4BIOA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
339
Chain Sequence
b'SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4bioA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bioA01
2ILMA 2XUMA 3KCXA 4B7KA 4AI8A 4Z1VA 4QU2A 4B7EA 3P3NA 1IZ3A 4NR1A 3OD4A 2CGNA 3KCYA 5JWPA 4BIOA 2YDEA 2Y0IA 4Z2WA 4JAAA 1H2LA 3P3PA 1MZFA 1YCIA 1H2MA 1H2NA 2CGOA 2WA4A 2W0XA 2YC0A 1H2KA 3D8CA 2WA3A 1MZEA
chains in the Genus database with same CATH superfamily
4WCEV 4WVWA 2P06A 4MW3A 4YM0A 4FAGA 3BUCA 3ZXAC 2QWQB 3AKRA 4C1XA 4AVVA 1AX1A 3PUQA 1O5UA 1GOGA 4OQ9A 4LA3A 4DUXA 4HNAB 1AI7A 2NM1A 3FX3A 2IJIA 3B7MA 4BYYA 4LF5O 4MV2A 2QQIA 3CXHF 3UGFA 2DWEC 4P5YA 2P2KA 3QVNA 3WDYA 2PHXA 4Q2FA 2ATKC 1AR93 4ZIBA 1VQMV 5IVYA 4PV1B 4OULA 1JFFB 4IV3C 2RQ6A 2Y33A 1VF6C 2AZ0A 1M1KW 3EJKA 1WLWA 2Q5ZA 5K0UB 3CWBH 4GB33 3P6BA 3LQCA 1WD3A 4UBGA 1R6KA 4UFHA 2Q9LA 5BYNA 5DM6V 1M4WA 3H8OA 3VZOA 1QNYA 4JZRA 3CEWA 4I0WB 3JCUZ 5TSWA 1ND2A 1Y7BA 4LFBB 1RMU2 4W6YA 4QX2A 4N43A 2OX0A 1JYTA 1Y76B 1MR5A 4Q4X1 2ARAA 1SFPA 5IJ0B 1NVPB 2V73A 2BOBC 1RHI2 1XREA 2J1TA 4R9CA 4LFBO 3DKWA 1W6OB 2AGSA 2R9RB 5LWBA 3ZMTA 4KG8A 4I50B 1W8NA 2JIZG 3CMGA 2EIMB 3I49A 5C8CC 1S2KA 1C8M2 4GXLA 5JR7B 5FYHA 5FCCA 4L97A 3ZN0A 1NKGA 3AFKA 1RUNA 5F3EA 3P1IA 3ZN6B 4Z82A 4PIXA 1OOPA 2OUJA 4LBOA 1I5YA 3K06A 5A7NA 5FZKA 5JOZA 1OKOA 1E57A 4FPJA 1KKDA 3B8MA 1G9AA 1CXZB 2CSGA 4JTCB 1AXKA 1IBLB 2CU5A 1GM7A 1AJPA 2WRAA 1OQ1A 3RWRD 1S0GA 3N2GB 3LSQA 5LMUB 4TTGA 2RDNA 1PMJX 3B9IA 2QQVA 1JU4A 1XNQO 1B6QA 1LULA 2E9QA 1PGW2 1A8MA 4WFEA 2JDMA 1NKDA 3VBSB 5IFTA 1OT5A 1UN1A 1K7DA 5LMUO 5FKBA 5B3SB 1DIWA 3ZO0B 3VBRA 3DC5A 1JI6A 4TSVA 2ZD9A 1V00A 4YJ2B 5LA6A 3S5AA 4L92A 5EJ3A 4GJYA 4MVOA 4ZBMA 5BXXA 2W3JA 1P8JA 2ZZQA 3LOIA 1ZUQA 2ZGOA 4AFCA 3HKBA 1QHTA 3B02A 3ZHUA 1UZVA 3E6CC 1ASJ3 1V6IA 5CG8A 4FPCA 3ASOC 5KXEA 3VKFC 2UXDB 3PUAA 3MHHC 3CSXA 4IIJA 5KHKA 3MF9A 2JEXA 3SC7X 3DYPA 1LGCA 4IYHA 2BOJA 3A0BZ 1ZM1A 4QPGA 4EB6B 4B7KA 1IKPA 2XJPA 1J3PA 1EFRG 2PUSA 5J9PC 3L2YA 1G9CA 5IK7A 5JI7A 2RS11 1OF3A 5A2QN 1TME2 4AE2A 2HWB1 4O9GA 4UUJC 2XXZA 5DAQA 4FPKA 5C70A 3RS6A 1SF9A 2YI8A 4P2ZA 2GV9A 1R3IC 3MIFA 1NXD1 4ASMB 2YIBD 3I2DA 4LKFA 1NCQB 4D94A 1XMOB 1TVKA 2KG7B 2OTJV 4XEZA 3KGZA 1AR81 4I4TA 2ZHKA 1SCRA 3JSNA 1RP3B 4HKWA 4XDOA 2IBZH 3TAYA 1DQ1A 3VL8A 2QWPB 3MFCA 3UKVA 5IAVA 1WNSA 1DLBA 2Z0AA 5LP6A 3AG4C 1LKNA 2D5HA 2P6HA 1JVMA 2MW2B 2VQUA 2ZCEA 3H1JH 4CU7A 1JZ6A 3OF1A 4AQYO 1AJKA 3TCUA 4YYOA 4R4XA 4IE0A 4NYKA 4IEZA 1US2A 1S72V 1J1TA 1H8HG 3ILNA 4O7XA 4AFBA 4NWWA 4NXMO 3ITQA 1QHDA 1BSMA 3MI8A 1VBA3 1NG0A 4FTEA 3K48A 3O14A 3ZRWB 4FT8A 1S77D 4G4FA 4R6ZA 3ACIA 5F1RA 4J11A 1L8DA 2P4VA 2ZIMA 4CDQC 1VMFA 4G3YC 2WKKA 5GTHZ 4A44A 1QJY1 3N7JA 2K9PA 2YICA 2R073 3VZJA 3T1CA 2PTMA 3VBUA 1QOSA 4CBCA 3OGRA 3K5MA 4JDMA 5J09A 2BBVA 1G6UA 1X33A 3KG2A 2L35A 1M56C 1L7RA 1W8WA 3L73H 4BR6A 5EIBC 3ZSLA 3CIHA 3D0SA 2G9GA 3DXUA 3NJZA 4QQHA 1GICA 1YTFD 1VMHA 1YFYA 4QGNA 4P9GA 1VBE2 1LODA 1U0AA 4RA0A 5JXHA 5DG2A 3URFA 4GQ7A 1KJRA 5H6QA 5JI9A 1DQ0A 2VTXJ 4LBQA 1KD7A 3WW2A 1LESA 1UZWA 5C4WC 2ZX0A 4Q4V2 4FFBA 4CDWB 1Y67A 2ZEZA 3CO2A 4I0XB 2DU0A 2QZ3A 5FZ8A 5I91A 2RM21 1J3RA 1S0DA 1COV1 2YI9A 1NCRB 1UPSA 4CU9A 5KXCA 1AXZA 4CPBD 5FQ0B 3VBOB 2UUCB 2FDGA 1N0NA 1U5ZA 1AR73 2YGLA 5A6QA 1W2NA 3RMYA 1BLZA 4LKEA 1AF9A 2VS0A 2YEVA 1MEC2 5CB4B 5JMOA 1VQ8V 1RUG3 3GWKC 1LU1A 4CDXB 3TN91 3O1TA 4LKDA 1Q7YW 4UCSA 1VIWB 4XCBA 1LHNA 3AXEA 1BJQA 2JG8B 1BHBA 1AYN2 3F7YC 5KX5B 4B3NA 3E8FA 3JD73 5E8AA 1K9MW 1IGOA 3H3UA 4AHCA 3RYPA 3UO3A 2Q5TA 4CH6A 4MS2A 5A3UA 1QXRA 2WO2A 4XUPA 1RVF3 1GNZA 3QG5A 4DUZB 4ZY9A 1O3TA 3V0BA 4I02A 4M3CA 1N33B 1KP3A 1DQ5A 2HWD1 5DN6G 1ZLZA 1B35C 4BW5A 3VD4A 4HT1T 4BOWA 3MHZA 2QZ2A 1CD3G 1PHMA 1QLEC 4COVA 4K3AA 5APAA 1FJGB 1OBNA 3R4SA 4MXWB 2D6OX 4GWJA 4YGCA 3ZR6A 1IZ3A 2QJ1A 4YM1A 4XTPA 4JVAA 5IYDO 2DWDC 4CE8A 4LF9B 2VCCA 2XHBA 1AL0G 4DK0A 2ZTNA 3RRDA 3JAWA 3WX5A 5CFDC 1DG6A 2VZPA 4UVCA 2VW1A 1ZBA1 1PKXA 3EB7A 2PA7A 1XL6A 2WO1A 1Q86W 3OB8A 1IURA 2P1BA 2XH6A 3RYHB 3ACLA 4QPWA 5AG2A 1DGWA 3U78A 1R1A1 1LGNA 1XNAA 1PNGA 4IE6A 4RR3C 2AEYA 4M3CF 3O5SA 3WF0A 3AL5A 5IHRA 1EZJA 1RITA 4UW6A 4XFFA 1DFQA 4Q4W3 1RUH3 1J84A 3SH5A 1EY2A 1UOFA 4CP2A 4NAOA 1A34A 4XBQA 4RS5C 2PHTA 2ET1A 1M57B 4I01A 3JATA 3VZNA 4JGZB 3WCRA 2KSDA 2WFF3 2Q8EA 2XJUA 3DPRA 2VULA 2WLIB 3RVHA 3ABLB 4Q20A 4NHXA 2W87A 3ZMUA 1K73W 1N36B 4XJWA 4D3WA 3E89A 2JEMA 3VZMA 4AQSA 3RI9A 3L75H 3IT8A 4PQ9A 5LRRA 1URFA 4KI5M 3AP9A 3K4DA 2DCZA 3PHMA 3O65A 4CXXA 3KQ4B 4FZ1A 2JX9A 5FZ7A 3K75B 4Q4X2 3GNEA 4IGOA 4U36A 2R041 2P3IA 2Q68A 3LDBA 2DVBA 3EHBB 1DDLA 2QM7A 2Z79A 3SPHA 2ZPXA 3AG1C 4LMFA 1C1LA 4IEPA 2YXSA 2OIEA 4U7NA 5EC2C 1KS5A 2OKXA 1AUYA 5FNVA 1V9PA 1CAVA 2VNVA 3VBFC 3OMNB 5ACA3 2LROA 4MGYE 3EVKA 2BQPA 5B1AC 3QACA 1DQ4A 4IE4A 1JX9A 1ZL8A 1ODMA 3I3MA 4DV5B 1X7NA 2R32A 1BMV1 3VDDA 4XBLA 4QHZA 4X6RB 5LBCA 1HDJA 4AG4A 1RUC1 4AQ6A 5LY1A 2Z69A 1NT0A 4LO4B 4BH9A 5A7OA 2JJ1G 3ZFGC 2HYKA 4FK5C 5T5OA 1NR1A 2EINB 3VQYA 4WZCA 4XDLA 4FPEA 1RINA 2IH3C 3QH7A 5BV6A 2UU8A 