4BIOA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4bioA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bioA01
1IZ3A 1H2LA 2CGOA 3D8CA 4Z2WA 2XUMA 4B7EA 1H2NA 1H2KA 2WA4A 3KCXA 3P3PA 1H2MA 2ILMA 5JWPA 3OD4A 3KCYA 4BIOA 4NR1A 1YCIA 3P3NA 2CGNA 2WA3A 2W0XA 4Z1VA 1MZEA 2Y0IA 2YDEA 4AI8A 4B7KA 1MZFA 4QU2A 4JAAA 2YC0A
chains in the Genus database with same CATH superfamily
4MO3M 4O4IB 1TG7A 3TBDA 2VNGA 1K8AW 1UPSA 1A6CA 4IGOA 1GBGA 3K0DA 2BRTA 1VQ6V 1NXD1 4PCRA 2UY8A 4XZPA 5GZFA 3LNMB 3J4UH 4GWIA 1AR63 2Z5WA 1SDWA 5IYDO 5JZGA 2PXJA 1JZ7A 4I0XB 3JD73 5FMOL 1B6QA 4OZXA 4LUKA 2VQEB 1VMFA 1M56C 3CXCU 4HN0A 2ZDIC 3LDEA 4D6QA 2YROA 3GBFA 1W3XA 2W52A 3UJQA 4PI2A 3FB8C 2QA4V 3POEA 1S3JA 3WNXA 5HV4A 3QG5A 1PVXA 1JR9A 1MSWD 4TZDA 1O4TA 2QKCA 1J5EB 2W94A 1DF4A 4UAPA 3FL7A 1FYJA 3KWVA 3O1TA 5GALA 1YC61 4XBNA 5FBZA 2JDHA 3KZ4C 3UCSC 4AEDC 4DR4B 5LB6A 2HWB1 4FCAA 1XSQA 3ASNB 2VWJA 3I2IA 5JIUA 2IXKA 1XE8A 4TYSA 1VIWB 2OIIA 4LP8A 2XAQA 3WVJA 2JEMA 4R8HA 4XAAA 2X5IA 4WVWA 4XF3A 1W6MA 2ZX3A 1V6OA 2AH2A 1W59A 4CPBD 3VBUB 2DU0A 5CG9A 4JDOA 1UY0A 1HB3A 1GN4A 2A6ZA 4QHBA 2LJ2A 5FZ3A 3HKCB 5AFBA 1BHGA 3OYWA 1PVC3 4ET7A 1JFFB 3CC7V 5LWBA 1NVPD 3G6EV 4JI6B 4WFEA 1WUVA 2GMEA 5CBHA 1EN4A 5LRRA 2ZE6A 3BPZA 2R30A 3MIFA 4AQTA 4TQDA 1YQ5A 3AG1B 1R1A1 1QJEA 3U11A 1CXZB 4IV3A 4DUYO 3M2MA 3SXWA 3TK1A 4R50A 3KGLA 2VQFO 4IESA 2GNTA 3C7OA 4MGYE 3IFXA 1SLLA 3LSDA 5FMCA 4DY3A 1HB1A 3WNMA 2WNUC 5LOVB 4C8DA 3I2JA 2E7AA 1OSGA 1PP9H 1JYIA 5I8YA 3ZXLA 1STMA 3JAKB 3C7FA 1PMIA 1ASJ2 3GGLA 3IPVB 2ZXQA 1HB4A 4BR6A 3K08A 3IC7A 1F5JA 3D4KA 1DHKB 5K1PA 1GWKA 5IVCA 1RHI2 3J7HA 2HHHO 1V55B 3CCEV 3TEXA 5BNNC 2XL7A 4L0PA 2Q30A 4TSFG 1OVSA 4P9WA 5BZBA 1RVF2 5D8AC 3ETQA 3P1IA 5A3TA 2YIBD 2BTVC 4O4HA 1ULCA 1SDDB 2Y60A 2D44A 4Q0VA 4K9SA 2K46A 3C8XA 1S0BA 4UF0B 1Q8PA 5CISA 1B35A 2TNFA 4CRQA 4HSJA 3KT4A 1XNTA 1VBE3 2XDVA 1Q86W 2WLPA 4RN5A 2VZSA 1H2MA 4IEXA 3I55V 4TT3G 5IYZA 5F5IA 3QTCA 4O4JA 3FN9A 1SQXH 5A1AA 1HRV3 5H9CA 4RHV1 1NTMH 1AYN3 1OCCB 5LRSA 1RPOA 5FYIA 1NG0A 4XUNA 5CFDC 4IDZA 1RB8G 1KECA 3ZRVA 3JU9A 2IH1C 3BTXA 2QKAA 1I5PA 4HT1T 4LFAB 1QJY2 4PBOA 2EIKC 5FLIA 2A6XA 1CIYA 2A6YA 3QOPA 4XILA 3GB7C 4O4LB 4N43A 3AMMA 2VZQA 4PIXA 3LD8A 5LA9A 2YIDA 5LA6A 3LA2A 4QDSA 2W6IG 1DGWA 4FPLA 3WW4A 5DMYA 4LF4O 1VBC2 4OZOA 2B9UA 2UYBA 3VKNA 2JE8A 2BVVA 1WB7A 1UNBA 2A79B 5L9RA 3T4DA 1LECA 1W6PA 1GU3A 2O0OA 4XUQA 4PDVA 4LF7O 2ZEWA 4DV0B 3RWNA 3CPWU 4JTAB 5BNPC 4YZ2A 3RZHA 3SEPA 2PY5A 1UU6A 5IT6A 2QWNB 3AG3C 1LCLA 2LRPA 4NIAA 2XB6C 1EV11 4XXAA 4GKKO 3D36A 1Y74A 1W9FA 5FWJA 3OGRA 3FBYA 3ZXEA 1NKGA 5JPMB 4D8MA 2EBOA 3O12A 3SITA 2YIAA 4XMIA 2PTMA 2CTRA 3ABMB 2YB7A 3ZYIB 1SLTA 5KMGB 1G6NA 5DQ0A 5IVEA 1XNCA 3K75B 5TISZ 3CEIA 5FKCA 3SPIA 4CDXB 3CB2A 4RGAA 5LK7B 3ZSEA 1DQ0A 2EJRA 1GN3A 1QOTA 1VQPV 1H9PA 2ZA9A 3ZMVA 1HV1A 3CMEV 2ZX1A 1OQEA 2H6CA 1MVQA 1SQBH 5EJZB 1WA4A 2WLIA 4BMBA 5EWSA 2QDRA 3FHIB 2QE7G 4J10A 3Q8CA 4AHYA 3KZIZ 3SGIA 4HPKA 1ZRCA 3VQVA 3HPNA 1H1AA 5L3DA 2C6SA 3H3LA 4CP9A 3VBFB 2ZKOA 2NN4A 4WVVA 1DGLA 4RS5B 4FO9A 4HN1A 3MD0A 4IE6A 1VB4A 1KQSU 3H01A 1F51A 4MYEA 4COVA 4PDWA 3LEIA 2ZM6B 1NA1A 2LROA 3OOXA 2ZGQA 5F5AA 1I3HA 2W2IA 4DUVA 1XXNA 4BQWA 4B4QA 1ENXA 5EP9A 4W65A 1RUJ3 4Q8LA 5FLHA 4JRAA 1RSOB 3DYPA 4WF9V 3H1KH 2XH6A 2FDHA 1DQ1A 3B69A 5D21A 1KKDA 1OCCC 1C1LA 3K04A 3MIBA 2F43G 1WPBA 1O3QA 3L70H 5ERLA 4QPWA 4ZHNA 1E57A 4I55A 1CR7A 2WNEA 4LTAA 4BDVB 2XAGA 1FMD3 4Y24A 1QJX1 1BXHA 1HNWB 4LF5O 5C93A 1WD3A 3VQWA 1O3RA 2JG8C 2EIMB 2E9QA 3BI3A 2HP8A 3VDDA 5FYZA 2D6PA 2JDMA 2RR13 1G9CA 1O5UA 1YQ6A 1WW5A 3BGAA 4JHZA 4JI3B 3O0VA 4BW5A 1D7PM 4QKFA 3VL9A 4AOCA 4QXBA 5C9AB 5GONA 4LFBO 1LHWA 5FZ4A 4LF6O 4FLWA 1QJZA 1Q43A 4K1YA 5FMOS 2UU9O 4RFT0 3CRQA 4BLIA 1Y43B 3MYXA 2WZR1 1YFXA 2D6MA 2Y4TA 2W3JA 4CP1A 1F4HA 3J26N 3WF3A 1DYKA 3M7MX 5HFLA 1ALYA 3ZSKA 2YBSA 3SKVA 5I0RA 2DYCA 1FOD2 3VQXA 3PIJA 3CDZB 1PZ8A 3N3HA 4NUBA 3ABMC 1SA0A 2M6YA 3C3VA 1PNKA 3MBWA 4I3PA 4XFCA 2J42A 5IYCO 3FUOA 2EAKA 3V65A 3BOWA 3USUB 2EZOA 3EBRA 2DVFA 4Q4Y1 4UCOA 2ZHLA 1V54B 3KV4A 3B94A 5FYHA 1W6OA 3WV6A 1SBEA 4UVAA 1EAH1 3NNLA 3N36A 2KD7A 5L36A 1TME3 4PQ9A 1S0DA 3WUCA 1N3OA 4Z2WA 5LW9A 2UXCB 3WDVA 3A2FA 4PT6A 3EXAA 1FJGO 2HWE1 2I07B 5F3CA 4Z07A 5FZHA 2WFF3 5F3IA 1E5RA 5A33A 4BW9A 1LR1A 4MVQA 1X8MA 4FOQA 1M93A 2DU1A 1Z7S3 1H30A 3U0ZA 3NJVA 4QGNA 4LNVA 3VQYA 4UFLA 3B8NA 4FT8A 2QBXA 4DV1O 4OPHA 5C3RA 4BM8A 1QQP2 1AR93 3ZMZA 3BCWA 3EVKA 1DZTA 4PDMA 4P9XA 4I02A 1RIRA 3ZMTA 3AYEA 3ZIXA 4XUPA 4B3RO 4LF8B 4U7OA 4DR1O 2ZKLA 4I7ZB 2R062 3K9SA 1QHDA 1BT8A 3FB6C 3FAVA 1JUIA 3CJHA 4LKDA 5EV7A 1EPZA 3J8F2 1WCSA 2PLV3 2UWBA 3OUIA 3D3QA 1LGNA 1AYM2 4N9HA 3KCXA 2DVDA 5F5QA 4F3JA 4Y1ZA 1POQA 2DN9A 1DIWA 1QOSA 1WCKA 4H33A 3RYHA 2ET1A 1AUYA 1X8EA 1U5XA 4AEMA 2EIMC 3G6BA 5ITZA 4Y22B 3SLIA 1GV9A 2WQ4A 1K5QA 1UOJA 3LAGA 3KT1A 4EWAA 4G27B 4X6RB 2OTJV 1AL0G 4AVTA 2F4VB 4NRPA 3OTOB 5FYMA 3SJBC 4FIPC 4CS2A 4K6BA 4EE2A 3WDUA 5DN6G 1FKAO 2YZ4A 1YJLA 2PQSA 2QUOA 3AG2C 4DR6O 1SHWB 2OA2A 3GZTB 1M4UA 2FDGA 1XQNA 