1Y76B

Solution structure of patj/pals1 l27 domain complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
AVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords protein associated to tight junctions
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76B00
1Y76A 1Y76B 1ZL8A 1ZL8B 1VF6C 1VF6A 1Y74A 1Y74B 3B40A 1RSOB
chains in the Genus database with same CATH superfamily
1HWYA 3ZMVA 1NH2B 3HKCA 5J2TB 1WB8A 1BE3H 1VQNV 3IFXA 2UUAB 1GN4A 3O65A 3T1YB 1S77D 1FYJA 4EB6B 3HKBB 4DV4B 4X20B 4YIOA 3JD3A 4BW5A 1I0HA 1VQPV 2VS0A 3OT7A 3G71V 4JGSA 2OCCC 1PNMA 1Y76A 1BCCH 3K5MA 2OT5A 1CP9A 3T1HO 3JASA 1OZ0A 1AP5A 3QTCA 2OTLV 3QNEA 1MG1A 3SJBC 2F93B 2GSMB 3ZRSA 4JYYA 3B77A 1PD3A 2DW4A 2EILC 2PTMA 5LOVA 3E35A 2WA3A 1IBLO 2EJ7A 3FX7A 4B08A 1R73A 4JZGA 2E76B 4FZ0A 5HFMA 4L87A 2EINB 3ABKB 4DV6O 1EZVH 3FB6C 1S76D 3DC5A 1SA0A 4FLZA 1R1BA 1WLEA 5EYPA 1XQ8A 1P49A 2GBOA 5AG2A 3QVNA 3TXSA 3VQWA 1URFA 4PV1B 4DV7O 1MSDA 2LGQA 2QSAA 3L75H 4PDMA 3K03A 4RAIA 4TOIA 3K9AA 2OIGA 3CJHA 1FXHA 2DQ3A 1MNGA 3CX5F 2JEUA 3OEHG 2EJRA 1K8AW 4I4TA 3M99B 4LWSB 1HP8A 3ETEA 1IXBA 2HHHO 2JGDA 1ZTEA 2C2AA 1GN6A 2PI4A 5F2VO 2ZE7A 5KUKA 3CEIA 4FLUA 4BIUA 3HKEA 4YHHB 1WA8A 4JV5O 3GB7C 5JWPA 4ASUG 4I50A 1NT2B 4I0XA 4PDLA 1H2NA 1OV9A 3QF7A 3WG7C 5LA6A 2KB1A 4FJCC 1K9MW 5JVDB 1WP7A 2CTRA 4GZRB 4H44B 3I55V 3SJCC 4I9QA 5H9CA 4O2BB 1Y67A 5IYZA 4O4LB 3K06A 2E74B 2UU9B 2IJIA 3HKCB 2WA4A 4FM1A 1OCOB 3ZS8C 2GUZA 1Y66A 4FPPA 2K1EA 4J80A 3F5TA 4WFEA 1UPGA 3ZMTA 1LR1A 2IU3A 2YICA 3B40A 1Z5VA 4E4EA 2O57A 2Q6AA 1AVMA 2BOBC 1I08A 2FB5A 3GVMA 1Y76B 2EIKB 4JASA 1S72V 3G80A 5BZBA 5KA6A 2VRZA 2CTWA 1ZWIC 3CCUV 2P4KA 2XAFA 5H6RA 1NKDA 4FZ1A 1AR4A 2HEPA 1RSOA 4JF3A 3JATA 5LOVB 4DR2O 4ICGA 2WPDG 2DMXA 2Q7HA 3UO2A 1YJ9V 2Z3YA 4WFGA 1R6NA 4FLWA 4K35A 5CA1A 3AEIA 1M57C 1ENVA 1SA0B 4ZI7A 4PHZA 2MW2B 3SYAA 4JI5O 2QTSA 2YI9A 5EYPB 3UT5A 4DR2B 4GX0A 2GTAA 1IBKB 2NN4A 4JI1O 1M5IA 1PP9H 3E8BA 4X9QA 4X65O 3H1KH 4MVSA 1THZA 4TT3G 2W0FC 3PJSK 2FYUH 2YXYA 2FMLA 5A2QN 3ASNB 4I4TB 2AXTZ 5JH7A 5KA5A 3CMAV 5L3EA 4F6EA 3W7SA 4JI1B 5DECA 2JGDB 4X65B 1TA8A 4WCEV 2CTQA 1Z2GA 1D2DA 1ROPA 5C93A 4I55A 4O2AB 5B3SC 3HKEB 1SRYA 1WA8B 2CTPA 1P7BA 1W2BU 2YIDA 4P9OA 2X7RB 5JQGA 4I50B 3ZEDA 1YCIA 4I0XB 3CMEV 3OR6C 3FYIB 1GM8A 2P5OA 3VQXA 3E8FA 4GUNA 5LA6B 3CRMA 2N05A 4MW3A 5LMUO 2XUMA 1U97A 2LO1A 4DV1O 1Y6XA 4BW9A 3WB0A 1UFIA 5IYZB 4X89A 3JAKB 2RN9A 3ZN0A 4P9PA 4QGPA 3IC9A 1ZL8A 3SJQC 2GUZB 1LUVA 2WSSG 2BOCC 4HZ3A 5LMUB 4Q6GA 2WLIA 4GT1A 4DR1O 4DV1B 1FJGO 3HKDB 3OGIB 1XMOO 1Y4MA 3ABMB 4DW1A 1B3QA 3FKSG 2F43G 4LF9B 3U0ZA 3J80N 1YJWV 2WLNA 1GO3F 5K1XA 4DR1B 3ZHRA 1FJGB 3VOUA 3FD9A 4CC6A 4UFZA 3JATB 5EBLC 1NJIW 2EINC 3ABKC 1NVPD 2ZR3A 4NTWA 3JAMN 4CS4A 1YXBA 1QLEB 3ZRWA 4GKKO 4E2LA 5B66Z 4ZI7B 1TVKA 4OPHA 4DRXA 5FNVA 4PA7A 1YI2V 1R3JC 4HNAA 3ZHUA 1RP3B 2UXDB 1O9HA 1HNZO 4ZKIA 5KHIA 2PGGA 3Q4HA 2KKWA 2E5LO 4BAYA 1B6QA 2XAQA 4MT8A 3JCZA 3H1HH 2P7TC 3CE2A 4JI8O 2KG7A 4RUFA 4LF8B 5JH7B 1SERA 3AG3C 3THOA 1E1QG 3QO8A 5EC1C 4PJ0Z 2ZNJA 4GLXA 3BABA 1ZAUA 3HR0A 1MSWD 2BE3A 4PDRA 1GN2A 1VQKV 3JD4A 1VQLV 4B3SO 4CS2A 2ZXWB 4IL6Z 3JCUZ 2P22C 1SQQH 4B3RO 4JI8B 4J11A 4LFAO 3B09A 4PD4F 2XT9A 5JQGB 4GX1A 3VBBA 3N2GA 3AK2A 4F6RA 3B2EE 3CC7V 4I7ZB 1DF4A 1HNWO 4ZBMA 4DR3O 3CXHF 2EIJB 4B3SB 4KHPO 1VMGA 4W4KA 3LDEA 1R3LC 4JTAB 3SYOA 1H2SB 1YHQV 4B3RB 4LFAB 5EIBD 4CH3A 1OCOC 2PF4E 2EZOA 3T4ZA 1I7FA 3SPHA 1I94O 3OW2U 1ZL8B 3JARA 3G4SV 2QWRB 1N4CA 2R72A 5BMVB 1K5QA 5BR8O 3ZX6A 2WLIB 3AG4B 1OCZB 4MVMA 2Q68A 4H37A 2EIKC 4NTXA 3P32A 4PI0A 2FKXA 1S5LZ 3RN4A 1KD1W 4WF9V 1Z5WA 3LDCA 4UCUA 2YI8A 3CRAA 1I94B 2LJ2A 3DC6A 3W7XA 4YJ3B 5IJ0B 3KCYA 4DK1A 4FLYA 5BR8B 1CPYA 2WLLA 3K04A 1R6TA 2FTKA 1NBMG 3D8CA 4ZHQA 4JI4B 4J7KA 