2UXDO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxdO00
4DR5O 4JI0O 1G1XB 4DR2O 1XNRO 2LW7A 4DV3O 4LF4O 4B3TO 1N34O 4LFCO 4KHPO 3M8AA 1N33O 4DUYO 3T1HO 1A32A 5BXZA 3R66A 2VQEO 1IBLO 1HNXO 4B3RO 4LFAO 1R1BA 1HR0O 5H5NA 5LL6Y 2DOSA 2UUCO 1FYJA 4YY3O 1D2DA 4JI1O 4LF9O 1IBMO 1FKAO 4DV5O 4OX9O 3O65A 2ZM6O 5BY1A 4JI4O 1AILA 5IWAO 2JRIA 4JYAO 4LF7O 1IBKO 4JI5O 1AB3A 4OPAA 3JAMN 1F7YA 5IT9N 4DUZO 4B3SO 2UXDO 1XEQA 5A2QN 1FJGO 1YZBA 1J5EO 1X59A 4JI6O 4K0KO 4JV5O 4NXMO 2ZKOA 4X62O 1HNWO 4X65O 4DV6O 2VQFO 1N32O 4DV2O 4GKKO 2UU9O 4B3MO 2N74A 2UXCO 4DR4O 2F4VO 1R6TA 1NS1A 1XMQO 2DJVA 4YHHO 1N36O 2HHHO 4DR1O 4JI7O 4DR6O 4DR7O 4LF8O 4JI2O 4DV1O 4AQYO 4LFBO 4DV7O 2UXBO 4NXNO 2AGAA 3SDLA 2UUBO 1XNQO 4DV4O 3T1YO 4LF5O 2E5LO 4X66O 1HNZO 4X64O 3OTOO 4DR3O 1XMOO 5BR8O 5LMUO 3J80N 4GKJO 1I94O 4DV0O 3J81N 1DK1A 1KUQA 4A5UB 4JI8O 5LMNO 4JI3O 4OPHA 3RT3C 4LF6O 3J7AU 5FLXN 2Z0AA 2FKXA 3F5TA 2UUAO
chains in the Genus database with same CATH superfamily
1FFXA 1FXKC 2FB5A 2LO1A 1FFTB 1H2LA 4LF4O 1JVMA 3LSQA 1CP9A 3A2FA 3M8AA 3RYIB 1IX9A 4XDKA 4O4HB 5ITZB 3ICXA 4PA9A 3JAWB 4JASA 4IYIA 2ZR2A 4FFBB 2A3QA 5GONA 2EIKB 3H1LH 4WCEV 2QEXV 4CH3A 5IWAO 2BTQB 3G80A 4BR6A 3ZN0A 3VQWA 4LF7B 1WP7A 2VWJA 2DW4A 2CAZC 3JAWA 2PZSA 3K0GA 4KXRA 2XUMA 3A0RA 2GBOA 4U3JA 4PA3A 4HZ3A 2H3OA 4C7UA 4BW5A 1SQGA 4JI4B 2RJZA 2PY5A 2QE7G 1YTFD 4O2BB 1F4NA 3UT5A 4X65O 5B1AC 1R6NA 4MVOA 3C90A 3CCEV 2ZE6A 3L72H 1N0JA 1TVKB 4X88A 3SR2C 2F4VO 1R6TA 5KHGA 2P7TC 2ZE7A 1VIBA 4RWUA 1HW7A 2DYSC 3SYAA 3UT5B 1YI2V 4RUFA 4RQEA 1BZKA 2MK3A 3H1KH 4N21A 5LGUA 4JI7B 3JALB 1GH6A 2CH7B 4LP8A 2X0LA 2HVJC 1YF2A 4DR3O 1XMOO 1VF6C 2LGWA 5LMUO 1L1FA 4UCRA 1WPXA 5TISZ 4K3AA 1T5EA 4DR5B 4L87A 3BHPA 3RYFB 5H2FZ 2V1DA 2OCCC 2RNBA 2JVDA 4U7NA 1VQ4V 5KLVH 1FFXB 2GSMB 5J2TB 2OYQA 1XI1A 5JQGA 4LFAB 3IFXA 2BE3A 2EILB 1DLBA 5EBWC 3S3WA 4JTDB 4UCOA 5C93A 3OTFA 3D36A 2YICA 2ADPA 5LA6B 4FLZA 3GB7C 1VMGA 2HG5C 1RPRA 3E8BA 2DE0X 4YY3O 2XASA 4JI1O 5JQGB 4UVBA 5HFMA 1IBMO 4QIWF 4ZOLB 1QCEA 3JARA 5CN0A 4XDLA 2LFSA 4FK5C 4IT5A 3F7YC 4UUJC 2JIZG 1WA8A 1XEQA 5B1BC 1SRYA 5B1BB 2DYSB 3L70H 2KB1A 5L3DA 4U3JB 3EXAA 3FFQA 2L35A 3STLC 1HWYA 1R3KC 3ZJZA 1Q7YW 5JCOC 4UCVA 4KP4A 2RQ6A 1EN4A 4FJCC 2HHHB 4MW3A 1OCZC 3UCSC 4KUMA 4LH7A 3FB8C 1K5QA 4FM0A 1Q5OA 2VQFB 1J5EB 4RUEA 1VEWA 3E22A 4L8JA 2BSKA 1S72V 3E8HA 1XNRB 3JD1A 1JFFA 1WAZA 3H1IH 2EILC 2DN9A 3PJSK 1SQVH 3MDSA 3GWOA 1AJNA 1VQ7V 4FLTA 2QWQB 4LWSA 3AG1B 3OMNB 5FLXN 1SQFA 3F5TA 1Q6IA 1YJ9V 2CE4A 1H2NA 5IJ9A 3K9AA 2F43G 5EC2C 1S0VA 4AHCA 3ASNB 3D36C 1DF4A 3ZHTA 4DV0B 5CA0B 