1WP8A

Crystal structure of hendra virus fusion core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
64
Chain Sequence
NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQKILDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Fusion glycoprotein F0,Fusion glycoprotein F0
publication title Crystal structures of Nipah and Hendra virus fusion core proteins
pubmed doi rcsb
source organism Hendra virus
total genus 30
structure length 64
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 1wp8A00
4FZ1A 3S3WA 3S3XA 1WP8A 3N27A 4NTWA 1WP7A 2L35A 2FB5A 4FZ0A 4NYKA 2QTSA 4NTXA 4NTYA 3IJ4A
chains in the Genus database with same CATH superfamily
4EFBA 1L0LH 4I50A 5L3BA 3E89A 2UXNA 2ZQMA 5LOVB 3B09A 2EULA 4OX9O 2XUMA 1K5QA 4LF8O 4GX1A 5LOVA 1VQKV 4X62B 2PI5A 3K57A 3OTFA 1H2SB 5D5PA 2HP8A 3G6EV 2F95B 1BMFG 3HKDB 5KHHA 2UXXA 1WPXA 5LP6B 4TV9B 4P30A 4WFAV 4J7KA 1XBLA 2YXYA 2WLIA 1DK1A 4O4LA 5LHHA 4JV5O 4U3JA 3SYAA 3G67A 1Q6UA 3AG1B 3ZN1A 4LWSB 2R9AA 2ZNJA 1IBMB 1JJ2U 3FYIB 4LWSA 2BSKB 3QG5A 2DJVA 5KHIA 1WP7A 4PHZA 2YXHA 1YEWA 5IYDO 3C90A 1HNWB 2OCCC 4DR1O 5EC2C 1H8HG 2W0FC 2YIDA 2LW7A 3HB3B 3OGIB 1DLBA 1SQQH 4LF9B 2X0LA 4MTXA 1XILA 2OIGA 3I56V 3UT5B 3L73H 3THOA 1N0JA 1W2BU 2WLHA 3O65A 4FK5C 3CCLV 1DGSA 2IW5A 3ZHQA 1VQMV 1RM1C 1OCZB 4O2AB 2X7RB 1NTKH 3T4DA 1RFYA 4AQYB 5B1BB 3RVYA 4DK1A 4DUYB 5LMNB 2FL4A 2ILMA 2AW9A 4C7UA 3O9OA 1KU9A 4PDVA 3UM7A 2WPDG 2OCHA 1AJNA 5LHGA 1WA8B 3L70H 1N36B 3K58A 5IYZA 3BAAA 2JJ2G 2LP7A 1IXBA 4ZOLB 5EIBD 4B3RB 5J2TB 3CCQV 4B3MO 1OJHA 1QR9A 2GV9A 1RSOA 5D5QA 2W6IG 4K0KB 1R6TA 4UXNA 5KUKA 2HKOA 4W4LA 1S0VA 3ABUA 4WBNB 3CWBH 3QO5A 1K7DA 4QNHB 3MHHC 1Q7YW 5E1AC 2HJFC 4WBNA 3CCMV 3ML0A 1JX9A 2Q0OC 1NH2D 3NR7A 4JI0B 2YUAA 3L71H 1JCHA 3DTUB 4PI2A 1AP6A 4K3AA 4MW3A 3OW2U 1N4CA 4B08A 4Q20A 2Q69A 1HR0B 4MVUA 3AG2C 4X1YB 3J80N 1IDSA 4LFBB 3P32A 4BIUA 4X1YA 4NTYA 1AR5A 3QF7A 5CA3A 1Y6XA 1B06A 5C8YA 1V9PA 4NXMO 2ZD9A 3FB8C 3BPZA 5EYPA 4UCVA 4JI4B 5DECA 1J95A 1K3EA 4YHHO 2P5OA 2F4VB 3FB6C 3CC4V 3CJHB 2XAQA 3ASOB 5LA6A 2F66C 1FXKC 3C3TA 3ZRSA 4DV2B 4CH5A 1ZL8B 4JASA 5FPOA 3W7WA 1FFXA 3WB0A 2BTOA 1ZL8A 1BE3H 1ROPA 4KUMA 4X88A 3IJ4A 3U0ZA 2EIMC 5JCOA 3BVOA 1XMOB 2JEUA 1I7FA 3JAKA 1OV9A 3SGIA 3JATB 5CB4A 4WFHA 2EINB 3ZEDA 1K9MW 2ITCC 4DUYO 2UXDB 3JATA 1YJNV 3MD0A 2ZIMA 3HKCB 4FZ0A 2FKXA 1CEZA 1VP7A 3HKCA 3ZHVA 1YI2V 3A2FA 1K4DC 5L3CA 4DV1O 1HNXO 2P4VA 3W7TA 3BCCH 3B40A 3IAYA 1AR4A 2XOKG 2JGUA 1ZX3A 2F1MA 3ZS8C 2ARHA 1OCOB 1YHQV 2IJKA 3CXCU 3K5LA 1M90W 1AILA 3AEIA 4DV7B 3AG3B 1PNMA 2GUZA 2YIBD 3KKYA 2ZR2A 2V1DA 3C3SA 3M99B 4RO2A 1SS3A 2G38A 4L8JA 1SQXH 2KQXA 3OM3B 1MZEA 2ITDC 2EJ7A 3RFRA 1I94O 1KKDA 3E86A 1AROP 4CS2A 2M7WA 4GX2A 3H1LH 3WB1A 4JTCB 2OCCB 2NNUA 1HR0O 5GONB 3JASB 3M8AA 5LP6C 5GONA 3RYIA 1VQ7V 3VOUA 4EFEA 4LFBO 1WLEA 2JS3A 4IGGA 1SKVA 2OTLV 3CCRV 3ZIAG 2QSAA 3EVKA 1DF5A 3MHSC 3RYFB 1NI8A 2PF4E 4N21A 4PA6A 1RM1B 1Y76B 1AI5A 1IXMA 4LF7B 2AHYA 4DV0B 5H5NA 2Q7EA 3FAVB 4BIZA 2K9PA 3RYCB 4BW9A 2BTQB 3WB2A 3K9AA 3FAVA 5IJ9A 5DEDA 3CRQA 2BTQA 4G28B 1P7GA 1AI4A 4PDMA 1R3IC 4LFCB 1I08A 4P2ZA 4FLVA 3EHBB 4DV2O 5LBQA 1URFA 4MVQA 2DWDC 2L6LA 2EBOA 2XASA 4DR7B 1KUQA 1XMOO 5IDJA 1KKCA 2UUAO 1R6NA 3I5DA 1BQ0A 4YJ2A 3W7UA 1P49A 2LFRA 4Z2WA 1KMIZ 2BOCC 1N32B 2XT9A 3ZRWA 4IT5A 2JEXA 4EKWA 2L35A 4FLZA 2UXDO 2QTSA 3N2GB 2ZE7A 1JA8A 1R73A 4TQFA 4ZHQB 1X59A 2EZOA 3OFNG 5IYCO 3E8FA 1SQBH 4ZHQA 2B1GA 4K35A 3SJQC 4Q6GA 3ICXA 3L75H 5KAFZ 5JH7B 5JQGA 3F7YC 1W0JG 3T1YO 1VQ5V 2JVDA 4GKJB 2JK5C 1QLEB 2WWWA 1Q5OA 4F4LA 4JI3O 2N04A 4IIJA 1G6UA 2QWNB 4CZZA 2HFEC 4BWAA 1GN4A 4RAIA 5LYJA 3I55V 5JJNB 2BOBC 2WLKA 1H2NA 2EILC 5CA0A 1JVMA 3PJSK 3IC9A 1YVWA 3CCEV 2EIJC 1P7BA 5IYBO 1HNZB 3RN4A 4TOIA 1BGYH 2YI8A 3N2KB 1LUVA 3UKMA 1FXKB 3K5OA 2IBZH 2HG5C 4I9QA 3WG7B 