3JAWB 2VZPA 1O9HA 3JARA 2IVIB 4BK5A 1Q8QA 1SQGA 2X53S 5L7OA 5H2FZ 4WBNA 1YWKA 4LNUA 1XMOO 3WFVA 1K45A 1SBDA 3OGGA 3IZOA 3PUSA 5H6QA 1S0FA 5IK4A 3ZN5A 4R8CA 5EC2C 4AHWA 4QHZA 4CH3A 2ATFA 4BH9A 2DJVA 2OWOA 2WWWA 4L9BA 4UVCA 3CU7A 1S2EA 5K7PA 4LHLA 4BXSV 3H42B 1RUF2 2VR4A 4PV1B 2ZACA 1W9SA 1MS5A 5I8SA 1H38A 5FPLA 4O2AA 1UYXA 3UKNA 4QKNA 5T3NA 2G38A 2E26A 3ZHQA 3DPRA 4B3TB 1CAVA 2HVKC 4MXWB 2XUMA 2Y6HA 3R65A 4IYHA 2ZZJA 1W0PA 2RS12 2RS33 5FZ1A 1COV2 1Q56A 1YSCA 1R1BA 1VBA3 4FPJA 4CEYA 4IV1A 4R9CA 3GDBA 3ZN6B 2WO7A 4GWMA 3HKEB 1D4M3 1AR73 5DABA 3DC5A 2XJUA 5FJKA 4FFGA 3P3NA 2FQPA 1YJWV 4JI1B 4KGQA 3TEZA 2VVFA 1V6MA 1SPPB 3AKTA 1SC5B 2V4DA 4G2KA 2GUZB 3CIHA 2A73B 2LW8A 3SYQA 1UYZA 2W0FC 5FPAA 3HR9A 1PGW1 1AX0A 1XU1A 4Q8KA 4YGEA 2PHDA 3JASA 4MVSA 4MTOA 1R082 5I0DA 5B4NA 1WLCA 3AXEA 2PELA 1MEC2 5JR2A 1SLIA 3THTA 2B7YA 4AHZA 3SCGA 3LQCA 5CMUA 1V70A 2YGLA 1N36B 3AYAA 3ETPA 1REDA 3CCMV 1REEA 4TSVA 3SPHA 1FXZA 3ETDA 2VTXA 5IVJA 2GV9A 4P5HA 2RDSA 2JJ1G 5EZYA 5GZEA 4FFHA 4DXZA 1RINA 5DPNA 1Y76B 3E86A 3ZYRA 3JD3A 5DG1A 4GB32 4F7ZA 3E2EA 4UXAA 4QB2A 1VE0A 2P6HA 4PA9A 3HNBM 1TE1B 2VZOA 5C3SA 5CBLA 5KXDA 4GZRB 1RUH2 2CTPA 3DXRA 1KITA 1AI5A 2BJSA 1UW8A 4YZ3A 3ZYJB 1LTEA 3K2OA 3F7YC 2HEYF 5LL6Y 2VULA 4EN6B 2RS52 1UZVA 2ETNA 3H8XA 4O65A 5A70A 5B5EZ 1ZBA1 3X2QB 1GMMA 5GLVA 4TV9B 3H1IH 4BQ3A 2GC0A 2DV9A 1RUD3 4ZS2A 2QTOA 2IUWA 4JDMA 3UGFA 5CB7A 2WJSA 3SJAC 1VBD2 1N32O 3ILRA 1I5ZA 3CMGA 2D3RA 1GKBA 2K9PA 2D5FA 3ZDSA 4JAVA 1DF0A 4M3CA 4MGZE 1QJU3 3ZFEA 2GP3A 3L9DA 5FPOA 3APQA 2GSMB 2ZE8A 2QQKA 4Z2AA 3RPQA 2V4VA 4JRLA 4GX5A 2VOXA 5FJHA 4LH7A 5KHKA 2D3SA 4DK0A 2AEZA 2RHPA 2ZABA 3ME2A 2UUBO 1R092 2D6KA 4X66O 3ZMUA 2DURA 3I49A 1GWMA 2CH7A 2AW9A 2XASA 1DG6A 3I97A 4BU2A 2K0GA 5C8CA 4UXNA 4I9WA 2DYRB 3MV11 1OUXA 4W4ZA 3S3XA 1OF4A 4LHKA 1BL8A 5KBFA 1LOFC 3BODA 4DZGA 3M8LA 4Q4V3 4F83A 1UX7A 2ZPXA 5EYPB 2CUGA 5FZGA 3D0SA 2EA7A 3ZHRA 5FXXA 3PN1A 1CJDA 4CA9A 4BCUA 3AEIA 2RJKA 3T2QA 4XXPA 1O59A 3V64A 5J09A 3PVEA 4XBLA 4P08A 3C7HA 5EIBD 1LHVA 1W3VA 2A0LA 2DQ0A 1JBCA 2PYJA 1PL0A 1FX5A 5ACA3 2JDYA 1BEV2 1JYNA 2J1EA 3CO2A 4AI2A 2JDIG 3L2HA 4LC1A 5C4WA 2NMOA 3LEMA 2Z4FA 1UMHA 1WA8B 4BB3A 1YJKA 4QPKA 3PU3A 1RITA 1ULEA 5H9RA 3AK0A 4CCLA 4BZ4A 4DV3O 2JJ2G 1ZLZA 1S77D 3P3PA 5J2UA 4FFFA 3ZFFB 1AJNA 4XZUG 3CMAV 5FO7B 3GALA 5GTIZ 5L73A 3SJQC 3APBA 1L0LH 4PDLA 1Y9MA 4Q4X2 3RZLA 5FY1A 2IJKA 4HSLA 3T1YO 2HJDA 1IPSA 3JD2A 1VBB3 4LXLA 1HV0A 4E2GA 2XTAA 2RM22 5CNAA 3UKTA 1JU4A 4X65O 5FY9A 4EYUA 4FAGA 4YFZA 5FXZA 2XHBA 3L74H 3FWEA 4AGGA 4XDKA 3TNPB 5C70A 3QH7A 4P9YA 4E2SA 2RJZA 1YJ9V 1YIJV 5H9QA 2VOWA 1WMEA 1VEWA 3CWBH 4RQPA 4IL7A 4L97A 1RM1C 5JJJB 2Z42A 1MR5A 1N1VA 4NRMA 4MSVA 2DFBA 2G9ZA 2ZE7A 1SCSA 1KYOF 2EINC 5DDJ3 1AJPA 1V6LA 1FYUA 4YM1A 1W8UA 2V72A 3NAPC 2OYQA 2YI9A 5H9SA 1ZA7A 2ERFA 2XG3A 3TEYA 4DR7B 4OHVA 2GALA 2YICA 4LUMA 2R9AA 4P2ZA 2BCCH 1I94B 1JOJA 4MVTA 1V9U3 1REFA 1BSMA 4JVAA 1MOFA 5JQGA 4GULA 3JATA 4LBQA 3LZZA 3PL0A 4QX1A 3OFNG 1BVP1 2DYRC 1DYPA 4F6RA 3EMRA 5I91A 2HEVF 1WJZA 3VZOA 3V0BA 4TUYA 5FP8A 3OAAG 3RVYA 4WM7A 3E5UA 2ZNIA 2R6QA 3VD4A 2WLLA 5E79Z 3ZSLA 2YIBA 1QNWA 4FPGA 2V1DA 5JCOA 5L3FA 4WM8C 4OMCA 3O0WA 1RUE1 1W2AX 3OPTA 4HNAA 3E5XA 2P17A 1PPJH 4JYCA 1OHFA 2VU9A 1M57C 5JVDB 1WCDJ 1IHMA 1O4ZA 2W91A 1JCHA 3BA9A 1JJ2U 3T1LA 2F4VO 1DTOA 4AVBA 1B06A 2Y69C 5A7WA 2W9XA 1H6XA 2Q1FA 3MIHA 4P5YA 4CUBA 4A42A 2VJXA 1C28A 3N2KA 4NWWA 3NNJA 1YCIA 4BQYA 2WBKA 3CJIC 3WNOA 5TSWA 3POSA 5JXGA 1WLTA 3PJQA 1F9KA 1H8TB 4DR5O 3I3QA 4JKLA 3ABTA 3HKDB 3DL3A 4J6GA 5FZOA 5LHHA 1KS4A 1PVC2 4QPGB 4AAXA 1SLAA 1O9GA 4Z1MG 1RC6A 4I5SA 3JSLA 1JHJA 1FXKB 3JBG3 4W6YA 3QCWA 3FFQA 1KDKA 2VOTA 2HWC1 2EXHA 4B1MA 1GICA 5B1BC 2YXHA 2QEXV 4X1IA 3AVSA 3INAA 3M99B 4XQDA 1RUNA 2FHRA 5J7MA 1JHNA 3ZRWA 4DS0A 4AXOA 3I3DA 5FCCA 5K9YA 4MW3A 2X10A 4IUGA 1N47A 1SKVA 2GN3A 4WZFA 3BU0A 1POV3 4CUAA 1F4NA 3LOBA 4GQ7A 4GWJA 1FPN3 3N4MA 2HWE3 3DF0A 3QBQA 2JIGA 1S5LZ 1Y9GA 2A3WA 2C24A 4ISRA 4AVAA 1YHFA 2EIEA 2P3IA 2B46X 2BERA 4AFCA 1QOOA 1K33A 1AHSA 3JAMN 3BALA 3MW3A 3CRCA 1IBLB 4R9DA 4N7IA 5BR8B 2NR5A 1AL23 1VRH1 4COWA 3ZKUA 1WLEA 3DKQA 4G9SB 3NJYA 1QLNA 4MHUA 4XFGA 4X20B 2HWF1 4WFGA 4KWLA 2B5UA 3ZS8C 1NT0A 1BBT1 1E5SA 1GOHA 2QKDA 3N2GA 3F5WC 5C3OA 5JOZA 2KKWA 2VW2A 2ZEXA 2OPKA 2AGSA 2IU0A 1Q6UA 3EFFK 2MEV3 1VPHA 3R66A 1RGSA 3LWCA 3B9CA 1OF3A 5B2GB 3O9OA 4CDUA 3L75H 4U7NA 1L7RA 3VD5A 4QPIA 4A6OA 4JTCB 1HRV2 4O2BB 4YW3A 1GKFA 1AYN2 3MW4A 2NYYA 5FKBA 2Y64A 2DWDC 4AHCA 1W6NB 1OKQA 3W7WA 1C4RA 5LATA 5EIBC 5A3WA 4D69A 4AEJA 5KA6A 1HDKA 4JI2B 2XOKG 1KFUL 2ZIOA 3NNFA 4ATFA 3OGCC 1GK9A 4BWOA 1YDXA 2E31A 4JGYB 2AR6A 3WF4A 2Q7EA 4AI3A 2FCUA 4YFWA 1N0NA 5A7OA 3BY6A 3Q8AA 4SBVA 4XIOA 2C0ZA 4MXVA 1JOBA 5ANQA 4QX0A 1UD1A 3M3CA 3E6BA 1XOUA 1CZTA 4QPGC 1SMVA 3T3YA 4CDQC 5IWAO 1F15A 4ZI7A 3KF3A 4DRXB 1E79G 3WG7C 4K0KO 2LTNA 3CCSV 4MW8A 1ASJ3 2O8OA 2WS93 2XBO2 3GBWA 1U12A 4N9IA 3LA3A 1ULDA 5JH7B 1WP7A 2YHJA 2ODMA 2PHXA 2B1IA 4XCBA 3UNPA 3KS7A 5FY0A 4H44B 1BK0A 4FLYA 2D98A 4YY3O 2AENA 2LS6A 