4BIOA

Factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 104
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4bioA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bioA01
1H2NA 4B7KA 3OD4A 4NR1A 1YCIA 2ILMA 1H2LA 4JAAA 1MZFA 1MZEA 2W0XA 3KCYA 2WA4A 2WA3A 3P3PA 3D8CA 2CGNA 2XUMA 2CGOA 4BIOA 4Z2WA 4Z1VA 2Y0IA 4B7EA 1IZ3A 4AI8A 3KCXA 3P3NA 4QU2A 1H2MA 5JWPA 2YDEA 2YC0A 1H2KA
chains in the Genus database with same CATH superfamily
4A5UB 1THZA 1OKOA 3M7MX 1YDXA 1LU1A 1V9U3 2WSVA 1AI7A 2B46X 2WFF3 2XXZA 4HFSA 1VBB1 1WA6X 5EIBD 3ZN6A 4IEWA 4QAWA 1TVGA 5J96B 4QKFA 4O9GA 4MOAA 2EXHA 3T1HO 2QE3A 2Q0OC 4WV8A 4GWMA 1OOPC 5CBHA 1AJOA 1LHOA 3N36A 3BUCA 4NROA 3E2EA 2ZGPA 1RXFA 3ENRA 2IJKA 5J2UB 2BTOA 4B4QA 2GMMA 4GWJA 2E5LB 3GWKC 2XNDG 2FDHA 1AXZA 4WM7A 1BHBA 4K8XA 1WA4A 3E22B 1LOBA 4RD7A 3M3CA 5GW7A 2B1IA 3ACHA 4YGDA 1REDA 2ZJCA 5L36A 4HANA 3VBSA 4A41A 4Q20A 1OCCB 2RS12 1XBFA 4XABA 2YICA 3AG1B 4B1LA 1SFPA 4S2FA 3TRSB 1TUBA 3ZRSA 4JGZC 2GH8A 4HK8A 3WDXA 3TNQA 3ZDSA 1NH2D 1X8EA 2A75A 5A3WA 1L0LH 4FTBA 3RW0A 2IWGB 2K2SA 1G9BA 4NHXA 1I0HA 3G6EV 3HKBB 5CFCA 4AI1A 3N2GA 5FO9B 4X20A 5FIXA 4M00A 4JZRA 5L3EA 4AEDC 2ENRA 3GBWA 1W03A 3M4FA 5FKBA 5L3GA 2UUBO 3ACLA 1LCLA 2R9IA 4NAMA 3JALA 3P6BA 2DFBA 1PO22 4M3CA 2XAJA 3AG3C 5FPUA 2XASA 3ZFFA 3Q9OA 1FXHA 2X10A 2ZE6A 1VQLV 4Q4X3 1QHDA 1FT9A 5BNOC 3RI9A 5IK7A 5FJHA 2ETEA 3KF3A 4EQVA 1K7DA 1V54B 2V4AA 3KM5A 3CZUA 4FZ0A 3E5UA 4NPLA 3MEPA 5FRAA 3K0DA 1C3HA 4X8PA 4NTWA 4A7KA 2DYRB 2VMIA 2UXNA 5BPXA 3B77A 2DOSA 3IN9A 4LK7A 4QB6A 2H94A 1S3JA 1R093 1D4VB 3B8NA 1EPZA 4XDJA 4YWAA 4AILC 4RUEA 1DQ2A 4W8JA 5LBEA 1W8NA 1N1TA 1GN6A 1JHNA 3GHMA 3VQWA 3JAWA 4Y24A 1GBGA 1UOBA 3HVDA 4GH4B 4HKWA 4CPBA 5FWEA 1REEA 2HJDA 1XNCA 2WT2A 3A7QA 1PPJH 3WOGA 1SCRA 1OCRC 1QXPA 2JICA 4WVWA 3NL1A 1EUUA 1NLSA 3HNYM 3UT5B 2LW8A 3WLUA 2JJ6A 2CTPA 4AHCA 5JCOA 1V9U2 1XYOA 2D6PA 1JZ8A 1FNYA 3B2EE 4FJCC 4CCDA 3NNMA 1EV11 4XETA 4PI0A 5K1XA 1Q82W 4OI2A 2ZGMA 3PMEA 3VBOC 4LOTA 1RPOA 4LF8B 4CUCA 1X8MA 4QXKA 4EJRA 5EBMC 1CPNA 1W6OB 4L97A 4XHBA 1L7QA 1XNBA 4NOTA 3VL8A 2QDOA 2QBXA 3SPIA 1DZTA 4PDVA 4UV8A 3ECQA 4XQWA 4RHV1 1PM7A 4R9DA 4NRQA 5FZ0A 3RPQA 3OR6C 3MHZA 4JV5B 3GNEA 3IB3A 3MFAA 1OOPB 4H55A 5FMOL 4QKNA 4I55A 3OEBA 5KC6A 1BBT2 3JAKA 2F1MA 3S57A 3VQVA 2VQFB 4DPNA 4XJ8A 1PZ8A 1NKDA 2WFF2 1SZBA 2VZRA 4P2ZA 2GHYA 4XF3A 2HG5C 4LBLA 3LPFA 1GSLA 4AG4A 4AAXA 3AZXA 4YVSA 5IWAB 1GK9A 1A8MA 5LRRA 5L3CA 2QZ2A 1AR61 4HPKA 2YC0A 2HJFC 3NO8A 3D3QA 4A42A 2ZXWC 1FPN3 3H9VA 4DINB 4ZHQB 3IDCB 1MR5A 3S6PA 4NTXA 4DK1A 1JI6A 3IMNA 3KLSA 4AAPA 1RUH2 2JEUA 1M57C 4QM8A 2PHWA 2QJVA 1SZTA 1QJX1 4G3YC 4E4EA 3LDCA 1IS5A 5A7QA 3AX4A 2JS5A 1AR83 2FCTA 3EJKA 3J26N 1FS0G 5KAFZ 4P5HA 3G4SV 1DGWA 1GZ9A 4XE9A 4E2SA 3BFRA 4WF9V 2QNKA 3HN1A 4PELA 2Z69A 2UWCA 2WZR2 3E6CC 2CAVA 2D3RA 2W3JA 4JC1A 4FXKB 2W95A 4LCUC 4XW3A 2ZGKA 3BVCA 3WCSA 1OA3A 4KGQA 2VZPA 3CJHB 2VTXA 1W59A 5H9RA 1CAVB 3MF9A 5JZGB 3ABZA 1DBNA 3RVYA 1WMXA 3OGGA 2EZPA 3IGAC 4Q0SA 3FBMA 2ZGLA 2P3JA 4GAZA 3HD8B 3OUFA 2A3QA 1ALYA 4R4XA 2VCBA 3ZYIB 4BCUA 2W2IA 1PGL2 5DN2A 2GNDA 3WFVA 4CDUB 3T3YA 1T6BX 3I59B 1YXWA 1SQFA 1UMHA 4LA2A 3N7LA 3BCWA 1M57B 4K3UA 4JI5B 2ZGTA 3CMEV 2AYHA 3BVOA 2R30A 4M01A 3MV11 2PYTA 1MQTA 3T4ZA 2ZKLA 1X36A 4CS2A 3MW3A 3NXSA 1N33O 4BQ1A 5KA6A 3SCGA 3H3ZA 4NIIA 1QIQA 2Q5ZA 1GM7A 5I0RA 3WQ0A 3VDAA 4CP9B 3E1F1 2LJ2A 1YJLA 4UFZA 4WFAV 2FCUA 2DVGA 2Y0PA 2A3XA 3T1MA 4N53A 5JSPA 3TXSA 5LK5A 1R1ZA 3H1IH 4CBCA 1I6XA 4YGCA 2BU9A 2NM1A 4KWUA 2VCMA 2WZPP 4EV0A 2BSKA 2QA4V 3R4SA 3P3NA 3IWZA 2J1VA 2NNUA 5KX5B 2EVXA 4PD4F 2QR4A 3NWKA 4H2AA 1S2BA 1VAVA 1STMA 2C5DA 1HRV2 1N34O 5FYSA 1BXHA 5FL7G 5B1BB 4JHZA 3LWCA 5FPRA 1BJQA 3F7YC 2ZACA 1U5IA 4P14A 5L7OB 4LJHA 2W0XA 3OTOB 3N2KB 5AC93 2W08A 4FCAA 1V0AA 4LBJA 5JJJB 1IQDC 2FCVA 1MABG 1H8HG 3LSDA 3B02A 1ZZBA 1IBLB 3MUZ1 5JVDB 1US3A 3UL2A 2RVAA 2RJZA 1XNRB 3V64A 4RS5A 4X1YB 1ZZCA 4Y1ZA 1MOFA 2ZMNA 2ZCEA 4H14A 2ZGNA 3K5OA 3BN6A 1H0BA 1DQ6A 1H1MA 4CH5A 2M6YA 2CTVA 4V2WA 1DQ5A 3SLIA 1VBE1 2PYJA 3ZFGB 2WR9A 1GOFA 2D5HA 1POV0 4LF6O 3PHMA 2R49A 1F8VA 2HBUA 4YJ3B 1XE0A 1Y3TA 4OHWA 3DXRA 5B1NA 5T5PA 1V6IA 2PHRA 5DAPA 3KT7A 1BSMA 4XTPA 3TCUA 2RV9A 1EZJA 3CJIA 3L75H 4QX5A 2B5HA 1UX6A 1LB2A 4H7LA 1K9MW 1D2DA 2HVKC 2G19A 5IWAO 3LSEA 2YIBD 4QDRA 3A0RA 2JDAA 1QOOA 2CGNA 3WDWA 1JZ4A 4I2OA 3JCUZ 5KC5A 1JODA 4BOWA 4ARYA 4R7CA 3OW2U 1JW6A 1GQGA 5A33A 3L71H 5F39A 4WBBA 2RJ2A 1QJX2 4CDQC 4EB6B 5A3MA 5DZFA 3F5TA 3SEEA 5J2TB 4IL7A 4DEQA 4DRVA 3ETDA 3Q4HB 3I55V 5KUMA 5FMCA 5BXXA 3AK2A 4R8HA 3C8XA 4FMTA 4DO2A 4E2QA 1QDCA 3J4UH 4KFMA 3W7SA 1VQ6V 4DEVA 5A70A 3VZKA 1NZ6A 1DGLA 2N04A 1RM1C 4WVVA 1G8WA 1RXGA 2BWAA 1W2AX 3AM2A 3R0RA 2R70A 2ADDA 5BR8B 1W04A 2GDSA 5HPOA 2D2CB 2TEPA 1CEZA 3U1XA 3SJBC 2JEMA 5LK7B 4GD4A 1XREA 4WM8A 4XVHA 4DZGA 5FPAA 3B93A 4AHZA 2HEYF 5F5QA 2VM9A 3ZFEA 5FMBA 2X29A 2OT5A 4JI5O 3OD0A 1DF4A 4KBBA 5HCFA 1GN3A 4K1YA 5A6XA 1C1FA 4ZKTB 4DR5B 2QQIA 1UKGA 3MBWA 1VE0A 2G9GA 1C8NA 2WT0A 5AC92 5FZOA 5F32A 3AJYA 1W8ZA 3K04A 4KHPO 1UYXA 