1WP8A

Crystal structure of hendra virus fusion core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQKILDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion glycoprotein F0,Fusion glycoprotein F0
publication title Crystal structures of Nipah and Hendra virus fusion core proteins
pubmed doi rcsb
source organism Hendra virus
molecule tags Viral protein
total genus 30
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp8A00
3IJ4A 2L35A 4NTXA 4NTWA 2QTSA 3N27A 2FB5A 4FZ1A 1WP7A 4NYKA 4FZ0A 4NTYA 3S3XA 1WP8A 3S3WA
chains in the Genus database with same CATH superfamily
2QWNB 3OMIB 1FFXA 4KL1A 4NTYA 2AGAA 2XUMA 1XUQA 3K08A 4ZOLA 1S5JA 4JI2B 3E86A 1GM7A 3KCXA 3L73H 3K9SA 4J41A 1Q86W 2EIMB 1ZSPA 4LH7A 2EIMC 2RQ6A 2F66C 2Q69A 1QR9A 4LCUC 1K5QA 2UXBO 1K9MW 3B09A 5C8YA 5KA6A 1KECA 1FXVA 4B3TB 4KFMA 3Q4HA 4FFBB 1WB8A 3T1YB 3CCUV 3PN1A 4GX1A 1U96A 4DR5B 3ZRSA 2CDYA 4B3MO 4QE9A 4X64O 2OWOA 4YHHB 2ADQB 3VQYA 4UVAA 3OGIB 5L3GA 3NR7A 2BTQA 1D5NA 5H2FZ 4UB6Z 2HFEC 3OTFA 3OFNG 4FM2A 2XAFA 1N8RW 1N33B 5E79Z 1SZTA 5LHIA 3ZMTA 2IU0A 1Q3EA 4IGGA 2OYQA 2Z5UA 1O9GA 2FKXA 3VQWA 2QM4A 4PHZA 1P7BA 2GHYA 4DV1B 3I5DA 1XEQA 1R1BA 2B1IA 1YZBA 2RJZA 3KCYA 3FB8C 1JJOA 3FKSG 3M8AA 2ZE6A 3JALB 2UUBB 5LA6B 4JI4O 1NTMH 1K97A 2YSUB 3CRQA 1F7YA 4DUZO 1BQ0A 5DECA 4BR6A 2AZ0A 5JH7B 4FVMA 1GK9A 4CH6A 4L87A 5FL7G 2UXBB 5KHKA 1M9NA 2CK3G 4NXNO 2ZE5A 4I4TA 5A2QN 5JQGB 4FZ0A 1BHAA 3H1KH 1D5AA 3HR0A 2CE4A 3OGCC 2DQ0A 5IJ9B 5B3SB 5IY5B 5B3SC 4B3MB 5IY5C 4U3JB 1I94O 3N2KA 4X64B 1JMKC 4EFBA 4ZIBA 2LGQA 4X62O 2FTKA 4O4IB 2AHYA 3RYFA 1HR0O 1GRJA 3C90A 4X89A 3E89A 2ZDIC 2JGDA 2EULA 4QPJA 4XDJA 4IT5A 5IYDO 4MW3A 4H33A 3DGEA 3AG1B 2DYRB 3AG1C 2QGNA 2UXDO 2A7WA 2DYRC 3CXCU 5JVDB 4Z1MG 2RCVA 1F4MA 3ETDA 1GO3F 3ABKC 3SYCA 3CYOA 1Q6UA 4JI4B 4DUZB 4QJFB 2Q6AA 4E2LA 1FJGO 3K0DA 4FJCC 1WJZA 2IJHA 2PTMA 1HWYA 3CS5A 3B8NA 1VF7A 4ZBMA 5B1BB 2PYJA 5B1BC 3SDLA 1AROP 4X1YA 3AG7A 4FFKA 1NH2D 4WBNA 4NXNB 2JRIA 2N74A 3CB2A 2A0LA 3JARB 4FK5C 1GN3A 2Q7HA 3ABLB 3D3QA 3ABLC 1CXZB 1BT8A 1I94B 1SRYA 5EYPB 1IZ3A 2N05A 4HZ3A 3BA9A 1LUVA 4TQDA 4MSWC 4X62B 4WFGA 1HR0B 3N2GA 1EZJA 5H6QA 2D3OW 3ABUA 1G6UA 1Q8IA 3CD6V 3E8HA 1NZ6A 4NYKA 5J2UA 5FPRA 2GDSA 5IT9N 2IBZH 4I5SA 5GONA 5L3DA 4DV0O 2ARHA 1RSOA 2P4VA 2UXDB 1XQ8A 1M4UA 3FB5C 4J7KA 1AJQA 4UB8Z 2WLMA 2P6JA 4TV8B 2X6AA 1N0NA 3JAWA 3SPIA 2QM7A 2Y0IA 3OR7C 2F95B 2H8PC 4UV9A 4JI1O 1KQSU 4J42A 5KAIZ 4WFFA 1ZL8B 2LFRA 1PKXA 1FJGB 2PI5A 3OTOO 1E1RG 3CJHB 4YY3O 1YIJV 5L3FA 1G4YB 2BE3A 4JV5O 3IC9A 1TUEB 3A0BZ 4BW9A 4FLYA 3WG7C 3WB0A 4TUYA 3CMAV 3G4SV 3OM3B 3OMNB 5KMGB 5CA1A 4OPAA 4Z1VA 2WLIA 1S0VA 5LHHA 3BABA 1L1FA 3UO2A 5JCOC 2KKWA 2M6YA 2ZIOA 3RGBA 4YJ2B 1NVPB 1QCEA 4R6ZA 1VQOV 4PA7A 4J9ZB 3FB7C 2WPDG 1QHTA 1Z5WA 1VQPV 3WFVA 3I55V 3ZEDA 4DV7O 4JTAB 3AEIA 1V54B 4DV0B 2P5OA 3U10A 1V54C 4DR2O 1J5EO 4CH4A 3EFFK 2JGUA 3E8BA 3OUFA 4PI2A 1F23A 5EZYB 3S3WA 2ZE8A 3BRCA 4U3FH 3BVOA 2Q7GA 4RAIA 1SQBH 5A9GA 1KB9F 5LP6A 4JI1B 3SYPA 3EHBB 4FLUA 4MS2A 2P67A 1JFFA 1IURA 2VWKA 1NT2B 1WB7A 5CMUA 3OTOB 1H8HG 3RYCB 3K06A 1OHHG 5L3CA 4UCSA 4DW0A 4YY3B 3P3NA 4JV5B 4I50A 1J95A 2QTOA 4HNAB 3BCCH 1AB3A 1YTFD 1K4DC 3OE7G 3ZHUA 2DJVA 1HNZO 5JWPA 3H1HH 3ZRXA 1H8EG 2IM9A 1JJ2U 2A79B 3KZIZ 5BXZA 3N2GB 3QNEA 2ZQMA 2WSSG 1VQ7V 4PDMA 1W0KG 4DXWA 1KP2A 1YCIA 4TV9A 1RSOB 3JATA 4DV7B 1R3JC 1I5YA 1E1QG 2NR5A 4DR2B 1J5EB 2A06H 3DC6A 3JAWB 1WAZA 1BL8A 1VQ4V 3JSNA 1KD1W 2L6LA 3QG5A 4KXRA 4R8CA 3T4DA 2VQEB 5IYCO 4LF6O 4O4LB 4UCUA 1FS0G 4NR1A 5BZBA 3UKMA 3H9VA 4U7NA 1ZAUA 1MZEA 3B4SA 3APOA 5EIBC 3ZS8C 4LF9O 2WLIB 1MNGA 2RDCA 1HNZB 1S5HC 4J7ZA 3P3PA 2AW9A 3UCSC 1URFA 4JI7O 4P9OA 5IYZB 3VQXA 4LF8O 1YVWA 4JZ2A 4FLVA 3UO3A 1KP3A 2LW1A 2QR4A 1ZWIC 4ASUG 1XI1A 3STZC 4CS3A 1IXBA 2JJ1G 4G28B 1NH2B 1Q6HA 