4BIOA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4bioA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bioA01
2WA3A 3OD4A 2ILMA 2YC0A 2YDEA 1H2NA 4Z2WA 3D8CA 4B7EA 4B7KA 4Z1VA 1H2KA 5JWPA 4QU2A 2XUMA 3KCYA 2W0XA 3P3PA 1MZEA 4AI8A 3P3NA 4JAAA 4NR1A 2CGOA 2Y0IA 2CGNA 1H2LA 2WA4A 1MZFA 3KCXA 1YCIA 4BIOA 1IZ3A 1H2MA
chains in the Genus database with same CATH superfamily
3J7AU 1AYM1 3ILRA 5HCHA 4O4HA 3MDPA 2E53A 1DGWA 2CTQA 1AYM2 2D98A 3FKSG 4DR7O 1YFXA 1XE8A 2BJSA 1T6GC 1LHOA 2BOBC 4CUAA 2JGDA 2E51A 3O9OA 4IUGA 1MZFA 1B35A 1XNDA 2Z42A 1RC6A 3F5WC 5D8AC 4F7ZA 2W94A 1D4M1 5LBFA 3ZHVA 2MEV1 5K0UB 2GSMB 3O1MA 3K3WA 1H4HA 2IJIA 1D4M2 5F32A 5EZYA 1QJZA 2MEV2 3ASIA 2RJZA 1BZWA 5CKMA 1PM4A 1WW7A 2JD4A 2OZ6A 2WQ4A 3WFVA 4YW7A 2FHRA 3RSJA 2ZZQA 2KR2A 3GJBA 4N9HA 5DMYA 3UYJA 1HXS1 1EN6A 3ZXGA 1PNLA 3WDVA 1SPPB 4DR3O 4W6WA 1HXS2 1AR4A 1TNRA 1G9AA 1J3PA 4P9OA 3KV6A 4TZDA 1OLME 4QT6A 4QXKA 2VG9A 2BCCH 3WG4A 4KU8A 3VKFC 3JCIA 1D2SA 4F4LA 1ND2B 3D3IA 4PF5A 4EN0A 3VDBA 3VD5A 1RSOA 1AR1B 4XBFA 4DW1A 4ZI7B 1VQLV 1SBDA 3ZBHA 4LORA 4DR1O 4AI2A 1H9PA 2WNUA 4CS3A 1W3XA 3RW0A 5JXIA 4N53A 3C3TA 4XDKA 2C24A 4Y20B 3UGFA 5IVVA 2XJPA 4WFFA 2VO5A 1AHSA 2XUMA 4CZSA 3U78A 3K5LA 4JAAA 4QGPA 1S77D 4M4PA 5DPNA 5L3DA 1XNKA 4X20B 1ULPA 1AJQA 4A42A 5FOBB 1N36O 1TVGA 2QKDA 5BMVA 3SH3A 4AI3A 1WP8A 4QXCA 1ZAUA 4GH4B 1WLCA 5EC2C 2KB1A 1QR9A 3N9MA 1DZTA 1NZ6A 5AVPA 1GWKA 1G9FA 4P9WA 1YJKA 4CEWA 1O59A 3KZ4C 2VCAA 3PNAA 1WKYA 1H6YA 2YFUA 3AG4B 1Q8PA 3WDTA 1AX2A 4XETA 5KXDA 4NPRA 2IJHA 2F93B 5M0TA 4OMDA 1I5YA 3OJBA 1NYWA 5B1BB 4MOAA 1WCDJ 4GJYA 3R4SA 3KZIZ 2FDKA 3EB7A 2E6VA 5DN2A 3IIAA 1V6MA 4LBMA 5FK8A 2ZT9B 1RJ8A 1UZWA 4CP9A 3RYKA 2XB6C 2GBOA 4MTGA 3CCLV 1YNAA 1EV11 1VBE1 1VP6A 2VZSA 4C0BA 2R071 2BGOA 1EV12 2LGWA 4DV4B 1VBE2 1HDJA 5DZEA 3BFRA 3ZHRA 2EIJB 4BAYA 3FMGA 4FPLA 2R072 1Y76B 3ZMVA 2CY6A 5IHRA 4W65A 4PJYA 4UB8Z 3A0HZ 1YCIA 1QXRA 1K8AW 4RUEA 5HCAA 2YMZA 3ENRA 1GOGA 1JZ8A 5E6HA 2GDFA 4JI8O 1LOFA 2CH7A 3CYOA 1GTOA 3ML0A 3O1OA 4AILC 2QCSB 1EPZA 3BYWA 4JI1B 5I0SA 1CAUB 2QDOA 4EZ4A 4AVSA 1ZYBA 4TT3G 4RQPA 1JYVA 4GMP0 4BYYA 4QX2A 1DDLA 1FXKB 1JOBA 4M3CA 1NBMG 4E9KA 1P84F 4N21A 1ASJ3 3SJAC 1PO11 5LATA 1ZSPA 3RZJA 4FM1A 1PO12 3PJQA 3SYPA 1F2NA 1GU3A 2QZ2A 4IIJA 4FVVA 1IS5A 5CKNA 1OHHG 1S2KA 4GAZA 3NR7A 4AGRA 2E7QA 4F6RA 2WLQA 3RYCA 3CNAA 4J41A 1CAVB 4JV5B 3OYWA 3FUQA 5IVCA 1FNYA 4MYEA 2JS3A 5C8YA 2XNDG 2VZUA 5T5JA 1W05A 4TLFA 4QX7A 1JYCA 1WCKA 2X5IC 3ZO0B 1H8TC 4BLJA 1QVGU 5F39A 1N47A 3RJRA 1MSDA 4DV7B 3S30A 5LA2A 3RN4A 1NT2B 1K4CC 3ATGA 3J80N 3MD0A 3SC7X 2WBKA 4LWSB 1UAIA 5FXWA 3OCPA 1BCCH 1REDA 2OA2A 5FXXA 3ES4A 3B8MA 2H3OA 5FZCA 3HKDB 2XAJA 5FQ0A 1OJHA 3MW3A 3OR7C 4XC9A 3AYEA 5A7NA 4CCDA 3ZIWA 1RL3A 1TMF3 2P06A 4DOUA 3OM3B 1QF3A 2WL1A 5DAXA 1SQXH 3MLLA 2ZEYA 4DQAA 2ZOEB 3KS7A 2UUCB 2JENA 4OUEA 1GMGA 1DIWA 4JI4B 1NTMH 2VNGA 1GN4A 2GC0A 5FZEA 4DV1B 1FMD3 3L2YA 2V5DA 1VQ4V 3K4ZA 4X8PA 5BR8O 4YVWC 2ZGTA 1YI9A 1GAXA 3RG0A 4HNAB 1M1KW 5JSRA 3MIGA 3OBZA 2E74B 5EIBD 3I59B 4CYDA 4KFMA 1VRH1 2RDRA 1XSQA 3JZVA 1G1XB 1QDCA 1VRH2 2PQSA 2PLV1 4HG6B 1H2SB 3ZYJB 1KS4A 5CA3A 4YVSA 3CLPA 2PLV2 4D6TH 4DY3A 3I3QA 5DXDA 1D2QA 4JPRA 3ZFGB 1J3RA 2AUYA 3VZOA 4FOWA 3BVOA 3T4ZA 4LFCB 5KXBA 4NHKA 4FTSA 3H0OA 1CJDA 5FMOL 2WS92 3VZJA 1XNCA 4BIUA 3N9PA 1AUYA 2F1MA 3G6EV 1FXVA 2DN9A 3R66A 3VD3A 3PTRB 1XOUA 5GLUA 3VHPA 1VBA3 1US2A 1Q7YW 1F31A 3MHSC 4DV4O 5J9PC 2PUSA 5LGUA 2Z5WA 5I8TA 4OFGA 1WMXA 1QOSA 2AHZA 2EALA 3VZLA 4FM2A 1T5EA 1W2AX 3DC6A 1NLSA 3MFAA 1AP5A 1WW6A 2YB7A 4K0KB 2D93A 1OT5A 4NIIA 2F23A 2P5BA 2ZGQA 3MFCA 1W2TA 4HKLA 1G9BA 1KS5A 1CPNA 1OUXA 1MR5A 3UM7A 5IUQA 1K5QA 5GZEA 2ZX2A 3R05A 1GN3A 2RMKB 1HNXB 1O9GA 5LZ6A 3R4UA 5C3PA 4CDQC 4OGQB 4UCSA 2DU0A 2ZPXA 2WWSA 3ACGA 2WT2A 4LE4A 2W52A 4LBQD 1EUTA 4Q29A 2YXLA 1YIFA 3N9QA 2YI9A 4TV8A 5FZOA 2Q8EA 4P5HA 5IVEA 1I9RA 2DUPA 3SGIA 3KF3A 4JV5O 4YFWA 2XH6A 2ZR2A 4BQYA 4QX1A 3IT8A 2AH2A 3C3VA 2QM4A 2F17A 4ZXKA 4CUBA 2RHPA 5FO8B 2DDUA 3OF1A 3H42B 4L92A 3LDRA 1KJLA 3T0DA 3LSSA 3G67A 2X53S 2FYUH 3WW2A 1A34A 1WCUA 5JH7B 2X09A 3PLQA 4AEDA 3NNFA 5ABJC 2ZCEA 2ZAAA 1WGPA 2ZHNA 1K3EA 2FDHA 3D5OA 5JOYA 3LF7A 1TUBA 3VDCA 4XOGA 2HWB3 3ABLB 4OLLA 3HKEA 4PDVA 4NKGB 1W99A 5CKQA 3DKQA 4SBVA 2JEXA 4P5YA 5B1AC 1MABG 4H7LA 2VL4A 2QNKA 1SCRA 2W46A 2UUCO 4E4ZA 3WDYA 5FZMA 4J25A 2KG7A 1UU5A 4AGVA 2WSUA 3TNPB 2J1TA 2WO2A 1THZA 3H1HH 2VMFA 4I3PA 2RM23 4FFBA 1I0HA 2YZ4A 1ZA4A 5C93A 2LO1A 5CIRA 5E1AC 5LA6A 3ZN5A 3MGUA 4DUXA 4I5SA 1W90A 2F43G 1SKVA 1PNMA 2GALA 5FP3A 2P6CA 5KR7A 1Z7S3 5FPUA 1PVC3 5JUVA 1SZXA 3ZXFA 4K21A 4LFCO 3E8HA 2TEPA 5C4WB 3O1PA 2YBPA 1NOVA 1FNZA 1AXZA 4ZBMA 5FJKA 3K5OA 5FZGA 4LF9B 3V64A 4GUNA 1E5HA 5C8CC 3D3QA 2BV4A 3I97A 3VQVA 4KGGA 3UT5B 1GV9A 3AK1A 2Q4PA 2BEOA 3WNKA 1O3TA 4NRMA 1REEA 4Q0QA 5LP6A 3ZKUA 5HCBA 4JGZC 3O14A 1EN5A 1ZBA3 2VOKA 2BZDA 4NROA 4YM0A 2YIDA 3CCJV 4K0KO 1MVEA 3CD6V 1S4CA 4ZPIA 3VBBA 2A75A 4GWIA 4DS0A 1M56B 4I50B 4FPPA 3V0BA 2BVVA 3VQYA 1RUE3 1ZRRA 3OBAA 3T1YB 1SQPH 5LK7B 4KWJA 