4LEJA 5L3FA 5IY5B 3ZMVA 1OFSA 3B4SA 3AYEA 3WU2Z 3G6BA 4D8MA 3EBRA 4IV1B 2IXCA 5J48A 5HFLA 2OCCB 1AR72 2ZABA 1Q6HA 2CGOA 1IOAA 3O1SA 3BTZA 1FV2A 5H9PA 4G4FA 4ZS2A 1KECA 1SA0A 3T2QA 3NSTA 5FP9A 3LZZA 4DUXA 4UCRA 4DRXB 1ZL8A 2X09A 2IXHA 4RQPB 3NR7A 4EEQA 3PUIA 1NYWA 3JSNA 3KZIZ 1D5AA 3DC5A 3AZYA 2BUKA 4A3XA 4TV9B 3NAPB 1OZ0A 5JIAA 1REFA 3VBHB 1PO12 3WINE 4FPJA 3WB0A 1GKFA 4PIXA 3VDBA 2JXAA 3WXPA 4I0BA 2P2KA 1RUC1 4YM0A 1DYOA 2XVKA 3A22A 3DPRB 5FMDA 2VOTA 4CYDA 2D3OW 2B42B 5IY5C 4NHMA 3AEIA 1WLCA 5BY5A 1GANA 2YC2A 5ABJA 4Q1PA 2MW2B 3SQOA 3AJZA 1HV1A 1SLLA 4BW5A 1SS3A 3CCMV 3WZ1A 5DABA 1YNAA 2Q7GA 4TT3G 3WR0A 4NHLA 5EYPB 2LS6A 3MW2A 3ASOB 4M4RA 1BEV2 3UT5A 1SCSA 1NXD1 3JBG1 3AKPA 2QQNA 3OAAG 2H3OA 2O14A 4NN0A 4Q4V3 3L73H 4XFGA 3UCSC 3O1TA 4CH3A 1IGOA 3ZYBA 2E5LO 2A70A 4UFIA 2ORXA 5JLVA 4FPKA 4LPLA 1N0NA 4U3FH 3UNPA 2E76B 3UKTA 3SYQA 3WQ7A 1R6KA 5I0DA 1TME1 2OPWA 5JXGA 2YFZA 3AVRA 2DYCA 4M0HA 3J8F3 4SLIA 2DVAA 3JASA 2Y33A 1BYHA 3K57A 1W6PA 4I3PA 1LECA 4NVPA 3N9QA 1W06A 3B09A 5L3BA 2EINC 1BT8A 4WFBV 1LGNA 2UYAA 1YIJV 2WQZC 3NV2A 1P8JA 4BK5A 1UL9A 1TMF1 4OZOA 4H3WA 1AR4A 1WMDA 2OCCC 1HRI1 1AILA 3O0XA 3ZSEA 4XQDA 3DXUA 3NNGA 2EF6A 3CP1A 1WLTA 3IBMA 2E7TA 4XHXA 3FX7A 4OZXA 2FDFA 1K33A 4X1KA 3DC6A 5LWBA 3ORJA 5LY1A 2A71A 5C8WA 3K4ZA 1PK6B 4CCJA 3OGCC 2Q8DA 2NZ9A 5FYCA 5L9BA 5DDJ1 1NE6A 3W58A 4META 4FP2A 1WLEA 3KQ4B 3HPLC 3UJQA 3I2KA 4YHHB 4NKGB 5FO7B 4B3NA 1AR81 3J8F1 5C93A 5FZMA 1PGL1 2JDYA 2FD8A 3H1MA 2OIEA 4N43C 1VQ5V 1O9HA 4QPIC 4B3RO 1B3QA 1FFXA 4K35A 4Z07A 1CAVA 2UUCO 4K6BA 3NNJA 1GUIA 2WNEA 5JZGA 2YBKA 1S55A 5GLWA 1MEC2 1LHUA 2JG8B 4N43B 5A3NA 4QDQA 4TSFG 2IVIB 3H9AA 2Y6GA 4Y4RA 1AR63 3CEIA 2C9AA 4NRMA 4FPHA 4LBQA 5C3SA 2RS13 4YZ5A 1YEWA 1G86A 5A6QA 1LGCA 2EJ7A 2JE7A 5D8AA 1JA8A 3E8HA 1AJPA 4MGTA 1JYXA 3RYIB 1US6A 4LE3A 1Y74B 4D7TA 4LLOA 1VMGA 4NXMB 3UK9A 2YGLA 1SBEA 4PA9A 1MQTB 3ZRXA 3SGIA 2V5DA 3QLQA 4NHYA 5FLHA 3C3VA 1MA1A 2WFPA 4J10A 5F3EA 1XNRO 4JI1O 3OTFA 1BHAA 3ZCCA 4J25A 4QQ2A 5T5JA 4XJUA 2VR4A 4IGPA 1FXKB 5DUXA 4MVUA 1H2LA 3AYCA 4ISRA 1XOUA 3UQ8A 4PIZA 1SQQH 1O8SA 4CU7A 3T1YO 1TA8A 2E74B 2Z4FA 3LUTB 1CWPA 4JPRA 4X66B 1QLEB 3NJVA 5GONA 5C8YB 4O4HA 4YW4A 3RQ0A 4JV5O 5L3DA 5HXMA 4RFT0 3TB0A 5FK8A 4JDNA 1D2SA 3JSLA 4LR4A 3MYXA 2A6XA 4DW0A 2ZR3A 4JGYA 2Z2SB 4RO2A 3ZXKA 4I09A 2VZ3A 4DYLA 3WVJA 1VBA3 4BQ5A 2WS91 4AQ6A 4K9SA 4E2GA 5FZGA 1COWG 1Z0HA 3QD6A 1ZBE1 5KHHA 4TLFA 1JFFB 1RVF1 1XYPA 4CP2A 2XBO1 3SR2C 5GZDA 4H0LB 1QDOA 1FOD3 3KVBA 2RJKA 3J8F2 4LO7A 3GB7C 2AZ2A 5FY9A 3FB6C 5DZEA 4MVMA 3SH4A 1DGRA 1Z7S3 3APBA 2DN9A 1A78A 2ZGUA 4UVBA 4CVUA 1QH7A 2CWMA 1FPOA 3O1RA 3VBRB 1UYYA 4XAEA 4ZBMA 3PIGA 1N8RW 1JHJA 4F6EA 2MPFA 5JIUA 1KEXA 1YXBA 2ZHKA 4N7UA 4CS3A 1GZWB 2E51A 2F93B 5E88A 3LOBA 1NI8A 1GLHA 3LSSA 1RUI2 2ZGOA 1HB1A 3ABKB 4CPBD 1GWLA 4JRAA 2G9ZA 1ZRDA 4TLGA 3ES1A 4Q4W2 3PU8A 3R4UA 2DTWA 2XUEA 3LSQA 2QM8A 2GAUA 1Q3EA 1KP3A 3CC4V 2JDUA 4JI0B 2XAFA 5IK8A 2BV4A 4LNVA 3I4IA 1Y9QA 1LHWA 3T2OA 1NTKH 1ZZ8A 1HRI2 4QX7A 4FOQA 4UF0A 1Y9MA 5B4NA 4DUZB 1ROPA 5J2TA 2AEZA 5FY8A 4IQPA 1HB2A 2QQMA 1W9YA 4QXCA 4DMIA 4FI9A 3AC0A 4RGGA 1R081 3SYCA 2YXSA 4JTCB 2IH3C 1AL21 1AXKA 2X0LA 1NT0A 4YVWA 1EV13 1WN7A 4MT8A 1LEDA 2BBAA 4F8AA 1DLLA 1OPMA 4I50B 3OJBA 3WNLA 5CKNA 5CVRA 2UY8A 3WQ1A 1Q8QA 4UW3A 1ND3B 2UYBA 3T4VA 3J80N 3GJAA 5T5OA 2RMU2 2V4DA 2BP6A 3M3IA 3AMHA 2PHDA 3PIJA 3ZN1A 4O2BB 1ASJ1 2DFCA 1S5HC 2BFUL 3MIHA 4OX9B 2ILMA 1Y6XA 3ZR6A 4CDWB 1H8TA 1HNXB 1AJNA 1NR7A 2ZDIC 3LDEA 2LROA 1GO3F 3P1IA 2KA3A 3VDDB 5FKCA 3T30A 3T1HB 3TEYA 1XL4A 2CUGA 1JUIA 4DV0B 5CEHA 3PJYA 1YLLA 1O4YA 2R7EB 1WWYA 2VUAA 3FN9A 2K46A 2J1SA 1UYZA 2B39A 1O9GA 2QQLA 2AREA 4QGPA 4INDA 5T55A 4QGLA 1PIV1 3OGJA 4J9YB 1QH6A 2HLDG 2QTSA 3ETQA 2WLLB 2RS11 4BQYA 5LMUO 2WKKA 4XBQA 1YFWA 5F3GA 5FCCA 1W2NA 1NVPB 1NCRA 4QE7A 1Q8SA 4XJ9A 4HKLA 5CU1A 1NT2B 4XF0A 5LBFA 4G27B 1RUG1 4PQQA 4JI4O 3BIEA 3ASIA 1QY4A 2UY9A 3CCUV 3NKTA 1COV1 5EC2C 2VUCA 1OD3A 4W6YA 4DY3A 4FLVA 2F43G 1YQ8A 1RHI1 3DPRA 4HNAA 1ASJ3 1ZRRA 3H1HH 3AK1A 1AYN1 4I0XA 2AC1A 3IAQA 3UGFA 2R6QA 3GCWA 2AZ0A 1ODNA 1OF3A 4QT6A 2Y69B 1HWYA 2VPVA 3POWA 1FATA 4XF4A 2A6WA 5LEKA 5KHKA 2JD4A 2YSUB 3WNMA 5FOBB 4ZU5A 2GU9A 5EYPA 1N3PA 2GH2A 5FZKA 4A2UA 5F3IA 1YYNA 2FL4A 4FLYA 3SPHA 4E27A 2EIGA 4WFEA 1ULPA 4OHZA 1WNSA 4KWKA 5A7WA 1RB8G 2D97A 1WA8A 4BLJA 3HOBA 1QNYA 1YCIA 1IXMA 1JVMA 2N74A 1CR7A 2E32A 1JCHA 1DYKA 2PHFA 1UOFA 4YZ2A 4R52A 2OS2A 1AF9A 5F37A 1AR62 2ZZQA 5CA1B 2DBIA 4ZIBA 5EYYA 1YJKA 1UU6A 2VNGA 1JYCA 3ZMZA 1Y76B 4A3ZA 2VAUA 2QQUA 4BK4A 4DR2B 4OYUA 5FO8B 2ZX3A 5FREA 1W6MA 1AR5A 1SLIA 2QKCA 3D36A 3WNXA 3LPGA 4DR2O 4O9EA 3ZFGC 3RMYA 1WW4A 1MS0A 3EXUA 2I2SA 1JPXA 1HN1A 1O91A 5H6RA 5AVAA 3TBDA 1NCRC 3I2OA 1XDCA 4CUBA 1CESA 5ACA1 1RUG2 3S5AA 4BHPA 1OSGA 2PYLA 4MVSA 4FPPA 1SBDA 3ILRA 1KQRA 4E4DX 3AG1C 3UYJA 1TNRA 4LNUB 4NR1A 2VZOA 1FPN1 1RHI2 3KHBA 3KV9A 1RPRA 3SPCA 2DV9A 1FNZA 3K4DA 2YZ4A 4LA3A 1VBC3 5C3OA 5FQ0B 2W1SA 4L87A 3AYDA 4PDWA 3KCXA 4CEYA 1J3RA 3VZMA 4NJ4A 1JR9A 1GOHA 4XEZA 5LA2A 4YG6A 