1Y76B

Solution structure of patj/pals1 l27 domain complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
AVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords protein associated to tight junctions
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76B00
3B40A 1Y74B 1Y74A 1Y76A 1ZL8B 1RSOB 1ZL8A 1VF6C 1Y76B 1VF6A
chains in the Genus database with same CATH superfamily
4DV0B 3QG5A 1SS3A 1JPXA 1NU1H 1XOUA 1YCIA 1SA0B 1V9PA 1ZTEA 3GVMA 3WB1A 2NR5A 2LFSA 4MS2A 3QVNA 2FMLA 1E79G 1BE3H 3SPGA 2LW7A 4NTXA 1M56C 2BCCH 3N2KB 4B3SO 1RM1B 2EULA 4X89A 5KHHA 3RYHA 1A32A 1IBKB 3P32A 4O2AA 3WB0A 2IU3A 4HNAA 3K0GA 3OW2U 4MVQA 5JH7A 1R3JC 4ZKIA 2KB1A 2K1EA 5JCOA 1TUBA 4FFBB 5LP6A 1NR1A 1FXHA 4MVSA 4BIZA 1Y66A 4X65B 4UV8A 3RWRD 1YITV 4D7TA 5FNVB 4N23A 4F4LA 4OX9B 4IL6Z 3JASA 1VEWA 4ZOLB 3RFRA 2LP7A 4DR6O 2HKOA 4LF9O 4JAAA 1P7BA 1P84F 4DRXB 4FIPC 5KHGA 2QWOB 1N0NA 4FM1A 4DV7O 4LF5B 4DV2O 1SERA 4MW8A 3HKBA 3OUSA 3E8HA 1JFFB 1F7YA 2OCHA 3ETEA 3ML0A 3WB2A 3F7YC 1XNQO 1IDSA 3ZHVA 2YUAA 5DN6G 4PDMA 1TVKA 3N27A 1SC5B 3W7WA 1GMGA 1WJZA 1ZWIC 4JYAB 3JD1A 4FZ0A 3D3QA 2UU9O 1I0HA 3ABLB 1THZA 2PTMA 3B8NA 5EYPA 3L74H 1YF2A 4ZI7A 2EINC 4I50B 4ZHQA 1BMFG 5EIBD 2PF4E 2GBOA 3DC5A 3M8AA 3LSUA 3H1HH 2A79B 2ETNA 4FFKA 1Q8IA 2W6IG 1FJGO 2OCCB 2WLIB 5L3FA 3G6EV 4XBFA 1SQQH 1VF6A 4NR1A 3ZHQA 2A0LA 4OPAA 4WF9V 3CD6V 3HB3B 5GTHZ 1UFIA 5CBHA 1SZTA 1W2BU 3QTCA 1Q82W 4UB8Z 2AZ0A 4W4KA 1VQNV 3HKDA 4WFAV 2UUBB 1KUQA 1T5EA 2ITDC 2C2AA 1M57C 2ZE8A 4J42A 3ZX6A 4K35A 4RUEA 1HNXB 2YC0A 2HJFC 4PA4A 1M90W 3ZN0A 5GTIZ 3IFXA 4DR2O 2E5LO 4GT1A 2Q0AA 3JAWB 3A0HZ 3DXRB 1AR1B 2VQEB 3IC9A 5J2TA 3JARA 2B1GA 3JSLA 5LGTA 3CRAA 1ENVA 1F23A 2W6JG 3R65A 1E1QG 2ITCC 3BABA 3AG4C 3JATB 5BR8O 3HKCB 5IYZB 4GKKB 2V4DA 4TUYB 4JI7B 1K33A 2L6LA 2ZQMA 4MVOA 3E86A 3N2KA 1NVPB 1ZLZA 2DYRB 3G71V 2JRIA 1U97A 3W7UA 1AILA 2CTRA 3LDEA 5B1NA 3OM3B 1VQ5V 2WLNA 4IIJB 4PDVA 3SYOA 3LNNA 1GM7A 3ASNB 3OMNB 3CCMV 4KL1A 3M7MX 3U0ZA 4D7SA 2JGDB 1FYJA 3H1JH 2PI5A 4I9QA 2F1MA 1IZ3A 3ZMSA 5FNVA 4EFBA 4ZOLA 4DUYB 3P3PA 2WA3A 2XASA 3E22B 5L3GA 4DRXA 2EJRA 3CYOA 2ZKOA 5LYJB 1BCCH 4ZIBA 5LMUB 4NXNB 1DGSA 2KQXA 4J7JA 1JFFA 2E3CA 4NKGB 5LL6Y 5LGUA 3AG3C 1W59A 1VQ4V 2EIJB 2RNBA 1NTMH 3JCZA 4H33A 2DMXA 1WB8A 2ADQB 4TQFA 2DQ0A 1KQSU 4U7NA 2ZDIA 1XBLA 1GN3A 4J11A 2XOKG 4DV6B 4HZ3A 1NH2D 1WP8A 3CMEV 4JI1B 2QGNA 1WPXA 4CC6A 1F51A 2Z3YA 1IBMO 1VP7A 2EBOA 1GN4A 1B6QA 3GB7C 4I50A 2RCVA 4LFAB 1O9GA 3OUFA 1I94B 1ZUQA 1VMGA 2Y0PA 2KKWA 3OMAB 5GONB 1SRYA 4B7KA 4FLZA 2UXCB 2WPDG 1JJ2U 1Y67A 2WLIA 1D2DA 1DLBA 5B3SB 3RW0A 1VQKV 1JOYA 1RP3B 2Y69B 2QKSA 2BSKB 3UT5A 2XAGA 2RN9A 1XI1A 2EZPA 1PP9H 2CTPA 2CH7B 2AHYA 3AEIA 4FLXA 2F4VB 3OD4A 3JALB 3JD3A 4PA7A 4LC1A 4PA6A 5IWAO 4LF4B 1JR9A 3IJ4A 2V7QG 2AHZA 1JA8A 3T1HO 1BHAA 3RN4A 1HR0B 4UXNA 2X6CA 4JI4O 1AI4A 1U96A 3G67A 3CS5A 4X88A 2GHYA 3JAWA 5KHKA 3DXRA 4JTAB 4DW0A 3JAMN 4OGQB 1NQTA 1OCRC 1K97A 4J7KA 4RQEA 4JASA 4ASUG 3E89A 3K59A 3ZRWA 3VBBA 3K9AA 3TXSA 3F5WC 4JF3A 1R3LC 3B77A 5IY5C 2ADPA 4UVCA 1L1FA 5DM6V 3I56V 3JATA 1G6UA 1M4UA 3VQXA 2F66C 3X2QB 5KAFZ 1YTFB 3HKCA 1NVPD 1PM9A 5IYZA 1EZVH 2DWDC 4TUYA 5KLVH 2EIKC 3BEHA 2QM4A 4P2ZA 2A3QA 1GH6A 4CH5A 5KA5A 4JV5B 4GX5A 4PI0A 4DV5O 4UCOA 2L35A 1HNZB 5EZYB 2Z0AA 4YJ2B 2QR4A 4GUNA 3FAVB 2WLLB 3K5MA 3OMIB 3S3XA 4EKWA 1GM8A 2IM9A 4DV1B 2YIAA 4LNUB 1BS3A 1CXZB 1KP2A 3BFRA 3D8CA 1NJIW 4DR1O 3ZBHA 2JGDA 4QIWF 1KKCA 2R72A 5H6QA 3MAQA 2E74B 3SJBC 4R6ZA 4X66O 3SYAA 4DW1A 4LH7A 1XHXA 2CGNA 2P06A 3ABMC 5B1OA 1MNGA 2XT9A 3E22A 4CH4A 1PV0A 3NR7A 5LYJA 3CE2A 3FKSG 4YY3B 3BA8A 2V1DA 4LF7B 2B1IA 1GN6A 3SPJA 4K8XA 1GM9A 1SETA 3H9VA 1NBMG 2IBZH 1M56B 1Q86W 5KA6A 2EIMC 3A2FA 2O57A 3ZS8C 1COWG 4LR3A 3APOA 4F6EA 4KHPB 2DN9A 4LFBB 