4TSFG 2EIKC 1YITV 3BY6A 1VIBA 1GN4A 3CCRV 3E8FA 3LDEA 5K1XA 4JI5O 1VQ9V 1WN7A 3W7WA 3FD9A 1SERA 2Y4TA 4OGQB 2WA3A 3K5NA 2R9RB 2DMXA 4LF6B 4D7TA 4X1KB 1WPBA 3ZCCA 3JALA 4MTOA 1WP8A 3SPCA 5LA6A 4F6RB 1H2SB 3GVMA 2YI9A 3JD0A 4LF9B 5JH7A 3VOUA 1MOFA 2XAQA 3IJ4A 3K0GA 4DK0A 1YDXA 1VF5B 3M99B 4LNUB 4JI7B 4MTGA 5KLVH 2WLNA 4LF8B 4QIWF 5JQGA 4TV9B 1L8DA 4JTCB 5B5EZ 3ZRWB 1DK1A 1V9PA 3OD4A 1IXMA 2LFSA 5IJ9A 3ETQA 5IDJA 3E2EA 2YUAA 3F5WC 4EFEA 5KHGA 4O4IA 3ASNB 3G80A 1OCCB 3K58A 1OCCC 2ZDIA 2LP7A 2BSKB 1XOUA 1RP3B 4LFBO 2YDEA 4JI5B 2ZCEA 2BOCC 4EEQA 4WFEA 4YXWG 1AR1B 4UCOA 5JVDA 5L3EA 2P90A 2PY5A 3OEEG 1NR7A 4J80A 4UUJC 1SF9A 4I0XA 2UUBO 5H6RA 4MTFA 1G8MA 4X9QA 2ZM6O 2W0XA 4I9WA 1K5SA 1NVPD 1IVSA 5FLXN 4GX2A 4X20A 2RMKB 2CGNA 2Q0AA 3L72H 4K0KO 1MSWD 2EJRA 3FYIB 1BMFG 5B1OA 3T1HO 2X0LA 1PM9A 3ZHVA 1SA0B 2Q7EA 3CCSV 4YIPA 1YEWA 5B1NA 1KC8W 3JARA 3TJTA 3DXRB 1NR1A 3K5LA 4NKGB 3ZN0A 3ZMSA 5LMNO 1N4CA 4CC6A 5EYPA 3OUSA 2ILMA 2VS0A 1MZFA 4RUFA 1YTFB 4PDLA 2CTPA 3GWOA 4BIUA 1Y76B 3DSQA 4BWAA 4MVSA 4CH3A 3O9OA 4LFBB 4LWSB 2WWWA 2YIDA 2P7TC 3IGAC 4LR3A 2CTQA 3RBZA 3L71H 1XILA 4TV8A 5LL6Y 2Q73A 4IYIA 3FX7A 2F1MA 2ZM6B 1SQGA 4W4KA 2MW2B 1ZL8A 3STLC 4IYHA 1ORQC 2Q9LA 1VQMV 3WB2A 1M5IA 3FAVB 3L9DA 4PA4A 4K0KB 3CJHA 2QWQB 1OCRB 1AI6A 1U97A 1OCRC 1AP6A 2Q5ZA 5LYJB 2XAGA 4AHCA 3T1HB 1JVMA 3AG2C 3HKEA 5EBLC 4UCVA 1HNXO 4F6EA 1QVGU 4D6TH 4A5UB 3CC4V 4R7CA 3A8TA 3D8CA 5KMGA 4J7JA 2AHZA 4ZHQA 1CPYA 1TVKB 5LMNB 4XBFA 5JCOA 1NKDA 3K03A 1DTOA 1E79G 2HJDA 3ML0A 1TUBB 4O2AB 4YJ2A 2PYLA 1SQVH 5EC1C 3MD0A 2YXHA 3B40A 1XMQO 2A9HA 2DOSA 5K1PA 2IU3A 4DV3O 4FMTA 5EIBD 3H1JH 1SETA 1Q81W 3OEHG 4I0XB 1Y74A 2YIAA 5EZYA 3ABKB 4BIOA 5KUKA 2EX3A 4JI8O 3HKDB 1QVFU 3GWKC 1I7FA 3G6BA 2ZNIA 3T4ZA 2QA4V 2UU9O 1AJPA 5GTHZ 4X20B 4U7OA 5LGUA 1M90W 2F43G 5CBHA 1W0JG 5GW7A 3CRMA 3RYCA 3D36C 1THZA 4RWUA 4WF9V 3CCQV 1T5EA 3W7SA 5JJJB 1US6A 1VEWA 1EFRG 1DF4A 1BSMA 1HNXB 2JS3A 3F7VC 4MVQA 4B7EA 4HNAA 1AI7A 1FXKB 1H2GA 1FXKC 4QGPA 4KP4A 1XL6A 3RYIB 1EBOA 1F4NA 1Y6XA 3JD1A 4JI3O 1JQ0A 1PL0A 1XREA 5C93A 1Q90D 1ROPA 1YJ9V 2XASA 5TISZ 2E3CA 2AZ2A 2HKOA 2UXCO 4MW8A 4B08A 2HVJC 3M7MX 1BGYH 1VQLV 1AR5A 1JA8A 1XMQB 3JSLA 2ZIMA 1KUQA 4DV3B 4CZZA 1YJWV 1M93A 3E22A 2EZOA 4K35A 4LH6A 4GKKO 3QO7A 2JJ2G 1GAXA 2ZXWB 4I9QA 3LDDA 2ZXWC 4JI8B 5LBQA 5EBMC 2UU9B 2DWEC 2OCCB 2OCCC 1UPGA 4MVOA 1JOYA 1VQKV 2NNUA 4DR1O 2Q8VA 4O4LA 3ZHRA 3CRRA 4C7UA 2ZNJA 3UT5B 1VQ6V 3HKEB 1I08A 1EM1A 3WG7B 2DYSC 4OPHA 2V7QG 1B06A 3QF7A 4ZHQB 4FLXA 2N04A 3E83A 2CTRA 4DUYO 1NI8A 5B66Z 4FM1A 2EJ7A 4X1IB 5HFMA 2P4KA 4JI3B 4DYLA 5IYZA 3J80N 3AG4B 1R6KA 4DO2A 3AG4C 3FYEB 2YIBD 3I56V 1MABG 1TGOA 2UXCB 3EVKA 2YXYA 2WLLB 2EILC 3SJQC 5AG2A 3ZX6A 4JAAA 3SGIA 2X6CA 5D5PA 4WFAV 4JAVA 4X66O 3LDCA 1Y74B 2JK5C 5EK0A 3SJAC 3L74H 4GKKB 1KMIZ 3APQA 4NXMO 1H2NA 2W6IG 4LP8A 4KUMA 2JDIG 1OZ0A 1Z5VA 2VQEO 3CWBH 1HDJA 1R73A 2JIZG 4Q20A 3U11A 2EIJB 2Q67A 4IHJB 3CCLV 3CP1A 1Z2GA 2EIJC 1K3EA 1O9HA 2YXLA 3RT3C 1NS1A 3ZJZA 4DR1B 1NQTA 2NLJC 1SKVA 4X1KA 1BCCH 4MTXA 1JPXA 1K4CC 4UCRA 3FFQA 2G38A 3LSQA 4RQFA 4F6RA 2DQ3A 3EXAA 2BTOA 4J10A 5EBWC 2R70A 3RVYA 5LOVB 1N34O 3ETEA 2R72A 3FB6C 3RN4A 2EINB 3TK1A 2EINC 3GB7C 4DUYB 2W6JG 3K5MA 2HEPA 5LMUO 4LNUA 4DR6O 2WA4A 4BW5A 1GH6A 1PD3A 4G27B 4YJ3B 1I5XA 1VMGA 1KYOF 1QR8A 3ZRWA 3AK3A 2HP8A 2LGWA 3E22B 2YICA 3TETA 1IDSA 1RPOA 1AI5A 4FPPA 4MT8A 3G67A 4FM0A 4IL6Z 1OJHA 2ETNA 4X66B 4DR7O 4O4JA 5CA3A 3PJSK 2DN9A 3P32A 4NXMB 2KQXA 3RYHB 1R3LC 1LR1A 4TT3G 3ASOC 2BSKA 1FKAO 1KBHA 2ZT9B 2GUZB 5E1AC 3K04A 4JPRA 2R9AA 1HNWO 4UVBA 3CCVV 1WPXA 1XBLA 2FB5A 1S3JA 1R6TA 1BE3H 3SYAA 4DK1A 2ITDC 3BAAA 1QLNA 4H0LB 2DW4A 5CBFA 4DR3O 5KA5A 2WLHA 4O2BB 4JYYA 2H94A 1N34B 3MAQA 1XNRO 2IH1C 4HAMA 1SQQH 1RFYA 4N23A 5LMUB 3SJCC 4DR6B 1D2DA 1SA0A 