2UXDO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxdO00
1HNWO 4DR5O 4DR3O 2DOSA 1XEQA 2AGAA 2UXCO 4DV2O 1J5EO 1FKAO 4JV5O 4NXMO 1HNZO 1IBMO 4OPAA 2UXBO 4LF7O 4DV1O 1R6TA 1N32O 4DUZO 3J7AU 1DK1A 4LFCO 1XNRO 1G1XB 1F7YA 4KHPO 1FYJA 1IBLO 4K0KO 4B3RO 4OX9O 1R1BA 4X62O 1YZBA 4JI3O 4DV5O 5BY1A 5BR8O 4JYAO 4X64O 4OPHA 4B3SO 4JI6O 2HHHO 4DR4O 1AILA 5A2QN 2UXDO 1XMQO 1XNQO 2Z0AA 1N33O 4GKKO 1N34O 4DUYO 2UUAO 3T1YO 4GKJO 5IT9N 3J80N 4A5UB 1I94O 1IBKO 5BXZA 3SDLA 4JI0O 4DR6O 5LMUO 2DJVA 4LF8O 4JI5O 3RT3C 3O65A 4JI8O 4LF4O 2VQFO 4LFBO 4LF5O 3JAMN 1X59A 2LW7A 4DR1O 4LF6O 2F4VO 5H5NA 4JI2O 2JRIA 2ZKOA 4LFAO 4DR7O 5IWAO 4DV0O 3F5TA 4X66O 2UU9O 2UUBO 4DR2O 1HNXO 4B3MO 1KUQA 4NXNO 1XMOO 1HR0O 1A32A 4DV6O 4LF9O 1AB3A 1FJGO 4DV7O 4JI4O 3J81N 2E5LO 5LL6Y 4YHHO 1NS1A 3OTOO 2N74A 4DV4O 2UUCO 3T1HO 4X65O 5FLXN 2ZM6O 3M8AA 5LMNO 4B3TO 3R66A 2FKXA 4YY3O 2VQEO 4DV3O 1D2DA 4JI1O 4AQYO 4JI7O 1N36O
chains in the Genus database with same CATH superfamily
3E22A 3KG2A 1PL0A 4CH6A 4X62B 1FPOA 5CMUA 3HKEA 4IHJA 4UCVA 2BTOA 2A7WA 1VEWA 3W7TA 1WJZA 5CA1B 1W2BU 3STZC 1JFFB 3BPZA 3LSUA 4NYKA 3D3IA 1KU9A 1Q43A 2H3OA 3APOA 3CCSV 4JI0B 2JS3A 5J2UA 3LNMB 1VQNV 2XAQA 3GVMA 2QJ1A 3HKBB 2EIKC 2FYUH 1SQQH 2CH7A 2G38A 2UUAO 5IE9A 4A5UB 1EZVH 1IX9A 2VQFB 1Q7YW 1M56C 3ZRWA 3QF7A 3A2FA 4LF6B 2YXYA 5LMUO 4FLUA 4LBEC 3B77A 2QKCA 1BS3A 2OWOA 4BAYA 3VQVA 4YIOA 1FFTB 5LOVA 2Y4TA 5CBHA 3RYIB 3CE2A 5FNVA 3WB1A 4YHHB 3BAAA 4DV4B 3A8TA 4NTYA 1GN4A 1L1FA 1JJ2U 5IWAO 3DGEA 3ZHRA 4WCEV 1Q6HA 1M90W 1XMOO 1HR0O 4LF9O 1SS3A 1L8DA 4FLYA 4JI7B 5LHHA 4DV7O 1L0NH 4JI6B 1NTMH 4JTAB 2OTJV 2JVDA 2ZM6O 2QTOA 2AZ2A 1XNQB 3ASOC 1YF2A 3W7WA 3TETA 5KMGA 2GBOA 4LFCB 4O4JA 5CBFA 1OJHA 2F23A 1P4RA 1G4YB 1N8RW 2VS0A 5JWPA 4TV8A 2ZR2A 2UXBO 4JYAB 5E1AC 3CCUV 1R3LC 5LA6A 5K1PA 3K5LA 4ZI7A 2ZDIC 4MTOA 4PHZA 1SKVA 5B1AC 1XOUA 1WN7A 1YTFD 5D5QA 4KUMA 1B04A 4PA7A 3HB3B 3OM3B 4AILC 3DXRB 2L6LA 3P3PA 3LDDA 3JALA 3ZN0A 5JJJB 2O57A 1OCZC 1FXKB 4MSWC 2ZIOA 4I9WA 2ZE5A 1GM7A 5EYPA 2NLJC 1CXZB 5LHGA 3O65A 3ZHQA 4LF4O 3AG1C 2Z3YA 4BR6A 1KECA 4X1YB 1Q3EA 4FM2A 1SQXH 2LW1A 3CS5A 3L72H 2JDIG 5LGNA 1VMGA 4DXWA 2X6AA 1IBLB 4B3TB 3EXAA 2E75B 4GLXA 2UU9O 5AG2A 1AP6A 1L0LH 3BABA 1YHQV 3CX5F 4XDKA 3CCEV 4GCZA 1VQPV 2X0LA 3ETDA 5IYZB 1TVKB 3DC5A 3B4SA 1HNZB 5EIBD 2PF4E 3QTCA 4DRXB 4TQDA 1P7BA 4PDMA 4BIUA 4X20A 1NH2D 2WLKA 2Q69A 2QWQB 1FKAO 5BMVA 4I55B 4YXWG 5LP6B 3CRQA 1LR1A 4IL6Z 1EZJA 5C8YB 4TV9A 4DV1O 1R6TA 1B06A 1DF5A 3U11A 2F43G 3CSXA 2UXDB 3ZN1A 3AK2A 3JARA 1XUQA 2YI9A 3E83A 3CPWU 2E3CA 4ABMA 4I9QA 1FS0G 4TUYB 2N05A 4JI6O 2QM4A 2DYSC 4QGPA 3CC7V 4J42A 4B3MB 1XNQO 1S0VA 1R73A 2QA4V 4L87A 3U0ZA 1VQ7V 1YJNV 1AI5A 1AI6A 2FMLA 4FM1A 4LF5B 3M7MX 2WWWA 3C3TA 3ZHSA 3SPIA 4DO2A 3K59A 3RT3C 4GUNA 3CWBH 4BIOA 4J9YB 3AK1A 2E74B 5BZBA 1H2LA 3MD0A 4I0XA 5KHHA 3OEEG 5EC2C 2UUCB 2ZKOA 4LR3A 5LMNB 3RGBA 3K0GA 3CCLV 3K06A 4F4LA 4X1IA 4CBCA 4NTWA 3JASB 4KFMA 3W7UA 4JTDB 2RN9A 4DV2B 3VBBA 1Q86W 2R9RB 5B1OA 1H8HG 3R66A 4D7TA 4NVPA 1VIBA 3CB2A 4J7KA 4CH3A 1HDJA 5LP6C 4U3JB 2KG7B 4CH4A 5JJNB 1NZ6A 3IAYA 5EK0A 1ZLZA 2KB1A 2UXCO 4PDRA 4Q6GA 3ABTA 4FFKA 3I56V 1GMGA 2HHHB 4DUZO 1S3JA 1DK1A 1G1XB 1IBLO 3UO3A 4GKKB 3ZBHA 4J41A 1EN4A 2A9HA 2ILMA 3RWRD 3N2GA 3N2KA 2IU0A 1KBHA 4ICGA 3CMEV 4B3SO 2Q9LA 4ZIBA 1S72V 4DR4O 5A2QN 4B08A 1XMQO 1UJWB 4E4EA 2ZE8A 1QU7A 3BFRA 3ABMB 1M4UA 4HNAB 3BY6A 1XDCA 2PZSA 1BCCH 5L3DA 1AR5A 4N21A 1BL8A 3SGIA 3ASNC 2IJJA 2EZPA 3HPLC 5H6QA 4I5SA 1NR1A 4PI2A 1YXBA 3SYCA 4ZOLB 4XBFA 1KC8W 3B8MA 4UCRA 3BEHA 3OEHG 2F4VO 2Y4UA 4LF7B 3AK3A 3Q4HA 4YJ2A 5IYDO 3T1HB 1V9PA 1K33A 1DLBA 5J2UB 3ZHUA 1SESA 2UUBO 4DR2O 5EBLC 4B3MO 5JH7A 1YJ9V 1BHAA 1AJQA 3R65A 2RQ6A 4AQYB 1WAZA 4GZRB 2CH7B 2E5LO 2NNUA 5B66Z 2ZXWC 4IYHA 3M8AA 3SJAC 3VQWA 2DE0X 2YIBA 4K35A 3X2QB 3DSQA 2QM8A 4ZBMA 4P30A 4DR5O 1JA8A 1F4MA 1KMIZ 4UB6Z 3CCMV 2A06H 1MZFA 3SYAA 5LYJA 2WA3A 3E8HA 1M57B 1PD3A 2WLNA 4MVRA 2EIJB 1VQ5V 1MABG 1T5EA 5FNVB 1K92A 2W6IG 2GTAA 4PDVA 3K08A 4O2AA 2YEVA 2UUAB 2MW2B 3AEIA 1KP2A 5FPOA 4NR1A 5LMUB 4DUYO 3B2EE 2W0FC 1M9NA 5KMGB 1BT8A 3HR0A 1E79G 4O4JB 2EINC 3H9VA 1PKXA 4D7SA 3OUFA 2DW4A 4JYCA 1DTOA 4TV8B 3OR6C 4IYIA 5IWAB 4JI8O 1B3QA 2ETNA 2XOKG 4FLTA 3JD3A 1SA0B 2WLIB 5LA6B 1XMOB 4JV5B 3JD2A 4X89A 4LF9B 2QWRB 1UPGA 2JS5A 3K9AA 4ZI7B 2PI5A 4DV7B 4MVMA 4DR7O 2Q4PA 4X66O 4TWKA 2X7RB 4CS4A 4O4HA 3K58A 3MAQA 3OMNB 5HFLA 2KSDA 1OZ0A 3UT5A 1PV0A 4X65O 3ML0A 2UXBB 2HFEC 3OMAB 1KB9F 1P49A 5ITZA 5KAIZ 5KHKA 1I94B 5EYPB 1BZKA 1XEQA 4YJ3B 1N0JA 1NU1H 2V1DA 3K79A 3ETGA 2LGWA 2ZNJA 3TXQA 3LSQA 5IJ0A 3JCUZ 3EVKA 1H2KA 4LF7O 4FMTA 1HWYA 2LGQA 1Q82W 2OYQA 1S76D 4X8AA 3P3NA 2EULA 3E89A 3SR2C 1R1BA 3K5NA 3JSLA 3HKDA 2YIAA 4JF3A 4EFBA 2HEPA 1W59A 2JK5C 1NVPD 1FXHA 4UCTA 3AG3B 1ZX3A 3OFNG 5FL7G 3AG7A 1N33O 3BA9A 3IFXA 1N34O 3J80N 4IIJB 4LF4B 3JAKA 2RDCA 1ZTEA 4FLXA 1IBKO 2K9PA 1WPXA 4EEQA 4X20B 2ZD9A 2HVJC 2WLLA 4AQYO 5KLVH 4FK5C 5BMVB 5B1BC 4D6TH 3F5WC 5CB4A 2XASA 1Q81W 1E1QG 4TV9B 2UU9B 4LFBO 1PP9H 3RYFB 4I4TA 2XAJA 1PNLA 3JARB 2F66C 3TK1A 1XL4A 3IC7A 5IY5B 5B3SB 1OHHG 2P5OA 1WB7A 3QNEA 1BGYH 4Z2WA 5DM6V 4DW0A 4O4LA 4MVUA 4NXNO 4DV6O 4X9QA 2CK3G 5KX5A 2IU3A 2YUAA 4HAMA 3RYHA 3ZMVA 4FLZA 1SQVH 1VQLV 3E2EA 4DV1B 3G67A 2XUMA 5GONA 5J9PC 1NI8A 3AG2B 3OGIB 1N36O 3SYQA 2EJRA 4JV5O 4I50A 4LF8B 1K5SA 1WA8A 3K0DA 3D36C 3ICXA 1XNRO 4I0XB 2AXTZ 1FYJA 1PNMA 1CEZA 2BOCC 3P30A 4AHCA 3OR7C 3AG3C 1H2GA 1YZBA 2Q73A 2PYLA 4PELA 4Z1VA 4X1IB 1ZL8A 2WSSG 4MVQA 3T1CA 2H94A 1EBOA 1ZSPA 1Q8IA 4RQEA 3G71V 3T1YO 1US6A 3ABLB 1I94O 1TAEA 4WFHA 5KUMA 5EZYB 1IXMA 1R3JC 2KQXA 3HKCA 2HR3A 4U7OA 4UXNA 1FAFA 2QGNA 2X6CA 1SZTA 4OGQB 1IVSA 1BE3H 2Q7EA 4QJFB 2OT5A 1IXBA 1D5AA 2E76B 5B3SC 2A79B 1WPBA 3RYCA 1WP7A 1QLNA 1R3IC 2BOBC 2IJIA 2F1MA 4J7ZA 2BE3A 4KP4A 1JCHA 4X1KB 3N2KB 2B5UA 1U96A 5DEDA 3F5TA 4OX9B 2YDEA 1HNXO 3MDSA 3P32A 2WA4A 1A32A 4PA4A 2OTLV 3OTOO 2UXCB 1QHTA 2KKWA 3AG2C 1QBZA 5DECA 1XILA 4GKJB 2XT9A 4FVMA 4DUZB 1D2DA 2DQ0A 3L71H 3VQYA 2JGDA 4MTXA 1OCOB 2M6YA 2R70A 1OCRB 4U7NA 2DYRB 1TA8A 4B3SB 1VQ4V 1D5NA 3SPGA 1I5YA 4DR4B 3Q4HB 1YEWA 4YJ2B 1XREA 1H8EG 1XMQB 1F7YA 1BQ0A 2OCHA 3ZCCA 1TUBA 3H1IH 4L8JA 5JH7B 2PUSA 5J2TA 2ZIMA 3OUSA 4LC1A 4BW9A 4F6RB 1WB8A 4CC6A 5A9GA 2JEXA 4G27B 1GKFA 4R50A 5IT9N 4UUJC 4XDJA 5LXTA 1MZEA 5CA1A 1SERA 2Z5UA 4H0LB 4DK1A 1VQ9V 3L75H 2F4VB 3E8BA 4AI8A 4JZGA 3ZEDA 4LF8O 2ZDIA 1YSCA 1NT2B 1FXKC 3PJSK 1JPXA 2B1IA 4DR2B 2UUBB 4IGGA 3VQXA 4O2AB 2YEVB 5GW7A 2E5LB 1Y67A 3CRRA 3EHBB 1PM9A 1EN5A 2EILB 4N23A 2YS8A 3WG7B 1M1KW 4UCOA 4MW8A 4DR5B 1THZA 1CP9A 2ZR3A 3WFVA 3FX7A 1I7FA 3RYIA 5JCOC 5KA5A 1EFRG 3ZX6A 2ODMA 3T2MA 4K3AA 1RM1B 5EC1C 4FLWA 4WFAV 2ITDC 4JI1O 1HNWO 1M5IA 2AGAA 1J5EO 3ZRXA 1Y74B 3SJBC 4G2KA 1CPYA 2P22C 4OPAA 1V55B 1XHXA 2V7QG 4H44B 2IM9A 4DUYB 4TSFG 3AG4B 4OX9O 4RO2A 2CTPA 4LNUA 5BR8O 2P67A 1PPJH 2QE7G 4O4HB 3STLC 1QLEB 4MVZA 3ZHVA 3UT5B 3JATA 2DWDC 4GKJO 5JVDA 2XAGA 4JI8B 3NR7A 1AI7A 3MHHC 4QE7A 4B7EA 3CCRV 3FB7C 3CJHB 2QWPB 3ZMZA 3T4ZA 5IJ9A 3C90A 2NR5A 4DR7B 5LGTA 1HW7A 3L70H 4RAIA 3GB7C 5IJ0B 4X66B 3DXRA 2B1GA 2RCVA 2Q0OC 2EILC 3KKYA 1Z5WA 1KKDA 4F6EA 4P2ZA 1VP7A 4X65B 3F7YC 1FFXB 1JR9A 1W0JG 1PL4A 2HLDG 3E22B 3IC9A 1ORQC 1SZXA 1K8AW 3IJ4A 5K1XA 1Q6IA 3HKEB 4IHJB 2PGGA 3JAKB 3L73H 2W6JG 1YTFB 2Q0AA 3U10A 2WLLB 1R3KC 1ZAUA 1O9GA 3ABUA 2VWKA 1GAXA 5LHIA 4UFZA 5JCOA 4MTFA 2JIZG 2BSKA 2FTKA 5CB4B 4X88A 3CCVV 5GTIZ 4UCSA 2PY5A 4UCUA 4JAVA 5E79Z 2LQTA 3OAAG 1N32O 4I4TB 2YICA 2Q68A 3J7AU 3M99B 3UQ8A 1N33B 4UV9A 3ZRWB 1N34B 3CP1A 2V4DA 1RPRA 1K5QA 1S5JA 3ABKB 3H01A 4O4LB 1IBKB 4JI3O 2L35A 4RUEA 2ADQB 3QG5A 2ZE7A 4DK0A 1SETA 1GO3F 1LUWA 1AILA 5KX5B 1Q90D 5LP6A 5LOVB 2IW5A 2ZINA 5C8YA 1G8MA 3C3SA 2A0LA 4O2BA 3RYHB 1VQ8V 1Y76A 5KUKA 3GWKC 4LFBB 5GONB 2EZOA 1VQKV 2RJZA 3OT7A 4YY3B 3BRCA 1H2NA 2WLMA 4JI5O 3ABMC 1EM1A 1WA8B 1XBLA 5KHJA 1SF9A 3ZMUA 2AHYA 3A0HZ 1NH2B 4NXNB 2XAHA 2HG5C 4QPKA 2ADPA 4DV6B 2Q7HA 1K73W 1QR8A 1MA1A 5JQGA 4IT5A 2HVKC 4DV0O 4NTXA 1YCIA 3BCCH 4FPPA 2CUGA 3OMIB 3OW2U 2EIMB 4R7CA 4X64B 1N36B 1YI2V 1AB3A 1MG1A 3LUTB 4QPJA 2YI8A 2VRZA 1F23A 2PTMA 1FXVA 3K5MA 1ZWIC 5L3GA 3CMAV 3HKCB 1HP8A 4LH6A 3TXSA 3E86A 2HJDA 4NKGB 2PYJA 1XNRB 1DF4A 3ZMSA 1ZUQA 1X4TA 2LFSA 4PA6A 4P9OA 3H1HH 3RYCB 2OCCB 1EN6A 2AZ0A 4QIWF 3X2QC 3JALB 2QTSA 2H8PC 3BVOA 1IDSA 4GX1A 5TISZ 3CD6V 4PDLA 4K0KO 1VF7A 3FB6C 2EIKB 3T1YB 1AROP 4FFBA 4GT1A 1M57C 2EIJC 1KKCA 4LFAB 1M56B 1MSDA 2N04A 1QVGU 2ZNIA 2Z0AA 1WP8A 3ZRVA 5L3BA 