2QJ1A 5IYBO 3W7TA 1Q3EA 4IGGA 1JCHA 3FB8C 4MVMA 1XILA 5L3CA 1L0NH 3FYIB 4NTYA 3SJCC 1S0VA 3E2EA 3T4ZA 3B8MA 2Y48A 1FS0G 2CUGA 4YJ3B 4PD4F 5GONA 3CWBH 4O4JB 1MSDA 2HG5C 2UUAO 1AJQA 4UCTA 4IT5A 5LMNB 2ZXWC 4U3JB 2Q73A 5B1BC 5J9PC 2BTOA 1K7DA 1P4RA 3UQ8A 1NKDA 4DV4O 1M9NA 5IJ9B 1EFRG 1XMOB 1YSCA 2KG7B 3FB7C 2BSKA 2QWRB 1PNLA 2D3OW 4YIOA 1LUWA 3BRCA 1J5EB 5EK0A 1KP3A 1WNSA 2YIBD 4P30A 1NI8A 1VARA 2OTLV 3JALA 4XDKA 3I55V 2YIBA 4JPRA 2JVDA 3A0RA 1EN5A 2YEVB 3U10A 2VWKA 4G28B 4G2KA 4B3RO 3MHHC 4PJ0Z 2B9ZA 2EINB 1FD9A 2ARHA 1SQFA 4DR7O 1CEZA 4IHJB 2QM8A 2JEXA 3ZHRA 1N8RW 3C90A 1H2GA 3UKMA 3OTOB 3AK2A 1N33B 1EN4A 1V55C 1N34B 3EHBB 3ASOB 4CC5A 4GKJB 1EBOA 1IBLO 4B08A 1PNKA 2IW5A 1SQBH 4P9OA 4AQYB 4J41A 1H2SB 1H2NA 4MVUA 5KUKA 2R9RB 4ICGA 5K1XA 1YTFD 1IVSA 1Y76A 3A8TA 1AVMA 1IXMA 2H94A 3UO3A 3FB6C 1E1RG 4JI5B 1MG1A 4A5UB 1KECA 2ODMA 3ZRSA 1FFTB 5CA0B 1QQCA 4K3AA 4X64B 4DR5O 2GTSA 4Z1MG 5EZYA 2HJDA 4XDJA 5EBLC 2QDOA 2UXBO 2Y4UA 4YJ2A 1M57B 1LNQA 2QTSA 4CBCA 3CCQV 3FAVA 1QNMA 2WLLA 3TCUA 5EIBC 4I55B 3ETQA 5B5EZ 2X6BA 5LXTB 3ZMZA 4BIOA 1BT8A 4LNUA 4B3MO 1PNMA 1XREA 2HHHO 2DJVA 2DE0X 4UB6Z 2D2CB 2ZR2A 1DF5A 5IT9N 4H37A 1QHTA 2F23A 4JI2O 3TK1A 4E2LA 5IJ0B 3JAKB 2QWNB 4ZBMA 2YS8A 2FYUH 3HR0A 4BW5A 1Q43A 3WG7C 1YJ9V 3LSSA 2VQFB 1VQLV 5LHHA 4JI6B 2CAZC 3TJTA 3AG4B 2LGQA 1KBHA 1K92A 5A9GA 2P6JA 3DC6A 4GX2A 3OR7C 3J80N 1JX9A 1FPOA 2YDEA 2DQ3A 4DUZB 2WWWA 4KUMA 4TWKA 1MOFA 3FB5C 1B04A 1GO3F 1GKFA 4NB5A 1VIBA 2AGAA 4FPPA 1KMIZ 3E8GA 2LQTA 2HEPA 2G38A 1W0JG 2Q5ZA 4R50A 2JJ1G 3SPHA 1FXKC 1R6TA 4TOIA 2JDIG 3CJHB 2RQ6A 3ZHSA 3BY6A 4EFEA 3L70H 4X1KA 2P4KA 2OTJV 1V54C 4YJ3A 4F6RB 2OIGA 4I7ZB 4O4JA 1FXVA 1N36O 5JJEB 4U3JA 2Q8VA 1SQVH 3ICXA 3ZMTA 2ZR3A 5IYCO 3HKEB 1F4NA 4O4LA 1YIJV 1S3JA 1RPRA 5BY1A 3AG3B 4YIPA 3ZHUA 2Q4PA 2FTKA 4E4EA 2BTQB 3B2EE 2OYQA 4TV9B 4Q6GA 4K0KO 3ETDA 3MD0A 1N0JA 2N05A 4BWAA 3JCUZ 4IYHA 4DXWA 4DR6B 4JI1O 4LF9B 3JYCA 2JK5C 2XUMA 1KYOF 4DV7B 2B5UA 4DV2B 2QM7A 3F5TA 4IHJA 2Q9LA 4CS4A 1SA0A 4DR3O 1WA8B 1WP7A 1AP5A 1FAFA 4J80A 5KUMA 1XNQB 1IURA 3ABTA 1H2LA 2CDYA 3CC4V 1MA1A 4GX0A 3LNMB 4CS3A 4TQDA 3K5OA 2FKXA 2UU9B 3SR2C 3E8FA 3E8BA 5KX5B 3ZN1A 4JI0O 3AG7A 5ITZB 5E79Z 3N2GB 1YEWA 4NXMO 3RYIB 3SJQC 2YXHA 4UUJC 4FFBA 2QTOA 3SDLA 5CA0A 3J81N 1R3IC 1Q6UA 3CPWU 3CCSV 4QPJA 3T1CA 3VQYA 1Y4MA 5EBWC 3RYFB 2BOBC 4I0XB 1FJGB 2N04A 5EC2C 2A7WA 2VS0A 2ZE6A 4I55A 1QBZA 2F95B 3D36C 1N32O 5LXTA 5EBMC 5CMUA 1XL6A 2OT5A 4DR4O 4B3TO 4C7UA 1AR5A 3AG1C 5JJNB 1LR1A 1NZ6A 5LHGA 3ABKC 5IJ0A 4YXWG 1S72V 2UXDO 2ZINA 4MTFA 5LA6B 5IY5B 2XAJA 1HWYA 2UUCO 4LF8O 3EXAA 4JYYA 2P5OA 3B4SA 2OIEA 1AROP 1HP8A 4FJCC 1KC8W 1Z2GA 2EIKB 4DR2B 2E5LB 3KCYA 4QJFB 2DYSC 4BW9A 1YXBA 2WLJA 3F7VC 4J9YB 1S5JA 2QE7G 4CZZA 5C8YB 1ZL8B 1Z5WA 1M93A 2XNDG 2DWEC 1JMKC 3SPIA 3OEEG 2GUZB 2RMKB 3G80A 4FLVA 5C93A 2HP8A 4WFGA 4X20B 1N4CA 2IJHA 3CJHA 1UJWB 1EZJA 2UXNA 2M6YA 1K5SA 2N74A 2AXTZ 1AJNA 4X62O 4WFEA 1O9HA 2QSAA 4F6RA 5H2FZ 3ABMB 4N21A 1YI2V 2RJZA 1X59A 3IGAC 4WCEV 5JVDB 4UVAA 1BHBA 1Y74B 3KCXA 3JD2A 2Q0OC 3CRQA 1WAZA 1SQPH 3HKEA 3B40A 4WBNB 5D5QA 1VQ7V 1BL8A 5CA3A 3T1YO 4LF6O 5CBFA 2BTQA 1AI5A 2EIMB 2ZIOA 1ORQC 4JAUA 1Q5OA 1TA8A 5IDJA 4KP4A 4TV9A 1B06A 4PDRA 5CN0A 2YXYA 4LFCO 2Y0IA 4DV3O 1H2KA 2BOCC 4GX1A 4DK0A 2Q69A 4JI3B 3ZRXA 5BZBA 2R9IA 4PELA 3DSQA 1K73W 4JI8O 5CA1B 1WA8A 1MABG 3OR6C 3K57A 3RBZA 3GWOA 5K1PA 2LGWA 2ZXWB 4RUFA 3LSQA 2JGUA 5B1BB 3CCJV 1L0LH 3G4SV 2IH3C 3KG2A 3UCSC 3RYHB 3B09A 1CPYA 1W0KG 2ZM6O 4YHHO 5EC1C 1UPGA 4HNAB 5KX5A 1IBMB 4JYCA 5ITZA 4IIJA 3N2GA 3H1KH 1ZAUA 3CMAV 5B1AC 1NS1A 3ABUA 4KFMA 1XNRO 4LWSB 4D6TH 1Q81W 3G6BA 4Z2WA 3K5LA 3CCUV 2QWPB 3CX5F 4QE7A 2X6AA 3JASB 3RYFA 3THOA 2W0FC 4I0XA 3ZMUA 1XMQO 1Q6IA 3QO7A 2FL4A 3HPLC 