4AILC 3AG3C 1BHBA 3J7AU 3HKCB 5CA0A 1XL4A 3CCJV 1XHXA 2UUAO 1MG1A 3DXRA 3A0HZ 1YJNV 4TOIA 3CSXA 3IFXA 3A2FA 1SS3A 2EIKB 1P84F 1SESA 4DR7B 4DR4O 1KKDA 1JX9A 2QKAA 2YC0A 1X59A 2C2AA 5KHIA 1Y76A 2OTLV 4FZ1A 2UUCO 4L8JA 4IIJB 1CEZA 3OT7A 5GTIZ 4LWSA 2KG7B 1PPJH 2M7WA 4LF4O 1NTKH 2OIEA 3HKBA 4KHPO 1HNWB 3ZMVA 5BR8O 2XHBA 5LP6C 2QE7G 1H2LA 1IBMO 4X8AA 2CUGA 5FPOA 1WP7A 4RQEA 2P22C 3H1LH 2Z0AA 4DR3B 2KB1A 4R50A 3FAVA 4JI0O 1RM1B 1RM1C 3N27A 1GN6A 1XNRB 4PJ0Z 3K3WA 4TQFA 5LYJA 2IJKA 1P4RA 1V55B 4ZI7B 1V55C 2F93B 4JF3A 3E35A 4DRXA 5DN6G 2R9IA 1XHZA 1VQ5V 1S77D 3TCUA 1QQCA 1FXHA 4DW1A 3TXQA 2VQFO 2UUAB 2HG5C 4BAYA 1TVKA 2GSMB 4O4JB 5EC2C 5KHHA 4OXSA 4O4HB 4DR4B 1TUBA 4O2AA 2QKCA 2E74B 4TWKA 2F4VO 5KX5B 2GTSA 4EB6B 4I55B 1SZXA 1WA8B 1S76D 4ZKIA 3F5TA 1Q7YW 4FLZA 2HHHO 2UUCB 2PGGA 4P9PA 4CBCA 1P7GA 3JD3A 1SQXH 1PL4A 4LF4B 5CN0A 4KHPB 3JAMN 4GLXA 5BR8B 4NTWA 3UQ8A 4E4EA 1PV0A 2ZE7A 5JJNB 4NVPA 3ZHQA 3HKDA 1DLBA 3W7UA 1IBMB 3CC7V 1XDCA 1PNLA 3SPGA 3CE2A 3KG2A 3CCMV 3RWRD 4JASA 3ABMB 4HYOA 3ABMC 4LFAO 3D36A 4JI0B 4FLTA 3P30A 2H3OA 3ZHTA 5D5QA 2IW5A 4OX9O 5KUMA 4JGSA 5KAFZ 5CA0B 3DTUB 2UXNA 5CB4B 3K79A 1FXKA 3CHXA 3X2QB 1XNQO 5HFLA 3X2QC 1DF5A 3AK1A 3RFRA 3HB3B 3RYIA 4ABMA 2VQFB 1JCHA 1VF6C 3ZN1A 4Z2WA 4JYAO 3CEIA 1M56B 3D3IA 1FFTB 2JEUA 1M56C 5L3BA 2XTAA 5BMVB 3K57A 2F4VB 4B3SO 3JASB 3KKYA 3ZBHA 1TAEA 2O57A 1AI4A 3HKBB 2WAMA 2V4DA 2HHHB 2BCCH 2B5UA 4JYCA 4BIZA 4GCZA 4GKJB 4CS4A 2Z3YA 3R65A 1N32O 3SR2C 1Q82W 1B6QA 4J9YB 2QWPB 5IJ0B 3J81N 4JTDB 5LXTB 1ZX3A 3OR6C 1BS3A 1EN4A 4HBNA 4LFAB 1F51A 1ZTEA 4GT1A 5ITZA 3THOA 1S5LZ 2UXXA 3AG2B 3UT5A 3JAKB 4UVCA 1W59A 1QU7A 1VARA 4DRXB 4OX9B 1ENVA 2IH3C 2W0FC 2PF4E 4X88A 4CH5A 1K92A 1XNQB 4UV8A 1PNMA 3IC7A 5LGTA 3LSSA 4X1IA 2QDOA 3RVZA 2IJIA 1DGSA 2LQTA 1L0LH 4JYAB 4RO2A 1KU9A 2E5LO 4D7SA 4B3SB 2WLLA 5BY1A 4DV5O 3CMEV 3SYQA 1GMGA 3CRCA 4K8XA 1FPOA 2EBOA 5IE9A 1BQZA 2YEVB 3JYCA 1ZLZA 4LBEC 3S3XA 1N32B 2XAJA 4H44B 2Q68A 3SPHA 3SPJA 2XNDG 4CC5A 4IHJA 1FFXB 2QM8A 2OTJV 1W2BU 2ZINA 4ZOLB 1Q6IA 2FMLA 3UM7A 1H2MA 5C8YB 3LSUA 3QO5A 2PUSA 3Q4HB 3BEHA 4P2ZA 1OCZB 5LOVA 1OCZC 3NXSA 2GV9A 2RNBA 3HPLC 2OT5A 1QLEB 1QLEC 4MVMA 4P30A 4B7KA 2YS8A 1EN6A 1YHQV 1FD9A 5IWAO 2JVDA 2FL4A 2X7RB 3ETGA 1K73W 1Y66A 3OW2U 4YJ3A 2E5LB 3QO8A 2PZSA 1K8AW 3C3SA 4DV5B 2BTQB 3ZMZA 4DV2O 3ZMUA 4UCTA 3VQVA 1HW7A 1OCOB 3L75H 1OCOC 2ODMA 2ZR3A 3BA8A 1JR9A 4MVUA 3RYHA 4FIPC 3WB1A 3CCEV 1M57B 3JD2A 4WFHA 1M57C 2DE0X 2LW7A 5H9CA 3DC5A 1K7DA 1YI2V 2OIGA 2GUZA 4JZGA 5LGNA 5ITZB 3A0RA 3LUTB 2QSAA 4JAUA 4AQYO 1AVMA 1A32A 4QPKA 4XDKA 3G6EV 2DYSB 2P06A 3K59A 4LF5O 1P49A 3K5OA 2A3QA 2CGOA 1IX9A 1EZVH 4ICGA 4N21A 4O2BA 2JS5A 2XAHA 4I4TB 4JI6O 3T2MA 1CP9A 1LNQA 1LUWA 4K8ZA 2X6BA 1YSCA 3BFRA 1MMMA 4K3AA 2Y48A 3JCZA 2QWRB 3JCUZ 2CH7A 1SQPH 1UFIA 2B1GA 4X65O 2EILB 3N2KB 3ZRVA 5IWAB 1IBLO 1K33A 3HKCA 1I0HA 4LF7O 1M1KW 1FAFA 4RUEA 3RYFB 4DV2B 4WCEV 2IJJA 2V1DA 1R3IC 4FLWA 2FYUH 1R6NA 2NN4A 2JGDB 3ZIAG 1R3KC 2GTAA 1AR4A 3QVNA 5FNVA 3MDSA 1SQFA 2CTWA 2F23A 1NJIW 3O65A 2HLDG 1FYJA 4PDRA 1GKFA 5J9PC 4PDVA 2YI8A 4W4LA 2Y69B 4IIJA 2Y69C 2KG7A 3W7TA 2K9PA 5CBGA 3CC2V 5DM6V 5J2TA 1SC5B 1Y67A 4AQYB 4LFCO 3LNMB 4J11A 4LC1A 3K9AA 4PA3A 1QBZA 5F2VO 3ZHSA 4LF5B 1YF2A 2DWDC 2QWOB 4QNHB 4GYCB 1S72V 4X1YB 1B04A 4WBNB 3B2EE 1NU1H 4JI6B 5B1AB 4PA9A 5B1AC 1VQNV 3R66A 1ZUQA 4ZI7A 3RW0A 4X65B 2HJFC 3LNNA 1IBLB 4CS2A 4AI8A 5LHGA 4DV4O 1OV9A 2ZD9A 4LF7B 3B8MA 4H13B 4B3RO 1MSDA 5J2UB 4O4HA 4GX0A 2LO1A 3ASOB 5GONB 3SYOA 2ATKC 5KX5A 3AK2A 2QEXV 4EB6A 4I55A 1HP8A 1COWG 1WA8A 4GZRB 1GM8A 4PD4F 1H2KA 5KHJA 3VBBA 1IBKO 1N36O 3MHSC 5IYBO 2LJ2A 1B3QA 3CPWU 4MVRA 1XMOO 4YIOA 4EKWA 3OMAB 3TXSA 2JEXA 2YIBA 3H1IH 4G2KA 2Y4UA 5JJEB 4LFCB 1X4TA 1GTOA 4UFZA 3IAYA 2K1EA 3CX5F 4MVZA 4F4LA 3BPZA 2AXTZ 3G71V 