3AFGA 3WW3A 2JXAA 2E31A 3NNFA 3CX5F 2CGOA 5B5EZ 4HVQA 3JQWA 5LYJB 3FX7A 3W9AA 1XDCA 1J1LA 4QU2A 1SMVA 3NJXA 4TUYA 2QKAA 3BGAA 4HSLA 4N8MA 2VM9A 1YQ6A 3GZEA 3ZVXA 1VQ7V 1PK6C 2B1IA 5EBWC 1IBKB 3B77A 2EIKC 2JE7A 1W8ZA 4B3SO 3J7AU 4QXKA 4QB2A 3KGLA 2WC2A 5B1OA 4DR7B 3OTOB 2UXBB 3TRSB 2ZKNA 2HWF1 1SG3A 2WSUA 5T5LA 3VQXA 5FPZA 4LIVA 3HBZA 5BPXA 4XDPA 2WLMA 3NAPC 5D5PA 4DV4B 2OYZA 1BCCH 4PCRA 5EIYB 2D6MA 5JAXA 4JYCA 2RDCA 2RS12 2HVJC 5FBJA 2RNBA 3DTUB 2HWB2 3L9DA 5JXIA 4MVRA 3FWEA 4MVTA 2JK5C 1DF5A 4WFGA 3K57A 4DK1A 3AYCA 1W6MB 2VZTA 5BZBA 5DG1A 2O8OA 3W21A 4O2BB 1OCCB 4X66B 4X20B 5CEHA 1CAXA 2Y6KA 1AR82 1K97A 4JHTA 1W6QB 1D4VB 3RMXA 1I9RA 3SYQA 1O8PA 3MW2A 1QVFU 1H30A 3ENRA 4WM8B 5EZYA 2ZS6B 5EK0A 1DBNA 3KS7A 2RS51 4CDUC 2ZBJA 3OSDA 4EROA 4BQ4A 1R083 4BQ5A 3CC7V 1MSDA 2Y0OA 3LF7A 4C91A 3E6BA 3JUUA 4P9OA 3WLUA 1LU2A 1RHI3 5IWAB 2QM8A 4QX1A 4LFCB 1X4TA 4AHWA 1FT9A 3CEIA 1M90W 3J81N 4IW3A 3VDBA 4BQWA 2W1WA 1OA2A 5DPNA 5CA0A 4KWUA 1JU3A 1DF0A 3B01A 1H1AA 4JV5B 3PVBB 3H7JA 4UCOA 3AMHA 5E89A 4LFCO 4NHYA 4CCKA 3AG7A 2A79B 4YZ3A 3SHRA 4LO8A 3SYOA 1H2GA 1OZ0A 5CMUA 5EJZB 1QJY2 1DTOA 1U96A 1ZSPA 3ZJZA 1CZTA 4JV5O 5BUVA 3APBA 3FFQA 4A7KA 3KZIZ 2JDZA 1PP9H 2BTQB 3IDAA 2P5OA 3MFAA 1KFXL 3G80A 5IYZA 2K0GA 2QA4V 3MLKA 2EA7A 3AG3C 1RXFA 4MHRA 1LCLA 1B3QA 2CAVA 5F5QA 5GJ6A 3OUJA 2WLKA 1W6PB 3BB6A 4QPIB 5F6LB 3CC2V 4EKWA 4EYUA 2UY8A 2VXJA 4JYAO 2WNOA 2B9ZA 1AR63 3JALA 5JZGC 5F32A 1QU7A 1V9U3 4KG0A 4CUCA 4SLIA 1VP6A 2JGDA 2VBBA 2VECA 1F4HA 3FZ3A 1HQLA 4UAPA 2ZXQA 4NE9A 3T4VA 1G8MA 3ZMZA 4AEDC 4NHMA 1WA6X 4GX2A 1X9PA 3SEEA 1N47A 3AKTA 1OPOA 5CU1A 2RM22 2A70A 3IPVA 1COV2 4BQYA 4XUQA 2X53S 4JDNA 3O1PA 1GM9A 1JQ0A 5I0UA 3CJHA 1KYOF 3J7HA 4B29A 3H1IH 1UMHA 3IFXA 5EYPB 2PQQA 2XQRA 4GKJO 4LPLA 4KP4A 2JDKA 5B66Z 2OYQA 4JPRA 1CPNA 4NUBA 4ZPIA 3TN92 2Y4TA 3WCSA 1NI8A 1JOYA 2GUZB 4DIQA 1YITV 5K8SA 3W20A 4IHJA 1K8AW 4N53B 4JI0B 4E4EA 1LENA 4LBQD 2X10A 3LIGA 3O0VA 2FBEA 1GO3F 5BNPC 2C26A 4JTNA 4BIFA 4F6RA 1FFXA 4YIOA 4KHPB 4CEYA 3J7NA 3VKMA 3N7MA 1Y74A 4XURA 1GNYA 4DOUA 2LJ2A 2OQ7A 4LJHA 2AHYA 3LSSA 1K5MB 2GMMA 3ME2A 3JSLA 2HWD2 1FV2A 4ES9A 4BB3A 1R093 1UF2C 3G6BA 1RJ7A 4QM8A 4QXHA 4HK9A 2E7AA 3BVOA 3C8XA 2VOTA 1RM1B 3IBMA 5J37A 2G9FA 3TEYA 4CZSA 4CEWA 4Y4RA 4J9ZB 3I3BA 5SV8A 5C7GA 2PI5A 1WP7A 2JRIA 1GQGA 4DXZA 5BY5A 5A1AA 4DV0B 1ZBA2 1H2LA 2RS33 2XJTA 2VQAA 4LNUA 2ZX2A 1G9BA 1F2NA 4H44B 1SZXA 2E5LB 1SC5B 3WOGA 5FP8A 3LDDA 4LF7B 3AP5A 1R1A2 4LBJA 3ZYBA 1JMKC 5FV3A 1NQDA 5A32B 1WBLA 1OC1A 3M3IA 1Y4MA 1GZ9A 3ABZA 2GC2A 2XAQA 4Y1XA 3E2EA 1V6LA 1H1IA 4AI2A 2LW8A 4XFAA 1KJLA 4YVSA 4LH7A 3GJAA 3VBRC 1E5RA 1ND3A 1H6XA 3PIGA 2Y8KA 4DUYO 2Z4FA 2HWC1 2KR2A 4KL1A 3KF5A 2KQXA 1JYNA 4K40A 2Q7EA 4K6BA 3ZOIA 5FO9B 1UOJA 4KWJA 2GH8A 3WG2A 4B08A 1EAH1 5FO8B 1UY1A 3POSA 1PO11 3SPJA 1TQ5A 4KWKA 4UYBA 1W03A 2R042 1A32A 5BR8B 4X64B 1N3OA 1RUF3 3UO2A 2BERA 4DV3B 2WN2A 4XFCA 1NR7A 1LAJA 4X89A 5FUNA 3DUIA 1BEV3 2EZOA 1S76D 3GHMA 3Q8BA 3MBWA 3CCEV 5GONB 4P9LA 3OEHG 1TVGA 2ZQMA 3WHUA 5LK7B 2I74A 3HT1A 1IS5A 5C6CA 5BNNA 2OT7A 2JG9B 2WNUA 1SFYA 5L19A 4N9HA 5IY5C 2AACA 3TETA 4MTFA 1BMV2 3VV1A 5DUVA 3G4SV 4U7OA 4MVMA 1OLRA 5DDJ1 3JBG1 1RUC2 1DLCA 5A1FA 2GN3A 3K0GA 3WDUA 1L1FA 4H7MA 2IJHA 4PBOA 2E32A 4OI2A 5CKNA 2ARXA 4GWMA 1I5PA 2F4VO 4J7JA 1CPMA 2W1QA 3K79A 3DGEA 2EIJC 4H33A 5LRSA 3N27A 1YJ9V 3K9SA 3OGVA 4MLOA 4UVAA 3FBYA 1QJFA 3DEMA 2PAEA 4X1IA 1HXS3 2W1SA 1YQCA 5K1PA 1XNKA 2MEV3 5DAXA 1VBC3 3ZFFA 3JAKB 3RN4A 4GH4C 4EFEA 5CIRA 2Z2SB 2H94A 2D3PA 1B09A 2GNTA 4JI4B 4UI9L 2H6BA 1FV3A 4MGIE 3LFIA 4UBHA 3PUSA 3RZHA 2QTOA 2TBVA 3THDA 5HCAA 1UYXA 1KDMA 3IMNA 3P3NA 1DHKB 4L9BA 1SBEA 5L3GA 4O2AA 3NO8A 4NTXA 3IC7A 4RGAA 3DXRB 1X59A 2HWF2 4WFFA 1TAEA 2OS2A 4GMP3 3GJBA 4I0BA 1MVQA 4ATFA 3RW0A 3WXPA 1K5SA 4GWNA 4IEYA 3LSUA 2WNEA 3ZS8C 5FZOB 1Z5VA 2BGPA 5A6ZA 2XNDG 1QDCA 1Q8QA 3ASNB 4U3FH 4YJ3B 1D2DA 1S0IA 1YC61 1HW5A 3A22A 5KMGB 1WB7A 3I8TA 4NAMA 4KUMA 4WFBV 1HRI1 3HVDA 4QGLA 1EPWA 2ATFA 2BSKB 4MVZA 4DR2B 4XW3A 1HV1A 4L8QA 2KB1A 4COUA 1IKQA 1POV3 2RS52 3ETPA 5FYIA 3U1XA 1W8UA 4I7ZB 3QD6A 3JASB 1OCOC 2ZE7A 2E74B 3ZCCA 2FZ1A 4P08A 3DECA 1O4YA 3U0ZA 4Q4X3 3AMQA 2JEUA 2D7FA 3WFVA 3LA3A 1UW8A 3O7OA 3RZZA 4COZA 5I93A 3IKWA 5FYBA 1D2SA 5JPMB 4OFGA 2Y48A 4CCCA 3TYJA 2VOKA 3FJSA 1AJQA 4UF0A 4E4SA 3RYFB 4MSWC 3OUFA 4Q0VA 1XOYA 2CY6A 4YHHB 2R70A 2XBO1 5C5UA 1ZRDA 4FOWA 3FLPA 1G8WA 4XMIA 2K46A 4QKBA 2FCUA 5J2UA 2YSUB 2J7MA 2X5IB 1MA1A 2IWGB 3ZRXA 4IEQA 1QOOA 3SEPA 3V0AB 5FOBB 2B39A 2RE9A 2JENA 3HKCA 2AW9A 4WM7A 1W2OA 1LHVA 5FYZA 4X1KB 4RGGA 3O1SA 1W3XA 3EMRA 2OCCC 1N1VA 3AMMA 1GZWB 2PMWB 2IW5A 2WFPA 4DR3B 1IQDC 3T1MA 2YBSA 3RFRA 4EN7B 4JASA 1HIXA 3AJYA 3M1HA 4TV8A 2W08A 1CESA 1SQ4A 4OVEA 4ET7A 1WA8A 2XASA 2DVAA 3CCRV 1GZCA 3CMAV 5FZ6A 4Z8BA 4OUEA 5LK5A 5JSOA 3OBZA 4HBNA 5FYTA 2RJKA 2PHLA 1PV0A 3MV11 2GTSA 2X6BA 1GK9A 2ZAAA 4IGGA 1XOUA 1KU9A 1IBMO 1SLLA 2SBAA 2ZGTA 3A23A 1GOHA 4D7YA 4IV3A 3N9OA 3LGRA 4PIZA 2VVFA 2FDJA 4BQ1A 1CVNA 4QDRA 4RQPB 2X09A 2NN4A 2A71A 2QKDA 4JI8O 1D5AA 