5B3SB 1QBZA 1US6A 3B2EE 4H44B 3SPIA 1FFTB 3HKBB 3Q4HA 4H13B 2GTSA 4Z1VA 2EIMB 3HKEB 4J10A 3HKBA 1UFIA 2P6JA 3OT7A 2P06A 1RP3B 4QPJA 2VQFB 4CH6A 2F43G 4DV5B 4GKKB 1SF9A 3JCUZ 2IU3A 2WLLB 4I9WA 2R70A 3ZHUA 3K0DA 3ETGA 3PN1A 1PV0A 1R6KA 2RMKB 2VWKA 2R72A 1IZ3A 5IJ0B 3ZMZA 5JCOC 4IYIA 2YI9A 5FL7G 4WFEA 4FLYA 4GUNA 1DF4A 4JI7B 3ZHRA 2N74A 3CCUV 4O4JB 3NXSA 3ABMC 4ICGA 4DV3B 2ZINA 4DV6B 1F23A 2R9RB 2A79B 1W59A 4RUFA 3H1HH 1TUEB 1N32O 3GWKC 2ZDIC 1F4MA 3OUFA 1TGOA 1MSWD 2UXBB 2YICA 4I50B 2XHBA 4R50A 4FIPC 4JYAO 4QE9A 3J7AU 5HFLA 3F7VC 3OEEG 2QR4A 2Z3YA 4FLTA 3AG4C 2LFSA 4JYBA 2ZIOA 3H01A 3SJBC 1OCOC 1KP3A 1Y66A 4J7JA 2NR5A 3K04A 1NKDA 1EZVH 2E74B 4H0LB 2WLIB 4O4LB 1YDXA 3AG3C 5CA1A 4U3JB 3D36A 3IC7A 4PD4F 4CS3A 2FTKA 3K03A 4B7KA 2DOSA 4DV4O 1K33A 3AK2A 5JJEB 3AK1A 1Q8IA 2CAZC 1FKAO 1GN6A 1GKFA 4U7OA 4KP4A 4UB6Z 3ABLC 4B3TO 1Q6HA 4BW5A 5H6RA 2QWRB 3ZJZA 3FD9A 1HP8A 5LMUB 1E1RG 2QWPB 2F93B 1ZAUA 3RVZA 4F6RA 3DSQA 3TJTA 3JD3A 3ASNC 4GX0A 1U96A 3HR0A 4PDRA 2QKCA 2UU9B 2VQFO 2VRZA 2ZNIA 4D7SA 1JJOA 3SJAC 1IBLO 5IYZB 4GT1A 5TISZ 3M7MX 2PTMA 4X8AA 1FXHA 3ABTA 4JI6B 4X66B 1QR8A 3EFFK 2Q5ZA 4GZRB 1SRYA 1YJWV 2PGGA 4RWUA 2LO1A 1RSOB 3OMAB 1FJGB 3G80A 3S3XA 1XI1A 1SZTA 4LF4B 2JRIA 2GDSA 2ZCEA 1AJPA 4JAVA 2P90A 1PL4A 1FYJA 4DV6O 1M56C 1AVMA 1WN7A 5AG2A 2H8PC 4QJFB 4NVPA 5KHGA 4PI0A 2Q9LA 2UXCB 1EZJA 4EB6B 2HJDA 1GN2A 3KZIZ 2Q67A 2YC0A 4EB6A 2GTAA 1ZSPA 2CH7A 1FPOA 2EILB 1BCCH 2JGDA 1F7YA 4JI1O 4AHCA 2FYUH 3CMEV 5JVDA 3MDSA 2QKAA 1H2KA 2EIJB 2DN9A 1G4YB 4QE7A 4X62O 3L9DA 3CPWU 1VARA 3SPHA 3F5TA 5ITZA 1CPYA 2NN4A 3SPCA 3R66A 1D5NA 1QLEC 1XOUA 4LH6A 1SETA 5C8YB 1W0KG 3GWOA 1YTFB 3G4SV 5F2VO 5EYPB 1IBMO 5KX5A 4ABMA 3SJCC 5DN6G 3BFRA 4DO2A 5LA6B 2ZE5A 2JJ1G 4OPHA 3K3WA 1K92A 5FPRA 3E8GA 1M5IA 1QU7A 2IJJA 1F51A 4I0XA 1QHTA 3CMAV 1HNWO 1Z2GA 2DYRB 1SESA 4E4EA 1FFXB 4P9PA 3WG7C 3RGBA 4HBNA 5B3SC 4LF9O 3WFVA 4HZ3A 2W0XA 3JCZA 4JI8B 1GRJA 4PA4A 2CTRA 4MT8A 3JAKB 1PP9H 2RDCA 3TK1A 5LGUA 5H2FZ 1THZA 3K0GA 3T1HB 5CN0A 3ABMB 4X64B 1V54B 5CB4B 1ZTEA 2R9IA 3LNNA 1R3KC 2OTJV 5EBMC 5EZYB 2HVKC 4AQYO 2B5UA 1WB7A 2UU9O 2GBOA 5LMNO 3CB2A 5EZYA 3T1CA 2E5LB 4CBCA 5L3EA 4J11A 1BZKA 5B1NA 4HAMA 3AG7A 4PA9A 4TV8A 2QWQB 1KB9F 1KECA 4JI6O 1N36O 1Q82W 2AHZA 1QCEA 4NXNB 1DTOA 1PL0A 1JOYA 1LUWA 3AG4B 4B3RO 3EXAA 2VWJA 1FJGO 1Q90D 1S5JA 4P9OA 5EBWC 1KBHA 2WAMA 5IY5C 2GUZB 1N33B 1MA1A 3SYPA 4RQEA 5B5EZ 2OWOA 1Q43A 4DUZB 2QGNA 4K0KO 2RQ6A 2QM8A 4IL6Z 2ETNA 2LGWA 3ZHTA 1M57B 2ZE8A 1GTOA 2ZXWC 3FX7A 1JFFB 5C93A 1YCIA 1VQOV 3LNMB 4NTWA 1JFFA 4NYKA 4X9QA 4UVCA 1SQFA 1TAEA 1AB3A 2ATKC 4JI0O 1XNRB 2ADPA 5GW7A 4XDJA 4AI8A 3TGUH 2CUGA 1WP8A 1IBKB 3P3NA 3ABLB 1IVSA 1TA8A 4DR6B 4J9YB 3K5NA 2XAGA 1X4TA 3VBBA 1G1XB 3G71V 3D36C 3RYIB 4H33A 2PYJA 2CGOA 3STZC 2Y4UA 3DXRA 4MVOA 4JTDB 1K5SA 5LGNA 4MTOA 4UVAA 4FFBA 4AILC 1VF6A 3ETDA 4J41A 4XDKA 3SPJA 4WFFA 3ZRVA 1SERA 4I55B 4JGSA 3ASNB 4K8XA 1XNQB 1M93A 4JTAB 4J9ZB 2QM4A 4I55A 2P7TC 4X1IB 5BMVA 5KA6A 2Q6AA 5IJ9B 5A2QN 2Y69C 4JI4O 4YJ3A 2BCCH 2A7WA 3CRAA 3CEIA 4O2BA 4X1IA 4LFAB 1COWG 4DR4B 2F4VO 2D2CB 3FB7C 4KXRA 1B3QA 5B1AB 4LH7A 4RUEA 1NTZH 1R3LC 1M4UA 3KCXA 4I4TA 3S3WA 1TVKA 4MTFA 1M9NA 4UCSA 4JI8O 2BE3A 4YJ2B 4TUYB 1WNSA 4X65B 4FLXA 2E75B 1NT2B 3ZRWB 3T1HO 4FJCC 4TUYA 1M1KW 3D3IA 1M56B 2Y48A 4LCUC 4MVZA 3FYEB 3ZBHA 3RWRD 2Z0AA 4I5SA 2A06H 2E5LO 3CYOA 2KSDA 2NLJC 1S5LZ 4FVMA 3W7XA 3D8CA 1RPOA 4OXSA 2WLNA 4QPKA 1J5EB 3TXQA 4LF5B 4NXNO 3LDCA 5JQGB 1NQTA 4FM0A 1KYOF 4BR6A 3K59A 1YF2A 4IYHA 4IIJB 1NJIW 2FB5A 3JALB 4DUZO 5LXTA 4DV7O 4GYCB 4LF8B 5LYJB 4O4IB 3JALA 1P84F 5CA0B 3VQXA 3OUSA 3CRMA 2YSUB 3P3PA 2UUBB 2MK3A 1WPBA 1S5HC 4O4IA 3MAQA 1S76D 1VF5B 3KG2A 4LR3A 1MABG 2WSSG 2JIZG 2JS5A 1EN6A 2YIBA 3APQA 3E35A 3E83A 4R7CA 5B66Z 1LNQA 5CBHA 4Z1MG 2DWEC 1PNKA 2OYQA 