3T1HO 2W6JG 5DM6V 2HJDA 3QF7A 1AR4A 1V54B 2O57A 1GN4A 1R1BA 1TGOA 1NVPD 2E74B 3P32A 3SPIA 1H2SB 3AG4B 2QJ1A 5CA0A 4B3MB 5KA6A 1KQSU 4J7ZA 4MW8A 3ZMSA 1B6QA 2Q4PA 3E35A 1NJIW 1FJGO 3DC6A 3X2QC 1QVGU 3JD2A 2WA3A 2HP8A 4JV5O 3Q4HB 1NKDA 2ZNJA 5JJNB 3ASOC 1K97A 3U10A 3KG2A 2Q7GA 1K3EA 3OR6C 2UU9O 2ETNA 2JEUA 2YIBD 3ZCCA 4FPPA 1VQ6V 3APOA 1JA8A 4P9PA 2Y69B 2QKSA 4NXNB 3C3TA 4NKGB 4D7SA 4LFBO 1M56C 3QO8A 1L0LH 1BS3A 4O4LB 4DV4O 3NXSA 2Y48A 4JTAB 3CHXA 2XOKG 4KFMA 1AP6A 1SQXH 3T1YO 4EFEA 3ZEDA 4O4HA 1I0HA 1P4RA 4O2BA 4RO2A 2B9ZA 1NI8A 4GZRB 3DXRB 5LBQA 2XHBA 5EZYA 4WFAV 2JGDA 4J9ZB 3ZS8C 3W7UA 2UUAO 4QNHB 2R9RB 3AG4C 3FX7A 3TJTA 4X20B 1VF6A 1H2MA 2B5UA 1NZ6A 4LFCO 2GHYA 5L3CA 1R3LC 2HJFC 2IJJA 3X2QB 1JJOA 1OCCB 4LFAO 3FYIB 1WLEA 2DOSA 3AG3C 5CB4A 1BHBA 1ORQC 3FB7C 3K08A 4JI5B 3G67A 4X1YB 4J7KA 4PHZA 2UXDB 1VF5B 1YXBA 1IBKO 3CRMA 2F4VB 1AB3A 4DO2A 3AG1C 3EVKA 3RBZA 1AR1B 5CBFA 3FB6C 4ZHQB 2QKCA 2XNDG 1RSOA 1Y6XA 5LP6C 4I9WA 5BMVB 4X1YA 5KUKA 4X62O 3ABUA 1LUVA 1HNWO 4XBFA 4TQDA 2QSAA 5LHHA 4DR3B 1SF9A 1CXZB 2UXCO 4DW1A 2CDYA 1NS1A 5B1NA 4WFGA 2ZDIA 3CSXA 2CTPA 1KU9A 1N36B 2UUBB 1AR5A 1R73A 5BMVA 1BQZA 4PA6A 4DV7B 1PPJH 4JAAA 4OGQB 2F66C 3CC4V 1NTKH 4Z2WA 5JJEB 5IJ0B 3D3QA 1QQCA 3OR7C 1MG1A 4DV2B 2ZQMA 2EBOA 2YI8A 5J9PC 1JPXA 1WP8A 3RWRD 3RN4A 4X64B 1QLEC 1W2BU 3B2EE 4GX5A 4JI3B 3ZRVA 1YITV 1MSDA 3K79A 3ZMZA 4JYCA 1IBMB 2ZXWC 2R9IA 5H9CA 4O2AB 4CH4A 4WFBV 1N33B 1FAFA 2AZ2A 1Y74B 3BAAA 4U3FH 2KSDA 1TUBA 3CCJV 1N34B 4WBNB 5FNVB 3P3NA 2IW5A 2YSUB 1P7GA 4P2ZA 2XAGA 4WF9V 2PYLA 1ZLZA 3LSSA 4AILC 2OIEA 2JRIA 1P7BA 2GTSA 3CJHA 4UVAA 4K0KB 2X6BA 4TWKA 4QE7A 2ZE8A 1P84F 1J5EO 5L3GA 4B3RB 3U11A 5KMGA 1PNLA 3K03A 3JASA 4PELA 4ASUG 1QLNA 1GKFA 3ABMC 3I56V 4GLXA 4D6TH 1XMQB 1GTOA 3K06A 4YHHO 3HKCB 2Y69C 1RFYA 3TXQA 2M7WA 5KMGB 1QLEB 1YHQV 2A7WA 4UB6Z 2P5OA 5LA6A 2QKAA 5EBLC 3ASNC 4X66O 1JJ2U 1R3JC 1K7DA 3OTOO 2Q8VA 2BOBC 1ZL8A 4DV0O 1DK1A 4R50A 1US6A 4QPKA 4MVSA 4PDVA 2XAJA 5CBGA 5EZYB 5HFLA 4LF6O 1VQMV 3E2EA 1H8EG 3BABA 1GM9A 4JI0O 2ZCEA 5L3BA 3CCLV 3MAQA 2PI5A 4PA7A 5JVDA 1WNSA 4DRXB 5B5EZ 1H2GA 4IIJA 1Y74A 4DUYO 3ABKC 5K1PA 2UUAB 1OCZB 1VQ5V 5BXZA 3W7WA 3JCZA 3T4DA 1CPYA 2ZDIC 4WBNA 3H01A 5EK0A 2UUCO 1D2DA 5IYZB 4DV5B 4AI8A 4YY3B 3ASOB 3K57A 2YIDA 3L75H 3ABMB 3OUSA 2JGDB 2UU9B 4F6EA 2IJKA 2QA4V 4R8CA 2R72A 3FAVB 2Q73A 1F7YA 1KB9F 1I5YA 4Q20A 4EB6B 4LFBB 1HNXB 5JWPA 1X59A 4MS2A 3JYCA 2ZINA 1M1KW 2JGUA 5L3FA 1PV0A 1MABG 4XDJA 1I08A 5KHKA 5KA5A 4TV9A 5B66Z 1MZFA 3ABKB 4ZI7B 2HHHO 3CD6V 4EFBA 1PM9A 1TAEA 2JS5A 3CPWU 2WWWA 3SDLA 3D8CA 3CC2V 2IM9A 