3NRUA 3S57A 1VQ4V 1UN1A 4D7YA 2OVUA 5A3MA 4E4HA 4N53A 4GH4A 5CFCA 5I0TA 4XCAA 2Q8CA 1KD1W 1S76D 4UCVA 5IDJA 2XLAA 1Q8SA 5EYYA 1TNRA 1JQ0A 3OUJA 4M3CE 1KRIA 1HP8A 1YI7A 3RYCA 3SNMA 4NPMA 4XJ9A 1MZFA 1F35A 3CKHA 4XBQA 1H2NA 5FPUA 5L3CA 3B01A 2ZNJA 2R1BA 1F8VA 2AUYA 1B3QA 3ENRA 4AQ6A 4BQ1A 1GQHA 2BOIA 5C71A 2BFUS 3STLC 1CAWA 2C9KA 1OMIA 3AMHA 4I01A 4PQQA 1AXKA 4LR4A 5DZGA 5A7NA 3ILFA 1QJY3 3VBHB 5JLVA 1XBLA 4FP3A 1GZ9A 4Q29A 1W6QA 2OIEA 3HT2A 3U37A 3H3UA 1PM7A 3LSEA 2JK5C 1ND2A 3AZZA 4HBNA 4LWSA 2N74A 1UOGA 1BJQA 2JS3A 5DUUA 2F4PA 1Q7YW 4PF5A 3S3WA 2XJVA 1HLCA 3JSNA 4L92A 3SYCA 3HAGA 4KI5M 2WINB 2W68A 5H6RA 1XRUA 2RNBA 4BA6A 3SYPA 1QXPA 3A0KA 5FP4A 1UZYA 1JODA 4OCTA 3AKQA 1AR82 4E4ZA 1OT5A 1C5IA 1MQTB 3NJZA 4FPPA 4UOJA 1FMD2 3MPBA 2C9AA 3N9NA 3N7JA 1SLBA 1BCCH 3K9AA 3ECQA 4LKEA 3ZXFA 3LDRA 5CEHA 3OB8A 4YGBA 4CDWC 3CS5A 4QAWA 2RR12 1LKNA 1MSDA 2VUAA 4RD7A 1K5MA 2ZEZA 4GCZA 2UU8A 3JD4A 4ASUG 3N27A 3RVZA 1D5NA 3I2OA 4PJ0Z 5FPXA 2A7AA 3ZR6A 2EILC 1J59A 1RJ8A 3OUFA 4KG8A 4YW1A 1KD7A 3IIIA 1W0NA 3FYIB 3IMMA 2ZGUA 1UPGA 4UV8A 3I2FA 1RYYA 2VNVA 4BE3A 2W6JG 1J83A 1CWPA 4K35A 3MICA 1QCEA 1LR5A 5JXJA 1F7YA 1OUSA 2JJ6A 1SZTA 4XAEA 2GZWA 4B7EA 5BV6A 4B4RA 1ENVA 5LMUB 2P5OA 2VZRA 4FOYA 1I0HA 2AEYA 3WP6A 2V7QG 3MFCA 3ICXA 2KM2A 1WD4A 1DBNA 4RO2A 5LA2A 4RL7A 3MPPG 1ZZ7A 5JIAA 3IAQA 2AZ5A 4TV8B 4BOWA 2XVLA 3QO5A 5LHGA 1KBHA 1OCZB 4KFMA 2YFZA 2CWSA 1ZZ8A 2ZGRA 4B3MO 1TME2 3AZYA 2Y0PA 5GZDA 3WDXA 2JGDA 4E9KA 4RSUA 4ZZ8A 1RHI1 3IN9A 1YVWA 1S0JA 2JG9A 5EQUA 5LP6C 4DV5B 1W9TA 2C4XA 3POFA 1RVF1 1HQNA 4QPJA 2VRZA 5B3SB 4XDLA 1NR1A 5AC92 5BY5A 2G9FA 1OOPC 3A22A 2X5IB 3T1HB 3ZYFA 1HNXB 4O4IA 4QM9A 4ZU5A 3CL1A 1NXMA 3AX4A 2QVSB 1Z7S2 5FMBA 2JXAA 3AC0A 1FI2A 2EIJB 1QH7A 4QXCA 5F6LB 2ZHMA 1MZ5A 1U0AA 5DECA 2HH9A 4S2GA 2AXTZ 3VBSC 4I0XA 1AR92 4B8EA 2ID4A 4JV4A 4M4PA 4Z82A 3C3TA 2RVAA 3TB0A 3UGHA 2FBEA 4J1XA 3THOA 2LP7A 1LULA 1PHMA 3G67A 1BK1A 2OT5A 2NP0A 4YSFA 1C8M3 3CF6E 1M5IA 4IV3B 4JAUA 5F2VO 2FTKA 4QE7A 2PLV2 4FQZA 1JYTA 2ZGOA 4JI4B 5FNVB 5LGUA 5FYYA 3ACGA 4XDQA 4OYUA 2G4IA 2P6CA 2UY9A 4ES9A 1NCRC 1GZWA 2IJJA 4FZ0A 1XNDA 5DZEA 1VQ9V 2P4KA 4HL0A 3QF7A 4W6WA 1J1LA 3HNYM 1QDOA 3LDCA 1VBC1 1Q6IA 4ZY9A 3MHSC 3CRRA 4XJ8A 3ZXKA 1IDSA 2WNOA 4WM8A 1IG3A 3HQUA 4YZ1A 3PJSK 1LOBA 3AB0A 2KG7B 4JI8O 2VOVA 1FOD3 1WCQA 5JZGC 1OLRA 2Y4UA 1UMZA 1VR3A 1F2NA 4L8JA 1UOFA 2UUCO 3JD0A 4K3AA 1UX6A 3WX5A 3BOPA 1WA6X 2ENRA 4JF3A 1W2TA 4XC9A 1G4YB 4CS3A 1PK6B 1FT9A 1B09A 4LFCB 3FX7A 3FKSG 4OULA 3M1HA 2XT9A 3W5NA 1K5JA 4URAA 4OUMA 5J96B 4D0QA 5IVYA 4BMEA 1NZIA 3OG2A 3HKCA 2PF4E 1IS5A 3U78A 2K2SA 1BE3H 1JFFA 5FWEA 4YG6A 2BTQB 3AM2A 4AYUA 3J7AU 4AEKA 2B45X 4EV0A 4XW3A 3WHTA 1CVNA 3DEMA 2R70A 4LKSA 4DV2O 3UT0A 1W99A 3UV9A 1JZ4A 5BXZA 1QVGU 4GMP3 1QQP3 2Q8EA 3SPGA 2D6NA 3BABA 1K5SA 1VBA2 4JI0O 3ZFGB 2ZS6B 3H1HH 1YEWA 3CCQV 3T2TA 5LOVA 3JB4C 2DYSC 4LPLA 4DR3B 2X5IC 3WHUA 4XF9A 5FZIA 1AR72 1UKGA 2KR2A 1K97A 3FZ3A 2YDEA 4Y1UA 2IZWA 3JAKA 3DC6A 1WAZA 4JASA 3K4DA 5EBMC 3IPVA 2FKXA 4LULA 4LT5A 4BQXA 3MHHC 1H2SB 4K20A 5DAQA 2PA7A 3I8TA 4NIIA 4I4TA 5I0SA 2OPWA 5A80A 4ASLA 3RYIB 5KLVH 3SCFA 3ZXGA 4UWDA 5LBBA 3SMHA 4DIQA 2TEPA 2FYUH 5GZCA 4CH5A 3BB6A 3VN4A 1KFXL 4IV3C 1W05A 3FBMA 5ABJB 2EXIA 5IY5C 4RR3B 3E8BA 4BLJA 4OHWA 5APAA 1CZSA 1QNMA 1U97A 1Z0HA 3MHZA 4XJWA 1YFWA 4YNIA 1W03A 2XL9A 1C1FA 3A0NA 5A32B 4QE9A 2Y6GA 1W8WA 4EWEA 4DEQA 5KHGA 1ZZ9A 5CKMA 3I54A 1YF2A 1O8PA 4AF9A 1P7GA 1J95A 2B8MA 1XNQB 4IQPA 2ZE5A 1WZXA 4ITCA 2Q73A 2WLIB 4JHTA 1JI6A 4FK5C 4JYYA 1FATA 1PD3A 4DUXA 4O7XA 4X64B 3ZPOA 4O4LA 4DV4O 2E63A 4EEQA 4CP9B 3P32A 4CVUA 3NSTA 1N0JA 5CZKA 2A6VA 4HKWA 2FZ1A 4JDNA 3OY8B 4PLNA 3OM3B 3ABLB 1QLEB 1P8JA 3ASOC 4YVSB 1W0OA 3VZNA 3APOA 1HRI3 3T0DA 1F23A 1B35C 2RS13 1NTKH 1KMIZ 4FMTA 2ARHA 2DTYA 3RG0A 1OKOA 1XNRB 2JIJA 2D93A 1RUD2 2WFPA 2GNBA 4DV7B 1OCOB 3SH3A 5SV8A 1BQPA 1HXS1 1W04A 1FNZA 2NQYA 2JX9A 4UFIA 4EN9B 1UIJA 2VQ0A 3FE5A 5C5UA 4N8MA 3B02A 1G9FA 2WLJA 3IAPA 4I55B 4FPEA 1LHNA 2QZ3A 3B5LB 1UF2C 3VBRB 3AFGA 3LEKA 4WFAV 4HK8A 1XYPA 4N43C 3C90A 2ORXA 5JOXA 3SR2C 4RGGA 2WSSG 2DVAA 3A0RA 5KR7A 2JDUA 3ZYGA 2VTFA 3BTAA 1BMV1 5ANNA 1MEC3 4CDXA 1RP3B 3UJOA 3M3QA 3S5AA 4NAMA 5A9GA 2FCTA 3AVRA 1HWYA 5GONB 3AG4B 4UV9A 4DRRA 5J9PC 4NPLA 2R16A 2WLHA 1YIPA 4IEVA 1XHXA 4HETA 4Q4V2 4DO0A 3B40A 3CJXA 2HLEA 3O1PA 2R061 1W2BU 1RPRA 2E74B 4LKFA 1DGWX 4HG6B 4BWAA 3VBFA 4YM2A 4EFEA 4QQOA 3J8F1 3D36C 4GT1A 2ARCA 1AYM1 5SV5A 3R6SA 5FAXA 2VO5A 4NE9A 3FB7C 2RMKB 1ODNA 4NTXA 3HQXA 2SBAA 3TXSA 1JOPA 5ACA2 3M4FA 1HB2A 1RUH3 2WO2A 2ZBJA 1W8TA 1H9WA 2BP6A 1ND3C 3LE0A 1Z5VA 3N7KA 2VM9A 4MSWC 1RSOA 3IDAA 3OMAB 4XFAA 2A06H 2BOBC 1SFNA 5CKNA 4XJZA 5CA1B 1N34B 2P37A 4YW7A 2Q0OC 5BNOA 4QM8A 2JE7A 1OH3A 5CN0A 3PJYA 1VLNA 4RWUA 4GKXA 2H8PC 2ITCC 2ZX0A 4UCRA 3AMPA 1PO21 4DPNA 3R05A 2VZTA 2UYAA 3ZXAC 1VBB2 3UQ8A 3VB9A 5DUVA 3TWIA 5FP7A 4W8JA 1W9YA 5F9TA 2QR4A 1K73W 3GCXA 4MTGA 5LA1A 1IKPA 2ZXWC 3H1MA 4JGZA 2P06A 3QO7A 1JYCA 3RYFB 4PDWC 4SLIA 2DVGA 1NA1C 4HVOA 5F6KA 4HONA 3HOBA 