1EM1A 2NNUA 1BSMA 4UFZA 1FFXB 1YDXA 4DV0O 4FVMA 1GN2A 2YICA 1H8HG 2F93B 3JD0A 2Q68A 1VF7A 1V55B 2QEXV 1KU9A 3MDSA 3EFFK 2MK3A 1OCZC 3K03A 3TETA 2WAMA 5LA6A 4UCRA 5IWAB 5F2VO 4B7EA 1SKVA 1S76D 3TXQA 4KXRA 3T1HB 1IBKO 4JI4B 3K06A 2GDSA 2PUSA 5EYPB 2YSUB 1GAXA 5LGNA 3O65A 2Q67A 4X65O 1P7GA 2QWQB 5C8YA 1ZL8A 3JD4A 2YI8A 4JAVA 1S5LZ 2Q7HA 4FK5C 4OX9O 1GRJA 1M5IA 1OCOC 4RQFA 3CSXA 3WFVA 4WFHA 4X20A 4BAYA 4LF5O 2P22C 4H44B 2HVKC 3GWKC 1WPBA 5CB4B 3ZEDA 1QCEA 2CTQA 4FZ1A 5HFLA 1DF4A 4OPHA 4HYOA 5LP6C 1K3EA 1LUVA 2CH7A 5JCOC 4DV5B 1RPOA 3WG7B 1G8MA 3CC2V 3OGIB 5JVDA 4QNHB 1Y74A 3CCVV 3OE7G 3C3TA 3CEIA 5CBGA 5JJJB 1PD3A 1ROPA 4JI6O 4JYAO 1NTZH 2GSMB 1TAEA 4ABMA 1I08A 3A0BZ 3VQVA 4DR1B 2XAHA 2EZOA 1PPJH 1QLEC 1F4MA 2NN4A 3CB2A 2W0XA 4H0LB 1HNWB 3K08A 2IJKA 1K8AW 3M99B 2ZCEA 3P30A 1FXKB 1OJHA 1VF5B 4MTXA 3LDDA 4UV9A 5JWPA 3E35A 5DECA 1IXBA 5CA1A 5J2UB 1V54B 1SQXH 4MT8A 2P90A 4BR6A 5L3DA 1OCCC 5LBQA 2X0LA 1K9MW 2HR3A 1K34A 5FL7G 3ZHTA 1PKXA 2H8PC 2UUBO 1D5NA 3IAYA 1K4DC 1JQ0A 3VOUA 1HNXO 1OZ0A 1P49A 4O2BB 2LJ2A 1BQ0A 2GTAA 5KHJA 1VF6C 2JS5A 4X1IB 1IX9A 1SF9A 5TISZ 3C3SA 1YHQV 3L75H 2VQEO 4LWSA 1SQGA 5L3BA 3SYPA 2UUAB 3BCCH 3STLC 2YI9A 1XDCA 1FFXA 5BXZA 3AG2C 4U3FH 4UVBA 3CCRV 4DV4B 2EILC 1JVMA 4K8ZA 1QR9A 1KD1W 3ZCCA 4GKKO 3O9OA 2PZSA 2PYLA 4JI7O 2CE4A 4TT3G 2LO1A 3KKYA 4FMTA 3L9DA 2PY5A 3T2MA 2ZE7A 1NH2B 3E83A 2PYJA 3FX7A 4B3RB 1I5YA 4DR7B 2HFEC 1MZFA 4FLYA 5AG2A 3H1IH 1Q90D 3SGIA 3ASOC 1IBLB 4DUYO 4LH6A 4B3SB 3L71H 1YJWV 1RSOB 1RM1C 5FLXN 3AG1B 4TV8B 5LMUO 3RYCB 1R73A 4NXNO 4RWUA 5CB4A 4JGSA 4UCVA 1QU7A 4CH3A 1VQ6V 5IJ9A 1ZSPA 3UT5B 2KG7A 2PGGA 1RFYA 1BZKA 2WSSG 3ABKB 4UCUA 1OHHG 2Q7GA 3LDCA 4X9QA 4DR5B 4JYBA 4GYCB 4MTGA 1FKAO 2UXBB 4DV6O 1AB3A 1HDJA 3P3NA 4AI8A 4EEQA 3H1LH 4IYIA 1M1KW 4FLWA 1URFA 2YEVA 4JZGA 4B3MB 5FPRA 4DO2A 2DYSB 1Q6HA 2HHHB 2KSDA 4LFAO 3OEHG 1VQPV 1I94O 4CS2A 4JI2B 3CCEV 3S3WA 1QLNA 4Z1VA 4WFBV 3ZRWB 2UXCO 4FLTA 2HLDG 1US6A 1FXKA 1YZBA 4PA9A 2ZDIC 1XHZA 4CH6A 4I4TB 3AK1A 5BMVB 2QA4V 3D3IA 1AI7A 5J2UA 1GK9A 4AHCA 1NT2B 2ZNIA 2Q6AA 3ABLC 4P9PA 5LOVB 4XDLA 5H6RA 3VQWA 4J9ZB 3W7XA 1MSWD 5IYDO 4AILC 2F4VO 4LF4O 3J7AU 4X8AA 3ETGA 1QVGU 4HAMA 1YJNV 1HR0O 4O2BA 2OCCC 3R66A 3K5NA 4EB6B 3RVZA 4X1IA 3BA9A 2P67A 1NTKH 1VQMV 3BVOA 2OWOA 1OCRB 3MHSC 1H2MA 3K79A 3FFQA 3SYCA 2DW4A 2ZNJA 3ZRVA 2WA4A 3AK3A 3CC7V 3JAKA 4FM0A 1GTOA 4NYKA 1N36B 3UO2A 1K5QA 5GW7A 1R1BA 4JI3O 3K58A 2QKAA 4PA3A 5JQGB 1J95A 3QO5A 1AP6A 2M7WA 2CGOA 3Q4HB 2R9AA 4O4IB 5KMGB 4JV5O 4LP8A 2UXXA 3RGBA 4K0KB 4PDLA 1HNZO 3BPZA 3OFNG 3RVYA 1G1XB 5H5NA 4GZRB 5FPOA 2H3OA 2ATKC 4JTDB 2IU0A 1H8EG 3FYEB 4DV1O 1I5XA 5B1AB 5KHIA 2FB5A 4JZ2A 3K04A 1WLEA 3CCLV 4DR3B 1AR4A 1G4YB 5B66Z 4X1YB 3BHPA 4O4HB 2YIDA 5BR8B 4LCUC 5H9CA 2P7TC 1DTOA 4I5SA 1VQOV 2LFRA 1XQ8A 3CHXA 3IC7A 3SYQA 3D36A 2NLJC 3RT3C 2CTWA 4MVRA 1RSOA 4JTCB 3WU2Z 2DYRC 5KAIZ 4TV8A 3DGEA 1KB9F 2X7RB 1EN6A 4YY3O 3RYCA 3TGUH 4LF7O 1MMMA 1TGOA 1Q7YW 4DYLA 2JIZG 4JI0B 2K9PA 2E76B 1YVWA 2XTAA 1ZX3A 4R7CA 4NXMB 4NTWA 1S77D 2WLMA 1OCZB 1D5AA 4QPKA 1XEQA 2Z5UA 2P4VA 3ASNC 3SPCA 4FLUA 2ZD9A 1TUEB 1H38A 4H13B 1R6NA 4RO2A 3CRMA 3ZMVA 3QO8A 4KHPO 1N32B 2E75B 4LFBO 2HVJC 2A9HA 2AW9A 4RAIA 2JS3A 4DR4B 4B3TB 3NXSA 2CK3G 2IJIA 4PHZA 1HW7A 2IJJA 1AJPA 4WFFA 3K0DA 4PV1B 2UXDB 1OCOB 2EIJC 4BIUA 2EX3A 5LMNO 4MVZA 1Y6XA 1K4CC 4I4TA 2WLKA 2GV9A 3U11A 2UUCB 4LF8B 5BMVA 2JJ2G 3PJSK 3OGCC 1Y76B 3W7SA 3H01A 3K3WA 4O2AB 1I7FA 3OT7A 3CRRA 5L3EA 1XMOO 2AZ2A 5LOVA 1DK1A 5JH7B 3ZJZA 1VQ9V 3RYIA 1TUBB 5LP6B 1J5EO 1OV9A 3CXCU 1S5HC 1XUQA 3EVKA 3I5DA 1R6KA 1SZXA 1B3QA 3APQA 4L8JA 1NR7A 2IH1C 3FD9A 4I9WA 4W4LA 4DK1A 4QGPA 4EB6A 5HFMA 5B3SC 3HKBB 2VWJA 1BGYH 1QLEB 1QVFU 4X62B 4U7OA 2Y69C 3LUTB 3DTUB 3OTOO 2QKCA 1N33O 