2QA4V 1H8EG 1VMGA 1NTMH 5LGTA 2ZKOA 1IBKO 4DR2B 4JI2B 1AR1B 1NVPB 4JZGA 3LSQA 1QQCA 1G8MA 3JARA 3Q4HB 2GHYA 3BRCA 2P4KA 3RW0A 1IX9A 4IHJA 1VIBA 3JSNA 2CE4A 5J9PC 4JYYA 1VQ8V 1WAZA 5HFMA 1PM9A 5L3FA 3CRRA 4R6ZA 4OPAA 1VQPV 5KMGB 2ODMA 1XNQO 2XTAA 2CK3G 2Z5UA 2DYSB 4LF7O 3QO8A 5KMGA 4DV0O 1VQ4V 4ZI7A 4DR4O 1PD3A 4JPRA 1S77D 2RN9A 1K4CC 2DYRC 4LFCO 1UPGA 2IM9A 4LNUA 3APOA 4JF3A 3AK3A 4ZIBA 4PA7A 4WF9V 2UUCB 3B4SA 3F5WC 1FAFA 2AZ2A 4JI5B 1V54C 5BY1A 4L87A 3STLC 3K08A 4B3SB 1SA0A 4DR7O 1GMGA 1VEWA 2Y0PA 2C2AA 3GB7C 5FLXN 2Q7GA 4PDLA 2HHHB 2KKWA 2OT5A 5IY5B 1AI7A 4J80A 2H94A 4DXWA 4B3MB 1Z5WA 3R65A 4MVMA 4YY3B 2ZXWB 3P30A 4UCUA 1QLNA 1N34B 3J81N 1J5EO 4TT3G 3JAWA 2E3CA 4X89A 1BS3A 2KG7B 3FFQA 1NBMG 3FB5C 4ZBMA 4LF5O 3DGEA 1SQVH 2KG7A 1BHBA 1P4RA 4UB8Z 3E22A 4HNAA 3E8HA 1R1BA 2WLMA 5FNVA 5CA1B 1HWYA 4U3FH 4YIOA 1NU1H 1KD1W 4O4HA 5EC1C 4X1KA 4D7TA 4GKJO 1M57C 1GN3A 2ZM6B 1QVFU 3X2QB 4DW1A 1SC5B 3ZCCA 2XAFA 1S3JA 4DRXB 2B9ZA 3H1IH 1JPXA 2UUBO 4J42A 1D2DA 4FM2A 3L74H 4DRXA 2Q4PA 1EN5A 1YTFD 4CC6A 4PV1B 2Y4TA 4YIPA 4GX5A 5J2UB 2Y69B 3BABA 3HKDA 4KL1A 5KA5A 3CRCA 4R8CA 1SQPH 3B8MA 5LP6A 4TV9A 4NXMB 1OCRB 2Q68A 5J2UA 4QIWF 1HNZO 4G27B 4MS2A 3QNEA 2CTQA 4LBEC 2VQEB 4DR2O 2XAHA 4JI2O 1VF6C 1S72V 4YHHB 1GM8A 4I7ZB 4F6RB 4TQDA 1MG1A 2BSKA 1FXVA 4MVRA 1GM9A 3ETEA 2ZT9B 5CBGA 5BXZA 3E2EA 3L72H 5JJJB 1A32A 3RT3C 3K79A 1L1FA 2RCVA 3B8NA 1LR1A 4DV5O 4GKKO 1NZ6A 5BZBA 5CBFA 3QO7A 4FPPA 3UT5A 1E79G 4BAYA 1MNGA 3CHXA 5B1AC 3OMNB 1XREA 3IFXA 1YIJV 1ENVA 1ORQC 4JYCA 3TXSA 3UCSC 3T2MA 2EX3A 1AP5A 4O2AA 2ADQB 3HPLC 4EEQA 3TETA 1I5YA 1K8AW 1ZUQA 1BL8A 3A8TA 4JI7O 3ZMUA 2UUCO 4FLUA 3LUTB 1SZXA 2HEPA 4JI5O 1CP9A 3ETQA 2H3OA 5LL6Y 4B3SO 4DV3O 5EBLC 4GCZA 4DV1B 3A0BZ 1HNXB 2HHHO 1WA8A 3LSSA 2PI4A 3LDEA 3CX5F 1AJQA 4KHPB 2CH7B 2JGDB 2UXBO 4GLXA 2PUSA 4ZOLA 2HLDG 5J2TA 4YY3O 5IT9N 1N34O 5JVDB 3BEHA 5KHJA 1KC8W 2Q0AA 2XNDG 2Q73A 3QTCA 1N0NA 2PZSA 1Y74B 3IGAC 2YS8A 5ITZB 3CSXA 2X6BA 1Y74A 3CE2A 3UO3A 2K1EA 1I94B 1QNMA 1I5XA 2VS0A 2LGQA 1VF7A 2ZM6O 5KX5B 1MZFA 2QKSA 3K9SA 1VQ9V 3SYOA 5LHIA 2EIKC 2IJIA 3U11A 1RPRA 2IJHA 3CCVV 2B1IA 4MTGA 2RJZA 5L3DA 4I0XB 4LF6B 4NTXA 1B04A 4PELA 1V55B 1U97A 2KB1A 3H1KH 1JMKC 1ZWIC 4K8ZA 2VQEO 1ZLZA 1NS1A 5IWAB 1XMQB 1OCCB 4BIOA 5LMUO 2F23A 3DC6A 1UJWB 3D3QA 3OR6C 4RQFA 4JZ2A 1H2MA 3CJHA 2O57A 3G6BA 3SR2C 3VQVA 2DYSC 2HVJC 1Q6IA 2EJRA 3ABKB 3RBZA 4FFKA 3LSUA 4TV8B 2UUAB 3W7SA 4WCEV 1GO3F 3CD6V 1KP2A 5IE9A 4DW0A 4X66O 3CC2V 5KUMA 1MOFA 2DW4A 4F6EA 2V7QG 3OTOB 3A0RA 1JQ0A 4WFBV 1XEQA 3LDDA 3OE7G 1O9GA 2PY5A 1JR9A 4DR5B 2ZDIA 4LF4O 3CC7V 3SYCA 4U7NA 2Q8VA 2DMXA 1GAXA 2IU0A 2RNBA 2UXCO 2M6YA 2N05A 1MMMA 5KHKA 4KHPO 3OD4A 2QDOA 1NR1A 3T1YB 1YZBA 1XQ8A 3WU2Z 4A5UB 2YIAA 1R3JC 3SPGA 4JI3B 3CCJV 2A9HA 3CCSV 3U10A 1NH2B 5JWPA 2LW1A 2WA3A 4NKGB 3K06A 3DXRB 4UCTA 1I0HA 2CTPA 4D6TH 4UVBA 4FFBB 3SDLA 1H2LA 3CS5A 3X2QC 1FS0G 1NVPD 2E76B 5BMVB 3A0HZ 3BA9A 2ZE6A 4UCRA 2OIEA 2QTOA 5KAIZ 4YJ3B 4O2BB 3ZN0A 5DM6V 5K1PA 1B6QA 4J7ZA 3JASA 5GTIZ 3AG1C 4LF6O 1OCRC 1H38A 1BQZA 5A9GA 1E1QG 2X6CA 4YXWG 4DR3B 1VQNV 4I4TB 1TVKB 3DC5A 3RYFA 3ZRXA 4CH3A 4FM1A 1K97A 1SQGA 4WFGA 5EK0A 4DK0A 1FD9A 1Y76A 5IWAO 1XMQO 4XDLA 4B7EA 2DQ0A 3GVMA 1YSCA 5BR8B 1WB8A 3RYCA 1XHXA 2AGAA 3ZMSA 2JDIG 3RYHB 4X64O 4FMTA 1EBOA 1O9HA 2XAJA 3RYHA 2Y0IA 4XBFA 3ZMVA 1L8DA 3TCUA 3BY6A 1Y67A 2QE7G 3FKSG 5K1XA 4JAUA 1TUBB 1OCZC 4H37A 2MW2B 4ASUG 4MW8A 1VQ6V 1TUBA 1NR7A 5B1BC 1BHAA 3ZHSA 4OGQB 4LC1A 2LQTA 2X6AA 3VQWA 3JD4A 3OTOO 2D3OW 4CH4A 1HW7A 3T4ZA 2Q7HA 1BT8A 3BHPA 4QGPA 3N2GA 4DR5O 4LP8A 1XUQA 4JYAB 3UQ8A 3JAMN 5LXTB 4NR1A 1N33O 2CGNA 2YEVB 1BSMA 4OX9B 1N8RW 4HYOA 2YEVA 1EM1A 2AZ0A 2FMLA 3N27A 4N23A 5B1OA 4DYLA 1Y4MA 4KFMA 2WA4A 2WLJA 3AG2B 1MSDA 2EIKB 5JH7A 4CS4A 1Z5VA 1K73W 3JD1A 4JV5B 1XNRO 2ZR3A 