5C9AA 1RUF1 4XABA 2QQMA 1YI9A 2RDQA 1G9DA 4YM0A 1M56B 2O57A 3F95A 1YTFD 2CYFA 5LEKA 3W7SA 1XSRA 3VD7A 2Y6JA 4UW5A 3T30A 1MS9A 4NIHA 3T0AA 1OCOC 4QMAA 4P9PA 3H8OA 2VCCA 2VOKA 3ZIAG 1I6XA 2WAOA 2WLQA 4MGTA 2NNUA 4HZFA 5FY4A 1KS5A 4L8QA 3EHBB 4YW5A 1OFSA 4H3WA 3EHKA 1COV1 3KB5A 1W0JG 3RYHB 1FNYA 5J36A 1JW6A 2XAJA 1MS0A 1YO8A 2W0XA 4Z1VA 1XMQB 1TMF3 3VDDC 2TUNA 1V9U2 2XLFA 3K5OA 4K40A 1VQ7V 5A1FA 1J1TA 4UCUA 3USUA 4JV5B 4AFDA 4M4RA 3MGUA 4YHHO 4AEDB 4A7YA 2NMNA 3VHOA 1AF9A 1JA8A 1AXYA 1XC6A 4QKDA 3G6JB 4COYA 2ZX2A 5FUNA 5FPVA 4XUOA 2D2CB 1EZVH 4LH6A 4PLOA 4KP4A 2R32A 3TGUH 2UXNA 3WDYA 5FO8B 5L7OB 3J81N 4UCTA 3T09A 1R081 4EROA 5T5PA 2QJ1A 1APNA 3EB7A 3CCJV 4QIWF 4MG2A 4AVVA 2BDRA 5EFUA 3O1UA 4BQ2A 1F31A 3WCRA 1HR0O 2HR3A 2WRAA 3DECA 2GDSA 4DUWA 4M0NA 1UXXX 2UXBB 3FMGA 1PMHX 1ZRFA 5FL7G 3FLTA 2HJFC 1W06A 2YGMA 2ARBA 4B3SO 3L72H 2WA3A 5FR3A 4DRVA 3DPRB 1ZWIC 4GB31 1CP9A 3ZRXA 1A3KA 3LKJA 3POWA 2P90A 1OI6A 3H1LH 3ILNA 3KQ4B 4GAZA 4RA0A 2YBPA 4JX0A 1SQPH 2HKXA 1S4CA 4N7UA 1NUKA 4HK9A 3MFAA 3EXUA 3JBG2 2JIZG 1SZXA 1QVFU 4Y22A 2Y33A 4AVCA 1RMU3 2GC3A 4LF9B 1KGYA 1W39A 1FPOA 3DYOA 5IHRA 3WLUA 3KV5A 2RS51 5FK8A 3L9JT 4UFJA 3SISA 2QWQB 2XJPA 4QQLA 1G7YA 1MZ6A 1GN2A 4UW6A 2RMU1 3LDBA 2RDNA 1PGL2 1AJQA 3QD6A 1K12A 5J48A 4YZ4A 2UUAO 1RUG3 5BNNB 2VCAA 1N33O 4MVZA 3WG1A 1JX9A 1RUI3 4INDA 4L11A 5D8AB 1EN5A 3JAWA 2ZINA 3L2YA 4JI5B 2C5DA 1FPN2 1VBD1 2HWE2 3AZVA 3VLBB 3B9IA 4P30A 5IJ9B 1DYOA 1ZVFA 3KMHA 2ARXA 1AJKA 1SLCA 1L7QA 5KHIA 2UXDB 3A7QA 4NHYA 5EBLC 4AFAA 4J25A 4JCKA 4A41A 1WKYA 2FMYA 2R7EB 3R0RA 4ZU7A 1VIBA 4J7JA 1AL22 1PIV3 3O0XA 1OD3A 1GFF2 2E53A 1GM8A 1R091 1K4CC 5CFDB 4MV2A 3ZHTA 1RUC3 1S2KA 2W46A 4GXLA 2EIKB 3IMNA 1G8WA 1QU0A 4TTGA 1BYHA 3GXUA 4Q4W3 2P1BA 4MXWA 3I59B 5KUKA 1OJHA 5BMVA 4H7MA 3ZBHA 2WN2A 2MEV2 1LOGA 4ES8A 1QXRA 5FPBA 4FFBA 2R073 2CNAA 4HOOA 1QR8A 5L7OC 3ZN4A 2XVKA 4YIPA 4AQYO 1DU3D 2HWD1 3ZN6A 2BWAA 1ZUQA 3HKEA 3MLLA 3ZVXA 1HQLA 4H37A 5BUVA 4MZUA 2WLNA 4B7KA 1DQ6A 2YU1A 1FS0G 1BEV1 4CS4A 3QH6A 5JXHA 1SPPA 5BNPB 5E8AA 2GUZA 2ARAA 2R043 3I2DA 1W8NA 3O7OA 3PVBB 5GKAC 1GOGA 1UAIA 4DUZO 2ZHKA 3AG3B 4WCEV 1G86A 4Y20B 3DPRC 1Y4MA 3RWKX 4J7ZA 4CP0A 1GWLA 5LMNO 1WLWA 1NH2B 1IOAA 1DFQA 2Y26A 2YEVA 5B1AB 1ZL8A 4Q4X1 1IBMB 1BQ0A 4LBJA 1FAFA 4ZS3A 4DR2O 4CEYC 4IV1C 3B7MA 5KXBA 2WWSA 4E2LA 1AX2A 4LBQD 1NKDA 4DXSA 2RM21 1DK1A 2JRIA 2E7QA 5F3GA 2CAZC 2OUHA 4IW3A 4Q1PA 1QR9A 4WVMB 3E83A 2WS92 3OUHA 1RXFA 5C8CB 1TEIA 4META 4CU7A 1Y76A 2Q1MA 4CBCA 2PYLA 5JMOA 2CWMA 4DMIA 1IBKO 1MG1A 5EK0A 1TNFA 3OR6C 2LFSA 4GJYA 2F93B 2PQQA 1NAEA 3S30A 1CPYA 5LGTA 4X9QA 3QO8A 4NYKA 3CZJA 3VDCA 3IWZA 2WZEA 4YW6A 2E51A 3Q8EA 2EIDA 1T6BX 5HCHA 4FLTA 2QKSA 4MLOA 4YM3A 3KVBA 1X36A 4CCEA 4IHJB 1ZBE3 1AR61 3OMNB 1OCRC 5FZCA 2IWGB 3JD71 2Y0OA 4X62B 5C4WB 4NOTA 4A45A 5T55A 4G28B 2Z2SB 4XACA 4NXNO 3HWJA 2PFWA 1A8MA 1EY2A 2EULA 1PGW2 3MUZ1 3RFRA 4NWVA 2J1AA 1V6NA 1JS9A 3ON7A 1XU2A 4DY5A 1GTOA 3KQRA 2Z5UA 2ZGLA 4J80A 1VB2A 2JG8B 3WP5A 5AVAA 3JQWA 1HNZO 2BWCA 4FXKB 1H4GA 4OVEA 5C7GA 4FLVA 1K92A 2VMDA 1PNMA 1K42A 4GKJO 3IDBB 2QM4A 5F1RA 3H1JH 1HW7A 4DV6B 3CZUA 2CTQA 2E3CA 5FP3A 1I5XA 4MVRA 1BKZA 3E8HA 1O5LA 3PVOA 4NHXA 4Q27A 3RJ2X 2XMLA 2CU5A 4PLMA 1YITV 3H50A 4IEUA 2FL4A 3VDAA 1NVPB 1FFTB 3JCZA 5M0TA 5EYPA 5HI0A 5JDBA 2RDRA 5GZGA 2XBO3 1U96A 1K7DA 1Q82W 4FOVA 1CGPA 3ACFA 1OH4A 2HEPA 3HBKA 3STZC 4IGQA 2C2AA 3ZFEC 5H9PA 5B1AC 4BXFA 4GJZA 4CXWA 1ZBA2 2VC9A 3N9PA 1PVC1 3ZXDA 3E8FA 3VHRA 1ND3A 3RN4A 2D3PA 4UCSA 4Q5OA 5JQGB 4FVMA 1WA8A 3UYJA 2Q5ZA 3ZX6A 3JATB 3LDKA 1QWRA 3I56V 2BQPA 5A6ZA 4FJCC 2Q5TA 4XTPA 3AMNA 1JYWA 4U2AA 2FCVA 1W2OA 4S2DA 5C8CC 2BUKA 4IGPA 4AWDA 4JZ2A 3TN93 2YPJA 1SCRA 2F95B 2QJVA 1XILA 2AZ0A 4QU2A 2A9HA 3OGIB 2HYXA 3SPJA 4PF1A 4XF4A 4TUYB 3JALB 3OCPA 3FFZA 2VY0A 1W2NA 3BVOA 2HBTA 4NHLA 1HN1A 1I1EA 1H1MA 4Y1YA 3LPFA 2WLLB 3LNNA 5CIRA 1R73A 4UW3A 1UL9A 4JI7O 4PIYA 1HW5A 4OGQB 1XMQO 4GIQA 4NXMO 2D6OX 3RMXA 4NIDA 1F4AA 2EICA 4XFIA 1GQPA 1FV3A 2XJSA 5C4WC 2Q4SA 2JKXA 5CAZA 2KA3A 4XDJA 2YI8A 3MUY1 4MH0E 3FD9A 1UWWA 3WF1A 2WO1A 1AR83 1JMUB 3FX3A 4BQ5A 2J1TA 2Q7GA 3Q4HA 5D5PA 1UY1A 5C3PA 2PHLA 5JJNB 1VBE1 1NY72 1PO13 3K51A 4UBHA 1AXZA 5FY7A 4ONUA 1R6KA 2W5FA 4WVZA 2OKXA 1HRV1 1R3KC 4XF0A 1AYN1 3G7DA 4QX5A 4AI9A 3U10A 5A3LA 1C8M2 2DWRA 4FQ4A 3DUIA 4X1IB 1GYKA 4PIZA 4LBEC 4K21A 1VJ2A 1CN1A 3AG2B 3BTYA 5LHIA 3UM7A 4RQPC 2ITDC 1K3IA 3RYKA 1L8DA 4K1ZA 5IK5A 3GYDA 4F8AA 4KHPO 3B77A 4U3JA 2QQUA 2YMZA 4QKBA 3MLJA 1HJGA 4CZSA 2VNRA 3KM5A 2FDFA 3LGRA 2F6BA 2F17A 3H7JA 5EPAA 2JDKA 2DUQA 3CE2A 3M8AA 1MMMA 4Q6GA 2AZ2A 2H0VA 4KGGA 4LO7A 4H0LB 1JZ5A 3ETEA 3W5MA 5JVDA 4G3YC 3ZCCA 1M1KW 3BKZA 2W87A 5FZ7A 3SYAA 2R0HA 5FZ6A 4DUYB 3GNEA 2R0FA 3VV1A 2VQFB 3E22B 1VF6A 2R49A 1LOEA 2VQEO 1YNAA 2GC2A 4DEVA 3TYJA 2WWUA 4ZBMA 1XJAA 5GLWA 3N2GB 4EZ4A 4XTMA 1LENA 4CCCA 5KC5A 5A6YA 2ZGKA 5EYXA 4J9ZB 3POYA 2P7TC 3D6EA 1H8TA 1GOFA 1G9AA 2JB4A 3HKDA 4HKLA 4FPKA 5FZFA 4P9IA 3POJA 5AC93 4WM7C 4CCKA 4I50B 1X33A 5HFMA 2Y6LA 1IZ3A 1FXKA 2VXRA 1J5EO 3HN1A 