4FLUA 4BQ4A 4IYHA 1K5MA 3FX7A 5HXMA 1HNZO 1FS0G 4KG0A 4IE0A 5KHKA 4QPGB 1RHI1 4QU1A 5JQGB 4KWKA 3WF1A 1RHI2 1UOJA 1OCZB 1EP0A 3I4IA 4KU7A 4RQPC 1TVKB 1PL0A 3WCSA 4RHV1 1DGSA 3AP6A 2QBXA 4RHV2 1UQXA 1DG6A 1R1A3 1BE3H 3POEA 3EBRA 1N0JA 4MX3A 5K9YA 3OOXA 4JTAB 3QCWA 1V9U1 2XDVA 2ETEA 1BSMA 1SFNA 3NJXA 2IXJA 4YGBA 1K92A 1V9U2 5CB7A 1OKOA 1JHNA 2HHHO 5K0UA 4PA4A 3MIDA 4FOQA 4FQZA 4LFAB 4HSLA 2YICA 2P3JA 1VF5B 2M6YA 5C6CA 5FZ7A 1VMJA 4QQLA 4JI3B 4DO2A 4HKWA 3AXDA 2RS53 4EFBA 1R64A 2K0GA 3O1RA 2ZEXA 5I0RA 4KMQA 1O9HA 5C9AC 3LDDA 1PO23 1TME3 4YW4A 3CMGA 4RS5A 5EJ3A 1RUG1 1L3JA 4O2AB 2GDSA 2P4EA 1YI2V 5IK8A 2P5OA 1RUG2 2QTOA 2O8OA 3CCUV 1ND2A 4GT1A 3UQ8A 2JECA 4FLZA 4ZI7A 4S2HA 2BQPA 3N7KA 4J11A 4WBBA 1CGPA 4AQYO 4LP8A 1RPRA 4GZ9A 4Y20A 2H0VA 4CE8A 4UV8A 4PCRA 3WDWA 2EZOA 1V6IA 3N36A 4A5UB 4RGAA 1UJWB 4X20A 3S0MA 1ENQA 4IV3B 1DFQA 2B9UA 2WLLA 3ST7A 4HVQA 2CHHA 2DU1A 5KXCA 1HW5A 3BRCA 1EY2A 5FUPA 4QDRA 3G4SV 4X1YB 2RQ6A 4LHSA 3JQXA 3RYHA 4BCUA 3BI3A 4E27A 4YVSC 1EN4A 4IGPA 1AL23 2ARCA 3AZWA 4Q4W3 5CA1B 5GLTA 5JOZA 1RTVA 2Q0OC 4RR3B 5F3IA 5A3MA 1JS9A 2X7RB 1SMVA 1QH6A 4ASKA 3I2KA 4ZXEA 4WM8B 4P9PA 4CEYB 2PAKA 3KV5A 2DW4A 4X89A 3OPZA 5I8SA 4BOWA 2EINB 3CP1A 3AFKA 5JCOA 5A3OA 3J8F3 1YQ5A 2QWNB 2UU9B 5FXZA 3AVRA 3IWZA 4AVAA 4QX0A 1JCHA 1GP5A 1RXGA 3HN1A 2Q7EA 2HWF1 1P4RA 2VMEA 3HIFA 3ITQA 1UF2C 3V0AA 4JGYB 2Q0AA 2Y64A 5IJRA 4GA9A 2QQUA 3AP7A 2FDIA 4O61A 4XMAA 3T1YO 4JTDB 1Y76A 4S2GA 1PGW1 2GH8A 1H1MA 3ZLIA 3GGLA 1QJY2 1RMU3 4R8CA 3HKCB 1F8VA 4GULA 4MGSA 1P49A 5JZGA 2NLJC 3RJ2X 4Q4Y3 3RPQA 4XDOA 3J7HA 5LHIA 1FKAO 2DCKA 2RN9A 2VTFA 2JEMA 3FLTA 2B1GA 1CAUA 3RYPA 5A1LA 2YGLA 2IM9A 5D2AA 2XONA 4JI7B 2OYQA 1SLIA 3ELNA 1SESA 4QB6A 3CXHF 4ISQA 1FXKA 1XBFA 1RYYA 2NNUA 4YJ2B 4YNIA 1OI6A 3M2MA 2UY9A 1SZBA 3X2QC 4YXWG 4NAMA 4PQQA 2F4PA 1KD1W 2EIKB 1W0JG 1S0BA 4JKMA 1CAVA 4LFAO 4DR2O 5K7PA 2BE3A 1HW7A 5LOVB 2BDRA 3LNMB 1GN2A 2BSKB 3PUHA 1XQ8A 3ZYRA 1GO3F 3FB7C 1JUHA 1BEV3 5CFDB 1AZDA 2VZTA 3H3UA 1VF6C 4Z82A 4AEDC 1PZ8A 3QNEA 3WOGA 2LW8A 3L74H 1O8PA 1VP7A 2HWE3 3CCRV 4Y3OA 5GONB 2ORXA 5FLXN 4LWSA 5KHJA 1Y7BA 2WT1A 4MSWC 1XMOB 2AR6A 2YFZA 3FJSA 3TEYA 2PHUA 3ZN4A 4TN7A 3D3AA 3HKDA 4LBQB 4C91A 2GHYA 1UO9A 4N9IA 3ASNC 5E88A 2R72A 1BZKA 2IXIA 1A8MA 2JJ1G 3B69A 4LCUC 5FCCA 4ZU5A 5DQ0A 5GZDA 1XL4A 2GUZB 2D6LX 5IW0A 4EWDA 3ICXA 2VUDA 1AJNA 4EB6B 3B4SA 1V6KA 1WW5A 4WF9V 3GZAA 4DXRA 4LO4B 4CDWA 1XBLA 3ZFEB 4ASUG 4YWAA 4HNAA 3MW2A 3OY8B 3KM5A 2WZR3 4X66B 4Z1VA 4KHPB 3OTFA 5H5NA 1QHDA 4XDQA 1OV9A 3USUA 4GXLA 1GM7A 3AG2B 1LR5A 3B94A 3RZMA 4QKFA 4HAMA 3KT1A 1FAFA 4D94A 4DUWA 3X29B 5J2UB 1XDCA 3CC7V 2KQXA 2XQRA 2EXHA 2KKWA 2WA4A 4XURA 1ZZ8A 1Q8IA 3VKLA 2B5UA 1XE0A 2UU9O 4XBNA 2QM7A 4U7OA 5CYYA 3BODA 2A3QA 2W0XA 4Y1VA 4Y4YA 1RUF1 3IBMA 4E2QA 4CCNA 4GWMA 5LRRA 1CP9A 1CAXB 1RUF2 1LNSA 1SDDB 4XE9A 3OUIA 3JD2A 4QB2A 1YF2A 2PHWA 4PQ9A 4XZPA 1KFUL 1WD3A 2GMEA 4UVBA 1BMFG 5JDBA 1H8EG 4MTOA 3W7TA 5AVAA 3AZYA 2H6BA 3WQ0A 2GZWA 4FPHA 4CS2A 4UUJC 1D0HA 3ACLA 1SLBA 4LF5B 4UW3A 5L3EA 2AZ0A 3BKZA 1UXZA 2JG8C 5FWJA 1S3JA 1ODMA 5DG1A 4O4IB 1W2OA 2W6IG 5CA0B 2N04A 4HK9A 5EZWA 4B8EA 3W7UA 4QU2A 3NJZA 5SV5A 2ZX1A 5GKAC 2A0LA 4U7NA 1GQHA 1WA8A 4LF4B 5E8AA 3F7YC 1N1SA 3D36A 1F35A 4XBLA 3VBOC 5BUVA 3LGRA 4P9YA 3TN93 4TOIA 1PKXA 4QWNA 4WFAV 4DPNA 3LDEA 5K4LA 5B3SC 3I55V 1S1AA 2D6NA 1RIRA 2ZDIA 3I2OA 2IXLA 2G9GA 4EKWA 2RR11 4MO3M 4DR5B 2O57A 4RQFA 5K0UC 1VQ9V 2LW7A 1EAH1 3JSLA 2RR12 2Q67A 4LFBO 4LH7A 4D3WA 1VQ7V 1EAH2 4PHZA 1U96A 1BL8A 1BCXA 2YYOA 3ZXEA 1AX1A 4PT6A 5J36A 2DCZA 1XMOO 3C7FA 4DV3O 3O1SA 1NQTA 3I3EA 5FWEA 1L1FA 1F4NA 4W8JA 4WVVA 4AHZA 4E4SA 3ZKYA 4NO4A 4AHYA 4IQPA 2IZWA 3I54A 3TJTA 1IKQA 3MPBA 3K5NA 3DYOA 5FYIA 2JD9A 4NWWA 1WUVA 5EV7A 3E35A 1WLWA 2OPKA 3AKSA 2ITCC 2RMU1 2HBUA 4D7TA 2RMU2 5DAVA 4DK1A 1P8JA 2HG5C 2CYFA 3FYIB 4I09A 2JJ2G 2BTOA 5JJEB 2FMLA 4EN6B 1XNRB 3E83A 4IE4A 4KHPO 4CU7A 3ABZA 3NJVA 5DEDA 4B4QA 1SACA 3UKTA 1HR0B 1R1BA 2N05A 4GH4C 5I0TA 2WQZC 1ZZ7A 3DUIA 1QJEA 1UMIA 4DV2B 3E6CC 4IYIA 4Q4X3 1NQDA 4AF9A 5B4XA 2A9HA 5A3LA 2DCTA 2QUOA 4H55A 4JI6B 1W6OA 5IYZB 3MW4A 2NLRA 3AG4C 3AK0A 5C4WA 1FPOA 1KUQA 2YBSA 4HK8A 3WT3A 4GKXA 4LNVA 2I45A 3POWA 4WFGA 4HFSA 2OKXA 2QZ3A 1NCQB 3IC7A 2NN4A 5B1BC 4G3YC 3OUFA 1YHFA 1DTOA 5KC6A 4FQ4A 3UT5A 3TWIA 3A0RA 4XILA 1OLQA 2DUOA 5GTHZ 2XR4A 1NY71 1AI4A 1TQ5A 2LTNA 1NY72 5LGNA 2VTXJ 1ZZCA 2YC2A 4PBPA 4MTXA 4MW3A 2BERA 1RXFA 3LKJA 1WN7A 4UCUA 1NA1A 1LR1A 2EIJC 2ADPA 4GCZA 4J42A 3HOBA 3T1CA 2R043 1FOD3 3FB6C 2F4VO 4I50A 1YTFD 5LXTA 1COWG 5DAWA 5A2QN 4CCCA 3CJHA 3I2FA 1QXJA 3WP6A 3LZZA 2RE9A 4IESA 1DZRA 1RUD1 1GSLA 3SDLA 2XBO3 3SITA 1RUD2 4H3WA 3JAMN 4AQTA 1R083 2YI8A 1NR1A 3UL2A 4QPGA 4N43B 2ZXQA 1E1RG 1Y43B 4H13B 3N9NA 1RUC3 2HH9A 5FAXA 4DXTA 4LF4O 1JVMA 3WEZA 2W9XA 3ZHQA 2R16A 1TVKA 1Q6UA 4EN8B 4LBLA 3RVYA 1ST8A 4XUTA 2JE7A 3E6DA 1CESA 3VOUA 3M70A 3UESA 2VUAA 3DV8A 4O65A 4PI0A 3E8BA 3MPPG 3SH5A 3BCWA 3GZUC 2P1BA 2IFRA 1YXBA 1P7BA 4AI0A 1JJ2U 1YFYA 1H8HG 1D5AA 2IU3A 2UXNA 4KNCA 3O65A 4LR4A 1XYPA 