3D3IA 2HJFC 4P30A 1JQ0A 1NTKH 2Y0IA 2WLKA 2RNBA 4JYAB 3UQ8A 2CAZC 1XNQO 2IJKA 4DXWA 1GKFA 3B4SA 2R9IA 4JI7B 3W7UA 3ZRWB 1BGYH 4DRXB 4X66O 5IWAB 5FNVB 3APOA 1K3EA 4HNAB 1KYOF 1W0KG 2AHZA 3EHBB 2XAHA 3E22A 3L72H 4UVBA 4J7JA 4HAMA 3Q4HB 4Z2WA 4WFAV 4DUYB 3RVYA 1N34O 1K7DA 4J10A 3ASNC 1SQFA 4GKJB 4X66B 3CC2V 4NVPA 4LF4B 3ZN1A 4NXMO 1GM9A 1XMQO 1FXVA 3NR7A 5FLXN 5LP6A 2KG7B 3L73H 2Q69A 1US6A 3RYHA 4DV5O 1KU9A 2BCCH 1JFFA 1H2MA 3ZCCA 4NB5A 3H9VA 2H3OA 4JI2O 3CHXA 5LHIA 1N36B 3K5LA 2L35A 1VP7A 1M93A 4B7KA 2QJ1A 4IIJA 3JYCA 2YXLA 3CCMV 1P4RA 5LHHA 1D5NA 3LNMB 2IM9A 3RFRA 3OUSA 3N2GB 4F6RB 5H2FZ 4LC1A 3E8GA 1SZXA 3H1JH 1IURA 2HFEC 4X1YA 3FB8C 4JI2B 4FLXA 4AQYB 4DR5O 3OMAB 2DYRB 1J5EO 1FXKA 1DF5A 1SZTA 3OEEG 1P7GA 4ZIBA 3EXAA 1PNLA 3FAVA 3OE7G 1WJZA 2YDEA 3K5NA 1H2GA 4DR6O 1XHXA 1VQOV 4DR5B 2HG5C 3JARB 2OYQA 4PA3A 3OTFA 1W59A 1H8EG 5FPRA 4Z1VA 3ABMC 1QR9A 4YXWG 3K0DA 4BWAA 3A0BZ 4R50A 3W7TA 5EZYA 5B1AB 3T1HB 3SJAC 1BT8A 3KG2A 3BAAA 3K79A 4TQDA 3OM3B 4DV3O 1SQXH 2WLLB 5L3GA 1IZ3A 4X1KB 4LFCO 3DXRA 2Z0AA 1IBLB 4U3FH 2PUSA 1F7YA 5IYBO 1G6UA 3AK3A 2ZDIA 1QLEC 4H33A 4MTOA 1Q86W 1S5JA 3KZIZ 1L0LH 2CH7B 3CCRV 1V9PA 2EX3A 3BHPA 3JAWA 2CDYA 4RQEA 4DV6B 1JCHA 5EBMC 4DV3B 3RT3C 3BA8A 4CC5A 1F4NA 2EBOA 2RMKB 5LGTA 4LFCB 4WBNA 1S5HC 1RPRA 4XDKA 2V4DA 4DV7B 1XI1A 3C3TA 4IYIA 5LL6Y 1OHHG 4J7ZA 5CN0A 2LW7A 2ZCEA 2F4VO 4AI8A 2P90A 3BFRA 4EEQA 4WFFA 2R9RB 1K34A 3U11A 1K92A 2W0XA 5LP6B 3M8AA 1S3JA 1IBMO 3AK1A 2HHHB 3RYHB 4JI0O 2Q4PA 4NYKA 1JFFB 1GH6A 3R66A 2PYLA 5LHGA 3L70H 3L74H 1YTFD 1I5YA 4LNUB 2ZXWC 2IBZH 4RWUA 2ARHA 3STLC 4EFEA 1BQZA 1Q43A 1EFRG 4JV5B 1TUBB 4HBNA 4EFBA 1XDCA 4CH5A 1DLBA 3OGCC 3N2KA 3ZRVA 5J2UA 2OTJV 2EIJC 1Q90D 4X1YB 1FAFA 1QHTA 3OR7C 2QKSA 1SS3A 1FXKB 2RCVA 4OPAA 5LGUA 1KP3A 4MVOA 3JALA 4JI6O 3ZHVA 3WB1A 1WPBA 2P67A 2DWEC 2B9ZA 1XL4A 1F4MA 1NQTA 3FAVB 3JASB 5KHGA 5CA3A 3AG4C 3D36C 1OCZC 5B5EZ 1Y74A 4JI6B 2QE7G 4LF6O 4QE7A 2HLDG 1P84F 4XDJA 4B7EA 4NR1A 5B1NA 5L3DA 1S0VA 4R8CA 2Q0OC 1PL0A 2NR5A 3RWRD 2VQFO 3U10A 1E1RG 2Q73A 4OXSA 3IAYA 4OX9O 5IDJA 1JA8A 4LF6B 3J81N 3DXRB 4LF5O 1BMFG 3RGBA 3P3PA 4DK0A 4G2KA 2B5UA 3OMNB 2VQFB 3JAWB 2ZKOA 3OAAG 3CJHB 2LQTA 1VQ8V 1N8RW 5IJ9A 4IGGA 4JI5B 1FD9A 3QO7A 4WBNB 2PY5A 3AG2B 2XHBA 3ZHQA 3A0HZ 4FLTA 4LF5B 1W0JG 4KXRA 3QG5A 4G27B 5HFLA 4C7UA 2DYSB 4JZ2A 2QWQB 4MTFA 5TISZ 4CZZA 5LXTA 2JS5A 4UVAA 3BVOA 5FL7G 1AILA 2QWPB 3K08A 1UJWB 2CE4A 4FLVA 1R6KA 2YIBD 4MS2A 1XILA 4GYCB 4AHCA 1XNRO 1K5SA 3D3QA 2CK3G 2JEXA 1F23A 2P6JA 3SPGA 4DV2O 3N2KB 5J2UB 3I5DA 4FFKA 4R6ZA 2DYRC 2JIZG 1VF6A 3W7WA 1MZFA 4R7CA 1Q6HA 1QBZA 3G67A 3VQYA 2DQ0A 2F23A 2EIMB 1FFTB 3JALB 1N33O 3APQA 1XEQA 2QM4A 4UCSA 3CCLV 2BTQA 5LMNO 4DV2B 2IH1C 3IC7A 4K3AA 4Z1MG 1NVPB 2RJZA 1XUQA 1NR1A 1R3KC 3FB7C 2ADPA 2YEVA 1DTOA 1ZUQA 1JJ2U 4KUMA 2BSKA 3AG1B 4GCZA 1PV0A 3CRQA 4PA6A 4A5UB 1V55B 3ETQA 1YIJV 5B1AC 1AP6A 3BEHA 5KHKA 5LMNB 1RSOB 1SQVH 1WP8A 2Y0PA 3FFQA 1XMOB 2YIAA 3GWKC 1ZX3A 4LP8A 3A2FA 4YY3O 4DR4O 1XBLA 4UUJC 3WU2Z 1ZLZA 5CA1B 3EVKA 2DOSA 5KX5A 5CA0A 3UT5B 1PKXA 3OD4A 1QR8A 4JI3O 1EBOA 4YY3B 1VQ6V 3MD0A 4K8XA 3CCJV 3ETDA 4GKKB 3MAQA 1BL8A 1YVWA 4P2ZA 5IJ9B 1IXMA 4J42A 2EZPA 2WLJA 2AGAA 2Y69B 2ZD9A 3BCCH 2UUCO 2JK5C 1HNZB 1KKDA 4JI3B 1FPOA 1FKAO 1YITV 2OIEA 5JJNB 3K3WA 1N32O 4TV8A 1AROP 3LSSA 4IHJA 3ZHTA 2E5LB 3I56V 2VQEO 1AI4A 1AI7A 1IVSA 4TV9A 5BY1A 5LXTB 1XL6A 5LP6C 3SPIA 4I55B 2IJHA 4BR6A 1CXZB 1B04A 5KMGA 2V1DA 5CB4A 5BXZA 1N32B 1AI6A 2ZR2A 1EN6A 4DV0O 4LR3A 4U3JA 2A06H 3IGAC 1X59A 1AJQA 3ICXA 4X64O 3L71H 3ZIAG 1Q81W 3C90A 4J41A 3RYIA 1XOUA 1JMKC 4D7SA 2Y48A 3LUTB 3X2QB 1WAZA 4PI2A 1FXKC 2IJJA 1HNWB 4DR3B 4UVCA 4XBFA 1NR7A 3HKBA 4X64B 4KHPB 2R9AA 5IY5B 2HP8A 3F7YC 4H13B 3SYCA 1N0NA 3VQVA 4XDLA 1AJNA 