1WP8A

Crystal structure of hendra virus fusion core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQKILDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion glycoprotein F0,Fusion glycoprotein F0
publication title Crystal structures of Nipah and Hendra virus fusion core proteins
pubmed doi rcsb
source organism Hendra virus
molecule tags Viral protein
total genus 30
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp8A00
1WP8A 3N27A 4NYKA 2QTSA 1WP7A 3S3WA 4NTWA 4NTXA 4FZ1A 3IJ4A 2FB5A 3S3XA 2L35A 4NTYA 4FZ0A
chains in the Genus database with same CATH superfamily
1K7DA 4ABMA 3E8BA 4DK0A 2ZDIA 5CBHA 1M57C 4HYOA 4X1KA 1GRJA 3S3WA 5E1AC 2Z0AA 2P90A 4AQYO 4MVUA 3DTUB 4L87A 4MS2A 2YIBA 1XMOO 4GCZA 4DXWA 4X62B 3F5TA 1KC8W 2PY5A 1COWG 4YY3O 3S3XA 3QG5A 4LNUB 4HNAA 5KMGB 3G6EV 1Z5VA 4BW9A 3K0DA 2YUAA 1HWYA 2BCCH 3E8FA 5IJ9B 3F7YC 4DUYB 4JTCB 3JD2A 3W7XA 4ZOLA 4DR6O 2ZR3A 3K5OA 4X1IA 5EYPA 1H2LA 3RT3C 2JGDB 5ITZA 1PM9A 3M7MX 4NTXA 3G71V 1OCZC 2HKOA 1BCCH 2IU0A 2V7QG 3JAWB 3AK1A 2UXDO 2CK3G 4PELA 3TGUH 1K73W 4X20B 2OIGA 4J9ZB 2H8PC 1BL8A 4J7KA 2A0LA 2BOBC 4BW5A 1DTOA 3N2KB 1D2DA 1K3EA 4CH6A 4NXMO 1SKVA 5L3EA 4LF4B 1HNXO 4J41A 1V9PA 1W2BU 2ADQB 4DW0A 2KG7A 4JPRA 2IU3A 3CS5A 5IJ0A 3E2EA 4KL1A 3K59A 1PKXA 3UQ8A 2WLJA 1M5IA 4TQDA 4H33A 2Q0AA 3LNMB 4NVPA 1IBKO 1DGSA 3FB7C 1QU7A 3CCRV 1RFYA 1BSMA 1A32A 5B66Z 2ZE6A 5CB4B 1VQLV 4JI2O 2BTOA 5KX5B 2H94A 1V55C 2ETNA 2QR4A 3ZHUA 4UUJC 4QJFB 3EHBB 5IYBO 5JCOC 2HVKC 3T4ZA 4WFFA 1N33O 5IT9N 2WLHA 1FKAO 3IFXA 2JGUA 2X6AA 1FPOA 1NH2D 4AQYB 3DSQA 2GV9A 5AG2A 3E86A 4O2AB 1EFRG 2EJRA 2RN9A 4I50B 3SJCC 5EBMC 1XMOB 1J95A 2AW9A 2F95B 1K8AW 1Q8IA 4FIPC 5LOVB 4FLVA 2AZ2A 4YY3B 5LYJB 1YVWA 4DV4O 5FNVA 3CRQA 1ZL8A 4UB6Z 4I4TB 3HKEA 1YXBA 2OWOA 4PDLA 2QM4A 3OT7A 2OYQA 4JYAO 1WPXA 4BIOA 4UCVA 5CA0A 5GTIZ 5BMVA 5LMNO 1HDJA 4ZHQA 2ZT9B 4DR6B 3L9DA 4UB8Z 5B1AB 4LBEC 4UCRA 4DK1A 1QHTA 4EFEA 3LNNA 4X1YB 2Q7HA 3SGIA 1W0JG 1Y76B 3ZN1A 2XT9A 1BQZA 4O2BA 3SR2C 4CH4A 3N2GB 1M1KW 5FL7G 2CTRA 3M99B 5B1AC 2UXDB 2L35A 4F6RB 3FAVB 2LP7A 4YJ2A 2DOSA 3K5LA 3I56V 2B1IA 2PUSA 3F5WC 2QA4V 4R7CA 5JWPA 3A0RA 4NXMB 2LGQA 5C8YA 3JYCA 3ASOB 3UT5A 1QNMA 1HNXB 3UO3A 2YS8A 5LGTA 1M4UA 1L0NH 2FYUH 3OR6C 3CRCA 1YJNV 3BABA 1EN4A 1ZLZA 5K1XA 1IBLO 3ASOC 5H5NA 1G6UA 1JFFB 3ZRWB 1VQMV 1IBKB 3OD4A 1SQVH 2YIAA 3RWRD 4YXWG 4AILC 4EFBA 1VF6A 5JVDA 1BZKA 1EZVH 2QKSA 4UCSA 3D8CA 2HHHO 3UM7A 3P32A 2YDEA 4JI2B 3OR7C 5DECA 1GN4A 1RSOA 2XASA 1MZFA 4EB6B 1N33B 4BWAA 1VQ5V 4JF3A 4IYHA 5D5QA 4LWSB 1X4TA 3WU2Z 1SS3A 5JQGB 4J7ZA 3ZRVA 3RYCB 2QWQB 4O4JB 2Y4TA 2RNBA 3AG1B 4J11A 3HB3B 2AGAA 3VOUA 1GM7A 2YEVA 5IYZB 1D5NA 5K1PA 2XAJA 1MSWD 2EBOA 2X6BA 1VQ6V 1W59A 3H1JH 3B8NA 4QE9A 3AG1C 4JGSA 3W7SA 5J2TB 3JD0A 2PZSA 2BTQA 2WA4A 4DV4B 3JAMN 3RYFA 4JAVA 3DC6A 3SPJA 4X9QA 4JYAB 1VIBA 4PDRA 3RYIB 2JEXA 2VQFO 1YHQV 4FFKA 5LMNB 5E79Z 4TT3G 4I55B 4B7EA 3ABUA 3R65A 1TUBB 4PJ0Z 4X89A 4DUZO 2CGOA 5GTHZ 3RYHB 4DR2O 1TUEB 2A9HA 5KAIZ 3K03A 4QPKA 3LUTB 4GX0A 4JI0O 1HNZO 1TA8A 3WB1A 2W0XA 3A8TA 4TOIA 3MHSC 1GH6A 4FFBB 3ZMUA 5IY5C 1B3QA 1QQCA 3LDCA 4WFEA 5KHJA 4O4LA 1WA8B 2N04A 3AG2B 4LF6O 3CXCU 3E22B 3JAKA 2NR5A 2YICA 3THOA 3T4DA 1FFXB 1L8DA 4G27B 4ZI7B 3BEHA 2B9ZA 3F7VC 2DYSB 2BE3A 1MNGA 1IBLB 5GONB 1BE3H 3QTCA 1OCOB 1H2KA 1XILA 5LP6C 2CTWA 3SPCA 2WLLA 2UXBO 2E75B 1QVFU 1YJWV 2DYSC 1K4CC 3KCXA 1OCOC 2HHHB 4KUMA 2FB5A 1PPJH 4DW1A 1ZSPA 3IGAC 2IJHA 5J2UA 1L0LH 1XHXA 3KKYA 1AJNA 3SYQA 1FXKB 2NNUA 1PD3A 1GM9A 4XDKA 1SZTA 2ARHA 1M56B 1P84F 1NTKH 1OCRB 1Q7YW 3P3PA 2WAMA 4DR7O 4JASA 1CXZB 4GUNA 1H2GA 1NQTA 4NXNO 4XDJA 3CC7V 4QE7A 4MVRA 1M56C 1N36O 1FFTB 3C90A 2CDYA 1OCRC 3JCUZ 1OV9A 4OGQB 1KD1W 3U10A 3JARA 2N74A 3H9VA 1NR1A 3B2EE 1HNWO 3CRMA 2ODMA 3K57A 4FLUA 2ZR2A 1AI5A 2P6JA 