3VDDC 5A7WB 4GQ7A 4COVA 2B9VA 3FFQA 3M8AA 3Q8EA 1WNSA 2P3KA 2YY1A 1CONA 5J37A 4L11A 4OUSA 4JX0A 2C9KA 1RVF3 4BWAA 1CEZA 3CRCA 2D6PA 4JRAA 3AZZA 4YVWB 4DXWA 4QPJA 4XFHA 1HRV3 3FAVB 1O4ZA 1V55B 3DL3A 3UJQA 4GWNA 4LBKA 5AFBA 2DF7A 2PN5A 3JYCA 5A7SA 3K58A 2ZIOA 4CDXC 3RZLA 4YW1A 4X1KA 4LXLA 2WFF3 1K34A 4CU6A 2CNAA 3HPNA 2CWSA 1KBHA 3EYPA 3OEAA 3IKWA 1IKPA 2J7MA 3GBWA 1HN0A 4P30A 2ZE7A 4D69A 3NVCA 2EAAA 5IAXA 2X6BA 3JARB 2Q7GA 2B4KA 3PUIA 3WX5A 3ABTA 4PD4F 4LIUA 3PMEA 1X7NA 2D6KA 3B9IA 4OHWA 1XNRO 2UUBB 3WNXA 1MVQA 3C7HA 4BXSV 2X8KA 3H1WA 4UT5A 1UY0A 4UV9A 4P2ZA 4AQSA 1HR0O 1JOYA 1C8M3 4I9WA 4DV0B 1PK6B 2VC9A 1LECA 3M3OA 4LQRA 4DV2O 4FPGA 2JIZG 3WF4A 1SFPA 1PV0A 3QH6A 3T2MA 1MPXA 2CTRA 4CPBD 1AB3A 1OA4A 4N7UA 5FUNA 5JPMB 2A6YA 4QGMA 3T2OA 5LBBA 5FYYA 3QVNA 3OUHA 1YQ6A 5F2WA 4RR3A 3ZFGC 4AEMA 3ZXLA 4COUA 3TYJA 3EMRA 4CC6A 1W2BU 1IZ3A 2JDZA 4FZ1A 4CEYA 1MSWD 3QF7A 1REFA 3HD8B 1QNWA 3GYDA 4CDQB 4AVTA 1W6QB 3WSOA 4K3AA 2HWC3 4IV1B 5HV0A 2WO7A 3IIIA 5CBFA 2E26A 2XVKA 4JGYA 2ZX0A 1CZSA 2YUEA 2YEVB 1FV3A 2W1WA 2WLJA 5JJJB 4B3TO 2R9AA 5FZFA 2W3JA 3ORJA 1IBKO 1GLHA 1F4MA 1JU4A 3K59A 4Y22B 3OGVA 3ZFFA 2D5HA 1JYIA 1W0NA 4LO8A 3HKCA 3L9JT 5A6XA 1IQDC 5FK7A 2ZGNA 4NPMA 1RITA 1PGL1 4UFIA 1AR83 2UY8A 2B46X 3OUJA 2IH1C 1WA6X 3BU0A 1M57B 3P30A 3K0DA 4RWUA 3B02A 2D3OW 5FZ3A 1LOAA 5ABJB 2LALA 4MVSA 3W7WA 4J9ZB 1R093 4F6EA 5IFPA 4B7EA 4AQ6A 1CZTA 2J1SA 3ZYBA 1R3IC 1W6NB 2C1FA 1UZYA 2WFPA 3FZ3A 2BW8A 2CGOA 3H9VA 2IH3C 2OXBA 5CMUA 4FIPC 4QE9A 2P37A 4AFAA 4YJ2A 4PDMA 5AG2A 3MBWA 4CXYA 3I49A 4OPAA 1UPIA 4K20A 3CEWA 3CRRA 3VKNA 1NVPD 1UYZA 3I2HA 3WHUA 1SBFA 3W59A 4UW4A 1NTKH 5IYYA 2QEXV 1O4YA 3EFFK 1ZREA 3UT0A 4YLZA 2VULA 2ZM6B 5KBFA 1L8DA 3AKPA 2ZDIC 4XF3A 4LHLA 1QWRA 5F1RA 1AYN3 5LOVA 1GZTA 2BSKA 4X65O 1N34B 4Q8LA 4Y1UA 4B08A 2R0FA 5IYDO 3TEZA 5T5PA 2ZIMA 4K1ZA 5F2VO 1X8MA 4RL7A 3C7OA 2Z69A 4XQWA 3ZXDA 1W8ZA 4Y4RA 3VV1A 3BY6A 3M3IA 3ABLC 2YPDA 3JD1A 2XKOA 5GONA 3U4SA 1ZBE3 1ZX3A 3KVBA 2VBPA 5KHIA 2A6ZA 5FY4A 4LBQA 3BALA 1M93A 1X9TA 1TGOA 2G4IA 1IDSA 3ZXJA 2VMDA 3H8OA 1WW4A 3RDIA 5H6RA 3K79A 3NNLA 2Q1FA 2GC3A 2RDQA 3W7SA 2W92A 2UUBO 3DN7A 1Y6XA 4FFGA 2CGPA 3M3EA 2GUZA 3K08A 5IFTA 2ZE5A 2QE7G 4EB6A 2HWD1 4YGEA 4DV0O 3EQEA 1D4M3 2MEV3 1X33A 3OEEG 1YI7A 2HWD2 4JGZB 3ZFEA 4D6SA 1J95A 1Y66A 3NSTA 4X88A 1ULCA 5IYCO 3ES1A 2UURA 3UGHA 2VXRA 3OY8A 5CBGA 1ZRIA 4LKFA 4IHJB 1N1YA 2R1DA 1DQ6A 1LKNA 3POGA 4XVHA 4MVOA 3W5MA 1ALYA 4U36A 1Y74B 4AFDA 2D3SA 1D5NA 1UKGA 4NJ4A 2P4KA 5BZBA 4LF7B 4GALA 5EC1C 2ZINA 4L8QA 1NXMA 5C4WC 3ZPOA 1IS4A 5J2UA 3K04A 2GMPA 5FPXA 1WWYA 4I55A 3VGIA 5DDJ1 2BTQB 4IL7A 4K35A 2G1MA 5DDJ2 1BBT1 4HN1A 4W6YA 4H37A 5EHDA 3V56A 1DQ1A 3MV01 1BBT2 1FMD1 3DGEA 2DQ0A 1MS8A 1FMD2 2FDFA 1X9PA 1CAXA 1URFA 2Y69B 2VQAA 1JZ7A 2VECA 4PF1A 4XUQA 2AENA 4PLMA 4COWA 3NNJA 1UX6A 3E89A 4X6QB 1XMQO 2HYXA 3WNMA 1ND3B 3LEKA 1M56C 1N33O 4BHPA 3JXSA 1UKRA 2BFUS 2DWDC 5D8AA 2V4VA 3WF3A 3OUSA 1R6TA 4LO5B 5FY1A 5JWPA 4UXNA 3T1LA 2ZAHA 1VARA 2GP3A 3WVJA 3T2TA 4MXWB 5H9RA 3OMNB 4I7ZB 3PU3A 2Q8VA 3MUZ1 4O4IA 4QPGC 1CR7A 3ABMC 3AFGA 2GP5A 5CADA 2BPA2 2ERFA 4NN0A 1VBA1 1OCZC 1FFTB 5C9AB 1VBA2 4I2OA 3BOWA 3B2EE 2V73A 1L7QA 1QIQA 5LYJA 3BTYA 5KMGB 2WLIA 2Y6LA 2ZM6O 5LBCA 1EV13 1XUQA 1VBE3 2WWWA 2OCHA 1VRBA 1QBZA 2R073 3GBGA 4NHYA 3SH4A 4FSJA 4OMCA 2R7EB 4ZHQA 1FPN1 4JDMA 3K5MA 3A0NA 1XHXA 1N34O 1QCEA 3ETPA 3MO4A 1FPN2 3AX4A 1US6A 1ENSA 1R3KC 4JI0O 5FZ0A 1O8SA 3Q4HA 1YTFB 3SCGA 4OHVA 2PF4E 1GZWB 1E57A 3AKQA 3JBG3 2ITDC 3PDQA 4TV9B 3ZX6A 1MMMA 4L0PA 1CVNA 3UKVA 1DYPA 4CCKA 1XC6A 1FT9A 4QDSA 1XU1A 2Q9LA 4AFMA 3POIA 1SETA 5CN0A 3NJYA 1PO13 3OGIB 1GM8A 1RUI1 4LOTA 3OT7A 5A9GA 4O2BA 1BGYH 1AL0G 2VCCA 4WVMB 2HYKA 1RUI2 4Q26A 3WUCA 3JUUA 2JWPA 5BNNB 1UD1A 4FM0A 2DMXA 2FDGA 4DRXB 3DSQA 4JYBA 1OC1A 5IK4A 4Q2FA 1ENVA 1MS1A 1W6MB 3H7YA 3HMYA 2D2CB 2B42B 4QHOA 4IV3C 1AR71 5K1XA 2HWB1 4IEYA 4JV4A 4M3CF 1AR72 1ZZ9A 2HWB2 2AEYA 1SG3A 4BDVB 3IM0A 1HB4A 4UFMA 3STZC 2LW1A 1EZJA 4MG2A 4HXCA 5EK0A 4PJ0Z 2OQ7A 4K8ZA 4ATEA 4X8NA 4FI9A 2VNRA 4XHBA 1L0LH 5C3OA 3WG1A 3PVBB 4Q20A 3E6BA 2HJDA 3QO5A 3ACFA 5I0DA 2B7YA 5KLVH 4WM8C 4CEYC 4JI5O 3HT1A 4AE2A 1BHGA 2EINC 2D3PA 2WAOA 4A7YA 3VBRB 2ZCWA 4QGLA 1K97A 2EIBA 1VF7A 2WIIB 2CU5A 4E8DA 4XFCA 4HPKB 3PUSA 4IEZA 5A6YA 1JHJA 4JGYC 1L7RA 5LL6Y 2EF6A 3K3NA 1NTZH 5F9TA 1YJ9V 4MVRA 4NIAA 5FTTC 5EJ1B 2PYLA 1QJU1 3CO2A 4JF3A 2JDPA 1VRH3 1WB7A 1YRZA 4S2FA 2AACA 2XG3A 3KGZA 1PVC1 4PA6A 1QJU2 5LBQA 4S2DA 2PLV3 1PVC2 2L35A 1G6UA 2DCJA 3IPVA 4QPKA 3POSA 1Y9GA 2VNVA 4JKKA 1YQ8A 3DEMA 1JW6A 3BVCA 5IK7A 1GZ9A 4FTEA 2JEUA 3IC9A 4EV0A 3OBRA 4N43A 1DYOA 2AZ5A 3HPLC 1HV0A 4J7KA 1S0JA 1HV1A 3J4UH 3VZMA 1E5SA 1DBNA 5J2TB 3LSUA 3ACHA 2XQXA 3RZZA 4EWAA 5L36A 4C90A 4DR3B 1H2GA 1N1TA 4QKBA 3P1IA 3MUY1 3H1JH 4D6QA 4CU8A 2EJRA 3FB8C 4OQ9A 4UCTA 3ZYGA 1LU1A 3ZCCA 5KX5B 3M99B 3BAAA 3ZIXA 5A7WA 3FBMA 4BXFA 5A32B 3SMHA 1O3SA 4DR1B 1FI2A 2AYHA 2EICA 4Y24A 4AHCA 2ZGPA 4XJUA 3MLKA 2VZ3A 2OIGA 4N7IA 5CFDC 2BOJA 2I07B 2JDUA 4PELA 3CZUA 3N9OA 4LF6O 