1MA1A 4TUYB 3B77A 1AILA 1N0JA 4NB5A 3W7XA 1UJWB 1TA8A 2CH7B 3AG3B 5CA1B 3ABTA 4PI0A 2RN9A 3C3TA 2EZPA 5CB4A 3E8GA 1PP9H 4DV4B 4QE7A 3JD4A 4FFBA 3F7YC 1VF6A 5FNVB 1Q5OA 4GX5A 1Y4MA 4B3RB 2ZKOA 2QKSA 3ICXA 4PV1B 4JYBA 3BHPA 5BMVA 4PA6A 4GUNA 1Q43A 1AJNA 3JASA 2VWJA 5H5NA 2HR3A 1BZKA 2QJ1A 2ZR2A 5J2TB 1IBKB 1N36B 4NTXA 2MK3A 2ADPA 4DV6O 1XMOB 5LP6B 2GBOA 1WNSA 2BOBC 2WLJA 3H01A 4I7ZB 3WU2Z 3CXHF 1JFFB 1GM9A 2B9ZA 1H38A 2VRZA 5IJ0A 5LXTA 4I50B 2HVKC 2WLKA 2Y0PA 4Q6GA 2CAZC 1NBMG 3OAAG 3CRAA 4JI2O 4UXNA 3JAKA 3QTCA 2QTSA 1VP7A 4XDLA 2KSDA 3L70H 1G1XB 2Q0OC 2E75B 2ITCC 2L35A 4B3TO 1PNKA 3T1YO 5DEDA 1K34A 4WFBV 4PELA 1GN2A 1VQ8V 1AP5A 1KKCA 4DR5O 2OCHA 2E76B 3JATB 4YHHO 2XOKG 3U0ZA 4U3JA 3MHHC 1QNMA 4GKJO 2XT9A 4H37A 2PI4A 1RPRA 3ASNC 1WLEA 2YEVA 3TGUH 1N33O 4DV6B 1EN5A 2D2CB 1L0NH 3SJBC 3T1CA 2Q4PA 4DV1O 1YXBA 1NTZH
chains in the Genus database with same CATH topology
3IJ4A 2L35A 4NTXA 4NTWA 2QTSA 3N27A 2FB5A 4FZ1A 1WP7A 4NYKA 4FZ0A 4NTYA 3S3XA 1WP8A 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ4 A;  2L35 A;  4NTX A;  4NTW A;  2QTS A;  3N27 A;  2FB5 A;  4FZ1 A;  1WP7 A;  4NYK A;  4FZ0 A;  4NTY A;  3S3X A;  1WP8 A;  3S3W A; 
#chains in the Genus database with same CATH topology
 2QWN B;  3OMI B;  1FFX A;  4KL1 A;  4NTY A;  2AGA A;  2XUM A;  1XUQ A;  3K08 A;  4ZOL A;  1S5J A;  4JI2 B;  3E86 A;  1GM7 A;  3KCX A;  3L73 H;  3K9S A;  4J41 A;  1Q86 W;  2EIM B;  1ZSP A;  4LH7 A;  2EIM C;  2RQ6 A;  2F66 C;  2Q69 A;  1QR9 A;  4LCU C;  1K5Q A;  2UXB O;  1K9M W;  3B09 A;  5C8Y A;  5KA6 A;  1KEC A;  1FXV A;  4B3T B;  4KFM A;  3Q4H A;  4FFB B;  1WB8 A;  3T1Y B;  3CCU V;  3PN1 A;  4GX1 A;  1U96 A;  4DR5 B;  3ZRS A;  2CDY A;  4B3M O;  4QE9 A;  4X64 O;  2OWO A;  4YHH B;  2ADQ B;  3VQY A;  4UVA A;  3OGI B;  5L3G A;  3NR7 A;  2BTQ A;  1D5N A;  5H2F Z;  4UB6 Z;  2HFE C;  3OTF A;  3OFN G;  4FM2 A;  2XAF A;  1N8R W;  1N33 B;  5E79 Z;  1SZT A;  5LHI A;  3ZMT A;  2IU0 A;  1Q3E A;  4IGG A;  2OYQ A;  2Z5U A;  1O9G A;  2FKX A;  3VQW A;  2QM4 A;  4PHZ A;  1P7B A;  2GHY A;  4DV1 B;  3I5D A;  1XEQ A;  1R1B A;  2B1I A;  1YZB A;  2RJZ A;  3KCY A;  3FB8 C;  1JJO A;  3FKS G;  3M8A A;  2ZE6 A;  3JAL B;  2UUB B;  5LA6 B;  4JI4 O;  1NTM H;  1K97 A;  2YSU B;  3CRQ A;  1F7Y A;  4DUZ O;  1BQ0 A;  5DEC A;  4BR6 A;  2AZ0 A;  5JH7 B;  4FVM A;  1GK9 A;  4CH6 A;  4L87 A;  5FL7 G;  2UXB B;  5KHK A;  1M9N A;  2CK3 G;  4NXN O;  2ZE5 A;  4I4T A;  5A2Q N;  5JQG B;  4FZ0 A;  1BHA A;  3H1K H;  1D5A A;  3HR0 A;  2CE4 A;  3OGC C;  2DQ0 A;  5IJ9 B;  5B3S B;  5IY5 B;  5B3S C;  4B3M B;  5IY5 C;  4U3J B;  1I94 O;  3N2K A;  4X64 B;  1JMK C;  4EFB A;  4ZIB A;  2LGQ A;  4X62 O;  2FTK A;  4O4I B;  2AHY A;  3RYF A;  1HR0 O;  1GRJ A;  3C90 A;  4X89 A;  3E89 A;  2ZDI C;  2JGD A;  2EUL A;  4QPJ A;  4XDJ A;  4IT5 A;  5IYD O;  4MW3 A;  4H33 A;  3DGE A;  3AG1 B;  2DYR B;  3AG1 C;  2QGN A;  2UXD O;  2A7W A;  2DYR C;  3CXC U;  5JVD B;  4Z1M G;  2RCV A;  1F4M A;  3ETD A;  1GO3 F;  3ABK C;  3SYC A;  3CYO A;  1Q6U A;  4JI4 B;  4DUZ B;  4QJF B;  2Q6A A;  4E2L A;  1FJG O;  3K0D A;  4FJC C;  1WJZ A;  2IJH A;  2PTM A;  1HWY A;  3CS5 A;  3B8N A;  1VF7 A;  4ZBM A;  5B1B B;  2PYJ A;  5B1B C;  3SDL A;  1ARO P;  4X1Y A;  3AG7 A;  4FFK A;  1NH2 D;  4WBN A;  4NXN B;  2JRI A;  2N74 A;  3CB2 A;  2A0L A;  3JAR B;  4FK5 C;  1GN3 A;  2Q7H A;  3ABL B;  3D3Q A;  3ABL C;  1CXZ B;  1BT8 A;  1I94 B;  1SRY A;  5EYP B;  1IZ3 A;  2N05 A;  4HZ3 A;  3BA9 A;  1LUV A;  4TQD A;  4MSW C;  4X62 B;  4WFG A;  1HR0 B;  3N2G A;  1EZJ A;  5H6Q A;  2D3O W;  3ABU A;  1G6U A;  1Q8I A;  3CD6 V;  3E8H A;  1NZ6 A;  4NYK A;  5J2U A;  5FPR A;  2GDS A;  5IT9 N;  2IBZ H;  4I5S A;  5GON A;  5L3D A;  4DV0 O;  2ARH A;  1RSO A;  2P4V A;  2UXD B;  