4CCLA 5L7OC 3QNEA 5F3CA 1MZ6A 4J9ZB 4LFAB 5D8AC 1UPGA 2IH1C 3MHSC 2HWD1 3NV3A 1NBMG 1WP8A 1Z7S2 1SFYA 2ITCC 3I3MA 3ASNC 3FWEA 5FPBA 1PGW1 4X20B 1VBD3 1W2UA 3THTA 4ASLA 4D3WA 3E22A 5D2AA 4BYYA 1C4RA 4G28B 1AZDA 3AL6A 1AYM3 3K77A 3THOA 1YHQV 2Z0AA 4JI3O 5CG9A 1W0OA 4QU1A 4X65O 1XHZA 2ADPA 5LHHA 3ZFFB 4X8NA 4XFFA 3VHRA 2EXIA 5LMUB 4LHSA 1RUI3 5FZ6A 3D3IA 2ARCA 3HNMA 3WP3A 4O4JB 5GZGA 2ZE7A 4OMCA 5KR7A 2JGUA 4XAAA 4GXLA 2HWB1 1ASJ2 5CAZA 1WBFA 2O57A 4KWJA 3VZNA 3VQXA 1DGWX 4FSJA 5H6QA 1S0FA 3JD4A 5CA3A 1Z7S1 3O9OA 5CB4A 3GYDA 5IJ9B 5FZDA 4AFBA 4BIFA 4QPIB 4RR3C 4EZ4A 2B1GA 1XQNA 3IDBB 1BMFG 4LFCB 1O5UA 3VZJA 1OQ1A 2QM7A 4ORFA 5CISA 1ND2A 2GNMA 4L8JA 2WO3A 3MHHC 4RWUA 4RN5A 2UU8A 1FXKA 4AEMA 3PVOA 1C8M2 1KP2A 3ZXFA 1RUF2 4MVZA 5K1PA 5FV3A 1SFNA 3CLPA 3JAWB 2HEPA 2XOMA 4GH4A 2BOJA 3VKFC 3ATGA 2UWBA 1N47A 3TEXA 1DZQA 5GONB 2C1FA 3RZKA 5FZ8A 3K08A 2ATFA 1PGW2 1KJLA 5JPNB 3KCYA 1LESA 4HSLA 2WUHA 1AP5A 4NXNO 2BW8A 1F4MA 4DXZA 1CP9A 3FHAA 3GZAA 1DYPA 2VU9A 4JGYB 2AGAA 2LO1A 5DZGA 3RZJA 1OLQA 1WW5A 3VD3A 1MS5A 5F1RA 1F15A 1R64A 3OPZA 4B29A 4Q1RA 4FOWA 3BI3A 1MSDA 4IT5A 1GTOA 2MEV3 1DZRA 1V6LA 2OKXA 3C3TA 4XZPA 1VARA 3CRCA 2DU1A 1OOPA 3QOPA 4A44A 3VBHC 1RHI3 3ST7A 2HWD2 2P06A 2K0GA 4CCOA 2QVSB 4RQEA 1UKRA 2GTAA 4JX0A 2V72A 1LOFC 4AI2A 2XDVA 2JDZA 4D7YA 1XYNA 4WM8C 1ZBE2 1W6OA 4BXFA 5IAXA 2V7QG 3OFNG 4YW3A 3THPA 4Q0QA 3A8TA 4Q29A 5FYIA 4Q4V2 5J9PC 1FJGO 2ZIOA 1NE4A 1Y9GA 4QHZA 4FAGA 2D7FA 1R3KC 3VBRC 4JTAB 3LGRA 5C9AA 2IC1A 4WCEV 4J7ZA 3KV4A 1SF9A 2V1DA 4OI0A 3ELNA 4I55B 1RMU2 5ITZB 3POYA 4CEWC 1YJ9V 4JTDB 2ZS6B 2ODMA 5FZ7A 2WS92 2ZHLA 4XUNA 1ENRA 3SITA 5J37A 1K4CC 2E53A 3B69A 1FFTB 5FFOC 4XFHA 3W7UA 4M0NA 4DUYO 3QO7A 4I3GA 2WFF1 1UU4A 2DDUA 1XRUA 4JZ2A 2EA7A 1DTOA 4PQ9A 4DV4B 5CMUA 4GMP0 3WG3A 4JVAA 4V2VA 1RUD3 1VR3A 4BQ2A 4AR2A 4UF0B 4PA6A 1RINA 4PLNA 2Q67A 4YRDA 4FPYA 2DCZA 3WF4A 3PU3A 3MPPG 4TQFA 2VY0A 4URAA 4XBNA 5EXOA 4D6TH 3L2HA 1UN1A 4QPWA 3U11A 2D5FA 4NIDA 2A9HA 1OPOA 1GMMA 2R9RB 4Y1XA 5FLIA 1PNFA 4FQ4A 3CCSV 2JGDB 3HN3A 3KV6A 2Q0AA 2BTVC 1O3RA 1RUNA 4V1PA 4IHJB 2FDIA 1UZZA 1I94B 5J98B 2VNOA 3I3BA 2BVVA 5E1AC 1VF6C 1AI6A 4J6GA 5IYCO 1IS3A 4YNIA 4EN9B 3I97A 2QTOA 2Q7HA 1TEIA 3ASNB 1D4M3 1MEC1 1IBKO 3DECA 3N9MA 3B9CA 4L0PA 1H8TC 2LFSA 2HHHB 1ZUQA 1H8TB 1C5HA 1HLCA 1K5MB 2RDQA 1KD1W 3E8FA 1MS9A 1OLME 1FI2A 2VMCA 4LF5O 3RN4A 1AL22 3WF2A 1LENA 2VTFA 4GALA 1W6QA 2W68A 2KM2A 1X4TA 3A0HZ 2WLIB 5KX5A 2EIBA 2H0VA 2UU9O 1L0NH 4NXNB 4TZDA 3BYWA 1AL23 2E33A 3RYFB 2ARAA 4TUYB 4CP9A 1J59A 4Z8BA 4YW1A 1XMOB 4OUEA 3WV6A 4YVWC 4KUMA 2PF4E 1PP9H 1XOYA 1NG0A 4YZ1A 2UXDB 4N53B 4K40A 2XKPA 1NQTA 1OC1A 4CP1A 2YI9A 2Y64A 4RGAA 4JDMA 1H1AA 2AGSA 3J7MA 2CAUA 1SQPH 1OQEA 1J3PA 1K3IA 4LR3A 4ZXEA 3URFA 4A4AA 2RM22 1OT5A 2IJJA 4GQ7A 4X1YA 4PDLA 1VBC2 3CEWA 3MDPA 3CD6V 1VB4A 4I7ZB 2GTSA 1VBC1 1EM1A 1B35C 4N7IA 3AKRA 3USSA 1SDDB 4LBNA 4FFKA 5FNVA 4JCKA 4DW1A 2FDGA 2PHXA 4ES9A 2JIZG 1IG0A 2CWSA 3GZTB 1BZKA 1YF2A 2XAGA 1Z2GA 2ZNIA 4EWDA 1W2OA 1N3QA 3DTUB 3C3SA 4P9YA 3B9IA 5F9TA 2EIJB 1R082 3JATA 3H7YA 1I5YA 2UXBB 1JMUB 1LNQA 2WSUA 4XDPA 1LR5A 3WNNA 3STLC 4Q4W1 1H9PA 4JTOA 1KU9A 1FOD1 4ZS3A 1E1RG 1Y76A 1S4CA 4GB31 1YTFD 4LF9O 1SQGA 2IXKA 1ST8A 5A33B 1NZIA 3WSOA 3VUOA 5LMNO 4FIPC 2W6IG 3IT8A 4QGNA 3QG5A 3S7IA 5FPVA 3LDRA 1KJRA 5D5PA 4Z1VA 5CB7A 5T5LA 4IGQA 1QU7A 4LKSA 4E8DA 3NJXA 3B8MA 4IGGA 1XI1A 3LFMA 3K5NA 2VJXA 4XPVA 2QUOA 1GYKA 2TBVA 1HNWB 4JGYC 2NPIA 4MXWB 1X9TA 4XFAA 4HZFA 5FZBA 1OCZC 1XE7A 2KQXA 4X1IB 1KXGA 4PF1A 4DXRA 5BNPB 1ZREA 4YZ3A 4DR4O 5H9SA 3H1YA 4JRLA 2OTJV 4WM8B 4EB6A 4BR6A 2YMZA 2Q68A 3ROUA 4FFBA 3J9SA 1JYNA 1NTZH 5KXDA 3W5MA 2E63A 4CDWC 3I3QA 1YFUA 2WO1A 1Q8VA 2P17A 5LP6B 1BQZA 2BFUS 5DECA 4GKJO 4DV7B 4GKJB 2B9VA 1DF5A 1PX4A 3NNFA 5FYHA 2XL7A 3AB0A 4CUAA 2AH2A 1EUTA 2AW9A 2WLJA 4FLXA 4RQFA 5JOWA 3VD7A 1HB4A 2CGPA 5FY5A 1URXA 1G6UA 4FM1A 2EIEA 5JR2A 2MNGA 3S30A 3Q8FA 1XNDA 1OURA 1F5JA 4QIWF 2ZBJA 4Y22A 1J5EB 3LSUA 2HWD3 4IV1C 4KXRA 4R9AA 4CU8A 1HNWO 3MAQA 3L70H 1SA0B 4Q0PA 2ZHNA 1AB3A 2EIMB 3SKJE 3HKCA 1K5JA 2JDHA 2MEV2 1ZL8B 2YY1A 4P9PA 4AQYO 2BQPA 3BODA 4LITA 4UCVA 5K4LA 3IIIA 3POEA 5CN0A 1I5XA 1WCDJ 5IJ9A 4KMQA 1DLBA 4BU2A 1W3XA 2BGOA 4K20A 5BNOB 4Q6GA 3BPZA 4B4RA 4DR7B 1KS5A 1K5SA 2VQEO 4EFBA 4AL9A 3KWVA 4MGQA 4AI9A 2N7GA 1KKDA 3E86A 4LF9B 2A3YA 4TTGA 3ACFA 2AR6A 1ND2B 1ZTEA 3CMGA 3D82A 4YG0A 4UBGA 4RR3B 3EVKA 3CF6E 4FLZA 3ZIWA 3VDCA 4OXSA 3WW3A 4JKMA 4IE4A 1BBT3 5FY7A 2JIJA 2DWDC 3KT4A 2RMKB 1CIYA 3ZSKA 2A3WA 1RM1B 3ZRWA 1W8OA 3F7VC 2B5UA 2BJSA 3CX5F 1JJOA 3HKDB 1VBE3 3N9NA 5L19A 1Q7YW 3ZMOA 4FM2A 2ORZA 1AI4A 2JRIA 1LHVA 1ENXA 2VQEB 2OUHA 2H6CA 4XFIA 4NE9A 2D43A 3MUY1 4XILA 3ZHSA 1XU2A 4UT5A 1DHKB 1NA1C 2GP5A 1P4RA 3RI8A 4NHKA 1W9WA 1QJZA 5CA0A 3Q8AA 4R9BA 1NR1A 2VVDA 4TXWA 4JGSA 4JYAO 3EB7A 2E6VA 2QQKA 3FBYA 1WMFA 1VQNV 4JI8B 2UXCB 3JAMN 3QCWA 2DWRA 4CXWA 2JVDA 3MFCA 5LYJB 4AF9A 1W6PB 2JDPA 4ARXA 4MH0E 1IQAA 5GLZA 2VMDA 1QNMA 3ABTA 3RZLA 3MZHA 2Q4SA 3PUQA 4OMDA 1W6NA 1KKCA 1PVXA 1F35A 2NLRA 2VG9A 4I30A 