2TNFA 3RWKX 1GICA 4YVWA 2VWJA 5LEKA 3Q8AA 5FPRA 2MPFA 2FL4A 2ZR3A 4HZFA 3EJKA 5TISZ 4AHXA 4U3JB 1VEWA 5FZHA 3J9SA 2Y6HA 1R1A2 4HZ3A 1IQAA 3H3LA 2ZKOA 2JRIA 5BPXA 3CMAV 2LQTA 4ARYA 1G8MA 4YM3A 1HX6A 1NVPB 3CE2A 2CAUA 5CVRA 5L9VA 5LMUB 1UOGA 2R061 2RCVA 4BK5A 4D0QA 2PHXA 2R062 3ZFEC 3FBYA 2YSUB 2C2AA 2UUAO 3PURA 4XCAA 1US3A 1YJLA 1PK6A 4CS4A 2E5LB 2ZEWA 3RVHA 4J10A 5ACA1 5JI7A 2WT0A 2DWEC 1ORQC 4K1YA 2AREA 5ACA2 5J1XA 2NM1A 1OCCB 1PO21 1UY2A 1X82A 4NOTA 2Q8OA 5G05L 3I3MA 1PO22 3OGRA 1GUIA 3RVZA 4RGGA 1GNHA 4QGNA 2XLAA 1BQ0A 4GX2A 1UYYA 2Q68A 5FYVA 4XTMA 3I2JA 4C0HA 3H9AA 4J9YB 3RS6A 1SCSA 4GKJB 1SS3A 4RD7A 4ZKIA 1VBD1 1N3OA 3SXWA 4WVZA 3K9SA 5FZAA 5FPAA 4CDQA 3F95A 1VBD2 1BYHA 5T3NA 2W68A 2KA3A 1W6QA 1JZ3A 3RYIB 4GX5A 3MIHA 2RDNA 2EXJA 4DEVA 3D6EA 1MS5A 4LF8B 4IEPA 4OZOA 2ZE8A 3BIWE 3VBOB 2PXJA 2XKPA 2ZHKA 4DXSA 2VY0A 3IFXA 5LA0A 3LAGA 2A6VA 3WP4A 2HEWF 2CDPA 4GKKB 5B3SB 1M90W 3T2PA 2NN8A 3FX3A 1NX9A 3O5SA 2RDCA 2QQLA 4XEZA 5HFLA 1UIKA 2XJTA 5GJ6A 2P22C 4INDA 3H50A 1SQQH 5ABJA 3K46A 3LEIA 5H2FZ 2A3WA 4QKNA 1FFXB 1ZRFA 4QHBA 4UAPA 4A3XA 1JZ2A 5FY7A 5FMDA 1ZLZA 1QJX1 3CDZB 1W6NA 4K8RB 2CWMA 2HEYF 1QJX2 1O7FA 1G6NA 4GIQA 3AMPA 3EHKA 1VAVA 2ADDA 5FZ4A 2DJVA 5KAFZ 4MW8A 1W03A 3WF2A 3N2GB 4MGKE 4UFKA 1YZBA 3P3NA 3ILNA 5DG2A 1JXNA 3KWVA 3RFRA 2OUHA 4HLTA 4AEJA 4B3SB 1OH4A 1S5JA 2CAVA 3ZYPA 4LT5A 5CU1A 3AJZA 5FREA 1GP4A 4XF4A 3IAQA 4LKDA 4QAWA 4UFJA 1QMJA 2XVGA 1JR9A 2UYBA 3D4KA 2VQTA 5BR8B 1OPMA 1WPXA 5CB4B 2VQUA 1HQLA 1YFWA 4UCVA 3ZEDA 2JE9A 1AVBA 4QKDA 3RGBA 1XNBA 4YPJA 5J48A 4C8DA 3ZN6B 2OYZA 1KKDA 4RHV3 2J1VA 4I01A 1ODNA 4IT5A 5EFUA 1S0FA 2W95A 1VIWB 3RI9A 4YZ1A 5A6QA 4R9CA 3UJOA 1YDXA 5C8CA 5LMUO 1V9U3 1Q90D 2CUGA 2JDAA 4U2AA 5EJZB 5HFMA 2MNGA 3NRUA 5EBMC 1BEV1 5FR3A 2QWQB 2P3YA 2E5LO 4Z8BA 3FUOA 1BEV2 2TBVA 4JGZA 1AR63 4CZZA 4FP3A 3UO2A 4ARXA 1S76D 3AKTA 2HWE1 2ORZA 4JVAA 4Y33A 3ZYHA 4PDWB 2HWE2 1O3QA 2VW2A 1CPYA 3CMEV 1KC8W 4IHJA 1IPSA 2V4DA 4KBBA 3C7EA 1Y74A 2LUWA 2YS8A 4XYXA 5F5CA 4GKJO 3ZHSA 2Q1MA 5T52A 3E5QA 1XU2A 5CG8A 4O4HB 2VH9A 4FOVA 1RUG3 2XWBB 4NHLA 2HKOA 3IB3A 2P6HA 4FPKA 4OI4A 3WG7C 2VZOA 4E8CA 1NCQC 1VLNA 1PVXA 2ZGSA 4MVUA 2BTQA 3AB0A 4PIZA 1B35B 2Q5ZA 1H2NA 2JDHA 1LUVA 3QBQA 4LF8O 1OMIA 4I0AA 2WUHA 3ZYFA 1A3KA 4BMBA 1SQBH 1LEDA 2WZ8A 2RDSA 2ZHLA 1QLEC 4YY3B 1RJ7A 2XLGA 3NWKA 1MNGA 4ORFA 5FY5A 1JA8A 1F5JA 4DIQA 1KEXA 1PHMA 2BU9A 4GKKO 3TGUH 2WZR2 5IK5A 1DQ2A 3FHQA 4NYKA 1ND3A 3ABUA 1FATA 1H0BA 4KWLA 4XF0A 1CPMA 3HKBB 1UZZA 1GKBA 3VDDB 2VRZA 3ZMZA 2VW1A 2HJIA 3O0WA 4ISRA 2ZJCA 3PUQA 3IDAA 5DM6V 2ZE6A 3HNYM 1HP8A 4N43C 5IT6A 2R32A 1UYPA 4BJ0A 2VUCA 4QQPA 2QDRA 2D6OX 2VVEA 1A8DA 4IGQA 3UV9A 5C9AA 4CDXB 3O0VA 5JMCA 3JCUZ 1BVVA 4FCAA 1V00A 4O4JB 3J7MA 2QQVA 3H1KH 4I30A 2HWF3 3GZEA 2Y0OA 3WV6A 5FDBA 5BMVB 1R6NA 3AXEA 5FYHA 3EXAA 1RUH1 4B3SO 1RUH2 1DLBA 4CEWB 2GN3A 3CB2A 2VUJA 4DUZB 2BYVE 3MIEA 3AMNA 3GWKC 2C0ZA 3LOBA 3L9DA 4RQEA 3T1HB 3MF6A 1GZWA 4TWTA 3KF5A 5T54A 3ZRVA 3B77A 4XBQA 3WW1A 2PHLA 2BGPA 4AVBA 1OF4A 3FYEB 1V55C 1S2EA 3KQRA 3KQ4B 4IL6Z 5CISA 1W3VA 1W9YA 2VTXA 3SPIA 4AXOA 4CP9B 4BW5A 4QXBA 3NV1A 1GNYA 4BIOA 1DZQA 2UXCO 1V6JA 5A1FA 3DF0A 2ES3A 3LSEA 3P5BA 5KA6A 4MVMA 2E76B 1Q8SA 3WF0A 3JB4C 1X36A 5F37A 3LSQA 3KHCA 4XJ9A 4WVMA 1UY1A 2WS91 5BNNA 5I91A 3T2QA 3OG2A 2VVDA 2WQ8A 1U5IA 4NTYA 1CAWA 4DRXA 5AC91 3ZHUA 3HB3B 3PJSK 5FZDA 2CH7B 4CTEA 4H14A 5AC92 2QJ1A 2IU0A 1W6MA 3B40A 4F3JA 1PK6C 1DF5A 4TUYB 1G8WA 3GHNA 4K40A 4PIXA 1SHWB 2PHFA 4CH5A 3N35A 3F7VC 4MS2A 3CC2V 1OCOC 2E75B 4OULA 1GQGA 1IXBA 4XACA 2A70A 2DBIA 2ADQB 3OGSA 3CCEV 5C3RA 3RZHA 3UKMA 4KGQA 2M7WA 4QMAA 2K9ZA 4NB5A 5C8WA 1ULGA 5FBJA 3VD4A 1R3JC 3RYFA 1EUUA 3LIGA 1VAKA 4MT8A 5IT9N 2PZSA 1S0DA 1M4UA 3VHRA 1SLCA 4YY3O 1DU3D 5FMCA 2DUQA 1HNZB 5C8YB 1HRI1 2QKCA 5ITZB 2OQ6A 4IV1C 3VBRA 1HRI2 3LUTB 2VD7A 3BCCH 5EYPA 4HYOA 3FC0A 2CK3G 3WNNA 5CAZA 2IC1A 1KRIA 1G9CA 1PD3A 3U11A 3SPGA 1OLRA 3POYA 2GU9A 5KHHA 2CDOA 2DYSC 4YG6A 4QM9A 2JG9B 4JAVA 2PELA 4ZS3A 1JFFB 4K3UA 1IPJA 2VS0A 5FQ0B 4CPBA 1MS4A 2EXKA 1NR7A 2HHHB 1HJGA 2BGCA 2C26A 1M57C 5TSWA 1N8RW 1VF6A 2ET7A 4NXMB 1FYUA 1WMFA 1J58A 2FMDA 4X62B 2ZGKA 1IS6A 5J2TA 5FP7A 2VQ0A 3ZSLA 3AG3B 5IATA 3LPFA 2XJRA 1AVMA 3EO6A 2N74A 4BW9A 3A2FA 3VQXA 1RUF3 1YC61 1AP6A 2I2SA 4XMIA 1Z0HA 2QDNA 3IDCB 3WP5A 2OVUA 2R041 4DUZO 2R042 4IERA 3ON7A 4LBOA 2P67A 4CCMA 1XNQB 1TE1B 2W91A 5FP8A 3T1HO 5A32A 4WFHA 1H30A 5IAVA 2XBO1 2O0OA 3KLSA 1I1EA 3K48A 2DVBA 2ZEZA 3L75H 3E8GA 3CRMA 4AQYB 1DGLA 4OI0A 2XBO2 3KT4A 5JR2A 3L70H 1K45A 3BUCA 5LB6A 2FD8A 4L8JA 2WZPP 1G9DA 4FPJA 3LOIA 1R082 2UXDO 4LK7A 4XFGA 1AR5A 1RUC1 4J1WA 1PGSA 2GMMA 3N27A 1OXCA 2XASA 1I3HA 1RUC2 5EYYA 3R4DB 4IE5A 1Y9QA 1I7FA 2A6WA 4MSVA 1VBB3 5FLIA 3CWBH 2ZKLA 4CP1A 3OFNG 4CH4A 4I0XB 4A6OA 3SPHA 4OCTA 5BNOC 1D2DA 5FPBA 1OA2A 2AC1A 1D0GA 3FN9A 5E1RA 2Q8CA 4R50A 3E86A 5GM0A 1OVPA 1BMV1 2VAUA 3CRQA 2BOIA 2V5YA 3TOJA 3LEGA 5JVDA 1BMV2 2DFCA 3GF6A 3AMQA 1W2UA 1PM7A 1NS1A 1DQ0A 3UETA 4D8MA 4DEQA 4LUKA 1ULFA 2ZXWC 5JOWA 4BLIA 2RR13 4LULA 