3SYPA 3SJAC 2WLNA 2UXCB 3SPCA 3RYIA 3G71V 1U97A 4PV1B 2CTRA 2Q9LA 2X6CA 4GCZA 4J11A 4FM2A 1FPOA 4LFCB 2YC0A 3T1CA 1I94O 3J81N 4E4EA 3K59A 5A9GA 3TCUA 1JOYA 4H44B 4OPHA 2ZR3A 3T4ZA 4IYHA 2Z0AA 5B3SB 2Z3YA 1PKXA 2CGNA 4KHPB 4DW0A 3EFFK 4LH6A 3VQVA 4MTXA 3IC9A 2E3CA 4W4LA 1Y66A 2VS0A 3D3IA 4UFZA 2GUZB 1KECA 1RP3B 1XL4A 1LUWA 5H5NA 5LL6Y 2AZ0A 1IBLB 1DTOA 1TVKA 5EC1C 1KYOF 4HAMA 4J10A 2Q5ZA 2KKWA 2ZM6O 1S5HC 2WLIA 5IY5C 1SKVA 5JH7A 3CE2A 2CTWA 2HR3A 4I5SA 4UB8Z 3VQYA 5E1AC 1AP5A 1GM8A 2B1GA 5LHIA 3STZC 1G8MA 1Y76A 5IJ9B 4EB6A 4DV6B 4JZGA 4UCUA 3DXRA 4JYYA 2WLLB 1PL0A 4JI2B 1BCCH 3E22B 4O4IA 4DV2O 1RM1B 4JAUA 2DQ0A 2HKOA 1S5LZ 4DR6O 1M57B 1XHZA 2WA4A 4TSFG 2WLLA 3HPLC 4PJ0Z 4GKJB 4NXNO 2ZT9B 1K5SA 4FLXA 1ZTEA 4D7TA 1PP9H 3BY6A 4JI8B 1XNQO 2F95B 2UXNA 1BHAA 1FS0G 2E5LO 1R3IC 3W7TA 2GTAA 4HBNA 1AJQA 1ZL8B 1S3JA 1NU1H 1KMIZ 1SC5B 3J80N 2Q67A 4U7OA 1KUQA 1GMGA 2LP7A 2HEPA 5LOVB 1MNGA 3LDDA 4CC5A 4X66B 1OJHA 5EIBD 1ENVA 4YXWG 1IDSA 1B04A 3B8NA 1WA8B 3E89A 2LFRA 4OXSA 1K34A 4TQFA 4LF4B 4G27B 2N05A 4FMTA 2YIAA 2VQEO 4ZBMA 4MT8A 4B3RO 2GUZA 1HDJA 4GX2A 3MHSC 3CWBH 3Q4HA 3HKCA 2YDEA 3K5MA 3DTUB 5LYJA 4FM1A 3F5WC 2ADQB 2JJ2G 4PI2A 3E8FA 3T2MA 4PDLA 2E75B 5IT9N 2RDCA 4JI6B 1LNQA 5IWAB 3CMEV 4QPJA 1WB8A 4H33A 1RPOA 2KG7B 3TGUH 1DGSA 1FXVA 4X62B 4CS4A 2DMXA 2EIMB 4ZI7A 3L9DA 4I4TB 3ZRSA 1FXHA 4LF8B 3B09A 4IHJB 4DUZB 5B1OA 4PA4A 2RMKB 2P06A 5LP6A 3P30A 1J95A 2QM7A 3NR7A 1AI7A 4G28B 3CXHF 4JI0B 1IZ3A 3CYOA 3ZHVA 1OZ0A 3CEIA 5B1AB 3CCVV 1FD9A 1ZWIC 1OHHG 1RM1C 3SGIA 1XILA 3G6BA 4FZ1A 3K5LA 3HKDB 1B3QA 4DUYB 2Y4TA 2QR4A 3ML0A 2YS8A 3OMIB 3BCCH 3DSQA 4YJ3A 3OD4A 1NR7A 1ZX3A 2ATKC 1N8RW 2ZIMA 1GN2A 4BIOA 4EKWA 4DR5O 2CTQA 1G1XB 3W7SA 2ZXWB 5GONB 4DV3O 4MVZA 1PD3A 3AK2A 1SETA 1BGYH 4BWAA 1KP2A 4OX9B 5FL7G 3QVNA 5JJJB 5LMNB 3CB2A 2BTQA 2JK5C 1HNXO 1G6UA 1BE3H 1NT2B 2IU3A 1Q90D 2A06H 2QWRB 1EN5A 2QTSA 4LNUA 3CS5A 3UO2A 4ZHQA 2P22C 4CS3A 4DXWA 1KC8W 2EIJB 3JARB 4UXNA 4DRXA 4RAIA 4IIJB 4JI1B 4GYCB 5IYDO 3OEHG 2ZNIA 2NLJC 3K0DA 1TUEB 2D3OW 4OPAA 5BZBA 2P4KA 1JR9A 2EINC 1JCHA 2NR5A 4LNUB 5A2QN 2EULA 3AG2B 3M99B 1KKCA 4X1IB 2Q0OC 2ITCC 4TUYA 3SJCC 1UPGA 4NXMO 3ZHRA 2PUSA 4QE9A 1MA1A 5CA1B 3APQA 2Y4UA 2DJVA 1XMQO 3E8GA 2G38A 2CUGA 4YHHB 4JI2O 4DV1O 4UV9A 3CRCA 2AGAA 2JS3A 4CBCA 4NR1A 4X8AA 4LF5B 3HKBB 2Y0PA 1VP7A 2ZE5A 3RVYA 5LP6B 1Z2GA 3UM7A 2A0LA 2EJRA 3CJHB 4DR6B 1KBHA 3MD0A 4DK0A 2HLDG 4FLYA 2WLJA 3N2GB 2EIMC 4GKJO 4DR4B 3B77A 3CC7V 4JI8O 3M7MX 1EZVH 2EZOA 2XAQA 1VF7A 2KG7A 1F51A 2E5LB 4LF6B 1EN6A 3HR0A 3QG5A 1I7FA 2FTKA 4JAVA 3ZHSA 1VQKV 4P30A 