQXA 1IBMO 1S3JA 3X2QB 2Q8VA 4DR2B 1Y76A 2A0LA 2WLMA 4QE7A 4DR1O 2UXCB 2JGUA 3CMAV 4HZ3A 3NXSA 4IIJB 4C7UA 1ZAUA 4JI2O 4AQYO 1VQPV 4ASUG 4WBNA 4DRXB 1M1KW 3PJSK 5IWAO 2LQTA 1TGOA 4DYLA 4EKWA 1XREA 1GN3A 1KKCA 3CP1A 5CBHA 1N0NA 1NI8A 3CJHB 4JI8B 2GHYA 2XHBA 2LO1A 1US6A 3QTCA 2ODMA 1K4DC 4PA9A 3GVMA 2ITDC 2ZE7A 2XAQA 1AILA 1Q6HA 4BIOA 3CSXA 4XDJA 4X66O 5D5PA 3BAAA 3RVYA 2QJ1A 4G28B 4AHCA 2FB5A 2B5UA 5FPOA 2HG5C 4DV1O 4I50A 2O57A 5IWAB 4X64O 1HNWB 3OGCC 3WB1A 1TA8A 3OGIB 4H0LB 1XOUA 3OM3B 1SF9A 2XOKG 4UV8A 2EIKC 3LSSA 1F7YA 3SPGA 1R3KC 4I55B 5EYPB 2DOSA 4X66B 3B40A 1OJHA 4CH4A 1MSWD 2Z0AA 2KG7B 3K04A 4CH3A 4DV1B 2F1MA 1XHZA 5JQGA 2WLHA 4DR5B 1K8AW 2RQ6A 3JAKB 3RN4A 1XUQA 3WG7C 4LF9O 5H6QA 5H6RA 3E22B 3E8HA 2X6CA 3RYFA 1H2KA 2YXYA 3JARB 1GN2A 4MVMA 2JVDA 3K5OA 3K5LA 5B1AC 2PGGA 3CWBH 4LF8O 2BOCC 5B1BB 2E76B 3SYQA 1S5HC 4BR6A 3ABKB 2Y0IA 3H1IH 3ABUA 3K0DA 3K06A 4FMTA 2CUGA 4B7KA 3AG7A 5LXTB 3ZRVA 1R3JC 5HFLA 2F23A 3FX7A 3MHHC 3SJAC 4B3MO 4FZ1A 1R1BA 2QGNA 5ITZA 3LDCA 4X89A 1AP6A 2VWKA 5LHGA 4WFGA 1I5XA 5EC2C 4BIZA 1P4RA 4JYYA 1JJOA 2P90A 1IBLO 1M4UA 3AK2A 5B1NA 4LF6O 3L74H 1RM1C 1AJNA 2CH7A 1TUBA 2VWJA 3HB3B 2Z3YA 2P67A 1XHXA 4KL1A 2QWOB 3WU2Z 4FK5C 3SR2C 3N2KB 4ZI7B 4CC6A 4O4IA 4MW8A 3OFNG 3RYCA 1YSCA 3ZBHA 2WLIB 2UXNA 4I0XB 4L8JA 3I56V 1IBLB 4DR3B 1FXHA 4PI0A 5GONB 2AZ0A 3ETGA 4LF6B 1W2BU 3HKCA 4PDRA 4DV4O 2UUCO 1YF2A 2JK5C 1BHAA 4JF3A 1U96A 1H2GA 3T1HB 1AR1B 4JGSA 3P32A 2HHHO 2YIBD 5IJ0A 4LF5O 2Z5UA 4OGQB 1E79G 1XMQB 3P30A 2LGWA 5IY5C 5J2UB 4PA6A 4X20B 1R6KA 5F2VO 2RCVA 1OZ0A 3UT5B 3RBZA 4DV5B 1KUQA 1WB8A 3ZX6A 2UUCB 1DLBA 1QVFU 1BQ0A 4FM0A 1Q81W 3MHSC 4RAIA 3RYIB 5C8YA 1P7BA 2JEXA 4DV7O 3CHXA 3CC2V 1FD9A 1EN4A 1R73A 1S5LZ 5LL6Y 3JASB 4X9QA 5L3FA 4O2BB 2Y48A 3G71V 2Q68A 3ASOB 4NTXA 4B3SB 2EINC 4J7JA 3IGAC 1JOYA 4J7KA 1K9MW 4DUYO 4X65O 3W7TA 1OHHG 1WNSA 3HKBA 2EILC 5KMGA 5IE9A 1BS3A 1G1XB 4OX9O 1IXBA 2WWWA 1NU1H 3RGBA 3KCXA 3CRRA 2WAMA 2UU9B 4TUYA 4Z1MG 2XAJA 4JTAB 4LC1A 4J11A 2JGDB 2QE7G 2OCCB 4JAVA 3SYPA 5KX5B 1NBMG 3AG2C 1D5NA 1I0HA 2X6BA 1AROP 2DYSC 2YEVB 4JV5O 3RT3C 1Q7YW 1I08A 4IYHA 1PP9H 3DGEA 3L72H 3ZMUA 3JAWA 1WA8A 5EZYA 1AVMA 1JX9A 5JCOA 3KG2A 5GTIZ 2EIJC 1YITV 2HLDG 2ZIMA 3BPZA 2OIEA 1KBHA 1YJNV 1N32B 3RWRD 4J80A 2MK3A 3BABA 5BY1A 4LNUB 3DC6A 1JA8A 3ABLB 4NVPA 1GN4A 3KKYA 4UCUA 4JI7B 2LFSA 2WLLA 4MVRA 3JCZA 3CCEV 4EFBA 4AI8A 1Q90D 2E74B 2Y4TA 2NN4A 1DF5A 3CC4V 2BTQA 1DF4A 1SZXA 4FLZA 3SGIA 4ZIBA 2VRZA 4E4EA 1YXBA 5B3SB 3ZHQA 3RW0A 3FAVA 2ZIOA 4J10A 1IXMA 2QR4A 1H2SB 3CC7V 1AI5A 3SYAA 4YJ2A
chains in the Genus database with same CATH topology
2JJ2G 2DWEC 3STZC 1FS0G 3E8GA 3TETA 2HVKC 3M99B 3B8MA 5LHIA 4RO2A 5E1AC 4P2ZA 3SJQC 3SPJA 3CCJV 4MVQA 2BOBC 2WSSG 4L87A 4MVSA 1EBOA 3LNMB 1GM7A 1M56B 4KFMA 5L3EA 1CP9A 3T1CA 1Y66A 1FXKB 1EFRG 2EJRA 1VQNV 2NNUA 2R9IA 2OTLV 2DQ3A 4MVOA 3SYOA 1AI6A 4MVZA 3AG2B 2ZQMA 4PDMA 3K03A 1ZWIC 2W0FC 2XAGA 2IJHA 1K4CC 2B1IA 1LNQA 4LP8A 3ZMZA 2D3OW 1QVGU 1BMFG 2OTJV 4JAUA 2UXXA 1K92A 3B77A 2K1EA 2ZXWC 4P9OA 2EIMB 1KQSU 3OMIB 5EBMC 5KA6A 5LGUA 1S3JA 2EZPA 4FIPC 3X2QB 1V54B 2A0LA 2WLMA 4PA7A 2EIJB 4QE7A 5B1BC 3D36A 3CMAV 4HZ3A 3NXSA 3T2MA 4PDVA 3E8BA 3AG3C 3ABKC 1G4YB 3CXCU 1DTOA 1BL8A 1VQPV 4ASUG 3ZN0A 2WLIA 1M1KW 3PJSK 5FL7G 4EKWA 3ZMVA 5H9CA 3CP1A 4GX2A 3LSQA 1H8EG 4TSFG 5CBHA 5L3BA 5LGNA 3B8NA 4E2LA 1F23A 2GHYA 3F5WC 3AEIA 2FTKA 4RQEA 2Q6AA 3QO5A 4QPJA 5IYBO 5B1OA 1OCRC 2W6IG 1K4DC 4PA9A 1W0JG 1E1QG 2ITDC 2DWDC 3CCMV 2XAQA 5EBWC 4WFAV 3ABMB 4XDJA 1NR7A 3CPWU 3RVYA 4BW5A 4X8AA 1Y4MA 1PNLA 4GX0A 2XAFA 1OCOC 4G28B 2HR3A 1NH2D 3FB5C 1KP2A 2B5UA 2HG5C 1NKDA 2Y69C 1KP3A 2NLJC 3W7XA 4QE9A 1THZA 3ZRSA 3OGCC 2HVJC 1AJPA 1K34A 3UM7A 1SETA 5CA3A 1RPOA 3CCUV 1I5YA 3OM3B 2XOKG 1K73W 3VOUA 3JD0A 2QM8A 4UV8A 4MTGA 2EIKC 3LSSA 2ZR2A 4R8CA 4DXWA 1XL4A 3SPGA 4MS2A 1QR8A 1R3KC 3IC7A 1VQLV 4JTCB 2JEUA 1UJWB 1K33A 2JJ1G 3W7SA 2QM7A 2DYRC 4WF9V 1MSWD 4PDLA 4G2KA 4FJCC 3K04A 1JPXA 1R6NA 4H33A 4F4LA 3WFVA 1VQ4V 2LFRA 3ZMSA 2EILB 1FXVA 2IJKA 4GX1A 2F43G 2WLHA 1S72V 3W7UA 