3VBOB 2LRPA 2BTQA 1Q8IA 4F6RB 4O4IB 5CIRA 1QJU2 3WF0A 2HWF2 2GC0A 3RWNA 1QJY2 1UFIA 3RSJA 1X59A 4IIJA 2YPJA 2YB7A 3OG2A 3WEZA 1RUH3 3I2FA 3N27A 4LE4A 2HWC2 2W92A 1WCSA 3WDUA 2P34A 2HWB3 1IXBA 2Z3YA 5GTHZ 5IFTA 4JF3A 1SESA 1LRHA 4DUZO 2A6VA 4X62O 4QGMA 2Q8VA 3AP7A 3P3PA 3ZHRA 4AVAA 2QWQB 3CRQA 5J2UA 5F6KA 2YPDA 1SLCA 3DYPA 2ITDC 4JGZB 3K03A 1BZWA 4ICGA 1JS9A 5EP9A 4YJ2B 4Z2AA 4CE8A 1GV9A 1QJFA 3AMNA 1Q8PA 1JYTA 3SJAC 2ZT9B 4B4PA 1RGSA 4GUNA 3VBSB 4KQ7A 4LP8A 4GZRB 4GX0A 1FYJA 4X1KB 2JG8A 3BY6A 2ZTNA 5FZAA 1UYPA 3JCIA 5FZ1A 1VAMA 4E9KA 3O1OA 1Q8OA 1UOJA 1B04A 2YG0A 4QJFB 1G9DA 1R083 4YHHO 4AI3A 3EMRA 2EIKC 3P30A 5LMNB 5IYYA 3VOUA 4TYSA 1VBA1 2QQWA 1EN4A 1EAH3 3VLBB 2YIAA 3HKBA 1V6NA 3N2GB 3HPNA 2YHJA 1YITV 2YS8A 1Q43A 3FX3A 3OR7C 5HBAA 1HIXA 3ZMUA 5L9RA 2XBO2 1HV0A 1UIKA 4Z1MG 1I9RA 2PAEA 1JZ7A 1UU5A 4SBVA 4XIOA 2N05A 1WP7A 4N43A 4IL6Z 4UOJA 1OKQA 4LBQD 5B1AC 4M3CB 2K9ZA 2VZUA 2A7AA 4QX1A 1RUE2 5E16A 1OJHA 3GGLA 1LOCA 4J41A 3CQOA 4WBNB 4PLMA 1GKBA 1O59A 4AFDA 1C1LA 3R66A 1AVMA 1H4HA 2ZEZA 5DG2A 5F2SA 4HL0A 4EN6B 3JD71 1WJZA 1RP3B 4BMBA 4L99A 3RS6A 2JG9B 5GLTA 4JHTA 1V70A 5C8YA 1MEC3 1ODMA 3HBZA 4X89A 3AG2C 4BMEA 4DUVA 1HXS2 2PA7A 4XJWA 2A79B 3FB8C 2BOIA 4Q4W3 4LT5A 5FZ9A 3LB9A 2VD7A 5JI7A 5FUNA 1QOSA 2XR4A 1M1KW 4HLTA 4QU2A 2ZAAA 1NLRA 4MTOA 2UUAO 2WLNA 2B9ZA 4Q8LA 4CEWB 3FC0A 2W46A 5JDBA 4AVVA 3ALQA 2IBZH 1GFF2 1BBT1 1PM9A 4XXPA 3SDLA 1W0KG 1JOYA 2UU9B 2DCYA 3WDYA 3MGUA 3AZWA 3H1WA 1MS1A 3IM0A 1P84F 1V9U1 4P9OA 4RL7A 1I5PA 3UGGA 3ES4A 3CC7V 2LGQA 4O7XA 1Q5OA 3O12A 3NKGA 5IWFA 4UW6A 4LBOA 2HKXA 3OEEG 1PO23 1S0GA 1RL3A 2ZCWA 3V65A 4QQPA 2PGGA 1VQMV 2XMLA 1PIV2 3JATB 1TMF3 1D0HA 3PMSA 4GMP1 2RS33 4RAIA 3JAKB 2ADEA 3D5OA 5I8SA 4MS2A 3ZYGA 1OLRA 2YXLA 4PJ0Z 4IESA 2NMOA 2DVFA 2VXJA 3IKWA 3ZFFC 2WC2A 1ZX5A 2VBBA 1YQ6A 1CD3G 1AR82 2LGWA 3DPRC 3UO2A 1XXNA 2RS52 4OHVA 4P9JA 2VQFO 2O8QA 3VBRA 4FAHA 4FPGA 3OYWB 3O0WA 5IT6A 3UV9A 1D4M1 1QKQA 4CZZA 2QM4A 5IJ0A 2YU2A 2C6SA 1GZCA 3FAVB 5EZYB 4RUFA 1RUF1 5FYYA 5A1LA 1DLCA 1OCOC 1NX9A 4UXNA 4RSUA 3ZSJA 1SC5B 4YVWB 2J1EA 1RUD2 3FLRA 2XJRA 4IXLA 2XAQA 3CPWU 5IUQA 5HCHA 2JS3A 4QM9A 3OUJA 1COV3 4ATFA 4GIQA 5A3PA 2Q9LA 1B35A 4LIVA 3X2QB 2XKOA 1S0VA 4JKLA 3JZVA 4IV3C 1BS3A 4JI3B 3OUIA 5BR8O 1BHGA 4FBFA 3B5LB 1LOGA 5F2VO 3N4MA 3W20A 5A3TA 4MLOA 3DKQA 3TNPB 3NVCA 1D0GA 4BIUA 1WCKA 2DYRC 4I9QA 1TME3 1Y67A 1PNGA 3ZFEC 4CC6A 2VBPA 5FYUA 3I59A 3JYCA 2YYOA 2JB4A 4IV3A 5BNNC 1XBLA 3VDDA 1UZ0A 2EXJA 1AR91 2Z5WA 3NNLA 3LFIA 1QVFU 1F2NA 1RUF3 1EN5A 4IEUA 3F95A 5KWRA 2V73A 4XQ4A 3VZOA 1BEV1 1J5EO 4GKKO 1SLTA 1RUC3 5A32B 5FLXN 2PZSA 2JIGA 1XSQA 1AP6A 3CRMA 4TN7A 5DAWA 1G9CA 1VJ2A 1M06G 2Q4PA 2XLFA 4GLXA 2G4IA 2JB8A 1HDKA 2F23A 4QPGA 4C90A 4ZHNA 4X64B 5JH7A 5F2WA 2C24A 5HV0A 1E5RA 2YUAA 3U0ZA 4ATEA 2O1QA 3GZEA 1CN1A 1T6GC 1ORQC 1HB3A 1NU1H 4E4ZA 2WZ8A 1GR3A 1R6NA 1RUI1 4CSWA 2JE9A 5B1BC 5CYYA 4J7JA 3SC7X 2YXHA 3H8UA 3BALA 3RJRA 5FYBA 4LF4B 4MADA 2JDMA 4HNAB 3JCZA 4ZY9A 4Y20B 4I01A 2DMXA 3FD9A 1ENVA 4DV6B 3E8BA 4KL1A 3ZM8A 3RYCA 1C5IA 4PBOA 1QJU3 1XSRA 5HI0A 1OFNA 4Y5TA 1YC61 1MACA 5L7OA 2EJRA 3CB2A 2OQ7A 5CBLA 4H33A 4MHRA 4GWNA 5CFCC 1NCRB 1M4UA 4XFCA 5DMYA 4D6RA 1POV3 4XXAA 2FQPA 3TN93 2MEV1 2R72A 3ZHUA 5APAA 1YSCA 4YW6A 2ARHA 4A6SA 4LFCO 3AL5A 2HYKA 1RJ8A 4ASKA 3GDBA 2Y6HA 2A5ZA 4ASUG 1G9AA 3U78A 2PHLA 4I0XB 4XTMA 3J81N 1JYIA 4Q4X1 4DR5O 3WG4A 4E8CA 3VBUC 3C7OA 2XGXA 4WFHA 1XNAA 1TNFA 1XNQO 4BB3A 2Y6KA 1QQCA 3H8OA 4XOGA 5J3UA 4WM7C 5T3NA 1N34B 3WG7B 1F5FA 1D5NA 5EJ1B 4CCKA 4GX5A 4H37A 3ZJZA 1XEQA 3MLLA 4K8ZA 4YJ3A 5CNAA 3W5NA 5I0TA 1R3LC 4D7SA 1VAKA 3J7HA 2YXYA 1LR1A 4MGYE 2OW4A 3POJA 1KITA 2ADQB 3FJSA 4JZGA 4HK9A 3UJOA 1NCQA 4J1WA 5GZCA 4JASA 1OUSA 3ACGA 2CV6A 4UV9A 1MMMA 1NJIW 3T1CA 5BY1A 4Z92B 4GX2A 5FPZA 1EZVH 2VUDA 4LNUA 2Q8OA 4UFHA 2JD9A 4Q5OA 3NV4A 2SBAA 3TOJA 1N33B 3ZX7A 5A3UA 3SKVA 4HAMA 4DV3O 3HQUA 2W9XA 2ZX0A 1BL8A 4HN1A 4DV0O 2EINB 1JYVA 4JYYA 3TJTA 2PLV3 3OF1A 5SV5A 4DR3O 1ZZ6A 4HXCA 3SEPA 3DYOA 1V6JA 3CCEV 3UM7A 2EAAA 1PK6C 1RUE3 5J7MA 5JI9A 4EZHA 4PA3A 2P7TC 4NIAA 3OEHG 1K97A 3RBZA 2Y0OA 2QWOB 5F5IA 2DBNA 4PBPA 1TVKA 3WHTA 1L7LA 3MIDA 3C7HA 2Q1MA 1YJWV 5EIYB 4ZKIA 3GVMA 3OOXA 1V55B 4D0QA 1RITA 3RWKX 4LOSA 3QVNA 1GP5A 5EHDA 1H2KA 3AP6A 5JAXA 4CEYB 2ATKC 3UO3A 1EV12 3BPSA 4MHUA 1WD3A 1AYM1 4O4JA 4PLOA 3K5MA 1XMQO 5IK4A 5KA5A 1PHMA 3LF7A 1ULFA 4WFGA 2HEVF 1CQ9A 3CRRA 1HKDA 2RDNA 2CDYA 2CU5A 1MVQA 5C5UA 4W4KA 4FO9A 2RM21 5FZOB 1CX4A 5LBCA 1J58A 4XMAA 4DUWA 5AVPA 2WYFA 3VHNA 1K45A 1P7GA 2XHNA 1CAUA 5JXJA 3APOA 1BMV1 2KG7B 2EAKA 2J22A 4NIHA 3AMPA 4RA0A 5F8PA 2JK5C 1HNZB 2YI8A 3CE2A 4U36A 2NN8A 2ZKOA 2WLHA 4XYXA 4QMAA 5DUWA 1ZBA1 4UW5A 3ABLB 2QWPB 1GWKA 2OYQA 4MGSA 4Q27A 4LF7O 4DRXA 2VMGA 2QKSA 3THCA 3EQEA 3SXWA 4FP3A 4RQPA 4FQZA 4W65A 2DVBA 3BTXA 4PHZA 1HN0A 2PELA 5CB4B 2GNTA 5CG8A 1QLNA 3KHCA 4DV1O 4I02A 2QQOA 2O8OA 2WLMA 3NJZA 3RGBA 1VIBA 1YUDA 1AR93 4XUQA 5AFEA 4BAYA 2P67A 3ZMSA 5IVCA 3VD4A 1SG3A 2BRTA 4S2HA 2D6LX 1VIWB 2HLEA 2AEYA 4Q0VA 4EKWA 1A32A 3HB3B 1BEV3 