2LW7A 1K33A 1Q43A 3KKYA 3K5NA 4B3TO 5H6RA 2EZPA 1Y76B 4JF3A 3IC7A 1QNMA 1QVFU 3JD0A 1IURA 2WPDG 4JTCB 5GTHZ 4F6RB 2ZD9A 2Q0AA 3A8TA 5J2TA 4H37A 3ZN1A 2F23A 5J2UA 4LF9O 2UUCB 4BIUA 2Q7EA 1FKAO 1GK9A 4DV5O 4I0XA 2IU0A 4I50B 3RVZA 2VQEB 3CP1A 4BAYA 3CMAV 5LGTA 3KCXA 3JAMN 1V9PA 5DECA 3WU2Z 3ETGA 4UVCA 1X4TA 3AEIA 5IYBO 3ABLC 4DR1B 1RSOB 3OGIB 4JPRA 2EIKC 1SQQH 2DWDC 4GKKB 3K3WA 3ZRWA 3L71H 1YIJV 1VQLV 3H1JH 4HNAA 3TETA 2LW1A 4DR7B 4UCTA 1MZEA 2CK3G 2Q6AA 2LQTA 2V4DA 1SA0A 3ZRXA 1TA8A 2YUAA 1BSMA 1Y4MA 2WAMA 2YIBA 1TUBB 1SESA 3HKEB 1XMOB 3BEHA 1EM1A 5IYCO 2XAHA 2MW2B 4PD4F 3CCMV 4DR2B 1YJWV 1N4CA 3FYEB 2EX3A 1GO3F 3ZMTA 2ILMA 2BCCH 3JD3A 1ZSPA 1QR8A 4BIZA 3AG3B 4X20A 1E79G 4RQFA 1EFRG 3OW2U 4ZIBA 4O2AA 3SPGA 2JJ1G 3RW0A 4MTGA 4O4JA 4P9OA 2Q7HA 4KL1A 4FFBA 3SYOA 4F6RA 2IH1C 1SQBH 4DV3B 1HR0O 3ABLB 4FIPC 2CH7A 3JATB 3THOA 3AG7A 1B06A 2M6YA 4DK1A 4OX9O 4IHJA 5BY1A 3F7VC 5FPRA 3LDEA 1V55C 1K92A 4Z1VA 2C2AA 4MVRA 4JI5O 3B4SA 4DUZO 2UXDO 4FLUA 1DF5A 4GX0A 1IBKB 5EBMC 3SPHA 4JGSA 1ZAUA 1Q82W 4WFFA 3CRRA 2N04A 1OCOB 3GVMA 2NNUA 1N32O 1IXMA 1Q81W 3PN1A 2IJHA 2W6IG 1F23A 4B3SB 1XDCA 2OT5A 4W4KA 3HKBA 1W0KG 2UXBO 2ITDC 2QWOB 3DGEA 2WLIB 3H9VA 5B3SC 4CC6A 2UUBO 1MMMA 1VQNV 1GAXA 5KAIZ 2K1EA 1Q86W 4JZ2A 2P67A 4PDMA 1THZA 2NN4A 4A5UB 3CCUV 1AI6A 5LMNO 1QU7A 3CCSV 4LWSB 1KKDA 3WB0A 5LXTB 4I55B 2XT9A 3TK1A 2YEVA 2BTOA 4X89A 1WN7A 3OUFA 2A79B 4FVMA 3N2KA 2Z5UA 2FL4A 2W0XA 4CS2A 3BA8A 4TV8B 1N33O 2WLHA 3OFNG 5LXTA 1M5IA 1JFFB 3KCYA 5J2UB 3DC5A 5DEDA 3L74H 3A0BZ 5E79Z 3JATA 5EYPB 5IE9A 1QBZA 5LOVA 2RCVA 4O4IB 1FJGB 4NYKA 2H94A 3IGAC 4JV5B 5EIBC 2P4VA 3ETDA 4K0KO 1S76D 4Q6GA 1VQ9V 2DWEC 5EYPA 2H8PC 2QGNA 2YXLA 3C3SA 1S77D 4YIOA 5IY5B 1YTFB 1E1QG 2OTJV 3N27A 4DR4O 3OAAG 1YDXA 4DR1O 4LF8O 1H8HG 3BPZA 3WB1A 4AQYO 4DV4B 3T1YB 2ZIOA 3LNNA 2QWNB 5LGNA 1EZJA 5DN6G 1U96A 1HNZO 1K4DC 3EHBB 4NB5A 5CMUA 3CXCU 4FLWA 2OTLV 3HB3B 3OTOB 2QM8A 3ZMUA 1OCCC 2X7RB 4HNAB 2YXYA 5JH7B 4NTWA 2FKXA 5KUMA 4ICGA 4DR2O 1O9GA 1SA0B 1BQ0A 1VARA 5AG2A 5H6QA 1JQ0A 3ZX6A 3ZIAG 3W7XA 2D2CB 1BT8A 3AK1A 2LJ2A 1A32A 1K4CC 3OMAB 4YIPA 4JYAB 4J7JA 4Z1MG 3ZRWB 4F4LA 1AI4A 1V54C 2AHYA 2YI9A 2XTAA 1F4MA 1SS3A 3RYCB 4WFEA 4B7EA 3ETQA 4B08A 1AILA 1XQ8A 4YJ3B 4LF7O 3G6EV 3K5OA 3JALA 5FPOA 1AROP 2Y0IA 3E83A 5KHJA 1YCIA 1HNWB 2AXTZ 1NTMH 2PF4E 4ABMA 1SERA 4X65B 2ODMA 4NXMB 1OCOC 5K1XA 4X1KA 1XREA 3UKMA 2CGOA 1SQPH 4MTFA 1IVSA 3KZIZ 1XHXA 5ITZA 3O9OA 2F1MA 1PNKA 2QDOA 1D5NA 2VRZA 1SZXA 5KAFZ 4DV1B 3JAKA 3I5DA 5F2VO 4CZZA 1N32B 4FLVA 2P6JA 4GT1A 4ZKIA 1OCRC 3QNEA 2VWKA 3VOUA 1Z5VA 3K04A 4O4JB 