4K1YA 2IVJA 1HP8A 4AVCA 1QJX2 1UZ0A 2PAMA 2EXKA 1RSOA 3OY8A 4RFT0 3LPGA 3RNSA 2RR11 2NLJC 1CAUA 2PLV2 3WP4A 3X2QB 4JRAA 2ZGMA 4XF1A 4YY3B 2EAKA 5IFPA 2VOXA 2TUNA 4JI1B 2DURA 4GJZA 3U4SA 4JYBA 5LHHA 2E6VA 5CA1B 1VAMA 2QDOA 3AB0A 5BMVA 5DUXA 4C8DA 4LF6O 1NLSA 4JF3A 3J8F3 5FKCA 4K0KO 5A6XA 2PI4A 2HWB3 2QQWA 2CH7B 4JQRA 2Q0OC 3OEEG 3ZDVA 2HVKC 1O3SA 1I94B 1ULFA 3W5MA 2FMLA 4TV9B 5B2GB 4CSWA 3QNEA 2BVBA 5J96B 4GWIA 1PIV1 3IIAA 1I3HA 3AK0A 3BU7A 4O4HB 1LHOA 1KXGA 1CP9A 5A33A 1H4GA 2XHNA 1FMD1 4FTBA 2YIAA 4HN1A 1OURA 3NNJA 4UXAA 3QO7A 4DRXA 1OCRB 1J58A 3UESA 1SA0B 2D97A 2GZWA 2R0HA 4QB6A 3ZYPA 1LHWA 3FHIB 2WBKA 4UV9A 5FPBA 2R6QA 2X6AA 2WWSA 3VBHB 2O57A 5K1XA 5A7WB 3VBBA 4BMEA 1QH7A 2DYSB 5JXGA 3HKEB 1VRH3 3CPWU 2XAJA 4LQRA 5LBEA 1RUE3 1ZZ8A 3VDDC 2GC0A 4LBNA 2VH9A 1ENQA 1S5HC 5EBMC 4YW2A 1VF7A 3ZFEB 1Y9QA 1Q3EA 5EPAA 3C2UA 4CTEA 1JZ4A 3CKHA 4JQTA 4LLFA 5JDBA 4JCKA 2ADQB 1S0FA 2PYJA 1AI5A 1C28A 3ZSEA 4Q27A 1KBHA 3JD3A 3AZZA 3FUQA 5FK8A 1KECA 3JU9A 4HNAA 1JZ5A 3KZ4C 3O0WA 1DGRA 3AVRA 4LCUC 1KP2A 3HB3B 1QJEA 3HKDA 2BWAA 1QNMA 4Z07A 4QIWF 4QX0A 3ZKYA 3ZYFA 4AI3A 1HX6A 2NPIA 2HLEA 4LULA 4FXKB 2XVGA 4YGEA 3BA8A 4K8XA 3F2ZA 4HVOA 2AGAA 2VJXA 1WA4A 2SLIA 1EAH2 1PO12 2B5HA 1SS3A 1XNRO 3HQXA 2ZGRA 5FYYA 4EN0A 3T2QA 1UFIA 2IJKA 1EM1A 4B1MA 4JI6O 5J2TA 2BU9A 4GX5A 1JFFA 2P7TC 2RM23 1FXZA 3SITA 2GTAA 2ZE8A 1LHUA 2RG4A 3OBRA 1VQLV 4PDMA 4Q4Y1 2YU1A 1XMQB 3ML0A 2VQTA 4UCUA 1RYYA 1NX9A 2G1MA 2YHJA 2R9IA 2YXHA 3VQVA 4OHWA 5KA6A 1X8MA 1N32O 2VRZA 1ZZ7A 1V54B 3K04A 5ABJC 5IUQA 1Y76A 1YIPA 4IL7A 2D3RA 3H9AA 1AILA 1FXKC 2ZE6A 2B4KA 5DDJ2 2ZX4A 3JBG2 4N43B 3POWA 1JOJA 1L7QA 4I50A 2X8KA 3L70H 1D0HA 4MH0E 3K4AA 4IE7A 2EILB 3OD0A 3ZN4A 4CDQA 1UZZA 2BFUL 5J48A 1S5LZ 3CJXA 3AYEA 2YGMA 2RDQA 4R8HA 3VZLA 1M9NA 5FIXA 3WT3A 4XIOA 4FP3A 4E8DA 5F2VO 4RSUA 2W2IA 1FAFA 1N1SA 2FDKA 1OOPB 3ETQA 5C3SA 2TNFA 1GN6A 4WVVA 4B7EA 1HNXO 1M93A 4NRQA 1GZTA 1HNZO 1DK1A 4NIGA 3H3LA 3I2JA 4ZKTB 4JI2O 1W9WA 4L87A 2BNNA 5J3UA 3ELNA 3K77A 2MHFA 5C93A 4NR1A 1H8TC 2VAUA 3PN1A 2WR9A 1UOBA 2Q1ZB 3RZGA 2DE0X 2F17A 5FJKA 2NMNA 2CWSA 1SRYA 4D8MA 2FMYA 1EUUA 3C7FA 4LF8B 5C4WA 2DTYA 5IVCA 1XRUA 4OZXA 5IVJA 5LA6B 1SQPH 4FPLA 2UY9A 4AL9A 2G38A 4ABMA 3LFMA 4G9SB 3RYCB 3AVSA 5D21A 2A6XA 2N05A 4UW3A 2F6BA 2HEWF 1QR8A 3WF2A 3IAYA 3ZFEC 3HKBB 4N23A 3F7VC 3FFZA 3DN7A 1GOFA 2CYFA 1FX5A 3USSA 4K20A 2HEVF 1NA1C 2UWAA 1FPN1 2DVDA 3VD9A 2DU1A 2D44A 4QPYA 4EJRA 4XFIA 3M3OA 1VBD1 5B4NA 2WLPA 1YHFA 2DW4A 3I55V 1QJU1 1HRI2 2WWJA 4IIJB 4MSVA 2DTWA 1SPPA 2RJ2A 2IC1A 2GU9A 5JH7A 4HOOA 3U37A 1T2XA 5JJNB 4WBNA 1SLTA 3T0BA 4LBKA 4LHNA 1M06G 1WLDA 4JI5O 3NW4A 3WVJA 4QE9A 1STMA 4QPGB 1UPIA 3O1RA 5L3BA 2WAAA 4AI9A 4DMIA 4HPKA 1XPWA 3CDZB 1PO23 3WB0A 1MS8A 3ZM8A 3GALA 2ZDIC 2R043 1AVBA 2G4IA 4CC6A 1B35A 1NCQA 2XONA 1RPOA 5C3RA 5KXBA 2OWOA 4YLZA 3ZKUA 3OGSA 1AP5A 3AX4A 2P3YA 3H3ZA 1ZREA 1W2AX 4I3GA 1REEA 1TVKB 4ATEA 4TSFG 3Q8FA 2UXCO 1MSWD 2V4VA 3TNQA 1JPXA 3LEMA 2DQ3A 5JIAA 2VD7A 1QMJA 1COWG 1CAWA 1ULOA 4W4KA 4INDA 1H9PA 4CEYC 1IS3A 3CCVV 4NPRA 3BEHA 1GWMA 4NHKA 5LP6B 3W7TA 2ZMKA 5CBFA 1ONAA 5FZ4A 2QVSB 3LNNA 1W0NA 2Q1FA 2C2AA 1IX9A 3KVAA 1HN1A 4J41A 3DGTA 1OV9A 1RUC3 2E53A 4JKKA 4CVUA 1Q90D 3ZEDA 1RUJ1 2ETNA 3GF6A 1P7GA 3THCA 3D0JA 2QUOA 4RR3A 3GZUC 1UO9A 4L11A 1EP0A 2LUWA 3KD4A 1WMDA 5C3OA 4P9JA 1HR0B 2Y6JA 4FZ0A 4D6SA 2QNKA 5IWFA 2ZAHA 5D5QA 2NYYA 3AK2A 4ZOLA 3K08A 2Q8OA 1KQRA 1RUD1 4RS5A 1O4TA 1VE0A 3QH6A 2PHRA 3VBUB 1U5IA 3ZHSA 4X1YA 2IVIB 4OQ8A 3GGLA 5JIUA 4D69A 2VVEA 4DRVA 5F39A 3UT5A 3BOWA 2DYRB 4AXOA 4X6QB 3RI8A 4Q0UA 4P30A 3ES1A 1FXVA 1OPMA 3PVNA 3K46A 2P17A 4PJ0Z 2CDPA 2XPJA 5FPOA 1XB9A 1LTEA 3K58A 2UXXA 1WCQA 2GNMA 1HN0A 3ZMSA 4E4ZA 1EPZA 2RR12 3AC0A 2XOMA 5I8TA 2HWF3 3SCFA 4YXWG 4A7YA 3MW3A 4FOYA 2IFWA 4BCUA 1OI6A 4B3TO 2C0ZA 1AR91 4AVTA 3PUIA 1L3JA 5FPAA 4FFBB 5JLVA 4FFGA 5A6YA 4EFBA 2BGCA 3LE0A 3OGCC 3WNKA 4GB31 4PI0A 1MZ6A 1VQPV 3WG7B 2EZPA 2CDYA 2W0FC 3AMPA 3EFFK 1XJAA 1PIV2 3PIJA 5AFBA 3FD9A 1QWRA 5IJ9B 2RN9A 2YEVB 2UUBO 2XJSA 1G1XB 2JG8A 2WA3A 4Y26A 3RJ2X 2LO1A 1FMD2 1VAKA 1PVC3 2BVVA 5KHIA 3F95A 4MVUA 1KKCA 5DUUA 2RS53 3R0RA 4K21A 1ZZBA 4YARA 4ZHQA 3WP5A 1EZVH 5L3EA 4X88A 3GCXA 2DUQA 3CL1A 1W0JG 3ZMNA 5T50A 3V0BB 5E6HA 3IDCB 3BPZA 1R64A 2V4DA 2ZEYA 4Y5Z0 1Q5OA 4OHVA 1V6KA 1E1RG 3GCWA 4MTGA 5L7OB 2VMFA 4J1WA 1XE0A 4WVMB 3BCWA 1VQKV 1S55A 4YGBA 4DB5A 5GZDA 5FXWA 4MT8A 2XUEA 5J1XA 2HG5C 4ASKA 1PK6A 1VQNV 2ITCC 5IVFA 2AREA 3ABKC 2VL4A 5E88A 1DZTA 3OUIA 1Q82W 3D82A 5CA6A 2W95A 3PVEA 4UB8Z 2A5ZA 5FXVA 5HCBA 1Z2GA 1RFYA 3JAWB 3RYHA 4XF0A 5F3GA 4CPBA 4H55A 4YRDA 4DW0A 2XAFA 1O8SA 1BBT3 5IT6A 3GB7C 1JZ7A 1YFUA 1X82A 2VR4A 2R9AA 3W7SA 3LB9A 2OIGA 2VZQA 3NAPA 1AROP 3PJYA 1QH6A 1MZFA 1KDKA 3ZHVA 2D6PA 3D3AA 5ERLA 1WN7A 2WT0A 4XFGA 5FMOL 1WUVA 4BLIA 3C7OA 2AXTZ 1BYHA 4OX9O 2JE8A 1CIWA 1PL4A 1T6GC 1ASJ1 2I07B 4XCAA 5EFUA 2EIBA 4FPYA 2VMCA 1VMGA 3AP4A 1DGLA 5B1BB 5CFCC 3K3OA 5AVPA 3POYA 2WNVB 2QKSA 2WYSA 3ZXDA 5CG9A 3OR6C 5A7PA 4BAYA 4GMP0 4R9BA 4Q4Y2 3WQ0A 3JATB 4NIAA 1RC6A 