1N4CA 3ZJZA 2WLJA 3ZIAG 4EB6A 3G6EV 3WB0A 1VF6C 2JGDB 1BMFG 3APQA 1BHBA 2IH3C 2ARHA 5IYCO 2Q8VA 4Q20A 2VWJA 3WB2A 5B1NA 5GTHZ 1RP3B 1ENVA 3THOA 1HNXB 4U3FH 3B8NA 4RWUA 4EFEA 2HKOA 2JRIA 3OTOB 1Y6XA 1TUBB 1F51A 2Q6AA 2GUZA 5J2TB 3KZIZ 3JYCA 2JJ1G 3ASOB 2PI4A 3G6BA 3CCQV 2IH1C 1KUQA 3FAVA 1NJIW 2P06A 3FD9A 1H38A 2JEUA 4FJCC 4MT8A 2Y69B 4ZOLA 3D3QA 5LXTB 4ASUG 4UVAA 4UVBA 2FKXA 4YY3O 2VQEO 1GK9A 4JAAA 5L3FA 4ZHQA 1XQ8A 2OCCC 3JSNA 3T4DA 4KL1A 5EBMC 5B1AB 2XTAA 1YJWV 2CTWA 2Q7GA 5LBQA 1K34A 1W0KG 4B3RO 3E35A 1YVWA 1QR9A 2XNDG 1UFIA 4CS3A 1OCZB 5CN0A 4X64O 4OPHA 3H1JH 1AI4A 4FM0A 2QR4A 3FYEB 3AG1B 3JAWA 2CAZC 2LFRA 2HP8A 2P4KA 2Y48A 4UV8A 5B5EZ 1GN3A 1RFYA 2GHYA 1NKDA 4J9ZB 1AR1B 4O4IA 1VF6A 1V54B 4H37A 4WFFA 4MVSA 3K57A 1X59A 4NXMB 4CZZA 1LNQA 1GTOA 4J11A 3WU2Z 2ZQMA 1F4NA 3CHXA 3L9DA 3I55V 4LFAO 3ZRSA 4WFGA 4LNUB 3E8GA 1M93A 3FFQA 4BIZA 1YIJV 2Y69C 3ZMTA 4JI1B 3JATB 2UXXA 1FJGO 5IY5C 3CYOA 1HNWB 4JI4O 2DN9A 3J81N 4BWAA 4GX2A 5JVDB 3CC4V 1J5EB 1SA0A 2WLIA 3OGCC 4WFBV 2GSMB 4JASA 3I5DA 2OIEA 4TOIA 4DV3O 1KQSU 3N2GB 2QM7A 5IJ9B 5CA3A 1IZ3A 4WBNA 3MHSC 5CA0A 4XDLA 1IBMO 5BR8B 1XL6A 4MW3A 4JYBA 2CTRA 5D5PA 1GH6A 3TGUH 2DYSB 1YITV 3RW0A 4KHPO 4DR1B 2JJ2G 2IJHA 4X62O 1WNSA 1R6NA 3FB5C 2A3QA 3CEIA 5CBGA 2D3OW 4YJ3A 4J7JA 3W7XA 1O9HA 1QCEA 1NQTA 1RSOA 1VQ6V 1KD1W 3L74H 2RMKB 4LCUC 1K3EA 4LWSA 1Q6UA 1S77D 1JMKC 2AHZA 4JI0O 3D36A 3UO2A 1V54C 2BTQA 2BSKB 3H1KH 2R9AA 2ZT9B 1AP5A 3ABLC 1I08A 2VQFO 1S5LZ 1VF5B 4DR3B 2P7TC 3OD4A 2BCCH 2ZE6A 3ZS8C 2QSAA 3ETEA 4LF6O 1SC5B 4IIJA 1P7GA 5KA6A 3A0RA 5IDJA 5H5NA 1NTKH 4K8ZA 1JFFA 5KAFZ 5L3CA 1NTZH 1LUVA 3K5OA 3G80A 5LYJB 4TT3G 4DV5B 4O2BB 4YHHO 1NS1A 3TJTA 1Y66A 4DV4O 3HKBA 1Y76B 1Z2GA 3RYFA 1R6KA 4PA3A 2D2CB 1TGOA 3LSSA 2EX3A 1N32B 1GM9A 1NVPB 1I5XA 4B7KA 2B9ZA 2W0XA 3E8FA 4JI7O 1FD9A 2CE4A 3N27A 1K7DA 2UXNA 1K97A 3UM7A 2FB5A 2P90A 3B40A 4FZ1A 3KCXA 3RBZA 5F2VO 4JI3B 4NXMO 3RN4A 5DN6G 4H33A 1COWG 4LFCO 1JQ0A 4TQFA 1OCOC 5JQGB 5L3EA 1H2SB 3S3XA 1OCRC 4QNHB 2DYRC 1JVMA 5BY1A 3OE7G 4JYAO 3EFFK 2EJ7A 1VQOV 1J95A 2IJKA 3B09A 3ASNB 4PV1B 2YSUB 3ZHTA 1OV9A 3JD4A 4JI5B 1QQCA 4R8CA 5BXZA 4UVCA 4RQFA 3UKMA 1RPOA 4W4KA 4KXRA 1VARA 4MVOA 2QKAA 3BA8A 3ETQA 5IYBO 4DV0B 1TUEB 2CGNA 1JOYA 1B6QA 2LW7A 4DR1O 1Q5OA 1SQBH 3QO8A 5JJEB 4J80A 5H9CA 4JTCB 4ZKIA 3QO7A 5EZYA 5ITZB 4FFBB 3W7SA 2WPDG 1BSMA 5H6RA 2ZXWB 2IBZH 3IGAC 4C7UA 3F7VC 3CCJV 1JJOA 4JAUA 3FKSG 1AVMA 1K4CC 2DWEC 3K3WA 2YC0A 5LL6Y 2N74A 2K1EA 5LGUA 4EB6B 4B3TO 3BHPA 1Z5VA 4DYLA 1FXKA 3WG7C 4X1KA 3S3WA 4JYYA 3VOUA 3HKDB 3FYIB 4K0KB 3LNNA 4DR6B 2RNBA 4DR3O 2DOSA 1QVFU 4JPRA 2R9IA 5C93A 2CGOA 1HNZO 1RM1C 4UB8Z 5FPRA 4X1YA 1XHZA 2LO1A 4CH5A 3DC6A 1NBMG 4WFEA 2Y0IA 4G28B 4P9PA 2GUZB 3D8CA 4QE9A 4JI2B 4EKWA 4DV5O 3FAVB 1MMMA 1GM8A 3PN1A 2HJFC 1V55C 2QWOB 2EINB 4PD4F 2WAMA 2UXDO 3KCYA 3K9SA 2CDYA 3RFRA 3K04A 2EBOA 3AG4C 4RUFA 1SQFA 5IYZA 1URFA 2M7WA 1TVKA 1Y4MA 3SDLA 4GX5A 5H2FZ 3JCZA 1SQGA 4ZHQB 4DRXA 4YIPA 1P84F 2DJVA 1QLEC 2YXLA 1JX9A 2R72A 3RVYA 1IURA 4I55A 3SPCA 4K8XA 4PI0A 4F6RA 1PNKA 2C2AA 4LF5O 1GN2A 1KYOF 3JAMN 4H13B 2JGUA 4J10A 4BW5A 3G4SV 2YXHA 3QVNA 2F93B 2QWNB 2GDSA 4JZ2A 1XI1A 3CXCU 4GX0A 2VQEB 1H2MA 4TUYA 1OCCB 4HYOA 4I50B 2YIDA 1MNGA 1BQZA 3SYPA 4FZ0A 5EBWC 2UUCO 1AJNA 3JAWB 5LMNO 3SPJA 3CXHF 2DMXA 1ROPA 2GV9A 1GRJA 2LP7A 4FLVA 4B3RB 1QNMA 4PJ0Z 1ZL8B 4O4IB 2FL4A 1KP3A 4DV2O 2WLHA 1YDXA 2CTQA 4I7ZB 3SPHA 2P4VA 4OXSA 2LJ2A 1G6UA 1K9MW 4JGSA 2X6BA 4R6ZA 1SQPH 1WLEA 2GTSA 4CC5A 1U97A 4MTGA 1AJPA 3RVZA 1S5HC 2ZCEA 3DTUB 3GWOA 2HHHO 3NXSA 1Y74A 1AR4A 4PA9A 5B1BB 4GKKO 1E1RG 4FIPC 1K4DC 3JASA 3O9OA 4W4LA 1DGSA 1HR0B 4DW1A 2P6JA 3LDCA 3ABKC 1N0NA 3CC2V 3A0BZ 2MK3A 1I0HA 4DR6O 4E2LA 2ZM6B 4LH7A 4MS2A 2OIGA 4WBNB 4U3JA 2KG7A 4CS2A 2QEXV 3TCUA 1NR7A 2NN4A 4HBNA 4NB5A 5CA0B 3H1LH 4Z1MG 2AW9A 2F95B 3JD0A 1SRYA 5KHIA 2XHBA 4HZ3A 4GYCB 1FJGB 4JI4B 4JI2O 1OCCC 1VQMV 5EIBC 2QKSA 3CRMA 1MSWD 3CJHA 2YIBD 2ATKC 2XAFA 3SYOA 4DV3B 3SJQC 3K03A 1RSOB 2Q5ZA 5KHGA 2DQ3A 4LP8A 3T1HO 4LWSB 5FLXN 3CRAA 3UCSC 1IBMB 4HNAA 3LDEA 4WF9V 2BTQB 2Y0PA 3JD1A 3CRCA 3OTFA 2QDOA 3QO5A 1MOFA 2EIMC 1FFXA 5HFMA 1GN6A 4KHPB 3SJCC 2Q67A 2ITCC 3FB8C
chains in the Genus database with same CATH topology