3K5MA 1KYOF 3PJSK 2VQFB 1ZTEA 3H1HH 1Q86W 1JOYA 4FMTA 3HR0A 4FLWA 1QLEB 3M8AA 4AHCA 1R1BA 1SQPH 1VQ7V 2FMLA 3JASA 1XUQA 4DUZB 3CCSV 1I94O 4DR2B 1N4CA 2XUMA 4X88A 4GX1A 1KBHA 4JI0B 1HNZB 5IJ0B 2Q7EA 2RQ6A 5EZYB 4HZ3A 4EEQA 3E89A 2DJVA 4LP8A 3CCJV 3E8HA 3B40A 4P9PA 4U3JA 4IHJB 1LUWA 2XAQA 1DF5A 5LHIA 4FZ1A 2LJ2A 3IJ4A 2MW2B 4LF6B 4TUYA 3TETA 5IWAO 3GWKC 1JJOA 4EKWA 2XAGA 5KLVH 4OXSA 1YEWA 5LGNA 1VP7A 5KHGA 1WNSA 1AP5A 3G67A 4FLXA 2CH7B 3ML0A 4X8AA 3QO8A 2YXLA 1SESA 1S5LZ 1Y6XA 3K08A 2UXBB 4KP4A 4O4IA 2XAHA 1MA1A 2EILC 2V1DA 2VWJA 2IJJA 1SA0A 3ZMVA 1AR5A 3OMNB 1GN3A 4NTYA 1M9NA 2Q68A 1AJQA 5B5EZ 4K3AA 1VARA 3KZIZ 1R6NA 2IM9A 5H6QA 3DGEA 1AP6A 1EZJA 2JS3A 5EC1C 5LHGA 2YC0A 1YTFB 3Q4HA 2Q8VA 2LW1A 2QDOA 1WAZA 3FYEB 4DR7B 4DR5O 1KP3A 4UCOA 5BMVB 1Q82W 3VQYA 3QVNA 3TCUA 4NXNB 4IIJA 4HAMA 4RQFA 2ZE8A 2XHBA 1OCZB 1M93A 5LA6B 4R8CA 1N36B 4PA3A 1GM8A 5HFMA 1F23A 2LO1A 3ICXA 1KECA 2ITCC 4Z1MG 2UXCO 3A0BZ 4DRXA 3HPLC 4WF9V 5B1NA 1HNWB 2ZCEA 4WBNA 3ZN0A 1M90W 2P4VA 2O57A 4YJ2B 3J80N 1FS0G 1R73A 2HJDA 3OM3B 4LH6A 1KKCA 4CS2A 1H2SB 3SPHA 3H1IH 5KUMA 3J81N 2ZNIA 3UT5B 1I94B 4PI2A 3OE7G 3SJAC 2CE4A 3T1YO 4RWUA 2WLNA 1TGOA 3OTOO 3KG2A 5A9GA 4MVOA 3HKDA 1SERA 5LXTB 2EIJB 3L75H 5CN0A 1N0JA 5L3BA 1Z2GA 2M7WA 2ZE5A 4TV9B 2Q69A 3KCYA 4IYIA 3OEHG 2QWRB 2RMKB 2ZM6O 2EIJC 1V55B 2OCHA 3J7AU 2B5UA 3VQVA 5JH7B 4IL6Z 3HKBA 5IWAB 3CRRA 4OPAA 1R6KA 3JATB 4QPJA 5FLXN 4B3MO 1VF6C 5L3FA 3MDSA 1WJZA 3HKCB 3BPZA 4RO2A 3EFFK 1IBMO 4LF5O 2Q73A 3JCZA 3CYOA 2HJFC 1B6QA 1XHZA 4FZ0A 1AI6A 1ZX3A 4K8XA 3W7WA 2KB1A 3GB7C 2ITDC 3LDEA 3STLC 1H8EG 2F4VO 2VQEO 2GDSA 1WP8A 2ZE7A 4X65O 3ABKB 4I9WA 1SQQH 3A2FA 1S5JA 4H44B 2GHYA 1K33A 1K9MW 4BIZA 4DR5B 4WFHA 1JPXA 3OEEG 4FJCC 1Y74B 3ABKC 2AZ0A 1WP7A 5L3CA 3ZHSA 1BGYH 2QE7G 3QO7A 4QGPA 1Q90D 2RDCA 1MABG 1FAFA 1SQXH 3ZJZA 2BSKB 1OCCB 4F4LA 3CD6V 2UXCB 1BS3A 4N23A 1FXHA 4LNUA 2D3OW 4K35A 1GKFA 2ZNJA 3ETGA 5CA1B 5KMGA 2Z3YA 1JA8A 3OUSA 1S72V 1OCCC 5GW7A 4K0KO 4MTFA 5IJ9A 3BHPA 1GN2A 3WB2A 1NJIW 2QM8A 1K92A 3CJHA 1NT2B 4XDLA 1Q6IA 3IC9A 3AG4B 1KB9F 3CC4V 2JGDA 3T1YB 2WSSG 1RPRA 3ZRSA 2LW7A 3OTOB 3JAWA 1X59A 2EJ7A 5KAFZ 4J9YB 2CUGA 2N05A 1YSCA 4X20A 3FKSG 3U11A 3T1CA 3AG4C 4PHZA 4X64O 1I5XA 1NR7A 1PL0A 5B1OA 2Q6AA 1F51A 2WLLB 3FB8C 2HR3A 2PYJA 3N2KA 4G28B 3LDDA 3APOA 4F6EA 2ZM6B 5EIBC 4CC5A 4JI6O 3B8MA 2Q7GA 3U0ZA 4UFZA 2R9RB 4MVZA 3ASNB 1DF4A 2QM7A 1J5EO 5J2UB 4B3MB 5DM6V 1S76D 1PV0A 5LMUO 3RBZA 3CP1A 1VQKV 1SC5B 4OPHA 1JX9A 3ASNC 1IBMB 2FL4A 2X0LA 3CHXA 2NN4A 4LF5B 3VQWA 3APQA 1NVPB 2DN9A 5IDJA 5JCOA 3D3QA 4NB5A 3K9SA 1TVKB 1ZUQA 3ZX6A 1P7GA 3BCCH 5CB4A 2A79B 4P2ZA 1R3LC 5KX5A 3R66A 3N27A 1UJWB 4LFCO 4UCUA 1PNKA 1P4RA 2VQEB 2F4VB 4O4HB 2NLJC 4X65B 3H1KH 1EM1A 4J42A 2FTKA 3ETQA 1BHBA 3RVYA 1NBMG 3K04A 1YTFD 4I50A 3ZCCA 4GT1A 1BMFG 5LOVA 2UUBO 2P67A 5LYJA 1OHHG 4GKKO 2GUZB 2WLKA 4Z2WA 2P06A 5FPOA 2D2CB 5IY5B 4TWKA 4DR4O 4I4TA 4H37A 3AK2A 4MTGA 3MAQA 1ZAUA 1NKDA 3OUFA 1RPOA 2HEPA 1AB3A 4K0KB 5LHHA 3B77A 1VEWA 3DXRB 1SZXA 1QLNA 4C7UA 4X1YA 3BAAA 4TV8B 3EVKA 1N32O 3ABMB 1Y76A 1EBOA 4YHHO 5LP6B 3N2GA 3TK1A 2QTSA 4PV1B 5L3DA 2W0FC 3OW2U 2ZINA 2EZOA 4DV6O 4F6RA 1VQOV 3FAVA 1XI1A 1VQ9V 4GKJO 3NXSA 5EBLC 4KHPO 1U97A 2M6YA 4X64B 3ABMC 1SQBH 1MG1A 1AJPA 2DE0X 4Z1VA 4DV1O 1AR4A 1SF9A 1Z5WA 2Q5ZA 1ZWIC 4CC6A 4JI6B 4X1KB 2X6CA 3BVOA 3VBBA 4LF8O 2WWWA 4A5UB 1NS1A 1MZEA 3BA8A 5EBWC 3D36C 2QJ1A 1IZ3A 1XL4A 1J5EB 2OTLV 1H38A 2ZDIC 5LGUA 3NR7A 5LMUB 4YIOA 3P3NA 4LH7A 4NR1A 3X2QB 2ZIMA 3ZRWA 2DWDC 4HNAB 1O9GA 3G6BA 1EN5A 1QBZA 2CTQA 4ZKIA 2EULA 3X2QC 1Y4MA 2LFSA 2QEXV 1U96A 4N21A 3SDLA 3SYCA 3OFNG 4ZOLB 5CBFA 1S0VA 4JTDB 2DQ0A 2VWKA 2WLIA 4LFCB 3G80A 4X1IB 4MVMA 1N0NA 4GZRB 5EYPB 1E1QG 5BZBA 1JQ0A 4WFBV 4IGGA 5ITZB 4YJ3A 1TAEA 3L73H 2L6LA 3RYCA 5HFLA 2YI9A 4O4JA 