2WLKA 1V55C 4WFBV 1K8AW 2WLLB 3WG7C 4N21A 2IH1C 5KUKA 5H6QA 5H6RA 3E8HA 3DTUB 2X6CA 3ETDA 1AI4A 1SERA 1Q86W 3D3IA 2X7RB 5C93A 1PKXA 3FYEB 4HYOA 4MVMA 5DN6G 4QJFB 2ZR3A 4WFHA 3EFFK 5B1AC 4N23A 2R9RB 5CMUA 5GW7A 3K79A 1F51A 2QKSA 4QIWF 3CMEV 1GO3F 2V1DA 3E35A 2BOCC 2IW5A 5KA5A 1KKDA 5B1BB 3GWOA 3SYQA 2ZD9A 3FB6C 2DYSB 2ZDIC 1S5HC 3AG3B 3JD1A 3ABKB 3K3WA 1OCCC 3ABUA 3K0DA 3K06A 4KP4A 4DO2A 1VQ7V 3UKMA 1YI2V 2YEVA 4FMTA 3BEHA 1YIJV 1YTFD 3ZRVA 1PD3A 1R3JC 3AG1C 1OCZC 5HFLA 1YJ9V 3MHHC 2X0LA 4WCEV 2Q67A 1OCRB 2HJFC 3E83A 1NVPB 2OT5A 3BY6A 5L3GA 2M7WA 1YHQV 3LDCA 5IDJA 4X89A 1GTOA 3ASOC 3OMAB 3SPIA 5LHHA 2HFEC 5LHGA 5CBFA 4XDLA 4JPRA 4JYBA 4WFGA 1I5XA 1WPXA 3FKSG 1GM8A 5EC2C 2PI4A 4RUFA 4PA4A 4BIZA 1OCOB 3OR7C 1M57C 4MTFA 1P4RA 2Y69B 3ML0A 1QLEB 3FB7C 5L3DA 3ZN1A 2P90A 2W6JG 1QBZA 4RQFA 2IH3C 5B1NA 3G4SV 3ZIAG 1RM1C 1AJNA 3ASNC 2P6JA 1VQKV 1ORQC 2EIKB 4UVAA 3HB3B 1AI7A 1W0KG 2Z3YA 3T4ZA 3E2EA 2P67A 3OAAG 5KUMA 3ZRWA 1TUEB 2A9HA 4FK5C 4GX5A 2XNDG 1K5SA 3A0RA 3CCQV 1VQ6V 1NQTA 2DYRB 2ITCC 2OCCC 4J9YB 4OXSA 3JD3A 3X2QC 5CN0A 4MW8A 4LCUC 3OFNG 4UVBA 4UVCA 2ZDIA 4JYCA 1YSCA 2WLIB 1PNMA 2UXNA 3I56V 4X88A 1FXHA 3ETGA 4HAMA 1CEZA 1W2BU 1CPYA 3K08A 1NVPD 3HPLC 4PDRA 1R3IC 4BIUA 4JASA 2JK5C 4R50A 4CZZA 4JF3A 4WFFA 1BHAA 1V55B 4TT3G 1H8HG 1H2GA 1AR1B 4JGSA 3P32A 3LDDA 3MD0A 2Z5UA 4ZKIA 5J9PC 1G8MA 1E79G 2CK3G 4QPKA 3P30A 3QNEA 3G6EV 5IY5C 2QTOA 1K5QA 4PA6A 5B1AB 1FXKA 4UXNA 1PL0A 1R6KA 4WFEA 2IJJA 4UV9A 1K97A 1OZ0A 3ABLC 3RBZA 4XBFA 1B6QA 1GKFA 4QNHB 2IU3A 2DW4A 3ZRXA 3TK1A 3CD6V 4MT8A 1OCCB 1DLBA 2ATKC 2KB1A 3JYCA 3CCSV 1QVFU 1MOFA 3OUSA 4UUJC 1Q81W 1JCHA 3OMNB 2ZXWB 3MHSC 4RAIA 1F4MA 3E8FA 1SRYA 1P7BA 4PELA 1NJIW 1L1FA 2A79B 3AG1B 4FPPA 2JEXA 3CC2V 1VQ9V 3CCVV 1R73A 5L3CA 3F7VC 3F7YC 4GT1A 5L3FA 2Y48A 3G71V 2Q68A 3AG4C 3TCUA 3ASOB 1ROPA 1E1RG 1FFTB 2EINC 3STLC 2WLJA 3IGAC 1JJ2U 3RVZA 1JOYA 1HWYA 5B3SC 3OR6C 1K9MW 4KUMA 4MTOA 3W7TA 3OUFA 1AJQA 1OHHG 3K0GA 1RPRA 4P9PA 2EILC 2C2AA 1M57B 2LP7A 3JD4A 5EBLC 3EHBB 5DM6V 2QA4V 4Q20A 3H01A 1K7DA 3LUTB 1JVMA 1YJWV 5IYCO 4MVUA 1NR1A 3ZCCA 2WWWA 3SPHA 4LBEC 1RM1B 3SYCA 1NH2B 3E89A 3ETEA 3ASNB 3JD2A 2WAMA 2H8PC 3ZMTA 1M56C 4Z1MG 2XAJA 1GK9A 4JTAB 5EC1C 4BAYA 3CCLV 1FXKC 5IYDO 4LC1A 3E86A 2QE7G 2OCCB 2YSUB 4JAVA 1EZJA 4U7NA 3SYPA 4XDKA 4H37A 1N8RW 1NBMG 3AG2C 3GB7C 1QCEA 1VQMV 1KC8W 4GCZA 1J95A 2X6BA 1AROP 3ABTA 2DYSC 2YEVB 3OEHG 1WLEA 1Q7YW 1VQ5V 5BZBA 3R65A 2HKOA 5HFMA 4P30A 2P7TC 3DGEA 2H94A 1VQOV 3ZMUA 5LGTA 2EIMC 3K9AA 3I55V 1JX9A 4R7CA 2PI5A 1S77D 3KG2A 2B1GA 5CBGA 1M90W 2JIZG 2EZOA 1V54C 2WLNA 1Q82W 4YXWG 2IJIA 2EIJC 4MTXA 1YITV 2HLDG 1K3EA 2JDIG 5IY5B 4R6ZA 1PNKA 1YJNV 1MG1A 3CCRV 1S76D 3FB8C 3T4DA 2MK3A 1H38A 1S0VA 1QR9A 3FYIB 2X6AA 4ZBMA 2GSMB 3ABLB 3OW2U 3QO7A 4J9ZB 1KECA 1QLEC 4I5SA 3QO8A 1KD1W 2AHYA 3CYOA 3WG7B 5LBQA 1GMGA 3IFXA 2LFSA 1GM9A 2WLLA 3ZJZA 2Q69A 3W7WA 2IU0A 1MABG 1QLNA 2WPDG 5EK0A 3LDEA 1XL6A 4MVRA 3JCZA 3CCEV 4I9WA 3ZRWB 1JQ0A 3ABMC 2QEXV 2EBOA 1SESA 1DF5A 1VQ8V 3CC4V 3OEEG 4TWKA 4G27B 1DF4A 2XASA 2DQ0A 1YTFB 3AG4B 1SZTA 3VBBA 2EINB 3OE7G 4CBCA 1R3LC 2AHZA 2V7QG 4JTDB 4MSWC 5B3SB 1F4NA 4RUEA 3RW0A 3SPCA 4PA3A 1BHBA 1IXMA 1ENVA 1M9NA 4MW3A 3CC7V 2XAHA 1AI5A 1COWG 1OCZB 3SYAA 4U7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRW B;  1F51 A;  3ZCC A;  4GT1 A;  3D36 A;  2WWW A;  3NXS A;  5IDJ A;  4BIU A;  4JAS A;  2P67 A;  4JYB A;  3DGE A;  3ZRW A;  4JAU A;  4KP4 A;  1JOY A;  3ZRX A;  4FMT A;  2QM7 A;  3P32 A;  4I5S A;  4MT8 A;  3TK1 A;  4BIZ A;  3A0R A;  3MD0 A;  4LC1 A;  2FTK A;  3ZRV A;  5C93 A;  2LFS A;  2C2A A;  4QPJ A;  4ZKI A;  4JAV A;  5B1O A;  4U7N A;  1IXM A;  4Q20 A;  4QPK A;  2LFR A;  4JYC A;  4FPP A;  5B1N A;  4MTX A;  4GCZ A;  4U7O A;  2QM8 A; 
#chains in the Genus database with same CATH topology