1HNWO 4DR5O 4DR3O 2DOSA 1XEQA 2AGAA 2UXCO 4DV2O 1J5EO 1FKAO 4JV5O 4NXMO 1HNZO 1IBMO 4OPAA 2UXBO 4LF7O 4DV1O 1R6TA 1N32O 4DUZO 3J7AU 1DK1A 4LFCO 1XNRO 1G1XB 1F7YA 4KHPO 1FYJA 1IBLO 4K0KO 4B3RO 4OX9O 1R1BA 4X62O 1YZBA 4JI3O 4DV5O 5BY1A 5BR8O 4JYAO 4X64O 4OPHA 4B3SO 4JI6O 2HHHO 4DR4O 1AILA 5A2QN 2UXDO 1XMQO 1XNQO 2Z0AA 1N33O 4GKKO 1N34O 4DUYO 2UUAO 3T1YO 4GKJO 5IT9N 3J80N 4A5UB 1I94O 1IBKO 5BXZA 3SDLA 4JI0O 4DR6O 5LMUO 2DJVA 4LF8O 4JI5O 3RT3C 3O65A 4JI8O 4LF4O 2VQFO 4LFBO 4LF5O 3JAMN 1X59A 2LW7A 4DR1O 4LF6O 2F4VO 5H5NA 4JI2O 2JRIA 2ZKOA 4LFAO 4DR7O 5IWAO 4DV0O 3F5TA 4X66O 2UU9O 2UUBO 4DR2O 1HNXO 4B3MO 1KUQA 4NXNO 1XMOO 1HR0O 1A32A 4DV6O 4LF9O 1AB3A 1FJGO 4DV7O 4JI4O 3J81N 2E5LO 5LL6Y 4YHHO 1NS1A 3OTOO 2N74A 4DV4O 2UUCO 3T1HO 4X65O 5FLXN 2ZM6O 3M8AA 5LMNO 4B3TO 3R66A 2FKXA 4YY3O 2VQEO 4DV3O 1D2DA 4JI1O 4AQYO 4JI7O 1N36O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW O;  4DR5 O;  4DR3 O;  2DOS A;  1XEQ A;  2AGA A;  2UXC O;  4DV2 O;  1J5E O;  1FKA O;  4JV5 O;  4NXM O;  1HNZ O;  1IBM O;  4OPA A;  2UXB O;  4LF7 O;  4DV1 O;  1R6T A;  1N32 O;  4DUZ O;  3J7A U;  1DK1 A;  4LFC O;  1XNR O;  1G1X B;  1F7Y A;  4KHP O;  1FYJ A;  1IBL O;  4K0K O;  4B3R O;  4OX9 O;  1R1B A;  4X62 O;  1YZB A;  4JI3 O;  4DV5 O;  5BY1 A;  5BR8 O;  4JYA O;  4X64 O;  4OPH A;  4B3S O;  4JI6 O;  2HHH O;  4DR4 O;  1AIL A;  5A2Q N;  2UXD O;  1XMQ O;  1XNQ O;  2Z0A A;  1N33 O;  4GKK O;  1N34 O;  4DUY O;  2UUA O;  3T1Y O;  4GKJ O;  5IT9 N;  3J80 N;  4A5U B;  1I94 O;  1IBK O;  5BXZ A;  3SDL A;  4JI0 O;  4DR6 O;  5LMU O;  2DJV A;  4LF8 O;  4JI5 O;  3RT3 C;  3O65 A;  4JI8 O;  4LF4 O;  2VQF O;  4LFB O;  4LF5 O;  3JAM N;  1X59 A;  2LW7 A;  4DR1 O;  4LF6 O;  2F4V O;  5H5N A;  4JI2 O;  2JRI A;  2ZKO A;  4LFA O;  4DR7 O;  5IWA O;  4DV0 O;  3F5T A;  4X66 O;  2UU9 O;  2UUB O;  4DR2 O;  1HNX O;  4B3M O;  1KUQ A;  4NXN O;  1XMO O;  1HR0 O;  1A32 A;  4DV6 O;  4LF9 O;  1AB3 A;  1FJG O;  4DV7 O;  4JI4 O;  3J81 N;  2E5L O;  5LL6 Y;  4YHH O;  1NS1 A;  3OTO O;  2N74 A;  4DV4 O;  2UUC O;  3T1H O;  4X65 O;  5FLX N;  2ZM6 O;  3M8A A;  5LMN O;  4B3T O;  3R66 A;  2FKX A;  4YY3 O;  2VQE O;  4DV3 O;  1D2D A;  4JI1 O;  4AQY O;  4JI7 O;  1N36 O; 
#chains in the Genus database with same CATH topology
 3E22 A;  3KG2 A;  1PL0 A;  4CH6 A;  4X62 B;  1FPO A;  5CMU A;  3HKE A;  4IHJ A;  4UCV A;  2BTO A;  2A7W A;  1VEW A;  3W7T A;  1WJZ A;  5CA1 B;  1W2B U;  3STZ C;  1JFF B;  3BPZ A;  3LSU A;  4NYK A;  3D3I A;  1KU9 A;  1Q43 A;  2H3O A;  3APO A;  3CCS V;  4JI0 B;  2JS3 A;  5J2U A;  3LNM B;  1VQN V;  2XAQ A;  3GVM A;  2QJ1 A;  3HKB B;  2EIK C;  2FYU H;  1SQQ H;  2CH7 A;  2G38 A;  2UUA O;  5IE9 A;  4A5U B;  1EZV H;  1IX9 A;  2VQF B;  1Q7Y W;  1M56 C;  3ZRW A;  3QF7 A;  3A2F A;  4LF6 B;  2YXY A;  5LMU O;  4FLU A;  4LBE C;  3B77 A;  2QKC A;  1BS3 A;  2OWO A;  4BAY A;  3VQV A;  4YIO A;  1FFT B;  5LOV A;  2Y4T A;  5CBH A;  3RYI B;  3CE2 A;  5FNV A;  3WB1 A;  4YHH B;  3BAA A;  4DV4 B;  3A8T A;  4NTY A;  1GN4 A;  1L1F A;  1JJ2 U;  5IWA O;  3DGE A;  3ZHR A;  4WCE V;  1Q6H A;  1M90 W;  1XMO O;  1HR0 O;  4LF9 O;  1SS3 A;  1L8D A;  4FLY A;  4JI7 B;  5LHH A;  4DV7 O;  1L0N H;  4JI6 B;  1NTM H;  4JTA B;  2OTJ V;  2JVD A;  2ZM6 O;  2QTO A;  2AZ2 A;  1XNQ B;  3ASO C;  1YF2 A;  3W7W A;  3TET A;  5KMG A;  2GBO A;  4LFC B;  4O4J A;  5CBF A;  1OJH A;  2F23 A;  1P4R A;  1G4Y B;  1N8R W;  2VS0 A;  5JWP A;  4TV8 A;  2ZR2 A;  2UXB O;  4JYA B;  5E1A C;  3CCU V;  1R3L C;  5LA6 A;  5K1P A;  3K5L A;  4ZI7 A;  2ZDI C;  4MTO A;  4PHZ A;  1SKV A;  5B1A C;  1XOU A;  1WN7 A;  1YTF D;  5D5Q A;  4KUM A;  1B04 A;  4PA7 A;  3HB3 B;  3OM3 B;  4AIL C;  3DXR B;  2L6L A;  3P3P A;  3LDD A;  3JAL A;  3ZN0 A;  5JJJ B;  2O57 A;  1OCZ C;  1FXK B;  4MSW C;  2ZIO A;  4I9W A;  2ZE5 A;  1GM7 A;  5EYP A;  2NLJ C;  1CXZ B;  5LHG A;  3O65 A;  3ZHQ A;  4LF4 O;  3AG1 C;  2Z3Y A;  4BR6 A;  1KEC A;  4X1Y B;  1Q3E A;  4FM2 A;  1SQX H;  2LW1 A;  3CS5 A;  3L72 H;  2JDI G;  5LGN A;  1VMG A;  4DXW A;  2X6A A;  1IBL B;  4B3T B;  3EXA A;  2E75 B;  4GLX A;  2UU9 O;  5AG2 A;  1AP6 A;  1L0L H;  3BAB A;  1YHQ V;  3CX5 F;  4XDK A;  3CCE V;  4GCZ A;  1VQP V;  2X0L A;  3ETD A;  5IYZ B;  