4MVSA 3VQYA 1YXBA 1T5EA 3QVNA 4DV4B 5E79Z 3BA8A 4DR6O 3E8BA 1Q81W 3CXHF 4W4KA 3JARB 3OAAG 3K5MA 4X20B 2QM7A 4IHJB 2QJ1A 5KLVH 3ZMTA 4G2KA 4X20A 2LJ2A 3JD2A 4B3TB 3H1JH 4DR1B 1OHHG 3SYQA 2GSMB 1CXZB 3H9VA 4CC5A 3CP1A 1GM7A 1OZ0A 5H9CA 1GH6A 2QEXV 2P67A 3OGCC 4PJ0Z 2EZPA 4FZ1A 3JSLA 4PA3A 3N2KA 3B77A 5L3GA 1FXKA 4ZI7B 2PYLA 2A0LA 2CDYA 1QVGU 4TWKA 4LFAO 3JD0A 1V55C 4ZKIA 1EFRG 4LNUB 1WJZA 1Q86W 2AXTZ 3UO2A 3HKEA 1YJ9V 3OR7C 4DR3O 2YXLA 5CMUA 1OCCC 1PNLA 2HR3A 1VQLV 1YITV 4JAAA 1AI6A 5H6QA 3KCYA 1SA0B 4UCOA 4TSFG 3ASOC 1IBLB 5BR8O 4UUJC 2WLLA 3OMIB 2CTWA 1Q3EA 4X65O 1K34A 3OEHG 4NB5A 4UFZA 1XL6A 3ABKC 4UV9A 2IH1C 2YDEA 1XDCA 5IJ0A 4E2LA 2A3QA 1HDJA 2P22C 4UV8A 1GK9A 4O4JA 3JAWB 1XHZA 2DQ3A 2V4DA 1F4NA 1XL4A 1KQSU 2EINC 1IURA 3ZX6A 3JYCA 4FLWA 1EN4A 2QWOB 1H2GA 1D5AA 3E22B 1L0NH 4HNAB 2DE0X 2W6JG 1PPJH 2IH3C 5FNVB 4O4HB 4X1KB 5EIBC 5GTHZ 1PKXA 4MSWC 4JI1B
chains in the Genus database with same CATH topology
4FZ1A 3S3WA 3S3XA 1WP8A 3N27A 4NTWA 1WP7A 2L35A 2FB5A 4FZ0A 4NYKA 2QTSA 4NTXA 4NTYA 3IJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ1 A;  3S3W A;  3S3X A;  1WP8 A;  3N27 A;  4NTW A;  1WP7 A;  2L35 A;  2FB5 A;  4FZ0 A;  4NYK A;  2QTS A;  4NTX A;  4NTY A;  3IJ4 A; 
#chains in the Genus database with same CATH topology
 4EFB A;  1L0L H;  4I50 A;  5L3B A;  3E89 A;  2UXN A;  2ZQM A;  5LOV B;  3B09 A;  2EUL A;  4OX9 O;  2XUM A;  1K5Q A;  4LF8 O;  4GX1 A;  5LOV A;  1VQK V;  4X62 B;  2PI5 A;  3K57 A;  3OTF A;  1H2S B;  5D5P A;  2HP8 A;  3G6E V;  2F95 B;  1BMF G;  3HKD B;  5KHH A;  2UXX A;  1WPX A;  5LP6 B;  4TV9 B;  4P30 A;  4WFA V;  4J7K A;  1XBL A;  2YXY A;  2WLI A;  1DK1 A;  4O4L A;  5LHH A;  4JV5 O;  4U3J A;  3SYA A;  3G67 A;  1Q6U A;  3AG1 B;  3ZN1 A;  4LWS B;  2R9A A;  2ZNJ A;  1IBM B;  1JJ2 U;  3FYI B;  4LWS A;  2BSK B;  3QG5 A;  2DJV A;  5KHI A;  1WP7 A;  4PHZ A;  2YXH A;  1YEW A;  5IYD O;  3C90 A;  1HNW B;  2OCC C;  4DR1 O;  5EC2 C;  1H8H G;  2W0F C;  2YID A;  2LW7 A;  3HB3 B;  3OGI B;  1DLB A;  1SQQ H;  4LF9 B;  2X0L A;  4MTX A;  1XIL A;  2OIG A;  3I56 V;  3UT5 B;  3L73 H;  3THO A;  1N0J A;  1W2B U;  2WLH A;  3O65 A;  4FK5 C;  3CCL V;  1DGS A;  2IW5 A;  3ZHQ A;  1VQM V;  1RM1 C;  1OCZ B;  4O2A B;  2X7R B;  1NTK H;  3T4D A;  1RFY A;  4AQY B;  5B1B B;  3RVY A;  4DK1 A;  4DUY B;  5LMN B;  2FL4 A;  2ILM A;  2AW9 A;  4C7U A;  3O9O A;  1KU9 A;  4PDV A;  3UM7 A;  2WPD G;  2OCH A;  1AJN A;  5LHG A;  1WA8 B;  3L70 H;  1N36 B;  3K58 A;  5IYZ A;  3BAA A;  2JJ2 G;  2LP7 A;  1IXB A;  4ZOL B;  5EIB D;  4B3R B;  5J2T B;  3CCQ V;  4B3M O;  1OJH A;  1QR9 A;  2GV9 A;  1RSO A;  5D5Q A;  2W6I G;  4K0K B;  1R6T A;  4UXN A;  5KUK A;  2HKO A;  4W4L A;  1S0V A;  3ABU A;  4WBN B;  3CWB H;  3QO5 A;  1K7D A;  4QNH B;  3MHH C;  1Q7Y W;  5E1A C;  2HJF C;  4WBN A;  3CCM V;  3ML0 A;  1JX9 A;  2Q0O C;  1NH2 D;  3NR7 A;  4JI0 B;  2YUA A;  3L71 H;  1JCH A;  3DTU B;  4PI2 A;  1AP6 A;  4K3A A;  4MW3 A;  3OW2 U;  1N4C A;  4B08 A;  4Q20 A;  2Q69 A;  1HR0 B;  4MVU A;  3AG2 C;  4X1Y B;  3J80 N;  1IDS A;  4LFB B;  3P32 A;  4BIU A;  4X1Y A;  4NTY A;  1AR5 A;  3QF7 A;  5CA3 A;  1Y6X A;  1B06 A;  5C8Y A;  1V9P A;  4NXM O;  2ZD9 A;  3FB8 C;  3BPZ A;  5EYP A;  4UCV A;  4JI4 B;  5DEC A;  1J95 A;  1K3E A;  4YHH O;  2P5O A;  2F4V B;  3FB6 C;  3CC4 V;  3CJH B;  2XAQ A;  3ASO B;  5LA6 A;  2F66 C;  1FXK C;  3C3T A;  3ZRS A;  4DV2 B;  4CH5 A;  1ZL8 B;  4JAS A;  5FPO A;  3W7W A;  1FFX A;  3WB0 A;  2BTO A;  1ZL8 A;  1BE3 H;  1ROP A;  4KUM A;  4X88 A;  3IJ4 A;  3U0Z A;  2EIM C;  5JCO A;  3BVO A;  1XMO B;  2JEU A;  1I7F A;  3JAK A;  1OV9 A;  3SGI A;  3JAT B;  5CB4 A;  4WFH A;  2EIN B;  3ZED A;  1K9M W;  2ITC C;  4DUY O;  2UXD B;  3JAT A;  1YJN V;  3MD0 A;  2ZIM A;  3HKC B;  4FZ0 A;  