4DS0A 3FYEB 3DL3A 5C3QA 2DCKA 5ANNA 3CCRV 1LKNA 2DTYA 4YFZA 3IFXA 3WG2A 5C4WC 3W7TA 4X6QB 2DUOA 2RDSA 2WO2A 3VGIA 1QOTA 2D40A 4NUBA 1BCXA 1XC6A 4O65A 5LEJA 3GWOA 1R1BA 1VBB3 4UFLA 3USUB 5LRSA 4DXTA 1F9KA 4DIQA 3AKTA 1MSWD 2VMHA 3K51A 4X8AA 4OCTA 1VBB2 1YIFA 1KUQA 4CEYC 2RR11 1OUXA 2VWJA 2HH9A 1CVNA 3DCQA 2P6JA 3H1JH 3JD3A 2ETNA 1NA1A 1DFQA 3WW2A 2YBPA 3ZYPA 1OHHG 1EP0A 3RVZA 1W3VA 2DF7A 4TWKA 1SPPA 1SEFA 3KGLA 1HNXO 1JJ2U 5JR7B 5KUKA 2ZD9A 4LBMA 1QF3A 4FLTA 2QCSB 1OH4A 4FPOB 2WLQA 1YQCA 2X53S 1RUC2 2VZTA 1HJGA 4B3TB 3ZXDA 2Z42A 4WVMB 5E8AA 2A73B 4UCTA 2ZGQA 2HEWF 1WUVA 1H2GA 2DE0X 1U12A 1RMU1 5C8CC 2WJSA 2LW1A 4Y1VA 3T1YB 2J1TA 4DFSA 2GC3A 1OCCC 2X5IC 2Y69C 1QVGU 5D21A 4CH6A 4BE3A 4OQ8A 4I0WB 3EHBB 1G7YA 1HRI3 2WNUA 1QXJA 3TYJA 2PI4A 3AXDA 4J80A 4YGEA 1VQKV 2XJPA 1U5ZA 5C9AB 5FUIA 2CL2A 3BAAA 1UZWA 5C8CB 1OH3A 3AP9A 4M4PA 5BNNA 2RJLA 3OY8A 2FHRA 1ENQA 3AP4A 1X7NA 1PK6A 1ZBE3 1FMD2 1XJAA 4P9LA 4TSVA 4DXSA 1Z78A 2WZEA 1WKYA 2ZKNA 5KXBA 1LJ7A 4HMZA 1S2KA 1XMQB 1J1TA 2XH6A 4LXLA 4OHYA 3DYMA 2ID4A 4D69A 1GQPA 5K0UC 3T4DA 4N9IA 2IU0A 1PM4A 4QKDA 1JBCA 4L8QA 1H30A 4FPCA 4BH9A 4BQWA 2R16A 3V0AB 4GA9A 4Q4V1 1PMJX 1FAFA 2ZIMA 4ZI7B 4FT8A 1HW5A 4RS5C 2IJHA 5H2FZ 4XCBA 5A7NA 1RUOA 5KBFA 2JE8A 2WQ8A 3OEAA 2D98A 4KHPB 4OUSA 3OSDA 4FFFA 1UF2C 2ZX2A 2V4VA 1WMEA 1K42A 1MG1A 3DF0A 3SCHA 1K5MA 2RMU1 3EHKA 2YIDA 3AG4B 4QWNA 1ZRFA 3LCPA 3RYIA 1Y74A 2Y38A 3M8AA 4NWVA 3RG0A 5B66Z 1V9PA 1VBA2 4GX1A 1IBMB 5C9AC 1W6QB 2VUJA 2R32A 4U7NA 2JKXA 4XDOA 3ZSLA 2WLIA 3N9OA 2LUWA 4QKBA 2HJIA 4JDOA 1SQXH 1IG3A 2J1AA 4GJZA 4BWOA 2GUZA 1UIJA 3GZUC 3M7AA 5E6HA 4AWDA 2GN3A 1O3SA 1OCOB 4JYBA 2D6KA 1JOPA 3TXQA 4JV4A 3BHPA 3K0GA 2HWE2 4XIKA 2H6BA 1H6YA 3IPVB 2Y48A 2WNVC 5BNQA 2ZGSA 1CZTA 3BU0A 4BQXA 5IK5A 1CPYA 4U3JA 2OIIA 1MVEA 4AVTA 5A1FA 2FTKA 1CAWA 4RGKA 5JSOA 5FYTA 2JDNA 2Q7EA 4N8MA 2PLV2 4O4HB 5LGNA 4WZFA 4J1XA 1UY4A 4K7JA 3PLQA 2YGMA 2ZE8A 3PUHA 1O3TA 3WP4A 5IW0A 4DV1B 1XILA 3VHPA 1H2MA 3OBTA 2L9LA 1U5YA 5IT9N 2PMWB 5A1AA 1BVP1 3OM3B 4ZZ5A 2ZAHA 4UB6Z 4DRRA 1SETA 5BYNA 5AFBA 3MF6A 1AX0A 3CIHA 2YBSA 1W28A 3K3NA 3SH5A 1IX9A 1ZZ9A 3JB8A 2LALA 2IU3A 1N32B 3SNMA 5FYMA 2CAZC 1LOAA 3H3LA 1CJPA 1JFFA 3I7DA 5ACA3 2QQPA 1YHFA 1UXXX 3WNKA 3O7OA 3OMIB 1W8HA 2XB6C 1IDSA 1Z5VA 4M3CE 4DV6O 3PVBB 4MSVA 3K48A 5DN6G 3T2PA 4NXMO 2WWWA 1W90A 3WF3A 5F5CA 1DIWA 1R3JC 5EBLC 2AUYA 5KXCA 3TGUH 2EBOA 3QO8A 2BGCA 3RT3C 1I08A 2RS32 1JTZX 1PKXA 2EIDA 1CAXB 1PVC1 4CDUC 5DUVA 4QX3A 1SMVA 2QE7G 5B3SC 5G04L 3ASOC 4ZZ8A 5DDJ3 2WSSG 3ZMNA 3MDSA 5D5QA 2VW1A 2H0BA 1EY2A 2UUCB 1T5EA 4AZZA 1LAJA 2A6ZA 1RVF2 3ILNA 2XVGA 1PIV3 1EPWA 4Y26A 3TEZA 2EALA 1WLDA 2ZXWB 2EZOA 5EC1C 3OTOO 2RNBA 3VB9A 3FKSG 1S0JA 2HBTA 4QB1A 5BNPA 1LOEA 4HT1T 3H1KH 2HWF3 2UWAA 3WNOA 4LH6A 1BQPA 3D3AA 2AHZA 5CZKA 3TETA 3ZN6B 3CO2A 5LY2A 2ZINA 4K3AA 2P5OA 1Q86W 4XMIA 5FZEA 2QDRA 5I91A 5KHJA 4IGOA 1W2TA 5A6YA 4LHNA 1BK1A 5LP6A 5GALA 2IM9A 2XJSA 4HOOA 1F51A 4JI4B 5FXXA 4QPGC 1DP0A 2OVUA 4CXXA 3OPWA 2VE1A 2E26A 4PDWC 2D3PA 2BYVE 3ZLIA 4X1IA 3NRUA 1ULOA 3QACA 1YFXA 3A0KA 3THDA 4MGKE 2Q1FA 2EICA 1CONA 2CDPA 4OI4A 4B7EA 3VBFB 1ND3A 1WBLA 5FZFA 4ZONA 1AR1B 2EIJC 3K3OA 4YSFA 3WUCA 3H0OA 2SLIA 1COV2 2OA2A 4D6QA 1Y4WA 3BEHA 3E5QA 5K7PA 3I2HA 4E2LA 1MS4A 1W05A 4XACA 2WO7A 5GZEA 1Q90D 1V00A 3ZXAC 5LGTA 4MZUA 3WD5A 2A1XA 2WZR1 4O2AB 1W9FA 3HKCB 2IW5A 2UXXA 3M70A 1YTFB 3KT1A 3ETEA 4JI7B 4CDXA 1JMKC 1UAIA 1VQ8V 3VL9A 3AG7A 1UD1A 2J1UA 4CU9A 1KB9F 4GZ9A 4TWTA 5C4WA 1FXZA 1APNA 1R3IC 5JCOC 3SCFA 1PV0A 2JDIG 4W4LA 5GKAC 1PGSA 2YEVB 4Y22B 1GN2A 3KSCA 1N36B 1ZVFA 5C33A 1QU0A 2ARBA 4YVSC 1J95A 3F2ZA 2LTNA 4JI6O 2ZMLA 4IEVA 4UFJA 1QLEC 2D6MA 2X5IA 2PUSA 3ZDVA 4UI9L 2XHKA 3WG1A 1FXVA 3KVAA 4GH4C 2ZR2A 5LA6A 2QFEA 1V6KA 3R05A 3K79A 3EXAA 3MO4A 2VO5A 3AK3A 4YIPA 1FXKC 3WB1A 3AG3B 4LHKA 4FFHA 1HQLA 1X33A 2FZ2A 4CA9A 2D3SA 4FK5C 4OQ9A 4RR3A 3WB2A 2GZWA 1FAYA 1JQ0A 1AUYA 4AE2A 4FPEA 4PA4A 2MHFA 2NR5A 5CA0B 5FYZA 3FLPA 5JXHA 2HWF1 4B1MA 3E83A 1AVBA 2DW4A 1PZ7A 2JEXA 4AXOA 3S7EA 4ZOLA 4AFMA 2Y4UA 3A2FA 3ZRWB 5LATA 1XUQA 2HVJC 4IYIA 1MZFA 1IPKA 2VZ1A 1L8DA 3L2YA 3HKDA 3S0MA 2VULA 2CDOA 3CWBH 4U7OA 4GKKB 4AEKA 4DNYA 1VQ9V 1TZOA 4UCSA 2JENA 3OE7G 5DPNA 4P9XA 3M3EA 1F4AA 1WA8B 1SDWA 2VTXJ 2TUNA 4P5YA 1W6NB 4YPJA 1X82A 5FY0A 2VZSA 3J7LA 2YV8A 4BISA 3VBOA 3LE0A 4JAVA 1SPPB 3K06A 4JI2B 4NO4A 1S0CA 2QWNB 5LXTB 1LUWA 3C7GA 1J83A 3H8RA 5EWSA 1P7BA 1VQOV 1AL0G 5GLVA 3U75A 3PTRB 1HJFA 4F7ZA 4FXGB 1UQXA 3M8LA 4R6ZA 3G80A 4HVRA 5KMGB 1TMF2 3ZKUA 3KCCA 3MW4A 4AFCA 1Y7BA 2A0LA 2P4KA 5A7OA 1QR8A 2XWBB 2J42A 4QPYA 5JZGC 2DYSC 4YVSB 1D2QA 1JYWA 2VWKA 5EFUA 4Z2WA 1B09A 4PI2A 3DN7A 2BTQB 1S5LZ 3P32A 2UXBO 3JB4C 2ZMKA 5LOVB 1ULGA 4Q26A 2H8PC 4IIJB 3MIGA 4LKEA 5BNNB 4MVRA 1BMV2 4PDWB 3BA9A 4URTA 4Y5SA 2Q1ZB 3NAPC 4CH4A 1AHSA 4H44B 1UPSA 2HYXA 4KBZA 4KH9A 5KLVH 2FYUH 4QX0A 3UKVA 1VRBA 1W9SA 4X66O 3N7JA 4WVZA 2JJ1G 1VP6A 2KKWA 4HVQA 1AR71 2B9UA 4JGZA 3VKMA 4O4LB 3HNBM 1A6CA 2W87A 2HFEC 3HT1A 4MVTA 5FY4A 2CH7A 4L2NA 1ULCA 1R091 3PL0A 4BXSV 2G9FA 