1TVK B;  3DC5 A;  3B4S A;  1HNZ B;  5EIB D;  2PF4 E;  3QTC A;  4DRX B;  4TQD A;  1P7B A;  4PDM A;  4BIU A;  4X20 A;  1NH2 D;  2WLK A;  2Q69 A;  2QWQ B;  1FKA O;  5BMV A;  4I55 B;  4YXW G;  5LP6 B;  3CRQ A;  1LR1 A;  4IL6 Z;  1EZJ A;  5C8Y B;  4TV9 A;  4DV1 O;  1R6T A;  1B06 A;  1DF5 A;  3U11 A;  2F43 G;  3CSX A;  2UXD B;  3ZN1 A;  3AK2 A;  3JAR A;  1XUQ A;  2YI9 A;  3E83 A;  3CPW U;  2E3C A;  4ABM A;  4I9Q A;  1FS0 G;  4TUY B;  2N05 A;  4JI6 O;  2QM4 A;  2DYS C;  4QGP A;  3CC7 V;  4J42 A;  4B3M B;  1XNQ O;  1S0V A;  1R73 A;  2QA4 V;  4L87 A;  3U0Z A;  1VQ7 V;  1YJN V;  1AI5 A;  1AI6 A;  2FML A;  4FM1 A;  4LF5 B;  3M7M X;  2WWW A;  3C3T A;  3ZHS A;  3SPI A;  4DO2 A;  3K59 A;  3RT3 C;  4GUN A;  3CWB H;  4BIO A;  4J9Y B;  3AK1 A;  2E74 B;  5BZB A;  1H2L A;  3MD0 A;  4I0X A;  5KHH A;  3OEE G;  5EC2 C;  2UUC B;  2ZKO A;  4LR3 A;  5LMN B;  3RGB A;  3K0G A;  3CCL V;  3K06 A;  4F4L A;  4X1I A;  4CBC A;  4NTW A;  3JAS B;  4KFM A;  3W7U A;  4JTD B;  2RN9 A;  4DV2 B;  3VBB A;  1Q86 W;  2R9R B;  5B1O A;  1H8H G;  3R66 A;  4D7T A;  4NVP A;  1VIB A;  3CB2 A;  4J7K A;  4CH3 A;  1HDJ A;  5LP6 C;  4U3J B;  2KG7 B;  4CH4 A;  5JJN B;  1NZ6 A;  3IAY A;  5EK0 A;  1ZLZ A;  2KB1 A;  2UXC O;  4PDR A;  4Q6G A;  3ABT A;  4FFK A;  3I56 V;  1GMG A;  2HHH B;  4DUZ O;  1S3J A;  1DK1 A;  1G1X B;  1IBL O;  3UO3 A;  4GKK B;  3ZBH A;  4J41 A;  1EN4 A;  2A9H A;  2ILM A;  3RWR D;  3N2G A;  3N2K A;  2IU0 A;  1KBH A;  4ICG A;  3CME V;  4B3S O;  2Q9L A;  4ZIB A;  1S72 V;  4DR4 O;  5A2Q N;  4B08 A;  1XMQ O;  1UJW B;  4E4E A;  2ZE8 A;  1QU7 A;  3BFR A;  3ABM B;  1M4U A;  4HNA B;  3BY6 A;  1XDC A;  2PZS A;  1BCC H;  5L3D A;  1AR5 A;  4N21 A;  1BL8 A;  3SGI A;  3ASN C;  2IJJ A;  2EZP A;  3HPL C;  5H6Q A;  4I5S A;  1NR1 A;  4PI2 A;  1YXB A;  3SYC A;  4ZOL B;  4XBF A;  1KC8 W;  3B8M A;  4UCR A;  3BEH A;  3OEH G;  2F4V O;  2Y4U A;  4LF7 B;  3AK3 A;  3Q4H A;  4YJ2 A;  5IYD O;  3T1H B;  1V9P A;  1K33 A;  1DLB A;  5J2U B;  3ZHU A;  1SES A;  2UUB O;  4DR2 O;  5EBL C;  4B3M O;  5JH7 A;  1YJ9 V;  1BHA A;  1AJQ A;  3R65 A;  2RQ6 A;  4AQY B;  1WAZ A;  4GZR B;  2CH7 B;  2E5L O;  2NNU A;  5B66 Z;  2ZXW C;  4IYH A;  3M8A A;  3SJA C;  3VQW A;  2DE0 X;  2YIB A;  4K35 A;  3X2Q B;  3DSQ A;  2QM8 A;  4ZBM A;  4P30 A;  4DR5 O;  1JA8 A;  1F4M A;  1KMI Z;  4UB6 Z;  3CCM V;  2A06 H;  1MZF A;  3SYA A;  5LYJ A;  2WA3 A;  3E8H A;  1M57 B;  1PD3 A;  2WLN A;  4MVR A;  2EIJ B;  1VQ5 V;  1MAB G;  1T5E A;  5FNV B;  1K92 A;  2W6I G;  2GTA A;  4PDV A;  3K08 A;  4O2A A;  2YEV A;  2UUA B;  2MW2 B;  3AEI A;  1KP2 A;  5FPO A;  4NR1 A;  5LMU B;  4DUY O;  3B2E E;  2W0F C;  1M9N A;  5KMG B;  1BT8 A;  3HR0 A;  1E79 G;  4O4J B;  2EIN C;  3H9V A;  1PKX A;  4D7S A;  3OUF A;  2DW4 A;  4JYC A;  1DTO A;  4TV8 B;  3OR6 C;  4IYI A;  5IWA B;  4JI8 O;  1B3Q A;  2ETN A;  2XOK G;  4FLT A;  3JD3 A;  1SA0 B;  2WLI B;  5LA6 B;  1XMO B;  4JV5 B;  3JD2 A;  4X89 A;  4LF9 B;  2QWR B;  1UPG A;  2JS5 A;  3K9A A;  4ZI7 B;  2PI5 A;  4DV7 B;  4MVM A;  4DR7 O;  2Q4P A;  4X66 O;  4TWK A;  2X7R B;  4CS4 A;  4O4H A;  3K58 A;  3MAQ A;  3OMN B;  5HFL A;  2KSD A;  1OZ0 A;  3UT5 A;  1PV0 A;  4X65 O;  3ML0 A;  2UXB B;  2HFE C;  3OMA B;  1KB9 F;  1P49 A;  5ITZ A;  5KAI Z;  5KHK A;  1I94 B;  5EYP B;  1BZK A;  1XEQ A;  4YJ3 B;  1N0J A;  1NU1 H;  2V1D A;  3K79 A;  3ETG A;  2LGW A;  2ZNJ A;  3TXQ A;  3LSQ A;  5IJ0 A;  3JCU Z;  3EVK A;  1H2K A;  4LF7 O;  4FMT A;  1HWY A;  2LGQ A;  1Q82 W;  2OYQ A;  1S76 D;  4X8A A;  3P3N A;  2EUL A;  3E89 A;  3SR2 C;  1R1B A;  3K5N A;  3JSL A;  3HKD A;  2YIA A;  4JF3 A;  4EFB A;  2HEP A;  1W59 A;  2JK5 C;  1NVP D;  1FXH A;  4UCT A;  3AG3 B;  1ZX3 A;  3OFN G;  5FL7 G;  3AG7 A;  1N33 O;  3BA9 A;  3IFX A;  1N34 O;  3J80 N;  4IIJ B;  4LF4 B;  3JAK A;  2RDC A;  1ZTE A;  4FLX A;  1IBK O;  2K9P A;  1WPX A;  4EEQ A;  4X20 B;  2ZD9 A;  2HVJ C;  2WLL A;  4AQY O;  5KLV H;  4FK5 C;  5BMV B;  5B1B C;  4D6T H;  3F5W C;  5CB4 A;  2XAS A;  1Q81 W;  1E1Q G;  4TV9 B;  2UU9 B;  4LFB O;  1PP9 H;  3RYF B;  4I4T A;  2XAJ A;  1PNL A;  3JAR B;  2F66 C;  3TK1 A;  1XL4 A;  3IC7 A;  5IY5 B;  5B3S B;  1OHH G;  2P5O A;  1WB7 A;  3QNE A;  1BGY H;  4Z2W