3TXSA 4MVSA 1K97A 1Y66A 2ZXWB 1N34O 4FLYA 4UV9A 1NU1H 2C2AA 1YJ9V 5IYZA 2IBZH 2DMXA 4JYYA 3ETDA 4PI0A 3CEIA 2ZXWC 1F7YA 2UUBB 5J2TA 4GKKB 2JDIG 2AXTZ 2F23A 1K34A 4HBNA 3HKDB 4DR4B 2KG7B 1BT8A 3K06A 4RQEA 4J7JA 2F93B 4GX2A 3RYIA 2PF4E 4DO2A 3MD0A 1IVSA 4TSFG 4I55A 1YIJV 3JALA 2QTOA 1R6TA 4ZIBA 2KQXA 2K1EA 3OGCC 4MW3A 1XL6A 3RYHA 3ZIAG 1HW7A 1N32B 4CH3A 4D7TA 1S5HC 4YHHB 1SQGA 4U7NA 2WLMA 2QWNB 4DV6B 2JVDA 1GO3F 1EN6A 4GKJB 1I08A 4KHPB 4LFAO 1Q3EA 2XOKG 3AG7A 5F2VO 1KKDA 4U3FH 4X66O 4JYBA 4FLTA 2DWEC 2EILB 1W0KG 3E8GA 4DV1B 1T5EA 1JMKC 3QF7A 4MTXA 1WA8A 5EIBD 3ETEA 1VF7A 1YZBA 2JRIA 1GN6A 4LF8B 3ZRXA 4DV2O 5B3SB 3E22A 2GTAA 5B1BB 2JJ1G 3AG3B 1FFXA 4ZI7A 1KUQA 2FKXA 4I0XA 3SJBC 5GONA 4DV7O 2KSDA 3AK3A 5B3SC 3A0HZ 2PGGA 5B1BC 3AG3C 5KA6A 5BR8O 4J10A 3CCLV 3CXHF 4L8JA 4FPPA 4DV0O 5FNVB 1ZL8B 2LGWA 2W6IG 3HKEB 2A7WA 2LFRA 4G2KA 5CA0B 4YIPA 4ZHQB 1OJHA 2H3OA 2UUCO 1NVPD 2ILMA 1XQ8A 2OT5A 3LSUA 4NYKA 2DQ3A 2Z5UA 1FXKA 3CCMV 4WFAV 4BAYA 1S3JA 2CAZC 2Y69B 4MVQA 3SPGA 2IJIA 1XDCA 4O2BB 2R70A 4PA6A 1D5AA 3C3SA 1VQ8V 1IX9A 3E83A 4K8ZA 2YXHA 1R3KC 1IURA 1N34B 4W4LA 1HP8A 2KKWA 2Y69C 3CJHB 3K9AA 1FXVA 1THZA 2EX3A 1YCIA 4E4EA 3FB6C 5C8YB 2W6JG 2Q4PA 3CB2A 2QKCA 2OTJV 1VF5B 3ABLB 1NTZH 3I55V 1SRYA 1H2NA 3PN1A 4J80A 2VRZA 3D3IA 2A06H 2OIEA 5KHIA 4FK5C 4JI4O 3K58A 1GAXA 1QR9A 3ABLC 3RVZA 3CMEV 1ORQC 1ENVA 1R3JC 2QWPB 3P30A 3TJTA 1K4DC 4JI7O 4DYLA 3B09A 2AHYA 3JSNA 4MT8A 5JVDB 2Y48A 3ABTA 2IW5A 2HLDG 4D7SA 4GYCB 3G4SV 1WB8A 2EINB 1E79G 4LC1A 5EZYA 1RSOB 2A3QA 5KA5A 4LFAB 1UFIA 4UVBA 4X66B 4JI3O 1LR1A 4IHJA 1WLEA 3E35A 2RJZA 4R50A 1Q6UA 1F4MA 2EINC 2YXYA 3L71H 1BHAA 4CH5A 1I7FA 2UXXA 1N8RW 4JAAA 1L1FA 1KQSU 4DV2B 2P7TC 1E1RG 5BXZA 4LF9O 2CTPA 4FM1A 4DV3O 2YEVB 3H01A 3ZHVA 4JI8O 2HFEC 2EIMB 5EK0A 4KFMA 4UCTA 1YI2V 4DV7B 3OAAG 1VMGA 1YF2A 1BQ0A 2CH7A 1KU9A 2AHZA 5BR8B 2BTQB 4DV0B 4CBCA 3RYFB 2EIMC 2YIBD 4MSWC 2X7RB 1G8MA 4RAIA 1QR8A 5J9PC 3FD9A 2DYRB 1VQ4V 4GLXA 2UUCB 2VS0A 3OMIB 1V54B 2QSAA 3I5DA 4RUEA 4MTOA 3OMAB 2DYRC 5CA3A 4DR1O 5IE9A 1V54C 3FB5C 1XEQA 2IJKA 3ZHRA 4LF7O 1US6A 3W7TA 1GMGA 2IH3C 1GK9A 3WFVA 5LA6A 2ZIOA 1YITV 2Y0IA 4O4LB 4D6TH 5JJNB 3IC7A 3L72H 3OTFA 1WPBA 3JAKB 2UXNA 5KHHA 1XMQO 4AI8A 1AVMA 1PP9H 4RUFA 3RGBA 1XREA 3QNEA 1YDXA 4B3SO 1AI4A 2K9PA 1XNRO 4P30A 2F1MA 3SPIA 4NTWA 4JI4B 4BIUA 3CSXA 2Q67A 3BFRA 4I9QA 2HP8A 1IXMA 4KXRA 1S77D 3L74H 3JSLA 2R72A 2Y0PA 4MW8A 2UUAO 4B3TO 4JI7B 3IAYA 3JD4A 4NKGB 4DV5O 1RP3B 4PD4F 2PI4A 2YSUB 2YIDA 5C93A 1H8HG 3CE2A 4Q20A 4B3RO 4ZBMA 3ZBHA 3SYAA 3CWBH 5LXTA 4ICGA 5KHKA 5LL6Y 3W7UA 2Y4UA 4OX9O 4JI3B 4CS4A 5D5PA 3RFRA 5IYDO 2XNDG 1SQFA 1XNQO 4TV9A 2P4KA 4QIWF 4E2LA 2JS5A 1FJGO 2EIKB 3CCVV 2RCVA 3K5NA 5JH7A 4JYCA 2QGNA 2JIZG 4R6ZA 2F43G 4QNHB 2E76B 2E74B 3JATA 3T1HO 4LF9B 1CP9A 2UU9O 1LUVA 4DV3B 4CZZA 4JI8B 2WLIB 4UV8A 2EIKC 4Q6GA 2P22C 4WCEV 1JR9A 1MMMA 3HKCA 2R9AA 4XBFA 3LSSA 3ZHTA 4WFGA 4YJ3B 1ROPA 5KUKA 1P49A 3JARB 1QCEA 3FYIB 2GTSA 4FM2A 3C3TA 3FFQA 3SJQC 3OGIB 1Q43A 2GBOA 4O2AA 4B7KA 4BR6A 2JK5C 1IXBA 4PDMA 1Y67A 3JASB 4H0LB 3GVMA 1XBLA 1G4YB 1I0HA 2ZQMA 5BY1A 1PNMA 1Q5OA 3K3WA 4DR1B 5DN6G 1PNLA 5JJJB 4PA4A 3ZMZA 2IH1C 1VQPV 4H13B 4LF7B 1Y74A 2HVJC 4FVMA 1K5SA 3TXQA 3JALB 4CS3A 1HR0O 1I5YA 4U3JB 2ADPA 2XAFA 2B1GA 4JI1O 4JI5O 1K5QA 2BSKA 1LNQA 2JEUA 2HG5C 4I5SA 3VQXA 3JD3A 4TUYB 5CA1A 1NI8A 4JV5O 2WA3A 1XMQB 2MK3A 3WB0A 3CCQV 2OCCB 3SYOA 4B3SB 1JCHA 5IYCO 3CRAA 1XNRB 2R9IA 3B4SA 2EZPA 5CBGA 3CPWU 1DK1A 2UUAB 2F66C 1CEZA 2OCCC 4B3TB 4O4IB 2DW4A 4DV5B 5L3GA 2V4DA 5TISZ 1H2MA 4B3RB 1SA0B 4DR3O 1URFA 3ZS8C 3ZMSA 4I0XB 3AG2C 4LFBO 1NH2B 2E5LO 4OX9B 3H1LH 3L70H 3JD1A 3K0GA 1XNQB 3ZEDA 1UPGA 1FJGB 1JFFA 3K79A 4PDVA 2GSMB 3MHHC 4UVAA 4P9OA 3CX5F 3Q4HB 2Q0OC 1B06A 2XTAA 4JZ2A 3WG7B 1B04A 3T1HB 3BA9A 2UU9B 