 4ZOL A;  4U3J B;  5JCO C;  3TET A;  3CB2 A;  2HVK C;  4EB6 A;  2LJ2 A;  5E1A C;  3SJQ C;  3K59 A;  2XT9 A;  2BOB C;  4LH7 A;  2WSS G;  4MVS A;  1P84 F;  1EBO A;  3LNM B;  4KFM A;  5L3E A;  4HNA A;  1CP9 A;  1EFR G;  5JH7 A;  4JAA A;  2K9P A;  2R9I A;  1W59 A;  4H13 B;  4ZHQ B;  2QTS A;  4MVO A;  1AI6 A;  2ZQM A;  3CE2 A;  3KCY A;  1WN7 A;  4FFB B;  4Z1V A;  1HNZ B;  1GN6 A;  2Q9L A;  2XAG A;  1QQC A;  2B1I A;  2M6Y A;  1LNQ A;  4IHJ A;  4O2A A;  1MA1 A;  3ZMZ A;  3LSU A;  2OTJ V;  2Y4U A;  4JAU A;  2UXX A;  1K92 A;  2F4V B;  4IGG A;  4P9O A;  2EIM B;  1KQS U;  5KHJ A;  2BSK A;  4DW0 A;  1KYO F;  4NXN O;  2QKA A;  5KA6 A;  4YJ3 A;  2A3Q A;  2EZP A;  3SJB C;  4FIP C;  1V54 B;  4PA7 A;  3D36 A;  4YIP A;  4F6R A;  3ZHR A;  3AG3 C;  2YXH A;  4K0K B;  1DTO A;  3ZN0 A;  1RFY A;  5H9C A;  5LYJ A;  3LSQ A;  5LGN A;  5L3B A;  2EUL A;  4E2L A;  3AEI A;  3JSN A;  5A2Q N;  4QPJ A;  3BA8 A;  3N2G B;  5IYB O;  1OCR C;  2W6I G;  5IJ9 A;  2EJ7 A;  5EBW C;  4WFA V;  1XEQ A;  1RP3 B;  4RWU A;  3ABM B;  1Y4M A;  1PNL A;  2Q7E A;  1FKA O;  1NH2 D;  1YCI A;  1LR1 A;  1NKD A;  2Y69 C;  1KP3 A;  2NLJ C;  3CS5 A;  1THZ A;  3ZRS A;  5LP6 A;  1NTK H;  3ZHT A;  4O4H B;  2HVJ C;  3BHP A;  3T1Y O;  4K35 A;  4MTG A;  4FM2 A;  2ZR2 A;  4R8C A;  4DXW A;  2GV9 A;  1XL4 A;  3HKD A;  4MS2 A;  3IC7 A;  1VQL V;  4JTC B;  2JEU A;  5FNV B;  1UJW B;  1K33 A;  4FLW A;  4X1I A;  2DYR C;  3D36 C;  3Q4H B;  4G2K A;  4B3R B;  4FJC C;  3EXA A;  2V4D A;  4UCO A;  1JPX A;  1R6N A;  4H33 A;  4F4L A;  5LA6 A;  4U3F H;  2Q7H A;  1VQ4 V;  4GKK O;  2PYL A;  4GX1 A;  3GWK C;  5J2T A;  4TOI A;  4FVM A;  5DED A;  3OTO B;  2AGA A;  1Z2G A;  4N21 A;  1AI4 A;  3D3I A;  5C93 A;  4HYO A;  2ZR3 A;  1ZX3 A;  4N23 A;  2R9R B;  1F51 A;  3E35 A;  4GKK B;  5LP6 C;  3CEI A;  1KKD A;  2UXB O;  3JAT A;  1BCC H;  1FFX B;  2P5O A;  5AG2 A;  1XDC A;  3K3W A;  4KP4 A;  1LUW A;  2P4V A;  2DJV A;  3AG1 C;  1Q43 A;  4JI1 B;  2Q67 A;  3FFQ A;  5BR8 O;  4Q6G A;  3HR0 A;  5L3G A;  4DV3 O;  5IDJ A;  1GTO A;  3SPI A;  2YIC A;  2H3O A;  1WPX A;  2QM4 A;  3CXH F;  2UXB B;  2EX3 A;  2PI4 A;  4RUF A;  5BXZ A;  1M57 C;  4MTF A;  1PM9 A;  4LWS A;  2UUA B;  3ZN1 A;  4LFC B;  5LMN O;  4IYI A;  1QHT A;  1QBZ A;  4O4L A;  2IH3 C;  4CS4 A;  5CA0 B;  2PTM A;  1VQK V;  1IBM B;  1JFF B;  5BR8 B;  2EIK B;  3T4Z A;  2Q5Z A;  1W0K G;  4LR3 A;  3E2E A;  4DR1 B;  3ZRW A;  1JMK C;  1TUE B;  5LMU O;  4GX5 A;  2NR5 A;  1FJG O;  4JI2 B;  4AQY B;  1K5S A;  3A0R A;  1JR9 A;  1ZLZ A;  1VQ6 V;  1Y76 B;  2IM9 A;  2ITC C;  3X2Q C;  2CTW A;  4UVB A;  4UVC A;  4JYC A;  2QWP B;  5DEC A;  4WBN B;  5LMN B;  4CS3 A;  2P4K A;  1CPY A;  4BIU A;  1WPB A;  4JAS A;  1CXZ B;  1H8H G;  3CRM A;  5LMU B;  3UO3 A;  2JS5 A;  4ZKI A;  1AP5 A;  4QPK A;  2IBZ H;  3QNE A;  4LH6 A;  2BCC H;  1VF7 A;  1VP7 A;  4X64 B;  2QTO A;  1K5Q A;  5B1A B;  4TV8 A;  4I50 B;  2IJJ A;  4WFE A;  1K97 A;  4NKG B;  4XBF A;  1T5E A;  3A2F A;  3L75 H;  4X1Y A;  1B6Q A;  2GUZ A;  3ZRX A;  2ATK C;  3JYC A;  3OUS A;  1JCH A;  3OMN B;  3L71 H;  2OIG A;  1L1F A;  4TV9 A;  4FPP A;  1L8D A;  4GT1 A;  2FML A;  3TCU A;  1FFT B;  3QVN A;  2WLJ A;  1JJ2 U;  2ZE8 A;  5JQG B;  4KUM A;  3ZHV A;  2YIB A;  4P9P A;  5EBL C;  3EHB B;  4LF9 B;  1XQ8 A;  1K7D A;  3LUT B;  2DE0 X;  2DMX A;  5IYC O;  3M7M X;  4OPH A;  3ZCC A;  1RM1 B;  3SYC A;  1HNX O;  3E89 A;  3D3Q A;  3ETE A;  3RYF B;  3JD2 A;  4LF8 B;  1SQV H;  3CCL V;  1SC5 B;  1Y74 A;  4NB5 A;  1VQM V;  1J95 A;  5CA1 A;  4B08 A;  1GAX A;  1D2D A;  1WLE A;  4B3M B;  1TVK A;  2HJD A;  1A32 A;  3JSL A;  1VQO V;  3K9A A;  2OWO A;  3I55 V;  3B2E E;  4R7C A;  5JVD A;  1S77 D;  5ITZ B;  2YI8 A;  4K8X A;  2ZT9 B;  1Q82 W;  2IJI A;  3ZHU A;  1VF6 A;  5IY5 B;  1S76 D;  3FB8 C;  5JJN B;  1H38 A;  1S0V A;  2B9Z A;  2GSM B;  3QO8 A;  1XNQ O;  3B4S A;  2CH7 B;  2Q69 A;  1TUB B;  1MAB G;  1QLN A;  5EK0 A;  3L70 H;  4I9W A;  2QEX V;  2EBO A;  4TWK A;  4G27 B;  4O4I B;  1YTF B;  4D6T H;  3RYC B;  4DV0 O;  2EIN B;  2QDO A;  3H1J H;  1R3L C;  4JI3 O;  2V7Q G;  3RYH A;  4DV4 B;  4JTD B;  4MSW C;  4RUE A;  4PA3 A;  1BSM A;  3WB2 A;  3HKE A;  2YID A;  1XNQ B;  1GH6 A;  1BHB A;  1ENV A;  3HKC B;  4YY3 O;  2HHH B;  3BFR A;  4LF5 B;  