A;  5DM6 V;  4DW0 A;  4O4L A;  4MVU A;  4NXN O;  4DV6 O;  4X9Q A;  2CK3 G;  5KX5 A;  2IU3 A;  2YUA A;  4HAM A;  3RYH A;  3ZMV A;  4FLZ A;  1SQV H;  1VQL V;  3E2E A;  4DV1 B;  3G67 A;  2XUM A;  5GON A;  5J9P C;  1NI8 A;  3AG2 B;  3OGI B;  1N36 O;  3SYQ A;  2EJR A;  4JV5 O;  4I50 A;  4LF8 B;  1K5S A;  1WA8 A;  3K0D A;  3D36 C;  3ICX A;  1XNR O;  4I0X B;  2AXT Z;  1FYJ A;  1PNM A;  1CEZ A;  2BOC C;  3P30 A;  4AHC A;  3OR7 C;  3AG3 C;  1H2G A;  1YZB A;  2Q73 A;  2PYL A;  4PEL A;  4Z1V A;  4X1I B;  1ZL8 A;  2WSS G;  4MVQ A;  3T1C A;  2H94 A;  1EBO A;  1ZSP A;  1Q8I A;  4RQE A;  3G71 V;  3T1Y O;  1US6 A;  3ABL B;  1I94 O;  1TAE A;  4WFH A;  5KUM A;  5EZY B;  1IXM A;  1R3J C;  2KQX A;  3HKC A;  2HR3 A;  4U7O A;  4UXN A;  1FAF A;  2QGN A;  2X6C A;  1SZT A;  4OGQ B;  1IVS A;  1BE3 H;  2Q7E A;  4QJF B;  2OT5 A;  1IXB A;  1D5A A;  2E76 B;  5B3S C;  2A79 B;  1WPB A;  3RYC A;  1WP7 A;  1QLN A;  1R3I C;  2BOB C;  2IJI A;  2F1M A;  4J7Z A;  2BE3 A;  4KP4 A;  1JCH A;  4X1K B;  3N2K B;  2B5U A;  1U96 A;  5DED A;  3F5T A;  4OX9 B;  2YDE A;  1HNX O;  3MDS A;  3P32 A;  2WA4 A;  1A32 A;  4PA4 A;  2OTL V;  3OTO O;  2UXC B;  1QHT A;  2KKW A;  3AG2 C;  1QBZ A;  5DEC A;  1XIL A;  4GKJ B;  2XT9 A;  4FVM A;  4DUZ B;  1D2D A;  2DQ0 A;  3L71 H;  3VQY A;  2JGD A;  4MTX A;  1OCO B;  2M6Y A;  2R70 A;  1OCR B;  4U7N A;  2DYR B;  1TA8 A;  4B3S B;  1VQ4 V;  1D5N A;  3SPG A;  1I5Y A;  4DR4 B;  3Q4H B;  1YEW A;  4YJ2 B;  1XRE A;  1H8E G;  1XMQ B;  1F7Y A;  1BQ0 A;  2OCH A;  3ZCC A;  1TUB A;  3H1I H;  4L8J A;  5JH7 B;  2PUS A;  5J2T A;  2ZIM A;  3OUS A;  4LC1 A;  4BW9 A;  4F6R B;  1WB8 A;  4CC6 A;  5A9G A;  2JEX A;  4G27 B;  1GKF A;  4R50 A;  5IT9 N;  4UUJ C;  4XDJ A;  5LXT A;  1MZE A;  5CA1 A;  1SER A;  2Z5U A;  4H0L B;  4DK1 A;  1VQ9 V;  3L75 H;  2F4V B;  3E8B A;  4AI8 A;  4JZG A;  3ZED A;  4LF8 O;  2ZDI A;  1YSC A;  1NT2 B;  1FXK C;  3PJS K;  1JPX A;  2B1I A;  4DR2 B;  2UUB B;  4IGG A;  3VQX A;  4O2A B;  2YEV B;  5GW7 A;  2E5L B;  1Y67 A;  3CRR A;  3EHB B;  1PM9 A;  1EN5 A;  2EIL B;  4N23 A;  2YS8 A;  3WG7 B;  1M1K W;  4UCO A;  4MW8 A;  4DR5 B;  1THZ A;  1CP9 A;  2ZR3 A;  3WFV A;  3FX7 A;  1I7F A;  3RYI A;  5JCO C;  5KA5 A;  1EFR G;  3ZX6 A;  2ODM A;  3T2M A;  4K3A A;  1RM1 B;  5EC1 C;  4FLW A;  4WFA V;  2ITD C;  4JI1 O;  1HNW O;  1M5I A;  2AGA A;  1J5E O;  3ZRX A;  1Y74 B;  3SJB C;  4G2K A;  1CPY A;  2P22 C;  4OPA A;  1V55 B;  1XHX A;  2V7Q G;  4H44 B;  2IM9 A;  4DUY B;  4TSF G;  3AG4 B;  4OX9 O;  4RO2 A;  2CTP A;  4LNU A;  5BR8 O;  2P67 A;  1PPJ H;  2QE7 G;  4O4H B;  3STL C;  1QLE B;  4MVZ A;  3ZHV A;  3UT5 B;  3JAT A;  2DWD C;  4GKJ O;  5JVD A;  2XAG A;  4JI8 B;  3NR7 A;  1AI7 A;  3MHH C;  4QE7 A;  4B7E A;  3CCR V;  3FB7 C;  3CJH B;  2QWP B;  3ZMZ A;  3T4Z A;  5IJ9 A;  3C90 A;  2NR5 A;  4DR7 B;  5LGT A;  1HW7 A;  3L70 H;  4RAI A;  3GB7 C;  5IJ0 B;  4X66 B;  3DXR A;  2B1G A;  2RCV A;  2Q0O C;  2EIL C;  3KKY A;  1Z5W A;  1KKD A;  4F6E A;  4P2Z A;  1VP7 A;  4X65 B;  3F7Y C;  1FFX B;  1JR9 A;  1W0J G;  1PL4 A;  2HLD G;  3E22 B;  3IC9 A;  1ORQ C;  1SZX A;  1K8A W;  3IJ4 A;  5K1X A;  1Q6I A;  3HKE B;  4IHJ B;  2PGG A;  3JAK B;  3L73 H;  2W6J G;  1YTF B;  2Q0A A;  3U10 A;  2WLL B;  1R3K C;  1ZAU A;  1O9G A;  3ABU A;  2VWK A;  1GAX A;  5LHI A;  4UFZ A;  5JCO A;  4MTF A;  2JIZ G;  2BSK A;  2FTK A;  5CB4 B;  4X88 A;  3CCV V;  5GTI Z;  4UCS A;  2PY5 A;  4UCU A;  4JAV A;  5E79 Z;  2LQT A;  3OAA G;  1N32 O;  4I4T B;  2YIC A;  2Q68 A;  3J7A U;  3M99 B;  3UQ8 A;  1N33 B;  4UV9 A;  3ZRW B;  1N34 B;  3CP1 A;  2V4D A;  1RPR A;  1K5Q A;  1S5J A;  3ABK B;  3H01 A;  4O4L B;  1IBK B;  4JI3 O;  2L35 A;  4RUE A;  2ADQ B;  3QG5 A;  2ZE7 A;  4DK0 A;  1SET A;  1GO3 F;  1LUW A;  1AIL A;  5KX5 B;  1Q90 D;  5LP6 A;  5LOV B;  2IW5 A;  2ZIN A;  5C8Y A;  1G8M A;  3C3S A;  2A0L A;  4O2B A;  3RYH B;  1VQ8 V;  1Y76 A;  5KUK A;  3GWK C;  4LFB B;  5GON B;  2EZO A;  1VQK V;  2RJZ A;  3OT7 A;  4YY3 B;  3BRC A;  1H2N A;  2WLM A;  4JI5 O;  3ABM C;  1EM1 A;  1WA8 B;  1XBL A;  5KHJ A;  1SF9 A;  3ZMU A;  2AHY A;  3A0H Z;  1NH2 B;  4NXN B;  2XAH A;  2HG5 C;  4QPK A;  2ADP A;  4DV6 B;  2Q7H A;  1K73 W;  1QR8 A;  1MA1 