5LBQA 4IIJB 2JJ2G 3UKMA 1R3IC 3RW0A 3O65A 5H2FZ 4X62O 4EB6A 3CCEV 3CC2V 1P7BA 3T2MA 2ZD9A 1AR1B 3WG7C 4LR3A 4LWSA 2BOCC 4JTAB 1AI7A 1GTOA 4DRXB 5JQGA 3EXAA 4WBNB 4GX5A 1FXKC 1TVKA 1DLBA 1F4NA 3AEIA 3BRCA 4DUYO 3FX7A 4W4KA 4O4HA 2YI8A 3QO5A 3DC5A 1PL4A 1FYJA 4UXNA 3LSQA 4B08A 2QWOB 4TQFA 3STZC 5FPRA 1CPYA 4IT5A 1QVGU 1RM1B 1KMIZ 2P5OA 1WN7A 1FD9A 2WPDG 1O9HA 1HR0B 2PI5A 1Q81W 5EC2C 4JI1B 1OZ0A 4JI5B 2G38A 1RM1C 4UVCA 1TUBA 3BY6A 4LF4O 1Q6HA 2E3CA 1QLEC 3ZHQA 2GUZA 4PA7A 3HKBB 1JVMA 5DEDA 4ASUG 1WB7A 4JV5B 2ATKC 3SYPA 2PYLA 4I7ZB 5H6RA 2Q9LA 3GWOA 4FM0A 1KP2A 5JJEB 2PTMA 1XOUA 4FFBA 3O9OA 3UCSC 3DXRA 1AROP 1VQNV 4PA9A 1JJ2U 3CMAV 1IDSA 3UO2A 3CCUV 4U7OA 1MOFA 5H9CA 4TV8A 1AILA 1NTMH 2CGNA 4JAUA 3ZMTA 3RN4A 5LP6A 4LCUC 5CMUA 1MSDA 1NZ6A 5A2QN 4DR3B 4FLZA 1SETA 1M57B 2ZKOA 4LFBB 1G1XB 2E5LB 2LQTA 4JZGA 3D36A 2QKAA
chains in the Genus database with same CATH topology
1WP8A 3N27A 4NYKA 2QTSA 1WP7A 3S3WA 4NTWA 4NTXA 4FZ1A 3IJ4A 2FB5A 3S3XA 2L35A 4NTYA 4FZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  3N27 A;  4NYK A;  2QTS A;  1WP7 A;  3S3W A;  4NTW A;  4NTX A;  4FZ1 A;  3IJ4 A;  2FB5 A;  3S3X A;  2L35 A;  4NTY A;  4FZ0 A; 
#chains in the Genus database with same CATH topology
 1K7D A;  4ABM A;  3E8B A;  4DK0 A;  2ZDI A;  5CBH A;  1M57 C;  4HYO A;  4X1K A;  1GRJ A;  3S3W A;  5E1A C;  2Z0A A;  2P90 A;  4AQY O;  4MVU A;  3DTU B;  4L87 A;  4MS2 A;  2YIB A;  1XMO O;  4GCZ A;  4DXW A;  4X62 B;  3F5T A;  1KC8 W;  2PY5 A;  1COW G;  4YY3 O;  3S3X A;  3QG5 A;  4LNU B;  4HNA A;  5KMG B;  3G6E V;  1Z5V A;  4BW9 A;  3K0D A;  2YUA A;  1HWY A;  2BCC H;  3E8F A;  5IJ9 B;  3F7Y C;  4DUY B;  4JTC B;  3JD2 A;  3W7X A;  4ZOL A;  4DR6 O;  2ZR3 A;  3K5O A;  4X1I A;  5EYP A;  1H2L A;  3RT3 C;  2JGD B;  5ITZ A;  1PM9 A;  3M7M X;  4NTX A;  3G71 V;  1OCZ C;  2HKO A;  1BCC H;  2IU0 A;  2V7Q G;  3JAW B;  3AK1 A;  2UXD O;  2CK3 G;  4PEL A;  3TGU H;  1K73 W;  4X20 B;  2OIG A;  4J9Z B;  2H8P C;  1BL8 A;  4J7K A;  2A0L A;  2BOB C;  4BW5 A;  1DTO A;  3N2K B;  1D2D A;  1K3E A;  4CH6 A;  4NXM O;  1SKV A;  5L3E A;  4LF4 B;  1HNX O;  4J41 A;  1V9P A;  1W2B U;  2ADQ B;  4DW0 A;  2KG7 A;  4JPR A;  2IU3 A;  3CS5 A;  5IJ0 A;  3E2E A;  4KL1 A;  3K59 A;  1PKX A;  3UQ8 A;  2WLJ A;  1M5I A;  4TQD A;  4H33 A;  2Q0A A;  3LNM B;  4NVP A;  1IBK O;  1DGS A;  3FB7 C;  1QU7 A;  3CCR V;  1RFY A;  1BSM A;  1A32 A;  5B66 Z;  2ZE6 A;  5CB4 B;  1VQL V;  4JI2 O;  2BTO A;  5KX5 B;  2H94 A;  1V55 C;  2ETN A;  2QR4 A;  3ZHU A;  4UUJ C;  4QJF B;  3EHB B;  5IYB O;  5JCO C;  2HVK C;  3T4Z A;  4WFF A;  1N33 O;  5IT9 N;  2WLH A;  1FKA O;  3IFX A;  2JGU A;  2X6A A;  1FPO A;  1NH2 D;  4AQY B;  3DSQ A;  2GV9 A;  5AG2 A;  3E86 A;  4O2A B;  1EFR G;  2EJR A;  2RN9 A;  4I50 B;  3SJC C;  5EBM C;  1XMO B;  1J95 A;  2AW9 A;  2F95 B;  1K8A W;  1Q8I A;  4FIP C;  5LOV B;  4FLV A;  2AZ2 A;  4YY3 B;  5LYJ B;  1YVW A;  4DV4 O;  5FNV A;  3CRQ A;  1ZL8 A;  4UB6 Z;  4I4T B;  3HKE A;  1YXB A;  2OWO A;  4PDL A;  2QM4 A;  3OT7 A;  2OYQ A;  4JYA O;  1WPX A;  4BIO A;  4UCV A;  5CA0 A;  5GTI Z;  5BMV A;  5LMN O;  1HDJ A;  4ZHQ A;  2ZT9 B;  4DR6 B;  3L9D A;  4UB8 Z;  5B1A B;  4LBE C;  4UCR A;  4DK1 A;  1QHT A;  4EFE A;  3LNN A;  4X1Y B;  2Q7H A;  3SGI A;  1W0J G;  1Y76 B;  3ZN1 A;  2XT9 A;  1BQZ A;  4O2B A;  3SR2 C;  4CH4 A;  3N2G B;  1M1K W;  5FL7 G;  2CTR A;  3M99 B;  5B1A C;  2UXD B;  2L35 A;  4F6R B;  3FAV B;  2LP7 A;  4YJ2 A;  2DOS A;  3K5L A;  3I56 V;  2B1I A;  2PUS A;  3F5W C;  2QA4 V;  4R7C A;  5JWP A;  3A0R A;  4NXM B;  2LGQ A;  5C8Y A;  3JYC A;  3ASO B;  3UT5 A;  1QNM A;  1HNX B;  3UO3 A;  2YS8 A;  5LGT A;  1M4U A;  1L0N H;  2FYU H;  3OR6 C;  3CRC A;  1YJN V;  3BAB A;  1EN4 A;  1ZLZ A;  5K1X A;  1IBL O;  3ASO