5JCOC 4CH6A 2VQAA 3RYPA 4O9EA 2HHHB 4E4SA 1FV2A 1AB3A 1WN7A 1O4YA 1Z5WA 4DK1A 4IIJB 3E97A 4U3FH 1I08A 1E5HA 4WV8A 2H3OA 4DR4O 3VHNA 3GVMA 1S5HC 3GWOA 4R6ZA 1CQ9A 3N9LA 4O61A 1Y66A 3ZDVA 2VAUA 1WB8A 3IT8A 4JC1A 1SQ4A 1MACA 1R3LC 4JYAB 3JCIA 5IVBA 5IFPA 4FZ1A 1WMFA 5L3BA 3M3EA 3ES1A 2GHYA 3K57A 3BFRA 3URFA 1DLLA 1GANA 1COWG 1RUJ1 4NAOA 5B4XA 1T6GC 3OEAA 4OUSA 3BVCA 4YARA 4GD4A 5JSOA 4R9BA 1POV0 3K3WA 2R9IA 3I7DA 4X20A 2QFEA 5IW0A 1WPXA 2WYSA 4JI6O 5G04L 2X05A 2O8QA 2QWPB 2MNGA 3T1MA 3VKFC 1IX9A 1FMD1 4TXWA 4LO8A 4LF4B 4XFBA 3WINE 1YQ8A 4XDOA 4GH4B 5CYYA 4B29A 5CFCB 1MS3A 3CCRV 1A8DA 2RR11 3WG4A 2XLGA 1KKCA 2YS8A 2QTSA 3AP5A 2W1UA 1ZYBA 2VBPA 1IG0A 3P5BA 5E1AC 2XJTA 4URTA 5JMCA 3KD4A 4FI9A 4LF7B 2H0BA 4BJ0A 3T4VA 5LBFA 3RZMA 3NWKA 3RYCB 4K7JA 5HXVA 5LXTB 2JEUA 2FDJA 3X29B 4KH9A 5CKQA 3GF6A 3ZKYA 4CTEA 4GKKB 4I0AA 1WW6A 4AE2A 2E75B 5L9BA 2LUWA 1CAWB 1HDJA 4JGYA 2AACA 4DOUA 5F3EA 3ATGA 3G80A 2PHTA 3CC2V 1HRI2 2BNNA 3RDIA 3T0BA 3W7UA 3E6DA 4RFRB 3UESA 2VMHA 5IAXA 4OQ8A 1I5YA 5FYVA 4LWSB 3PNAA 4NPRA 4CDUC 2P2KA 2ZCWA 4CXXA 3FHQA 5I8TA 4QPIC 3F5TA 4YGCA 4DRXA 2ILMA 1YHQV 3HN3A 1GRJA 1U5ZA 2OCCC 4IE4A 2HWF2 3JXSA 4TLGA 1TME1 3UKVA 1SF9A 1DGRN 1SS3A 1Y67A 1BBT2 5JH7A 2LW7A 3F2ZA 3TXQA 3HJRA 2P4EA 4QT6A 2HWB3 3IGAC 4LBKA 2PAEA 3HKBB 4DYLA 5FY8A 3ABUA 1QH6A 3TOJA 1O3SA 4WZCA 4LFAO 5J2TB 4I30A 4PA7A 4W4LA 2WFF1 3AKPA 3SHRA 1K5MB 1OPOA 5D5QA 3D8CA 4IEOA 1AI7A 5FZBA 3FB5C 5EJ3A 2CE4A 1Z7S1 4RAIA 1PNFA 1DLCA 1UZWA 1ZZ6A 1AR5A 1VAKA 3D3AA 1N1TA 1AR91 1BZKA 3ACLA 3CQOA 3MAQA 4DV6O 2CY6A 4D6TH 3LCPA 4MGQA 1NQDA 3PMEA 2VZUA 2XONA 3WP4A 1HIXA 4DV0O 2RJLA 4B1LA 1HQWA 4I2OA 5KHHA 2PLV1 1R1A3 4LO6B 4W50A 2EALA 1X9PA 4F6EA 4OMDA 4X8PA 3VBHA 4QU1A 1G1XB 4YRDA 2AHYA 4N53C 3CNAA 4GH4C 5CFCC 4J42A 3WDTA 1IS4A 4DW0A 1C8NA 4NRQA 2V5YA 1KEXA 2ZGNA 1PMJX 4FPOB 3TAYA 2L6LA 4LFBB 3SKJE 1WW7A 4LF6B 3AZWA 2ZX4A 5FZLA 3H1YA 2UU9B 3H1WA 5LBCA 3EO6A 2JENA 1MQTA 3WNPA 3CX5F 2BEOA 1RM1B 4UFKA 1S0GA 4CU8A 3S7IA 3IM0A 3LUTB 1ACCA 1WNSA 3AYCA 3KF5A 2DMXA 1C3HA 5T54A 2XQRA 4X6QB 4B08A 4IERA 5EXOA 2EINB 5LBQA 2XJQA 2AC1A 1KXGA 1YFYA 3NAPB 1ZM1A 3LFMA 2UXXA 3AL6A 2I45A 3BHPA 1NE6A 2L35A 2YY1A 1UPIA 1UOBA 3N9MA 4EFBA 2BVBA 4HVRA 1FD9A 1ND2C 1UFIA 3K5MA 1H2GA 5DM6V 2GU9A 4JQRA 5HPOA 1JJOA 1SQVH 3W7XA 2ZM6O 1J3RA 2V5DA 3ACHA 1U5IA 1KJRA 3ZSJA 4RHV3 2IXJA 1ZREA 5BYNA 2WNVA 4EB6A 4Y4YA 3OGSA 2TBVA 2JEXA 5T50A 1FJGB 4HZ3A 1K3EA 2RS31 1YUDA 2RE9A 1GZWB 1BZWA 2AHZA 3U75A 2HFEC 1VBA1 3H9VA 5K0UA 4YLZA 2ZOEB 4Y5Z0 1PX3A 1TMF2 2BSKA 3W9AA 1P7BA 1D4M1 3G4SV 1HNWO 2BBVA 1AR71 1K5MC 2WO3A 1TVKB 4TV8A 4WM8B 1UY4A 3WEZA 4KUMA 4DV1B 4C91A 2IH3C 3O1SA 2RV9A 1M57B 1OHHG 5A3PA 2G1MA 4XJAA 1LRHA 4B3RB 4DR1B 4FPHA 4X8NA 2DDUA 1R3JC 5A2QN 1ZRDA 5CA0B 4JI3O 4CEWA 5KX5B 2Y69B 2BFUL 3K58A 1GNHA 4RUEA 1UU4A 1CAXA 4YZ5A 4IEZA 3HEIA 2ZEYA 3UL2A 3CJIB 4QDRA 5JWPA 1YZBA 4YPJA 1EV13 1PKXA 2PGGA 3K48A 4FXGB 5LCWL 5AVPA 4B3NA 1VF7A 2CGNA 1EUUA 2IW5A 3MIDA 1MNGA 4OFGA 2CGPA 2VD7A 4IT5A 1IQDC 2LALA 3KSCA 3KGZA 1GNYA 3UO3A 1LESA 3U14A 4KXRA 5A1LA 5B1BB 1OFNA 3MW2A 4LE4A 2VUJA 3JQXA 4IE0A 4ZXEA 4DXTA 4DR6B 4Q2FA 1QMJA 3ITQA 4A44A 3OEHG 2BOCC 4AVSA 4UBGA 3LDDA 3BTZA 3BEHA 2QWOB 5CB4A 4LIUA 4K8FA 1JYXA 2YUAA 4BIOA 2YC2A 4ATEA 3OGVA 1XMOB 4O9GA 1WP8A 3MO4A 5FNVA 2JG9C 4WBBA 4PA3A 5GTHZ 2PHUA 1S0IA 1XL6A 4ZHQB 1RMU2 2UXCO 4XVHA 1QIQA 5DAXA 3K46A 3I5DA 1VAMA 1XE0A 2ZD9A 2Q7HA 1VQ5V 2VW1A 3DN7A 3W58A 4MADA 2KG7A 1MS4A 2IXCA 4JTOA 1CPNA 3K59A 5FQ0B 1RUG2 1RUD1 4I4TB 4CC5A 1RUI2 2AYHA 4KL1A 5IYBO 2IXHA 3C7EA 4BIZA 1GMGA 4Y33A 4WFFA 4E2QA 1PK6A 4LF8O 2VVDA 1QJU1 2X8KA 3E89A 5T5JA 4FFIA 5IJRA 3NV1A 4M3CF 1QJX3 3OPWA 2OCHA 4CCJA 1PIV2 4JYAO 3BA8A 5DXDA 2GN7A 4BIUA 1IVSA 1NX9A 4NROA 4XEZA 2BTQA 4D7TA 1ZX5A 4LITA 5CADA 4LR3A 3R4SA 2MHFA 4IEYA 4Q0SA 4M01A 2IXIA 1RUC2 5C8YB 1TUBB 1DZQA 4A4AA 4FBFA 5FUPA 1IPKA 3KKYA 1OLMA 5A7PA 3RBZA 4Q4W2 1HN0A 3K3NA 1SQFA 2VTXJ 4AQSA 3N7MA 4MHRA 3U07A 4NTYA 2VWKA 3H9AA 3OTOO 1US3A 4Q4V1 4OI0A 2YPDA 3ASNC 2WABA 2R072 2W1WA 2XHKA 4QGLA 4CCNA 2WZR3 3ZFGA 4P9LA 1ZAUA 4AGRA 5CU1A 3BU7A 5K4LA 2HVJC 1PNGA 1VQLV 1CX4A 3VBUC 4CUGA 2A7WA 3CCLV 4S2FA 5ACA1 3OJBA 4XUTA 2X09A 2K1EA 4I0BA 2XUEA 4CDQB 3ZEDA 4CH4A 2PHWA 3ZHVA 4J1WA 1GSLA 3AJZA 1QQCA 2YYOA 4GMP0 3WG7B 5CA6A 3VD9A 1XREA 5A3UA 2VCMA 2R042 3O5SA 3VZLA 1W2UA 2HG5C 4YVWA 3RYIA 4Q4Y3 3ELNA 3JB8A 1G9BA 5IUQA 1EUTA 1H6YA 5J98B 4XURA 3RT3C 5FZAA 3WB0A 2BE3A 1NZ6A 4R7CA 1EAH3 4FOWA 3PUHA 3AG1C 2HEWF 2NLRA 3RYRA 1JUHA 2XOMA 5LYJA 5ABJA 4RR3A 3WXPA 1DQ5A 4HAMA 3BUCA 2WA4A 4B3TO 1CONA 1RXGA 4Q0UA 3P30A 4YJ2B 1VBB1 4DNYA 1Q3EA 5A32A 2AGAA 2BTOA 4KMQA 1AR1B 1EM1A 5F8PA 1DCSA 5E16A 3U4SA 1IS3A 2ET7A 3CP1A 4FPYA 3M3IA 3AYDA 2B9VA 2XXZA 2BNOA 1N8RW 1PL4A 2VZVA 1N32B 5EJ1B 4JI1O 2ADDA 2W95A 2WSUA 3C7GA 1QXJA 1V55C 2VMIA 3PTYA 3J9SA 2F1MA 2WAAA 1ENSA 3RSJA 5DDJ1 3W20A 3V0AA 1I7FA 2OXBA 4FTBA 3OF1A 3OY8A 1VARA 1OBNA 4LQRA 3MDPA 4YVSA 1ZBE2 1AJOA 1K4DC 4EN8B 1WWYA 2UUBB 5HCAA 4HVQA 2MPFA 4X66B 1JU3A 1V9U1 4ASMB 5FRAA 