1N0NA 4X64O 5BR8O 3CCRV 4CH6A 5GTIZ 3WB2A 1EBOA 3H1HH 2BOCC 3J7AU 3ZBHA 1PL4A 1I94B 3I55V 1HR0B 1XL6A 3JD4A 3UQ8A 1Z5WA 5CA1A 5C8YA 2WSSG 1WJZA 4J41A 4LC1A 4G2KA 5GW7A 1N34O 1V55B 4KHPO 4B3TB 3BRCA 3WG7C 2PTMA 3G4SV 2DQ3A 1WPBA 3OE7G 4MVQA 4YJ2A 4X9QA 1L8DA 1FYJA 4R6ZA 4I4TA 1I5XA 4LF9B 3BA9A 4FZ0A 3RYCA 2WLMA 2IJIA 1YVWA 3CRQA 2XAFA 2ZM6B 1K8AW 3IAYA 2WLKA 5L3EA 1URFA 4MTOA 4B3SO 3IJ4A 5LHGA 4MSWC 2L6LA 3L73H 4LR3A 4CH5A 2A9HA 1XUQA 2FMLA 3SJBC 3ETEA 2HFEC 3JSNA 2ZKOA 1NH2B 3RYHB 1L0NH 4DV6O 4E2LA 3ZHUA 3LUTB 4GKKO 3FAVA 5CB4B 4LCUC 3B8MA 4JYBA 2E76B 1MOFA 4R7CA 3SYQA 4DR7O 2RN9A 2KQXA 4J42A 5KHHA 2K9PA 3K58A 1W0JG 2YXHA 1K73W 3QTCA 5D5QA 2OCHA 1FXKA 1P49A 4H0LB 2OIGA 4AQYB 3LSUA 2QM4A 2W0FC 3HKDA 4EEQA 1M57C 3LNMB 3U0ZA 4LBEC 2DYRB 1FXKB 4PI0A 2PYJA 3RFRA 1GN3A 1ROPA 1HP8A 3K9SA 5C8YB 5KX5A 2JEXA 3QO5A 1AI5A 4ZOLA 4I50A 3JAKB 4NVPA 1Q6HA 5IJ0A 1IXBA 3A0HZ 4I55A 4MVUA 4BW9A 1G4YB 4K35A 5KX5B 1AVMA 1H2KA 4TV8A 4JI4O 1Y67A 2Q69A 3LDCA 4IL6Z 4NTXA 4J80A 5CBHA 4UCSA 2R9AA 2GV9A 4JYAO 1NH2D 3VBBA 3WG7B 3BFRA 3SJQC 1NBMG 1W59A 1XBLA 3AG2C 3R65A 2GDSA 4JI6O 2OCCB 4GUNA 1NR1A 4GX1A 5JVDB 4X1IA 1GM7A 4TUYB 3P3PA 1NVPB 1CEZA 3JSLA 1QHTA 1OV9A 1SZTA 4JI7O 5KHIA 1VQ8V 1LR1A 3N2KB 4TT3G 1AJPA 3RGBA 5LMUB 5IDJA 3JCUZ 2DYRC 3FD9A 2UXBB 1Q3EA 4IGGA 2QWPB 2JDIG 4TOIA 4K8XA 1VQOV 4QJFB 5FNVA 3S3XA 3N2GA 1ZUQA 1Q8IA 3CRAA 4DYLA 1YJNV 4B7KA 1R6KA 3VQXA 1XOUA 5BR8B 1XNRO 3OGCC 3ABTA 2V7QG 3GWKC 4UV8A 3OEEG 5CA3A 1UJWB 3OT7A 4I7ZB 3TXSA 2OWOA 2BSKB 1GN6A 2P90A 1M93A 1VQPV 3R66A 3OM3B 1IBLO 1QR9A 1Q6UA 4X1KB 3UO3A 2AW9A 2UXXA 5IYZA 1NTZH 2R70A 2B1IA 4J9YB 5JCOA 2FYUH 2ARHA 2HVKC 4HYOA 1KP3A 2QTOA 3O65A 3MHHC 1JX9A 3BVOA 2PI4A 1M4UA 4H13B 4I9QA 3CCQV 1M9NA 1H38A 1O9HA 3T1HB 3E86A 3HKEA 2IBZH 1M56B 2Q68A 1YZBA 4K8ZA 4WFHA 2IH3C 1JMKC 2LGQA 3FKSG 1YEWA 1OCRB 3WFVA 2PGGA 3RYFA 1S5JA 4MVMA 3SPJA 5LYJB 2EJ7A 4O4LA 5D5PA 2VQFO 4PDRA 1M90W 4B3MO 2N74A 3QO7A 1COWG 2X6AA 3SYCA 4N23A 1MSWD 1NQTA 1N36O 2F93B 3AK3A 2EINB 1XNQB 1K9MW 4QGPA 4DV7O 1YSCA 3ZHQA 1WB7A 3JASB 1PNMA 4LF5O 2EIJC 1D5AA 2YEVB 4YJ2B 2AHZA 1HNZB 1BL8A 4I0XB 3RYHA 1BMFG 3ZMVA 1GRJA 3RT3C 4JI3O 3B40A 3CX5F 1E1RG 4FFKA 1KD1W 4TV9B 1UFIA 3FB5C 4NTYA
chains in the Genus database with same CATH topology