A;  5JQG A;  4IT5 A;  2HVK C;  4DV0 O;  4NTX A;  1YCI A;  3BCC H;  4FPP A;  2CUG A;  3OMI B;  3OW2 U;  2EIM B;  4R7C A;  4X64 B;  1N36 B;  1YI2 V;  1AB3 A;  1MG1 A;  3LUT B;  4QPJ A;  2YI8 A;  2VRZ A;  1F23 A;  2PTM A;  1FXV A;  3K5M A;  1ZWI C;  5L3G A;  3CMA V;  3HKC B;  1HP8 A;  4LH6 A;  3TXS A;  3E86 A;  2HJD A;  4NKG B;  2PYJ A;  1XNR B;  1DF4 A;  3ZMS A;  1ZUQ A;  1X4T A;  2LFS A;  4PA6 A;  4P9O A;  3H1H H;  3RYC B;  2OCC B;  1EN6 A;  2AZ0 A;  4QIW F;  3X2Q C;  3JAL B;  2QTS A;  2H8P C;  3BVO A;  1IDS A;  4GX1 A;  5TIS Z;  3CD6 V;  4PDL A;  4K0K O;  1VF7 A;  3FB6 C;  2EIK B;  3T1Y B;  1ARO P;  4FFB A;  4GT1 A;  1M57 C;  2EIJ C;  1KKC A;  4LFA B;  1M56 B;  1MSD A;  2N04 A;  1QVG U;  2ZNI A;  2Z0A A;  1WP8 A;  3ZRV A;  5L3B A;  1N4C A;  3ZJZ A;  2WLJ A;  3ZIA G;  4EB6 A;  3G6E V;  3WB0 A;  1VF6 C;  2JGD B;  1BMF G;  3APQ A;  1BHB A;  2IH3 C;  2ARH A;  5IYC O;  2Q8V A;  4Q20 A;  2VWJ A;  3WB2 A;  5B1N A;  5GTH Z;  1RP3 B;  1ENV A;  3THO A;  1HNX B;  4U3F H;  3B8N A;  4RWU A;  4EFE A;  2HKO A;  2JRI A;  3OTO B;  1Y6X A;  1TUB B;  1F51 A;  2Q6A A;  2GUZ A;  5J2T B;  3KZI Z;  3JYC A;  2JJ1 G;  3ASO B;  2PI4 A;  3G6B A;  3CCQ V;  2IH1 C;  1KUQ A;  3FAV A;  1NJI W;  2P06 A;  3FD9 A;  1H38 A;  2JEU A;  4FJC C;  4MT8 A;  2Y69 B;  4ZOL A;  3D3Q A;  5LXT B;  4ASU G;  4UVA A;  4UVB A;  2FKX A;  4YY3 O;  2VQE O;  1GK9 A;  4JAA A;  5L3F A;  4ZHQ A;  1XQ8 A;  2OCC C;  3JSN A;  3T4D A;  4KL1 A;  5EBM C;  5B1A B;  2XTA A;  1YJW V;  2CTW A;  2Q7G A;  5LBQ A;  1K34 A;  1W0K G;  4B3R O;  3E35 A;  1YVW A;  1QR9 A;  2XND G;  1UFI A;  4CS3 A;  1OCZ B;  5CN0 A;  4X64 O;  4OPH A;  3H1J H;  1AI4 A;  4FM0 A;  2QR4 A;  3FYE B;  3AG1 B;  3JAW A;  2CAZ C;  2LFR A;  2HP8 A;  2P4K A;  2Y48 A;  4UV8 A;  5B5E Z;  1GN3 A;  1RFY A;  2GHY A;  1NKD A;  4J9Z B;  1AR1 B;  4O4I A;  1VF6 A;  1V54 B;  4H37 A;  4WFF A;  4MVS A;  3K57 A;  1X59 A;  4NXM B;  4CZZ A;  1LNQ A;  1GTO A;  4J11 A;  3WU2 Z;  2ZQM A;  1F4N A;  3CHX A;  3L9D A;  3I55 V;  4LFA O;  3ZRS A;  4WFG A;  4LNU B;  3E8G A;  1M93 A;  3FFQ A;  4BIZ A;  1YIJ V;  2Y69 C;  3ZMT A;  4JI1 B;  3JAT B;  2UXX A;  1FJG O;  5IY5 C;  3CYO A;  1HNW B;  4JI4 O;  2DN9 A;  3J81 N;  4BWA A;  4GX2 A;  5JVD B;  3CC4 V;  1J5E B;  1SA0 A;  2WLI A;  3OGC C;  4WFB V;  2GSM B;  4JAS A;  3I5D A;  2OIE A;  4TOI A;  4DV3 O;  1KQS U;  3N2G B;  2QM7 A;  5IJ9 B;  5CA3 A;  1IZ3 A;  4WBN A;  3MHS C;  5CA0 A;  4XDL A;  1IBM O;  5BR8 B;  1XL6 A;  4MW3 A;  4JYB A;  2CTR A;  5D5P A;  1GH6 A;  3TGU H;  2DYS B;  1YIT V;  3RW0 A;  4KHP O;  4DR1 B;  2JJ2 G;  2IJH A;  4X62 O;  1WNS A;  1R6N A;  3FB5 C;  2A3Q A;  3CEI A;  5CBG A;  2D3O W;  4YJ3 A;  4J7J A;  3W7X A;  1O9H A;  1QCE A;  1NQT A;  1RSO A;  1VQ6 V;  1KD1 W;  3L74 H;  2RMK B;  4LCU C;  1K3E A;  4LWS A;  1Q6U A;  1S77 D;  1JMK C;  2AHZ A;  4JI0 O;  3D36 A;  3UO2 A;  1V54 C;  2BTQ A;  2BSK B;  3H1K H;  2R9A A;  2ZT9 B;  1AP5 A;  3ABL C;  1I08 A;  2VQF O;  1S5L Z;  1VF5 B;  4DR3 B;  2P7T C;  3OD4 A;  2BCC H;  2ZE6 A;  3ZS8 C;  2QSA A;  3ETE A;  4LF6 O;  1SC5 B;  4IIJ A;  1P7G A;  5KA6 A;  3A0R A;  5IDJ A;  5H5N A;  1NTK H;  4K8Z A;  1JFF A;  5KAF Z;  5L3C A;  1NTZ H;  1LUV A;  3K5O A;  3G80 A;  5LYJ B;  4TT3 G;  4DV5 B;  4O2B B;  4YHH O;  1NS1 A;  3TJT A;  1Y66 A;  4DV4 O;  3HKB A;  1Y76 B;  1Z2G A;  3RYF A;  1R6K A;  4PA3 A;  2D2C B;  1TGO A;  3LSS A;  2EX3 A;  1N32 B;  1GM9 A;  1NVP B;  1I5X A;  4B7K A;  2B9Z A;  2W0X A;  3E8F A;  4JI7 O;  1FD9 A;  2CE4 A;  3N27 A;  1K7D A;  2UXN A;  1K97 A;  3UM7 A;  2FB5 A;  2P90 A;  3B40 A;  4FZ1 A;  3KCX A;  3RBZ A;  5F2V O;  4JI3 B;  4NXM O;  3RN4 A;  5DN6 G;  4H33 A;  1COW G;  4LFC O;  1JQ0 A;  4TQF A;  1OCO C;  5JQG B;  5L3E A;  1H2S B;  3S3X A;  1OCR C;  4QNH B;  2DYR C;  1JVM A;  5BY1 A;  3OE7 G;  4JYA O;  3EFF K;  2EJ7 A;  1VQO V;  1J95 A;  2IJK A;  3B09 A;  3ASN B;  4PV1 B;  2YSU B;  3ZHT A;  1OV9 A;  3JD4 A;  4JI5 B;  1QQC A;  4R8C A;  5BXZ A;  4UVC A;  4RQF A;  3UKM A;  1RPO A;  4W4K A;  4KXR A;  1VAR A;  4MVO A;  2QKA A;  3BA8 A;  3ETQ A;  5IYB O;  4DV0 B;  1TUE B;  2CGN A;  1JOY A;  1B6Q A;  2LW7 A;  4DR1 O;  1Q5O A;  1SQB H;  3QO8 A;  5JJE B;  