1HNWO 1N34O 4GKJO 1KKDA 1TVKB 2ZIMA 3KZIZ 4AQYO 2EJ7A 1BQZA 2XAFA 3L73H 5JQGA 3PN1A 4MSWC 3T1YB 4LF6B 1WN7A 2Q7EA 3Q4HA 4JI5O 1CP9A 1OCCB 4O4IA 3L72H 2F43G 4HBNA 3OTFA 3QNEA 4MW3A 2BE3A 4ZI7B 4ZHQB 5KMGA 4MTOA 4X64O 4Q20A 4J7ZA 2WLHA 1MZEA 4LFCB 5LHIA 4DV3B 1PL4A 2ILMA 2DOSA 2GUZA 1XL4A 3T4DA 3BAAA 4L87A 1L8DA 3CXHF 5E1AC 4JI8B 3UM7A 2Y4TA 4X1YA 4GLXA 4O4HA 4X1KB 4R8CA 4OXSA 1AI6A 3X2QC 4J10A 3ZIAG 3CRCA 3K9SA 1JJOA 4PI2A 3STZC 5DEDA 3HKDB 5D5PA 3AG2B 2XAQA 3CP1A 2JEUA 2YXLA 4TSFG 4G27B 2ZM6B 4NVPA 4GCZA 4YHHB 4O4LB 2VQFO 2ZT9B 2VRZA 2EILB 2MW2B 1R3KC 4QE9A 4WBNA 1X4TA 5A2QN 3SJAC 2R70A 2XHBA 1VQ8V 4FM2A 3OAAG 2PI4A 1PL0A 1XNRB 1QR8A 4UCSA 4DUZO 2A06H 1WB7A 5J2TB 3JARB 3JSNA 4LBEC 1Z5VA 2RDCA 2ZE5A 4X66B 1SESA 1XMQB 3QF7A 5IE9A 2LW1A
chains in the Genus database with same CATH topology
3B40A 1Y74B 1Y74A 1Y76A 1ZL8B 1RSOB 1ZL8A 1VF6C 1Y76B 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B40 A;  1Y74 B;  1Y74 A;  1Y76 A;  1ZL8 B;  1RSO B;  1ZL8 A;  1VF6 C;  1Y76 B;  1VF6 A; 
#chains in the Genus database with same CATH topology
 4DV0 B;  3QG5 A;  1SS3 A;  1JPX A;  1NU1 H;  1XOU A;  1YCI A;  1SA0 B;  1V9P A;  1ZTE A;  3GVM A;  3WB1 A;  2NR5 A;  2LFS A;  4MS2 A;  3QVN A;  2FML A;  1E79 G;  1BE3 H;  3SPG A;  2LW7 A;  4NTX A;  1M56 C;  2BCC H;  3N2K B;  4B3S O;  1RM1 B;  2EUL A;  4X89 A;  5KHH A;  3RYH A;  1A32 A;  1IBK B;  3P32 A;  4O2A A;  3WB0 A;  2IU3 A;  4HNA A;  3K0G A;  3OW2 U;  4MVQ A;  5JH7 A;  1R3J C;  4ZKI A;  2KB1 A;  2K1E A;  5JCO A;  1TUB A;  4FFB B;  5LP6 A;  1NR1 A;  1FXH A;  4MVS A;  4BIZ A;  1Y66 A;  4X65 B;  4UV8 A;  3RWR D;  1YIT V;  4D7T A;  5FNV B;  4N23 A;  4F4L A;  4OX9 B;  4IL6 Z;  3JAS A;  1VEW A;  4ZOL B;  3RFR A;  2LP7 A;  4DR6 O;  2HKO A;  4LF9 O;  4JAA A;  1P7B A;  1P84 F;  4DRX B;  4FIP C;  5KHG A;  2QWO B;  1N0N A;  4FM1 A;  4DV7 O;  4LF5 B;  4DV2 O;  1SER A;  4MW8 A;  3HKB A;  3OUS A;  3E8H A;  1JFF B;  1F7Y A;  2OCH A;  3ETE A;  3ML0 A;  3WB2 A;  3F7Y C;  1XNQ O;  1IDS A;  3ZHV A;  2YUA A;  5DN6 G;  4PDM A;  1TVK A;  3N27 A;  1SC5 B;  3W7W A;  1GMG A;  1WJZ A;  1ZWI C;  4JYA B;  3JD1 A;  4FZ0 A;  3D3Q A;  2UU9 O;  1I0H A;  3ABL B;  1THZ A;  2PTM A;  3B8N A;  5EYP A;  3L74 H;  1YF2 A;  4ZI7 A;  2EIN C;  4I50 B;  4ZHQ A;  1BMF G;  5EIB D;  2PF4 E;  2GBO A;  3DC5 A;  3M8A A;  3LSU A;  3H1H H;  2A79 B;  2ETN A;  4FFK A;  1Q8I A;  2W6I G;  1FJG O;  2OCC B;  2WLI B;  5L3F A;  3G6E V;  4XBF A;  1SQQ H;  1VF6 A;  4NR1 A;  3ZHQ A;  2A0L A;  4OPA A;  4WF9 V;  3CD6 V;  3HB3 B;  5GTH Z;  1UFI A;  5CBH A;  1SZT A;  1W2B U;  3QTC A;  1Q82 W;  4UB8 Z;  2AZ0 A;  4W4K A;  1VQN V;  3HKD A;  4WFA V;  2UUB B;  1KUQ A;  1T5E A;  2ITD C;  2C2A A;  1M57 C;  2ZE8 A;  4J42 A;  3ZX6 A;  4K35 A;  4RUE A;  1HNX B;  2YC0 A;  2HJF C;  4PA4 A;  1M90 W;  3ZN0 A;  5GTI Z;  3IFX A;  4DR2 O;  2E5L O;  4GT1 A;  2Q0A A;  3JAW B;  3A0H Z;  3DXR B;  1AR1 B;  2VQE B;  3IC9 A;  5J2T A;  3JAR A;  2B1G A;  3JSL A;  5LGT A;  3CRA A;  1ENV A;  1F23 A;  2W6J G;  3R65 A;  1E1Q G;  2ITC C;  3BAB A;  3AG4 C;  3JAT B;  5BR8 O;  3HKC B;  5IYZ B;  4GKK B;  2V4D A;  4TUY B;  4JI7 B;  1K33 A;  2L6L A;  2ZQM A;  4MVO A;  3E86 A;  3N2K A;  1NVP B;  1ZLZ A;  2DYR B;  3G71 V;  2JRI A;  1U97 A;  3W7U A;  1AIL A;  2CTR A;  3LDE A;  5B1N A;  3OM3 B;  1VQ5 V;  2WLN A;  4IIJ B;  4PDV A;  3SYO A;  3LNN A;  1GM7 A;  3ASN B;  3OMN B;  3CCM V;  4KL1 A;  3M7M X;  3U0Z A;  4D7S A;  2JGD B;  1FYJ A;  3H1J H;  2PI5 A;  4I9Q A;  2F1M A;  1IZ3 A;  3ZMS A;  5FNV A;  4EFB A;  4ZOL A;  4DUY B;  3P3P A;  2WA3 A;  2XAS A;  3E22 B;  5L3G A;  4DRX A;  2EJR A;  3CYO A;  2ZKO A;  5LYJ B;  1BCC H;  4ZIB A;  5LMU B;  4NXN B;  1DGS A;  2KQX