3CXCU 4YZ4A 4QB1A 2VQFO 1EAH3 4CBCA 3A8TA 3LIHA 2EAKA 3Q8FA 3ZR5A 5KWRA 1JODA 1UN1A 5EWSA 2R9IA 1WBFA 1AILA 4RN5A 1WLEA 5CFCC 1OBNA 3RMYA 4E4EA 4PDRA 1JPXA 2LS6A 4DB5A 1HB2A 4XFAA 2WFF1 1TNFA 2RS13 4TV8B 2I74A 3WU2Z 1N32O 2NMNA 2WFF2 1HNWO 1MZ5A 2W5FA 4HL0A 2XTAA 2PTMA 3M8LA 3WNPA 1S55A 3FB5C 2UXBB 1WB8A 1KB9F 2JG8A 3DPRB 3BN6A 4JI2B 3U1XA 3WR0A 3KHBA 4EJRA 3ABMB 5C71A 2RMU3 2Z4FA 1MQTC 3L2HA 5BV6A 1IOAA 2B5HA 1OCRB 4R9AA 4FVMA 1KP2A 5IVJA 4R9BA 4XJAA 5DAQA 1M06G 1JUIA 1TAEA 3VBFC 2Y69C 2KXLA 5I93A 3AG1B 3VBOA 3F2ZA 2GAUA 4QD2A 1TUBB 1ND3C 5K1PA 4FO9A 2O14A 1HJFA 3EVKA 3LDCA 4GZRB 3N2KB 4MHUA 4Y1XA 3ABKB 1X59A 3CU7A 4LBNA 3ZSKA 4MVQA 1GQPA 3LSDA 3TB0A 4BQ2A 3GWOA 4NXMO 1TEIA 5FYCA 2YU2A 2XAQA 2DTWA 3THDA 4L97A 4DR2B 1LUWA 3H8UA 2MHFA 4FK5C 3GDBA 4X62O 2CDYA 2VE1A 1GOFA 2GTSA 1NCRB 5FRAA 2EIMC 3ILFA 2Q1ZB 3ZRSA 1FFXA 4Q27A 1SPPA 4NUBA 4QPYA 3DECA 3MYXA 2YXYA 4QE7A 2YV8A 1LRHA 3B01A 4LLFA 2XGXA 1M5IA 2DCYA 1Z5WA 2X0LA 3TEWA 3ZX7A 5H9CA 3F5TA 1ULOA 4QQOA 1U5YA 5FFOC 1SERA 5LA6B 3N2GA 1XNQO 1WLTA 5JR7B 3W7XA 4J1XA 3G7DA 4LTAA 1NQJA 1UY3A 1LODA 1DCSA 2FCVA 4YG0A 1YUDA 1HKDA 2K2SA 4DV5O 4COYA 3T09A 3RWRD 1COV1 3E5UA 2ZGLA 4GD4A 4ASMB 2QM8A 3B3QE 2XWJB 1COV2 1DLLA 1QOTA 4JQRA 4HT1T 2CSGA 1ZRCA 2PQQA 2D7FA 4DRRA 5EQUA 3AK2A 4GH4A 1HN1A 3U07A 5DN6G 4YIOA 2D6MA 3VDAA 2P17A 2RV9A 3VUOA 4RAIA 5LP6B 2UU8A 4G9SB 3ZN6A 1K5SA 1VQ6V 1S5LZ 3KD4A 3BGAA 3JASB 1YQCA 3SNMA 2D44A 4EYUA 4F8AA 3PHMA 2V09A 1ACCA 4A45A 1OKQA 3AP5A 4JDNA 1APNA 5F2SA 4UCRA 1ZL8B 2JGUA 5BNNC 2RJ2A 3RMXA 2YIAA 1E1QG 3L71H 4DR4O 4K6BA 4WVWA 3RRDA 2XAGA 3NV4A 4Z92B 4DK0A 5FYSA 5JSPA 3W58A 2IJJA 2QGNA 3IGAC 3KCYA 2HEPA 1IVSA 3G80A 3FLPA 1JJOA 4FBFA 4G4FA 4AFBA 2PMWB 4YW3A 4XHXA 3ZXAC 1U97A 4PDWA 1ULEA 2VPVA 1E5IA 2P4VA 3PIGA 3KSCA 3DXRB 3WB1A 5L3FA 1BK1A 2YIBA 5CG9A 1QDOA 1ZBE2 1QJY1 2QQOA 5JI9A 3RZKA 5C5UA 1I94B 4L87A 2UXBO 4LO6B 2HR3A 4FFKA 1O5UA 4JI2O 1CZVA 2ZQMA 1ZA7A 3E1F1 4BQWA 3JD0A 1V70A 2WSVA 4HSJA 3PUAA 4YGCA 4URAA 3CC4V 3HN3A 4CSWA 5J3UA 4BQ1A 5EP9A 3UO3A 2Z79A 1RUJ1 1A78A 1VAMA 3VBRC 2OCCB 4LUMA 1RB8G 1RUJ2 1OQDA 5BYNA 1AROP 1S0CA 4FT8A 1POV3 1RP3B 4OQ8A 3WQ7A 4ZIBA 5CZKA 3VBUC 1JU3A 3I2IA 4OX9B 3WNLA 2R1BA 3OGCC 4CUGA 2IFWA 2GNBA 3BPSA 4D6RA 1EBOA 1Q8QA 3N7LA 4J80A 4UBGA 4PA7A 4EZHA 1RM1B 3HKBA 5IWFA 2VBBA 1PIV1 3VDDA 3HNBM 3MICA 3VD7A 4RS5B 1R1ZA 4XIOA 4K8FA 1PIV2 4DV6B 5GZGA 3H1YA 2ATFA 3TK1A 3SYCA 4CCOA 3M3QA 1UXXX 3SJQC 3CCVV 5KHGA 4A7ZA 1EM1A 5L9RA 1M4WA 4LFBB 1LGCA 5L3CA 4FFHA 2A73B 1J3QA 3K3OA 2ZMKA 2WLKA 1P7GA 5C5TA 5C3SA 4DO0A 1S2BA 4DMIA 4AHWA 4H44B 4MV2A 4CDXA 1UWWA 1QGLA 2VZVA 4XJ8A 2IXHA 4DV3B 4O4JA 1DF0A 2J42A 2PHDA 2HP8A 2WLLB 1L7LA 3VLBB 3SLIA 1GMMA 1UYXA 4QX8A 4ATFA 4PV1B 1PZ9A 2QE3A 1SQFA 3BTXA 2X10A 4TQFA 4AQ2A 5L7OB 1UIJA 5FYZA 3RYHB 4AI9A 1QU7A 2ILMA 1C3HA 4JAUA 4FAGA 1ZZ6A 1YVWA 4B1LA 1LGNA 2DFBA 3OSDA 4O4LB 5IWAB 4LNUB 3ROUA 5H9PA 5FP4A 4BMEA 5D1IA 1FYJA 4QX5A 1H1IA 4R4ZA 2B1IA 2Y6FA 5BNPC 1RPOA 1CX1A 3I59A 3ZYIB 2YROA 3LA3A 4FJCC 2A71A 1WA4A 3QG5A 4Y5Z0 1NKDA 3BHPA 2CGNA 1KDKA 5HCFA 4PI2A 3Q8CA 3V0AB 3A23A 2AGAA 2XAFA 4QNHB 3ECQA 4EFEA 4MHRA 3ZFGA 2EULA 1J1LA 2HBTA 2B45X 2Q8DA 4ZS2A 3LWCA 4XJWA 3U4XA 1LESA 5GZFA 4TQDA 1QU0A 1H2LA 5LCWL 2VVFA 1VMGA 5L19A 2XOKG 3A21A 5ISLA 2Y60A 1OOPB 3ZR6A 5ANQA 1H6XA 1U5ZA 1GM9A 3GALA 3UK9A 1H9WA 5A33B 5JZGB 3JBG1 4JTOA 3O1VA 4XW3A 1YO8A 4JCKA 3IMNA 5FV3A 2EXIA 3NAPC 3JBG2 3JQWA 1DGRN 4TUYA 4LO7A 2BOCC 4AEKA 4W4LA 5DUUA 3K2OA 3IAYA 3A22A 1OCCC 1I94O 2JK5C 2BFUL 2WSSG 5IE9A 1F4AA 3R0RA 4AR2A 2OIEA 4WFBV 1K73W 1WJZA 2A7WA 2GNTA 5FZKA 2F4VB 4R8HA 3V65A 4LKEA 2ZACA 1MEC1 1PMJX 1SBEA 4O9EA 4JZGA 5LA1A 1B3QA 1TA8A 3S7EA 1MEC2 2PI4A 4MVZA 4H7MA 3I3DA 2BBVA 4YJ3B 2YGMA 1UCXA 1J84A 5JSOA 5A7PA 1LHWA 2LP7A 2SLIA 4IEXA 1NE6A 5ITZA 2F66C 3FHAA 2GTAA 4OX9O 2HWD3 4MGIE 4Q4V1 5E79Z 3OD0A 4N90A 4K7JA 1ZVFA 4Q4V2 4AAXA 3J7LA 4HONA 1QOOA 3ZRXA 4RA0A 4DV6O 2JG9A 4N8MA 4M3CE 2IW5A 4LKSA 4IGGA 2DURA 2OT5A 4FTBA 1JFFA 1BHBA 3J81N 3CCQV 5GLVA 1XOYA 3OGJA 3CCMV 5FBZA 4FP2A 4B4PA 5L73A 2Y0IA 5B2GB 5JH7A 4GX0A 2W39A 1S0VA 4TWKA 1SF9A 1OFSA 1VMFA 2WO1A 5DDJ3 2DYRB 5ANNA 1UU6A 1W0KG 3O1TA 1SC5B 1BBT3 1M9NA 2F4LA 4CDWB 3NNGA 2Q6AA 2O1QA 1R3LC 5C3QA 1UFIA 1ENRA 4QXHA 4XXPA 4HN0A 2PFWA 1DLCA 2XHBA 4FPEA 2YUAA 4WV8A 4UVAA 4FLTA 3USUB 1QEXA 2ARHA 3E22B 3GVMA 1R73A 5F3GA 2HLDG 5IWAO 3CF6E 3B8NA 2A06H 4QQHA 4OHYA 3B93A 4IEUA 3WXPA 3I5DA 3QO7A 3MIFA 1KKCA 5KXEA 4NR1A 3PIJA 2QSAA 2P3IA 3L73H 3CJIB 1SQVH 4ZOLB 4H2AA 1KYOF 3AYAA 1KP3A 5I0UA 4BU2A 2PYJA 4XFIA 2R9RB 2WKKA 5B66Z 5FZ9A 3KCXA 4I0XA 4R7CA 5H9SA 3AMHA 4UWDA 4BPZA 1W9SA 5EYXA 5FMBA 3TAYA 4DW0A 4LBEC 3JD71 3E2EA 3LEMA 3WG7B 3JD72 3EHBB 2O8QA 3VBSC 4YW6A 2EIDA 1X4TA 4A41A 1CWPA 3AG7A 1FPN3 1QNYA 1CIWA 1RUOA 4CDUB 1QLEB 4Q0SA 1J83A 4JI1O 5C7GA 2Y34A 4TTGA 4NXNB 2ZMNA 4B4RA 1SA0B 1SQGA 2FKXA 5F6LB 3K77A 3CL1A 3ZSEA 4Z1MG 2Z2SB 4A44A 4JTNA 2H0BA 4PDWC 3EXUA 3K57A 3JCZA 4A6SA 3L72H 3QTCA 4UW6A 1IBMB 3MAQA 1VBC1 2LFRA 3OE7G 1UZ0A 4B3TB 4ZZ5A 1WA8B 