2J7MA 1LODA 4G2KA 3OT7A 2IJIA 4CS4A 1POV1 5FP3A 2FBEA 5BXZA 4AQSA 4B7KA 4JQRA 1H2SB 2K1EA 4GT1A 1U96A 2QKAA 1K5QA 3I2DA 2AXTZ 3PVEA 3KG2A 2IVJA 1S0BA 4KP4A 4R9CA 2XQXA 1IURA 2RE9A 4LBEC 3Q8BA 4XUPA 1RUJ2 1RTVA 1SKVA 3LQCA 1RUG3 3N7MA 1VMJA 4IERA 1POQA 1ZZ7A 3CCJV 2W91A 5L73A 5JMCA 2W6JG 1W9TA 5FTTC 4MVQA 3ABLC 5IVBA 4MW8A 2VMFA 2F6BA 3CDZB 2QJ1A 3SISA 1QJY3 2W47A 3KGZA 3A0NA 4QPIA 2VCAA 4MVOA 2ZNJA 3U07A 3RYRA 1VRH1 3MD0A 4E4HA 5ACA2 4Y3OA 4A7ZA 1QQP3 1CXZB 2Y8KA 4BLIA 1K4DC 2PTMA 4CCEA 1OCRB 4DK0A 1HW7A 3IPVA 4B3MB 4NRPA 5TSWA 4DQAA 4HONA 1PL4A 4AK3A 3WCRA 1HQNA 3INAA 2R061 3GXUA 1CAWB 4C1XA 4MSWC 5ABJC 3HKEB 4Y33A 3GBGA 2VQ0A 1AJQA 2R073 2GDFA 2CE4A 3ZIXA 3O1PA 4N90A 5B2GB 1UOGA 4UUJC 4UAPA 3D0JA 3JUUA 1J84A 1QR9A 3JARA 3E5XA 3CMAV 5FZIA 4DV3B 5SV8A 3TN92 3VKLA 1ZAUA 1KC8W 3ZO0B 2CTQA 1UMZA 5CADA 1GN4A 4IUGA 4LC1A 3E6DA 1HR0O 1UNBA 2R1DA 5FXVA 5T52A 1SHWB 2CTWA 1K34A 1S76D 2DJVA 3O1UA 4MW3A 2RR13 4Q8KA 3RZMA 4OFGA 3ZYFA 2I74A 2RS31 2EXKA 3KB5A 1KGYA 4G9SB 1PNMA 4K8RB 1TUEB 1I1EA 2C2AA 4RS5B 3SHRA 3UT0A 4QQLA 3HQXA 4R50A 1NKGA 2DYSB 2P6CA 4S2DA 2F4VO 3WP5A 4AEJA 3LAGA 3MPBA 5BNPC 1KFUL 4NAOA 1VBD2 3EYPA 4MG2A 3DV8A 1VMFA 4IE7A 4LO6B 1S0IA 2XTAA 4J11A 3GALA 2CY6A 2WINB 4NPRA 5JOZA 3UKNA 2GSYA 3N9PA 4DR6B 4DR7O 2ZEWA 3VBBA 3K5LA 4PF5A 3E35A 3BCCH 1LNSA 3E89A 4W6WA 1WGPA 3EO6A 1GNYA 4I5SA 5ITZA 4UYBA 1TG7A 4BQ4A 1AR73 3PUSA 1U97A 5A2QN 2ZEYA 4EROA 5D1IA 3ZX6A 1TME2 4CC5A 1CIWA 4PCRA 4CUGA 4HETA 2OYZA 4CP0A 1ZWIC 2F4PA 4AQ2A 2M7WA 4TV8B 1EBOA 3VBUB 1ZBA3 1E57A 1KRIA 2YFUA 3AMMA 1Z5WA 2V09A 1KDKA 1M90W 5JQGA 5EV7A 4XC9A 4FLUA 1R6TA 5DDJ2 5F7UA 3RMXA 1VRH3 5EK0A 1XNKA 3O0VA 1Q81W 3MLKA 2WAMA 3T08A 3ZR5A 2D93A 1G9FA 5IJ0B 3HEIA 3T0BA 4K8FA 5IYBO 4QXBA 3ABMC 3FAVA 2EIKB 3HBKA 5EZYA 1LEMA 3H42B 1V6MA 1XNTA 4A45A 4IE6A 1C8M1 5B1OA 4C8DA 3T0DA 5H5NA 5DQ0A 1W8WA 2Y60A 1W8TA 4IE0A 3IDAA 4IV3B 3H8XA 1PX3A 4XUOA 4AW7A 2OWOA 4IEZA 1NS1A 2QKDA 3J7NA 3MLJA 3SH3A 2Q6AA 1S72V 4JI6B 4CRQA 3HAGA 3B40A 1KDMA 5F6LB 5FMOS 3VBFA 2G38A 5C5TA 3RZHA 5JOYA 3TAYA 3L9JT 5ISLA 2RM23 2FMLA 1BVVA 3K9AA 1WPBA 3LDKA 4CDXC 5B5EZ 4YYOA 1GZTA 4OUMA 1O3QA 2P3IA 1HX6A 4B3TO 4PIYA 3VV1A 3ZFEB 2KB1A 2FMDA 3M99B 4JI8O 1UY3A 1S0DA 4QPGB 4GMP3 1VEWA 3ZXGA 5K9YA 3AK0A 5JH7B 1YVWA 2QGNA 2A6YA 3ZYJB 2DUPA 2RQ6A 4DR3B 3NW4A 3ZYHA 1WPXA 4E4SA 5C4WB 1PZ9A 2W5FA 1LHNA 1CPMA 3WNPA 1ACCA 4LF8O 5FJKA 4LMFA 4M3CF 5A32A 1VP7A 3RYFA 5CA6A 1PNLA 4Y20A 4TUYA 1LULA 1K12A 2NMNA 4JAUA 2TNFA 3RYCB 2VZVA 4EN0A 4NIGA 4I9WA 2QQJA 4EYUA 3CSXA 3S3WA 3CJXA 3QBQA 4DR1B 4YM1A 1K5MC 5GJ6A 1EN6A 4FTEA 5K8SA 2W52A 3PDQA 3U10A 4QQHA 2WYSA 2ZX4A 3GHNA 3LEMA 3LDDA 1W99A 3RVHA 3IMMA 3NAPA 2BOBC 4YARA 3FE5A 4EE2A 3VHOA 2ZEXA 1QHTA 4YW7A 3FHQA 5FZLA 2BCCH 3RYKA 2DQ0A 2P37A 3H50A 3J7AU 1IS6A 1DCSA 1DQ4A 1JXNA 4P08A 3JD72 4FVVA 2PXJA 4QHBA 2A06H 3HIFA 4MX3A 4CCNA 3TN91 1OF4A 1W8FA 5JOXA 1BE3H 4AQYB 4WZCA 1JU4A 2XUMA 5FR3A 4YY3O 4YW5A 2XLGA 2FKXA 5E79Z 1YRZA 1HXS3 5EJ3A 3ZSMA 5DAXA 1N1VA 2VVFA 5JUVA 5EIBC 3OGSA 1OXCA 4NYKA 1HNZO 1WB8A 1S77D 2W0FC 3LNMB 5KHIA 4KG8A 4D94A 2X6BA 3E6BA 1G6NA 3OPTA 3W21A 3QF7A 3L9DA 3CZJA 2P5BA 5DM6V 2UXDO 5LCWL 1N4CA 4K0KO 1A3KA 1ND2C 4C0HA 3AKQA 2F66C 4YW2A 2QZ3A 1ZRCA 5LGUA 4LO5B 4PT6A 1NUKA 1YI7A 1WAZA 3BIWE 4A6OA 4DV7O 1VQ4V 3QH6A 3MI8A 1IHMA 3T09A 2XG3A 1QNWA 1FMD3 4LF4O 4LTAA 1LOFA 2Y26A 5FDBA 5FP7A 2VC9A 4COUA 1E5SA 4CXYA 1AX2A 3UKMA 1AYN3 3HJRA 3O14A 1PO13 1KMIZ 1ZYBA 3VQYA 1ZA4A 2VOWA 2VL4A 5JCTA 3NMBA 3MIEA 3WW1A 4XDKA 3O1MA 1G1XB 2WIIB 5C71A 3MIFA 2FDJA 3LA3A 3ZOIA 1AROP 3D4KA 1OMIA 3BABA 4BQ3A 1DU3D 3ITQA 4LHLA 1BK0A 5DG1A 1UXZA 3ETPA 2BGPA 2HP8A 4AVSA 1JU3A 1L1FA 1W0PA 2YC4A 3ZXLA 4YLZA 4OPAA 3UETA 4XF1A 1F23A 2RDCA 1K73W 4FVMA 4COVA 3VKOA 2LFRA 1FKAO 3U14A 2WNVA 4HZ3A 2VW0A 1DDLA 2K9PA 2RS53 1MNGA 3CCQV 3VKNA 2BPA2 5C3PA 5LP6C 1E5HA 1YI9A 4XJZA 4LH7A 2PHUA 2ZZJA 1DQ0A 4FZ1A 1L7RA 4KNCA 4TQDA 4Q4Y1 3M1HA 2BOCC 5B4XA 2I07B 3BGAA 4KGGA 2PAKA 1PO21 1TVKB 1KQSU 2L35A 4BJ0A 2PQQA 2UURA 2ET7A 1DK1A 5A80A 1F31A 1FD9A 1AR92 1NXMA 4P30A 2OPKA 2P90A 3JALB 2WLKA 3AKSA 2Q73A 4NTYA 4DV4O 4AEDB 3CL1A 3KV5A 1TUBB 5LBBA 4LBQB 2O0OA 3GM8A 1R1A1 1G8MA 5CFDC 4DR1O 4AQTA 1N1SA 4AI8A 3KF5A 2OZJA 4FPLA 1RJ7A 3UESA 4XFBA 1PMHX 5CFCB 5LA9A 3KMHA 4XUTA 2MK3A 3WQBA 4KU7A 1W8UA 3LA7A 2P1BA 5FYVA 4K1ZA 3KD4A 2YU1A 3G71V 5FLJA 4CDQB 2OXBA 3I54A 5T50A 1BGYH 3WUDA 4C91A 3STZC 2KG7A 4LORA 1AX1A 1QCEA 3IC9A 4Q2FA 3K3WA 3ZRVA 1JH5A 2ET1A 4IEXA 2Z79A 4YFWA 3H1LH 1YQ5A 3ABMB 2JECA 2W1QA 3RJ2X 5GZFA 1MZEA 4LUMA 1GRJA 4ET7A 3AZVA 4L92A 1SACA 4MGZE 2BEOA 4COYA 1GM9A 3ZN5A 3ZEDA 3AG4C 4GYCB 3K75B 1XMOO 5DEDA 1S1AA 1D4M2 4K21A 3HKEA 4WFFA 2ZPXA 1IPSA 3JXSA 4IEYA 4NWWA 4X62B 1ZLZA 2HKOA 2GP3A 1V54C 2ARXA 5M0TA 3SPJA 2WWJA 3E8GA 1F4HA 1VQPV 4LKFA 5BZBA 2ZOEB 3CRAA 3I56V 5C3RA 2ZM6B 1ZX3A 4COWA 5TISZ 1XB9A 1Q56A 3A21A 3R65A 5LZ6A 4X88A 3W7XA 1SERA 3GJBA 1IKQA 3R6SA 4X64O 1M9NA 3NV1A 5LASA 3USUA 4LLFA 2KD7A 2RS51 3SJQC 1MS3A 5FPXA 5JPMB 4DV5B 5FY1A 3D6EA 5LA0A 5LYJA 2P4EA 