1COW G;  3AK1 A;  1VIB A;  1OCZ B;  1B3Q A;  2JJ2 G;  1ZUQ A;  3A0B Z;  2RN9 A;  3STZ C;  1FS0 G;  2RDC A;  5IJ0 B;  1L0L H;  4YHH O;  1ZL8 A;  4RO2 A;  4P2Z A;  4MVQ A;  1VF6 C;  1IVS A;  1J5E O;  4DV0 B;  1Y66 A;  3IAY A;  3CRQ A;  4JI3 B;  2OTL V;  2L6L A;  4FLX A;  1DGS A;  4MVZ A;  3AG2 B;  4YY3 B;  2E3C A;  2W0F C;  4DV7 B;  3K5M A;  1QVG U;  1BMF G;  5B5E Z;  4DK0 A;  5C8Y B;  3K9S A;  3B77 A;  2ADQ B;  3O9O A;  5E79 Z;  3JAL A;  5LGU A;  4DUY B;  4X65 B;  2QWN B;  4D7S A;  2LW7 A;  2EIJ B;  1SQX H;  4OX9 B;  3T2M A;  4PDV A;  3CXC U;  1SS3 A;  1BL8 A;  2Q7G A;  3HKB B;  5KMG B;  5FL7 G;  3ZMV A;  4GX2 A;  2ZM6 O;  2VQE O;  3B8N A;  1F23 A;  3F5W C;  2FTK A;  4RQE A;  3QO5 A;  5B66 Z;  3ICX A;  3TXQ A;  4Z2W A;  1W0J G;  2PUS A;  2DWD C;  3CCM V;  4TUY B;  4OPA A;  2ZNJ A;  1BQZ A;  2W0X A;  1NR7 A;  1N36 O;  4X62 O;  3ZED A;  4JI6 O;  2Q4P A;  4JV5 B;  2XAF A;  1OCO C;  1DK1 A;  3QG5 A;  2HR3 A;  3FB5 C;  5CB4 A;  4QE9 A;  1NT2 B;  1WP8 A;  2ZM6 B;  2VQE B;  1VMG A;  1AJP A;  4H44 B;  1SET A;  1RPO A;  1TAE A;  1K73 W;  3P3P A;  3VOU A;  2QM8 A;  3D8C A;  3CX5 F;  3JAW B;  1WA8 B;  5EZY B;  1Q6U A;  1N36 B;  2JJ1 G;  4PV1 B;  4JI6 B;  3W7S A;  2ILM A;  3DXR A;  4J7Z A;  4PDL A;  1H2L A;  2ZIN A;  2PY5 A;  2DN9 A;  2UUB O;  5BMV A;  2LFR A;  3ZMS A;  3P3N A;  4JI5 O;  2IJK A;  4JI0 O;  1R6T A;  1EM1 A;  3RFR A;  3W7U A;  2ETN A;  1V55 C;  2WLL B;  5K1P A;  1RSO A;  3J7A U;  5KHK A;  5KUK A;  1HP8 A;  3DTU B;  4UFZ A;  3ETD A;  3TGU H;  4YIO A;  5GTH Z;  1N33 O;  3BVO A;  2YDE A;  2BTQ B;  4WFH A;  3BRC A;  3EFF K;  2KKW A;  2QKS A;  3CME V;  2YS8 A;  1GO3 F;  5KA5 A;  3GWO A;  4I9Q A;  5KLV H;  2ZDI C;  3FAV B;  3AG3 B;  4UB8 Z;  2GTS A;  4LFB O;  1OCC C;  1FYJ A;  1VQ7 V;  4UCS A;  1YI2 V;  3UKM A;  3VQW A;  3BEH A;  4X1K A;  1YIJ V;  4NXM O;  2ZNI A;  4TQD A;  4YJ2 B;  2MW2 B;  4ZOL B;  1PD3 A;  1I94 O;  2CGO A;  4EB6 B;  2X0L A;  2ZE6 A;  1VF5 B;  4WCE V;  1XIL A;  1OCR B;  3H1H H;  3E83 A;  5KAI Z;  2OT5 A;  3BY6 A;  3KZI Z;  5EIB D;  5H5N A;  1G6U A;  2CGN A;  2YC0 A;  4FLT A;  4CH6 A;  5LHH A;  2RNB A;  5CBF A;  5IYZ A;  4HNA B;  4XDL A;  4JPR A;  4JYB A;  5JH7 B;  4ABM A;  4PI2 A;  3OR7 C;  4LFB B;  1YVW A;  3F5T A;  2Y69 B;  1QLE B;  3FB7 C;  5FLX N;  1HR0 O;  4RQF A;  4IHJ B;  4O2A B;  5LOV A;  3G4S V;  2AXT Z;  3ZS8 C;  4NXN B;  1Y6X A;  5JWP A;  3ASN C;  2P6J A;  2FKX A;  4UVA A;  2BSK B;  3OAA G;  5KUM A;  3OTF A;  4YJ3 B;  2A9H A;  3DSQ A;  4I4T A;  2XND G;  5TIS Z;  2Y0P A;  2FYU H;  1NQT A;  2DYR B;  3BCC H;  4GZR B;  3JD3 A;  1O9H A;  5CN0 A;  1PL4 A;  4F6R B;  4QGP A;  2QWR B;  4O4J A;  4I7Z B;  1PNM A;  1AR4 A;  4JI4 O;  4X88 A;  3H9V A;  5LYJ B;  5IT9 N;  2WA3 A;  1CEZ A;  2Q0A A;  3HPL C;  4CZZ A;  4WFF A;  5IJ9 B;  3LDD A;  3MD0 A;  1ZSP A;  3EVK A;  1YZB A;  3VQX A;  4DR4 O;  2GBO A;  3M8A A;  1XNR O;  1FXK A;  4UXN A;  3T1Y B;  2Q0O C;  1YEW A;  4UV9 A;  4JI4 B;  4NYK A;  5LP6 B;  4IL6 Z;  2CTP A;  3MDS A;  4FLU A;  1SA0 A;  2IU3 A;  2DW4 A;  3CD6 V;  2KB1 A;  4UUJ C;  2ZXW B;  3E8F A;  3HKD B;  4PEL A;  2A79 B;  3AG1 B;  2QWQ B;  4DR7 O;  1VQ9 V;  1PPJ H;  2Q73 A;  1SQF A;  1Y67 A;  3JCU Z;  4X1I B;  1XMO O;  4DR4 B;  3AG4 C;  4LF7 O;  2ADP A;  1ROP A;  5LA6 B;  4GYC B;  1HWY A;  4IIJ A;  2PYJ A;  2OCH A;  3OUF A;  5J2T B;  4DRX A;  4DR2 O;  2C2A A;  1M57 B;  2ZKO A;  3JD4 A;  4NR1 A;  5DM6 V;  2QA4 V;  4Q20 A;  1D5A A;  1GRJ A;  1JVM A;  4EEQ A;  3UQ8 A;  3CJH A;  1I7F A;  5H2F Z;  1NR1 A;  1BZK A;  4DR7 B;  4UCR A;  1NTM H;  3SDL A;  1H2N A;  2H8P C;  3ZMT A;  1M56 C;  2A06 H;  1FXK C;  2R72 A;  4AIL C;  3VQY A;  1EZJ A;  3G6B A;  3JAT B;  4J41 A;  3GB7 C;  1QCE A;  3OD4 A;  4GCZ A;  3PN1 A;  3ABT A;  2VS0 A;  4DUZ O;  3OEH G;  2G38 A;  1VQ5 V;  3SJC C;  4CS2 A;  2CTQ A;  4P30 A;  2KSD A;  1HNW O;  3J81 N;  3OT7 A;  2H94 A;  4DV3 B;  3THO A;  4I55 A;  2PI5 A;  1IX9 A;  2B1G A;  5CBG A;  5EYP A;  3H1L H;  4YXW G;  3G80 A;  4W4K A;  4MTX A;  2QKC