2WIIB 3RYRA 4JI3B 4CU8A 1IDSA 4D0QA 1F31A 3DPRB 3E86A 4CDUA 1DU3D 1OCZC 2OZJA 2IJJA 1QJX3 1ODNA 3FMGA 2E75B 3GVMA 4JI3O 1Q8SA 2PLV3 1A8DA 1UU5A 5CNAA 3OPTA 3AG2C 4G2KA 4KGQA 4ZXKA 3CJIC 5JQGA 2ZX3A 3P5BA 3VDCA 4XF9A 1VQ9V 1X8EA 3ABMB 3KQRA 3TEZA 4P00B 3N3HA 3LA2A 3SMHA 1L0LH 1SACA 3I3QA 3M8LA 4KFMA 2QQPA 5FPLA 1OA4A 3ETGA 1POV0 2YC0A 3FB7C 3WG7C 3D5OA 2EJ7A 1SLAA 3M4FA 5FNVB 4WFAV 3IN9A 1W04A 1UX7A 3H1HH 4AVAA 1O9HA 5C9AC 1SETA 1N34O 1YYNA 3CCMV 4K8FA 1QQCA 3VZKA 4OLLA 4AGRA 4GX1A 3ILRA 2GDFA 3BVCA 4AF9A 2YUAA 1CIYA 4DY3A 1LOAA 4GX0A 4P5HA 1ZL8B 2J1UA 3HBKA 5LY2A 1MQTB 4BLJA 1NVPD 5JZGA 2HKOA 2WLNA 4K1ZA 1FOD1 1CZSA 1VBA1 1QU0A 1LOEA 2NLRA 1BL8A 1E5SA 1S1AA 2G19A 4KBZA 4XIKA 3LUTB 4L99A 3KV5A 3L2HA 3PURA 2ZE5A 4YFWA 4X62O 3UCSC 4BPZA 2NMOA 2TEPA 4O4JA 4H2AA 2ZJCA 1I5XA 4AEDA 1GN3A 3M8AA 3POFA 4IV1B 5I0DA 2WLQA 2R071 1M5IA 2WWUA 4Q29A 4WM7C 5EJ1B 5HXMA 1JYXA 2VQEB 4H37A 4RQEA 4FLZA 4LT5A 1UL9A 3WP6A 1VMJA 3I2OA 4W4LA 5B4XA 1HRV1 2R061 4EZ4A 4OXSA 1ZZCA 5L3DA 4TUYB 5EIBD 4Z92B 4AI1A 1W06A 1FPN2 4E4HA 3E22A 2Q30A 4IGPA 3U07A 1ST8A 2Q8VA 1VBD2 3MDSA 2YC4A 1QJU2 1RL3A 4NTYA 3RWNA 1RPRA 4JGYC 3AEIA 2PZSA 1V70A 1NOVA 4H13B 1XQNA 5BNPA 1BCXA 2IU0A 3JXSA 3LEGA 5BNOC 3ABTA 3LDKA 3QF7A 4CCNA 4Z1MG 3JD0A 1TE1B 4F6EA 1W8HA 2VNRA 1AR71 3M3QA 4N90A 1ZTEA 5A3LA 4U3JA 4LP8A 1W6NA 2A75A 4X20A 2WNVC 3OTFA 1RUI1 1RUG1 4H7LA 4YGDA 1Z0HA 1J95A 1HNWB 4CCLA 2PHDA 2QR4A 1W6QA 5A70A 4LBLA 2CDOA 1N4CA 3WNLA 1UWWA 4NMIA 5A9GA 2ERFA 2UXNA 3U10A 1CAXB 3JD71 1WMFA 4XJ9A 4FCAA 3HNMA 3NNGA 3LEIA 2W47A 2VO5A 1QEXA 5EZYB 1XHZA 1RVF1 4PLMA 3MLJA 3EXUA 1U5YA 4S2GA 4A41A 4PLOA 4HVRA 1GP5A 3M3EA 1C1FA 1G6NA 4JRLA 4CCDA 4UFKA 3B4SA 3JBG3 5D1IA 5K7PA 1MNGA 5L36A 4GKKB 3T2OA 1RUJ2 3OGIB 5DXDA 4C1WA 4MZUA 5LZ6A 4LUKA 3HPLC 2ES3A 5HBAA 4QKDA 2Y64A 3HOBA 1K42A 2F4LA 1H2KA 5CA0B 3CBNA 3MLLA 5FXZA 1NT2B 1PL0A 1VR3A 3CC4V 2BTQA 4AFMA 2HWE1 1IBLO 1GR3A 2FQPA 2VQFB 3L72H 4WZFA 1RUD2 3WDVA 1PNMA 2BGOA 1W6PA 2YFZA 4D7SA 2WS93 1T5EA 1UKRA 1J5EB 2VZ3A 2XWJB 1Y66A 1NAEA 4YZ4A 5CISA 1RXGA 3O1UA 4NPMA 3D6EA 4AK3A 3C7EA 1BVP1 2VU9A 3SKJE 4Y33A 1D4M3 3BTXA 2QE3A 4RO2A 3SGIA 3JALB 2JVDA 4BK4A 2EVXA 3RGBA 2W91A 4EV0A 4IV1C 2JGDB 4I55A 4PDWB 4ISRA 1HDKA 5GLWA 4Q4W1 4PF1A 4P14A 4IGQA 3T09A 2E63A 1RUH1 2LALA 2WZR1 4O4IA 1AR92 3SKVA 3PUHA 2UXDO 5CADA 4PA6A 1W0PA 3TB0A 2N7GA 2WFF1 3IPVB 5EYPA 1JOPA 1JTZX 3BIWE 1ROPA 1W8TA 4GB32 1DYKA 1NXMA 5LEKA 4LFAB 4V2VA 3MZHA 3CJHB 2WSSG 4DZGA 3M7AA 1W9TA 5FZIA 1H38A 1GKFA 4RGKA 1YFWA 1HRI3 1GU3A 1I6XA 4BW9A 3T3YA 4Q5OA 1C4RA 1D5NA 5FBZA 4IHJB 4EN6B 2K2SA 4J7KA 1H6YA 1JUIA 1MOFA 1AZDA 3WQBA 5K0UC 4RUEA 4MYEA 2K9ZA 4I0AA 2ARCA 5D8AB 3TOJA 3ACGA 1G9FA 4CH4A 1ENSA 3IB3A 4TZDA 2W6IG 1XMOO 4QWNA 4DUVA 2P5BA 1FFXB 3E8HA 1YIJV 1Y74B 4C0BA 1OH4A 4MADA 1H0BA 3MO4A 1C5IA 2VPVA 1FNZA 3G7DA 2YFUA 4GH4A 3I5DA 3A4UA 4P9WA 2AR6A 4LKSA 1WAZA 5FZGA 1QNWA 5C8YA 1AYM2 4HLTA 1FNYA 1F4NA 4QB1A 2RVAA 2EIMC 1HV0A 2B8MA 5LMNB 4ZU4A 1HKDA 4MGZE 2DJVA 4FIPC 4N7IA 2ID4A 3UJQA 4CEWB 2VZ1A 3LPFA 2VCMA 4EN9B 2QSAA 4XBFA 1IS4A 1I0HA 4QKFA 5A80A 3RQ0A 3GBGA 1W0KG 4YG0A 4LNUB 2ZGSA 5JVDB 4DR6B 4FMTA 5FYCA 2A73B 1WW4A 4KH9A 4OZOA 2WDBA 2ENRA 3S0MA 3ZXEA 3G6JB 3BTZA 3UETA 3VBSC 3PJQA 1W2BU 4PA7A 3NJVA 5GTIZ 3MIDA 1ASJ2 1K3IA 2YC2A 3NQHA 4Y5TA 1F4MA 4PBPA 4CXWA 4I5SA 5B3SC 5GZFA 3QBQA 2RMU3 3KV6A 4CCJA 4YVSB 2QJVA 2UURA 2DDUA 5FZEA 2W5FA 4XUTA 3HMYA 4A3ZA 1AR4A 3WB2A 1ND3B 1TGOA 3JCZA 2A3XA 3Q9OA 4OUMA 2EICA 1RIRA 4FJCC 3A0HZ 1V55B 5EHDA 1NBMG 1JYCA 3SJCC 2LGWA 4UCRA 3Q8AA 1B06A 4CS4A 2QM4A 3ZSKA 2JS3A 2D40A 3B40A 1TZOA 1EV12 1E5HA 3FHQA 5LL6Y 2UUCO 1QJZA 4UCVA 3S3XA 5JUVA 1N1TA 4QPKA 2DUPA 1A3KA 4LWSB 3ZR5A 5HV4A 4Q26A 2C24A 4HANA 1UJWB 3KCCA 1TUEB 2GH2A 2IZWA 2Y6FA 3AYAA 3N9LA 1F8VA 4LXLA 3WNNA 3HQUA 1ENXA 4TN7A 3BTYA 4FLXA 3IC9A 4ZONA 1R081 3FB6C 2VZVA 5BNNB 1FMD3 4DUZO 3V65A 4B3RB 2WNUB 4AVSA 2IXIA 4JTAB 3H7YA 3A21A 2HHHB 1NCQC 4SBVA 1QQP2 4ISQA 1ZZ6A 2VNGA 1KS4A 1H2MA 1N33O 1FOD2 2YBKA 1VBA2 2OTLV 5T52A 3B2EE 4DV7B 5FZLA 5SV5A 1OLME 2BNOA 2P67A 3NXSA 2D3OW 2DBNA 3THPA 3NRUA 4X8PA 1FJGO 5FO7B 4OI1A 4DV7O 3KB5A 1IPJA 4JYYA 5LA0A 4XZPA 3NV2A 1W2UA 1VQ5V 4X1IB 4ZU5A 1AX0A 4LF9O 2Y6LA 2ZCWA 2JJ6A 3PDQA 1VAVA 1WCUA 4IEVA 5IK5A 2CUGA 3ZFFB 5HV0A 3RZLA 4K7JA 1HRV2 3JD2A 1UOGA 2R062 1XNBA 3EBRA 4AHZA 2W1UA 1O6UA 4QE7A 1AR61 1MS5A 1PGW1 3KV4A 1IHMA 3ORJA 1V9U1 2YBPA 3H01A 4JHZA 5CKQA 3UV9A 1DCSA 1WPBA 2ZHLA 1JS9A 1NS1A 1O4ZA 3CU7A 3KSCA 1SDDB 4AEJA 1Y43B 4FPHA 1VQOV 4JKMA 4YIPA 2D3SA 3OUSA 1ULCA 3MICA 1SZBA 3GXUA 2R1BA 1YCIA 4AWDA 2VMIA 4CCEA 4X8AA 1PD3A 1XNTA 5DABA 3AP7A 5FZOA 3SJBC 3A8TA 2KKWA 1VBB3 2VWJA 2GDSA 2R7EB 2JS5A 1JH5A 3P32A 3BHPA 1C8NA 4YJ3A 1AR72 2G9ZA 2KXLA 1GAXA 1WLCA 3AJZA 4N7UA 2AC1A 4X65B 4ARXA 2C9KA 4XF4A 1N36O 1RUI2 1RUG2 3R05A 3A0NA 1AR5A 4RN5A 5HI0A 3AM2A 2BSKA 2VBDA 2D6KA 3QO8A 3AZVA 4Y1ZA 4CDWC 3WG1A 3ETDA 3NKTA 2YV8A 5A7QA 4S2DA 4QDSA 1IPKA 1NCRC 1BS3A 3JD72 1V55C 2GHYA 3JASA 2JICA 4J25A 3VBOC 1NE6A 4RHV1 4BXFA 1DZQA 4QGPA 4YW1A 3ROUA 