1OD5A 4OX9B 3DV8A 4AL9A 1N36O 4RQFA 3VBOA 4LK6A 4ZOLA 3AFKA 3K0GA 1UZ0A 1ZX3A 3B00A 3A4UA 1SRYA 1JTZX 3K06A 1XHZA 5FXVA 4U36A 3L71H 4LCUC 4QX7A 5BNOB 1UYPA 4KWKA 3DYMA 3VBRA 2FB5A 4CDWB 3C3SA 2HJIA 4OHYA 2B9ZA 3KCCA 4XQWA 5GLUA 4BPZA 2IU3A 4EKWA 4D94A 3WUDA 4JGZB 4LA3A 3M70A 4IETA 4ZXKA 2NZ9A 2EILB 1Z2GA 4ISQA 3WNKA 4NIGA 2DQ3A 1LAJA 2QZ2A 1ST8A 4QX2A 4R9AA 4DV3B 1JOYA 1UO9A 2OIGA 3D0JA 1LB2A 2QNKA 2YBKA 1NQJA 4J9YB 4AW7A 5EC1C 3HNMA 4M0HA 4ZPIA 3T1YB 3LFIA 4IL6Z 1NCQA 2VS0A 2ADEA 3CC4V 4KBZA 3NNGA 4X1YA 1NLSA 3A21A 4X65B 5C6CA 1D0HA 5E88A 3OPZA 1LUWA 1KDMA 4KQ7A 3LSQA 4C0BA 1RTVA 3JBG1 4YW4A 3BRCA 3JCUZ 2BGOA 4CDXC 2D5HA 4NHKA 1HXS2 3NV2A 3RRDA 1CAUB 4J41A 3LOIA 3OBTA 5CA1A 2ZQMA 5JI9A 3TN92 1TUEB 1PGL1 4TWTA 4FLZA 1DGSA 2Y48A 1V6KA 4BK4A 1QJFA 3ETGA 1LHOA 3UK9A 3KHCA 1N3QA 1Q8OA 5LP6B 1IPJA 5JSRA 2YXYA 1POV1 1OOPB 4UFZA 2X7RB 1IURA 1O8SA 3I4IA 2PZSA 1FPN1 3VBFC 2DUOA 5FXWA 2E5LB 1LU2A 3ZN1A 1BMV2 4RS5C 4CU6A 2DE0X 2WKKA 3FC0A 4CU9A 2QQVA 4E27A 5LASA 1WBLA 2YV8A 4CCDA 4XE9A 2ZR2A 2I74A 1V6IA 2JVDA 4OUEA 3RYFA 3UGGA 4YJ3B 1XE7A 3VBSB 3WR0A 1LOCA 5FZ0A 5K8SA 1AL21 1IXMA 2RCVA 1US2A 1JZ6A 4TN7A 2BBAA 2ZDIA 3AP7A 4Z92B 1RUOA 5H5NA 2ZR3A 3UT5B 3OE7G 1AP5A 4G4FA 1TZOA 5FFOC 4XOGA 4TQFA 4Y26A 2CDYA 2JB8A 3WY6A 2JDNA 5BNOC 5IJ0B 4A7ZA 2MEV1 3AMQA 4MTFA 5T52A 1NCRB 3HT1A 5FREA 1PO12 3CD6V 1CEZA 2PUSA 4V2VA 4FAHA 1WW4A 4MVUA 2N7GA 1UU5A 1LGCA 1VP6A 1GUIA 3IJ4A 3HR0A 2ZJCA 1LEMA 4I0WB 4JGZC 3SDLA 2IM9A 4MGIE 5A7SA 5T5OA 1H0BA 5FTTC 4AEDA 3PUAA 5JZGB 1QNYA 1WLDA 2VH9A 1LODA 3ZYPA 1ZBA3 5C9AC 2CTWA 2WQZC 3IDEA 3I3MA 2VMCA 2EJ7A 4E4DX 2LFRA 5IT9N 3KCYA 3A0BZ 1ZTEA 4FM0A 3LIGA 1PO22 2DCKA 5GM0A 4QQPA 4CCOA 3W59A 2XGXA 5FYCA 4X1KA 4DR5B 3I2KA 3PU8A 3WW2A 2DBIA 3T4ZA 1YFUA 3MIGA 4PA6A 3ZJZA 3WU2Z 4YG0A 1KP2A 2WN3A 4Q0QA 3B93A 3KV9A 5A3OA 1OC1A 5B1NA 2XKOA 2YC0A 2BZDA 2Z3YA 2PHFA 1VQ8V 4DR7O 2D43A 2XWJB 1ASJ1 5FZDA 1US6A 3E35A 1V54C 2WS91 5FK7A 1XI1A 1ZNPA 4GLXA 5KUMA 2CHHA 4OI2A 2ADQB 1I94O 2PYTA 3ZRSA 5L3EA 3VZKA 2ZGTA 4AK3A 4L87A 5BMVB 2GNDA 3ORJA 1V00A 4QGPA 1Y4WA 2A1XA 2VQTA 4FFBB 2OS2A 2WNUA 2DYSB 2A5ZA 1FFXA 1W6MB 1NLRA 2Q8DA 4H2AA 1GAXA 1UXZA 1AX1A 3ROUA 1WMXA 1JXNA 5FZEA 3T2MA 2RDCA 2CV6A 3OYWB 3MDSA 3ZMSA 2DOSA 4W4KA 1MVEA 2NN8A 5BNNA 3K77A 1YQ2A 3O1MA 2EX3A 5D8AA 3RI8A 5F7UA 4AZZA 1YXWA 1B04A 2DVBA 4OPAA 1BCXA 1OLME 4DXRA 5IY5B 5IJ9A 1QJY1 2VBDA 2R9RB 2ZT9B 3UETA 3PUIA 2YEVB 5D2AA 1ZL8B 4NR1A 4RGKA 2FZ2A 1ZRIA 3I3BA 1LJ7A 1AVBA 3WQ7A 1EPWA 3G71V 2P5BA 3HB3B 2Q9LA 3AL5A 2GMMA 5F32A 4CSWA 3EJKA 2X0LA 4FSJA 2E76B 1S0EA 3RI9A 2V73A 3M3OA 3DKWA 5CFDA 3ZHUA 2DCZA 5A6QA 1Q90D 4XYXA 1ULPA 3W21A 4AAPA 1RFYA 4UUJC 2C1FA 1KUQA 3I59A 2JECA 2WQ8A 1UYYA 3AG7A 2JD4A 4HXCA 1DQ2A 1BQZA 3CLPA 5CVRA 2J1UA 1OA4A 3VZMA 4O4HB 5E89A 2CAUA 1V0AA 2UWCA 3SCHA 3ASOB 4K8ZA 2WUHA 5FMDA 2VZ3A 2D7FA 1Q6HA 4XHXA 1ROPA 1FAYA 3ASIA 2YFUA 2NM1A 4RYDA 1B35B 2QQJA 1Y9QA 3NJXA 2Y6FA 4LOSA 5IWAB 3VBUA 1GP4A 1GLHA 1SACA 2W1SA 3THDA 5FV3A 4CYDA 1QY4A 1H2LA 4K0KB 1SESA 2RMU2 5IYZB 2B42B 1Y6XA 3OEBA 5JPNB 4XQ4A 4D3WA 4O4JB 2D6LX 3VKMA 5BNPA 1AI4A 5DZFA 4IE7A 1CESA 4ASKA 1PM9A 1IBLO 4GKYA 4YY3B 3S5QA 5BR8O 1BHAA 4FPFA 2GBOA 4Y20A 4OQ9A 1SEFA 2QCSB 4N43B 4Y5SA 3JZVA 2EZPA 2J7MA 4CC6A 5LA6B 4C0HA 4IXLA 5CBGA 1GZTA 2K9ZA 1GNZA 1K34A 1YI2V 4P02B 5F2WA 3DTUB 3MV01 4YXWG 3IIAA 4V1PA 4P9OA 1UKRA 1L7LA 5FDBA 4FM1A 2OTLV 3PURA 1W6PB 4WVMA 3E1F1 1UY3A 1RUE3 3WD5A 4GWNA 4QDQA 1TA8A 3QNEA 4OX9O 2ZAAA 5J37A 2LW1A 2Q1ZB 2Y38A 2HWB2 4ZKTB 4JTNA 3VHPA 2YC4A 2BV4A 1LOAA 1OPMA 4LA2A 3J7NA 2YXSA 3I2GA 3LIHA 2GNMA 3MF9A 4JI2O 1Y74B 2LGWA 1VMHA 2HWD2 5BXXA 1ONAA 4CUCA 5IWFA 3AJYA 2P3JA 4UF0A 4JAAA 4KU8A 1IS6A 4IHJA 1NY71 5CG8A 3Q8FA 2N04A 5IFTA 1ND3B 2F66C 2I2SA 3MEPA 3IKWA 3DCQA 3WT3A 3HMYA 3GJBA 1FXHA 2VL4A 4H13B 4DW1A 3E5QA 2HWC3 5JCTA 2HLDG 1C8M1 3NKGA 1MS1A 2FDIA 3RW0A 2RG4A 4QB6A 1R1A2 2VZ1A 3ZXJA 4CZZA 4MOAA 5HXMA 2MK3A 3GHMA 1D4VB 4ZKIA 1X82A 1N1SA 4DQAA 1BMFG 4HPKB 2Z69A 2JG8A 5IVFA 3O65A 1RL3A 4PHZA 1QKQA 2ZKNA 4Y1XA 1YLLA 2VE1A 1AVMA 3WQBA 2Q69A 4PBPA 3IC9A 3HD8B 2ZXWB 2WSVA 5DEDA 3PTRB 2OW4A 4PDWB 2F23A 5LY2A 4F4LA 1NA1B 3KVAA 1WMDA 1FOD1 3ZMNA 3NO8A 4CPBA 4I3GA 3X2QC 3WW1A 4LBLA 1VQKV 2OX0A 2L9LA 2B39A 4NKGB 4XFFA 4X89A 5BNQA 1VRH3 2DTWA 2J1SA 3T4HB 3WB2A 4AG4A 4QPYA 4KBBA 3KHBA 2D3OW 5HCFA 4KNCA 5HCBA 4AILC 3RZGA 2HWF3 2QQWA 3K5LA 4ZIBA 1NI8A 2XAHA 1G8MA 2A3YA 1ZZCA 5LY1A 3CCVV 4A6SA 4FLUA 1BBT3 1D2QA 4FM2A 3Q4HB 2DCTA 2JICA 1ENQA 4EWDA 1AR62 2CDOA 2E5LO 1AR4A 3VDDB 2EIGA 3JD72 3SJCC 3NV4A 3QACA 2LGQA 1NYWA 2Z79A 5KMGA 5EIYB 3WQ1A 1CJPA 1FXVA 4B3MB 5L3GA 1JVMA 3LSUA 2BPA2 4RHV2 3O1RA 4NB5A 2OUJA 4RUFA 2KQXA 1AROP 1Y7BA 2ZCEA 3RJRA 5DUWA 3WG3A 4IYIA 1NZCA 4QHOA 5KAFZ 4ZZ5A 5JOWA 4PA4A 1MABG 3RZKA 4GMP1 1QQP1 3I2HA 4JKMA 2B5HA 4LLFA 3JALA 1GM9A 2ZMKA 3ZYHA 4AI1A 4U3JB 3NQHA 3MF6A 2GMPA 3ZX7A 2JGUA 1E1QG 2WLMA 3WZ1A 4RS5A 2QE3A 2H94A 4QQ2A 2VUCA 3GBGA 3OR7C 4J7KA 2CDPA 4XETA 3I3EA 5I0UA 5K1XA 1SA0B 1DQ4A 3LSSA 1VQOV 2HYKA 1DP0A 1XNKA 