A;  4J7J A;  1JFF A;  2E3C A;  4NKG B;  5LL6 Y;  5LGU A;  3AG3 C;  1W59 A;  1VQ4 V;  2EIJ B;  2RNB A;  1NTM H;  3JCZ A;  4H33 A;  2DMX A;  1WB8 A;  2ADQ B;  4TQF A;  2DQ0 A;  1KQS U;  4U7N A;  2ZDI A;  1XBL A;  1GN3 A;  4J11 A;  2XOK G;  4DV6 B;  4HZ3 A;  1NH2 D;  1WP8 A;  3CME V;  4JI1 B;  2QGN A;  1WPX A;  4CC6 A;  1F51 A;  2Z3Y A;  1IBM O;  1VP7 A;  2EBO A;  1GN4 A;  1B6Q A;  3GB7 C;  4I50 A;  2RCV A;  4LFA B;  1O9G A;  3OUF A;  1I94 B;  1ZUQ A;  1VMG A;  2Y0P A;  2KKW A;  3OMA B;  5GON B;  1SRY A;  4B7K A;  4FLZ A;  2UXC B;  2WPD G;  1JJ2 U;  1Y67 A;  2WLI A;  1D2D A;  1DLB A;  5B3S B;  3RW0 A;  1VQK V;  1JOY A;  1RP3 B;  2Y69 B;  2QKS A;  2BSK B;  3UT5 A;  2XAG A;  2RN9 A;  1XI1 A;  2EZP A;  1PP9 H;  2CTP A;  2CH7 B;  2AHY A;  3AEI A;  4FLX A;  2F4V B;  3OD4 A;  3JAL B;  3JD3 A;  4PA7 A;  4LC1 A;  4PA6 A;  5IWA O;  4LF4 B;  1JR9 A;  3IJ4 A;  2V7Q G;  2AHZ A;  1JA8 A;  3T1H O;  1BHA A;  3RN4 A;  1HR0 B;  4UXN A;  2X6C A;  4JI4 O;  1AI4 A;  1U96 A;  3G67 A;  3CS5 A;  4X88 A;  2GHY A;  3JAW A;  5KHK A;  3DXR A;  4JTA B;  4DW0 A;  3JAM N;  4OGQ B;  1NQT A;  1OCR C;  1K97 A;  4J7K A;  4RQE A;  4JAS A;  4ASU G;  3E89 A;  3K59 A;  3ZRW A;  3VBB A;  3K9A A;  3TXS A;  3F5W C;  4JF3 A;  1R3L C;  3B77 A;  5IY5 C;  2ADP A;  4UVC A;  1L1F A;  5DM6 V;  3I56 V;  3JAT A;  1G6U A;  1M4U A;  3VQX A;  2F66 C;  3X2Q B;  5KAF Z;  1YTF B;  3HKC A;  1NVP D;  1PM9 A;  5IYZ A;  1EZV H;  2DWD C;  4TUY A;  5KLV H;  2EIK C;  3BEH A;  2QM4 A;  4P2Z A;  2A3Q A;  1GH6 A;  4CH5 A;  5KA5 A;  4JV5 B;  4GX5 A;  4PI0 A;  4DV5 O;  4UCO A;  2L35 A;  1HNZ B;  5EZY B;  2Z0A A;  4YJ2 B;  2QR4 A;  4GUN A;  3FAV B;  2WLL B;  3K5M A;  3OMI B;  3S3X A;  4EKW A;  1GM8 A;  2IM9 A;  4DV1 B;  2YIA A;  4LNU B;  1BS3 A;  1CXZ B;  1KP2 A;  3BFR A;  3D8C A;  1NJI W;  4DR1 O;  3ZBH A;  2JGD A;  4QIW F;  1KKC A;  2R72 A;  5H6Q A;  3MAQ A;  2E74 B;  3SJB C;  4R6Z A;  4X66 O;  3SYA A;  4DW1 A;  4LH7 A;  1XHX A;  2CGN A;  2P06 A;  3ABM C;  5B1O A;  1MNG A;  2XT9 A;  3E22 A;  4CH4 A;  1PV0 A;  3NR7 A;  5LYJ A;  3CE2 A;  3FKS G;  4YY3 B;  3BA8 A;  2V1D A;  4LF7 B;  2B1I A;  1GN6 A;  3SPJ A;  4K8X A;  1GM9 A;  1SET A;  3H9V A;  1NBM G;  2IBZ H;  1M56 B;  1Q86 W;  5KA6 A;  2EIM C;  3A2F A;  2O57 A;  3ZS8 C;  1COW G;  4LR3 A;  3APO A;  4F6E A;  4KHP B;  2DN9 A;  4LFB B;  2QJ1 A;  5IYB O;  3W7T A;  1Q3E A;  4IGG A;  1JCH A;  3FB8 C;  4MVM A;  1XIL A;  5L3C A;  1L0N H;  3FYI B;  4NTY A;  3SJC C;  1S0V A;  3E2E A;  3T4Z A;  3B8M A;  2Y48 A;  1FS0 G;  2CUG A;  4YJ3 B;  4PD4 F;  5GON A;  3CWB H;  4O4J B;  1MSD A;  2HG5 C;  2UUA O;  1AJQ A;  4UCT A;  4IT5 A;  5LMN B;  2ZXW C;  4U3J B;  2Q73 A;  5B1B C;  5J9P C;  2BTO A;  1K7D A;  1P4R A;  3UQ8 A;  1NKD A;  4DV4 O;  1M9N A;  5IJ9 B;  1EFR G;  1XMO B;  1YSC A;  2KG7 B;  3FB7 C;  2BSK A;  2QWR B;  1PNL A;  2D3O W;  4YIO A;  1LUW A;  3BRC A;  1J5E B;  5EK0 A;  1KP3 A;  1WNS A;  2YIB D;  4P30 A;  1NI8 A;  1VAR A;  2OTL V;  3JAL A;  4XDK A;  3I55 V;  2YIB A;  4JPR A;  2JVD A;  3A0R A;  1EN5 A;  2YEV B;  3U10 A;  2VWK A;  4G28 B;  4G2K A;  4B3R O;  3MHH C;  4PJ0 Z;  2B9Z A;  2EIN B;  1FD9 A;  2ARH A;  1SQF A;  4DR7 O;  1CEZ A;  4IHJ B;  2QM8 A;  2JEX A;  3ZHR A;  1N8R W;  3C90 A;  1H2G A;  3UKM A;  3OTO B;  3AK2 A;  1N33 B;  1EN4 A;  1V55 C;  1N34 B;  3EHB B;  3ASO B;  4CC5 A;  4GKJ B;  1EBO A;  1IBL O;  4B08 A;  1PNK A;  2IW5 A;  1SQB H;  4P9O A;  4AQY B;  4J41 A;  1H2S B;  1H2N A;  4MVU A;  5KUK A;  2R9R B;  4ICG A;  5K1X A;  1YTF D;  1IVS A;  1Y76 A;  3A8T A;  1AVM A;  1IXM A;  2H94 A;  3UO3 A;  3FB6 C;  1E1R G;  4JI5 B;  1MG1 A;  4A5U B;  1KEC A;  2ODM A;  3ZRS A;  1FFT B;  5CA0 B;  1QQC A;  4K3A A;  4X64 B;  