2FKX A;  1CEZ A;  1VP7 A;  3HKC A;  3ZHV A;  1YI2 V;  3A2F A;  1K4D C;  5L3C A;  4DV1 O;  1HNX O;  2P4V A;  3W7T A;  3BCC H;  3B40 A;  3IAY A;  1AR4 A;  2XOK G;  2JGU A;  1ZX3 A;  2F1M A;  3ZS8 C;  2ARH A;  1OCO B;  1YHQ V;  2IJK A;  3CXC U;  3K5L A;  1M90 W;  1AIL A;  3AEI A;  4DV7 B;  3AG3 B;  1PNM A;  2GUZ A;  2YIB D;  3KKY A;  2ZR2 A;  2V1D A;  3C3S A;  3M99 B;  4RO2 A;  1SS3 A;  2G38 A;  4L8J A;  1SQX H;  2KQX A;  3OM3 B;  1MZE A;  2ITD C;  2EJ7 A;  3RFR A;  1I94 O;  1KKD A;  3E86 A;  1ARO P;  4CS2 A;  2M7W A;  4GX2 A;  3H1L H;  3WB1 A;  4JTC B;  2OCC B;  2NNU A;  1HR0 O;  5GON B;  3JAS B;  3M8A A;  5LP6 C;  5GON A;  3RYI A;  1VQ7 V;  3VOU A;  4EFE A;  4LFB O;  1WLE A;  2JS3 A;  4IGG A;  1SKV A;  2OTL V;  3CCR V;  3ZIA G;  2QSA A;  3EVK A;  1DF5 A;  3MHS C;  3RYF B;  1NI8 A;  2PF4 E;  4N21 A;  4PA6 A;  1RM1 B;  1Y76 B;  1AI5 A;  1IXM A;  4LF7 B;  2AHY A;  4DV0 B;  5H5N A;  2Q7E A;  3FAV B;  4BIZ A;  2K9P A;  3RYC B;  4BW9 A;  2BTQ B;  3WB2 A;  3K9A A;  3FAV A;  5IJ9 A;  5DED A;  3CRQ A;  2BTQ A;  4G28 B;  1P7G A;  1AI4 A;  4PDM A;  1R3I C;  4LFC B;  1I08 A;  4P2Z A;  4FLV A;  3EHB B;  4DV2 O;  5LBQ A;  1URF A;  4MVQ A;  2DWD C;  2L6L A;  2EBO A;  2XAS A;  4DR7 B;  1KUQ A;  1XMO O;  5IDJ A;  1KKC A;  2UUA O;  1R6N A;  3I5D A;  1BQ0 A;  4YJ2 A;  3W7U A;  1P49 A;  2LFR A;  4Z2W A;  1KMI Z;  2BOC C;  1N32 B;  2XT9 A;  3ZRW A;  4IT5 A;  2JEX A;  4EKW A;  2L35 A;  4FLZ A;  2UXD O;  2QTS A;  3N2G B;  2ZE7 A;  1JA8 A;  1R73 A;  4TQF A;  4ZHQ B;  1X59 A;  2EZO A;  3OFN G;  5IYC O;  3E8F A;  1SQB H;  4ZHQ A;  2B1G A;  4K35 A;  3SJQ C;  4Q6G A;  3ICX A;  3L75 H;  5KAF Z;  5JH7 B;  5JQG A;  3F7Y C;  1W0J G;  3T1Y O;  1VQ5 V;  2JVD A;  4GKJ B;  2JK5 C;  1QLE B;  2WWW A;  1Q5O A;  4F4L A;  4JI3 O;  2N04 A;  4IIJ A;  1G6U A;  2QWN B;  4CZZ A;  2HFE C;  4BWA A;  1GN4 A;  4RAI A;  5LYJ A;  3I55 V;  5JJN B;  2BOB C;  2WLK A;  1H2N A;  2EIL C;  5CA0 A;  1JVM A;  3PJS K;  3IC9 A;  1YVW A;  3CCE V;  2EIJ C;  1P7B A;  5IYB O;  1HNZ B;  3RN4 A;  4TOI A;  1BGY H;  2YI8 A;  3N2K B;  1LUV A;  3UKM A;  1FXK B;  3K5O A;  2IBZ H;  2HG5 C;  4I9Q A;  3WG7 B;  5B3S B;  1QBZ A;  1US6 A;  3B2E E;  4H44 B;  3SPI A;  1FFT B;  3HKB B;  3Q4H A;  4H13 B;  2GTS A;  4Z1V A;  2EIM B;  3HKE B;  4J10 A;  3HKB A;  1UFI A;  2P6J A;  3OT7 A;  2P06 A;  1RP3 B;  4QPJ A;  2VQF B;  4CH6 A;  2F43 G;  4DV5 B;  4GKK B;  1SF9 A;  3JCU Z;  2IU3 A;  2WLL B;  4I9W A;  2R70 A;  3ZHU A;  3K0D A;  3ETG A;  3PN1 A;  1PV0 A;  1R6K A;  2RMK B;  2VWK A;  2R72 A;  1IZ3 A;  5IJ0 B;  3ZMZ A;  5JCO C;  4IYI A;  2YI9 A;  5FL7 G;  4WFE A;  4FLY A;  4GUN A;  1DF4 A;  4JI7 B;  3ZHR A;  2N74 A;  3CCU V;  4O4J B;  3NXS A;  3ABM C;  4ICG A;  4DV3 B;  2ZIN A;  4DV6 B;  1F23 A;  2R9R B;  2A79 B;  1W59 A;  4RUF A;  3H1H H;  1TUE B;  1N32 O;  3GWK C;  2ZDI C;  1F4M A;  3OUF A;  1TGO A;  1MSW D;  2UXB B;  2YIC A;  4I50 B;  2XHB A;  4R50 A;  4FIP C;  4JYA O;  4QE9 A;  3J7A U;  5HFL A;  3F7V C;  3OEE G;  2QR4 A;  2Z3Y A;  4FLT A;  3AG4 C;  2LFS A;  4JYB A;  2ZIO A;  3H01 A;  3SJB C;  1OCO C;  1KP3 A;  1Y66 A;  4J7J A;  2NR5 A;  3K04 A;  1NKD A;  1EZV H;  2E74 B;  4H0L B;  2WLI B;  4O4L B;  1YDX A;  3AG3 C;  5CA1 A;  4U3J B;  3D36 A;  3IC7 A;  4PD4 F;  4CS3 A;  2FTK A;  3K03 A;  4B7K A;  2DOS A;  4DV4 O;  1K33 A;  3AK2 A;  5JJE B;  3AK1 A;  1Q8I A;  2CAZ C;  1FKA O;  1GN6 A;  1GKF A;  4U7O A;  4KP4 A;  4UB6 Z;  3ABL C;  4B3T O;  1Q6H A;  4BW5 A;  5H6R A;  2QWR B;  3ZJZ A;  3FD9 A;  1HP8 A;  5LMU B;  1E1R G;  2QWP B;  2F93 B;  1ZAU A;  3RVZ A;  4F6R A;  3DSQ A;  3TJT A;  3JD3 A;  3ASN C;  4GX0 A;  1U96 A;  3HR0 A;  4PDR A;  2QKC A;  2UU9 B;  2VQF O;  2VRZ A;  2ZNI A;  4D7S A;  1JJO A;  3SJA C;  1IBL O;  5IYZ B;  4GT1 A;  