2WT1A 2UUAB 1VMHA 1UPIA 4UCUA 2WDBA 3ZS8C 3FFQA 2WQ4A 1GNHA 1GU3A 3ZMTA 1YQ2A 2HWC3 3PUAA 4Y5Z0 3ZN0A 2VGDA 4FFGA 4QHOA 4AVBA 3OGVA 2C9KA 2WNUB 2WA3A 2BERA 1GICA 5FBJA 3IC7A 3RYHA 4HPKB 5DUUA 4F6RA 3LEKA 4W50A 1IS4A 4MTGA 3O65A 2HWE3 1OD5A 2VZQA 2DUQA 1PVC3 4LWSB 1RVF3 4IE5A 4DV2O 1GZWA 1HXS1 3AP5A 1GQHA 1EAH1 4Q4X2 1O4TA 3PVNA 5EYXA 1XU1A 1NZCA 3OGIB 2VRZA 5IYZA 1QJEA 4B8EA 5HFMA 1NY71 1ULDA 3JQXA 1GMGA 4F4LA 2WAAA 3ZIAG 1MS8A 4XBLA 5JWPA 4PDRA 3CCVV 4RYDA 3S3XA 1H1IA 5FXZA 3K9SA 5L9VA 4YJ2A 2AACA 3WY6A 3VDDC 3CJHA 3RNSA 3X2QC 2GALA 3V0AA 1YI2V 1SRYA 3FZ3A 4BPZA 1Y43B 5C8CA 4PV1B 1HRV3 3OY8B 2AZ5A 4BZ4A 4AOCA 3U4XA 2WLPA 1R73A 1Y4MA 4GB32 4B3SO 2IXIA 2BVBA 2B7YA 2W94A 4MO3M 3MV01 3HWJA 4J42A 4LO8A 4ASMB 1HQWA 4QDSA 3N9LA 1O5LA 3FLTA 4YXWG 2IZWA 3OD4A 4MGIE 1ND3C 4I50A 1C8M3 1VPHA 3JD2A 2Z5UA 4LF7B 2AENA 4UWDA 1MPXA 1QWRA 4EWEA 2VS0A 3IDEA 5IVFA 3B01A 4YM3A 5EBWC 5I8TA 1KYOF 1O4ZA 4ZI7A 1BKZA 3CS5A 1JOBA 5T54A 4R8CA 2NLJC 4WBNA 3RDIA 1WCUA 4FOYA 2Q30A 2I45A 1K92A 1KS4A 4AGGA 3ZPYA 2Q8EA 4Q4Y3 2PHTA 3QTCA 1P49A 1E1QG 3CXHF 2ZM6O 5A3LA 2JG9A 3SJCC 3G6JB 2HWC1 3WW4A 4GULA 2OQ6A 1OV9A 4OULA 2EILB 4OPHA 1I3HA 2PI5A 4LF5B 1N0JA 2RG4A 3AZZA 2GUZB 1YJNV 2EILC 5CBGA 5IVEA 4COZA 3G7DA 2GMEA 3PNAA 1H4GA 4DR4B 2NN4A 2HHHO 5CKQA 4FTSA 3AFKA 3PURA 4QQOA 1H8VA 2XT9A 3BOWA 1JN2P 5BMVB 1U5XA 4QX2A 2BSKB 3SYPA 2FMYA 1UY2A 1O8PA 4U3JB 5JVDA 3D36C 5A7PA 4CEWA 4B08A 2R0FA 4JTNA 5I0SA 4MXVA 1I5ZA 2Y6JA 3O1VA 5HCBA 4Q4Y2 3FUOA 4FM0A 3ON7A 2ZA9A 1V6OA 5FZ4A 4YY3B 2WPDG 4JYAB 3X29B 5H9CA 1H2NA 3H3UA 4X9QA 1A8DA 2J1RA 2VQUA 4UB8Z 5C6CA 1V55C 4B3SB 1RUD1 1PL0A 4FOVA 5K0UB 2W1WA 2C4XA 5B3SB 2BWCA 4P9GA 1G4YB 1YFYA 4OLLA 2EULA 2VECA 3MICA 3WP6A 5FZCA 3PTYA 3PN1A 1CAXA 3W9AA 5A7SA 1WB7A 3FL7A 2PFWA 1FX5A 1S2EA 3V0BB 5JXIA 5AG2A 1UY1A 5A7WB 3OGRA 2R071 5GLUA 4C1WA 4R4ZA 1JUHA 2WNOA 4IW3A 3LKJA 4DUYB 1PMIA 3ZN4A 5E89A 5CBFA 4KI5M 1RIRA 2ZGRA 4IEOA 2VBDA 1C28A 3B94A 4LIUA 2BBVA 2NQYA 3MIBA 1XNQB 1US2A 1GH6A 2LP7A 3LEIA 4AVCA 1W6MB 2NYYA 1LGBA 3OYWA 4I0AA 1AJKA 4YIOA 4P9WA 1MZ5A 3DKWA 5EJZB 3TEWA 3ZBHA 2VXRA 3FUQA 5IVYA 3I2JA 3CJIB 5FK7A 2XONA 4IEQA 1YWKA 1DGSA 1PO11 4OX9O 3RYPA 1FJGB 1SLAA 1D7PM 1NTMH 1M4WA 5FP8A 2XPJA 1DGRN 2V5YA 1WW6A 3CU7A 1NH2B 2FDKA 3BTYA 2E9QA 3WG7C 1MQTC 2GC1A 3ZPOA 1B35B 2BNOA 3W7WA 5FQ0A 1TE1B 4AGVA 3LA2A 1I7FA 3C90A 1XQ8A 2QEXV 4HSJA 4LO4B 2WNVB 5JJNB 3Q4HA 3O5SA 3BB6A 4GKYA 4BDVB 3K4AA 1NOVA 5JMOA 3RRDA 2VCCA 2B45X 3CBNA 1UCXA 4O2AA 3BU7A 4DXWA 1ZM1A 5FAXA 2DCTA 3LIHA 2XL9A 1B06A 4CDXB 2RMU3 4XJAA 2ES3A 3DGEA 4P00B 4PDMA 3RWRD 4IETA 1NAEA 2HR3A 2XWJB 4K0KB 5CFDA 2F17A 2VNVA 3JBG3 1GP4A 1VF6A 5I93A 5C70A 4ZU4A 4O61A 4OHXA 1GOGA 4LFBB 2P4VA 1WD4A 1RSOA 3LIGA 4AEDA 1CGPA 4L9BA 4FFIA 2GC2A 3DSQA 2JX9A 1LU2A 4ITCA 1I94O 3A23A 2UXCO 2WN2A 5FBZA 3CHXA 4LQRA 4OGQB 2E3CA 2A7WA 4QX8A 2X5IB 2DCJA 2X6CA 1QQP1 1O6UA 1X9PA 1CJDA 1RUE1 4XBFA 3GF6A 4TV9A 3OBZA 5LB6A 3SYAA 2WRAA 4CDQA 5GM0A 3T0AA 3OUSA 1DQ1A 2KR2A 4IV1A 1OVSA 1JZ5A 4DY5A 1FV3A 4JI7O 1HDJA 4CCMA 3RZGA 4OVEA 3OMAB 5FZ3A 1H38A 5FOJB 3DXTA 2YEVA 4MTFA 2WAOA 3ML0A 4BWAA 1WCQA 4FPFA 1XHXA 1YO8A 3WDTA 3VBFC 5H9QA 1NQJA 3LDBA 3RZZA 1OI6A 1WW7A 4XCAA 1S5JA 4QPJA 3I5DA 1FOD2 1BQ0A 1QJX3 2Y6LA 2XAHA 1URFA 1F7YA 3SYOA 1M93A 2GNBA 3ZYRA 1NLQA 2LM3A 4PA7A 2EIMC 3CJIC 2Y34A 3CC2V 4A7YA 5LA6B 2XHBA 1RUJ1 3VD9A 1YZBA 4EWAA 5JSRA 4F83A 3FFZA 1WZXA 3I49A 2F4LA 3VBHA 5KHGA 2WS93 1SBFA 2JG8C 2VQTA 3TK1A 3L74H 4YM2A 1FYUA 3ZHVA 1HR0B 4GB33 5IHRA 4DV2B 4I4TA 4IDZA 3NJYA 5LA1A 3SMHA 4J7KA 3C2UA 1R092 4LKDA 4MYEA 5ABJB 3D0SA 1OA2A 1QEXA 5LXTA 5IJRA 1OHFA 1CZVA 5IDJA 3M3OA 3JD73 4JYCA 4ZOLB 3PJQA 2IXLA 3OUHA 4RHV3 2YROA 3OMNB 2VOVA 1Q6UA 1EYBA 2BE3A 3LEGA 3AYAA 1XE8A 2R9AA 1AI5A 4UW4A 4B3MO 1CX1A 2QTWB 4Q0UA 4LFBO 2JWPA 1NCQB 2VOKA 3LD8A 3RYHB 1VF5B 2DU0A 2GV9A 1S0EA 2KXLA 4GKXA 4JI1B 3T1LA 2QQVA 3V56A 3AG2B 1J3QA 4LWSA 3ABKC 2HWB2 4QD2A 4HYOA 1GWMA 3BOPA 2PN5A 4LF6B 1W0NA 1C57A 1QBZA 3JASB 2W39A 5IVVA 4EN7B 1R1A2 5E1RA 3WF1A 3POGA 2P6HA 5KMGA 2P22C 5IYZB 2E7AA 5J09A 1FPN2 1M5IA 3TWIA 4GCZA 1RC6A 2R063 2D6NA 3I2GA 1KBHA 1W0JG 1SQVH 1AYM2 3OCPA 4DOUA 4WM7B 5B1AB 2WWSA 4RFRB 2WBKA 1L3JA 2BZDA 2DVDA 2CH7B 1RFYA 3LOIA 2RDRA 5BV6A 3B3QE 1N32O 5LOVA 4ZPIA 3P5BA 1QXRA 4N9HA 2Q5TA 2LQTA 1SZXA 1DF0A 2GBOA 2XOKG 1HP8A 1GAXA 2ZHMA 2XJUA 1X50A 3M3QA 5IE9A 3PJSK 1M56B 4UVCA 2L6LA 3A4UA 4U2AA 4DR6O 3JD0A 2ZXQA 4CCCA 3M2MA 5ANQA 4AHYA 3DUIA 1IPJA 4P9IA 2JGDA 4EN8B 2XJQA 2D44A 3ME2A 4YZ4A 1SLBA 2LW7A 2JKBA 5J1XA 4IHJA 1OLMA 2IFWA 4O4LA 1LUVA 4QXHA 4Z82A 5G05L 4XF9A 4F3JA 2KSDA 2IUWA 2F4VB 2R062 2JG9C 4BIZA 2E7QA 1FFXB 5IVJA 3VBSC 1VF7A 2WNUC 3BA8A 1JX9A 1IVSA 3LNNA 4S2GA 1CAUB 4X65B 3Q8CA 1OCZB 3POBA 4ISQA 4D6SA 3QO5A 3IJ4A 4H13B 2Y0IA 1PNKA 5D8AB 5HV4A 4P02B 4RQPC 4OI1A 4QNHB 2Y4TA 4MUVA 3CCLV 4GWIA 4XURA 4BM8A 4MTXA 2VQAA 4X6RB 1NY72 2CSGA 4N53C 1N3OA 4AYUA 4FLWA 4EFEA 4LFAO 2E31A 4HKOA 2EX3A 4HBNA 3ZHQA 3B00A 1AXYA 1A34A 1H9WA 1IBMO 5LW9A 2B8MA 2RCVA 1FMD1 3SPGA 3T4HB 2X05A 5EZWA 