1WWYA 1SESA 4CDXC 1LEDA 2P4EA 2W6JG 4O4LB 5JCOC 2DV9A 4B4PA 2JG8C 2PHWA 4Y4YA 3AKPA 1R091 2MPFA 1VJ2A 2LQTA 5GLZA 1U97A 2ZXWB 3OYWA 4UXNA 1IPSA 4DV5O 3K03A 1Z78A 2X5IA 4YZ2A 5LXTA 4Y22A 2HWE2 5H6RA 2R0FA 1GQHA 1LGBA 4HKLA 1HWYA 5HFMA 4QX5A 1YJKA 1NUKA 3WNXA 5CYYA 1C57A 5CAZA 2LGQA 1MZEA 4X1KA 5J2UB 1NLRA 4A4AA 5FY5A 1VIBA 2E51A 3N4MA 1GZWA 2VW0A 4IEXA 2Q4PA 4QQOA 1HLCA 4XJZA 3HKCB 1UYZA 1PZ8A 2RS31 1SBFA 3VB9A 4XQ4A 2VNOA 5IATA 1C3HA 3T30A 1US3A 3WINE 2OXBA 3O1MA 4D6RA 1UXXX 4Q1RA 1TMF1 2PXJA 1VRBA 3D36A 5I0SA 3J7MA 5IK8A 5KR7A 3OGJA 2HR3A 5A3PA 2C5DA 2BUKA 3EYPA 1WA8B 2PN5A 1SEFA 4MGKE 2PFWA 1OJHA 4DR4B 1RTVA 4AHXA 3JYCA 2XVLA 2XLFA 4Q4W2 5A3OA 3ZX6A 1GV9A 3E8GA 5H2FZ 2WZR2 2IXHA 2ZIOA 1ZRCA 2O0OA 2P3JA 1IBKO 2FTKA 1BXHA 4AEKA 5KHHA 2JE9A 1O3QA 4JTDB 3KWVA 5JSRA 2WFF2 1I1EA 4DV2B 3WG4A 4DR7O 3OTOO 2UXBO 3CCJV 1LJ7A 4BWOA 3C90A 3RVYA 4J42A 2UUAB 3ZPOA 5ABJA 1FPN3 5HCFA 3WW4A 1OUSA 1CJPA 2QKCA 1FXKA 4DV4O 3OGGA 4BIUA 2VG9A 2D43A 1RSOB 4HKOA 3P30A 1PPJH 3FYIB 3OY8B 2P37A 1GUIA 1M57C 5LB6A 1AL21 2QQNA 5CA1A 4JGZC 2A1XA 2WJSA 4ASUG 2EIDA 1ZVFA 2W94A 4YZ1A 1RUF1 3E35A 1MVEA 3ABLC 1LEMA 5ITZA 4WF9V 3KV9A 1S0EA 2CH7A 5C5TA 1PM9A 4GD4A 1BEV1 2LFSA 4X66O 5GALA 1TUBA 2D6LX 4XC9A 1ENVA 4DPNA 5C8CB 4J1XA 4AAXA 5LBBA 4MTOA 4DY5A 5IYCO 5LASA 1JYVA 2GC1A 1JYIA 2VC9A 5F3IA 2BNMA 1RMU3 2J42A 1W8OA 1YQ8A 4XJ8A 4M0NA 4J80A 5I0TA 4UW5A 2FKXA 4HFSA 1H2SB 2RMKB 5FRAA 4YVWB 4DV6B 5A33B 4D7TA 2C1FA 1WB8A 1KD1W 3T1YB 1RJ8A 5JVVA 2UWBA 4FQZA 4B1LA 4QKNA 3CZJA 1H8TA 2NNUA 4EZHA 2V1DA 5IWAO 1C8M3 2ORZA 4DV6O 4PLNA 4GKYA 3WQ1A 2EJRA 3I2FA 3UT0A 1FATA 4RD7A 5A7WA 4BMBA 1KRIA 1BKZA 2WZEA 3RWKX 2R49A 3K3NA 4S2FA 1YXBA 4XDJA 1CQ9A 1F23A 3WEZA 2QQMA 4CP0A 2AZ2A 2UU9B 3B00A 3Q4HB 2ZT9B 1HXS1 4XXPA 2ET7A 1UPGA 3ICXA 1S0CA 3VL9A 1ZBE1 3CE2A 4DR5B 2MEV1 2JDNA 3K0DA 2XT9A 1VBC1 3ZFEA 5FLHA 3BAAA 3HWJA 1K5QA 1DYOA 3A2FA 3FE5A 2E26A 1NA1A 1YI9A 4HONA 2QGNA 3UQ8A 2WO3A 1XE8A 4HAMA 3K9AA 2EINC 3H1WA 1MMMA 3ASOB 3PVOA 2ZA9A 1TNRA 4LF5B 3T4ZA 4QT6A 2NQYA 4PDRA 2J1SA 4X8NA 4BA6A 2V72A 4YW6A 2FDFA 2DVFA 3OEBA 2AH2A 4URTA 4QQPA 4ZKIA 3MUY1 5L9VA 1JUHA 2M7WA 2CWMA 2X0LA 2IU3A 3SYCA 3HKDB 4GMP1 2BOIA 2RDSA 2PGGA 2XAHA 3RYKA 1YQ5A 3O9OA 4DUWA 3AP6A 2ZMNA 2ZDIA 4CH3A 4G27B 3J80N 1UU6A 3DL3A 3SXWA 2ARHA 3R4DB 2XJQA 4DFSA 3MD0A 4FPGA 4DS0A 3AXDA 2ZGNA 3BABA 4PHZA 4ZI7A 2BZDA 5J2TB 2CTPA 2GBOA 4XMAA 1GM8A 4OPAA 5F2SA 1PZ9A 3EXAA 1O3RA 1THZA 1VQ4V 5ISLA 3SR2C 3CB2A 1TME3 1POV1 4JTOA 5LA1A 4JI0O 4OMDA 3EO6A 2IXKA 2WA4A 3CCSV 3AG4B 1R3KC 2F93B 2CK3G 1R082 1X9TA 5FYUA 5CN0A 4NB5A 4KHPO 4ZZ8A 4BDVB 3D3QA 2JB8A 1OCCC 5FP7A 3FAVB 4E2SA 1S0BA 5L9RA 2A6ZA 1H4HA 3WUCA 3J7LA 4XFHA 2VZOA 2PF4E 3JARB 5FY9A 4WM8C 5A3NA 5FZ9A 2H3OA 1A6CA 4XFBA 1AHSA 5FY4A 4DXWA 5LW9A 5JMCA 4CDQB 4DXTA 4BISA 2WWWA 4GUNA 2GN7A 1S0JA 4C90A 1OH3A 1WW7A 4YVWC 1QLNA 4CUGA 1XNQB 4Y20B 5FP9A 1W9SA 1AYM3 2XG3A 1M56B 4YPJA 5KUKA 5EBLC 5CBLA 1PNFA 5LGUA 4DV0O 5FJHA 5IE9A 1AR62 4IUGA 1PGSA 4RQFA 2GNDA 2FD8A 3H1KH 2XR4A 2E5LO 2XL7A 1V9U2 4A42A 4F8AA 2JD4A 4A7ZA 4OYUA 4LF7O 5LOVB 1PZ7A 5FREA 1B04A 1ZWIC 2VUDA 4HN0A 1HJFA 2LS6A 2OCHA 3G67A 2F95B 1LUWA 3RYCA 4K35A 4QPIC 5C4WB 5IYYA 3EHKA 4RAIA 4XE9A 1OKQA 4P9XA 2W68A 2J1VA 3POBA 4MUVA 4QNHB 2WZ8A 2Q67A 4LE3A 1VBE3 3ASIA 4HG6B 2ZGPA 5IVVA 3TXQA 4UFIA 3SJAC 1WCDJ 4XAEA 2XHKA 4GYCB 4C7UA 4XVHA 2NZ9A 1VP7A 1ZRIA 2P6JA 2L6LA 2PHUA 4Q4V3 3A7QA 3ST7A 1LOFC 1EN6A 4NO4A 5KA5A 3T2MA 1KFUL 4TLGA 1SPPB 2DVGA 1PVXA 5JH7B 4YSFA 1WP8A 4WBNB 4RHV2 3IAPA 5BR8O 4X64O 4DV3O 2BTVC 3J8F1 1E1QG 3I59B 3QOPA 4JZ2A 1EV13 1MEC3 1LNSA 4HPKB 2YB7A 4P9PA 4OHXA 1QIQA 1BGYH 4COYA 2QQOA 4MGTA 3KT7A 2ZKOA 4EEQA 3BFRA 3T0AA 1AYN3 1R092 1B35B 3ZXLA 4N53C 1Q6IA 3GDBA 4KMQA 4JDOA 1QLEB 5GW7A 3LWCA 2BTOA 3MPPG 5J36A 4AQYB 3I54A 4AI0A 2EXHA 4WV8A 2CNAA 1W0OA 2W52A 1W9YA 1HQNA 1FAYA 5GZCA 4AHYA 1R3LC 3T4DA 3BALA 3RPQA 4LLOA 1K5MC 1UMZA 4NXMB 2R30A 2CL2A 4M0HA 1CAWB 3F5WC 3PJSK 4A6OA 5CFDB 4YFZA 4NPLA 3VD5A 4EWAA 2E3CA 1QQP3 2RS32 5EV7A 3CQOA 1AR1B 1FOD3 3NSTA 2IFRA 2XB6C 4E2QA 1HB1A 1VRH1 1TMF2 3QCWA 4MXVA 1RM1C 1YZBA 1RUE1 4XF3A 1SCSA 4KU7A 3K5LA 4RR3B 2H0VA 3F5TA 4YW5A 1POQA 1UNBA 3K59A 4IE5A 5LBFA 4M4RA 4QJFB 4A3XA 4JI4O 3HD8B 3MV01 5JXJA 5CFCA 3FKSG 3CMEV 3LOBA 5CB7A 2VZRA 3FB8C 2GAUA 4ZOLB 4RS5B 3KHCA 4QXCA 2QCSB 2WQ4A 1YJLA 1HRV3 2R063 2O8QA 4X1YB 2XAGA 3NWKA 1BQ0A 4OUSA 4LNVA 1Q56A 3AK1A 3UT5B 1YXWA 3L71H 2EXIA 2R72A 3K51A 4XJUA 2PYTA 3INAA 1AI4A 1YF2A 1GKBA 3CJIA 5BNQA 1CPYA 1S0VA 3MGUA 4JAVA 2DBIA 1AL22 3SYAA 4DNYA 1QBZA 3RVZA 3C7HA 4L2NA 1RUF2 3AG1B 3NMBA 4UOJA 2Z5UA 2VTFA 2DOSA 2VQ0A 2BOCC 3WUDA 1QDOA 3U75A 2ZNIA 1BEV2 2UYBA 4HSJA 4M01A 1R3JC 1F35A 3VBFB 2ZGLA 5EZWA 3PL0A 1WZXA 5FY0A 5C9AA 2WT1A 5IJ9A 3QTCA 4DR2O 3CRQA 1RUI3 3WP3A 1LNQA 5B1AB 3NL1A 4B8EA 3OBAA 2GMEA 5GLUA 1JYWA 3RYIA 4NJ4A 3OAAG 3C3VA 2XKPA 4GLXA 2QWRB 4XTMA 3OMAB 2YXYA 1R73A 1F4AA 3CD6V 1SZTA 1L7LA 1JN2P 5L3CA 4LR4A 1CZVA 5TISZ 4BU2A 4XQDA 4DYLA 3TK1A 3H1MA 4FOVA 1N1YA 3AK3A 3ZFGB 2J1AA 4XXAA 5H9QA 