1Q3EA 2BTQB 1GTOA 1RM1B 5LGNA 1EN4A 2LFRA 1MOFA 4KFMA 2YEVB 5DM6V 2BSKB 1G4YB 3P30A 3H1LH 2R70A 1EM1A 2IH3C 3ABTA 1OCCB 3K0GA 2BTOA 3ABLB 4CH6A 3OMIB 1VQ4V 1VQ5V 4DR7O 5KHJA 2K9PA 3RBZA 3CD6V 4LCUC 1L8DA 2A3QA 1KKCA 2YS8A 3FB5C 2RDCA 3RW0A 4ZOLA 4G28B 1AI5A 1TVKB 2JRIA 2ZDIC 5CA0B 2X6AA 5KAFZ 2F95B 4QE9A 1LNQA 1QVGU 4DR7B 1E79G 1MMMA 1EN5A 1QCEA 1XNQB 4BIOA 2DN9A 3KKYA 1SF9A 3AG2C 1VQ7V 2ZINA 5LYJA 1VARA 1QNMA 1IDSA 2DYSC 1COWG 3CCVV 3A0RA 1IX9A 1V54B 1YJNV 2QR4A 4LWSA 5H6QA 1I5XA 3E86A 1JJOA 1H2KA 4IHJB 4TV8B 1KECA 1AR1B 3ASOB 1QVFU 5B1BB 1N34B 3SYPA 2QM7A 1WNSA 4IT5A 1FFXA 4TV9B 4PELA 3A8TA 4NXMB 3IJ4A 1XMQB 3CB2A 1ORQC 1K73W 1H8HG 2L6LA 2UXXA 5JJJB 4DV5B 3S3XA 5KMGB 5CB4B 5CBFA 4FVMA 1GMGA 4U3JB 3T1YO 3EFFK 5J9PC 4LH7A 1Q5OA 2ETNA 4DV4O 2HVKC 4F4LA 5E1AC 4D6TH 3OTOO 4RUEA 3RYIB 4O4LA 1TUEB 2LW1A 1HR0O 4UV9A 4LF7O 1MA1A 2NLJC 5DEDA 3MHSC 5C8YA 1GN3A 2EIMC 1T5EA 4FIPC 1J5EB 5JCOA 2ZM6O 4JTCB 1K4DC 1KC8W 3OTOB 1WN7A 2DJVA 1EZJA 2ZE8A 1JPXA 1HR0B 4LF7B 1NH2D 1VF5B 3AG1C 1LUWA 1VQMV 1VIBA 4DR6B 5EK0A 1Q6IA 1V55C 2P06A 2P4VA 2NNUA 3T2MA 2ZM6B 2F1MA 2A79B 2DWDC 2ITCC 3T1CA 4ZHQB 1ZSPA 1TGOA 1VEWA 4DUZO 3ZHSA 4YJ2A 3F5WC 5CBHA 2DE0X 1BHBA 3DGEA 2ZIMA 4MW8A 1SQBH 1B06A 1YZBA 4ABMA 4NXNO 5L3BA 3S3WA 2GTSA 4ZOLB 3CP1A 4I5SA 2H94A 3CWBH 2WLHA 4DUZB 1QQCA 4UCVA 3NXSA 4J9YB 3E22B 2UXCO 2ITDC 5KAIZ 5IE9A 3SPJA 4NXNB 2YXHA 1PPJH 1YTFB 2YIBA 3JSLA 3PN1A 2Y69C 4LFBO 2QDOA 1L1FA 5LYJB 3B8MA 4TQFA 4JAVA 4YHHO 3JD1A 4QIWF 2PI5A 2HJDA 2QKCA 2UXCB 3CS5A 1D5AA 1WB7A 2F4VB 2YUAA 5E79Z 4B3TO 5EBWC 3BRCA 3AG3B 2JDIG 4LFBB 1N0JA 1FFXB 2JJ2G 1MABG 4CH4A 1YSCA 4X88A 4MSWC 4O2AA 5CMUA 5EIBC 2VWJA 4N23A 5ITZA 3TGUH 2Q67A 3OUFA 2N04A 5L3FA 1L0NH 4IIJB 3STZC 1IBMB 4PA4A 4JYBA 4JI0B 3K58A 3QO5A 4N21A 2UU9O 4QPKA 2QA4V 4B3TB 1GRJA 3M7MX 3SR2C 1JOYA 2ZQMA 3MHHC 1F51A 2W6IG 3GWOA 2Q7GA 2QTOA 2QWNB 4H0LB 3X2QC 3MDSA 1CEZA 3LSQA 2GV9A 4J9ZB 3JAKA 1VF7A 2Y4TA 1VF6C 4IYHA 2AZ2A 1SQGA 1BSMA 2XTAA 3SYQA 5IY5C 4NKGB 5C8YB 2D2CB 3JSNA 2XASA 4X62O 1OJHA 3J7AU 4GX2A 4CBCA 3WFVA 5LBQA 1RM1C 5IYCO 3T4DA 3HKDA 3ZRXA 4MVRA 5L3CA 2X6BA 2AHYA 1FS0G 5EZYB 1SC5B 3ZMSA 3FYEB 3DSQA 1OCCC 3H1IH 3ABLC 1G8MA 5KLVH 4X62B 2Z5UA 5K1PA 1PM9A 4FMTA 2EULA 3ETGA 4UCTA 2FL4A 4TSFG 3BY6A 4AILC 4YJ2B 1QU7A 3ZJZA 3E89A 1IBKO 3RYCA 4JPRA 1NZ6A 4PDVA 2F66C 1KQSU 4OX9B 4UCRA 1KUQA 3RYFA 4JYCA 1HDJA 3HPLC 3TCUA 1SQPH 2Q0AA 4X1IA 1NI8A 1DGSA 1BZKA 2JJ1G 4CS3A 2KQXA 1O9GA 4QNHB 1VQ9V 1K97A 2X6CA 4KL1A 3ZMZA 2QWOB 2UUBO 3B8NA 2XOKG 1M90W 1V54C 4MVUA 4UV8A 1M56B 4O4IA 1BHAA 4MTXA 4FFBA 1PL4A 2D3OW 4K0KO 3E83A 3LNNA 1Q7YW 1X4TA 2YC0A 3ASOC 5B1BC 1M9NA 1M1KW 5B1OA 1OCRB 3K59A 2UUBB 1J95A 5GTIZ 2ZIOA 3ML0A 2UXNA 4K0KB 5KUMA 3K9SA 3KCXA 4UCOA 2JGUA 3L9DA 4U7OA 4MVZA 4UB6Z 4DYLA 5ITZB 1H2LA 2E75B 2MK3A 4TUYA 4QPJA 3E2EA 1KMIZ 4KP4A 1XNRB 3CPWU 1HW7A 4I9WA 4RQFA 2GDSA 2QEXV 2IW5A 4UXNA 2PYJA 5EC2C 2PZSA 2OCCB 4LF9O 3SPCA 1Y74B 5BMVA 5KHHA 3D36A 3C3SA 4D7TA 3BPZA 1N33B 1AB3A 2QKAA 2IU0A 1HNXO 1RFYA 1K33A 2HVJC 2XNDG 3JD2A 3CCSV 1Q6UA 1YDXA 3ABUA 3TXQA 1KB9F 1Q8IA 2EILB 4YJ3A 5GONA 5IJ0A 3O9OA 2X0LA 5GW7A 1A32A 1KP2A 1SKVA 2OCHA 2RQ6A 4JAAA 2ODMA 2QM8A 1HNXB 2G38A 5DN6G 3H01A 2HR3A 2UXDO 1NTMH 5H5NA 2WAMA 2AZ0A 3RYCB 4DR4B 1WPXA 3ZMUA 1U96A 4O4HA 1SETA 3UO3A 2ADQB 1YEWA 2Q8VA 2UXBO 4FM2A 3CC4V 3SGIA 4FM0A 3RYFB 1NS1A 4X1IB 2XAGA 4O4JA 4LF8O 4W4LA 4QJFB 2XAJA 1DK1A 2YSUB 2Q5ZA 2UXBB 4O4IB 2AW9A 2VWKA 3K57A 4FFBB 2UUCB 2ATKC 2H8PC 3UM7A 2ZE6A 1RPOA 1MZEA 1XREA 5FPOA 2A0LA 4K8ZA 5JJEB 2B1GA 2VQEB 1NTZH 2W6JG 5CBGA 2HKOA 4OGQB 3WG7B 1M4UA 3CCEV 1BQ0A 2Q9LA 4TUYB 3TK1A 5J2TA 1G1XB 3F7VC 4DV0B 3CSXA 3CCQV 3CYOA 2N74A 4EB6A 4X20A 1BS3A 4DW0A 2M6YA 3K5OA 4YIPA 2CUGA 1QLNA 3RVZA 