C;  5H5N A;  1G6U A;  1JFF B;  3ZRW B;  1VQM V;  1IBK B;  3OD4 A;  1SQV H;  2YIA A;  3RWR D;  4YXW G;  4AIL C;  4EFB A;  1VF6 A;  5JVD A;  1BZK A;  1EZV H;  2QKS A;  4UCS A;  3D8C A;  2HHH O;  3UM7 A;  3P32 A;  2YDE A;  4JI2 B;  3OR7 C;  5DEC A;  1GN4 A;  1RSO A;  2XAS A;  1MZF A;  4EB6 B;  1N33 B;  4BWA A;  1VQ5 V;  4JF3 A;  4IYH A;  5D5Q A;  4LWS B;  1X4T A;  3WU2 Z;  1SS3 A;  5JQG B;  4J7Z A;  3ZRV A;  3RYC B;  2QWQ B;  4O4J B;  2Y4T A;  2RNB A;  3AG1 B;  4J11 A;  3HB3 B;  2AGA A;  3VOU A;  1GM7 A;  2YEV A;  5IYZ B;  1D5N A;  5K1P A;  2XAJ A;  1MSW D;  2EBO A;  2X6B A;  1VQ6 V;  1W59 A;  3H1J H;  3B8N A;  4QE9 A;  3AG1 C;  4JGS A;  3W7S A;  5J2T B;  3JD0 A;  2PZS A;  2BTQ A;  2WA4 A;  4DV4 B;  3JAM N;  3RYF A;  4JAV A;  3DC6 A;  3SPJ A;  4X9Q A;  4JYA B;  1VIB A;  4PDR A;  3RYI B;  2JEX A;  2VQF O;  1YHQ V;  4FFK A;  5LMN B;  5E79 Z;  4TT3 G;  4I55 B;  4B7E A;  3ABU A;  3R65 A;  1TUB B;  4PJ0 Z;  4X89 A;  4DUZ O;  2CGO A;  5GTH Z;  3RYH B;  4DR2 O;  1TUE B;  2A9H A;  5KAI Z;  3K03 A;  4QPK A;  3LUT B;  4GX0 A;  4JI0 O;  1HNZ O;  1TA8 A;  3WB1 A;  2W0X A;  3A8T A;  4TOI A;  3MHS C;  1GH6 A;  4FFB B;  3ZMU A;  5IY5 C;  1B3Q A;  1QQC A;  3LDC A;  4WFE A;  5KHJ A;  4O4L A;  1WA8 B;  2N04 A;  3AG2 B;  4LF6 O;  3CXC U;  3E22 B;  3JAK A;  2NR5 A;  2YIC A;  3THO A;  3T4D A;  1FFX B;  1L8D A;  4G27 B;  4ZI7 B;  3BEH A;  2B9Z A;  3F7V C;  2DYS B;  2BE3 A;  1MNG A;  1IBL B;  5GON B;  1BE3 H;  3QTC A;  1OCO B;  1H2K A;  1XIL A;  5LP6 C;  2CTW A;  3SPC A;  2WLL A;  2UXB O;  2E75 B;  1QVF U;  1YJW V;  2DYS C;  1K4C C;  3KCX A;  1OCO C;  2HHH B;  4KUM A;  2FB5 A;  1PPJ H;  4DW1 A;  1ZSP A;  3IGA C;  2IJH A;  5J2U A;  1L0L H;  1XHX A;  3KKY A;  1AJN A;  3SYQ A;  1FXK B;  2NNU A;  1PD3 A;  1GM9 A;  4XDK A;  1SZT A;  2ARH A;  1M56 B;  1P84 F;  1NTK H;  1OCR B;  1Q7Y W;  3P3P A;  2WAM A;  4DR7 O;  4JAS A;  1CXZ B;  4GUN A;  1H2G A;  1NQT A;  4NXN O;  4XDJ A;  3CC7 V;  4QE7 A;  4MVR A;  1M56 C;  1N36 O;  1FFT B;  3C90 A;  2CDY A;  1OCR C;  3JCU Z;  1OV9 A;  4OGQ B;  1KD1 W;  3U10 A;  3JAR A;  2N74 A;  3H9V A;  1NR1 A;  3B2E E;  1HNW O;  3CRM A;  2ODM A;  3K57 A;  4FLU A;  2ZR2 A;  1AI5 A;  2P6J A;  3K5M A;  1KYO F;  3PJS K;  2VQF B;  1ZTE A;  3H1H H;  1Q86 W;  1JOY A;  4FMT A;  3HR0 A;  4FLW A;  1QLE B;  3M8A A;  4AHC A;  1R1B A;  1SQP H;  1VQ7 V;  2FML A;  3JAS A;  1XUQ A;  4DUZ B;  3CCS V;  1I94 O;  4DR2 B;  1N4C A;  2XUM A;  4X88 A;  4GX1 A;  1KBH A;  4JI0 B;  1HNZ B;  5IJ0 B;  2Q7E A;  2RQ6 A;  5EZY B;  4HZ3 A;  4EEQ A;  3E89 A;  2DJV A;  4LP8 A;  3CCJ V;  3E8H A;  3B40 A;  4P9P A;  4U3J A;  4IHJ B;  1LUW A;  2XAQ A;  1DF5 A;  5LHI A;  4FZ1 A;  2LJ2 A;  3IJ4 A;  2MW2 B;  4LF6 B;  4TUY A;  3TET A;  5IWA O;  3GWK C;  1JJO A;  4EKW A;  2XAG A;  5KLV H;  4OXS A;  1YEW A;  5LGN A;  1VP7 A;  5KHG A;  1WNS A;  1AP5 A;  3G67 A;  4FLX A;  2CH7 B;  3ML0 A;  4X8A A;  3QO8 A;  2YXL A;  1SES A;  1S5L Z;  1Y6X A;  3K08 A;  2UXB B;  4KP4 A;  4O4I A;  2XAH A;  1MA1 A;  2EIL C;  2V1D A;  2VWJ A;  2IJJ A;  1SA0 A;  3ZMV A;  1AR5 A;  3OMN B;  1GN3 A;  4NTY A;  1M9N A;  2Q68 A;  1AJQ A;  5B5E Z;  4K3A A;  1VAR A;  3KZI Z;  1R6N A;  2IM9 A;  5H6Q A;  3DGE A;  1AP6 A;  1EZJ A;  2JS3 A;  5EC1 C;  5LHG A;  2YC0 A;  1YTF B;  3Q4H A;  2Q8V A;  2LW1 A;  2QDO A;  1WAZ A;  3FYE B;  4DR7 B;  4DR5 O;  1KP3 A;  4UCO A;  5BMV B;  1Q82 W;  3VQY A;  3QVN A;  3TCU A;  4NXN B;  4IIJ A;  4HAM A;  4RQF A;  2ZE8 A;  2XHB A;  1OCZ B;  1M93 A;  5LA6 B;  4R8C A;  1N36 B;  4PA3 A;  1GM8 A;  5HFM A;  1F23 A;  2LO1 A;  3ICX A;  1KEC A;  2ITC C;  4Z1M G;  2UXC O;  3A0B Z;  4DRX A;  3HPL C;  4WF9 V;  5B1N A;  1HNW B;  2ZCE A;  4WBN A;  3ZN0 A;  1M90 W;  2P4V A;  2O57 A;  4YJ2 B;  3J80 N;  