1XQ8 A;  1M4U A;  3FB5 C;  4J7K A;  1AJQ A;  4UB8 Z;  2WLM A;  2P6J A;  4TV8 B;  2X6A A;  1N0N A;  3JAW A;  3SPI A;  2QM7 A;  2Y0I A;  3OR7 C;  2F95 B;  2H8P C;  4UV9 A;  4JI1 O;  1KQS U;  4J42 A;  5KAI Z;  4WFF A;  1ZL8 B;  2LFR A;  1PKX A;  1FJG B;  2PI5 A;  3OTO O;  1E1R G;  3CJH B;  4YY3 O;  1YIJ V;  5L3F A;  1G4Y B;  2BE3 A;  4JV5 O;  3IC9 A;  1TUE B;  3A0B Z;  4BW9 A;  4FLY A;  3WG7 C;  3WB0 A;  4TUY A;  3CMA V;  3G4S V;  3OM3 B;  3OMN B;  5KMG B;  5CA1 A;  4OPA A;  4Z1V A;  2WLI A;  1S0V A;  5LHH A;  3BAB A;  1L1F A;  3UO2 A;  5JCO C;  2KKW A;  2M6Y A;  2ZIO A;  3RGB A;  4YJ2 B;  1NVP B;  1QCE A;  4R6Z A;  1VQO V;  4PA7 A;  4J9Z B;  3FB7 C;  2WPD G;  1QHT A;  1Z5W A;  1VQP V;  3WFV A;  3I55 V;  3ZED A;  4DV7 O;  4JTA B;  3AEI A;  1V54 B;  4DV0 B;  2P5O A;  3U10 A;  1V54 C;  4DR2 O;  1J5E O;  4CH4 A;  3EFF K;  2JGU A;  3E8B A;  3OUF A;  4PI2 A;  1F23 A;  5EZY B;  3S3W A;  2ZE8 A;  3BRC A;  4U3F H;  3BVO A;  2Q7G A;  4RAI A;  1SQB H;  5A9G A;  1KB9 F;  5LP6 A;  4JI1 B;  3SYP A;  3EHB B;  4FLU A;  4MS2 A;  2P67 A;  1JFF A;  1IUR A;  2VWK A;  1NT2 B;  1WB7 A;  5CMU A;  3OTO B;  1H8H G;  3RYC B;  3K06 A;  1OHH G;  5L3C A;  4UCS A;  4DW0 A;  4YY3 B;  3P3N A;  4JV5 B;  4I50 A;  1J95 A;  2QTO A;  4HNA B;  3BCC H;  1AB3 A;  1YTF D;  1K4D C;  3OE7 G;  3ZHU A;  2DJV A;  1HNZ O;  5JWP A;  3H1H H;  3ZRX A;  1H8E G;  2IM9 A;  1JJ2 U;  2A79 B;  3KZI Z;  5BXZ A;  3N2G B;  3QNE A;  2ZQM A;  2WSS G;  1VQ7 V;  4PDM A;  1W0K G;  4DXW A;  1KP2 A;  1YCI A;  4TV9 A;  1RSO B;  3JAT A;  4DV7 B;  1R3J C;  1I5Y A;  1E1Q G;  2NR5 A;  4DR2 B;  1J5E B;  2A06 H;  3DC6 A;  3JAW B;  1WAZ A;  1BL8 A;  1VQ4 V;  3JSN A;  1KD1 W;  2L6L A;  3QG5 A;  4KXR A;  4R8C A;  3T4D A;  2VQE B;  5IYC O;  4LF6 O;  4O4L B;  4UCU A;  1FS0 G;  4NR1 A;  5BZB A;  3UKM A;  3H9V A;  4U7N A;  1ZAU A;  1MZE A;  3B4S A;  3APO A;  5EIB C;  3ZS8 C;  4LF9 O;  2WLI B;  1MNG A;  2RDC A;  1HNZ B;  1S5H C;  4J7Z A;  3P3P A;  2AW9 A;  3UCS C;  1URF A;  4JI7 O;  4P9O A;  5IYZ B;  3VQX A;  4LF8 O;  1YVW A;  4JZ2 A;  4FLV A;  3UO3 A;  1KP3 A;  2LW1 A;  2QR4 A;  1ZWI C;  4ASU G;  1XI1 A;  3STZ C;  4CS3 A;  1IXB A;  2JJ1 G;  4G28 B;  1NH2 B;  1Q6H A;  4TSF G;  2EIK C;  1YIT V;  3BY6 A;  1VIB A;  1GN4 A;  3CCR V;  3E8F A;  3LDE A;  5K1X A;  4JI5 O;  1VQ9 V;  1WN7 A;  3W7W A;  3FD9 A;  1SER A;  2Y4T A;  4OGQ B;  2WA3 A;  3K5N A;  2R9R B;  2DMX A;  4LF6 B;  4D7T A;  4X1K B;  1WPB A;  3ZCC A;  3JAL A;  4MTO A;  1WP8 A;  3SPC A;  5LA6 A;  4F6R B;  1H2S B;  3GVM A;  2YI9 A;  3JD0 A;  4LF9 B;  5JH7 A;  3VOU A;  1MOF A;  2XAQ A;  3IJ4 A;  3K0G A;  4DK0 A;  1YDX A;  1VF5 B;  3M99 B;  4LNU B;  4JI7 B;  4MTG A;  5KLV H;  2WLN A;  4LF8 B;  4QIW F;  5JQG A;  4TV9 B;  1L8D A;  4JTC B;  5B5E Z;  3ZRW B;  1DK1 A;  1V9P A;  3OD4 A;  1IXM A;  2LFS A;  5IJ9 A;  3ETQ A;  5IDJ A;  3E2E A;  2YUA A;  3F5W C;  4EFE A;  5KHG A;  4O4I A;  3ASN B;  3G80 A;  1OCC B;  3K58 A;  1OCC C;  2ZDI A;  2LP7 A;  2BSK B;  1XOU A;  1RP3 B;  4LFB O;  2YDE A;  4JI5 B;  2ZCE A;  2BOC C;  4EEQ A;  4WFE A;  4YXW G;  1AR1 B;  4UCO A;  5JVD A;  5L3E A;  2P90 A;  2PY5 A;  3OEE G;  1NR7 A;  4J80 A;  4UUJ C;  1SF9 A;  4I0X A;  2UUB O;  5H6R A;  4MTF A;  1G8M A;  4X9Q A;  2ZM6 O;  2W0X A;  4I9W A;  1K5S A;  1NVP D;  1IVS A;  5FLX N;  4GX2 A;  4X20 A;  2RMK B;  2CGN A;  2Q0A A;  3L72 H;  4K0K O;  1MSW D;  2EJR A;  3FYI B;  1BMF G;  5B1O A;  3T1H O;  2X0L A;  1PM9 A;  3ZHV A;  1SA0 B;  2Q7E A;  3CCS V;  4YIP A;  1YEW A;  5B1N A;  1KC8 W;  3JAR A;  3TJT A;  3DXR B;  1NR1 A;  3K5L A;  4NKG B;  3ZN0 A;  3ZMS A;  5LMN O;  1N4C A;  4CC6 A;  5EYP A;  3OUS A;  2ILM A;  2VS0 A;  1MZF A;  4RUF A;  1YTF B;  4PDL A;  2CTP A;  3GWO A;  4BIU A;  1Y76 B;  3DSQ A;  4BWA A;  4MVS A;  4CH3 A;  3O9O A;  4LFB B;  4LWS B;  2WWW A;  2YID A;  2P7T C;  3IGA C;  4LR3 A;  2CTQ A;  3RBZ A;  3L71 H;  1XIL A;  4TV8 A;  5LL6 Y;  2Q73 A;  4IYI A;  3FX7 A;  2F1M A;  2ZM6 B;  1SQG A;  4W4K A;  2MW2 B;  1ZL8 A;  3STL C;  4IYH A;  1ORQ C;  2Q9L A;  1VQM V;  3WB2 A;  1M5I A;  3FAV B;  3L9D A;  4PA4 A;  4K0K B;  3CJH A;  2QWQ B;  1OCR B;  1AI6 A;  1U97 A;  1OCR C;  1AP6 A;  2Q5Z A;  5LYJ B;  2XAG A;  4AHC A;  3T1H B;  1JVM A;  3AG2 C;  3HKE A;  5EBL C;  4UCV A;  1HNX O;  4F6E A;  1QVG U;  4D6T H;  4A5U B;  3CC4 V;  4R7C A;  3A8T A;  3D8C A;  5KMG A;  4J7J A;  2AHZ A;  4ZHQ A;  1CPY A;  1TVK B;  5LMN B;  4XBF A;  5JCO A;  1NKD A;  3K03 A;  1DTO A;  1E79 G;  2HJD A;  3ML0 A;  1TUB B;  4O2A B;  4YJ2 A;  2PYL A;  1SQV H;  5EC1 C;  3MD0 A;  2YXH A;  3B40 A;  1XMQ O;  2A9H A;  2DOS A;  5K1P A;  2IU3 A;  4DV3 O;  4FMT A;  5EIB D;  3H1J H;  1SET A;  1Q81 W;  3OEH G;  4I0X B;  1Y74 A;  2YIA A;  5EZY A;  3ABK B;  4BIO A;  5KUK A;  2EX3 A;  4JI8 O;  3HKD B;  1QVF U;  3GWK C;  1I7F A;  3G6B A;  2ZNI A;  3T4Z A;  2QA4 V;  2UU9 O;  1AJP A;  5GTH Z;  4X20 B;  4U7O A;  5LGU A;  1M90 W;  2F43 G;  5CBH A;  1W0J G;  5GW7 A;  3CRM A;  3RYC A;  3D36 C;  1THZ A;  4RWU A;  4WF9 V;  3CCQ V;  1T5E A;  3W7S A;  5JJJ B;  1US6 A;  1VEW A;  1EFR G;  1DF4 A;  1BSM A;  1HNX B;  2JS3 A;  3F7V C;  4MVQ A;  4B7E A;  4HNA A;  1AI7 A;  1FXK B;  1H2G A;  1FXK C;  4QGP A;  4KP4 A;  1XL6 A;  3RYI B;  1EBO A;  1F4N A;  1Y6X A;  3JD1 A;  4JI3 O;  1JQ0 A;  1PL0 A;  1XRE A;  5C93 A;  1Q90 D;  1ROP A;  1YJ9 V;  2XAS A;  5TIS Z;  2E3C A;  2AZ2 A;  2HKO A;  2UXC O;  4MW8 A;  4B08 A;  2HVJ C;  3M7M X;  1BGY H;  1VQL V;  1AR5 A;  1JA8 A;  1XMQ B;  3JSL A;  2ZIM A;  1KUQ A;  4DV3 B;  4CZZ A;  1YJW V;  1M93 A;  3E22 A;  2EZO A;  4K35 A;  4LH6 A;  4GKK O;  3QO7 A;  2JJ2 G;  1GAX A;  2ZXW B;  4I9Q A;  3LDD A;  2ZXW C;  4JI8 B;  5LBQ A;  5EBM C;  2UU9 B;  2DWE C;  2OCC B;  2OCC C;  1UPG A;  4MVO A;  1JOY A;  1VQK V;  2NNU A;  4DR1 O;  2Q8V A;  4O4L A;  3ZHR A;  3CRR A;  4C7U A;  2ZNJ A;  3UT5 B;  1VQ6 V;  3HKE B;  1I08 A;  1EM1 A;  3WG7 B;  2DYS C;  4OPH A;  2V7Q G;  1B06 A;  3QF7 A;  4ZHQ B;  4FLX A;  2N04 A;  3E83 A;  2CTR A;  4DUY O;  1NI8 A;  5B66 Z;  4FM1 A;  2EJ7 A;  4X1I B;  5HFM A;  2P4K A;  4JI3 B;  4DYL A;  5IYZ A;  3J80 N;  3AG4 B;  1R6K A;  4DO2 A;  3AG4 C;  3FYE B;  2YIB D;  3I56 V;  1MAB G;  1TGO A;  2UXC B;  3EVK A;  2YXY A;  2WLL B;  2EIL C;  3SJQ C;  5AG2 A;  3ZX6 A;  4JAA A;  3SGI A;  2X6C A;  5D5P A;  4WFA V;  4JAV A;  4X66 O;  3LDC A;  1Y74 B;  2JK5 C;  5EK0 A;  3SJA C;  3L74 H;  4GKK B;  1KMI Z;  3APQ A;  4NXM O;  1H2N A;  2W6I G;  4LP8 A;  4KUM A;  2JDI G;  1OZ0 A;  1Z5V A;  2VQE O;  3CWB H;  1HDJ A;  1R73 A;  2JIZ G;  4Q20 A;  3U11 A;  2EIJ B;  2Q67 A;  4IHJ B;  3CCL V;  3CP1 A;  1Z2G A;  2EIJ C;  1K3E A;  1O9H A;  2YXL A;  3RT3 C;  1NS1 A;  3ZJZ A;  4DR1 B;  1NQT A;  2NLJ C;  1SKV A;  4X1K A;  1BCC H;  4MTX A;  1JPX A;  1K4C C;  4UCR A;  3FFQ A;  2G38 A;  3LSQ A;  4RQF A;  4F6R A;  2DQ3 A;  3EXA A;  2BTO A;  4J10 A;  5EBW C;  2R70 A;  3RVY A;  5LOV B;  1N34 O;  3ETE A;  2R72 A;  3FB6 C;  3RN4 A;  2EIN B;  3TK1 A;  2EIN C;  3GB7 C;  4DUY B;  2W6J G;  3K5M A;  2HEP A;  5LMU O;  4LNU A;  4DR6 O;  2WA4 A;  4BW5 A;  1GH6 A;  1PD3 A;  4G27 B;  4YJ3 B;  1I5X A;  1VMG A;  1KYO F;  1QR8 A;  3ZRW A;  3AK3 A;  2HP8 A;  2LGW A;  3E22 B;  2YIC A;  3TET A;  1IDS A;  1RPO A;  1AI5 A;  4FPP A;  4MT8 A;  3G67 A;  4FM0 A;  4IL6 Z;  1OJH A;  2ETN A;  4X66 B;  4DR7 O;  4O4J A;  5CA3 A;  3PJS K;  2DN9 A;  3P32 A;  4NXM B;  2KQX A;  3RYH B;  1R3L C;  1LR1 A;  4TT3 G;  3ASO C;  2BSK A;  1FKA O;  1KBH A;  2ZT9 B;  2GUZ B;  5E1A C;  3K04 A;  4JPR A;  2R9A A;  