3CRCA 4HYOA 3P3NA 4JTDB 2CGOA 2A9HA 4LBEC 5JCOC 1H38A 1GK9A 2V7QG 5GTHZ 3E8HA 3LSUA 4JI4O 3LDDA 4GX5A 4L8JA 4JYAO 3DTUB 2ZNIA 4NTYA 5GONB 4DO2A 4BIZA 2ZE5A 4JI7O 1TAEA 5KX5B 3TJTA 1M57B 4X1KA 5IYDO 5IWAO 4WFBV 3WB2A 2Y4UA 2JS3A 4U7NA 4Q20A 3CRRA 2LFSA 1GM7A 2WWWA 2CH7A 4X8AA 1K4CC 5D5PA 4PA9A 4DUYO 1JVMA 4O4HB 2LGWA 3JD0A 1R3IC 4GKJO 4LH6A 2B1IA 4LF4O 4FK5C 4MTGA 1AR5A 1SESA 4O4JB 2QGNA 4RO2A 1JX9A 3TETA 4MVQA 1M56C 2Q7EA 1XHZA 4JAUA 2GHYA 2LP7A 1N36O 4EKWA 1YF2A 3G6EV 2M7WA 1OCRC 2A7WA 4B3MO 2OWOA 5IT9N 2ILMA 3CXCU 5B3SB 2WLMA 1JR9A 1GAXA 3N27A 1PNKA 2JVDA 3UKMA 1Q82W 3G6BA 3OFNG 4LNUA 3ZBHA 1NU1H 2KSDA 4UB8Z 3SDLA 3R65A 2UUAO 1KBHA 2ZT9B 5JVDA 4AQYO 2E3CA 1AJPA 4TWKA 3HB3B 4WFHA 1TUBA 3BA9A 3AG7A 3UCSC 4O2BA 5A9GA 4B3MB 2CGNA 5D5QA
chains in the Genus database with same CATH topology
1Y76A 1Y76B 1ZL8A 1ZL8B 1VF6C 1VF6A 1Y74A 1Y74B 3B40A 1RSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 A;  1Y76 B;  1ZL8 A;  1ZL8 B;  1VF6 C;  1VF6 A;  1Y74 A;  1Y74 B;  3B40 A;  1RSO B; 
#chains in the Genus database with same CATH topology
 1HWY A;  3ZMV A;  1NH2 B;  3HKC A;  5J2T B;  1WB8 A;  1BE3 H;  1VQN V;  3IFX A;  2UUA B;  1GN4 A;  3O65 A;  3T1Y B;  1S77 D;  1FYJ A;  4EB6 B;  3HKB B;  4DV4 B;  4X20 B;  4YIO A;  3JD3 A;  4BW5 A;  1I0H A;  1VQP V;  2VS0 A;  3OT7 A;  3G71 V;  4JGS A;  2OCC C;  1PNM A;  1Y76 A;  1BCC H;  3K5M A;  2OT5 A;  1CP9 A;  3T1H O;  3JAS A;  1OZ0 A;  1AP5 A;  3QTC A;  2OTL V;  3QNE A;  1MG1 A;  3SJB C;  2F93 B;  2GSM B;  3ZRS A;  4JYY A;  3B77 A;  1PD3 A;  2DW4 A;  2EIL C;  2PTM A;  5LOV A;  3E35 A;  2WA3 A;  1IBL O;  2EJ7 A;  3FX7 A;  4B08 A;  1R73 A;  4JZG A;  2E76 B;  4FZ0 A;  5HFM A;  4L87 A;  2EIN B;  3ABK B;  4DV6 O;  1EZV H;  3FB6 C;  1S76 D;  3DC5 A;  1SA0 A;  4FLZ A;  1R1B A;  1WLE A;  5EYP A;  1XQ8 A;  1P49 A;  2GBO A;  5AG2 A;  3QVN A;  3TXS A;  3VQW A;  1URF A;  4PV1 B;  4DV7 O;  1MSD A;  2LGQ A;  2QSA A;  3L75 H;  4PDM A;  3K03 A;  4RAI A;  4TOI A;  3K9A A;  2OIG A;  3CJH A;  1FXH A;  2DQ3 A;  1MNG A;  3CX5 F;  2JEU A;  3OEH G;  2EJR A;  1K8A W;  4I4T A;  3M99 B;  4LWS B;  1HP8 A;  3ETE A;  1IXB A;  2HHH O;  2JGD A;  1ZTE A;  2C2A A;  1GN6 A;  2PI4 A;  5F2V O;  2ZE7 A;  5KUK A;  3CEI A;  4FLU A;  4BIU A;  3HKE A;  4YHH B;  1WA8 A;  4JV5 O;  3GB7 C;  5JWP A;  4ASU G;  4I50 A;  1NT2 B;  4I0X A;  4PDL A;  1H2N A;  1OV9 A;  3QF7 A;  3WG7 C;  5LA6 A;  2KB1 A;  4FJC C;  1K9M W;  5JVD B;  1WP7 A;  2CTR A;  4GZR B;  4H44 B;  3I55 V;  3SJC C;  4I9Q A;  5H9C A;  4O2B B;  1Y67 A;  5IYZ A;  4O4L B;  3K06 A;  2E74 B;  2UU9 B;  2IJI A;  3HKC B;  2WA4 A;  4FM1 A;  1OCO B;  3ZS8 C;  2GUZ A;  1Y66 A;  4FPP A;  2K1E A;  4J80 A;  3F5T A;  4WFE A;  1UPG A;  3ZMT A;  1LR1 A;  2IU3 A;  2YIC A;  3B40 A;  1Z5V A;  4E4E A;  2O57 A;  2Q6A A;  1AVM A;  2BOB C;  1I08 A;  2FB5 A;  3GVM A;  1Y76 B;  2EIK B;  4JAS A;  1S72 V;  3G80 A;  5BZB A;  5KA6 A;  2VRZ A;  2CTW A;  1ZWI C;  3CCU V;  2P4K A;  2XAF A;  5H6R A;  1NKD A;  4FZ1 A;  1AR4 A;  2HEP A;  1RSO A;  4JF3 A;  3JAT A;  5LOV B;  4DR2 O;  4ICG A;  2WPD G;  2DMX A;  2Q7H A;  3UO2 A;  1YJ9 V;  2Z3Y A;  4WFG A;  1R6N A;  4FLW A;  4K35 A;  5CA1 A;  3AEI A;  1M57 C;  1ENV A;  1SA0 B;  4ZI7 A;  4PHZ A;  2MW2 B;  3SYA A;  4JI5 O;  2QTS A;  2YI9 A;  5EYP B;  3UT5 A;  4DR2 B;  4GX0 A;  2GTA A;  1IBK B;  2NN4 A;  4JI1 O;  1M5I A;  1PP9 H;  3E8B A;  4X9Q A;  4X65 O;  3H1K H;  4MVS A;  1THZ A;  4TT3 G;  2W0F C;  3PJS K;  2FYU H;  2YXY A;  2FML A;  5A2Q N;  3ASN B;  4I4T B;  2AXT Z;  5JH7 A;  5KA5 A;  3CMA V;  5L3E A;  4F6E A;  3W7S A;  4JI1 B;  5DEC A;  2JGD B;  4X65 B;  1TA8 A;  4WCE V;  2CTQ A;  1Z2G A;  1D2D A;  1ROP A;  5C93 A;  4I55 A;  4O2A B;  