1VBC2 3HR9A 1K33A 1GK9A 1IBKB 3DTUB 3LD8A 2JIJA 3GB7C 2B9ZA 4DXZA 2IUWA 1RUI3 3K03A 2HVKC 2IXKA 3DPRA 4RSUA 3BOPA 1B35C 1W28A 3MEPA 1F9KA 3PVOA 3IDBB 5JQGA 2LFSA 4ABMA 4E2GA 2JDYA 1OD5A 3GXUA 2OIIA 1O91A 2WJSA 2Y26A 4O7XA 1H8VA 4ZU4A 4DV7O 3U37A 4GB31 3ZMNA 5FLJA 5IJ0B 3CIHA 3IZOA 5A3TA 2DV9A 4GB32 2ENRA 2P90A 4AW7A 4HVOA 1AR73 2D5FA 2V7QG 1GYKA 2OT7A 5JXHA 3VD9A 3I56V 5FUIA 2VMHA 4G27B 3N2KA 2OUJA 4NE9A 4YW2A 3T4VA 5JAXA 1PP9H 2EX3A 3VKMA 2HKXA 4XDLA 5FYBA 4K9SA 3H8RA 3QO8A 2XPJA 3G6JB 5FOJB 2AHYA 1AR91 1V6NA 1EPWA 1LHUA 2EILB 4LOSA 4TLGA 1N3QA 1AR92 4JC1A 4XPVA 4X65B 2D43A 1ENXA 2WNUC 1NCRA 4JI4O 1ZUQA 2WABA 4DUYB 4N53C 4DV1O 1Q56A 5DUWA 4DR6B 2BWAA 1DQ4A 4PIYA 3ZPYA 1NAEA 1W8UA 4CCLA 3T3YA 4GLXA 1C8NA 1Z78A 1G4YB 4O2AA 1NZCA 4GKYA 5T50A 4FLWA 5HI0A 1W8NA 5F8PA 1UNBA 4IDZA 2WC2A 2DBNA 5BY1A 1AX0A 1NH2D 4CEWC 5JIAA 1OSGA 1QJU3 1ZRDA 1W6OB 5HXVA 3VL8A 4GX1A 1WCQA 4NRQA 3GNEA 4FPCA 4AYUA 3G71V 1GH6A 2V1DA 1GBGA 2BVBA 2CTPA 3APOA 2C5DA 3FFZA 4PBOA 1LEMA 4ASLA 5A7OA 1W8FA 4IV3A 2ET1A 2ZS6B 3RNSA 2FDJA 2HJFC 3AP4A 3G6BA 4XQDA 5LWBA 4XFBA 2B39A 3I3BA 3JAKB 2LROA 4NPLA 2CTWA 1BLZA 1OCOB 4YM2A 4X1YA 4EN9B 2UXXA 2VQEB 2BRTA 1VQNV 4IEVA 2H8PC 4UW5A 4QPIB 2WINB 4MXVA 1NI8A 3JASA 4OHXA 5CA1A 4XCBA 4AVCA 1QNMA 4F83A 1NA1B 3BTAA 4LR3A 3P3PA 4ZHNA 2YC4A 3OPTA 1ZL8A 4WM8A 1I5PA 1VQ5V 3SKJE 5LXTB 5JJNB 3CJHB 2Q73A 1Q81W 2OW4A 1JZ5A 1N1VA 2JXAA 1DK1A 4NXNO 1HNXO 2ZX3A 1LOFC 3WINE 4UCOA 2Q4SA 2BP6A 4GMP3 4OXSA 3SCHA 5A3WA 3Q8BA 4XDJA 1PPJH 1S0IA 3CJXA 1I6XA 3T0AA 1IBMO 3B09A 3CKHA 1ZM1A 2QWPB 3DXRA 5H6QA 2X29A 5JIUA 4L9BA 2DYSB 4XTPA 1QQP3 4Q6GA 4YIPA 1ZWIC 4B1MA 3K4DA 3CX5F 1XMQB 4GJZA 3OD4A 3DGTA 3B5LB 1N33B 4Y26A 2ZGMA 2XAHA 1Y9MA 1QXPA 1YJNV 1X50A 1GWMA 1XYNA 1QLNA 3D82A 1STMA 3S57A 4B3NA 1K4DC 5B1OA 5L3BA 1LTEA 2N7GA 4XF1A 5LHGA 1KGYA 1N3PA 5LY2A 1IGOA 2AW9A 1AR61 1AI6A 3URFA 1AR62 2R063 1PNGA 4KH9A 2NQYA 3PTYA 5A7QA 4AFCA 5ACA3 3VQWA 3LFIA 1GRJA 3S6PA 4YSFA 4X1KB 1W59A 2JG9C 1QH7A 1XQNA 1PMHX 3C3SA 4Z2WA 2QKAA 1W8OA 4HMZA 2EZPA 3OB8A 3J26N 1U0AA 1J59A 2WLNA 5CFDA 1IS3A 1Q8VA 4WBNB 4DUYO 3NKTA 1AXYA 1T6BX 4JI0B 2Y6KA 5JVVA 1B09A 2L6LA 4DR6O 1V6LA 3K51A 4C1WA 4QQ2A 4YZ2A 1Q5OA 1VBD3 2OWOA 4MUVA 3VBHB 2RS33 2XJVA 2HFEC 2Y48A 1UMZA 4PA3A 4CC5A 3AG3C 2ADEA 4LA2A 4ES9A 2VCBA 1ASJ1 3STLC 1KITA 4KQ7A 1ASJ2 5BNOB 2QR4A 3IJ4A 1HQWA 3BIEA 4IW3A 1DGRA 3VN4A 4M4RA 1AYM3 4YG3A 3HBZA 3ASOB 5FY9A 2Z5UA 5IY5C 3KCCA 4X64B 4LPLA 5L7OA 2UWBA 4CP2A 3OMAB 1V54B 2QQKA 5CNAA 2WLHA 1JN2P 2TUNA 4LF9O 4H33A 1FD9A 2ZXWB 1UOBA 2J1UA 4O4LA 2BNOA 2YHJA 4LNUA 1SRYA 1V6OA 2BTVC 5D21A 3IN9A 1H2MA 3N9LA 2DVAA 1IXMA 5CFCB 3IDEA 3T30A 2VQEO 3JALB 3OBTA 2GSYA 1HXS3 3WP3A 2V72A 5IJ9B 1LGBA 1QJX3 1ZTEA 4NTWA 3CBNA 2HWF2 2VBDA 1T2XA 1TMF1 3JD3A 1H2KA 4H0LB 1YSCA 2VM9A 4M00A 1OA3A 1TMF2 2PAMA 4BA6A 1X8EA 1JZ6A 4W50A 1PGW2 3ZFFB 1F51A 1MQTB 1OOPA 3C8XA 4QDQA 3GZTB 4JI5B 1XNTA 2RJLA 2SBAA 4YYOA 5A33A 1W39A 3W9AA 4FXGB 3MIBA 3VBFB 3N7MA 5D5PA 2Y33A 3LQCA 3AKRA 2Y4TA 4EN7B 4C1XA 4JZRA 1YWKA 3FL7A 5FZIA 2Y6GA 1QVFU 1SLAA 3CQOA 3JU9A 2B8MA 5A3UA 4BQ5A 2IJKA 5J7MA 3LNNA 2JDNA 2FCTA 3POJA 4A2UA 4HKOA 2GC2A 2ZABA 1JZ4A 4MADA 3PL0A 1VQ8V 4YJ3A 4OYUA 3SISA 1O6UA 4E4DX 3DPRC 4NHXA 3BU7A 2PGGA 3SKVA 2EIMB 5A70A 2Z3YA 5CA0A 2WNVB 5LASA 3VL9A 4A7KA 4UFZA 4P08A 1OCRC 4JYCA 3WNOA 4ZONA 4XUNA 4JI3O 5BY5A 2W1QA 3U14A 5H9QA 1IG0A 2A1XA 1FV2A 2DVFA 3SR2C 1PZ7A 1NT0A 1HDKA 3AG1C 2PAEA 2E31A 3LA7A 5IVYA 3AYCA 3DXUA 4NRPA 4WM7B 1NU1H 2FQPA 2EBOA 1I5XA 4UF0B 2EA7A 4MLOA 4UI9L 2VU9A 3ABKC 3KV4A 1IURA 1VR3A 3NNMA 3DCQA 3RZGA 3SPCA 2NR5A 3CRAA 3HR0A 4ICGA 2VOVA 3S5QA 4E4HA 3K0GA 5FKCA 2XUEA 3SJBC 1NCRC 1Y4WA 1OZ0A 3ZRWB 4LF6B 4P9XA 2VXJA 1MS9A 3APQA 5KUKA 2ZTNA 5E16A 4LJHA 2H6CA 1W04A 5KAIZ 1AI5A 2WLPA 1WBLA 5GALA 3NW4A 2J1AA 2BNNA 4OUMA 1Q3EA 4FPFA 3ZIAG 4X64O 4NVPA 1GFF2 3NO8A 3T4DA 5FYMA 1I08A 2WYFA 4AL9A 1QQCA 3E22A 4JQTA 4G28B 2YPJA 3MDSA 1VB2A 2FMYA 3FE5A 3QLQA 4D7YA 1UL9A 1C4RA 1W8TA 1PM9A 2YU1A 5DZGA 3JATB 4I55B 1PNKA 1F5FA 1POQA 2G19A 4B3MB 1JX9A 1TZOA 4WFEA 2K46A 1O4TA 5LBEA 4GYCB 2UUAB 1RFYA 3CJIA 4Q5OA 4ZOLA 2DOSA 5FMOS 3ETGA 3ACIA 3C90A 4AG4A 5FPOA 4I9QA 1LENA 1W8HA 3SPJA 2E7TA 1LOGA 5LP6C 5F5IA 2BWCA 2FBEA 2E33A 2CL2A 3UKNA 2QFEA 3FLRA 1VQKV 5IYZA 3ALQA 1W0PA 2R70A 4YZ5A 1HB3A 1OH3A 4EEQA 1Q43A 1FAYA 3PVEA 1NCQA 3IMMA 2VOWA 1RUH3 3QH7A 3NQHA 3ZOIA 1QHTA 5FIXA 4ZZ8A 4BM8A 2ARXA 2VMCA 5D8AB 2J1EA 3LE0A 2A3YA 3CCSV 4CDUA 2RG4A 4XDPA 2JIGA 3OEHG 1NH2B 2RM21 2WDBA 3T0BA 1Y67A 4CCJA 5B5EZ 1K5MC 1SA0A 2RM22 1YFUA 5A80A 4XABA 4P00B 1GN6A 4JI7O 3VBUB 1F23A 1Y3TA 5FYTA 1K9MW 2W1UA 5B1NA 5FO9B 4RUFA 3ZMSA 1YXWA 2WWUA 1VBB1 1XEQA 1DHKB 1VBB2 1Z7S1 2J1RA 2VCMA 3OEBA 1K12A 1MACA 2G9FA 5FY8A 3AZXA 1Q8OA 3JB8A 5LYJB 1Z7S2 3A7QA 4BK4A 2YC0A 2WLIB 3ZS8C 4LHKA 5KUMA 3BA8A 1JMUB 1MOFA 3M7AA 4NIGA 4X1IB 3HEIA 1HIXA 4KXRA 4FXKB 2YXHA 4ZHQB 3WDUA 3HJRA 2GNMA 4NHMA 2WS93 3VHOA 5DUVA 4DFSA 1XXNA 5LEJA 1AJOA 3HWJA 5BXXA 3GJAA 4FPYA 3I8TA 4OHZA 3U10A 4LMFA 1ZBA1 3Q4HB 