4DR5 O;  2GTS A;  4Z1M G;  5EZY A;  2HJD A;  4XDJ A;  5EBL C;  2QDO A;  2UXB O;  2Y4U A;  4YJ2 A;  1M57 B;  1LNQ A;  2QTS A;  4CBC A;  3CCQ V;  3FAV A;  1QNM A;  2WLL A;  3TCU A;  5EIB C;  4I55 B;  3ETQ A;  5B5E Z;  2X6B A;  5LXT B;  3ZMZ A;  4BIO A;  1BT8 A;  4LNU A;  4B3M O;  1PNM A;  1XRE A;  2HHH O;  2DJV A;  2DE0 X;  4UB6 Z;  2D2C B;  2ZR2 A;  1DF5 A;  5IT9 N;  4H37 A;  1QHT A;  2F23 A;  4JI2 O;  3TK1 A;  4E2L A;  5IJ0 B;  3JAK B;  2QWN B;  4ZBM A;  2YS8 A;  2FYU H;  3HR0 A;  4BW5 A;  1Q43 A;  3WG7 C;  1YJ9 V;  3LSS A;  2VQF B;  1VQL V;  5LHH A;  4JI6 B;  2CAZ C;  3TJT A;  3AG4 B;  2LGQ A;  1KBH A;  1K92 A;  5A9G A;  2P6J A;  3DC6 A;  4GX2 A;  3OR7 C;  3J80 N;  1JX9 A;  1FPO A;  2YDE A;  2DQ3 A;  4DUZ B;  2WWW A;  4KUM A;  4TWK A;  1MOF A;  3FB5 C;  1B04 A;  1GO3 F;  1GKF A;  4NB5 A;  1VIB A;  2AGA A;  4FPP A;  1KMI Z;  3E8G A;  2LQT A;  2HEP A;  2G38 A;  1W0J G;  2Q5Z A;  4R50 A;  2JJ1 G;  3SPH A;  1FXK C;  1R6T A;  4TOI A;  2JDI G;  3CJH B;  2RQ6 A;  3ZHS A;  3BY6 A;  4EFE A;  3L70 H;  4X1K A;  2P4K A;  2OTJ V;  1V54 C;  4YJ3 A;  4F6R B;  2OIG A;  4I7Z B;  4O4J A;  1FXV A;  1N36 O;  5JJE B;  4U3J A;  2Q8V A;  1SQV H;  3ICX A;  3ZMT A;  2ZR3 A;  5IYC O;  3HKE B;  1F4N A;  4O4L A;  1YIJ V;  1S3J A;  1RPR A;  5BY1 A;  3AG3 B;  4YIP A;  3ZHU A;  2Q4P A;  2FTK A;  4E4E A;  2BTQ B;  3B2E E;  2OYQ A;  4TV9 B;  4Q6G A;  4K0K O;  3ETD A;  3MD0 A;  1N0J A;  2N05 A;  4BWA A;  3JCU Z;  4IYH A;  4DXW A;  4DR6 B;  4JI1 O;  4LF9 B;  3JYC A;  2JK5 C;  2XUM A;  1KYO F;  4DV7 B;  2B5U A;  4DV2 B;  2QM7 A;  3F5T A;  4IHJ A;  2Q9L A;  4CS4 A;  1SA0 A;  4DR3 O;  1WA8 B;  1WP7 A;  1AP5 A;  1FAF A;  4J80 A;  5KUM A;  1XNQ B;  1IUR A;  3ABT A;  1H2L A;  2CDY A;  3CC4 V;  1MA1 A;  4GX0 A;  3LNM B;  4CS3 A;  4TQD A;  3K5O A;  2FKX A;  2UU9 B;  3SR2 C;  3E8F A;  3E8B A;  5KX5 B;  3ZN1 A;  4JI0 O;  3AG7 A;  5ITZ B;  5E79 Z;  3N2G B;  1YEW A;  4NXM O;  3RYI B;  3SJQ C;  2YXH A;  4UUJ C;  4FFB A;  2QTO A;  3SDL A;  5CA0 A;  3J81 N;  1R3I C;  1Q6U A;  3CPW U;  3CCS V;  4QPJ A;  3T1C A;  3VQY A;  1Y4M A;  5EBW C;  3RYF B;  2BOB C;  4I0X B;  1FJG B;  2N04 A;  5EC2 C;  2A7W A;  2VS0 A;  2ZE6 A;  4I55 A;  1QBZ A;  2F95 B;  3D36 C;  1N32 O;  5LXT A;  5EBM C;  5CMU A;  1XL6 A;  2OT5 A;  4DR4 O;  4B3T O;  4C7U A;  1AR5 A;  3AG1 C;  5JJN B;  1LR1 A;  1NZ6 A;  5LHG A;  3ABK C;  5IJ0 A;  4YXW G;  1S72 V;  2UXD O;  2ZIN A;  4MTF A;  5LA6 B;  5IY5 B;  2XAJ A;  1HWY A;  2UUC O;  4LF8 O;  3EXA A;  4JYY A;  2P5O A;  3B4S A;  2OIE A;  1ARO P;  1HP8 A;  4FJC C;  1KC8 W;  1Z2G A;  2EIK B;  4DR2 B;  2E5L B;  3KCY A;  4QJF B;  2DYS C;  4BW9 A;  1YXB A;  2WLJ A;  3F7V C;  4J9Y B;  1S5J A;  2QE7 G;  4CZZ A;  5C8Y B;  1ZL8 B;  1Z5W A;  1M93 A;  2XND G;  2DWE C;  1JMK C;  3SPI A;  3OEE G;  2GUZ B;  2RMK B;  3G80 A;  4FLV A;  5C93 A;  2HP8 A;  4WFG A;  4X20 B;  1N4C A;  2IJH A;  3CJH A;  1UJW B;  1EZJ A;  2UXN A;  2M6Y A;  1K5S A;  2N74 A;  2AXT Z;  1AJN A;  4X62 O;  4WFE A;  1O9H A;  2QSA A;  4F6R A;  5H2F Z;  3ABM B;  4N21 A;  1YI2 V;  2RJZ A;  1X59 A;  3IGA C;  4WCE V;  5JVD B;  4UVA A;  1BHB A;  1Y74 B;  3KCX A;  3JD2 A;  2Q0O C;  3CRQ A;  1WAZ A;  1SQP H;  3HKE A;  3B40 A;  4WBN B;  5D5Q A;  1VQ7 V;  1BL8 A;  5CA3 A;  3T1Y O;  4LF6 O;  5CBF A;  2BTQ A;  1AI5 A;  2EIM B;  2ZIO A;  1ORQ C;  4JAU A;  1Q5O A;  1TA8 A;  5IDJ A;  4KP4 A;  4TV9 A;  1B06 A;  4PDR A;  5CN0 A;  2YXY A;  4LFC O;  2Y0I A;  4DV3 O;  1H2K A;  2BOC C;  4GX1 A;  4DK0 A;  2Q69 A;  4JI3 B;  3ZRX A;  5BZB A;  2R9I A;  4PEL A;  3DSQ A;  1K73 W;  4JI8 O;  5CA1 B;  1WA8 A;  1MAB G;  3OR6 C;  3K57 A;  3RBZ A;  3GWO A;  5K1P A;  2LGW A;  2ZXW B;  4RUF A;  3LSQ A;  2JGU A;  