1FS0 G;  1R73 A;  2HJD A;  3OM3 B;  4LH6 A;  1KKC A;  4CS2 A;  1H2S B;  3SPH A;  3H1I H;  5KUM A;  3J81 N;  2ZNI A;  3UT5 B;  1I94 B;  4PI2 A;  3OE7 G;  3SJA C;  2CE4 A;  3T1Y O;  4RWU A;  2WLN A;  1TGO A;  3OTO O;  3KG2 A;  5A9G A;  4MVO A;  3HKD A;  1SER A;  5LXT B;  2EIJ B;  3L75 H;  5CN0 A;  1N0J A;  5L3B A;  1Z2G A;  2M7W A;  2ZE5 A;  4TV9 B;  2Q69 A;  3KCY A;  4IYI A;  3OEH G;  2QWR B;  2RMK B;  2ZM6 O;  2EIJ C;  1V55 B;  2OCH A;  3J7A U;  2B5U A;  3VQV A;  5JH7 B;  4IL6 Z;  3HKB A;  5IWA B;  3CRR A;  4OPA A;  1R6K A;  3JAT B;  4QPJ A;  5FLX N;  4B3M O;  1VF6 C;  5L3F A;  3MDS A;  1WJZ A;  3HKC B;  3BPZ A;  4RO2 A;  3EFF K;  1IBM O;  4LF5 O;  2Q73 A;  3JCZ A;  3CYO A;  2HJF C;  1B6Q A;  1XHZ A;  4FZ0 A;  1AI6 A;  1ZX3 A;  4K8X A;  3W7W A;  2KB1 A;  3GB7 C;  2ITD C;  3LDE A;  3STL C;  1H8E G;  2F4V O;  2VQE O;  2GDS A;  1WP8 A;  2ZE7 A;  4X65 O;  3ABK B;  4I9W A;  1SQQ H;  3A2F A;  1S5J A;  4H44 B;  2GHY A;  1K33 A;  1K9M W;  4BIZ A;  4DR5 B;  4WFH A;  1JPX A;  3OEE G;  4FJC C;  1Y74 B;  3ABK C;  2AZ0 A;  1WP7 A;  5L3C A;  3ZHS A;  1BGY H;  2QE7 G;  3QO7 A;  4QGP A;  1Q90 D;  2RDC A;  1MAB G;  1FAF A;  1SQX H;  3ZJZ A;  2BSK B;  1OCC B;  4F4L A;  3CD6 V;  2UXC B;  1BS3 A;  4N23 A;  1FXH A;  4LNU A;  2D3O W;  4K35 A;  1GKF A;  2ZNJ A;  3ETG A;  5CA1 B;  5KMG A;  2Z3Y A;  1JA8 A;  3OUS A;  1S72 V;  1OCC C;  5GW7 A;  4K0K O;  4MTF A;  5IJ9 A;  3BHP A;  1GN2 A;  3WB2 A;  1NJI W;  2QM8 A;  1K92 A;  3CJH A;  1NT2 B;  4XDL A;  1Q6I A;  3IC9 A;  3AG4 B;  1KB9 F;  3CC4 V;  2JGD A;  3T1Y B;  2WSS G;  1RPR A;  3ZRS A;  2LW7 A;  3OTO B;  3JAW A;  1X59 A;  2EJ7 A;  5KAF Z;  4J9Y B;  2CUG A;  2N05 A;  1YSC A;  4X20 A;  3FKS G;  3U11 A;  3T1C A;  3AG4 C;  4PHZ A;  4X64 O;  1I5X A;  1NR7 A;  1PL0 A;  5B1O A;  2Q6A A;  1F51 A;  2WLL B;  3FB8 C;  2HR3 A;  2PYJ A;  3N2K A;  4G28 B;  3LDD A;  3APO A;  4F6E A;  2ZM6 B;  5EIB C;  4CC5 A;  4JI6 O;  3B8M A;  2Q7G A;  3U0Z A;  4UFZ A;  2R9R B;  4MVZ A;  3ASN B;  1DF4 A;  2QM7 A;  1J5E O;  5J2U B;  4B3M B;  5DM6 V;  1S76 D;  1PV0 A;  5LMU O;  3RBZ A;  3CP1 A;  1VQK V;  1SC5 B;  4OPH A;  1JX9 A;  3ASN C;  1IBM B;  2FL4 A;  2X0L A;  3CHX A;  2NN4 A;  4LF5 B;  3VQW A;  3APQ A;  1NVP B;  2DN9 A;  5IDJ A;  5JCO A;  3D3Q A;  4NB5 A;  3K9S A;  1TVK B;  1ZUQ A;  3ZX6 A;  1P7G A;  3BCC H;  5CB4 A;  2A79 B;  4P2Z A;  1R3L C;  5KX5 A;  3R66 A;  3N27 A;  1UJW B;  4LFC O;  4UCU A;  1PNK A;  1P4R A;  2VQE B;  2F4V B;  4O4H B;  2NLJ C;  4X65 B;  3H1K H;  1EM1 A;  4J42 A;  2FTK A;  3ETQ A;  1BHB A;  3RVY A;  1NBM G;  3K04 A;  1YTF D;  4I50 A;  3ZCC A;  4GT1 A;  1BMF G;  5LOV A;  2UUB O;  2P67 A;  5LYJ A;  1OHH G;  4GKK O;  2GUZ B;  2WLK A;  4Z2W A;  2P06 A;  5FPO A;  2D2C B;  5IY5 B;  4TWK A;  4DR4 O;  4I4T A;  4H37 A;  3AK2 A;  4MTG A;  3MAQ A;  1ZAU A;  1NKD A;  3OUF A;  1RPO A;  2HEP A;  1AB3 A;  4K0K B;  5LHH A;  3B77 A;  1VEW A;  3DXR B;  1SZX A;  1QLN A;  4C7U A;  4X1Y A;  3BAA A;  4TV8 B;  3EVK A;  1N32 O;  3ABM B;  1Y76 A;  1EBO A;  4YHH O;  5LP6 B;  3N2G A;  3TK1 A;  2QTS A;  4PV1 B;  5L3D A;  2W0F C;  3OW2 U;  2ZIN A;  2EZO A;  4DV6 O;  4F6R A;  1VQO V;  3FAV A;  1XI1 A;  1VQ9 V;  4GKJ O;  3NXS A;  5EBL C;  4KHP O;  1U97 A;  2M6Y A;  4X64 B;  3ABM C;  1SQB H;  1MG1 A;  1AJP A;  2DE0 X;  4Z1V A;  4DV1 O;  1AR4 A;  1SF9 A;  1Z5W A;  2Q5Z A;  1ZWI C;  4CC6 A;  4JI6 B;  4X1K B;  2X6C A;  3BVO A;  3VBB A;  4LF8 O;  2WWW A;  4A5U B;  1NS1 A;  1MZE A;  3BA8 A;  5EBW C;  3D36 C;  2QJ1 A;  1IZ3 A;  1XL4 A;  1J5E B;  2OTL V;  1H38 A;  2ZDI C;  5LGU A;  3NR7 A;  5LMU B;  4YIO A;  3P3N A;  4LH7 A;  4NR1 A;  3X2Q B;  2ZIM A;  3ZRW A;  2DWD C;  4HNA B;  1O9G A;  3G6B A;  1EN5 A;  1QBZ A;  2CTQ A;  4ZKI A;  2EUL A;  3X2Q