4DR5O 4JI0O 1G1XB 4DR2O 1XNRO 2LW7A 4DV3O 4LF4O 4B3TO 1N34O 4LFCO 4KHPO 3M8AA 1N33O 4DUYO 3T1HO 1A32A 5BXZA 3R66A 2VQEO 1IBLO 1HNXO 4B3RO 4LFAO 1R1BA 1HR0O 5H5NA 5LL6Y 2DOSA 2UUCO 1FYJA 4YY3O 1D2DA 4JI1O 4LF9O 1IBMO 1FKAO 4DV5O 4OX9O 3O65A 2ZM6O 5BY1A 4JI4O 1AILA 5IWAO 2JRIA 4JYAO 4LF7O 1IBKO 4JI5O 1AB3A 4OPAA 3JAMN 1F7YA 5IT9N 4DUZO 4B3SO 2UXDO 1XEQA 5A2QN 1FJGO 1YZBA 1J5EO 1X59A 4JI6O 4K0KO 4JV5O 4NXMO 2ZKOA 4X62O 1HNWO 4X65O 4DV6O 2VQFO 1N32O 4DV2O 4GKKO 2UU9O 4B3MO 2N74A 2UXCO 4DR4O 2F4VO 1R6TA 1NS1A 1XMQO 2DJVA 4YHHO 1N36O 2HHHO 4DR1O 4JI7O 4DR6O 4DR7O 4LF8O 4JI2O 4DV1O 4AQYO 4LFBO 4DV7O 2UXBO 4NXNO 2AGAA 3SDLA 2UUBO 1XNQO 4DV4O 3T1YO 4LF5O 2E5LO 4X66O 1HNZO 4X64O 3OTOO 4DR3O 1XMOO 5BR8O 5LMUO 3J80N 4GKJO 1I94O 4DV0O 3J81N 1DK1A 1KUQA 4A5UB 4JI8O 5LMNO 4JI3O 4OPHA 3RT3C 4LF6O 3J7AU 5FLXN 2Z0AA 2FKXA 3F5TA 2UUAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 O;  4JI0 O;  1G1X B;  4DR2 O;  1XNR O;  2LW7 A;  4DV3 O;  4LF4 O;  4B3T O;  1N34 O;  4LFC O;  4KHP O;  3M8A A;  1N33 O;  4DUY O;  3T1H O;  1A32 A;  5BXZ A;  3R66 A;  2VQE O;  1IBL O;  1HNX O;  4B3R O;  4LFA O;  1R1B A;  1HR0 O;  5H5N A;  5LL6 Y;  2DOS A;  2UUC O;  1FYJ A;  4YY3 O;  1D2D A;  4JI1 O;  4LF9 O;  1IBM O;  1FKA O;  4DV5 O;  4OX9 O;  3O65 A;  2ZM6 O;  5BY1 A;  4JI4 O;  1AIL A;  5IWA O;  2JRI A;  4JYA O;  4LF7 O;  1IBK O;  4JI5 O;  1AB3 A;  4OPA A;  3JAM N;  1F7Y A;  5IT9 N;  4DUZ O;  4B3S O;  2UXD O;  1XEQ A;  5A2Q N;  1FJG O;  1YZB A;  1J5E O;  1X59 A;  4JI6 O;  4K0K O;  4JV5 O;  4NXM O;  2ZKO A;  4X62 O;  1HNW O;  4X65 O;  4DV6 O;  2VQF O;  1N32 O;  4DV2 O;  4GKK O;  2UU9 O;  4B3M O;  2N74 A;  2UXC O;  4DR4 O;  2F4V O;  1R6T A;  1NS1 A;  1XMQ O;  2DJV A;  4YHH O;  1N36 O;  2HHH O;  4DR1 O;  4JI7 O;  4DR6 O;  4DR7 O;  4LF8 O;  4JI2 O;  4DV1 O;  4AQY O;  4LFB O;  4DV7 O;  2UXB O;  4NXN O;  2AGA A;  3SDL A;  2UUB O;  1XNQ O;  4DV4 O;  3T1Y O;  4LF5 O;  2E5L O;  4X66 O;  1HNZ O;  4X64 O;  3OTO O;  4DR3 O;  1XMO O;  5BR8 O;  5LMU O;  3J80 N;  4GKJ O;  1I94 O;  4DV0 O;  3J81 N;  1DK1 A;  1KUQ A;  4A5U B;  4JI8 O;  5LMN O;  4JI3 O;  4OPH A;  3RT3 C;  4LF6 O;  3J7A U;  5FLX N;  2Z0A A;  2FKX A;  3F5T A;  2UUA O; 
#chains in the Genus database with same CATH topology
 1FFX A;  1FXK C;  2FB5 A;  2LO1 A;  1FFT B;  1H2L A;  4LF4 O;  1JVM A;  3LSQ A;  1CP9 A;  3A2F A;  3M8A A;  3RYI B;  1IX9 A;  4XDK A;  4O4H B;  5ITZ B;  3ICX A;  4PA9 A;  3JAW B;  4JAS A;  4IYI A;  2ZR2 A;  4FFB B;  2A3Q A;  5GON A;  2EIK B;  3H1L H;  4WCE V;  2QEX V;  4CH3 A;  5IWA O;  2BTQ B;  3G80 A;  4BR6 A;  3ZN0 A;  3VQW A;  4LF7 B;  1WP7 A;  2VWJ A;  2DW4 A;  2CAZ C;  3JAW A;  2PZS A;  3K0G A;  4KXR A;  2XUM A;  3A0R A;  2GBO A;  4U3J A;  4PA3 A;  4HZ3 A;  2H3O A;  4C7U A;  4BW5 A;  1SQG A;  4JI4 B;  2RJZ A;  2PY5 A;  2QE7 G;  1YTF D;  4O2B B;  1F4N A;  3UT5 A;  4X65 O;  