5B3S C;  3HKE B;  1SRY A;  1WA8 B;  2CTP A;  1P7B A;  1W2B U;  2YID A;  4P9O A;  2X7R B;  5JQG A;  4I50 B;  3ZED A;  1YCI A;  4I0X B;  3CME V;  3OR6 C;  3FYI B;  1GM8 A;  2P5O A;  3VQX A;  3E8F A;  4GUN A;  5LA6 B;  3CRM A;  2N05 A;  4MW3 A;  5LMU O;  2XUM A;  1U97 A;  2LO1 A;  4DV1 O;  1Y6X A;  4BW9 A;  3WB0 A;  1UFI A;  5IYZ B;  4X89 A;  3JAK B;  2RN9 A;  3ZN0 A;  4P9P A;  4QGP A;  3IC9 A;  1ZL8 A;  3SJQ C;  2GUZ B;  1LUV A;  2WSS G;  2BOC C;  4HZ3 A;  5LMU B;  4Q6G A;  2WLI A;  4GT1 A;  4DR1 O;  4DV1 B;  1FJG O;  3HKD B;  3OGI B;  1XMO O;  1Y4M A;  3ABM B;  4DW1 A;  1B3Q A;  3FKS G;  2F43 G;  4LF9 B;  3U0Z A;  3J80 N;  1YJW V;  2WLN A;  1GO3 F;  5K1X A;  4DR1 B;  3ZHR A;  1FJG B;  3VOU A;  3FD9 A;  4CC6 A;  4UFZ A;  3JAT B;  5EBL C;  1NJI W;  2EIN C;  3ABK C;  1NVP D;  2ZR3 A;  4NTW A;  3JAM N;  4CS4 A;  1YXB A;  1QLE B;  3ZRW A;  4GKK O;  4E2L A;  5B66 Z;  4ZI7 B;  1TVK A;  4OPH A;  4DRX A;  5FNV A;  4PA7 A;  1YI2 V;  1R3J C;  4HNA A;  3ZHU A;  1RP3 B;  2UXD B;  1O9H A;  1HNZ O;  4ZKI A;  5KHI A;  2PGG A;  3Q4H A;  2KKW A;  2E5L O;  4BAY A;  1B6Q A;  2XAQ A;  4MT8 A;  3JCZ A;  3H1H H;  2P7T C;  3CE2 A;  4JI8 O;  2KG7 A;  4RUF A;  4LF8 B;  5JH7 B;  1SER A;  3AG3 C;  3THO A;  1E1Q G;  3QO8 A;  5EC1 C;  4PJ0 Z;  2ZNJ A;  4GLX A;  3BAB A;  1ZAU A;  3HR0 A;  1MSW D;  2BE3 A;  4PDR A;  1GN2 A;  1VQK V;  3JD4 A;  1VQL V;  4B3S O;  4CS2 A;  2ZXW B;  4IL6 Z;  3JCU Z;  2P22 C;  1SQQ H;  4B3R O;  4JI8 B;  4J11 A;  4LFA O;  3B09 A;  4PD4 F;  2XT9 A;  5JQG B;  4GX1 A;  3VBB A;  3N2G A;  3AK2 A;  4F6R A;  3B2E E;  3CC7 V;  4I7Z B;  1DF4 A;  1HNW O;  4ZBM A;  4DR3 O;  3CXH F;  2EIJ B;  4B3S B;  4KHP O;  1VMG A;  4W4K A;  3LDE A;  1R3L C;  4JTA B;  3SYO A;  1H2S B;  1YHQ V;  4B3R B;  4LFA B;  5EIB D;  4CH3 A;  1OCO C;  2PF4 E;  2EZO A;  3T4Z A;  1I7F A;  3SPH A;  1I94 O;  3OW2 U;  1ZL8 B;  3JAR A;  3G4S V;  2QWR B;  1N4C A;  2R72 A;  5BMV B;  1K5Q A;  5BR8 O;  3ZX6 A;  2WLI B;  3AG4 B;  1OCZ B;  4MVM A;  2Q68 A;  4H37 A;  2EIK C;  4NTX A;  3P32 A;  4PI0 A;  2FKX A;  1S5L Z;  3RN4 A;  1KD1 W;  4WF9 V;  1Z5W A;  3LDC A;  4UCU A;  2YI8 A;  3CRA A;  1I94 B;  2LJ2 A;  3DC6 A;  3W7X A;  4YJ3 B;  5IJ0 B;  3KCY A;  4DK1 A;  4FLY A;  5BR8 B;  1CPY A;  2WLL A;  3K04 A;  1R6T A;  2FTK A;  1NBM G;  3D8C A;  4ZHQ A;  4JI4 B;  4J7K A;  3D3I A;  2HJF C;  4P30 A;  1JQ0 A;  1NTK H;  2Y0I A;  2WLK A;  2RNB A;  4JYA B;  3UQ8 A;  2CAZ C;  1XNQ O;  2IJK A;  4DXW A;  1GKF A;  3B4S A;  2R9I A;  4JI7 B;  3W7U A;  3ZRW B;  1BGY H;  4DRX B;  4X66 O;  5IWA B;  5FNV B;  3APO A;  1K3E A;  4HNA B;  1KYO F;  1W0K G;  2AHZ A;  3EHB B;  2XAH A;  3E22 A;  3L72 H;  4UVB A;  4J7J A;  4HAM A;  3Q4H B;  4Z2W A;  4WFA V;  4DUY B;  3RVY A;  1N34 O;  1K7D A;  4J10 A;  3ASN C;  1SQF A;  4GKJ B;  4X66 B;  3CC2 V;  4NVP A;  4LF4 B;  3ZN1 A;  4NXM O;  1GM9 A;  1XMQ O;  1FXV A;  3NR7 A;  5FLX N;  5LP6 A;  2KG7 B;  3L73 H;  2Q69 A;  1US6 A;  3RYH A;  4DV5 O;  1KU9 A;  2BCC H;  1JFF A;  1H2M A;  3ZCC A;  4NB5 A;  3H9V A;  2H3O A;  4JI2 O;  3CHX A;  5LHI A;  1N36 B;  3K5L A;  2L35 A;  1VP7 A;  1M93 A;  4B7K A;  2QJ1 A;  4IIJ A;  3JYC A;  2YXL A;  3CCM V;  1P4R A;  5LHH A;  1D5N A;  3LNM B;  2IM9 A;  3RFR A;  3OUS A;  3N2G B;  4F6R B;  5H2F Z;  4LC1 A;  3E8G A;  1SZX A;  3H1J H;  1IUR A;  2HFE C;  4X1Y A;  3FB8 C;  4JI2 B;  4FLX A;  4AQY B;  4DR5 O;  3OMA B;  2DYR B;  1J5E O;  1FXK A;  1DF5 A;  1SZT A;  3OEE G;  1P7G A;  4ZIB A;  3EXA A;  1PNL A;  3FAV A;  3OE7 G;  1WJZ A;  2YDE A;  3K5N A;  1H2G A;  4DR6 O;  1XHX A;  1VQO V;  4DR5 B;  2HG5 C;  3JAR B;  2OYQ A;  4PA3 A;  3OTF A;  1W59 A;  1H8E G;  5FPR A;  4Z1V A;  3ABM C;  1QR9 A;  4YXW G;  3K0D A;  