C;  1Y4M A;  2LFS A;  2QEX V;  1U96 A;  4N21 A;  3SDL A;  3SYC A;  3OFN G;  4ZOL B;  5CBF A;  1S0V A;  4JTD B;  2DQ0 A;  2VWK A;  2WLI A;  4LFC B;  3G80 A;  4X1I B;  4MVM A;  1N0N A;  4GZR B;  5EYP B;  1E1Q G;  5BZB A;  1JQ0 A;  4WFB V;  4IGG A;  5ITZ B;  4YJ3 A;  1TAE A;  3L73 H;  2L6L A;  3RYC A;  5HFL A;  2YI9 A;  4O4J A;  3TXS A;  4MVS A;  1K97 A;  1Y66 A;  2ZXW B;  1N34 O;  4FLY A;  4UV9 A;  1NU1 H;  2C2A A;  1YJ9 V;  5IYZ A;  2IBZ H;  2DMX A;  4JYY A;  3ETD A;  4PI0 A;  3CEI A;  2ZXW C;  1F7Y A;  2UUB B;  5J2T A;  4GKK B;  2JDI G;  2AXT Z;  2F23 A;  1K34 A;  4HBN A;  3HKD B;  4DR4 B;  2KG7 B;  1BT8 A;  3K06 A;  4RQE A;  4J7J A;  2F93 B;  4GX2 A;  3RYI A;  2PF4 E;  4DO2 A;  3MD0 A;  1IVS A;  4TSF G;  4I55 A;  1YIJ V;  3JAL A;  2QTO A;  1R6T A;  4ZIB A;  2KQX A;  2K1E A;  3OGC C;  4MW3 A;  1XL6 A;  3RYH A;  3ZIA G;  1HW7 A;  1N32 B;  4CH3 A;  4D7T A;  1S5H C;  4YHH B;  1SQG A;  4U7N A;  2WLM A;  2QWN B;  4DV6 B;  2JVD A;  1GO3 F;  1EN6 A;  4GKJ B;  1I08 A;  4KHP B;  4LFA O;  1Q3E A;  2XOK G;  3AG7 A;  5F2V O;  1KKD A;  4U3F H;  4X66 O;  4JYB A;  4FLT A;  2DWE C;  2EIL B;  1W0K G;  3E8G A;  4DV1 B;  1T5E A;  1JMK C;  3QF7 A;  4MTX A;  1WA8 A;  5EIB D;  3ETE A;  1VF7 A;  1YZB A;  2JRI A;  1GN6 A;  4LF8 B;  3ZRX A;  4DV2 O;  5B3S B;  3E22 A;  2GTA A;  5B1B B;  2JJ1 G;  3AG3 B;  1FFX A;  4ZI7 A;  1KUQ A;  2FKX A;  4I0X A;  3SJB C;  5GON A;  4DV7 O;  2KSD A;  3AK3 A;  5B3S C;  3A0H Z;  2PGG A;  5B1B C;  3AG3 C;  5KA6 A;  5BR8 O;  4J10 A;  3CCL V;  3CXH F;  4L8J A;  4FPP A;  4DV0 O;  5FNV B;  1ZL8 B;  2LGW A;  2W6I G;  3HKE B;  2A7W A;  2LFR A;  4G2K A;  5CA0 B;  4YIP A;  4ZHQ B;  1OJH A;  2H3O A;  2UUC O;  1NVP D;  2ILM A;  1XQ8 A;  2OT5 A;  3LSU A;  4NYK A;  2DQ3 A;  2Z5U A;  1FXK A;  3CCM V;  4WFA V;  4BAY A;  1S3J A;  2CAZ C;  2Y69 B;  4MVQ A;  3SPG A;  2IJI A;  1XDC A;  4O2B B;  2R70 A;  4PA6 A;  1D5A A;  3C3S A;  1VQ8 V;  1IX9 A;  3E83 A;  4K8Z A;  2YXH A;  1R3K C;  1IUR A;  1N34 B;  4W4L A;  1HP8 A;  2KKW A;  2Y69 C;  3CJH B;  3K9A A;  1FXV A;  1THZ A;  2EX3 A;  1YCI A;  4E4E A;  3FB6 C;  5C8Y B;  2W6J G;  2Q4P A;  3CB2 A;  2QKC A;  2OTJ V;  1VF5 B;  3ABL B;  1NTZ H;  3I55 V;  1SRY A;  1H2N A;  3PN1 A;  4J80 A;  2VRZ A;  3D3I A;  2A06 H;  2OIE A;  5KHI A;  4FK5 C;  4JI4 O;  3K58 A;  1GAX A;  1QR9 A;  3ABL C;  3RVZ A;  3CME V;  1ORQ C;  1ENV A;  1R3J C;  2QWP B;  3P30 A;  3TJT A;  1K4D C;  4JI7 O;  4DYL A;  3B09 A;  2AHY A;  3JSN A;  4MT8 A;  5JVD B;  2Y48 A;  3ABT A;  2IW5 A;  2HLD G;  4D7S A;  4GYC B;  3G4S V;  1WB8 A;  2EIN B;  1E79 G;  4LC1 A;  5EZY A;  1RSO B;  2A3Q A;  5KA5 A;  4LFA B;  1UFI A;  4UVB A;  4X66 B;  4JI3 O;  1LR1 A;  4IHJ A;  1WLE A;  3E35 A;  2RJZ A;  4R50 A;  1Q6U A;  1F4M A;  2EIN C;  2YXY A;  3L71 H;  1BHA A;  4CH5 A;  1I7F A;  2UXX A;  1N8R W;  4JAA A;  1L1F A;  1KQS U;  4DV2 B;  2P7T C;  1E1R G;  5BXZ A;  4LF9 O;  2CTP A;  4FM1 A;  4DV3 O;  2YEV B;  3H01 A;  3ZHV A;  4JI8 O;  2HFE C;  2EIM B;  5EK0 A;  4KFM A;  4UCT A;  1YI2 V;  4DV7 B;  3OAA G;  1VMG A;  1YF2 A;  1BQ0 A;  2CH7 A;  1KU9 A;  2AHZ A;  5BR8 B;  2BTQ B;  4DV0 B;  4CBC A;  3RYF B;  2EIM C;  2YIB D;  4MSW C;  2X7R B;  1G8M A;  4RAI A;  1QR8 A;  5J9P C;  3FD9 A;  2DYR B;  1VQ4 V;  4GLX A;  2UUC B;  2VS0 A;  3OMI B;  1V54 B;  2QSA A;  3I5D A;  4RUE A;  4MTO A;  3OMA B;  2DYR C;  5CA3 A;  4DR1 O;  5IE9 A;  1V54 C;  3FB5 C;  1XEQ A;  2IJK A;  3ZHR A;  4LF7 O;  1US6 A;  3W7T A;  1GMG A;  2IH3 C;  1GK9 A;  3WFV A;  5LA6 A;  2ZIO A;  1YIT V;  2Y0I A;  4O4L B;  4D6T H;  5JJN B;  3IC7 A;  3L72 H;  3OTF A;  1WPB A;  3JAK B;  2UXN A;  5KHH A;  1XMQ O;  4AI8 A;  1AVM A;  1PP9 H;  4RUF A;  3RGB A;  1XRE A;  3QNE A;  1YDX A;  4B3S O;  1AI4 A;  2K9P A;  