2G19A 1UIKA 5IVVA 1NTZH 2E6VA 1N4CA 1NS1A 1W6OB 4ORFA 1K9MW 4UB8Z 4LO4B 5JAXA 4LBMA 2LQTA 2BOJA 4TWKA 1GH6A 1EV12 2EF6A 3VBBA 3QLQA 4BAYA 2H6BA 5DG2A 4LHSA 3ZFFC 3N9QA 1ZA4A 3KT7A 3RWRD 5FZMA 4E8DA 5L19A 1PV0A 5E1RA 5LMUO 4JQTA 1R64A 4D6SA 1UZZA 5GLTA 1RJ7A 5A33B 2Y8KA 4JI8B 4XIKA 2JDPA 4JZRA 4N23A 2ATKC 2QQLA 1JZ8A 5KA5A 1R1ZA 2Q68A 2GC1A 3D82A 3BIEA 3VD3A 2HKOA 1QBZA 3ES4A 1S55A 2VXJA 1GO3F 2UUCB 2Q4PA 1MZEA 5T5LA 2SLIA 5LBEA 5DN2A 4LEJA 5FIXA 1M9NA 5BY1A 1OA3A 1YIFA 3THPA 1C57A 4FTEA 2D97A 3FAVB 3CJHB 2ETEA 4FP2A 2CAVA 2WT0A 3T1CA 1VAVA 3BPSA 3CHXA 2QQOA 4CXYA 4D7SA 1HRI1 4DV5O 1V9PA 1W0KG 2RS11 3EQEA 3H7YA 1QGLA 4DB5A 3W7TA 1WCUA 2X6AA 2CK3G 3T1HO 2HBUA 3K5NA 1HNXO 2VBBA 2PI4A 3ZO0B 1UY2A 3OBRA 4UW4A 5ITZB 2CTVA 3NL1A 2PN5A 4N21A 1Q8VA 4MVMA 1IKQA 4DV2B 2DFCA 4GX2A 3CRAA 4XDPA 3PDQA 3GWKC 1LNSA 4NTWA 1TGOA 3H3ZA 3WP3A 3E22A 1AILA 3SEEA 4QXHA 3JD1A 1GQGA 4X8AA 2E32A 1Q81W 5LGNA 4JI0B 4KU7A 5KWRA 1QJX2 3JARB 1VBE2 4LOTA 3RMYA 3S7EA 1X50A 4WBNB 1ODMA 2A6WA 2ZMNA 1NJIW 5JSPA 4LNUB 4JI4O 5LZ6A 1XNBA 1MEC1 3BIWE 1ORQC 3PIGA 4I50A 2PI5A 4V2WA 1LGBA 3POGA 2WC2A 1PZ9A 2J1RA 1SETA 3NW4A 3FUQA 2P3KA 4H14A 3WF2A 4IIJA 1VQMV 3FLRA 2PHRA 2P67A 4O2AB 4E4EA 4LE3A 1W28A 2JD9A 4W6XA 3HIFA 2WT2A 2XWBB 2IXLA 4IEQA 1VF6C 2XKPA 2WZR2 1CAVB 5F39A 1U5YA 2QTWB 4Y4RA 3ZSMA 4B4PA 2XR4A 1W8FA 1OLQA 4WFHA 1AI6A 2Q8VA 3USSA 4MTXA 2X6BA 1RUH1 4GX0A 2LO1A 1DGRA 4GZ9A 1H8TC 4IV1B 4CEYB 3CCUV 1A32A 4LFCO 4OI1A 2ZIMA 2M7WA 5C33A 3AZXA 3ZOIA 2WLKA 5IK8A 4PELA 1FXKC 4Q4Y2 1SZBA 2UWAA 1JMKC 5I93A 4X88A 2FD8A 4YGDA 1PZ7A 4BHPA 4D6RA 4AQ2A 1EAH2 4DV4B 4HFSA 3ZYBA 4QXKA 1S5JA 4AHXA 1RHI3 2IBZH 4Z8BA 4UVBA 4XF1A 3PLQA 1BS3A 1YTFB 3JASB 5KAIZ 3POIA 4A3XA 5F5CA 1RVF3 2UURA 2AREA 5EBWC 3WNLA 2BW8A 2RJ2A 2IC1A 1OCRB 1O91A 3AKRA 1VMJA 4DR3O 1NLQA 2EVXA 2ZAHA 1Q5OA 4LIVA 2E7TA 4ZONA 5LXTA 3OTFA 1X4TA 2QM7A 3WDWA 3ZPYA 5EZYB 1GM7A 4KWUA 1XUQA 4HANA 2XAFA 4K8XA 3B4SA 3WQ0A 4KG0A 4QB1A 4CP2A 1F4MA 1T2XA 5FUIA 3GZUC 3TCUA 3ACIA 5F37A 4P00B 3B09A 2P22C 3D5OA 4UFMA 1QU7A 1F5FA 3MIEA 3DXRB 1CIWA 2ADPA 4M00A 1TMF1 4Q1RA 2ZHNA 1OURA 1RUJ2 1M90W 5JOYA 1VBC3 3RZZA 5JVVA 3AK2A 5B66Z 3L73H 2W39A 2B4KA 3GJAA 1N3PA 2Q0AA 3KV6A 3SQOA 1Z78A 3MI8A 5FBJA 2BYVE 4LMFA 1XNQO 4LBOA 1LOFA 1S0VA 1S0CA 2Y34A 2P6JA 4XPVA 4K3UA 5DUXA 4FLXA 3HKBA 1UCXA 3HVDA 1C5HA 2EXKA 1E1RG 2QQNA 5J2TA 4MX3A 3O1OA 3POBA 4JGYC 5FPZA 2JDZA 4X64O 4UB6Z 2GH8A 3H0OA 4M3CB 1GP6A 3S0MA 2EAAA 3ZFEB 2PMWB 1JZ2A 4Q0PA 5A6XA 4Y1VA 3THCA 5LA0A 3NXSA 1BGYH 2JWPA 1M4WA 4HYOA 2A3QA 5EZWA 1NBMG 4EZHA 1OZ0A 2GTAA 3DXUA 4YW2A 2CH7B 2WNVB 4EB6B 1DDLA 3ZLIA 4OXSA 5IYYA 1XNRO 1PM4A 3WF0A 4BISA 5FYUA 2VVEA 4GUNA 3OSDA 3ZM8A 4DV7O 4EQVA 3OBAA 4FFKA 1TAEA 5IAVA 3RNSA 1DZRA 4TLFA 2GAUA 3CSXA 5K0UB 1V6JA 5C3QA 4JPRA 5JI7A 2BSKB 3BCCH 2OZ6A 4R4XA 1R6NA 3ZR5A 5DAPA 2NLJC 4MT8A 2VQUA 1RMU1 3GZEA 2VGDA 1KC8W 1H4HA 2CSGA 4WFBV 4ARYA 2R72A 3JUUA 2W47A 1QDCA 3VOUA 1SFPA 4IE5A 3UO2A 4ARXA 1IQAA 4JKKA 4LHNA 4MUVA 2PAKA 3CXHF 5C8WA 3H8UA 1H1IA 4TV9A 4CEWB 3WOGA 4AGVA 1ULFA 1RUG1 5BPXA 3WCSA 2W1QA 3LF7A 3N35A 1RUI1 1KU9A 2J1VA 1J3QA 5A7QA 3Q8BA 4A7KA 5DAWA 1CAXB 5J2UB 1SBFA 2EXJA 5GW7A 2WFF2 3C2UA 3T2OA 2R1DA 3NAPA 3AP9A 5KC6A 2W08A 1QEXA 1ENRA 4C1WA 3NV3A 3VBHC 4MGSA 4XBFA 5AG2A 4MVOA 3NVCA 1OVPA 4QJFB 3K79A 4YHHB 1PIV1 1XOYA 2ZGMA 1S1AA 1OV9A 4P9GA 2XVGA 5FLXN 4N90A 2Q8OA 5JR7B 4J11A 1JPXA 1J84A 1R6TA 1RUC1 4AI0A 5A3NA 2YG0A 3OGJA 1LUVA 1WGPA 1EZJA 3MLKA 3VUOA 5CB4B 1IGOA 4Q4W1 3B8MA 4RQPB 2DWEC 4QX8A 1MQTC 4Q26A 1SERA 1N34O 2WT1A 2DW4A 2DF7A 2R071 1OA2A 2B1GA 1URFA 3JYCA 3N7LA 1HX6A 4UI9L 1Y3TA 1HR0B 5IATA 2IVJA 1M06G 3PHMA 1TVKA 4K8RB 2E33A 1N1YA 2GDFA 1W8ZA 1KJLA 5EHDA 4ABMA 3WG2A 4B3SB 1EFRG 5E6HA 2R041 5CA0A 5KX5A 2V4AA 1XEQA 3SH4A 2ORZA 4LBQB 3WNNA 3TJTA 1HXS3 2Q6AA 2WNVC 3A8TA 4S2HA 2Q67A 4EN7B 2QM8A 4IGGA 3CJIA 4C1XA 3ZFFA 4F6RB 2WL1A 3FYEB 3U1XA 3VKLA 3V0BB 1ULGA 3ZHSA 3V56A 3WW3A 3GM8A 5K0UC 4JYBA 2O14A 4WM7B 4NHMA 1JZ3A 2BGPA 5FZ9A 4YG3A 1YQCA 2VCBA 1D2DA 5FO9B 1YYNA 4CCMA 1WBFA 4HNAB 2UUAB 1OCZC 2ES3A 3RZJA 1N33B 4GX1A 1ZZBA 3IAYA 1OXCA 4MGKE 2ZGPA 5JUVA 5LEJA 1BHBA 1KQRA 4NMIA 4JV5O 3FLPA 3SH5A 2WAMA 2WPDG 1X9TA 4CEWC 5J3UA 5LK5A 1L3JA 4XMAA 2RS32 5A7WB 1HKDA 2JKBA 4UFHA 3R4UA 1CD3G 4DINB 1P49A 2C26A 3RVHA 1XL4A 1L0NH 3N2KB 2R063 2XQXA 5B3SC 3B3QE 3AXDA 1P4RA 1D4M2 1W90A 3VL8A 5FOBB 4AFBA 4ZHQA 4OHXA 3J8F3 3KLSA 3T2PA 1AYM3 1ZBE1 5DAVA 3OT7A 2EIBA 5FZOB 2EIJC 2IJHA 4COUA 1X59A 2N05A 4LK7A 3SC7X 1DF5A 2DUPA 3VGIA 3ZIWA 1S72V 1O6UA 2OQ6A 4BYYA 4NVPA 1W9WA 1GN6A 2ZGSA 5FQ0A 1H8EG 4A2UA 4UT5A 4YVWB 2ZZQA 4TOIA 3EYPA 2VMEA 3AP6A 3LEGA 1XYOA 1NOVA 2UXBO 2QSAA 4LBNA 4FPCA 2QQPA 1EP0A 1ZSPA 2RN9A 3ZRWB 5LYJB 4AI8A 1I9RA 5JXIA 4DO2A 4AQYB 2QDNA 3VKOA 1TVGA 2OT7A 1PO23 2YSUB 4OHZA 2BU9A 2X6CA 2NPIA 4PI0A 2JS5A 4YYOA 4LORA 4YWAA 4IEPA 4P9JA 1YXBA 3KG2A 1OQ1A 5C8YA 1TUBA 2OYZA 1MS8A 4DUZB 2YXLA 4A5UB 1EYBA 5AFEA 4LF9O 3OUSA 1RUF3 1S2BA 2WDBA 2VNOA 1VP7A 3SYOA 2MW2B 4E8CA 3LB9A 3NKTA 1H2KA 5LMNB 3CYOA 