5TIS Z;  3M7M X;  2PTM A;  4X8A A;  1FXH A;  3ABT A;  4JI6 B;  4X66 B;  1QR8 A;  3EFF K;  2Q5Z A;  4GZR B;  1SRY A;  1YJW V;  2PGG A;  4RWU A;  2LO1 A;  1RSO B;  3OMA B;  1FJG B;  3G80 A;  3S3X A;  1XI1 A;  1SZT A;  4LF4 B;  2JRI A;  2GDS A;  2ZCE A;  1AJP A;  4JAV A;  2P90 A;  1PL4 A;  1FYJ A;  4DV6 O;  1M56 C;  1AVM A;  1WN7 A;  5AG2 A;  2H8P C;  4QJF B;  4NVP A;  5KHG A;  4PI0 A;  2Q9L A;  2UXC B;  1EZJ A;  4EB6 B;  2HJD A;  1GN2 A;  3KZI Z;  2Q67 A;  2YC0 A;  4EB6 A;  2GTA A;  1ZSP A;  2CH7 A;  1FPO A;  2EIL B;  1BCC H;  2JGD A;  1F7Y A;  4JI1 O;  4AHC A;  2FYU H;  3CME V;  5JVD A;  3MDS A;  2QKA A;  1H2K A;  2EIJ B;  2DN9 A;  1G4Y B;  4QE7 A;  4X62 O;  3L9D A;  3CPW U;  1VAR A;  3SPH A;  3F5T A;  5ITZ A;  1CPY A;  2NN4 A;  3SPC A;  3R66 A;  1D5N A;  1QLE C;  1XOU A;  4LH6 A;  1SET A;  5C8Y B;  1W0K G;  3GWO A;  1YTF B;  3G4S V;  5F2V O;  5EYP B;  1IBM O;  5KX5 A;  4ABM A;  3SJC C;  5DN6 G;  3BFR A;  4DO2 A;  5LA6 B;  2ZE5 A;  2JJ1 G;  4OPH A;  3K3W A;  1K92 A;  5FPR A;  3E8G A;  1M5I A;  1QU7 A;  2IJJ A;  1F51 A;  4I0X A;  1QHT A;  3CMA V;  1HNW O;  1Z2G A;  2DYR B;  1SES A;  4E4E A;  1FFX B;  4P9P A;  3WG7 C;  3RGB A;  4HBN A;  5B3S C;  4LF9 O;  3WFV A;  4HZ3 A;  2W0X A;  3JCZ A;  4JI8 B;  1GRJ A;  4PA4 A;  2CTR A;  4MT8 A;  3JAK B;  1PP9 H;  2RDC A;  3TK1 A;  5LGU A;  5H2F Z;  1THZ A;  3K0G A;  3T1H B;  5CN0 A;  3ABM B;  4X64 B;  1V54 B;  5CB4 B;  1ZTE A;  2R9I A;  3LNN A;  1R3K C;  2OTJ V;  5EBM C;  5EZY B;  2HVK C;  4AQY O;  2B5U A;  1WB7 A;  2UU9 O;  2GBO A;  5LMN O;  3CB2 A;  5EZY A;  3T1C A;  2E5L B;  4CBC A;  5L3E A;  4J11 A;  1BZK A;  5B1N A;  4HAM A;  3AG7 A;  4PA9 A;  4TV8 A;  2QWQ B;  1KB9 F;  1KEC A;  4JI6 O;  1N36 O;  1Q82 W;  2AHZ A;  1QCE A;  4NXN B;  1DTO A;  1PL0 A;  1JOY A;  1LUW A;  3AG4 B;  4B3R O;  3EXA A;  2VWJ A;  1FJG O;  1Q90 D;  1S5J A;  4P9O A;  5EBW C;  1KBH A;  2WAM A;  5IY5 C;  2GUZ B;  1N33 B;  1MA1 A;  3SYP A;  4RQE A;  5B5E Z;  2OWO A;  1Q43 A;  4DUZ B;  2QGN A;  4K0K O;  2RQ6 A;  2QM8 A;  4IL6 Z;  2ETN A;  2LGW A;  3ZHT A;  1M57 B;  2ZE8 A;  1GTO A;  2ZXW C;  3FX7 A;  1JFF B;  5C93 A;  1YCI A;  1VQO V;  3LNM B;  4NTW A;  1JFF A;  4NYK A;  4X9Q A;  4UVC A;  1SQF A;  1TAE A;  1AB3 A;  2ATK C;  4JI0 O;  1XNR B;  2ADP A;  5GW7 A;  4XDJ A;  4AI8 A;  3TGU H;  2CUG A;  1WP8 A;  1IBK B;  3P3N A;  3ABL B;  1IVS A;  1TA8 A;  4DR6 B;  4J9Y B;  3K5N A;  2XAG A;  1X4T A;  3VBB A;  1G1X B;  3G71 V;  3D36 C;  3RYI B;  4H33 A;  2PYJ A;  2CGO A;  3STZ C;  2Y4U A;  3DXR A;  4MVO A;  4JTD B;  1K5S A;  5LGN A;  4MTO A;  4UVA A;  4FFB A;  4AIL C;  1VF6 A;  3ETD A;  4J41 A;  4XDK A;  3SPJ A;  4WFF A;  3ZRV A;  1SER A;  4I55 B;  4JGS A;  3ASN B;  4K8X A;  1XNQ B;  1M93 A;  4JTA B;  4J9Z B;  2QM4 A;  4I55 A;  2P7T C;  4X1I B;  5BMV A;  5KA6 A;  2Q6A A;  5IJ9 B;  5A2Q N;  2Y69 C;  4JI4 O;  4YJ3 A;  2BCC H;  2A7W A;  3CRA A;  3CEI A;  4O2B A;  4X1I A;  4LFA B;  1COW G;  4DR4 B;  2F4V O;  2D2C B;  3FB7 C;  4KXR A;  1B3Q A;  5B1A B;  4LH7 A;  4RUE A;  1NTZ H;  1R3L C;  1M4U A;  3KCX A;  4I4T A;  3S3W A;  1TVK A;  4MTF A;  1M9N A;  4UCS A;  4JI8 O;  2BE3 A;  4YJ2 B;  4TUY B;  1WNS A;  4X65 B;  4FLX A;  2E75 B;  1NT2 B;  3ZRW B;  3T1H O;  4FJC C;  4TUY A;  1M1K W;  3D3I A;  1M56 B;  2Y48 A;  4LCU C;  4MVZ A;  3FYE B;  3ZBH A;  3RWR D;  2Z0A A;  4I5S A;  2A06 H;  2E5L O;  3CYO A;  2KSD A;  2NLJ C;  1S5L Z;  4FVM A;  3W7X A;  3D8C A;  1RPO A;  4OXS A;  2WLN A;  4QPK A;  1J5E B;  3TXQ A;  4LF5 B;  4NXN O;  3LDC A;  5JQG B;  1NQT A;  4FM0 A;  1KYO F;  4BR6 A;  3K59 A;  1YF2 A;  4IYH A;  4IIJ B;  1NJI W;  2FB5 A;  3JAL B;  4DUZ O;  5LXT A;  4DV7 O;  4GYC B;  4LF8 B;  5LYJ B;  4O4I B;  3JAL A;  1P84 F;  5CA0 B;  3VQX A;  3OUS A;  3CRM