A;  2KG7 A;  1V9P A;  1K3E A;  1NZ6 A;  4R6Z A;  1MG1 A;  3CCR V;  3IC9 A;  3S3X A;  4LWS B;  4B3T O;  1QR9 A;  4DUZ B;  4BW9 A;  1Z5V A;  3VQV A;  4O4L B;  1EN6 A;  1B04 A;  3CYO A;  3NR7 A;  3WG7 B;  1GMG A;  5LBQ A;  3JAK A;  3ZJZ A;  1FJG B;  3W7W A;  4DR5 O;  2WPD G;  3LDE A;  1S5J A;  3E22 A;  3ZRW B;  1JQ0 A;  3JAR A;  4GUN A;  1NS1 A;  2AW9 A;  1SES A;  2LGQ A;  4FZ0 A;  1KU9 A;  3OEE G;  4DK1 A;  2XAS A;  1MNG A;  4K3A A;  3VBB A;  3OE7 G;  4PJ0 Z;  2AHZ A;  4B3T B;  1F4N A;  3SPC A;  4JZG A;  1M9N A;  4MW3 A;  2YUA A;  4U7N A;  4U7O A;  5LXT A;  1HW7 A;  1XBL A;  1WP7 A;  5LHI A;  3SPJ A;  1BE3 H;  4DV2 O;  4KHP O;  2XTA A;  4L87 A;  1NTZ H;  1OV9 A;  1GM7 A;  1P49 A;  5K1X A;  1M5I A;  1VQN V;  4TV8 B;  4JYA O;  2DQ3 A;  2D2C B;  2WA4 A;  4X1Y B;  5JJE B;  2GUZ B;  3CRA A;  2IJH A;  4TV9 B;  2P06 A;  4DV2 B;  4KHP B;  1BT8 A;  1YDX A;  5EBM C;  1SQQ H;  3N2K A;  4ZI7 A;  2YIA A;  3C90 A;  4JYA B;  5B1B C;  1SQG A;  1URF A;  3E8B A;  3ABK C;  1G4Y B;  2WLI A;  3R66 A;  4I0X A;  2CDY A;  4TSF G;  1H8E G;  1HNX B;  5GON A;  3K57 A;  2Q6A A;  2AZ2 A;  2GTA A;  4DR3 O;  5B1O A;  3FD9 A;  3IJ4 A;  3C3T A;  1E1Q G;  5D5Q A;  1QNM A;  3T1H O;  1Y74 B;  3CPW U;  4BW5 A;  4X8A A;  4GX0 A;  5J2U A;  4JZ2 A;  1KP2 A;  1VEW A;  4X20 A;  1XMQ O;  3W7X A;  5CA1 B;  3UT5 A;  2BTO A;  4LF4 O;  1K34 A;  3UM7 A;  1TVK B;  5CA3 A;  3CRC A;  3CCU V;  1I5Y A;  2ARH A;  1Q3E A;  3JD0 A;  1BGY H;  4DV5 O;  3RYI A;  1QR8 A;  2PZS A;  5JVD B;  3APQ A;  1IDS A;  4UCV A;  3U11 A;  5KAF Z;  3JAS A;  4FM1 A;  2QM7 A;  5KHI A;  4O2B A;  4WF9 V;  1B06 A;  4B7E A;  2RMK B;  3WFV A;  1Q8I A;  2EIL B;  1FXV A;  2E75 B;  4LF4 B;  2N05 A;  1SQP H;  2F43 G;  1S72 V;  1M93 A;  2E5L O;  4B3S O;  1N4C A;  1UFI A;  1WB7 A;  2WLK A;  4J42 A;  4WFB V;  2IH1 C;  1SER A;  1Q86 W;  5DN6 G;  2X7R B;  1PKX A;  3FYE B;  4QJF B;  4DW1 A;  4HBN A;  3UCS C;  5CMU A;  3TXS A;  5GW7 A;  2N74 A;  3K79 A;  4ICG A;  1IZ3 A;  4QIW F;  2UU9 O;  2JGD A;  2V1D A;  2IW5 A;  3RYH B;  1AR5 A;  2ZD9 A;  3FB6 C;  2DYS B;  1PV0 A;  2E5L B;  5KX5 A;  5A9G A;  3JD1 A;  3HKE B;  3LNN A;  2HP8 A;  4DO2 A;  3C3S A;  1ZTE A;  2YEV A;  4KXR A;  4YHH B;  3L9D A;  1Z5W A;  1YTF D;  4LFA O;  3U10 A;  1OCZ C;  3BA9 A;  1YJ9 V;  1ZL8 B;  1J5E B;  2HJF C;  4UB6 Z;  1NVP B;  2M7W A;  2JRI A;  1YHQ V;  3TJT A;  3ASO C;  1WAZ A;  2A7W A;  3OMA B;  2HFE C;  4GLX A;  2FL4 A;  3O65 A;  3FKS G;  1MSD A;  1GM8 A;  3B09 A;  2HEP A;  4PA4 A;  1HDJ A;  1OCO B;  1VAR A;  3ML0 A;  5L3D A;  3AK3 A;  4LNU A;  2W6J G;  1N32 O;  4LFA B;  3ZIA G;  3N27 A;  4PD4 F;  1ORQ C;  1AI7 A;  3J80 N;  4JI7 O;  3JAL B;  1X59 A;  3CCQ V;  2OCC C;  4J9Y B;  3MAQ A;  4OXS A;  1Q6I A;  1H2M A;  3I5D A;  4LCU C;  1IUR A;  2ZCE A;  2ZDI A;  1LUV A;  4F6E A;  3K58 A;  2L35 A;  4HAM A;  3K08 A;  1NVP D;  1R3I C;  2YXL A;  4R50 A;  4NTY A;  1EZV H;  4DV6 O;  1V55 B;  4TT3 G;  4U3J A;  1KB9 F;  3ETQ A;  4X62 B;  5J9P C;  1G8M A;  2CK3 G;  1P7G A;  3G6E V;  4NTW A;  1FPO A;  1PL0 A;  4GKJ O;  5CB4 B;  4ZHQ A;  3ABL C;  3A8T A;  1GKF A;  4QNH B;  4FFB A;  3ZHS A;  3TK1 A;  4MT8 A;  1OCC B;  3CCS V;  2YI9 A;  4DV6 B;  1MOF A;  1O9G A;  1F4M A;  1SRY A;  2CE4 A;  1NJI W;  1HNZ O;  3CCV V;  2UUB B;  5L3C A;  3F7V C;  3F7Y C;  3QF7 A;  2F95 B;  4CH5 A;  3DXR B;  3H1K H;  4JI5 B;  4JI0 B;  2F4V O;  1E1R G;  1N0J A;  4GKJ B;  5BMV B;  3STL C;  4BWA A;  3L73 H;  3RVZ A;  5B3S C;  3OR6 C;  4MTO A;  1AJQ A;  5KHG A;  5EIB C;  5KHH A;  4CC5 A;  3K0G A;  1RPR A;  2LP7 A;  1EN5 A;  3H01 A;  1Q5O A;  1YJW V;  2QSA A;  4MVU A;  4K0K O;  1AB3 A;  5JJJ B;  1N33 B;  1RSO B;  3SPH A;  4LBE C;  4FLY A;  3N2G A;  1NH2 B;  3ASN B;  3U0Z A;  1MZE A;  4EFE A;  1FAF A;  1GK9 A;  5EC1 C;  4BAY A;  4FLV A;  5IYD O;  4FFK A;  3E86 A;  2ZE5 A;  2YSU B;  1IBK O;  3WB0 A;  4NXM B;  4W4L A;  4XDK A;  4H37 A;  1N8R W;  1KC8 W;  1I94 B;  4O4H A;  4X1K B;  3S3W A;  1WJZ A;  3K5N A;  5BZB A;  3R65 A;  2HKO A;  5HFM A;  