1HNW O;  4UVB A;  3CCV V;  1WPX A;  1XBL A;  2FB5 A;  1S3J A;  1R6T A;  1BE3 H;  3SYA A;  4DK1 A;  2ITD C;  3BAA A;  1QLN A;  4H0L B;  2DW4 A;  5CBF A;  4DR3 O;  5KA5 A;  2WLH A;  4O2B B;  4JYY A;  2H94 A;  1N34 B;  3MAQ A;  1XNR O;  2IH1 C;  4HAM A;  1SQQ H;  1RFY A;  4N23 A;  5LMU B;  3SJC C;  4DR6 B;  1D2D A;  1SA0 A;  4AIL C;  3AG3 C;  1BHB A;  3J7A U;  3HKC B;  5CA0 A;  1XL4 A;  3CCJ V;  1XHX A;  2UUA O;  1MG1 A;  3DXR A;  3A0H Z;  1YJN V;  4TOI A;  3CSX A;  3IFX A;  3A2F A;  1SS3 A;  2EIK B;  1P84 F;  1SES A;  4DR7 B;  4DR4 O;  1KKD A;  1JX9 A;  2QKA A;  2YC0 A;  1X59 A;  2C2A A;  5KHI A;  1Y76 A;  2OTL V;  4FZ1 A;  2UUC O;  4L8J A;  4IIJ B;  1CEZ A;  3OT7 A;  5GTI Z;  4LWS A;  2KG7 B;  1PPJ H;  2M7W A;  4LF4 O;  1NTK H;  2OIE A;  3HKB A;  4KHP O;  1HNW B;  3ZMV A;  5BR8 O;  2XHB A;  5LP6 C;  2QE7 G;  1H2L A;  1IBM O;  4X8A A;  2CUG A;  5FPO A;  1WP7 A;  4RQE A;  2P22 C;  3H1L H;  2Z0A A;  4DR3 B;  2KB1 A;  4R50 A;  3FAV A;  4JI0 O;  1RM1 B;  1RM1 C;  3N27 A;  1GN6 A;  1XNR B;  4PJ0 Z;  3K3W A;  4TQF A;  5LYJ A;  2IJK A;  1P4R A;  1V55 B;  4ZI7 B;  1V55 C;  2F93 B;  4JF3 A;  3E35 A;  4DRX A;  5DN6 G;  2R9I A;  1XHZ A;  1VQ5 V;  1S77 D;  3TCU A;  1QQC A;  1FXH A;  4DW1 A;  3TXQ A;  2VQF O;  2UUA B;  2HG5 C;  4BAY A;  1TVK A;  2GSM B;  4O4J B;  5EC2 C;  5KHH A;  4OXS A;  4O4H B;  4DR4 B;  1TUB A;  4O2A A;  2QKC A;  2E74 B;  4TWK A;  2F4V O;  5KX5 B;  2GTS A;  4EB6 B;  4I55 B;  1SZX A;  1WA8 B;  1S76 D;  4ZKI A;  3F5T A;  1Q7Y W;  4FLZ A;  2HHH O;  2UUC B;  2PGG A;  4P9P A;  4CBC A;  1P7G A;  3JD3 A;  1SQX H;  1PL4 A;  4LF4 B;  5CN0 A;  4KHP B;  3JAM N;  4GLX A;  5BR8 B;  4NTW A;  3UQ8 A;  4E4E A;  1PV0 A;  2ZE7 A;  5JJN B;  4NVP A;  3ZHQ A;  3HKD A;  1DLB A;  3W7U A;  1IBM B;  3CC7 V;  1XDC A;  1PNL A;  3SPG A;  3CE2 A;  3KG2 A;  3CCM V;  3RWR D;  4JAS A;  3ABM B;  4HYO A;  3ABM C;  4LFA O;  3D36 A;  4JI0 B;  4FLT A;  3P30 A;  2H3O A;  3ZHT A;  5D5Q A;  2IW5 A;  4OX9 O;  5KUM A;  4JGS A;  5KAF Z;  5CA0 B;  3DTU B;  2UXN A;  5CB4 B;  3K79 A;  1FXK A;  3CHX A;  3X2Q B;  1XNQ O;  5HFL A;  3X2Q C;  1DF5 A;  3AK1 A;  3RFR A;  3HB3 B;  3RYI A;  4ABM A;  2VQF B;  1JCH A;  1VF6 C;  3ZN1 A;  4Z2W A;  4JYA O;  3CEI A;  1M56 B;  3D3I A;  1FFT B;  2JEU A;  1M56 C;  5L3B A;  2XTA A;  5BMV B;  3K57 A;  2F4V B;  4B3S O;  3JAS B;  3KKY A;  3ZBH A;  1TAE A;  2O57 A;  1AI4 A;  3HKB B;  2WAM A;  2V4D A;  2HHH B;  2BCC H;  2B5U A;  4JYC A;  4BIZ A;  4GCZ A;  4GKJ B;  4CS4 A;  2Z3Y A;  3R65 A;  1N32 O;  3SR2 C;  1Q82 W;  1B6Q A;  4J9Y B;  2QWP B;  5IJ0 B;  3J81 N;  4JTD B;  5LXT B;  1ZX3 A;  3OR6 C;  1BS3 A;  1EN4 A;  4HBN A;  4LFA B;  1F51 A;  1ZTE A;  4GT1 A;  5ITZ A;  3THO A;  1S5L Z;  2UXX A;  3AG2 B;  3UT5 A;  3JAK B;  4UVC A;  1W59 A;  1QU7 A;  1VAR A;  4DRX B;  4OX9 B;  1ENV A;  2IH3 C;  2W0F C;  2PF4 E;  4X88 A;  4CH5 A;  1K92 A;  1XNQ B;  4UV8 A;  1PNM A;  3IC7 A;  5LGT A;  3LSS A;  4X1I A;  2QDO A;  3RVZ A;  2IJI A;  1DGS A;  2LQT A;  1L0L H;  4JYA B;  4RO2 A;  1KU9 A;  2E5L O;  4D7S A;  4B3S B;  2WLL A;  5BY1 A;  4DV5 O;  3CME V;  3SYQ A;  1GMG A;  3CRC A;  4K8X A;  1FPO A;  2EBO A;  5IE9 A;  1BQZ A;  2YEV B;  3JYC A;  1ZLZ A;  4LBE C;  3S3X A;  1N32 B;  2XAJ A;  4H44 B;  2Q68 A;  3SPH A;  3SPJ A;  2XND G;  4CC5 A;  4IHJ A;  1FFX B;  2QM8 A;  2OTJ V;  1W2B U;  2ZIN A;  4ZOL B;  1Q6I A;  2FML A;  3UM7 A;  1H2M A;  5C8Y B;  3LSU A;  3QO5 A;  2PUS A;  3Q4H B;  3BEH A;  4P2Z A;  1OCZ B;  5LOV A;  1OCZ C;  3NXS A;  2GV9 A;  2RNB A;  3HPL C;  2OT5 A;  1QLE B;  1QLE C;  4MVM A;  4P30 A;  4B7K A;  2YS8 A;  1EN6 A;  1YHQ V;  1FD9 A;  5IWA O;  2JVD A;  2FL4 A;  2X7R B;  3ETG A;  1K73 W;  1Y66 A;  3OW2 U;  4YJ3 A;  2E5L B;  3QO8 A;  2PZS A;  1K8A