A;  2YSU B;  3P3P A;  2UUB B;  2MK3 A;  1WPB A;  1S5H C;  4O4I A;  3MAQ A;  1S76 D;  1VF5 B;  3KG2 A;  4LR3 A;  1MAB G;  2WSS G;  2JIZ G;  2JS5 A;  1EN6 A;  2YIB A;  3APQ A;  3E35 A;  3E83 A;  4R7C A;  5B66 Z;  1LNQ A;  5CBH A;  4Z1M G;  2DWE C;  1PNK A;  2OYQ A;  2QA4 V;  1H8E G;  1VMG A;  1NTM H;  5LGT A;  2ZKO A;  1IBK O;  4DR2 B;  4JI2 B;  1AR1 B;  1NVP B;  4JZG A;  3LSQ A;  1QQC A;  1G8M A;  3JAR A;  3Q4H B;  2GHY A;  3BRC A;  2P4K A;  3RW0 A;  1IX9 A;  4IHJ A;  1VIB A;  3JSN A;  2CE4 A;  5J9P C;  4JYY A;  1VQ8 V;  1WAZ A;  5HFM A;  1PM9 A;  5L3F A;  3CRR A;  4R6Z A;  4OPA A;  1VQP V;  5KMG B;  2ODM A;  1XNQ O;  2XTA A;  2CK3 G;  2Z5U A;  2DYS B;  4LF7 O;  3QO8 A;  5KMG A;  4DV0 O;  1VQ4 V;  4ZI7 A;  4DR4 O;  1PD3 A;  4JPR A;  1S77 D;  2RN9 A;  1K4C C;  2DYR C;  4LFC O;  1UPG A;  2IM9 A;  4LNU A;  3APO A;  4JF3 A;  3AK3 A;  4ZIB A;  4PA7 A;  4WF9 V;  2UUC B;  3B4S A;  3F5W C;  1FAF A;  2AZ2 A;  4JI5 B;  1V54 C;  5BY1 A;  4L87 A;  3STL C;  3K08 A;  4B3S B;  1SA0 A;  4DR7 O;  1GMG A;  1VEW A;  2Y0P A;  2C2A A;  3GB7 C;  5FLX N;  2Q7G A;  4PDL A;  2HHH B;  2KKW A;  2OT5 A;  5IY5 B;  1AI7 A;  4J80 A;  2H94 A;  4DXW A;  4B3M B;  1Z5W A;  3R65 A;  4MVM A;  4YY3 B;  2ZXW B;  3P30 A;  4UCU A;  1QLN A;  1N34 B;  3J81 N;  1J5E O;  4TT3 G;  3JAW A;  2E3C A;  4X89 A;  1BS3 A;  2KG7 B;  3FFQ A;  1NBM G;  3FB5 C;  4ZBM A;  4LF5 O;  3DGE A;  1SQV H;  2KG7 A;  1BHB A;  1P4R A;  4UB8 Z;  3E22 A;  4HNA A;  3E8H A;  1R1B A;  2WLM A;  5FNV A;  5CA1 B;  1HWY A;  4U3F H;  4YIO A;  1NU1 H;  1KD1 W;  4O4H A;  5EC1 C;  4X1K A;  4D7T A;  4GKJ O;  1M57 C;  1GN3 A;  2ZM6 B;  1QVF U;  3X2Q B;  4DW1 A;  1SC5 B;  3ZCC A;  2XAF A;  1S3J A;  4DRX B;  2B9Z A;  3H1I H;  1JPX A;  2UUB O;  4J42 A;  1D2D A;  4FM2 A;  3L74 H;  4DRX A;  2Q4P A;  1EN5 A;  1YTF D;  4CC6 A;  4PV1 B;  2Y4T A;  4YIP A;  4GX5 A;  5J2U B;  2Y69 B;  3BAB A;  3HKD A;  4KL1 A;  5KA5 A;  3CRC A;  4R8C A;  1SQP H;  3B8M A;  5LP6 A;  4TV9 A;  4NXM B;  1OCR B;  2Q68 A;  5J2U A;  4QIW F;  1HNZ O;  4G27 B;  4MS2 A;  3QNE A;  2CTQ A;  4LBE C;  2VQE B;  4DR2 O;  2XAH A;  4JI2 O;  1VF6 C;  1S72 V;  4YHH B;  1GM8 A;  4I7Z B;  4F6R B;  4TQD A;  1MG1 A;  2BSK A;  1FXV A;  4MVR A;  1GM9 A;  3ETE A;  2ZT9 B;  5CBG A;  5BXZ A;  3E2E A;  3L72 H;  5JJJ B;  1A32 A;  3RT3 C;  3K79 A;  1L1F A;  2RCV A;  3B8N A;  1LR1 A;  4DV5 O;  4GKK O;  1NZ6 A;  5BZB A;  5CBF A;  3QO7 A;  4FPP A;  3UT5 A;  1E79 G;  4BAY A;  1MNG A;  3CHX A;  5B1A C;  3OMN B;  1XRE A;  3IFX A;  1YIJ V;  1ENV A;  1ORQ C;  4JYC A;  3TXS A;  3UCS C;  3T2M A;  2EX3 A;  1AP5 A;  4O2A A;  2ADQ B;  3HPL C;  4EEQ A;  3TET A;  1I5Y A;  1K8A W;  1ZUQ A;  1BL8 A;  3A8T A;  4JI7 O;  3ZMU A;  2UUC O;  4FLU A;  3LUT B;  1SZX A;  2HEP A;  4JI5 O;  1CP9 A;  3ETQ A;  2H3O A;  5LL6 Y;  4B3S O;  4DV3 O;  5EBL C;  4GCZ A;  4DV1 B;  3A0B Z;  1HNX B;  2HHH O;  1WA8 A;  3LSS A;  2PI4 A;  3LDE A;  3CX5 F;  1AJQ A;  4KHP B;  2CH7 B;  2JGD B;  2UXB O;  4GLX A;  2PUS A;  4ZOL A;  2HLD G;  5J2T A;  4YY3 O;  5IT9 N;  1N34 O;  5JVD B;  3BEH A;  5KHJ A;  1KC8 W;  2Q0A A;  2XND G;  2Q73 A;  3QTC A;  1N0N A;  2PZS A;  1Y74 B;  3IGA C;  2YS8 A;  5ITZ B;  3CSX A;  2X6B A;  1Y74 A;  3CE2 A;  3UO3 A;  2K1E A;  1I94 B;  1QNM A;  1I5X A;  2VS0 A;  2LGQ A;  1VF7 A;  2ZM6 O;  5KX5 B;  1MZF A;  2QKS A;  3K9S A;  1VQ9 V;  3SYO A;  5LHI A;  2EIK C;  2IJI A;  3U11 A;  1RPR A;  2IJH A;  3CCV V;  2B1I A;  4MTG A;  2RJZ A;  5L3D A;  4I0X B;  4LF6 B;  4NTX A;  1B04 A;  4PEL A;  1V55 B;  1U97 A;  2KB1 A;  3H1K H;  1JMK C;  1ZWI C;  4K8Z A;  2VQE O;  1ZLZ A;  1NS1 A;  5IWA B;  1XMQ B;  1OCC B;  4BIO A;  5LMU O;  2F23 A;  3DC6 A;  1UJW B;  3D3Q A;  3OR6 C;  4RQF A;  4JZ2 A;  1H2M A;  3CJH A;  2O57 A;  