4MO3M 4CRQA 5BY1A 4ZHQB 1SLIA 2JIJA 4CP1A 1LRHA 2JG9C 2B46X 2XMLA 5L7OA 4P9YA 1K33A 3WF4A 1DYPA 3KT4A 1HXS2 4YHHO 3N36A 5FP4A 2Y4UA 3N2KA 4WVMA 2HJDA 5G04L 2GMPA 1ZBE2 4HYOA 1WMXA 3ZIWA 4QXBA 1WCSA 2MEV2 5FMCA 3ECQA 1VBC2 4I2OA 2E7TA 3D3IA 1YTFB 1XU2A 1XI1A 3MEPA 4Z1VA 3ZXGA 1O59A 2BPA2 3WQ7A 4XBNA 2HWE3 3WDWA 4UV8A 1VLNA 1PK6B 4DR3O 4Q8LA 2WABA 1XXNA 3LSDA 2EIKB 2WLHA 1CEZA 4MTXA 2ZMLA 2DCTA 4FP2A 4NN0A 2Q0AA 5H9CA 5F2WA 5HFLA 3CZUA 4JGYA 1DGRN 5FPVA 2CE4A 2GP5A 1MS0A 2I45A 3UL2A 3QLQA 2DQ0A 1IXBA 3VKOA 4XILA 1OD3A 2A3WA 1DF4A 2A3QA 5BNOA 1IXMA 3NAPB 1PNKA 1XC6A 2IXJA 4KU8A 5JSPA 4NOTA 3HQRA 4OHZA 5FYSA 2HEPA 1N8RW 3TGUH 4BQ3A 2WNVA 5F5AA 2WLLA 4DR1B 3JCIA 4P02B 2WZR3 3ZHQA 4QM9A 1IG0A 5JOXA 1O9GA 4ITCA 3S7EA 1WBFA 1HB3A 2D2CB 2F23A 4DR1O 2EXJA 2W39A 4K3UA 2Q7GA 4UFJA 4XPVA 4CCOA 1MG1A 4A6SA 1YRZA 3AMNA 4YY3O 3NV3A 2RS13 4HMZA 1UY0A 2E33A 4FPOB 4AQ2A 3TBDA 1YFXA 5J7MA 4JI1O 4PDVA 4CDUB 1MS4A 1NLQA 3ASNC 1AJOA 3W5NA 1SQVH 2J1RA 3WNMA 2YU2A 3E8BA 5LA9A 1XU1A 1IOAA 1PO21 2BYVE 2Z5WA 2VCAA 3OG2A 1GMMA 5JQGB 2KM2A 1UD1A 2A06H 1BZKA 1NZIA 1I94O 1AR83 4RFRB 3ZIXA 4M4PA 3EQEA 2ZEXA 2CGNA 1VPHA 1S2BA 3R4UA 4CYDA 1QOTA 2A0LA 4YW7A 2ITDC 4XABA 3PU8A 2XUMA 5DAVA 2C6SA 4ZS2A 2ZR2A 2PAKA 5HCHA 1ZNPA 3IIIA 1LOCA 3HNYM 3AG3B 1F7YA 1ZA4A 1ZA7A 1MQTA 3V56A 4FM1A 3BYWA 4CS3A 3ACFA 3TEXA 4CP9B 2Y6HA 4CUAA 1XILA 3USUB 3H42B 4KGGA 2HBUA 4ZU7A 1NH2D 1Q8VA 5KBFA 3N9PA 2FCTA 3VUOA 4FFKA 5JZGB 2BP6A 4NROA 1VEWA 4F3JA 1QJY3 4OCTA 3ZN1A 2AZ5A 2ILMA 2X5IC 4IV1A 4GZ9A 4MX3A 2QQUA 1JZ2A 4FFIA 4O4JB 4XUNA 4AEDB 5C33A 3ZYIB 5EYXA 4AGGA 4FFHA 1EN4A 2Y69B 5EYYA 1U5XA 1XBFA 2JDHA 1WD4A 1UY2A 1GRJA 2HWC2 4R4ZA 1ZRRA 4B3SB 3LAGA 4CZZA 4HZFA 2ETEA 2V7QG 4Q1PA 2WL1A 3D36C 4LA2A 3SPIA 4U2AA 2OZ6A 4X9QA 5M0TA 3NKGA 2JB4A 4MVSA 5ANQA 4A45A 1OF4A 4ZS3A 4OMCA 4XUOA 3B9CA 1P84F 4BIOA 3J9SA 3E22B 3P3PA 2FDHA 2YS8A 2BRTA 5L9BA 4AEMA 2NN8A 4LBEC 3ACHA 4A2UA 1COV3 3C7GA 1PM4A 5K0UA 4RQPC 1E79G 2WQ8A 3G71V 2YPDA 5BNPB 2CAUA 1J83A 3J8F2 4CXYA 2WQZC 5L73A 4E27A 5LEJA 3OMIB 3IWZA 3RJRA 2VE1A 3TN93 3ZDSA 4CU6A 1XMQO 4GKXA 3JB4C 3X2QC 3VHPA 2RV9A 3AZXA 5IJ0A 2R16A 3JD4A 2VTXA 4FPFA 5KWRA 3K3WA 5FP3A 2IM9A 4U3JB 1F5FA 1W6NB 4IDZA 1ND2B 4D6QA 1PX3A 1SQBH 3UKTA 3ON7A 2W92A 2ODMA 2EAAA 3VOUA 5E79Z 1W6OA 3LKJA 1OA3A 3BU0A 4FLVA 1PVC1 4PJYA 4AFAA 3JQXA 2LP7A 1WGPA 2P34A 3Q8EA 1VARA 4QQ2A 3NNMA 1YQ2A 4UVBA 4F83A 3ZN6A 4FQ4A 3I3DA 1UCXA 2HWD3 1TG7A 2R1DA 3A0RA 2VUCA 4DEVA 3SQOA 4AR2A 3CYOA 1VQ6V 2FHRA 4UT5A 5DUWA 2B7YA 2VZSA 2HBTA 4LK6A 2ADDA 2CGPA 4OI0A 1VRH2 2BDRA 3N2GA 4LORA 2YZ4A 5H5NA 4LTAA 1RUE2 3POGA 3ZSJA 4PT6A 2VMEA 1OCRC 4LUMA 1OXCA 1FI2A 3VBSA 2N04A 3T1LA 4Y1VA 3NNLA 3LDEA 2M6YA 1W90A 4W65A 4V1PA 4OHYA 4BQXA 3ZBHA 4UWDA 3VBHC 2DYCA 3MIEA 4YJ2A 1ZBA3 4WVZA 3FYEB 3HT2A 4JYAB 4AYUA 2H8PC 1V6JA 2DYSC 1W99A 3ZYHA 4CCMA 5AC91 3IDEA 4S2HA 2OPKA 4KQ7A 3VBRB 3ALQA 4QQLA 3H0OA 3ILFA 1VB2A 1JW6A 1MABG 3DV8A 5F9TA 5FWJA 5AVAA 1R1A3 1LOGA 2YY1A 1BBT1 4TOIA 3KM5A 4RL7A 3WF1A 2DCKA 1BMFG 3N9QA 2Y0IA 4LF8O 2BE3A 2WAOA 4FM2A 4NRPA 3SYPA 1OHHG 4FFFA 5DZEA 2F43G 1ULPA 2DN9A 1Q6HA 1S4CA 4PDWA 3OW2U 2B5UA 4I30A 3C3TA 3TWIA 3T2PA 2JD9A 1CGPA 2OT5A 3NV1A 4MVQA 2ZNJA 1V6OA 5CBGA 1F9KA 2Y69C 4NIIA 4I55B 1HW7A 3J26N 2FCVA 1KITA 3JAMN 3PTYA 4EB6A 4GKJB 4PA4A 4O4IB 3N7LA 3DC6A 3NVCA 2LFRA 4O61A 3OCPA 1UY4A 2X6CA 4XDQA 3CRAA 5F37A 2MK3A 3KMHA 2OPWA 4G28B 2P22C 1QJX1 3SLIA 4YW3A 3HNBM 2QTWB 2DWRA 1DGSA 3O1OA 2PLV1 5CBHA 1O5LA 1BT8A 2ARBA 5IY5B 1BK1A 1CX4A 3APOA 2KG7A 3ZXJA 3IDBB 5E16A 3GZTB 4NXNB 3G6EV 3ZSMA 4DRRA 3PMEA 1CWPA 5D8AA 4R8CA 3WB1A 4RHV3 2FB5A 1ZZ9A 2VCBA 4Q0SA 3FHAA 3M99B 1PNLA 1H8VA 4L8JA 4ES8A 3Q8CA 2I2SA 1XSQA 4NXNO 4I4TB 2DUOA 2XBO2 4Y24A 1KB9F 4IETA 4EQVA 2EIJB 1JMUB 2ZEWA 1V54C 1Z7S1 2XWBB 1S2EA 2HLDG 4AQTA 3I4IA 1ND2C 3R6SA 4IEOA 3APQA 3IMMA 2BCCH 2OVUA 4N43C 5H9SA 4URAA 3KCXA 3FN9A 4GH4B 3L74H 3ZRWA 4DQAA 4K9SA 4JC1A 1TA8A 3OM3B 2EILC 2IH1C 3ATGA 3JD1A 4UB6Z 5C8YB 1YNAA 3CS5A 1OLMA 2XGXA 2P6CA 2ORXA 2Q73A 1NYWA 3GBFA 1K34A 1AXYA 3ZMOA 1Y4WA 4XAAA 3PU3A 2J22A 3KT1A 1KC8W 1ULDA 1OOPC 1XL4A 2XDVA 1EBOA 5JVDA 1W2TA 1HR0O 3MIBA 3U11A 5K4LA 4KNCA 4XHXA 5B1NA 1Y6XA 2N74A 5E1AC 1TMF3 2O1QA 4NWVA 3VGIA 2IXLA 4CUBA 1WPXA 4I09A 4EE2A 3E5XA 1UYPA 5FZMA 2Y34A 2QEXV 3MIHA 1REDA 1QVGU 4AZZA 4DEQA 1YI2V 4V2WA 3MW4A 4DUYB 3E97A 3SH3A 4Q0PA 3ZRSA 1SERA 2V4AA 4QAWA 4XZUG 3W59A 4ORFA 2B9VA 1W28A 3BOPA 4CDWA 4I0XA 4LBQB 4PA9A 1NCRA 2WINB 1K12A 5FZAA 5FQ0A 3SNMA 1HJGA 3VBOA 2ZZJA 1XYOA 5FUIA 5DQ0A 5DZFA 3I7DA 2GALA 3W7XA 1UYYA 4ZHNA 1BZWA 2EALA 1XE7A 3JB8A 5F6KA 4QPJA 1GP4A 5CB4A 4Z2AA 1OCOB 4CDXA 5KAIZ 1PO22 3UKNA 2HJIA 4FM0A 4LWSA 3LZZA 5JCOA 1AL23 3CCQV 2DMXA 2BBAA 3W58A 3O1VA 1SQFA 3OUHA 3DF0A 3SCHA 2P90A 4GALA 5KX5A 1DQ2A 2KD7A 1QGLA 3WDXA 4JKLA 3FC0A 2XQXA 2RHPA 2BW8A 3WV6A 5LGNA 2VY0A 4R50A 4NTWA 3HIFA 2YG0A 3X29B 4QPGC 4TYSA 1ENRA 3MUZ1 1PGL1 3S6PA 4AAPA 1JODA 1XBLA 1NQJA 3NV4A 1JR9A 1DLLA 1KEXA 4FI9A 2RJZA 4M3CB 5FK7A 3N9NA 4I3PA 2F4VB 4K8ZA 4TWKA 2OCCB 4MXWA 