4BWA A;  3A0B Z;  4R50 A;  3W7T A;  5EZY A;  5B1A B;  3T1H B;  3SJA C;  1BT8 A;  3KG2 A;  3BAA A;  3K79 A;  4TQD A;  3OM3 B;  4DV3 O;  1SQX H;  2WLL B;  5L3G A;  1IZ3 A;  4X1K B;  4LFC O;  3DXR A;  2Z0A A;  1IBL B;  4U3F H;  2PUS A;  1F7Y A;  5IYB O;  1G6U A;  3AK3 A;  2ZDI A;  1QLE C;  4H33 A;  4MTO A;  1Q86 W;  1S5J A;  3KZI Z;  1L0L H;  2CH7 B;  3CCR V;  1V9P A;  2EX3 A;  3BHP A;  3JAW A;  2CDY A;  4RQE A;  4DV6 B;  1JCH A;  5EBM C;  4DV3 B;  3RT3 C;  3BA8 A;  4CC5 A;  1F4N A;  2EBO A;  2RMK B;  5LGT A;  4LFC B;  4WBN A;  1S5H C;  1RPR A;  4XDK A;  2V4D A;  4DV7 B;  1XI1 A;  3C3T A;  4IYI A;  5LL6 Y;  1OHH G;  4J7Z A;  5CN0 A;  2LW7 A;  2ZCE A;  2F4V O;  4AI8 A;  2P90 A;  3BFR A;  4EEQ A;  4WFF A;  2R9R B;  1K34 A;  3U11 A;  1K92 A;  2W0X A;  5LP6 B;  3M8A A;  1S3J A;  1IBM O;  3AK1 A;  2HHH B;  3RYH B;  4JI0 O;  2Q4P A;  4NYK A;  1JFF B;  1GH6 A;  3R66 A;  2PYL A;  5LHG A;  3L70 H;  3L74 H;  1YTF D;  1I5Y A;  4LNU B;  2ZXW C;  2IBZ H;  4RWU A;  2ARH A;  3STL C;  4EFE A;  1BQZ A;  1Q43 A;  1EFR G;  4JV5 B;  1TUB B;  4HBN A;  4EFB A;  1XDC A;  4CH5 A;  1DLB A;  3OGC C;  3N2K A;  3ZRV A;  5J2U A;  2OTJ V;  2EIJ C;  1Q90 D;  4X1Y B;  1FAF A;  1QHT A;  3OR7 C;  2QKS A;  1SS3 A;  1FXK B;  2RCV A;  4OPA A;  5LGU A;  1KP3 A;  4MVO A;  3JAL A;  4JI6 O;  3ZHV A;  3WB1 A;  1WPB A;  2P67 A;  2DWE C;  2B9Z A;  1XL4 A;  1F4M A;  1NQT A;  3FAV B;  3JAS B;  5KHG A;  5CA3 A;  3AG4 C;  3D36 C;  1OCZ C;  5B5E Z;  1Y74 A;  4JI6 B;  2QE7 G;  4LF6 O;  4QE7 A;  2HLD G;  1P84 F;  4XDJ A;  4B7E A;  4NR1 A;  5B1N A;  5L3D A;  1S0V A;  4R8C A;  2Q0O C;  1PL0 A;  2NR5 A;  3RWR D;  2VQF O;  3U10 A;  1E1R G;  2Q73 A;  4OXS A;  3IAY A;  4OX9 O;  5IDJ A;  1JA8 A;  4LF6 B;  3J81 N;  3DXR B;  4LF5 O;  1BMF G;  3RGB A;  3P3P A;  4DK0 A;  4G2K A;  2B5U A;  3OMN B;  2VQF B;  3JAW B;  2ZKO A;  3OAA G;  3CJH B;  2LQT A;  1VQ8 V;  1N8R W;  5IJ9 A;  4IGG A;  4JI5 B;  1FD9 A;  3QO7 A;  4WBN B;  2PY5 A;  3AG2 B;  2XHB A;  3ZHQ A;  3A0H Z;  4FLT A;  4LF5 B;  1W0J G;  4KXR A;  3QG5 A;  4G27 B;  5HFL A;  4C7U A;  2DYS B;  4JZ2 A;  2QWQ B;  4MTF A;  5TIS Z;  4CZZ A;  5LXT A;  2JS5 A;  4UVA A;  3BVO A;  5FL7 G;  1AIL A;  2QWP B;  3K08 A;  1UJW B;  2CE4 A;  4FLV A;  1R6K A;  2YIB D;  4MS2 A;  1XIL A;  4GYC B;  4AHC A;  1XNR O;  1K5S A;  3D3Q A;  2CK3 G;  2JEX A;  1F23 A;  2P6J A;  3SPG A;  4DV2 O;  3N2K B;  5J2U B;  3I5D A;  4FFK A;  4R6Z A;  2DYR C;  2JIZ G;  1VF6 A;  3W7W A;  1MZF A;  4R7C A;  1Q6H A;  1QBZ A;  3G67 A;  3VQY A;  2DQ0 A;  2F23 A;  2EIM B;  1FFT B;  3JAL B;  1N33 O;  3APQ A;  1XEQ A;  2QM4 A;  4UCS A;  3CCL V;  2BTQ A;  5LMN O;  4DV2 B;  2IH1 C;  3IC7 A;  4K3A A;  4Z1M G;  1NVP B;  2RJZ A;  1XUQ A;  1NR1 A;  1R3K C;  3FB7 C;  2ADP A;  2YEV A;  1DTO A;  1ZUQ A;  1JJ2 U;  4KUM A;  2BSK A;  3AG1 B;  4GCZ A;  1PV0 A;  3CRQ A;  4PA6 A;  4A5U B;  1V55 B;  3ETQ A;  1YIJ V;  5B1A C;  1AP6 A;  3BEH A;  5KHK A;  5LMN B;  1RSO B;  1SQV H;  1WP8 A;  2Y0P A;  3FFQ A;  1XMO B;  2YIA A;  3GWK C;  1ZX3 A;  4LP8 A;  3A2F A;  4YY3 O;  4DR4 O;  1XBL A;  4UUJ C;  3WU2 Z;  1ZLZ A;  5CA1 B;  3EVK A;  2DOS A;  5KX5 A;  5CA0 A;  3UT5 B;  1PKX A;  3OD4 A;  1QR8 A;  4JI3 O;  1EBO A;  4YY3 B;  1VQ6 V;  3MD0 A;  4K8X A;  3CCJ V;  3ETD A;  4GKK B;  3MAQ A;  1BL8 A;  1YVW A;  4P2Z A;  5IJ9 B;  1IXM A;  4J42 A;  2EZP A;  2WLJ A;  2AGA A;  2Y69 B;  2ZD9 A;  3BCC H;  2UUC O;  2JK5 C;  1HNZ B;  1KKD A;  4JI3 B;  1FPO A;  1FKA O;  1YIT V;  2OIE A;  5JJN B;  3K3W A;  1N32 O;  4TV8 A;  1ARO P;  3LSS A;  4IHJ A;  3ZHT A;  2E5L B;  3I56 V;  2VQE O;  1AI4 A;  1AI7 A;  1IVS A;  4TV9 A;  5BY1 A;  5LXT B;  1XL6 A;  5LP6 C;  3SPI A;  4I55 B;  2IJH A;  4BR6 A;  1CXZ B;  1B04 A;  5KMG A;  2V1D A;  5CB4 A;  5BXZ A;  1N32 B;  1AI6 A;  2ZR2 A;  1EN6 A;  4DV0 O;  4LR3 A;  4U3J A;  2A06 H;  3IGA C;  1X59 A;  1AJQ A;  3ICX A;  4X64 O;  3L71 H;  3ZIA G;  1Q81 W;  3C90 A;  4J41 A;  3RYI A;  1XOU A;  1JMK C;  4D7S A;  2Y48 A;  3LUT B;  3X2Q B;  1WAZ A;  4PI2 A;  1FXK C;  2IJJ A;  1HNW B;  4DR3 B;  4UVC A;  4XBF A;  1NR7 A;  3HKB A;  4X64 B;  4KHP B;  2R9A A;  5IY5 B;  2HP8 A;  3F7Y C;  4H13 B;  3SYC A;  1N0N A;  3VQV A;  4XDL A;  1AJN A;  1Q3E A;  2BTQ B;  1GTO A;  1RM1 B;  5LGN A;  1EN4 A;  2LFR A;  1MOF A;  4KFM A;  2YEV B;  5DM6 V;  2BSK B;  1G4Y B;  3P30 A;  3H1L H;  2R70 A;  1EM1 A;  2IH3 C;  3ABT A;  1OCC B;  3K0G A;  2BTO A;  3ABL B;  4CH6 A;  3OMI B;  1VQ4 V;  1VQ5 V;  4DR7 O;  5KHJ A;  2K9P A;  3RBZ A;  3CD6 V;  4LCU C;  1L8D A;  2A3Q A;  1KKC A;  2YS8 A;  3FB5 C;  2RDC A;  3RW0 A;  4ZOL A;  4G28 B;  1AI5 A;  1TVK B;  2JRI A;  2ZDI C;  5CA0 B;  2X6A A;  5KAF Z;  2F95 B;  4QE9 A;  1LNQ A;  1QVG U;  4DR7 B;  1E79 G;  1MMM A;  1EN5 A;  1QCE A;  1XNQ B;  4BIO A;  2DN9 A;  3KKY A;  1SF9 A;  3AG2 C;  1VQ7 V;  2ZIN A;  5LYJ A;  1VAR A;  1QNM A;  1IDS A;  2DYS C;  1COW G;  3CCV V;  3A0R A;  1IX9 A;  1V54 B;  1YJN V;  2QR4 A;  4LWS A;  5H6Q A;  1I5X A;  3E86 A;  1JJO A;  1H2K A;  4IHJ B;  4TV8 B;  1KEC A;  1AR1 B;  3ASO B;  1QVF U;  5B1B B;  1N34 B;  3SYP A;  2QM7 A;  1WNS A;  4IT5 A;  1FFX A;  4TV9 B;  4PEL A;  3A8T A;  4NXM B;  3IJ4 A;  1XMQ B;  3CB2 A;  1ORQ C;  1K73 W;  1H8H G;  2L6L A;  2UXX A;  5JJJ B;  4DV5 B;  3S3X A;  5KMG B;  5CB4 B;  5CBF A;  4FVM A;  1GMG A;  4U3J B;  3T1Y O;  3EFF K;  5J9P C;  4LH7 A;  1Q5O A;  2ETN A;  4DV4 O;  2HVK C;  4F4L A;  5E1A C;  4D6T H;  3OTO O;  4RUE A;  3RYI B;  4O4L A;  1TUE B;  2LW1 A;  1HR0 O;  4UV9 A;  4LF7 O;  1MA1 A;  2NLJ C;  5DED A;  3MHS C;  5C8Y A;  1GN3 A;  2EIM C;  1T5E A;  4FIP C;  1J5E B;  5JCO A;  2ZM6 O;  4JTC B;  1K4D C;  1KC8 W;  3OTO B;  1WN7 A;  2DJV A;  1EZJ A;  2ZE8 A;  1JPX A;  1HR0 B;  4LF7 B;  1NH2 D;  1VF5 B;  3AG1 C;  1LUW A;  1VQM V;  1VIB A;  4DR6 B;  5EK0 A;  1Q6I A;  1V55 C;  2P06 A;  2P4V A;  2NNU A;  3T2M A;  2ZM6 B;  2F1M A;  2A79 B;  2DWD C;  2ITC C;  3T1C A;  4ZHQ B;  1ZSP A;  1TGO A;  1VEW A;  4DUZ O;  3ZHS A;  4YJ2 A;  3F5W C;  5CBH A;  2DE0 X;  1BHB A;  3DGE A;  2ZIM A;  4MW8 A;  1SQB H;  1B06 A;  1YZB A;  4ABM A;  4NXN O;  5L3B A;  3S3W A;  2GTS A;  4ZOL B;  3CP1 A;  4I5S A;  2H94 A;  3CWB H;  2WLH A;  4DUZ B;  1QQC A;  4UCV A;  3NXS A;  4J9Y B;  3E22 B;  2UXC O;  2ITD C;  5KAI Z;  5IE9 A;  3SPJ A;  4NXN B;  2YXH A;  1PPJ H;  1YTF B;  2YIB A;  3JSL A;  3PN1 A;  2Y69 C;  4LFB O;  2QDO A;  1L1F A;  5LYJ B;  3B8M A;  4TQF A;  4JAV A;  4YHH O;  3JD1 A;  4QIW F;  2PI5 A;  2HJD A;  2QKC A;  2UXC B;  3CS5 A;  1D5A A;  1WB7 A;  2F4V B;  2YUA A;  5E79 Z;  4B3T O;  5EBW C;  3BRC A;  3AG3 B;  2JDI G;  4LFB B;  1N0J A;  1FFX B;  2JJ2 G;  1MAB G;  4CH4 A;  1YSC A;  4X88 A;  4MSW C;  4O2A A;  5CMU A;  5EIB C;  2VWJ A;  4N23 A;  5ITZ A;  3TGU H;  2Q67 A;  3OUF A;  2N04 A;  5L3F A;  1L0N H;  4IIJ B;  3STZ C;  1IBM B;  4PA4 A;  4JYB A;  4JI0 B;  3K58 A;  3QO5 A;  4N21 A;  2UU9 O;  4QPK A;  2QA4 V;  4B3T B;  1GRJ A;  3M7M X;  3SR2 C;  1JOY A;  2ZQM A;  3MHH C;  1F51 A;  2W6I G;  3GWO A;  2Q7G A;  2QTO A;  2QWN B;  4H0L B;  3X2Q C;  3MDS A;  1CEZ A;  3LSQ A;  2GV9 A;  4J9Z B;  3JAK A;  1VF7 A;  2Y4T A;  1VF6 C;  4IYH A;  2AZ2 A;  1SQG A;  1BSM A;  2XTA A;  3SYQ A;  5IY5 C;  4NKG B;  5C8Y B;  2D2C B;  3JSN A;  2XAS A;  4X62 O;  1OJH A;  3J7A U;  4GX2 A;  4CBC A;  3WFV A;  5LBQ A;  1RM1 C;  5IYC O;  3T4D A;  3HKD A;  3ZRX A;  4MVR A;  5L3C A;  2X6B A;  2AHY A;  1FS0 G;  5EZY B;  1SC5 B;  3ZMS A;  3FYE