W;  3C3S A;  4DV5 B;  2BTQ B;  3ZMZ A;  4DV2 O;  3ZMU A;  4UCT A;  3VQV A;  1HW7 A;  1OCO B;  3L75 H;  1OCO C;  2ODM A;  2ZR3 A;  3BA8 A;  1JR9 A;  4MVU A;  3RYH A;  4FIP C;  3WB1 A;  3CCE V;  1M57 B;  3JD2 A;  4WFH A;  1M57 C;  2DE0 X;  2LW7 A;  5H9C A;  3DC5 A;  1K7D A;  1YI2 V;  2OIG A;  2GUZ A;  4JZG A;  5LGN A;  5ITZ B;  3A0R A;  3LUT B;  2QSA A;  4JAU A;  4AQY O;  1AVM A;  1A32 A;  4QPK A;  4XDK A;  3G6E V;  2DYS B;  2P06 A;  3K59 A;  4LF5 O;  1P49 A;  3K5O A;  2A3Q A;  2CGO A;  1IX9 A;  1EZV H;  4ICG A;  4N21 A;  4O2B A;  2JS5 A;  2XAH A;  4I4T B;  4JI6 O;  3T2M A;  1CP9 A;  1LNQ A;  1LUW A;  4K8Z A;  2X6B A;  1YSC A;  3BFR A;  1MMM A;  4K3A A;  2Y48 A;  3JCZ A;  2QWR B;  3JCU Z;  2CH7 A;  1SQP H;  1UFI A;  2B1G A;  4X65 O;  2EIL B;  3N2K B;  3ZRV A;  5IWA B;  1IBL O;  1K33 A;  3HKC A;  1I0H A;  4LF7 O;  1M1K W;  1FAF A;  4RUE A;  3RYF B;  4DV2 B;  4WCE V;  2IJJ A;  2V1D A;  1R3I C;  4FLW A;  2FYU H;  1R6N A;  2NN4 A;  2JGD B;  3ZIA G;  1R3K C;  2GTA A;  1AR4 A;  3QVN A;  5FNV A;  3MDS A;  1SQF A;  2CTW A;  2F23 A;  1NJI W;  3O65 A;  2HLD G;  1FYJ A;  4PDR A;  1GKF A;  5J9P C;  4PDV A;  2YI8 A;  4W4L A;  2Y69 B;  4IIJ A;  2Y69 C;  2KG7 A;  3W7T A;  2K9P A;  5CBG A;  3CC2 V;  5DM6 V;  5J2T A;  1SC5 B;  1Y67 A;  4AQY B;  4LFC O;  3LNM B;  4J11 A;  4LC1 A;  3K9A A;  4PA3 A;  1QBZ A;  5F2V O;  3ZHS A;  4LF5 B;  1YF2 A;  2DWD C;  2QWO B;  4QNH B;  4GYC B;  1S72 V;  4X1Y B;  1B04 A;  4WBN B;  3B2E E;  1NU1 H;  4JI6 B;  5B1A B;  4PA9 A;  5B1A C;  1VQN V;  3R66 A;  1ZUQ A;  4ZI7 A;  3RW0 A;  4X65 B;  2HJF C;  3LNN A;  1IBL B;  4CS2 A;  4AI8 A;  5LHG A;  4DV4 O;  1OV9 A;  2ZD9 A;  4LF7 B;  3B8M A;  4H13 B;  4B3R O;  1MSD A;  5J2U B;  4O4H A;  4GX0 A;  2LO1 A;  3ASO B;  5GON B;  3SYO A;  2ATK C;  5KX5 A;  3AK2 A;  2QEX V;  4EB6 A;  4I55 A;  1HP8 A;  1COW G;  1WA8 A;  4GZR B;  1GM8 A;  4PD4 F;  1H2K A;  5KHJ A;  3VBB A;  1IBK O;  1N36 O;  3MHS C;  5IYB O;  2LJ2 A;  1B3Q A;  3CPW U;  4MVR A;  1XMO O;  4YIO A;  4EKW A;  3OMA B;  3TXS A;  2JEX A;  2YIB A;  3H1I H;  4G2K A;  2Y4U A;  5JJE B;  4LFC B;  1X4T A;  1GTO A;  4UFZ A;  3IAY A;  2K1E A;  3CX5 F;  4MVZ A;  4F4L A;  3BPZ A;  2AXT Z;  3G71 V;  1MA1 A;  4TUY B;  3B77 A;  1AIL A;  1N0J A;  4NB5 A;  3W7X A;  1UJW B;  1TA8 A;  2CH7 B;  3AG3 B;  5CA1 B;  3ABT A;  4PI0 A;  2RN9 A;  3C3T A;  2EZP A;  5CB4 A;  3E8G A;  1PP9 H;  4DV4 B;  4QE7 A;  3JD4 A;  4FFB A;  3F7Y C;  1VF6 A;  5FNV B;  1Q5O A;  4GX5 A;  1Y4M A;  4B3R B;  2ZKO A;  2QKS A;  3ICX A;  4PV1 B;  4JYB A;  3BHP A;  5BMV A;  4PA6 A;  4GUN A;  1Q43 A;  1AJN A;  3JAS A;  2VWJ A;  5H5N A;  2HR3 A;  1BZK A;  2QJ1 A;  2ZR2 A;  5J2T B;  1IBK B;  1N36 B;  4NTX A;  2MK3 A;  2ADP A;  4DV6 O;  1XMO B;  5LP6 B;  2GBO A;  1WNS A;  2BOB C;  2WLJ A;  3H01 A;  4I7Z B;  3WU2 Z;  3CXH F;  1JFF B;  1GM9 A;  2B9Z A;  1H38 A;  2VRZ A;  5IJ0 A;  5LXT A;  4I50 B;  2HVK C;  2WLK A;  2Y0P A;  4Q6G A;  2CAZ C;  1NBM G;  3OAA G;  3CRA A;  4JI2 O;  4UXN A;  3JAK A;  3QTC A;  2QTS A;  1VP7 A;  4XDL A;  2KSD A;  3L70 H;  1G1X B;  2Q0O C;  2E75 B;  2ITC C;  2L35 A;  4B3T O;  1PNK A;  3T1Y O;  5DED A;  1K34 A;  4WFB V;  4PEL A;  1GN2 A;  1VQ8 V;  1AP5 A;  1KKC A;  4DR5 O;  2OCH A;  2E76 B;  3JAT B;  4YHH O;  2XOK G;  3U0Z A;  4U3J A;  3MHH C;  1QNM A;  4GKJ O;  2XT9 A;  4H37 A;  2PI4 A;  1RPR A;  3ASN C;  1WLE A;  2YEV A;  3TGU H;  1N33 O;  4DV6 B;  1EN5 A;  2D2C B;  1L0N H;  3SJB C;  3T1C A;  2Q4P A;  4DV1 O;  1YXB A;  1NTZ H; 
#chains in the Genus database with same CATH homology
 3IJ4 A;  2L35 A;  4NTX A;  4NTW A;  2QTS A;  3N27 A;  2FB5 A;  4FZ1 A;  1WP7 A;  4NYK A;  4FZ0 A;  4NTY A;  3S3X A;  1WP8 A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...