4F4LA 5FTTC 3VQWA 3DKQA 4LK7A 4PD4F 1VF5B 3NR7A 4BWAA 2ZX1A 4FSJA 5FZCA 4A5UB 3AKQA 3HN1A 1EYBA 1O91A 1BVVA 5GM0A 3DYOA 4MW8A 2JDAA 1YLLA 5LP6C 3S5QA 1VB4A 4BJ0A 1YWKA 1ZBE3 3WY6A 5C8WA 4M00A 2JECA 1NTZH 4XJAA 1BE3H 1W59A 1G9DA 1G7YA 2WS91 1MPXA 2YROA 3W7UA 4GZRB 3CNAA 3RT3C 5FZFA 2W46A 4IEUA 1W9FA 1UQXA 3ZIAG 2Q4SA 3T4HB 4PIYA 1D4M1 2BWCA 3OFNG 3GWOA 2JIGA 4YM2A 4UFZA 4GCZA 3UKMA 5IVEA 1DZRA 2JJ2G 3JZVA 2NP0A 4XOGA 3VBUC 4JGZA 4Y3OA 4B4QA 4QMAA 4BXSV 2HH9A 1AP6A 4E8CA 2WLIA 4BM8A 1NZCA 3R66A 4RYDA 1F5JA 1XYNA 2Y0PA 3T0DA 2L9LA 2X29A 4QHBA 3UGGA 2DYRC 4L0PA 3B93A 3M2MA 1R6TA 2HJFC 5FXXA 1FXHA 1DQ6A 3LA7A 1CJDA 3L9JT 5DZGA 1YDXA 4AW7A 3E1F1 1GYKA 3TJTA 3M70A 3ZMVA 1ZRFA 4KXRA 2ZGKA 1K92A 5CKMA 2X05A 4UFMA 3ZXFA 1P4RA 1PVC2 3CRCA 4B4RA 2CHHA 1FYUA 1FD9A 4IT5A 2XL9A 3HN3A 3I97A 1WW6A 5KXDA 2HKXA 2GNBA 3WG3A 1OVPA 1CAVB 1YO8A 5FAXA 4O4LA 4M3CE 1YI7A 2QTSA 5GLTA 3POEA 5FWEA 4FLUA 4JI7B 5IYBO 2E7QA 2YIDA 1M4UA 3SH4A 3S3WA 3S30A 2QWNB 2Y6GA 4BZ4A 5F5CA 5I8YA 4FXGB 2P4KA 3OOXA 4JI7O 3RZMA 4AOCA 4BE3A 4H0LB 2PQSA 2XJVA 1ZX5A 5DECA 3IJ4A 2QDNA 3VDDB 5KC5A 5F7UA 3T2TA 4JAUA 3OYWB 5CVRA 4AI8A 4DINB 1NTMH 1K3EA 2PHFA 2Q6AA 5LXTB 4Y22B 4MGQA 4C0HA 1RGSA 3STZC 2LRPA 4CH5A 5AC92 2DCJA 1Q8PA 5L7OC 2ZHNA 3MHSC 4LH6A 5LYJA 5KHJA 5T3NA 3SPCA 1J3QA 3RZJA 4QGMA 5FLJA 4D6TH 1BBT2 3UK9A 1AI6A 1S5JA 5G05L 1L0NH 1JA8A 2V5YA 3PLQA 3S7IA 1X36A 2XTAA 4UW4A 3VDAA 1YJWV 2FYUH 5J98B 3TNPB 3D4KA 2VQEO 1IBMB 3BTAA 3BI3A 3OEAA 5H9RA 1Q6UA 1G4YB 1WW5A 1QR9A 1GQPA 5C3PA 2RMU1 4R9AA 3IGAC 5CZKA 2V5DA 1OLQA 1J59A 2ADEA 1VF6A 4LHKA 3K5NA 2HWC3 4JI8B 2VWKA 1RB8G 3WF3A 2WN3A 2IXCA 1NU1H 2RJLA 1K4CC 3WU2Z 4RUFA 1Y9GA 1XQ8A 3LEKA 2J1EA 5GLVA 5H9PA 1EAH3 5E1RA 1OD5A 2JWPA 4IERA 1IS6A 1PO13 2D93A 2A9HA 1GLHA 4ONUA 1ULGA 2AEZA 2WUHA 1W6MA 5ABJB 4E2GA 5B1BC 4O2BA 1Y9MA 4BHPA 3WDTA 1FXKB 4LF6B 4K0KB 1U12A 5JPNB 1BHAA 1LR1A 3IM0A 3KHBA 1JJOA 3O0XA 3OPWA 4TLFA 5A3MA 4TWTA 2ZINA 3CF6E 4WM8A 2XJRA 3LDRA 5C8CA 3OR7C 1JCHA 1GWKA 3BODA 2AYHA 3DPRC 2XVKA 5FLIA 5ITZB 3GYDA 1HNWO 3ZXKA 1SFNA 4CC5A 4DXSA 4NKGB 1AVMA 4DO2A 3PMSA 1ALYA 4J7ZA 3W7WA 1Z7S2 2Y26A 2YPJA 1TUBB 1IVSA 2WYFA 5IDJA 3B94A 4LITA 1H9WA 1F51A 5L3FA 4HXCA 1O7FA 3B3QE 4GT1A 3MAQA 1SLBA 3ZX7A 4YVWA 1FYJA 3DYMA 3NJYA 1WLEA 1GFF2 3ABMC 5DDJ3 3UGHA 3D8CA 2Y60A 5IK4A 5T54A 1R1ZA 3B5LB 2GSYA 5I0RA 2AUYA 5EXOA 3K2OA 2D6NA 4HK8A 3HEIA 2LW7A 3I56V 2ZR3A 3QO5A 4GKKO 3AZYA 1H8TB 2DFCA 1SBDA 1NY71 4TXWA 5D2AA 3VKNA 1QCEA 3Q4HA 2V09A 5FYVA 2F4PA 4IEWA 4O9EA 3SPGA 1OFNA 2WSVA 1JOBA 2A7AA 3ZRVA 4CS2A 3MPBA 4QPIA 2JKBA 5IYZB 5T5PA 4EN8B 1UKGA 4YNIA 1CONA 3WNOA 3BPSA 3M7MX 1MQTC 1IQAA 2VQFO 4PA3A 4MG2A 4DO0A 2UWCA 1NZ6A 4PDLA 5IT9N 1URXA 1J5EO 1UIKA 1YIFA 1JJ2U 4E9KA 3C3SA 3VHRA 3CLPA 1NA1B 3FUOA 1UIJA 5FZBA 2GP3A 2A6VA 1HB2A 5C3QA 3J4UH 2Q69A 3POIA 4NRMA 3B69A 1LOFA 3B8NA 3OE7G 5FPRA 4TQDA 2OUHA 2BFUS 1DP0A 1XNRB 3TXSA 4ASLA 5GZGA 2QWOB 4ARYA 1QF3A 4LR3A 2BEOA 2QQLA 5A1LA 2VXRA 4JI6B 5FZ1A 5FMDA 1VBB1 4QU1A 3H50A 1GNHA 1SDWA 3OBTA 2Q7HA 3UYJA 4O65A 2GUZA 1H2NA 3GHNA 1SLCA 3FLTA 4ZZ5A 1UX6A 2W9XA 1FFTB 5A7SA 1GH6A 4W4ZA 4N53A 2Z3YA 2C9AA 1EUTA 4LFAO 5FYMA 1ZX3A 3FL7A 3WW1A 2WPDG 2EIEA 4ZI7B 3H9VA 1N32B 1NTKH 2RDRA 3BN6A 3CRRA 3WSOA 5JCTA 1QXPA 4FTSA 3N35A 1APNA 5F3CA 1PGL2 5DAPA 4XACA 2ADPA 1K5MA 2EF6A 2QDRA 4F6RB 3CP1A 4CEYB 3AYDA 1UZYA 2X7RB 3CCUV 5ACA1 1HQWA 1IG3A 3FAVA 1UY3A 4E4DX 1I08A 1REFA 2YYOA 5IVBA 5FLXN 4XQWA 2QBXA 5IAXA 4LE4A 5LA2A 3JARA 3BA9A 3DCQA 2HYXA 3RSJA 1NH2B 4FO9A 5FZ3A 1Z5WA 1I5ZA 2CTQA 4LOTA 4AILC 3MYXA 2QFEA 1XUQA 3KF3A 2XKOA 5FZ0A 2XBO3 3RDIA 4HZ3A 2NR5A 5DAWA 5DN2A 4W6WA 2B42B 3H8UA 1GMGA 2OQ6A 4XETA 4LO5B 3LSEA 1HNXB 2UYAA 2IUWA 2CTVA 3BRCA 4DXRA 4Y20A 3LCPA 1HNZB 2VOVA 1FS0G 3A0KA 4JI2B 5LMNO 1Q8IA 3BCCH 4OPHA 4ICGA 4DW1A 2WS92 3KLSA 3ZHRA 1XHXA 2CTWA 5LCWL 5EC1C 2YUEA 5LHGA 1WCKA 5A32A 1W8FA 2BV4A 5FR3A 2AENA 3AL6A 3OT7A 1JZ8A 5LOVA 2Q8DA 3H1YA 1YHQV 1XYPA 1D4M2 3ZN5A 1MACA 2EX3A 1PM7A 4DR6O 1DGWX 3E83A 1TNFA 2JDUA 1V6NA 2FDIA 4UFLA 2H6CA 4QD2A 5FL7G 5CA3A 1T6BX 4FLYA 3N9MA 4LO6B 4HL0A 1FKAO 1PX4A 1K5JA 1AJNA 2WLJA 2PY5A 1WJZA 3THTA 4LF4B 4KWLA 5HPOA 4NHLA 2VOWA 5JJEB 1MS9A 2FMDA 3HR9A 5KLVH 1NE4A 4LBMA 3SDLA 3HJRA 3M3CA 1H1MA 5FZDA 1Q43A 2JKXA 2OIIA 2B1GA 4PI2A 4LF4O 3ZYGA 1A78A 2DFBA 4FLTA 4LC1A 2RR13 4PDWC 4R9DA 5KC6A 3ZPYA 3B09A 1D0GA 4JI5B 1K45A 5LHIA 1HB4A 3V64A 1LB2A 2ZM6B 3UJOA 3STLC 4QX8A 4MOAA 5K9YA 2WO7A 1K4DC 3I59A 5GONA 5EP9A 4J10A 2BJSA 2ZM6O 3CHXA 4LEJA 3LNMB 1N3QA 3ZHTA 2JG9A 2VBPA 1PIV3 1OHFA 3H8XA 4FBFA 3UNPA 5GZEA 3MDPA 1RMU1 2UXCB 2B9UA 1R1BA 4COWA 4META 4BK5A 5F8PA 1ACCA 4OGQB 2ZGUA 1YJNV 1UAIA 2QE7G 4NIDA 1RHI1 2JGUA 4I9QA 1BHGA 1XNDA 5JR2A 2CV6A 5IW0A 1YUDA 1NJIW 2W0XA 4IYIA 4B3RO 5D8AC 3T08A 1GANA 1OFSA 5FUPA 5EQUA 3ABUA 2HHHO 1OQDA 2WZPP 3ABKB 2Y38A 1V0AA 5CFDA 1C8M1 4QHOA 2XLAA 5I8SA 4W50A 1CR7A 1MZ5A 3RZKA 2PELA 2H0BA 2VZUA 2R072 4N9IA 3AZWA 2LTNA 1GN4A 3JAKA 2ZGQA 3VHOA 2ZACA 5FPXA 3MF6A 4ZXEA 5FY8A 4HETA 1GBGA 1LECA 3KKYA 1JHNA 4Q0QA 3GM8A 4LHLA 3HPNA 4Y1UA 1ZYBA 1Q81W 3RBZA 3LIHA 3GBWA 3ZYJB 1ULEA 4CA9A 4YG6A 4CEWC 2Q1MA 1RUOA 4XHBA 2RMU2 4DV1B 4P9IA 3DXRA 3I2GA 5CFCB 1EN5A 4AVBA 1AB3A 2LM3A 1AX2A 3GZAA 5FDBA 2WAMA 5ANNA 4O2AB 1MS1A 5FZHA 4JAAA 1ORQC 4DV1O 4QX7A 3BIEA 1YSCA 2B45X 4KBBA 2E76B 2F1MA 1Q8OA 1OCZB 3RG0A 3VD7A 3HAGA 2GC3A 1LOBA 1OMIA 4GAZA 1P49A 4MHUA 2YIBA 4B3TB 4W6XA 4FPPA 2O14A 1NQTA 4W8JA 2XLGA 4TQFA 3S57A 5T55A 4GULA 5FY7A 4FVVA 3VD3A 5KMGA 3AG2B 5EWSA 3CJIB 3DXTA 2KA3A 4H14A 3UM7A 3O12A 4YVSC 5JOWA 4PQQA 1US6A 4J9YB 3CXCU 1SQXH 1WKYA 3VKLA 4X65O 1ND3C 1P7BA 4Q4Y3 1LUVA 1E5IA 1XEQA 3BKZA 3VBFA 5KHGA 3K4ZA 3OJBA 1JZ3A 5FPUA 2UUBB 3ES4A 1N3PA 1V6MA 5IJRA 1RVF2 4R52A 5LATA 2MNGA 1TME1 3PNAA 4PELA 1GWLA 5C9AB 1ZAUA 1D2QA 1G86A 1QXJA 1VALA 1SQGA 1KQSU 3HR0A 4K8RB 3DSQA 3KVBA 1XNCA 3VN4A 3RYFA 3I2IA 3RYIB 5FMOS 2VGDA 4R7CA 1Y3TA 3E6DA 3ZFGA 4Q6GA 1W05A 5BXZA 1XSRA 3N7KA 4UF0B 4LHSA 4IESA 2HEYF 1FPOA 1W39A 2C4XA 1GSLA 4YG3A 3E5UA 1NY72 1UMIA 2ZHMA 3AKSA 2VVDA 3V0AA 1CX1A 4FAHA 3POJA 5GKAC 3THOA 3FB5C 2CAZC 3WD5A 4Y1YA 3U4XA 2VW2A 5BNNC 1I7FA 1SKVA 2WNUC 4LIUA 1H8EG 4XYXA 1YVWA 4WM7B 3N2KB 5HXVA 5KAFZ 4Z2WA 4IL6Z 1AYM1 2ZKLA 4YZ5A 2QQKA 2F66C 4B3MB 3R65A 4GA9A 4I9WA 4F7ZA 2VMDA 4MGSA 1YEWA 5KUMA 1QKQA 4BQ2A 4LOSA 1SQQH 4TV8B 4YWAA 3CRMA 3I2KA 4B3MO 4PF5A 5AC93 1OSGA 4OI4A 4JV4A 1BQPA 3OPZA 1RUH2 1D7PM 2Q8CA 3WNPA 5C71A 4JGYB 3ZFFC 4DR4O 4RQPA 4OX9B 1GP6A 1KUQA 1WMEA 5F5IA 2P3KA 4QDQA 4IV3B 4IXLA 1QY4A 2A6WA 1OVSA 2VMHA 3VLBB 1VBB2 2CTRA 3CCLV 5BNOB 1JXNA 1MS3A 3TEWA 5FOJB 1S3JA 4Y5SA 5JJJB 1PMHX 1VBE1 4XDKA 3ETEA 4WBBA 2A7WA 4DV2O 5T5JA 5DEDA 2EIGA 4EWDA 3SCGA 1VBD3 3WR0A 1QJU3 2WLLB 5FFOC 3ZYRA 2UUAO 1BK0A 1CAUB 2VUJA 2ZABA 2HP8A 1GTOA 4UCTA 2JDIG 4WFHA 3E5QA 1X50A 4Q4V1 1KMIZ 2DCYA 1CN1A 1JBCA 1LR5A 4JGSA 3I3EA 3LD8A 2QQJA 3H1LH 1F15A 5BMVB 4TV9A 4N21A 2JDPA 2DF7A 5A3WA 4E2LA 1N0JA 5ACA2 2XOKG 2ZOEB 1PMIA 2LW1A 4NIHA 4O4HA 1EV11 1MEC1 2WT2A 1R6NA 3BY6A 2GSMB 4JX0A 3LDCA 2OA2A 3VHNA 4TT3G 4EWEA 2Z42A 2A6YA 4FOQA 3SISA 3PTRB 4H3WA 5AFEA 1AYN1 1SA0A 1W3VA 2OW4A 4AGVA 1N34B 5JOYA 3IAQA 3T1HB 2K1EA 2D98A 4IQPA 4Q8KA 3SJQC 1Z7S3 5LGTA 3OD4A 1BQZA 2HFEC 3WZ1A 3K5OA 2YMZA 4RWUA 4DRXB 5JWPA 4BIZA 3VBHA 3IZOA 3T1HO 4QX3A 3T1YO 3I2HA 3HKEA 2AHZA 1OUXA 3U14A 1C5HA 1KGYA 4CP9A 2RCVA 4AFDA 3FBMA 3USUA 3H8RA 4LO7A 3FLRA 1OQEA 3KCYA 1RUJ3 2VMGA 4JZGA 2YDEA 5LBQA 1QQP1 4X62B 2D5FA 3MIGA 4FVMA 2ZXWC 5DMYA 2FZ2A 2A3YA 5A3TA 1UU4A 1WLTA 2UU9O 2FL4A 1SHWB 1JHJA 4YM3A 2EBOA 3WHTA 4NVPA 4DR5O 1UXZA 2EULA 4FLWA 1TEIA 5FY1A 1GN2A 4J6GA 2PYLA 4YW4A 2YXLA 2JDYA 1RUD3 2VUAA 4GIQA 3ZLIA 5FMBA
chains in the Genus database with same CATH topology
2GH2A 3FLPA 4WVWA 1G8WA 2IZWA 4XMIA 3AYAA 3PTYA 1F8VA 4YM0A 4FAGA 2X5IB 3N7LA 3ZXAC 2IWGB 3AKRA 3NVCA 4C1XA 4IEQA 1QOOA 4AVVA 1AX1A 3V0AB 5FOBB 2B39A 3OCPA 1ENXA 1O5UA 2JENA 2RE9A 4WM7A 4LA3A 1DRYA 1LHVA 2NM1A 3FX3A 3B7MA 4RGGA 4XDQA 4BYYA 1R081 1N1VA 3KMHA 4MV2A 1DS0A 3AMMA 1GZWB 5BNNB 2WFPA 1FMD3 3V65A 1QJX1 2WNUB 3SLIA 3T1MA 4AVSA 4EN7B 2IXIA 4YW3A 3H7YA 1HIXA 2DWRA 3AJYA 1NCQC 3M1HA 2PLV1 1QQP2 4SBVA 1O5LA 2W08A 1CESA 4ISQA 2ARBA 2P2KA 1SQ4A 1ZZ6A 4OVEA 2VNGA 1KS4A 1H2MA 1BK1A 1CX4A 1FOD2 2DVAA 3MS5A 1VBA2 3WDYA 1GZCA 3ZXJA 3IDBB 5E16A 3GZTB 2PHXA 4Z8BA 5T52A 4Q2FA 5SV5A 3ZSMA 4DRRA 2BNOA 3PMEA 5LK5A 5JSOA 5D8AA 4HBNA 1ZZ9A 4RHV3 1AR93 2RJKA 2PHLA 4Q0SA 3PVJA 3THPA 1H8VA 2ZAAA 4ES8A 4X8PA 2I2SA 4OULA 4IV3C 5FO7B 2DUOA 2XBO2 4Y24A 4OI1A 1SLLA 2SBAA 2ZGTA 3EJKA 3KB5A 1IPJA 4IETA 1WLWA 4IV3A 4D7YA 4XZPA 5K0UB 4GB33 3LGRA 1Z7S1 3NV2A 2XWBB 4PIZA 1W2UA 2VVFA 1WD3A 4ZU5A 4UBGA 4AQTA 3I4IA 1AX0A 4BQ1A 1CVNA 5BYNA 2ZCWA 2JJ6A 1M4WA 4RQPB 1ND2C 1VAVA 3R6SA 4IEOA 2A71A 3VZOA 4IEVA 5IK5A 1QNYA 3CEWA 2QKDA 4I0WB 3ZFFB 5TSWA 1ND2A 4K7JA 2OVUA 1HRV2 4N43C 5H9SA 1Y7BA 4K1YA 2R062 4AVCA 1XNBA 3KCXA 1RMU2 4W6YA 3EBRA 4AHZA 4GH4B 4N43A 1QJX2 2PAMA 4DQAA 2EXKA 4K9SA 1AR61 1MR5A 1MS5A 4Q4X1 4JC1A 3OY8A 1PGW1 4RFT0 3RNSA 3ATGA 2RR11 2V73A 1CAUA 1IHMA 2PLV2 1RHI2 1V9U1 1YNAA 3WP4A 4JRAA 2ZGMA 4XF1A 4R9CA 2EAKA 3UV9A 2XGXA 3DKWA 1W6OB 2AGSA 2VOXA 2TUNA 2DURA 2ZHLA 1NYWA 3CU7A 1O4ZA 3GBFA 4KG8A 3KSCA 4AEJA 1AXYA 2E6VA 3ZMOA 1Y43B 4FPHA 5C8CC 1S2KA 1VAMA 3AB0A 1C8M2 4GXLA 5DUXA 3KT1A 5JR7B 5FCCA 2D3SA 1NLSA 1ULCA 1ULDA 3MICA 1OOPC 3J8F3 3AFKA 4L97A 1RUNA 2R1BA 1YCIA 4AWDA 2VMIA 3MIBA 3U11A 4Z82A 3ZN6B 3AP7A 4PIXA 2HWB3 1OOPA 4KNCA 4XHXA 4JQRA 1OIKA 1VBB3 1O3SA 1TMF3 2O1QA 1ULFA 2OUJA 4LBOA 4NWVA 5B2GB 1JH5A 3VGIA 5JOZA 2IXLA 2BVBA 4FPJA 1E57A 5J96B 1PIV1 4I09A 1C8NA 1AR72 2KXLA 1G9AA 3IIAA 3E5XA 1I3HA 1WLCA 3AK0A 3AJZA 3BU7A 4N7UA 4BHFA 1AXKA 1LHOA 1KXGA 5A33A 4XF4A 3MIHA 1H4GA 1OQ1A 1RUI2 1S0GA 1RUG2 1REDA 1FMD1 3B9IA 3R05A 4FTBA 3A0NA 4HN1A 3MW4A 5HI0A 1LULA 3AM2A 2E9QA 3E97A 1PGW2 2D6KA 3SH3A 4Q0PA 3AZVA 4UXAA 1A8MA 4Y1ZA 4CDWC 3WG1A 3VBSB 3NKTA 2YV8A 3W59A 4ORFA 1J58A 1UN1A 4S2DA 2D97A 1IPKA 1NCRC 3BOPA 4CDWA 3JD72 1DIWA 3ZO0B 3VBRA 4LBQB 2JICA 2GZWA 3VBOC 1NE6A 2R0HA 3ZYPA 1NCRA 2WINB 1LHWA 4TSVA 3FHIB 1V00A 5FQ0A 3SNMA