2VVEA 4RHV2 2X8KA 1CZSA 1PD3A 4H7MA 4JI2O 1UZVA 3ACIA 3JARB 2CHHA 3OBRA 1ZNPA 3WDVA 3DEMA 3EFFK 2GN7A 5ERLA 1TQ5A 3E97A 2ZE5A 5FPLA 2ZX1A 5BMVA 4BIOA 2ZDIA 3KKYA 2E75B 3WX5A 3WT3A 1VRH2 1OBNA 2W1UA 5CKMA 5IFPA 1XPWA 3BKZA 4DV5O 3RFRA 2X7RB 2JJ2G 2CNAA 1GP6A 4W4ZA 3POFA 1SQBH 1ZRIA 4Y4YA 2ERFA 1SQ4A 2DQ3A 4KG0A 5F5AA 5A6ZA 1NA1B 3ZVXA 4UCOA 5FNVB 2R043 3WHUA 2OUJA 5DXDA 1DG6A 5LBQA 5K0UA 4C0BA 2RHPA 3KQRA 4UVAA 2OTLV 5FP4A 4LK6A 1TAEA 3FB5C 3FMGA 5IAVA 2OX0A 4DO0A 3V0BA 1VB2A 1ENSA 1IBKB 4WVMA 1Y66A 2WABA 2C0ZA 2WWUA 2IXJA 5DAVA 4NPMA 3N35A 2OCHA 3L72H 1QJY1 3A0BZ 4QE9A 5LHIA 2VH9A 3K58A 1ONAA 4JI0O 1UJWB 3CKHA 4HN0A 1IKPA 4DB5A 1QMJA 5BUVA 1T2XA 4TV8A 2C26A 4QPKA 3FYIB 5FPOA 1K3EA 5I0UA 1UY0A 1JOJA 5JQGB 4TOIA 4ZHQA 2RN9A 2XVLA 3VZLA 2RR12 2WA4A 3D8CA 5FZHA 2VW2A 4AGRA 2YUEA 2Y6FA 3VD5A 4UXAA 5EPAA 2Q8CA 1GNZA 3BTAA 3N3HA 3K2OA 1OQDA 3DGTA 3IZOA 3S5QA 2JDKA 1F4NA 5A9GA 1PVC2 1JZ3A 3AVSA 4IEPA 3AFGA 4HVOA 5I8YA 4MXWA 2R0HA 1RYYA 2VOXA 4CTEA 3I3EA 3VBUA 1UZYA 2R072 2QWRB 1UW8A 1VBE2 5J36A 5LHGA 1N1YA 1BCCH 2XJTA 2PY5A 1B6QA 2ZQMA 4PJYA 2F95B 4FFBB 4LULA 2QDNA 1BLZA 1EFRG 3C7EA 4AFAA 3N7KA 4QB2A 1RUJ3 4LBKA 2XBO3 3T2MA 3CYOA 4O2BA 3JQWA 4KWLA 3CNAA 2FZ1A 3W59A 2DWEC 5HCAA 2GSMB 3OBAA 1KFXL 3VN4A 1HRV1 4CDUA 3JD1A 4UFMA 1ZBA2 2B4KA 4YGBA 3KS7A 1QJU1 1UWWA 4JAAA 3POIA 3G67A 3HR9A 3GCXA 5CFDB 1M56C 2YIBA 3APQA 1IZ3A 5KAIZ 2OIGA 1J1LA 1RSOB 3IIAA 2IFRA 4L11A 1E5IA 3B7MA 3ILFA 3ZKYA 4XZUG 4ONUA 3HR0A 1W39A 1UX7A 4CZSA 5HXVA 3T2TA 2PLV1 1VBD1 3ZXEA 2FB5A 4JQTA 4Y1YA 3IAYA 3KZ4C 3K46A 3ABUA 2CTRA 4CDWA 3JBG2 4CU6A 2R042 4JKKA 2Q69A 2UUBB 2D6OX 1OA4A 5AC91 1U0AA 5BNOA 2HWE1 4AHXA 2AHYA 1R1A3 2QSAA 2VMEA 1TGOA 5EQUA 1WLWA 1KD7A 2GMPA 1GM8A 3I8TA 3NQHA 5LL6Y 5IYDO 3I2IA 5FXWA 3U4SA 5C7GA 4GJYA 1H8EG 2XQRA 2YDEA 4W6XA 4LUKA 3ETGA 1YIPA 1RUH1 2P3YA 4NB5A 4NMIA 2OT7A 4IYHA 4ABMA 3AMQA 2G1MA 2WLLA 3ZXJA 3N2KA 3FB7C 5FWJA 1NCQC 1EAH2 3POSA 1N36O 2WN3A 2WZR3 2PQSA 4N23A 3OB8A 4C7UA 3CXCU 2BNMA 2OZ6A 1QQP2 3I3DA 5DAQA 3JU9A 1IBLO 2P3KA 2R1BA 4MV2A 1AYN2 1NVPD 3HQRA 1VQ7V 4B3RB 3AXEA 5KXEA 4ZU7A 1ULEA 2BNNA 4AHWA 3IAPA 4ZXKA 3HT2A 1K8AW 3F5WC 2XLAA 4I4TB 4XDLA 1OVPA 3Q8EA 1UO9A 3FHIB 4XDQA 1UMIA 4AI0A 2X6AA 1RMU3 5IATA 1Q6IA 1NQDA 1JZ6A 3C7FA 3UGHA 3ZFGA 4UBHA 2DURA 5A3OA 4Y1UA 3H7JA 3HMYA 1E79G 3ZHTA 2WL1A 2VNRA 4N21A 1VALA 1H6XA 1ZA7A 2BDRA 3R4DB 4YG3A 5JVVA 3DXRB 3U37A 1LTEA 3QH7A 3K59A 3GBFA 4BA6A 2NP0A 2R041 1XL6A 2XJVA 4KU8A 1W2BU 5FUPA 3H01A 4UFKA 2CK3G 5GTIZ 4BW9A 4HG6B 1JZ2A 2PAMA 4O4IA 1QGLA 1ZSPA 2CYFA 3BRCA 5JJEB 1VLNA 5CA1A 4ES8A 1O7FA 3ICXA
chains in the Genus database with same CATH topology
3MIEA 3WW1A 1O91A 5AVAA 3TBDA 1NCRC 2WIIB 3ZX7A 3MIFA 1LU1A 1V9U3 2WSVA 3LA3A 1CESA 5ACA1 2B46X 2WFF3 1RUG2 3D4KA 4HFSA 4BHPA 1OMIA 4Y0EA 1OSGA 1VBB1 2ZX0A 4HN1A 3ZN6A 4IEWA 1DU3D 4LHLA 5DG1A 5J96B 1SBDA 3ILRA 1KQRA 4E4DX 4O9GA 2EXHA 2PLV3 1TNRA 4AVSA 2QE3A 4NR1A 4WV8A 3OF1A 1W0PA 5SV5A 1FPN1 3ZXLA 4GWMA 1OOPC 1RHI2 4YLZA 1ZZ6A 1AJOA 1LHOA 4XF1A 3N36A 2DV9A 1FNZA 1V6JA 2EAAA 2YZ4A 1VBC3 2ZGPA 4LA3A 1PK6C 1RUE3 5J7MA 5JI9A 3ENRA 5FQ0B 4COVA 3AYDA 4PDWA 1OIHA 4B4QA 2GMMA 4BHIA 3VKOA 3KCXA 4CEYA 2Y0OA 1AXZA 4WM7A 1J3RA 3VZMA 2WNVA 2VW0A 4PBPA 1DDLA 2RS53 4XEZA 3WHTA 3VKNA 1WA4A 4YG6A 2BPA2 3MIDA 1LOBA 4RD7A 3M3CA 2Q1MA 5L7OC 1YI9A 4XJZA 4YGDA 1REDA 1MZ6A 2ZJCA 5L36A 2PHUA 4HANA 2ZZJA 5D8AC 3VBSA 2HWD1 3V17A 3NV3A 1DQ0A 1RITA 2RS12 1Z7S2 4KNCA 4Q4Y1 3M1HA 1SFYA 1H2KA 3AP6A 5JAXA 4CEYB 2I07B 3FWEA 4KGGA 1PGW1 1VBD3 1EV12 1W2UA 2PAKA 4S2FA 1PO21 3THTA 3TRSB 4ASLA 4D3WA 1WD3A 4JGZC 4BYYA 1C4RA 1AYM1 1AZDA 2GH8A 2ET7A 1AYM3 2PQQA 2UURA 4PLOA 4HK8A 3WDXA 3TNQA 3ZDSA 1F31A 5IK4A 1X8EA 2A75A 5CG9A 4FTBA 1PHMA 1W0OA 2IWGB 2K2SA 1AR92 1G9BA 1NXMA 1ULFA 1OTJA 2OPKA 5CFCA 2HEVF 1CQ9A 3AKSA 2WBPA 4AI1A 4AEDB 1HKDA 3ZFFB 4X8NA 4XFFA 5FO9B 3VHRA 3CL1A 2EXIA 4LBQB 2O0OA 1R1A1 1RUI3 4M00A 5CFDC 1MVQA 4FO9A 4AEDC 4AQTA 2RM21 3WP3A 2ENRA 1CX4A 5GZGA 1N1SA 4AI8A 1J58A 4XMAA 5AVPA 3GBWA 3VHNA 2OZJA 3M4FA 4GXLA 4FPLA 1RJ7A 4XFBA 2HWB1 1ASJ2 3ACLA 5CAZA 1WBFA 1LCLA 1CAUA 5CFCB 2DFBA 1PO22 1BMV1 4KWJA 3VZNA 3KMHA 2EAKA 4M3CA 1DGWX 4FSJA 1S0FA 3AMPA 4RA0A 3ZFFA 3Q9OA 4KU7A 1Z7S1 4Q4X3 4U36A 2NN8A 1QHDA 3LA7A 4XYXA 1FT9A 3GYDA 4K1ZA 4QMAA 5DUWA 5BNOC 1ZBA1 3RI9A 5IK7A 4UW5A 4AFBA 4M2FA 3KD4A 2ETEA 4BIFA 4QPIB 4RR3C 4Q27A 5FLJA 3KM5A 4CDQB 1XQNA 3I54A 5T50A 3IDBB 2VMGA 3WUDA 4C91A 3E5UA 3EQEA 3SXWA 1AX1A 1O5UA 4FP3A 4RQPA 3VZJA 1OQ1A 4FQZA 3MEPA 4ORFA 4W65A 1ND2A 4Q2FA 5FRAA 2DVBA 2GNMA 2PELA 4BHFA 2GNTA 1JH5A 2UU8A 5CG8A 1OIIA 2ET1A 4IEXA 1C3HA 2Z79A 4X8PA 4M23A 4YFWA 4I02A 4A7KA 4AEMA 2VMIA 2O8OA 3PVOA 2JECA 3NJZA 3RJ2X 1C8M2 3ZXFA 1YUDA 1AR93 5AFEA 1RUF2 5BPXA 5GZFA 1MZEA 4LUMA 1NX8A 1SFNA 3IN9A 3CLPA 4S2HA 3AZVA 2D6LX 1VIWB 4L92A 1SACA 4MGZE 2BEOA 4GH4A 4COYA 4Q0VA 4M27A 3ZN5A 1R093 1BEV3 3VKFC 4DS0A 1D4VB 3ATGA 1S1AA 2UWBA 3DL3A 1N47A 1EPZA 1D4M2 4K21A 2DCKA 2ZPXA 1LKNA 4M2CA 1DZQA 2DTYA 4IEYA 2C1FA 4YFZA 4NWWA 2ATFA 3WG2A 1PGW2 <