2XUM A;  2P7T C;  5LGT A;  2EIM C;  4D7T A;  1M90 W;  2JIZ G;  2EZO A;  1V54 C;  2WLN A;  5FNV A;  5IYZ B;  1X4T A;  2UXD O;  2BE3 A;  3Q4H A;  1IBK B;  2JDI G;  1HR0 B;  2F66 C;  1PNK A;  2R9A A;  3T4D A;  2CAZ C;  4B3R O;  3FYI B;  2X6A A;  4ZBM A;  3OW2 U;  3QO7 A;  4J9Z B;  2VQF O;  1KEC A;  1QLE C;  2CTR A;  4I5S A;  1KD1 W;  5LOV B;  2AHY A;  3IFX A;  1GM9 A;  3A0H Z;  3G67 A;  2IU0 A;  1XL6 A;  1MZF A;  1SQB H;  3JAM N;  3OTO O;  3ABM C;  4I4T B;  2JS3 A;  1U97 A;  2UXD B;  1VQ8 V;  4PHZ A;  1N34 O;  2DQ0 A;  3AG4 B;  4A5U B;  1SZT A;  4O4J B;  4CBC A;  1KMI Z;  1FFX A;  2VQF B;  4DR6 O;  2GDS A;  2XAH A;  2OYQ A;  2PF4 E;  2DWE C;  2R70 A;  3E8G A;  2F93 B;  3M99 B;  3B8M A;  1XNR B;  4IT5 A;  1QU7 A;  3CCJ V;  5FPR A;  4JI1 O;  1N34 B;  1M56 B;  2N04 A;  2P22 C;  3T1C A;  1FXK B;  2EJR A;  4TQF A;  2NNU A;  2UXC O;  1MMM A;  4UCT A;  3SYO A;  1XI1 A;  1UPG A;  4DR6 B;  1SA0 B;  4PDM A;  3K03 A;  1ZWI C;  1K4C C;  4LP8 A;  2D3O W;  5CA0 A;  3APO A;  4JI8 O;  1XMO B;  2UUA O;  2LW1 A;  2RJZ A;  4LFC O;  1JFF A;  2K1E A;  2ZXW C;  4LF7 B;  1SKV A;  4K8Z A;  1L0N H;  3UO2 A;  3DC5 A;  3OMI B;  2KQX A;  1IBM O;  1S3J A;  3X2Q B;  2Q8V A;  4DR2 B;  1Y76 A;  2A0L A;  2WLM A;  4QE7 A;  4DR1 O;  2UXC B;  2JGU A;  3CMA V;  4HZ3 A;  3NXS A;  4IIJ B;  4C7U A;  1ZAU A;  4JI2 O;  4AQY O;  1VQP V;  4ASU G;  4WBN A;  4DRX B;  1M1K W;  3PJS K;  5IWA O;  2LQT A;  1TGO A;  4DYL A;  4EKW A;  1XRE A;  1GN3 A;  1KKC A;  3CP1 A;  5CBH A;  1N0N A;  1NI8 A;  3CJH B;  4JI8 B;  2GHY A;  2XHB A;  2LO1 A;  1US6 A;  3QTC A;  2ODM A;  1K4D C;  4PA9 A;  3GVM A;  2ITD C;  2ZE7 A;  2XAQ A;  1AIL A;  1Q6H A;  4BIO A;  3CSX A;  4XDJ A;  4X66 O;  5D5P A;  3BAA A;  3RVY A;  2QJ1 A;  4G28 B;  4AHC A;  2FB5 A;  2B5U A;  5FPO A;  2HG5 C;  4DV1 O;  4I50 A;  2O57 A;  5IWA B;  4X64 O;  1HNW B;  3OGC C;  3WB1 A;  1TA8 A;  3OGI B;  4H0L B;  1XOU A;  3OM3 B;  1SF9 A;  2XOK G;  4UV8 A;  2EIK C;  3LSS A;  1F7Y A;  3SPG A;  1R3K C;  4I55 B;  5EYP B;  2DOS A;  4X66 B;  3B40 A;  1OJH A;  4CH4 A;  1MSW D;  2Z0A A;  2KG7 B;  3K04 A;  4CH3 A;  4DV1 B;  2F1M A;  1XHZ A;  5JQG A;  2WLH A;  4DR5 B;  1K8A W;  2RQ6 A;  3JAK B;  3RN4 A;  1XUQ A;  3WG7 C;  4LF9 O;  5H6Q A;  5H6R A;  3E22 B;  3E8H A;  2X6C A;  3RYF A;  1H2K A;  2YXY A;  3JAR B;  1GN2 A;  4MVM A;  2JVD A;  3K5O A;  3K5L A;  5B1A C;  2PGG A;  3CWB H;  4LF8 O;  2BOC C;  5B1B B;  2E76 B;  3SYQ A;  1S5H C;  4BR6 A;  3ABK B;  2Y0I A;  3H1I H;  3ABU A;  3K0D A;  3K06 A;  4FMT A;  2CUG A;  4B7K A;  3AG7 A;  5LXT B;  3ZRV A;  1R3J C;  5HFL A;  2F23 A;  3FX7 A;  3MHH C;  3SJA C;  4B3M O;  4FZ1 A;  1R1B A;  2QGN A;  5ITZ A;  3LDC A;  4X89 A;  1AP6 A;  2VWK A;  5LHG A;  4WFG A;  1I5X A;  5EC2 C;  4BIZ A;  1P4R A;  4JYY A;  1JJO A;  2P90 A;  1IBL O;  1M4U A;  3AK2 A;  5B1N A;  4LF6 O;  3L74 H;  1RM1 C;  1AJN A;  2CH7 A;  1TUB A;  2VWJ A;  3HB3 B;  2Z3Y A;  2P67 A;  1XHX A;  4KL1 A;  2QWO B;  3WU2 Z;  4FK5 C;  3SR2 C;  3N2K B;  4ZI7 B;  4CC6 A;  4O4I A;  4MW8 A;  3OFN G;  3RYC A;  1YSC A;  3ZBH A;  2WLI B;  2UXN A;  4I0X B;  4L8J A;  3I56 V;  1IBL B;  4DR3 B;  1FXH A;  4PI0 A;  5GON B;  2AZ0 A;  3ETG A;  4LF6 B;  1W2B U;  3HKC A;  4PDR A;  4DV4 O;  2UUC O;  1YF2 A;  2JK5 C;  1BHA A;  4JF3 A;  1U96 A;  1H2G A;  3T1H B;  1AR1 B;  4JGS A;  3P32 A;  2HHH O;  2YIB D;  5IJ0 A;  4LF5 O;  2Z5U A;  4OGQ B;  1E79 G;  1XMQ B;  3P30 A;  2LGW A;  5IY5 C;  5J2U B;  4PA6 A;  4X20 B;  1R6K A;  5F2V O;  2RCV A;  1OZ0 A;  3UT5 B;  3RBZ A;  4DV5 B;  1KUQ A;  1WB8 A;  3ZX6 A;  2UUC B;  1DLB A;  1QVF U;  1BQ0 A;  4FM0 A;  1Q81 W;  3MHS C;  4RAI A;  3RYI B;  5C8Y A;  1P7B A;  2JEX A;  4DV7 O;  3CHX A;  3CC2 V;  1FD9 A;  1EN4 A;  1R73 A;  1S5L Z;  5LL6 Y;  3JAS B;  4X9Q A;  5L3F A;  4O2B B;  2Y48 A;  3G71 V;  2Q68 A;  3ASO B;  4NTX A;  4B3S B;  2EIN C;  4J7J A;  3IGA C;  1JOY A;  4J7K A;  1K9M W;  4DUY O;  4X65 O;  3W7T A;  1OHH G;  1WNS A;  3HKB A;  2EIL C;  5KMG A;  5IE9 A;  1BS3 A;  1G1X B;  4OX9 