1XNR O;  4P30 A;  2F1M A;  3SPI A;  4NTW A;  4JI4 B;  4BIU A;  3CSX A;  2Q67 A;  3BFR A;  4I9Q A;  2HP8 A;  1IXM A;  4KXR A;  1S77 D;  3L74 H;  3JSL A;  2R72 A;  2Y0P A;  4MW8 A;  2UUA O;  4B3T O;  4JI7 B;  3IAY A;  3JD4 A;  4NKG B;  4DV5 O;  1RP3 B;  4PD4 F;  2PI4 A;  2YSU B;  2YID A;  5C93 A;  1H8H G;  3CE2 A;  4Q20 A;  4B3R O;  4ZBM A;  3ZBH A;  3SYA A;  3CWB H;  5LXT A;  4ICG A;  5KHK A;  5LL6 Y;  3W7U A;  2Y4U A;  4OX9 O;  4JI3 B;  4CS4 A;  5D5P A;  3RFR A;  5IYD O;  2XND G;  1SQF A;  1XNQ O;  4TV9 A;  2P4K A;  4QIW F;  4E2L A;  2JS5 A;  1FJG O;  2EIK B;  3CCV V;  2RCV A;  3K5N A;  5JH7 A;  4JYC A;  2QGN A;  2JIZ G;  4R6Z A;  2F43 G;  4QNH B;  2E76 B;  2E74 B;  3JAT A;  3T1H O;  4LF9 B;  1CP9 A;  2UU9 O;  1LUV A;  4DV3 B;  4CZZ A;  4JI8 B;  2WLI B;  4UV8 A;  2EIK C;  4Q6G A;  2P22 C;  4WCE V;  1JR9 A;  1MMM A;  3HKC A;  2R9A A;  4XBF A;  3LSS A;  3ZHT A;  4WFG A;  4YJ3 B;  1ROP A;  5KUK A;  1P49 A;  3JAR B;  1QCE A;  3FYI B;  2GTS A;  4FM2 A;  3C3T A;  3FFQ A;  3SJQ C;  3OGI B;  1Q43 A;  2GBO A;  4O2A A;  4B7K A;  4BR6 A;  2JK5 C;  1IXB A;  4PDM A;  1Y67 A;  3JAS B;  4H0L B;  3GVM A;  1XBL A;  1G4Y B;  1I0H A;  2ZQM A;  5BY1 A;  1PNM A;  1Q5O A;  3K3W A;  4DR1 B;  5DN6 G;  1PNL A;  5JJJ B;  4PA4 A;  3ZMZ A;  2IH1 C;  1VQP V;  4H13 B;  4LF7 B;  1Y74 A;  2HVJ C;  4FVM A;  1K5S A;  3TXQ A;  3JAL B;  4CS3 A;  1HR0 O;  1I5Y A;  4U3J B;  2ADP A;  2XAF A;  2B1G A;  4JI1 O;  4JI5 O;  1K5Q A;  2BSK A;  1LNQ A;  2JEU A;  2HG5 C;  4I5S A;  3VQX A;  3JD3 A;  4TUY B;  5CA1 A;  1NI8 A;  4JV5 O;  2WA3 A;  1XMQ B;  2MK3 A;  3WB0 A;  3CCQ V;  2OCC B;  3SYO A;  4B3S B;  1JCH A;  5IYC O;  3CRA A;  1XNR B;  2R9I A;  3B4S A;  2EZP A;  5CBG A;  3CPW U;  1DK1 A;  2UUA B;  2F66 C;  1CEZ A;  2OCC C;  4B3T B;  4O4I B;  2DW4 A;  4DV5 B;  5L3G A;  2V4D A;  5TIS Z;  1H2M A;  4B3R B;  1SA0 B;  4DR3 O;  1URF A;  3ZS8 C;  3ZMS A;  4I0X B;  3AG2 C;  4LFB O;  1NH2 B;  2E5L O;  4OX9 B;  3H1L H;  3L70 H;  3JD1 A;  3K0G A;  1XNQ B;  3ZED A;  1UPG A;  1FJG B;  1JFF A;  3K79 A;  4PDV A;  2GSM B;  3MHH C;  4UVA A;  4P9O A;  3CX5 F;  3Q4H B;  2Q0O C;  1B06 A;  2XTA A;  4JZ2 A;  3WG7 B;  1B04 A;  3T1H B;  3BA9 A;  2UU9 B;  5LBQ A;  4IIJ B;  2JJ2 G;  3UKM A;  1R3I C;  3RW0 A;  3O65 A;  5H2F Z;  4X62 O;  4EB6 A;  3CCE V;  3CC2 V;  1P7B A;  3T2M A;  2ZD9 A;  1AR1 B;  3WG7 C;  4LR3 A;  4LWS A;  2BOC C;  4JTA B;  1AI7 A;  1GTO A;  4DRX B;  5JQG A;  3EXA A;  4WBN B;  4GX5 A;  1FXK C;  1TVK A;  1DLB A;  1F4N A;  3AEI A;  3BRC A;  4DUY O;  3FX7 A;  4W4K A;  4O4H A;  2YI8 A;  3QO5 A;  3DC5 A;  1PL4 A;  1FYJ A;  4UXN A;  3LSQ A;  4B08 A;  2QWO B;  4TQF A;  3STZ C;  5FPR A;  1CPY A;  4IT5 A;  1QVG U;  1RM1 B;  1KMI Z;  2P5O A;  1WN7 A;  1FD9 A;  2WPD G;  1O9H A;  1HR0 B;  2PI5 A;  1Q81 W;  5EC2 C;  4JI1 B;  1OZ0 A;  4JI5 B;  2G38 A;  1RM1 C;  4UVC A;  1TUB A;  3BY6 A;  4LF4 O;  1Q6H A;  2E3C A;  1QLE C;  3ZHQ A;  2GUZ A;  4PA7 A;  3HKB B;  1JVM A;  5DED A;  4ASU G;  1WB7 A;  4JV5 B;  2ATK C;  3SYP A;  2PYL A;  4I7Z B;  5H6R A;  2Q9L A;  3GWO A;  4FM0 A;  1KP2 A;  5JJE B;  2PTM A;  1XOU A;  4FFB A;  3O9O A;  3UCS C;  3DXR A;  1ARO P;  1VQN V;  4PA9 A;  1JJ2 U;  3CMA V;  1IDS A;  3UO2 A;  3CCU V;  4U7O A;  1MOF A;  5H9C A;  4TV8 A;  1AIL A;  1NTM H;  2CGN A;  4JAU A;  3ZMT A;  3RN4 A;  5LP6 A;  4LCU C;  5CMU A;  1MSD A;  1NZ6 A;  5A2Q N;  4DR3 B;  4FLZ A;  1SET A;  1M57 B;  2ZKO A;  4LFB B;  1G1X B;  2E5L B;  2LQT A;  4JZG A;  3D36 A;  2QKA A; 
#chains in the Genus database with same CATH homology
 1WP8 A;  3N27 A;  4NYK A;  2QTS A;  1WP7 A;  3S3W A;  4NTW A;  4NTX A;  4FZ1 A;  3IJ4 A;  2FB5 A;  3S3X A;  2L35 A;  4NTY A;  4FZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...