2XBO1 3ML0A 3H8RA 2VMGA 3V0AB 5KHJA 1XBFA 3AP4A 1EBOA 4DR2B 1PK6C 3OMIB 3WSOA 3MZHA 4C7UA 1E5IA 1XB9A 3IDCB 4JI5O 5FYSA 2OZJA 1COV3 3A0HZ 4CDUB 3GCWA 1GR3A 5GLZA 2UXDO 3OEEG 4QPGA 4CDQA 4RQEA 4QPIB 3N9OA 3VBOB 4NO4A 2V09A 1JH5A 4ZOLB 2J22A 2CGOA 1IBKB 2OCCB 1VF5B 3IBMA 3PVNA 3AK1A 1SQQH 2XJRA 3CRMA 1KP3A 1BLZA 3TN91 1LEDA 2A3XA 3QVNA 1QJU2 3SPCA 3OW2U 4H55A 4R4ZA 2XNDG 3F7VC 3BN6A 3LPGA 4I09A 2W92A 2VPVA 1HJFA 5FPRA 1VALA 1SFYA 1PGSA 1NR7A 4JTDB 1UMIA 4YJ2A 4LO5B 2ZTNA 3CBNA 3TEWA 1R083 3ZFGC 3M7AA 5JJEB 1NU1H 1UQXA 3K03A 4DFSA 2GP5A 3U4XA 2WYFA 3D3IA 4R52A 4NXNB 1RUE2 1MA1A 1T5EA 2VMFA 3ABKB 1LNQA 4JGSA 3Q9OA 3WB1A 2VW0A 3RGBA 3A23A 4ZI7B 5J1XA 4QGMA 4Y5TA 4QQHA 1GZCA 4IEWA 1MPXA 5C5TA 4YVWC 2WZPP 3CEWA 2KSDA 1CX1A 1VRBA 4GB33 1HNZB 1AR81 3RQ0A 1KB9F 1THZA 1JYVA 1NCQB 2GTSA 2WR9A 5ABJC 4RR3C 3E8GA 2QQIA 1URXA 4GALA 3O14A 5FOJB 4X1YB 1PNLA 5FYTA 4ICGA 4N53B 1AP6A 4GKJB 1PO11 3FHAA 5IK7A 2QGNA 2DBNA 2KB1A 3OBZA 4JZGA 1A34A 3HPLC 4QX3A 3OD0A 4P14A 1R3IC 4LJHA 1DLBA 3ZMOA 1IBMO 4PDRA 2HWC2 3NR7A 1BVVA 4O2BA 4FVVA 4LLOA 4NN0A 2QDOA 4PD4F 2RS53 1W6NA 1A78A 4PJYA 4UYBA 2RMU3 1OQDA 3LA7A 4KWJA 5D1IA 3ST7A 2P4VA 2RQ6A 1W8HA 5IE9A 5B1OA 1L1FA 1NQTA 4QD2A 4AFMA 2VUDA 2BGCA 4CDWA 2KXLA 2XPJA 3B2EE 1VBD3 1XQ8A 2LM3A 4AR2A 3BAAA 2VECA 5FY5A 4XFHA 3ABLC 1QLEC 1XPWA 4YVSC 3ALQA 1W6QB 3AKSA 1XNAA 2IFRA 5FZKA 1ND2B 3TETA 1H8VA 1QF3A 5L9VA 3GZAA 1EN6A 4C90A 1XYNA 4XJUA 3K3OA 3TNQA 5HV0A 4FTSA 4H7LA 2X29A 3E6CC 1UJWB 1GP5A 1O7FA 2WZ8A 4ZU4A 1VRH2 3NMBA 1VMGA 3ABZA 1P84F 5CBFA 2A75A 3VBOC 5CA3A 2QWRB 1R093 4X62O 3S6PA 2JE9A 4Q20A 1TQ5A 5DDJ2 5HBAA 1D5AA 2CL2A 2Z0AA 1D2SA 1W8OA 3VZJA 2Y6KA 4HMZA 4L99A 3P6BA 3OD4A 2P34A 3VBRC 1YJNV 2YU2A 3VDBA 3O1VA 4GYCB 4JI7B 2Y0IA 5F2SA 3GHNA 5AC91 2JDAA 3BYWA 5FZ8A 5KXEA 4NXMB 2VG9A 2FMDA 4MS2A 4OLLA 4GA9A 2A70A 4I9QA 2XHNA 1VQNV 2DCYA 4OI4A 4XHBA 2HWD3 3HQRA 1G6UA 1YRZA 2F4LA 2GH2A 2YUEA 2DCJA 1QHTA 1CAUA 2ZMLA 2PAMA 3J7LA 3ABKC 3IB3A 3DGEA 4EJRA 1BEV3 3AG4C 3DSQA 3TRSB 1J58A 4HLTA 1JN2P 4BIFA 3RS6A 2A71A 3J7MA 3NNMA 1NE4A 1ULOA 3ZN0A 5LP6A 4CE8A 1XDCA 4X1KB 1LHUA 2WWJA 5FP9A 1OOPA 4LF5B 4QWNA 3HBZA 1D0GA 3UKMA 4YIOA 5ISLA 5G05L 1X7NA 1SG3A 1O3TA 2FMLA 5GJ6A 1NCQC 2BNMA 2OQ7A 1IXBA 1H8HG 4Q4X3 1LU1A 4DXWA 3T08A 2D40A 3FJSA 4YJ3A 1J3PA 2WIIB 3PMSA 3VBSA 5FLJA 1ZRRA 4HKOA 1CZVA 1CPMA 2O1QA 2RM23 5FYBA 3J80N 4Y3OA 3R4DB 2G9GA 1PX4A 3UT5A 5KXCA 2IJIA 3PUQA 3DXTA 1NH2D 1Q8IA 2JGDB 2P3YA 1NT2B 4L2NA 4BQ4A 4A3ZA 3K4ZA 4KHPB 4QNHB 5IJ0A 4COZA 2JG9B 3DGTA 2IFWA 3AK3A 3K4AA 1AZDA 1NCRA 2WNUB 2FDKA 4EN0A 4NJ4A 1FFXB 2GSYA
chains in the Genus database with same CATH topology
4C0HA 4IXLA 4SBVA 4XIOA 3TBDA 2C0ZA 2VNGA 2PHLA 4MXVA 1UPSA 1A6CA 1VBE1 2K9ZA 1GBGA 1GNZA 1UD1A 1NY72 1PO13 3K51A 3M3CA 4UBHA 1AXZA 1NXD1 4ONUA 3IIAA 4V1PA 3E6BA 4PCRA 1UKRA 4WVZA 2UY8A 4XZPA 5GZFA 1HRV1 5FDBA 3J4UH 1AR63 2Z5WA 4XF0A 1SDWA 4QPGC 1SMVA 4CDQC 1W6PB 1AYN1 3G7DA 5JZGA 4WVMA 4QX5A 3U10A 1RUE3 3WD5A 3JD73 5A3LA 1C8M2 5FMOL 4GWNA 4OZXA 2DWRA 4LUKA 2ZAAA 4FQ4A 5J37A 3DUIA 4PIZA 1GYKA 2LTNA 2Q1ZB 4HN0A 2Y38A 1ASJ3 2HWB2 4ZKTB 2O8OA 4K21A 1VJ2A 4JTNA 3VHPA 2WS93 1CN1A 2XBO2 3GBWA 2YROA 1DRYA 1U12A 3GBFA 1LOAA 4N9IA 1OPMA 3LA3A 1ULDA 4RQPC 4LA2A 2YHJA 2YXSA 2W52A 3UJQA 2PHXA 3KS7A 3RYKA 4BGMA 4K1ZA 2GNMA 3MF9A 2D98A 2AENA 5IK5A 3GYDA 3WNXA 1UN1A 4D7YA 1PVXA 4F8AA 2HWD2 2OVUA 5BXXA 1ONAA 2YMZA 5A3MA 4N53A 4TZDA 3MLJA 4GH4A 5CFCA 4CZSA 1O4TA 2VNRA 5I0TA 4CWDA 3AJYA 3KM5A 3LGRA 2P3JA 4JAAA 4KU8A 2F6BA 2XLAA 1Q8SA 1IS6A 4OJ8A 3H7JA 1NY71 2DUQA 5CG8A 5EYYA 1TNRA 4BGKA 1ND3B 2I2SA 3MEPA 4M3CE 1KRIA 3IKWA 4LO7A 2H0VA 4KGGA 3WT3A 5GALA 1YI7A 3HMYA 4XBNA 4G3YC 3SNMA 4XJ9A 1MZFA 5FBZA 3E5QA 3KZ4C 2HWC3 4AEDC 5JCTA 1C8M1 2R0HA 3NKGA 4XBQA 1MS1A 3GNEA 1H2NA 2R0FA 3VV1A 2HWB1 1R1A2 3B01A 2R1BA 4FCAA 1F8VA 2R49A 3ZXJA 1LOEA 1YNAA 2AUYA 2GC2A 5JIUA 3ENRA 2IXKA 3TYJA 4AQ6A 1XE8A 4BQ1A 1GQHA 1OTJA 4TYSA 3GHMA 2BFUS 1VIWB 1D4VB 2OIIA 5GLWA 1X82A 1CAWA 1N1SA 4XTMA 4DQAA 1LENA 1JR7A 3WVJA 1OMIA 2JEMA 3AMHA 4I01A 4HPKB 2Z69A 2ZGKA 5KC5A 5EYXA 1AXKA 3POYA 4LR4A 2JG8A 3D6EA 5DZGA 3ILFA 4R8HA 1QJY3 3VBHB 2X5IA 1Y0ZA 1RL3A 5JLVA 1QKQA 4WVWA 1H8TA 4XF3A 1W6MA 2ZKNA 2ZX3A 4FP3A 1YLLA 4Y1XA 1GZ9A 1V6OA 1G9AA 4Q29A 2AH2A 1W6QA 4HKLA 3HT2A 3VBUB 4FPKA 3H3UA 1PM7A 2DU0A 3LSEA 5CG9A 4P9IA 5AC93 4PBPA 3HD8B 4WM7C 4JDOA 1ND2A 3AZZA 2WSVA 4HBNA 1X33A 2A6ZA 4QHBA 1IZ3A 1BJQA 2OW4A 2VXRA 5DUUA 4PDWB 2F4PA 5AFBA 3OYWA 4PF5A 2XJVA 1NA1B 3HN1A 1HLCA 1FOD1 1WMDA 1PVC3 4FFAA 2VQAA 3RYPA 3NO8A 3ZMNA 4O9EA 4L92A 4I3GA 3HAGA 2WINB 4E4SA 2W68A 1FV2A 1XRUA 3WW1A 4BA6A 4LBLA 1O4YA 1WUVA 1QXPA 2GMEA 3E97A 3A0KA 2B39A 4XFFA 5BNQA 5LRRA 1VRH3 4WV8A 1UZYA 2DTWA 2WBOA 3BPZA 2R30A 4AG4A 4QPYA 4KBBA 3MIFA 3AKQA 4AQTA 1AR82 4E4ZA 5HCFA 1C5IA 1MQTB 3NJZA 1R1A1 4KNCA 5HCBA 3U11A 4IV3A 3VHNA 3M2MA 3SXWA 1FMD2 3MPBA 1CQ9A 2HWF3 3KGLA 4IESA 2C9AA 2GNTA 3N7JA 1SLBA 4MGYE 2A3YA 1ZZCA 3ECQA 1SLLA 3ZXFA 1BBT3 3LSDA 1D2QA 4YGBA 4DY3A 4CDWC 2DCTA 2JICA 3IT8A 4JC1A