O;  1IXB A;  2WWW A;  1NU1 H;  3RGB A;  3KCX A;  3CRR A;  2WAM A;  2UU9 B;  4TUY A;  4Z1M G;  2XAJ A;  4JTA B;  4LC1 A;  4J11 A;  2JGD B;  2QE7 G;  2OCC B;  4JAV A;  3SYP A;  5KX5 B;  1NBM G;  3AG2 C;  1D5N A;  1I0H A;  2X6B A;  1ARO P;  2DYS C;  2YEV B;  4JV5 O;  3RT3 C;  1Q7Y W;  1I08 A;  4IYH A;  1PP9 H;  3DGE A;  3L72 H;  3ZMU A;  3JAW A;  1WA8 A;  5EZY A;  1AVM A;  1JX9 A;  5JCO A;  3KG2 A;  5GTI Z;  2EIJ C;  1YIT V;  2HLD G;  2ZIM A;  3BPZ A;  2OIE A;  1KBH A;  1YJN V;  1N32 B;  3RWR D;  4J80 A;  2MK3 A;  3BAB A;  5BY1 A;  4LNU B;  3DC6 A;  1JA8 A;  3ABL B;  4NVP A;  1GN4 A;  3KKY A;  4UCU A;  4JI7 B;  2LFS A;  2WLL A;  4MVR A;  3JCZ A;  3CCE V;  4EFB A;  4AI8 A;  1Q90 D;  2E74 B;  2Y4T A;  2NN4 A;  1DF5 A;  3CC4 V;  2BTQ A;  1DF4 A;  1SZX A;  4FLZ A;  3SGI A;  4ZIB A;  2VRZ A;  4E4E A;  1YXB A;  5B3S B;  3ZHQ A;  3RW0 A;  3FAV A;  2ZIO A;  4J10 A;  1IXM A;  2QR4 A;  1H2S B;  3CC7 V;  1AI5 A;  3SYA A;  4YJ2 A; 
#chains in the Genus database with same CATH homology
 2JJ2 G;  2DWE C;  3STZ C;  1FS0 G;  3E8G A;  3TET A;  2HVK C;  3M99 B;  3B8M A;  5LHI A;  4RO2 A;  5E1A C;  4P2Z A;  3SJQ C;  3SPJ A;  3CCJ V;  4MVQ A;  2BOB C;  2WSS G;  4L87 A;  4MVS A;  1EBO A;  3LNM B;  1GM7 A;  1M56 B;  4KFM A;  5L3E A;  1CP9 A;  3T1C A;  1Y66 A;  1FXK B;  1EFR G;  2EJR A;  1VQN V;  2NNU A;  2R9I A;  2OTL V;  2DQ3 A;  4MVO A;  3SYO A;  1AI6 A;  4MVZ A;  3AG2 B;  2ZQM A;  4PDM A;  3K03 A;  1ZWI C;  2W0F C;  2XAG A;  2IJH A;  1K4C C;  2B1I A;  1LNQ A;  4LP8 A;  3ZMZ A;  2D3O W;  1QVG U;  1BMF G;  2OTJ V;  4JAU A;  2UXX A;  1K92 A;  3B77 A;  2K1E A;  2ZXW C;  4P9O A;  2EIM B;  1KQS U;  3OMI B;  5EBM C;  5KA6 A;  5LGU A;  1S3J A;  2EZP A;  4FIP C;  3X2Q B;  1V54 B;  2A0L A;  2WLM A;  4PA7 A;  2EIJ B;  4QE7 A;  5B1B C;  3D36 A;  3CMA V;  4HZ3 A;  3NXS A;  3T2M A;  4PDV A;  3E8B A;  3AG3 C;  3ABK C;  1G4Y B;  3CXC U;  1DTO A;  1BL8 A;  1VQP V;  4ASU G;  3ZN0 A;  2WLI A;  1M1K W;  3PJS K;  5FL7 G;  4EKW A;  3ZMV A;  5H9C A;  3CP1 A;  4GX2 A;  3LSQ A;  1H8E G;  4TSF G;  5CBH A;  5L3B A;  5LGN A;  3B8N A;  4E2L A;  1F23 A;  2GHY A;  3F5W C;  3AEI A;  2FTK A;  4RQE A;  2Q6A A;  3QO5 A;  4QPJ A;  5IYB O;  5B1O A;  1OCR C;  2W6I G;  1K4D C;  4PA9 A;  1W0J G;  1E1Q G;  2ITD C;  2DWD C;  3CCM V;  2XAQ A;  5EBW C;  4WFA V;  3ABM B;  4XDJ A;  1NR7 A;  3CPW U;  3RVY A;  4BW5 A;  4X8A A;  1Y4M A;  1PNL A;  4GX0 A;  2XAF A;  1OCO C;  4G28 B;  2HR3 A;  1NH2 D;  3FB5 C;  1KP2 A;  2B5U A;  2HG5 C;  1NKD A;  2Y69 C;  1KP3 A;  2NLJ C;  3W7X A;  4QE9 A;  1THZ A;  3ZRS A;  3OGC C;  2HVJ C;  1AJP A;  1K34 A;  3UM7 A;  1SET A;  5CA3 A;  1RPO A;  3CCU V;  1I5Y A;  3OM3 B;  2XOK G;  1K73 W;  3VOU A;  3JD0 A;  2QM8 A;  4UV8 A;  4MTG A;  2EIK C;  3LSS A;  2ZR2 A;  4R8C A;  4DXW A;  1XL4 A;  3SPG A;  4MS2 A;  1QR8 A;  1R3K C;  3IC7 A;  1VQL V;  4JTC B;  2JEU A;  1UJW B;  1K33 A;  2JJ1 G;  3W7S A;  2QM7 A;  2DYR C;  4WF9 V;  1MSW D;  4PDL A;  4G2K A;  4FJC C;  3K04 A;  1JPX A;  1R6N A;  4H33 A;  4F4L A;  3WFV A;  1VQ4 V;  2LFR A;  3ZMS A;  2EIL B;  1FXV A;  2IJK A;  4GX1 A;  2F43 G;  2WLH A;  1S72 V;  3W7U A;  2WLK A;  1V55 C;  4WFB V;  1K8A W;  2WLL B;  3WG7 C;  4N21 A;  2IH1 C;  5KUK A;  5H6Q A;  5H6R A;  3E8H A;  3DTU B;  2X6C A;  3ETD A;  1AI4 A;  1SER A;  1Q86 W;  3D3I A;  2X7R B;  5C93 A;  1PKX A;  3FYE B;  4HYO A;  4MVM A;  5DN6 G;  4QJF B;  2ZR3 A;  4WFH A;  3EFF K;  5B1A C;  4N23 A;  2R9R B;  5CMU A;  5GW7 A;  3K79 A;  1F51 A;  2QKS A;  4QIW F;  3CME V;  1GO3 F;  2V1D A;  3E35 A;  2BOC C;  2IW5 A;  5KA5 A;  1KKD A;  5B1B B;  3GWO A;  3SYQ A;  2ZD9 A;  3FB6 C;  2DYS B;  2ZDI C;  1S5H C;  3AG3 B;  3JD1 A;  3ABK B;  3K3W A;  1OCC C;  3ABU A;  3K0D A;  3K06 A;  4KP4 A;  4DO2 A;  1VQ7 V;  3UKM A;  1YI2 V;  2YEV A;  4FMT A;  3BEH A;  1YIJ V;  1YTF D;  3ZRV A;  1PD3 A;  1R3J C;  3AG1 C;  1OCZ C;  5HFL A;  1YJ9 V;  3MHH C;  2X0L A;  4WCE V;  2Q67 A;  1OCR B;  2HJF C;  3E83 A;  1NVP B;  2OT5 A;  3BY6 A;  5L3G A;  2M7W A;  