5B1B B;  3CCJ V;  1L0L H;  3G4S V;  2IH3 C;  3KG2 A;  3UCS C;  3RYH B;  3B09 A;  1CPY A;  1W0K G;  2ZM6 O;  4YHH O;  5EC1 C;  1UPG A;  4HNA B;  5KX5 A;  1IBM B;  4JYC A;  5ITZ A;  4IIJ A;  3N2G A;  3H1K H;  1ZAU A;  3CMA V;  5B1A C;  1NS1 A;  3ABU A;  4KFM A;  1XNR O;  4LWS B;  4D6T H;  1Q81 W;  3G6B A;  4Z2W A;  3K5L A;  3CCU V;  2QWP B;  3CX5 F;  4QE7 A;  2X6A A;  3JAS B;  3RYF A;  3THO A;  2W0F C;  4I0X A;  3ZMU A;  1XMQ O;  1Q6I A;  3QO7 A;  2FL4 A;  3HPL C;  1EM1 A;  2NNU A;  1BSM A;  4UFZ A;  1FFX B;  1YDX A;  4DV0 O;  4FVM A;  1GN2 A;  2YIC A;  1H8H G;  2F93 B;  3JD0 A;  2Q68 A;  1VF7 A;  1V55 B;  2QEX V;  1KU9 A;  3MDS A;  3EFF K;  2MK3 A;  1OCZ C;  3K03 A;  3TET A;  2WAM A;  5LA6 A;  4UCR A;  5IWA B;  5F2V O;  4B7E A;  1SKV A;  1S76 D;  3TXQ A;  4KXR A;  3T1H B;  1IBK O;  4JI4 B;  3K06 A;  2GDS A;  2PUS A;  5EYP B;  2YSU B;  1GAX A;  5LGN A;  3O65 A;  2Q67 A;  4X65 O;  1P7G A;  2QWQ B;  5C8Y A;  1ZL8 A;  3JD4 A;  2YI8 A;  4JAV A;  1S5L Z;  2Q7H A;  4FK5 C;  4OX9 O;  1GRJ A;  1M5I A;  1OCO C;  4RQF A;  3CSX A;  3WFV A;  4WFH A;  4X20 A;  4BAY A;  4LF5 O;  2P22 C;  4H44 B;  2HVK C;  3GWK C;  1WPB A;  5CB4 B;  3ZED A;  1QCE A;  2CTQ A;  4FZ1 A;  5HFL A;  1DF4 A;  4OPH A;  4HYO A;  5LP6 C;  1K3E A;  1LUV A;  2CH7 A;  5JCO C;  4DV5 B;  1RPO A;  3WG7 B;  1G8M A;  3CC2 V;  3OGI B;  5JVD A;  4QNH B;  1Y74 A;  3CCV V;  3OE7 G;  3C3T A;  3CEI A;  5CBG A;  5JJJ B;  1PD3 A;  1ROP A;  4JI6 O;  4JYA O;  1NTZ H;  2GSM B;  1TAE A;  4ABM A;  1I08 A;  3A0B Z;  3VQV A;  4DR1 B;  2XAH A;  2EZO A;  1PPJ H;  1QLE C;  1F4M A;  2NN4 A;  3CB2 A;  2W0X A;  4H0L B;  1HNW B;  3K08 A;  2IJK A;  1K8A W;  3M99 B;  2ZCE A;  3P30 A;  1FXK B;  1OJH A;  1VF5 B;  4MTX A;  3LDD A;  4UV9 A;  5JWP A;  3E35 A;  5DEC A;  1IXB A;  5CA1 A;  5J2U B;  1V54 B;  1SQX H;  4MT8 A;  2P90 A;  4BR6 A;  5L3D A;  1OCC C;  5LBQ A;  2X0L A;  1K9M W;  2HR3 A;  1K34 A;  5FL7 G;  3ZHT A;  1PKX A;  2H8P C;  2UUB O;  1D5N A;  3IAY A;  1K4D C;  1JQ0 A;  3VOU A;  1HNX O;  1OZ0 A;  1P49 A;  4O2B B;  2LJ2 A;  1BQ0 A;  2GTA A;  5KHJ A;  1VF6 C;  2JS5 A;  4X1I B;  1IX9 A;  1SF9 A;  5TIS Z;  3C3S A;  1YHQ V;  3L75 H;  2VQE O;  4LWS A;  1SQG A;  5L3B A;  3SYP A;  2UUA B;  3BCC H;  3STL C;  2YI9 A;  1XDC A;  1FFX A;  5BXZ A;  3AG2 C;  4U3F H;  4UVB A;  3CCR V;  4DV4 B;  2EIL C;  1JVM A;  4K8Z A;  1QR9 A;  1KD1 W;  3ZCC A;  4GKK O;  3O9O A;  2PZS A;  2PYL A;  4JI7 O;  2CE4 A;  4TT3 G;  2LO1 A;  3KKY A;  4FMT A;  3L9D A;  2PY5 A;  3T2M A;  2ZE7 A;  1NH2 B;  3E83 A;  2PYJ A;  3FX7 A;  4B3R B;  1I5Y A;  4DR7 B;  2HFE C;  1MZF A;  4FLY A;  5AG2 A;  3H1I H;  1Q90 D;  3SGI A;  3ASO C;  1IBL B;  4DUY O;  4LH6 A;  4B3S B;  3L71 H;  1YJW V;  1RSO B;  1RM1 C;  5FLX N;  3AG1 B;  4TV8 B;  5LMU O;  3RYC B;  1R73 A;  4NXN O;  4RWU A;  5CB4 A;  4JGS A;  4UCV A;  1QU7 A;  4CH3 A;  1VQ6 V;  5IJ9 A;  1ZSP A;  3UT5 B;  2KG7 A;  2PGG A;  1RFY A;  1BZK A;  2WSS G;  3ABK B;  4UCU A;  1OHH G;  2Q7G A;  3LDC A;  4X9Q A;  4DR5 B;  4JYB A;  4GYC B;  4MTG A;  1FKA O;  2UXB B;  4DV6 O;  1AB3 A;  1HDJ A;  3P3N A;  4AI8 A;  4EEQ A;  3H1L H;  4IYI A;  1M1K W;  4FLW A;  1URF A;  2YEV A;  4JZG A;  4B3M B;  5FPR A;  4DO2 A;  2DYS B;  1Q6H A;  2HHH B;  2KSD A;  4LFA O;  3OEH G;  1VQP V;  1I94 O;  4CS2 A;  4JI2 B;  3CCE V;  3S3W A;  1QLN A;  4Z1V A;  4WFB V;  3ZRW B;  2UXC O;  4FLT A;  2HLD G;  1US6 A;  1FXK A;  1YZB A;  4PA9 A;  2ZDI C;  1XHZ A;  4CH6 A;  4I4T B;  3AK1 A;  5BMV B;  2QA4 V;  3D3I A;  1AI7 A;  5J2U A;  1GK9 A;  4AHC A;  1NT2 B;  2ZNI A;  2Q6A A;  3ABL C;  4P9P A;  5LOV B;  4XDL A;  5H6R A;  3VQW A;  4J9Z B;  3W7X A;  1MSW D;  5IYD O;  4AIL C;  2F4V O;  4LF4 O;  3J7A U;  