4J80 A;  5H9C A;  4JTC B;  4ZKI A;  3QO7 A;  5EZY A;  5ITZ B;  4FFB B;  3W7S A;  2WPD G;  1BSM A;  5H6R A;  2ZXW B;  2IBZ H;  3IGA C;  4C7U A;  3F7V C;  3CCJ V;  1JJO A;  4JAU A;  3FKS G;  1AVM A;  1K4C C;  2DWE C;  3K3W A;  2YC0 A;  5LL6 Y;  2N74 A;  2K1E A;  5LGU A;  4EB6 B;  4B3T O;  3BHP A;  1Z5V A;  4DYL A;  1FXK A;  3WG7 C;  4X1K A;  3S3W A;  4JYY A;  3VOU A;  3HKD B;  3FYI B;  4K0K B;  3LNN A;  4DR6 B;  2RNB A;  4DR3 O;  2DOS A;  1QVF U;  4JPR A;  2R9I A;  5C93 A;  2CGO A;  1HNZ O;  1RM1 C;  4UB8 Z;  5FPR A;  4X1Y A;  1XHZ A;  2LO1 A;  4CH5 A;  3DC6 A;  1NBM G;  4WFE A;  2Y0I A;  4G28 B;  4P9P A;  2GUZ B;  3D8C A;  4QE9 A;  4JI2 B;  4EKW A;  4DV5 O;  3FAV B;  1MMM A;  1GM8 A;  3PN1 A;  2HJF C;  1V55 C;  2QWO B;  2EIN B;  4PD4 F;  2WAM A;  2UXD O;  3KCY A;  3K9S A;  2CDY A;  3RFR A;  3K04 A;  2EBO A;  3AG4 C;  4RUF A;  1SQF A;  5IYZ A;  1URF A;  2M7W A;  1TVK A;  1Y4M A;  3SDL A;  4GX5 A;  5H2F Z;  3JCZ A;  1SQG A;  4ZHQ B;  4DRX A;  4YIP A;  1P84 F;  2DJV A;  1QLE C;  2YXL A;  1JX9 A;  2R72 A;  3RVY A;  1IUR A;  4I55 A;  3SPC A;  4K8X A;  4PI0 A;  4F6R A;  1PNK A;  2C2A A;  4LF5 O;  1GN2 A;  1KYO F;  3JAM N;  4H13 B;  2JGU A;  4J10 A;  4BW5 A;  3G4S V;  2YXH A;  3QVN A;  2F93 B;  2QWN B;  2GDS A;  4JZ2 A;  1XI1 A;  3CXC U;  4GX0 A;  2VQE B;  1H2M A;  4TUY A;  1OCC B;  4HYO A;  4I50 B;  2YID A;  1MNG A;  1BQZ A;  3SYP A;  4FZ0 A;  5EBW C;  2UUC O;  1AJN A;  3JAW B;  5LMN O;  3SPJ A;  3CXH F;  2DMX A;  1ROP A;  2GV9 A;  1GRJ A;  2LP7 A;  4FLV A;  4B3R B;  1QNM A;  4PJ0 Z;  1ZL8 B;  4O4I B;  2FL4 A;  1KP3 A;  4DV2 O;  2WLH A;  1YDX A;  2CTQ A;  4I7Z B;  3SPH A;  2P4V A;  4OXS A;  2LJ2 A;  1G6U A;  1K9M W;  4JGS A;  2X6B A;  4R6Z A;  1SQP H;  1WLE A;  2GTS A;  4CC5 A;  1U97 A;  4MTG A;  1AJP A;  3RVZ A;  1S5H C;  2ZCE A;  3DTU B;  3GWO A;  2HHH O;  3NXS A;  1Y74 A;  1AR4 A;  4PA9 A;  5B1B B;  4GKK O;  1E1R G;  4FIP C;  1K4D C;  3JAS A;  3O9O A;  4W4L A;  1DGS A;  1HR0 B;  4DW1 A;  2P6J A;  3LDC A;  3ABK C;  1N0N A;  3CC2 V;  3A0B Z;  2MK3 A;  1I0H A;  4DR6 O;  4E2L A;  2ZM6 B;  4LH7 A;  4MS2 A;  2OIG A;  4WBN B;  4U3J A;  2KG7 A;  4CS2 A;  2QEX V;  3TCU A;  1NR7 A;  2NN4 A;  4HBN A;  4NB5 A;  5CA0 B;  3H1L H;  4Z1M G;  2AW9 A;  2F95 B;  3JD0 A;  1SRY A;  5KHI A;  2XHB A;  4HZ3 A;  4GYC B;  1FJG B;  4JI4 B;  4JI2 O;  1OCC C;  1VQM V;  5EIB C;  2QKS A;  3CRM A;  1MSW D;  3CJH A;  2YIB D;  2ATK C;  2XAF A;  3SYO A;  4DV3 B;  3SJQ C;  3K03 A;  1RSO B;  2Q5Z A;  5KHG A;  2DQ3 A;  4LP8 A;  3T1H O;  4LWS B;  5FLX N;  3CRA A;  3UCS C;  1IBM B;  4HNA A;  3LDE A;  4WF9 V;  2BTQ B;  2Y0P A;  3JD1 A;  3CRC A;  3OTF A;  2QDO A;  3QO5 A;  1MOF A;  2EIM C;  1FFX A;  5HFM A;  1GN6 A;  4KHP B;  3SJC C;  2Q67 A;  2ITC C;  3FB8 C; 
#chains in the Genus database with same CATH homology
 1HNW O;  4DR5 O;  4DR3 O;  2DOS A;  1XEQ A;  2AGA A;  2UXC O;  4DV2 O;  1J5E O;  1FKA O;  4JV5 O;  4NXM O;  1HNZ O;  1IBM O;  4OPA A;  2UXB O;  4LF7 O;  4DV1 O;  1R6T A;  1N32 O;  4DUZ O;  3J7A U;  1DK1 A;  4LFC O;  1XNR O;  1G1X B;  1F7Y A;  4KHP O;  1FYJ A;  1IBL O;  4K0K O;  4B3R O;  4OX9 O;  1R1B A;  4X62 O;  1YZB A;  4JI3 O;  4DV5 O;  5BY1 A;  5BR8 O;  4JYA O;  4X64 O;  4OPH A;  4B3S O;  4JI6 O;  2HHH O;  4DR4 O;  1AIL A;  5A2Q N;  2UXD O;  1XMQ O;  1XNQ O;  2Z0A A;  1N33 O;  4GKK O;  1N34 O;  4DUY O;  2UUA O;  3T1Y O;  4GKJ O;  5IT9 N;  3J80 N;  4A5U B;  1I94 O;  1IBK O;  5BXZ A;  3SDL A;  4JI0 O;  4DR6 O;  5LMU O;  2DJV A;  4LF8 O;  4JI5 O;  3RT3 C;  3O65 A;  4JI8 O;  4LF4 O;  2VQF O;  4LFB O;  4LF5 O;  3JAM N;  1X59 A;  2LW7 A;  4DR1 O;  4LF6 O;  2F4V O;  5H5N A;  4JI2 O;  2JRI A;  2ZKO A;  4LFA O;  4DR7 O;  5IWA O;  4DV0 O;  3F5T A;  4X66 O;  2UU9 O;  2UUB O;  4DR2 O;  1HNX O;  4B3M O;  1KUQ A;  4NXN O;  1XMO O;  1HR0 O;  1A32 A;  4DV6 O;  4LF9 O;  1AB3 A;  1FJG O;  4DV7 O;  4JI4 O;  3J81 N;  2E5L O;  5LL6 Y;  4YHH O;  1NS1 A;  3OTO O;  2N74 A;  4DV4 O;  2UUC O;  3T1H O;  4X65 O;  5FLX N;  2ZM6 O;  3M8A A;  5LMN O;  4B3T O;  3R66 A;  2FKX A;  4YY3 O;  2VQE O;  4DV3 O;  1D2D A;  4JI1 O;  4AQY O;  4JI7 O;  1N36 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...