3BABA 2OCCC 3I2GA 3WY6A 4Q0UA 5AC93 1U5XA 1KMIZ 1AI7A 1ZBA2 3GHMA 1UMHA 5IJ0A 4JZ2A 3VHNA 4LIVA 5FZLA 4Q0PA 1Q6HA 4QIWF 1CN1A 2RS11 3APBA 3RYRA 4ONUA 1XPWA 2JB4A 1RUE1 4KP4A 5DUXA 5L3GA 1RM1C 4L2NA 2RS12 2JKXA 2XOMA 1RUE2 4RS5C 1IPKA 1LAJA 5K8SA 4LITA 4XJZA 2XXZA 4IE7A 5EBLC 3PVNA 1ND2C 2OPWA 4CXXA 1XYOA 1S0GA 2OX0A 4O2BB 3H1MA 3UCSC 3AJYA 3PMSA 5EBWC 1VQPV 1H1AA 5BNPB 3FAVA 4AVVA 5E89A 3FWEA 5CEHA 1YEWA 5C33A 2A6XA 5LMNB 1LHNA 1S5HC 4IE6A 3VZKA 1B6QA 1HRI3 1R1A1 3U75A 4MZUA 4X66O 3THCA 1LOEA 3H1LH 2WLMA 3KT7A 2QTSA 3M7MX 4CCEA 4QHZA 2FCUA 4BZ4A 1W9TA 2W1SA 1YHQV 4P14A 3VB9A 4RFT0 1HWYA 3MZHA 3JARA 5KA5A 1KDMA 1SDWA 5IVBA 5L7OC 1ZZBA 5GLWA 5JXGA 2WPDG 1Z5VA 1OPOA 1CXZB 2E32A 1VALA 3DYMA 4O9GA 1AXKA 1ZNPA 4B3MO 4BH9A 2VOTA 5FYUA 1CQ9A 1PMIA 3CHXA 1NLRA 3GCXA 4IEQA 2DYCA 3NAPB 4JHZA 3QD6A 2RS51 4UBHA 2WYSA 3LB9A 2Q30A 4Z07A 5GLZA 4R9DA 3KGLA 1DYKA 4JGSA 2RS52 2YDEA 3WHTA 3R6SA 1XILA 2UWAA 1C5IA 4RYDA 4META 4X8AA 4G2KA 5JCOC 1TME1 1Q6IA 3I7DA 4PA9A 2E3CA 3JAKA 3KKYA 1WZXA 4A3ZA 2XJQA 1OD3A 1TME2 3PJYA 2ZMLA 3T4HB 4EWEA 1WCSA 4QPIA 2DVGA 2XJSA 4NMIA 2C6SA 2FB5A 3VZNA 5FPZA 4IEOA 4XIKA 3FHIB 1WMEA 3NMBA 1JYXA 2ZA9A 1JYTA 5HV4A 3BB6A 4LF5O 3MLJA 1XREA 4EE2A 4ZU7A 1OOPC 1Q86W 1Z2GA 1MG1A 3LFMA 3IPVB 1VQMV 1LJ7A 4IV1A 4CA9A 1KU9A 1Y4MA 4Q8KA 4CXWA 1BJQA 1OLMA 4AOCA 5JCTA 1KFXL 2QQJA 1OFNA 5JZGC 1B04A 2X5IB 3AL6A 1H8TB 2W47A 3ZM8A 5BNQA 1YJWV 1D4VB 2NMOA 2YEVA 2ZNJA 1S72V 2VZPA 4R6ZA 1BXHA 4I4TB 1FXZA 2NP0A 3ZDSA 1YQ2A 3A0KA 3HQXA 3OW2U 3H3ZA 4Y22A 1AL21 1FXKC 3M4FA 4Q4W1 5G04L 1XL6A 4P9LA 1AL22 2QJVA 1RGSA 3JAWB 1WMDA 2KD7A 4Q4W2 1ONAA 4QX3A 5BXZA 2R0HA 5FZ6A 1GANA 3D0JA 1WPBA 3D0SA 3O0XA 3THPA 3NV3A 3E8FA 1FJGB 4E2LA 1B06A 2NZ9A 2FTKA 4DR5O 2J22A 1KQSU 4MGZE 3K9AA 5DAPA 1C57A 1YYNA 3TEXA 3J8F1 2VJXA 3WQBA 4JHTA 4NWVA 3AVSA 5DZFA 5FLHA 4QM8A 3J8F2 5LY1A 4FLXA 2QTWB 5FNVB 2YBKA 5I8YA 4LHNA 1W6PB 1C1LA 1ULDA 3KVAA 3OR6C 3THOA 4NIDA 4WZFA 4P9IA 1BK0A 1IX9A 2C4XA 1E79G 3PU8A 4BISA 2BUKA 2QVSB 2WR9A 3ZSJA 4E2SA 5CBLA 4YM1A 1RMU1 3ZMTA 5L9BA 4BE3A 5T5LA 2P2KA 5EXOA 1SQ4A 2WNEA 4W6XA 4OZXA 1RMU2 4D7SA 5JLVA 4YW5A 3GCWA 1UPSA 3N7JA 2ODMA 3ZMUA 5C70A 4Q4Y1 3NXSA 3OAAG 3K75B 3KV9A 4KUMA 2DTYA 1MA1A 4TYSA 4WBNA 1JYNA 1GZCA 4Q4Y2 2KM2A 2JS5A 2PA7A 3GM8A 3NV2A 4ZKTB 5LMNO 1F7YA 2JE8A 4M0NA 4YGDA 2A7AA 3VBHA 4N23A 2DYRC 2CTVA 1N4CA 2WN3A 4CVUA 1RHI3 1EFRG 1HQNA 4B29A 4DNYA 4LBJA 1IBLB 2EIEA 1BVP1 3E97A 3WLUA 1POV1 3U0ZA 4CDWC 1BQPA 4P9JA 3ETQA 5BNOA 2VR4A 2OTLV 5APAA 1SEFA 1JTZX 2RVAA 2ARAA 4FFIA 2JDIG 4IEWA 2UXCB 1XRUA 2W08A 1BKZA 4Q0VA 4HETA 3QOPA 3S5AA 4JI6O 5LA9A 3JSNA 1H4GA 4QPWA 1SLTA 3VBSB 3I2DA 1TUEB 4BIFA 1NXD1 3WZ1A 4AWDA 2W6JG 2VNOA 3CPWU 5F7UA 4XQ4A 3H8XA 2WO3A 3KB5A 1GOHA 2JICA 1NZIA 3LA2A 1I5ZA 2D3RA 2QQNA 1VMHA 3S3XA 1J5EB 3SYOA 4PLOA 1IHMA 5HBAA 4MVTA 4AAPA 2R30A 1GKFA 2HVJC 5CFCA 3CJIC 3JALA 1MS3A 1W8WA 2XJUA 4RGKA 4CH3A 2IWGB 4MGYE 4X6RB 4YHHB 3P32A 2PYTA 2XT9A 5IJ9A 3IAPA 2W0FC 4TSFG 1DP0A 3T08A 3LDKA 4CH6A 2JKBA 2XL9A 1N0NA 4CUCA 2E9QA 3USSA 4EROA 1AJPA 2QQPA 4V2VA 4UFHA 2JGDB 2ATKC 4U3FH 1G7YA 2D40A 4OI1A 1YLLA 2DQ3A 1MQTA 4I0WB 2AXTZ 3DYPA 4CDUC 5EZYB 3W5NA 3WCRA 1UX7A 3RT3C 1PGL2 4NIHA 2AGSA 4BWOA 1COV3 3WB2A 4C7UA 3VBFA 2WZR1 5IVFA 4Q1PA 1UY4A 4P02B 1A6CA 2VGDA 1ZX5A 5IDJA 5DECA 4XZUG 4MGTA 1K7DA 4WZCA 2W87A 2K9PA 1CX4A 2YG0A 4KWUA 3WW3A 2CAZC 3TBDA 3ZSMA 1FJGO 3D36C 1J1TA 1EYBA 2LGQA 3TXQA 5FY0A 3NL1A 5LHHA 5B1AB 4DYLA 2CE4A 4MXWA 1KD7A 3O1UA 1RSOB 1DF4A 1C28A 3B00A 2WNUB 2P7TC 3WG3A 4N53B 3RQ0A 1VQOV 2WNVA 3TNQA 3ZN1A 2ZNIA 4DY5A 3LDBA 3NKGA 1RINA 4R4XA 2GH2A 5FP9A 5KMGA 2VW0A 5HPOA 2VMIA 1PX3A 5FKBA 4BQ3A 2FZ2A 2ZBJA 3WDXA 2PHTA 2ZZJA 2WZEA 1JQ0A 3WW4A 4WM7A 2NYYA 4Y5SA 1W9FA 4UF0A 3RI8A 1DGWX 2BBAA 4MGQA 2Q7HA 1JI6A 1QJY3 1AJKA 3TRSB 4BB3A 3HQRA 3AEIA 3B7MA 3CS5A 2EILC 4V1PA 4OPHA 5SV8A 1NUKA 4FMTA 1CD3G 5C8CB 4HOOA 5FXVA 5EIYB 1IBLO 4TV9A 3POBA 3SHRA 5FPVA 3ZRWA 2BNMA 1XSRA 2UXDB 1UU4A 4IGOA 2C9AA 2JVDA 3JD4A 5F6KA 5JPNB 1CJPA 4MH0E 1RUJ3 2MK3A 3TETA 4FOYA 1V0AA 3OGGA 1SLLA 2ZKNA 2YXSA 1FX5A 3TN91 1SFYA 1VE0A 5T55A 4JASA 1KQRA 1RUNA 3T1MA 2ZGUA 3TN92 4KG8A 1XI1A 1U12A 5FZ8A 2DVDA 1CIYA 3CEIA 4AK3A 1PIV3 1O3RA 3ZMOA 1J5EO 2EIGA 2P6JA 4ZY9A 3N3HA 4YRDA 3ETDA 3JATA 3SYAA 4JRLA 5A6ZA 4Y5TA 1DQ5A 4YHHO 4RO2A 2VQFB 4K8XA 2GC1A 2Y0PA 3DC5A 3INAA 4DINB 4RQPB 5EPAA 1QJFA 4B3RB 3AMMA 4J7JA 4M3CB 1F15A 5KC5A 4QPIC 3OTOB 3C2UA 1EZVH 1A32A 1N32B 1HNWB 2DE0X 1O5LA 3MI8A 4IIJB 3HNMA 1NA1C 4PDLA 4W4ZA 3ME2A 1W2NA 2VZRA 3WD5A 2A3XA 5FO7B 3BEHA 4F6RB 3TXSA 3RYCB 3OYWB 1LNQA 3ZXKA 4DZGA 2RJKA 3BA9A 1NE4A 1WLDA 3HQUA 3GBFA 5J96B 2OTJV 2UWCA 3AYDA 2JDMA 5F5QA 3KMHA 5LK5A 2R6QA 2X05A 3VBUA 4HPKA 1KXGA 2LM3A 5LW9A 2HEVF 3ZHTA 3MF9A 5T5OA 2ID4A 5DABA 4UXAA 2QWRB 4Q4X1 2Z0AA 3VKOA 4FLVA 4Q4X2 1VPHA 4KL1A 3SCFA 1POV0 2XHKA 3SEEA 2F95B 2R49A 2FZ1A 3MHHC 4TSVA 4WCEV 1D7PM 1W9WA 4X1IA 2WWJA 3E5XA 4KI5M 3A0BZ 4I0BA 4JTCB 4LK6A 2ZD9A 2VZQA 4Y1YA 2ZGOA 2V4AA 1W0OA 2OS2A 1SZTA 3MV11 1AF9A 2G9ZA 3AP9A 2ETNA 