4X8A A;  3ETG A;  1QVG U;  4HAM A;  1YJN V;  1HR0 O;  4O2B A;  2OCC C;  3R66 A;  3K5N A;  4EB6 B;  3RVZ A;  4X1I A;  3BA9 A;  2P67 A;  1NTK H;  1VQM V;  3BVO A;  2OWO A;  1OCR B;  3MHS C;  1H2M A;  3K79 A;  3FFQ A;  3SYC A;  2DW4 A;  2ZNJ A;  3ZRV A;  2WA4 A;  3AK3 A;  3CC7 V;  3JAK A;  4FM0 A;  1GTO A;  4NYK A;  1N36 B;  3UO2 A;  1K5Q A;  5GW7 A;  1R1B A;  4JI3 O;  3K58 A;  2QKA A;  4PA3 A;  5JQG B;  1J95 A;  3QO5 A;  1AP6 A;  2M7W A;  2CGO A;  3Q4H B;  2R9A A;  4O4I B;  5KMG B;  4JV5 O;  4LP8 A;  2UXX A;  3RGB A;  4K0K B;  4PDL A;  1HNZ O;  3BPZ A;  3OFN G;  3RVY A;  1G1X B;  5H5N A;  4GZR B;  5FPO A;  2H3O A;  2ATK C;  4JTD B;  2IU0 A;  1H8E G;  3FYE B;  4DV1 O;  1I5X A;  5B1A B;  5KHI A;  2FB5 A;  4JZ2 A;  3K04 A;  1WLE A;  3CCL V;  4DR3 B;  1AR4 A;  1G4Y B;  5B66 Z;  4X1Y B;  3BHP A;  4O4H B;  2YID A;  5BR8 B;  4LCU C;  5H9C A;  2P7T C;  1DTO A;  4I5S A;  1VQO V;  2LFR A;  1XQ8 A;  3CHX A;  3IC7 A;  3SYQ A;  3D36 A;  2NLJ C;  3RT3 C;  2CTW A;  4MVR A;  1RSO A;  4JTC B;  3WU2 Z;  2DYR C;  5KAI Z;  4TV8 A;  3DGE A;  1KB9 F;  2X7R B;  1EN6 A;  4YY3 O;  3RYC A;  3TGU H;  4LF7 O;  1MMM A;  1TGO A;  1Q7Y W;  4DYL A;  2JIZ G;  4JI0 B;  2K9P A;  2E76 B;  1YVW A;  2XTA A;  1ZX3 A;  4R7C A;  4NXM B;  4NTW A;  1S77 D;  2WLM A;  1OCZ B;  1D5A A;  4QPK A;  1XEQ A;  2Z5U A;  2P4V A;  3ASN C;  3SPC A;  4FLU A;  2ZD9 A;  1TUE B;  1H38 A;  4H13 B;  1R6N A;  4RO2 A;  3CRM A;  3ZMV A;  3QO8 A;  4KHP O;  1N32 B;  2E75 B;  4LFB O;  2HVJ C;  2A9H A;  2AW9 A;  4RAI A;  2JS3 A;  4DR4 B;  4B3T B;  3NXS A;  2CK3 G;  2IJI A;  4PHZ A;  1HW7 A;  2IJJ A;  1AJP A;  4WFF A;  3K0D A;  4PV1 B;  2UXD B;  1OCO B;  2EIJ C;  4BIU A;  2EX3 A;  5LMN O;  4MVZ A;  1Y6X A;  1K4C C;  4I4T A;  2WLK A;  2GV9 A;  3U11 A;  2UUC B;  4LF8 B;  5BMV A;  2JJ2 G;  3PJS K;  3OGC C;  1Y76 B;  3W7S A;  3H01 A;  3K3W A;  4O2A B;  1I7F A;  3OT7 A;  3CRR A;  5L3E A;  1XMO O;  2AZ2 A;  5LOV A;  1DK1 A;  5JH7 B;  3ZJZ A;  1VQ9 V;  3RYI A;  1TUB B;  5LP6 B;  1J5E O;  1OV9 A;  3CXC U;  1S5H C;  1XUQ A;  3EVK A;  3I5D A;  1R6K A;  1SZX A;  1B3Q A;  3APQ A;  4L8J A;  1NR7 A;  2IH1 C;  3FD9 A;  4I9W A;  4W4L A;  4DK1 A;  4QGP A;  4EB6 A;  5HFM A;  5B3S C;  3HKB B;  2VWJ A;  1BGY H;  1QLE B;  1QVF U;  4X62 B;  4U7O A;  2Y69 C;  3LUT B;  3DTU B;  3OTO O;  2QKC A;  1N33 O;  1HNW O;  1N34 O;  4GKJ O;  1KKD A;  1TVK B;  2ZIM A;  3KZI Z;  4AQY O;  2EJ7 A;  1BQZ A;  2XAF A;  3L73 H;  5JQG A;  3PN1 A;  4MSW C;  3T1Y B;  4LF6 B;  1WN7 A;  2Q7E A;  3Q4H A;  4JI5 O;  1CP9 A;  1OCC B;  4O4I A;  3L72 H;  2F43 G;  4HBN A;  3OTF A;  3QNE A;  4MW3 A;  2BE3 A;  4ZI7 B;  4ZHQ B;  5KMG A;  4MTO A;  4X64 O;  4Q20 A;  4J7Z A;  2WLH A;  1MZE A;  4LFC B;  5LHI A;  4DV3 B;  1PL4 A;  2ILM A;  2DOS A;  2GUZ A;  1XL4 A;  3T4D A;  3BAA A;  4L87 A;  1L8D A;  3CXH F;  5E1A C;  4JI8 B;  3UM7 A;  2Y4T A;  4X1Y A;  4GLX A;  4O4H A;  4X1K B;  4R8C A;  4OXS A;  1AI6 A;  3X2Q C;  4J10 A;  3ZIA G;  3CRC A;  3K9S A;  1JJO A;  4PI2 A;  3STZ C;  5DED A;  3HKD B;  5D5P A;  3AG2 B;  2XAQ A;  3CP1 A;  2JEU A;  2YXL A;  4TSF G;  4G27 B;  2ZM6 B;  4NVP A;  4GCZ A;  4YHH B;  4O4L B;  2VQF O;  2ZT9 B;  2VRZ A;  2EIL B;  2MW2 B;  1R3K C;  4QE9 A;  4WBN A;  1X4T A;  5A2Q N;  3SJA C;  2R70 A;  2XHB A;  1VQ8 V;  4FM2 A;  3OAA G;  2PI4 A;  1PL0 A;  1XNR B;  1QR8 A;  4UCS A;  4DUZ O;  2A06 H;  1WB7 A;  5J2T B;  3JAR B;  3JSN A;  4LBE C;  1Z5V A;  2RDC A;  2ZE5 A;  4X66 B;  1SES A;  1XMQ B;  3QF7 A;  5IE9 A;  2LW1 A; 
#chains in the Genus database with same CATH homology
 3B40 A;  1Y74 B;  1Y74 A;  1Y76 A;  1ZL8 B;  1RSO B;  1ZL8 A;  1VF6 C;  1Y76 B;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...