B;  3DSQ A;  1OCC C;  3H1I H;  3ABL C;  1G8M A;  5KLV H;  4X62 B;  2Z5U A;  5K1P A;  1PM9 A;  4FMT A;  2EUL A;  3ETG A;  4UCT A;  2FL4 A;  4TSF G;  3BY6 A;  4AIL C;  4YJ2 B;  1QU7 A;  3ZJZ A;  3E89 A;  1IBK O;  3RYC A;  4JPR A;  1NZ6 A;  4PDV A;  2F66 C;  1KQS U;  4OX9 B;  4UCR A;  1KUQ A;  3RYF A;  4JYC A;  1HDJ A;  3HPL C;  3TCU A;  1SQP H;  2Q0A A;  4X1I A;  1NI8 A;  1DGS A;  1BZK A;  2JJ1 G;  4CS3 A;  2KQX A;  1O9G A;  4QNH B;  1VQ9 V;  1K97 A;  2X6C A;  4KL1 A;  3ZMZ A;  2QWO B;  2UUB O;  3B8N A;  2XOK G;  1M90 W;  1V54 C;  4MVU A;  4UV8 A;  1M56 B;  4O4I A;  1BHA A;  4MTX A;  4FFB A;  1PL4 A;  2D3O W;  4K0K O;  3E83 A;  3LNN A;  1Q7Y W;  1X4T A;  2YC0 A;  3ASO C;  5B1B C;  1M9N A;  1M1K W;  5B1O A;  1OCR B;  3K59 A;  2UUB B;  1J95 A;  5GTI Z;  2ZIO A;  3ML0 A;  2UXN A;  4K0K B;  5KUM A;  3K9S A;  3KCX A;  4UCO A;  2JGU A;  3L9D A;  4U7O A;  4MVZ A;  4UB6 Z;  4DYL A;  5ITZ B;  1H2L A;  2E75 B;  2MK3 A;  4TUY A;  4QPJ A;  3E2E A;  1KMI Z;  4KP4 A;  1XNR B;  3CPW U;  1HW7 A;  4I9W A;  4RQF A;  2GDS A;  2QEX V;  2IW5 A;  4UXN A;  2PYJ A;  5EC2 C;  2PZS A;  2OCC B;  4LF9 O;  3SPC A;  1Y74 B;  5BMV A;  5KHH A;  3D36 A;  3C3S A;  4D7T A;  3BPZ A;  1N33 B;  1AB3 A;  2QKA A;  2IU0 A;  1HNX O;  1RFY A;  1K33 A;  2HVJ C;  2XND G;  3JD2 A;  3CCS V;  1Q6U A;  1YDX A;  3ABU A;  3TXQ A;  1KB9 F;  1Q8I A;  2EIL B;  4YJ3 A;  5GON A;  5IJ0 A;  3O9O A;  2X0L A;  5GW7 A;  1A32 A;  1KP2 A;  1SKV A;  2OCH A;  2RQ6 A;  4JAA A;  2ODM A;  2QM8 A;  1HNX B;  2G38 A;  5DN6 G;  3H01 A;  2HR3 A;  2UXD O;  1NTM H;  5H5N A;  2WAM A;  2AZ0 A;  3RYC B;  4DR4 B;  1WPX A;  3ZMU A;  1U96 A;  4O4H A;  1SET A;  3UO3 A;  2ADQ B;  1YEW A;  2Q8V A;  2UXB O;  4FM2 A;  3CC4 V;  3SGI A;  4FM0 A;  3RYF B;  1NS1 A;  4X1I B;  2XAG A;  4O4J A;  4LF8 O;  4W4L A;  4QJF B;  2XAJ A;  1DK1 A;  2YSU B;  2Q5Z A;  2UXB B;  4O4I B;  2AW9 A;  2VWK A;  3K57 A;  4FFB B;  2UUC B;  2ATK C;  2H8P C;  3UM7 A;  2ZE6 A;  1RPO A;  1MZE A;  1XRE A;  5FPO A;  2A0L A;  4K8Z A;  5JJE B;  2B1G A;  2VQE B;  1NTZ H;  2W6J G;  5CBG A;  2HKO A;  4OGQ B;  3WG7 B;  1M4U A;  3CCE V;  1BQ0 A;  2Q9L A;  4TUY B;  3TK1 A;  5J2T A;  1G1X B;  3F7V C;  4DV0 B;  3CSX A;  3CCQ V;  3CYO A;  2N74 A;  4EB6 A;  4X20 A;  1BS3 A;  4DW0 A;  2M6Y A;  3K5O A;  4YIP A;  2CUG A;  1QLN A;  3RVZ A;  3CRC A;  4HYO A;  3P3N A;  4JTD B;  2CGO A;  2A9H A;  4LBE C;  5JCO C;  1H38 A;  1GK9 A;  2V7Q G;  5GTH Z;  3E8H A;  3LSU A;  4JI4 O;  3LDD A;  4GX5 A;  4L8J A;  4JYA O;  3DTU B;  2ZNI A;  4NTY A;  5GON B;  4DO2 A;  4BIZ A;  2ZE5 A;  4JI7 O;  1TAE A;  5KX5 B;  3TJT A;  1M57 B;  4X1K A;  5IYD O;  5IWA O;  4WFB V;  3WB2 A;  2Y4U A;  2JS3 A;  4U7N A;  4Q20 A;  3CRR A;  2LFS A;  1GM7 A;  2WWW A;  2CH7 A;  4X8A A;  1K4C C;  5D5P A;  4PA9 A;  4DUY O;  1JVM A;  4O4H B;  2LGW A;  3JD0 A;  1R3I C;  4GKJ O;  4LH6 A;  2B1I A;  4LF4 O;  4FK5 C;  4MTG A;  1AR5 A;  1SES A;  4O4J B;  2QGN A;  4RO2 A;  1JX9 A;  3TET A;  4MVQ A;  1M56 C;  2Q7E A;  1XHZ A;  4JAU A;  2GHY A;  2LP7 A;  1N36 O;  4EKW A;  1YF2 A;  3G6E V;  2M7W A;  1OCR C;  2A7W A;  4B3M O;  2OWO A;  5IT9 N;  2ILM A;  3CXC U;  5B3S B;  2WLM A;  1JR9 A;  1GAX A;  3N27 A;  1PNK A;  2JVD A;  3UKM A;  1Q82 W;  3G6B A;  3OFN G;  4LNU A;  3ZBH A;  1NU1 H;  2KSD A;  4UB8 Z;  3SDL A;  3R65 A;  2UUA O;  1KBH A;  2ZT9 B;  5JVD A;  4AQY O;  2E3C A;  1AJP A;  4TWK A;  3HB3 B;  4WFH A;  1TUB A;  3BA9 A;  3AG7 A;  3UCS C;  4O2B A;  5A9G A;  4B3M B;  2CGN A;  5D5Q A; 
#chains in the Genus database with same CATH homology
 1Y76 A;  1Y76 B;  1ZL8 A;  1ZL8 B;  1VF6 C;  1VF6 A;  1Y74 A;  1Y74 B;  3B40 A;  1RSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...