1YHQ V;  3LDC A;  5IDJ A;  4X89 A;  1GTO A;  3ASO C;  3OMA B;  3SPI A;  5LHH A;  2HFE C;  5LHG A;  5CBF A;  4XDL A;  4JPR A;  4JYB A;  4WFG A;  1I5X A;  1WPX A;  3FKS G;  1GM8 A;  5EC2 C;  2PI4 A;  4RUF A;  4PA4 A;  4BIZ A;  1OCO B;  3OR7 C;  1M57 C;  4MTF A;  1P4R A;  2Y69 B;  3ML0 A;  1QLE B;  3FB7 C;  5L3D A;  3ZN1 A;  2P90 A;  2W6J G;  1QBZ A;  4RQF A;  2IH3 C;  5B1N A;  3G4S V;  3ZIA G;  1RM1 C;  1AJN A;  3ASN C;  2P6J A;  1VQK V;  1ORQ C;  2EIK B;  4UVA A;  3HB3 B;  1AI7 A;  1W0K G;  2Z3Y A;  3T4Z A;  3E2E A;  2P67 A;  3OAA G;  5KUM A;  3ZRW A;  1TUE B;  2A9H A;  4FK5 C;  4GX5 A;  2XND G;  1K5S A;  3A0R A;  3CCQ V;  1VQ6 V;  1NQT A;  2DYR B;  2ITC C;  2OCC C;  4J9Y B;  4OXS A;  3JD3 A;  3X2Q C;  5CN0 A;  4MW8 A;  4LCU C;  3OFN G;  4UVB A;  4UVC A;  2ZDI A;  4JYC A;  1YSC A;  2WLI B;  1PNM A;  2UXN A;  3I56 V;  4X88 A;  1FXH A;  3ETG A;  4HAM A;  1CEZ A;  1W2B U;  1CPY A;  3K08 A;  1NVP D;  3HPL C;  4PDR A;  1R3I C;  4BIU A;  4JAS A;  2JK5 C;  4R50 A;  4CZZ A;  4JF3 A;  4WFF A;  1BHA A;  1V55 B;  4TT3 G;  1H8H G;  1H2G A;  1AR1 B;  4JGS A;  3P32 A;  3LDD A;  3MD0 A;  2Z5U A;  4ZKI A;  5J9P C;  1G8M A;  1E79 G;  2CK3 G;  4QPK A;  3P30 A;  3QNE A;  3G6E V;  5IY5 C;  2QTO A;  1K5Q A;  4PA6 A;  5B1A B;  1FXK A;  4UXN A;  1PL0 A;  1R6K A;  4WFE A;  2IJJ A;  4UV9 A;  1K97 A;  1OZ0 A;  3ABL C;  3RBZ A;  4XBF A;  1B6Q A;  1GKF A;  4QNH B;  2IU3 A;  2DW4 A;  3ZRX A;  3TK1 A;  3CD6 V;  4MT8 A;  1OCC B;  1DLB A;  2ATK C;  2KB1 A;  3JYC A;  3CCS V;  1QVF U;  1MOF A;  3OUS A;  4UUJ C;  1Q81 W;  1JCH A;  3OMN B;  2ZXW B;  3MHS C;  4RAI A;  1F4M A;  3E8F A;  1SRY A;  1P7B A;  4PEL A;  1NJI W;  1L1F A;  2A79 B;  3AG1 B;  4FPP A;  2JEX A;  3CC2 V;  1VQ9 V;  3CCV V;  1R73 A;  5L3C A;  3F7V C;  3F7Y C;  4GT1 A;  5L3F A;  2Y48 A;  3G71 V;  2Q68 A;  3AG4 C;  3TCU A;  3ASO B;  1ROP A;  1E1R G;  1FFT B;  2EIN C;  3STL C;  2WLJ A;  3IGA C;  1JJ2 U;  3RVZ A;  1JOY A;  1HWY A;  5B3S C;  3OR6 C;  1K9M W;  4KUM A;  4MTO A;  3W7T A;  3OUF A;  1AJQ A;  1OHH G;  3K0G A;  1RPR A;  4P9P A;  2EIL C;  2C2A A;  1M57 B;  2LP7 A;  3JD4 A;  5EBL C;  3EHB B;  5DM6 V;  2QA4 V;  4Q20 A;  3H01 A;  1K7D A;  3LUT B;  1JVM A;  1YJW V;  5IYC O;  4MVU A;  1NR1 A;  3ZCC A;  2WWW A;  3SPH A;  4LBE C;  1RM1 B;  3SYC A;  1NH2 B;  3E89 A;  3ETE A;  3ASN B;  3JD2 A;  2WAM A;  2H8P C;  3ZMT A;  1M56 C;  4Z1M G;  2XAJ A;  1GK9 A;  4JTA B;  5EC1 C;  4BAY A;  3CCL V;  1FXK C;  5IYD O;  4LC1 A;  3E86 A;  2QE7 G;  2OCC B;  2YSU B;  4JAV A;  1EZJ A;  4U7N A;  3SYP A;  4XDK A;  4H37 A;  1N8R W;  1NBM G;  3AG2 C;  3GB7 C;  1QCE A;  1VQM V;  1KC8 W;  4GCZ A;  1J95 A;  2X6B A;  1ARO P;  3ABT A;  2DYS C;  2YEV B;  3OEH G;  1WLE A;  1Q7Y W;  1VQ5 V;  5BZB A;  3R65 A;  2HKO A;  5HFM A;  4P30 A;  2P7T C;  3DGE A;  2H94 A;  1VQO V;  3ZMU A;  5LGT A;  2EIM C;  3K9A A;  3I55 V;  1JX9 A;  4R7C A;  2PI5 A;  1S77 D;  3KG2 A;  2B1G A;  5CBG A;  1M90 W;  2JIZ G;  2EZO A;  1V54 C;  2WLN A;  1Q82 W;  4YXW G;  2IJI A;  2EIJ C;  4MTX A;  1YIT V;  2HLD G;  1K3E A;  2JDI G;  5IY5 B;  4R6Z A;  1PNK A;  1YJN V;  1MG1 A;  3CCR V;  1S76 D;  3FB8 C;  3T4D A;  2MK3 A;  1H38 A;  1S0V A;  1QR9 A;  3FYI B;  2X6A A;  4ZBM A;  2GSM B;  3ABL B;  3OW2 U;  3QO7 A;  4J9Z B;  1KEC A;  1QLE C;  4I5S A;  3QO8 A;  1KD1 W;  2AHY A;  3CYO A;  3WG7 B;  5LBQ A;  1GMG A;  3IFX A;  2LFS A;  1GM9 A;  2WLL A;  3ZJZ A;  2Q69 A;  3W7W A;  2IU0 A;  1MAB G;  1QLN A;  2WPD G;  5EK0 A;  3LDE A;  1XL6 A;  4MVR A;  3JCZ A;  3CCE V;  4I9W A;  3ZRW B;  1JQ0 A;  3ABM C;  2QEX V;  2EBO A;  1SES A;  1DF5 A;  1VQ8 V;  3CC4 V;  3OEE G;  4TWK A;  4G27 B;  1DF4 A;  2XAS A;  2DQ0 A;  1YTF B;  3AG4 B;  1SZT A;  3VBB A;  2EIN B;  3OE7 G;  4CBC A;  1R3L C;  2AHZ A;  2V7Q G;  4JTD B;  4MSW C;  5B3S B;  1F4N A;  4RUE A;  3RW0 A;  3SPC A;  4PA3 A;  1BHB A;  1IXM A;  1ENV A;  1M9N A;  4MW3 A;  3CC7 V;  2XAH A;  1AI5 A;  1COW G;  1OCZ B;  3SYA A;  4U7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...