5B1A C;  1R6N A;  4MVO A;  3C90 A;  3CCE V;  2ZE6 A;  3L72 H;  1N0J A;  1TVK B;  4X88 A;  3SR2 C;  2F4V O;  1R6T A;  5KHG A;  2P7T C;  2ZE7 A;  1VIB A;  4RWU A;  1HW7 A;  2DYS C;  3SYA A;  3UT5 B;  1YI2 V;  4RUF A;  4RQE A;  1BZK A;  2MK3 A;  3H1K H;  4N21 A;  5LGU A;  4JI7 B;  3JAL B;  1GH6 A;  2CH7 B;  4LP8 A;  2X0L A;  2HVJ C;  1YF2 A;  4DR3 O;  1XMO O;  1VF6 C;  2LGW A;  5LMU O;  1L1F A;  4UCR A;  1WPX A;  5TIS Z;  4K3A A;  1T5E A;  4DR5 B;  4L87 A;  3BHP A;  3RYF B;  5H2F Z;  2V1D A;  2OCC C;  2RNB A;  2JVD A;  4U7N A;  1VQ4 V;  5KLV H;  1FFX B;  2GSM B;  5J2T B;  2OYQ A;  1XI1 A;  5JQG A;  4LFA B;  3IFX A;  2BE3 A;  2EIL B;  1DLB A;  5EBW C;  3S3W A;  4JTD B;  4UCO A;  5C93 A;  3OTF A;  3D36 A;  2YIC A;  2ADP A;  5LA6 B;  4FLZ A;  3GB7 C;  1VMG A;  2HG5 C;  1RPR A;  3E8B A;  2DE0 X;  4YY3 O;  2XAS A;  4JI1 O;  5JQG B;  4UVB A;  5HFM A;  1IBM O;  4QIW F;  4ZOL B;  1QCE A;  3JAR A;  5CN0 A;  4XDL A;  2LFS A;  4FK5 C;  4IT5 A;  3F7Y C;  4UUJ C;  2JIZ G;  1WA8 A;  1XEQ A;  5B1B C;  1SRY A;  5B1B B;  2DYS B;  3L70 H;  2KB1 A;  5L3D A;  4U3J B;  3EXA A;  3FFQ A;  2L35 A;  3STL C;  1HWY A;  1R3K C;  3ZJZ A;  1Q7Y W;  5JCO C;  4UCV A;  4KP4 A;  2RQ6 A;  1EN4 A;  4FJC C;  2HHH B;  4MW3 A;  1OCZ C;  3UCS C;  4KUM A;  4LH7 A;  3FB8 C;  1K5Q A;  4FM0 A;  1Q5O A;  2VQF B;  1J5E B;  4RUE A;  1VEW A;  3E22 A;  4L8J A;  2BSK A;  1S72 V;  3E8H A;  1XNR B;  3JD1 A;  1JFF A;  1WAZ A;  3H1I H;  2EIL C;  2DN9 A;  3PJS K;  1SQV H;  3MDS A;  3GWO A;  1AJN A;  1VQ7 V;  4FLT A;  2QWQ B;  4LWS A;  3AG1 B;  3OMN B;  5FLX N;  1SQF A;  3F5T A;  1Q6I A;  1YJ9 V;  2CE4 A;  1H2N A;  5IJ9 A;  3K9A A;  2F43 G;  5EC2 C;  1S0V A;  4AHC A;  3ASN B;  3D36 C;  1DF4 A;  3ZHT A;  4DV0 B;  5CA0 B;  3T1H O;  2W6J G;  5DM6 V;  2HJD A;  3QF7 A;  1AR4 A;  1V54 B;  2O57 A;  1GN4 A;  1R1B A;  1TGO A;  1NVP D;  2E74 B;  3P32 A;  3SPI A;  1H2S B;  3AG4 B;  2QJ1 A;  5CA0 A;  4B3M B;  5KA6 A;  1KQS U;  4J7Z A;  4MW8 A;  3ZMS A;  1B6Q A;  2Q4P A;  3E35 A;  1NJI W;  1FJG O;  3DC6 A;  3X2Q C;  1QVG U;  3JD2 A;  2WA3 A;  2HP8 A;  4JV5 O;  3Q4H B;  1NKD A;  2ZNJ A;  5JJN B;  3ASO C;  1K97 A;  3U10 A;  3KG2 A;  2Q7G A;  1K3E A;  3OR6 C;  2UU9 O;  2ETN A;  2JEU A;  2YIB D;  3ZCC A;  4FPP A;  1VQ6 V;  3APO A;  1JA8 A;  4P9P A;  2Y69 B;  2QKS A;  4NXN B;  3C3T A;  4NKG B;  4D7S A;  4LFB O;  1M56 C;  3QO8 A;  1L0L H;  1BS3 A;  4O4L B;  4DV4 O;  3NXS A;  2Y48 A;  4JTA B;  3CHX A;  2XOK G;  4KFM A;  1AP6 A;  1SQX H;  3T1Y O;  4EFE A;  3ZED A;  4O4H A;  1I0H A;  1P4R A;  4O2B A;  