3G6B A;  3SR2 C;  3VQV A;  2DYS C;  2HVJ C;  1Q6I A;  2EJR A;  3ABK B;  3RBZ A;  4FFK A;  3LSU A;  4TV8 B;  2UUA B;  3W7S A;  4WCE V;  1GO3 F;  3CD6 V;  1KP2 A;  5IE9 A;  4DW0 A;  4X66 O;  3CC2 V;  5KUM A;  1MOF A;  2DW4 A;  4F6E A;  2V7Q G;  3OTO B;  3A0R A;  1JQ0 A;  4WFB V;  1XEQ A;  3LDD A;  3OE7 G;  1O9G A;  2PY5 A;  1JR9 A;  4DR5 B;  2ZDI A;  4LF4 O;  3CC7 V;  3SYC A;  4U7N A;  2Q8V A;  2DMX A;  1GAX A;  2IU0 A;  2RNB A;  2UXC O;  2M6Y A;  2N05 A;  1MMM A;  5KHK A;  4KHP O;  3OD4 A;  2QDO A;  1NR1 A;  3T1Y B;  1YZB A;  1XQ8 A;  3WU2 Z;  4A5U B;  2YIA A;  1R3J C;  3SPG A;  4JI3 B;  3CCJ V;  2A9H A;  3CCS V;  3U10 A;  1NH2 B;  5JWP A;  2LW1 A;  2WA3 A;  4NKG B;  3K06 A;  3DXR B;  4UCT A;  1I0H A;  2CTP A;  4D6T H;  4UVB A;  4FFB B;  3SDL A;  1H2L A;  3CS5 A;  3X2Q C;  1FS0 G;  1NVP D;  2E76 B;  5BMV B;  3A0H Z;  3BA9 A;  2ZE6 A;  4UCR A;  2OIE A;  2QTO A;  5KAI Z;  4YJ3 B;  4O2B B;  3ZN0 A;  5DM6 V;  5K1P A;  1B6Q A;  4J7Z A;  3JAS A;  5GTI Z;  3AG1 C;  4LF6 O;  1OCR C;  1H38 A;  1BQZ A;  5A9G A;  1E1Q G;  2X6C A;  4YXW G;  4DR3 B;  1VQN V;  4I4T B;  1TVK B;  3DC5 A;  3RYF A;  3ZRX A;  4CH3 A;  4FM1 A;  1K97 A;  1SQG A;  4WFG A;  5EK0 A;  4DK0 A;  1FD9 A;  1Y76 A;  5IWA O;  1XMQ O;  4XDL A;  4B7E A;  2DQ0 A;  3GVM A;  1YSC A;  5BR8 B;  1WB8 A;  3RYC A;  1XHX A;  2AGA A;  3ZMS A;  2JDI G;  3RYH B;  4X64 O;  4FMT A;  1EBO A;  1O9H A;  2XAJ A;  3RYH A;  2Y0I A;  4XBF A;  3ZMV A;  1L8D A;  3TCU A;  3BY6 A;  1Y67 A;  2QE7 G;  3FKS G;  5K1X A;  4JAU A;  1TUB B;  1OCZ C;  4H37 A;  2MW2 B;  4ASU G;  4MW8 A;  1VQ6 V;  1TUB A;  1NR7 A;  5B1B C;  1BHA A;  3ZHS A;  4OGQ B;  4LC1 A;  2LQT A;  2X6A A;  3VQW A;  3JD4 A;  3OTO O;  2D3O W;  4CH4 A;  1HW7 A;  3T4Z A;  2Q7H A;  1BT8 A;  3BHP A;  4QGP A;  3N2G A;  4DR5 O;  4LP8 A;  1XUQ A;  4JYA B;  3UQ8 A;  3JAM N;  5LXT B;  4NR1 A;  1N33 O;  2CGN A;  2YEV B;  1BSM A;  4OX9 B;  1N8R W;  4HYO A;  2YEV A;  1EM1 A;  2AZ0 A;  2FML A;  3N27 A;  4N23 A;  5B1O A;  4DYL A;  1Y4M A;  4KFM A;  2WA4 A;  2WLJ A;  3AG2 B;  1MSD A;  2EIK B;  5JH7 A;  4CS4 A;  1Z5V A;  1K73 W;  3JD1 A;  4JV5 B;  1XNR O;  2ZR3 A;  4MVS A;  3VQY A;  1YXB A;  1T5E A;  3QVN A;  4DV4 B;  5E79 Z;  3BA8 A;  4DR6 O;  3E8B A;  1Q81 W;  3CXH F;  4W4K A;  3JAR B;  3OAA G;  3K5M A;  4X20 B;  2QM7 A;  4IHJ B;  2QJ1 A;  5KLV H;  3ZMT A;  4G2K A;  4X20 A;  2LJ2 A;  3JD2 A;  4B3T B;  3H1J H;  4DR1 B;  1OHH G;  3SYQ A;  2GSM B;  1CXZ B;  3H9V A;  4CC5 A;  3CP1 A;  1GM7 A;  1OZ0 A;  5H9C A;  1GH6 A;  2QEX V;  2P67 A;  3OGC C;  4PJ0 Z;  2EZP A;  4FZ1 A;  3JSL A;  4PA3 A;  3N2K A;  3B77 A;  5L3G A;  1FXK A;  4ZI7 B;  2PYL A;  2A0L A;  2CDY A;  1QVG U;  4TWK A;  4LFA O;  3JD0 A;  1V55 C;  4ZKI A;  1EFR G;  4LNU B;  1WJZ A;  1Q86 W;  2AXT Z;  3UO2 A;  3HKE A;  1YJ9 V;  3OR7 C;  4DR3 O;  2YXL A;  5CMU A;  1OCC C;  1PNL A;  2HR3 A;  1VQL V;  1YIT V;  4JAA A;  1AI6 A;  5H6Q A;  3KCY A;  1SA0 B;  4UCO A;  4TSF G;  3ASO C;  1IBL B;  5BR8 O;  4UUJ C;  2WLL A;  3OMI B;  2CTW A;  1Q3E A;  4X65 O;  1K34 A;  3OEH G;  4NB5 A;  4UFZ A;  1XL6 A;  3ABK C;  4UV9 A;  2IH1 C;  2YDE A;  1XDC A;  5IJ0 A;  4E2L A;  2A3Q A;  1HDJ A;  2P22 C;  4UV8 A;  1GK9 A;  4O4J A;  3JAW B;  1XHZ A;  2DQ3 A;  2V4D A;  1F4N A;  1XL4 A;  1KQS U;  2EIN C;  1IUR A;  3ZX6 A;  3JYC A;  4FLW A;  1EN4 A;  2QWO B;  1H2G A;  1D5A A;  3E22 B;  1L0N H;  4HNA B;  2DE0 X;  2W6J G;  1PPJ H;  2IH3 C;  5FNV B;  4O4H B;  4X1K B;  5EIB C;  5GTH Z;  1PKX A;  4MSW C;  4JI1 B; 
#chains in the Genus database with same CATH homology
 4FZ1 A;  3S3W A;  3S3X A;  1WP8 A;  3N27 A;  4NTW A;  1WP7 A;  2L35 A;  2FB5 A;  4FZ0 A;  4NYK A;  2QTS A;  4NTX A;  4NTY A;  3IJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...