2A5ZA 4DUVA 3UGGA 1OVSA 1H38A 3MHZA 2ZX4A 1GR3A 4Y1ZA 5JMOA 2YIBD 4A4AA 2ARBA 1C5HA 3LPGA 1OURA 4YFZA 5A1AA 1FOD1 1XB9A 3QACA 1VIBA 5IY5B 5KX5A 3H7JA 5JXJA 4AI8A 1FOD2 3HAGA 4QJFB 4YVSB 5F3EA 2X6AA 4LEJA 2ZHMA 3AM2A 2E63A 1JOPA 1R081 4HVRA 4XAEA 2QWOB 1MEC3 3WQ1A 4DV5B 2DWRA 3DXTA 3R65A 4OVEA 5F3CA 2JX9A 5BNPA 1R6KA 3VBHC 3ZDVA 1F4HA 1CAWB 2XL7A 1MZ6A 2ZGRA 3AZVA 4RFRB 4U3JA 1W06A 1S0EA 5CBHA 3J7NA 5FPLA 2XLFA 4PLNA 4Q4V3 1XHZA 3RWNA 2GN7A 3ASOC 3H01A 1E5RA 3DKWA 3ZJZA 3P6BA 2VOXA 4UVCA 4JYAB 3K06A 4X9QA 4I02A 4LF7O 1WAZA 5FJHA 2E7AA 5AFEA 1V54C 4IETA 4FAHA 2Y4UA 1LOCA 4P9GA 2IVJA 2OZJA 1RVF1 4BR6A 4L99A 1GP6A 1LB2A 4DR4B 2Y38A 4RR3C 2D97A 1RVF2 1L0NH 1MS0A 1ROPA 3RYFB 3UNPA 2WRAA 3NAPA 1HRV1 4XUOA 3WG2A 4FFFA 2JJ6A 5GW7A 1G86A 1HRV2 4B3RO 1BQZA 2KSDA 2IXCA 3OTOO 3W21A 1XE7A 1HB1A 5EYPB 3PN1A 5J98B 4OI2A 3M1HA 2UYAA 1QR8A 4ET7A 5FZOB 3WUDA 3OMIB 4M0HA 4KBZA 1TG7A 5CA6A 3X2QB 2VZ1A 1OF3A 4J6GA 3BTZA 2Y8KA 3M3CA 4V2WA 1YIJV 2MW2B 4DR7B 5J09A 2GV9A 2AZ2A 1QKQA 3OPWA 1C1FA 3ZFFC 1XNAA 5EIBC 5GZCA 4MTFA 2X6CA 3SQOA 3RYIA 4B7KA 4XXAA 3HBKA 4IXLA 2WN2A 1C8M1 3B9CA 4FLYA 2QA4V 1UZVA 1BT8A 1C8M2 2X5IA 2PHRA 3ETEA 1LCLA 1H8TA 4AEDB 4UB6Z 4UFLA 4NAOA 1UPGA 1LU2A 4XF9A 1GWLA 4CP0A 1URXA 4I4TA 2QQIA 3HKEB 4HBNA 2WAAA 3SYQA 1NLQA 5FZ1A 4NTXA 3C7GA 5FL7G 3A4UA 4AI1A 4DRVA 3JAWA 4LA3A 2H94A 4J7ZA 2Q5TA 1GNZA 3ZVXA 2RNBA 2XMLA 3ASNB 4FPOB 3Q9OA 2W2IA 4FZ0A 1V9PA 3JD73 1WP7A 2A79B 4UOJA 2VWKA 1JMKC 2EIKC 2Q69A 1OQ1A 2KG7B 2HWC1 1PL4A 2GNDA 1JBCA 1XJAA 2P34A 2WNVC 2HWC2 5FZBA 4GMP1 3O12A 4LH6A 2K1EA 3CZJA 4COZA 1OQEA 3O7OA 5FNVA 2WAMA 4YARA 1BS3A 4ES8A 1W6PA 5JOXA 5A3NA 4FFBB 1FXHA 4M01A 2WA3A 2PY5A 1LOBA 2IBZH 4UYBA 1QY4A 1IG3A 2EJ7A 3BPZA 1QQP1 1N36B 4WM7C 2XHNA 2WNOA 1JYWA 1QQP2 4EQVA 5ERLA 3S7IA 5F5AA 1JH5A 1HLCA 2LRPA 1VBC3 3SEPA 4JDOA 2XVLA 4BQXA 1AR81 2CV6A 1VB4A 4GWJA 3S3WA 5LRSA 2HLEA 1AR82 2F6BA 4Z2AA 3WB0A 1JOJA 1RUD3 4XAAA 1K3IA 1NJIW 4XUPA 3H1IH 4LLOA 3AC0A 5D5QA 1R091 4XFFA 5IYBO 4ITCA 5JVDB 1R092 2QQWA 4AZZA 2EVXA 2VMGA 4HANA 3AL5A 4YZ3A 5CB4A 2G38A 1MZEA 1BHAA 4CRQA 3SJCC 3ZN0A 3W20A 4LE3A 1NG0A 5GTIZ 2QQMA 3AK3A 4JYAO 5B4NA 5LGTA 2AEZA 2IVIB 3K4AA 4GB33 2NPIA 4Q1RA 1KJRA 1PX4A 2LJ2A 2L9LA 4JKLA 3LCPA 1UOFA 1AYN1 3CSXA 3AG2C 1KECA 3V0BB 2JB8A 3VBSA 5A3PA 1AYN2 3RBZA 4TXWA 4JYYA 2JDKA 1VJ2A 3D8CA 1PNFA 4LC1A 1WD4A 4URTA 3THTA 2Y6JA 1K5MB 1AR93 2JG8B 4JI8B 1LULA 1YITV 1YIPA 2RS31 3HT2A 3HVDA 2QKSA 1K42A 1NKGA 2RS32 2PI5A 4R52A 3FD9A 1ZBE1 4SLIA 1OUSA 1Q82W 1K5JA 3N4MA 4BIZA 4AGGA 4W4KA 4CU9A 3KG2A 1LHVA 1UW8A 3TCUA 1OHFA 4I3GA 3POFA
chains in the Genus database with same CATH topology
1QXJA 1AYM1 3WP6A 3LZZA 3ILRA 2RE9A 3AKRA 3MDPA 1DU3D 2E53A 4IESA 2DUQA 1DZRA 1DGWA 1AYM2 1RUD1 2D98A 4EN7B 1HRI1 1YFXA 1GSLA 1XE8A 4C1XA 4IV1C 1T6GC 1LHOA 2XBO3 3VBRA 1YWKA 3SITA 1RUD2 4FFAA 2E51A 1HRI2 4H3WA 1SLAA 1MZFA 4AQTA 1R083 3FC0A 1B35A 1XNDA 2Z42A 1RC6A 3JU9A 3UL2A 1DRYA 2B8MA 4QPGA 5CAZA 5D8AC 4N43B 4F7ZA 5J7MA 2IC1A 1D4M1 1Y43B 2MEV1 5K0UB 1G9CA 1RUC3 5FAXA 1KRIA 4A2UA 4HKOA 1H4HA 2GC2A 3U11A 4M2IA 1OLRA 2ZABA 3POYA 1D4M2 2GU9A 1QJZA 2MEV2 2R16A 3ASIA 5KHHA 4EN8B 4LBLA 1BZWA 4YG6A 3SISA 1WW7A 2JD4A 2JE7A 2OZ6A 2WQ4A 3DPRC 3E6DA 4QM9A 2JG9B 4E4DX 2FHRA 3BU7A 1CESA 3RSJA 2PELA 2ZZQA 3M70A 4N9HA 4K3UA 1IPJA 2VUAA 3DV8A 1HXS1 5FQ0B 3ZXGA 2WNVB 3VL9A 4A7KA 3MPPG 3WDVA 1MS4A 2EXKA 3SH5A 3BCWA 1HXS2 4W6WA 3GZUC 2IFRA 1TNRA 4AI0A 1G9AA 1J3PA 1YFYA 2BGCA 5BY5A 4TZDA 4QT6A 5TSWA 2ET7A 1FYUA 5H9QA 4QXKA 4KNCA 2VG9A 4LR4A 1XYPA 1FV2A 3VDDC 2DVFA 1WMFA 4GQ7A 1J58A 1PZ7A 3WG4A 4COVA 4KU8A 1GY9A 1HDKA 3FFQA 2FMDA 3VKFC 2PAEA 2P3KA 2ZGKA 2YY1A 1IS6A 1CONA 3JCIA 4L11A 1D2SA 3LA7A 5J37A 3AYCA 4OUSA 2VQ0A 4WM7B 3ZSLA 1ND2B 4PF5A 2FQPA 4EN0A 1RVF3 2EA7A 4MLOA 2VU9A 1SBDA 2XJRA 2D6PA 3V15A 3EO6A 4JRAA 4AI2A 3AZZA 4YVWB 1H9PA 2WNUA 1RUF3 2I2SA 4XFHA 1VR3A 1HRV3 1Z0HA 1O4ZA 4N53A 4XMIA 3DL3A 3UJQA 4GWNA 4Y20B 2QDNA 3IDCB 4LBKA 2XJPA 5AFBA 3WP5A 2OVUA 2DF7A 2R041 1AHSA 2XUMA 2PN5A 4CZSA 2VOVA 4JAAA 2R042 4IERA 4CDXC 4LBOA 4YW1A 2WFF3 5FOBB 1XNKA 1TE1B 2CNAA 2CWSA 1NCRC 2QKDA 3IKWA 1IKPA 3SH3A 4AI3A 5A32A 1H30A 3GBWA 2XBO1 2O0OA 3KLSA 4P9XA 4GH4B 1I1EA 3K48A 1WLCA 1MS9A 2DVBA 1DGLA 2ZTNA 4OI0A 5E16A 4D69A 2XBO2 3KT4A 3NVCA 2H6CA 1DZTA 2EAAA 5AVPA 1Y0ZA 1G9FA 4P9WA 2WLPA 1YJKA 2WZPP 3WX5A 4CEWA 3N7MA 1G9DA 4FPJA 1WBLA 3LOIA 1R082 3KZ4C 3PMEA 3NW4A 5GALA 2BNNA 4XFGA 1X7NA 1RUC1 4J1WA 1PGSA 3PNAA 4OUMA 1Q3EA 4FPFA 2GMMA 2D6KA 1I3HA 3B9IA 4OHWA 1Q8PA 1RUC2 5EYYA 3WDTA 1AX2A 4NVPA 4XETA 5KXDA 4NPRA 3WNXA 1GFF2 3R4DB 1MVQA 3NO8A 1Y9QA 2A6WA 2X8KA 3H1WA 4MSVA 3OJBA 1VBB3 4AQSA 5FLIA 1C8M3 1NYWA 2ZKLA 4CP1A 1WCDJ 1PK6B 1LECA 2YPJA 5BNOC 3M3OA 1VB2A 3R4SA 2FMYA 4FPGA 3FE5A 3QLQA 2E6VA 4D7YA 1UL9A 3IIAA 1OA2A 3QH6A 1V6MA 1C4RA 4LBMA 1RJ8A 1D0GA 5E1RA 5DZGA 5GM0A 1OA4A 1F5FA 3RYKA 4N7UA 5JPMB 1BMV1 2A6YA 2V5YA 4QGMA 3TOJA 2XB6C 1O4TA 1YNAA 1EV11 1BMV2 2DFCA 1VBE1 1VP6A 3GF6A 3AMQA 1W2UA 1PM7A 4C0BA 1DQ0A 2R071 3CJIA 4LUKA 1EV12