4RO2 A;  2B9Z A;  1NI8 A;  4GZR B;  3DXR B;  5LBQ A;  2XHB A;  5EZY A;  4WFA V;  2JGD A;  4J9Z B;  3ZS8 C;  3W7U A;  2UUA O;  4QNH B;  2R9R B;  3AG4 C;  3FX7 A;  3TJT A;  4X20 B;  1VF6 A;  1H2M A;  2B5U A;  1NZ6 A;  4LFC O;  2GHY A;  5L3C A;  1R3L C;  2HJF C;  2IJJ A;  3X2Q B;  1JJO A;  1OCC B;  4LFA O;  3FYI B;  1WLE A;  2DOS A;  3AG3 C;  5CB4 A;  1BHB A;  1ORQ C;  3FB7 C;  3K08 A;  4JI5 B;  3G67 A;  4X1Y B;  4J7K A;  4PHZ A;  2UXD B;  1VF5 B;  1YXB A;  1IBK O;  3CRM A;  2F4V B;  1AB3 A;  4DO2 A;  3AG1 C;  3EVK A;  3RBZ A;  1AR1 B;  5CBF A;  3FB6 C;  4ZHQ B;  2QKC A;  2XND G;  1RSO A;  1Y6X A;  5LP6 C;  4I9W A;  5BMV B;  4X1Y A;  5KUK A;  4X62 O;  3ABU A;  1LUV A;  1HNW O;  4XBF A;  4TQD A;  2QSA A;  5LHH A;  4DR3 B;  1SF9 A;  1CXZ B;  2UXC O;  4DW1 A;  2CDY A;  1NS1 A;  5B1N A;  4WFG A;  2ZDI A;  3CSX A;  2CTP A;  1KU9 A;  1N36 B;  2UUB B;  1AR5 A;  1R73 A;  5BMV A;  1BQZ A;  4PA6 A;  4DV7 B;  1PPJ H;  4JAA A;  4OGQ B;  2F66 C;  3CC4 V;  1NTK H;  4Z2W A;  5JJE B;  5IJ0 B;  3D3Q A;  1QQC A;  3OR7 C;  1MG1 A;  4DV2 B;  2ZQM A;  2EBO A;  2YI8 A;  5J9P C;  1JPX A;  1WP8 A;  3RWR D;  3RN4 A;  4X64 B;  1QLE C;  1W2B U;  3B2E E;  4GX5 A;  4JI3 B;  3ZRV A;  1YIT V;  1MSD A;  3K79 A;  3ZMZ A;  4JYC A;  1IBM B;  2ZXW C;  2R9I A;  5H9C A;  4O2A B;  4CH4 A;  4WFB V;  1N33 B;  1FAF A;  2AZ2 A;  1Y74 B;  3BAA A;  4U3F H;  2KSD A;  1TUB A;  3CCJ V;  1N34 B;  4WBN B;  5FNV B;  3P3N A;  2IW5 A;  2YSU B;  1P7G A;  4P2Z A;  2XAG A;  4WF9 V;  2PYL A;  1ZLZ A;  3LSS A;  4AIL C;  2OIE A;  2JRI A;  1P7B A;  2GTS A;  3CJH A;  4UVA A;  4K0K B;  2X6B A;  4TWK A;  4QE7 A;  2ZE8 A;  1P84 F;  1J5E O;  5L3G A;  4B3R B;  3U11 A;  5KMG A;  1PNL A;  3K03 A;  3JAS A;  4PEL A;  4ASU G;  1QLN A;  1GKF A;  3ABM C;  3I56 V;  4GLX A;  4D6T H;  1XMQ B;  1GTO A;  3K06 A;  4YHH O;  3HKC B;  2Y69 C;  1RFY A;  3TXQ A;  2M7W A;  5KMG B;  1QLE B;  1YHQ V;  2A7W A;  4UB6 Z;  2P5O A;  5LA6 A;  2QKA A;  5EBL C;  3ASN C;  4X66 O;  1JJ2 U;  1R3J C;  1K7D A;  3OTO O;  2Q8V A;  2BOB C;  1ZL8 A;  4DV0 O;  1DK1 A;  4R50 A;  1US6 A;  4QPK A;  4MVS A;  4PDV A;  2XAJ A;  5CBG A;  5EZY B;  5HFL A;  4LF6 O;  1VQM V;  3E2E A;  1H8E G;  3BAB A;  1GM9 A;  4JI0 O;  2ZCE A;  5L3B A;  3CCL V;  3MAQ A;  2PI5 A;  4PA7 A;  5JVD A;  1WNS A;  4DRX B;  5B5E Z;  1H2G A;  4IIJ A;  1Y74 A;  4DUY O;  3ABK C;  5K1P A;  2UUA B;  1OCZ B;  1VQ5 V;  5BXZ A;  3W7W A;  3JCZ A;  3T4D A;  1CPY A;  2ZDI C;  4WBN A;  3H01 A;  5EK0 A;  2UUC O;  1D2D A;  5IYZ B;  4DV5 B;  4AI8 A;  4YY3 B;  3ASO B;  3K57 A;  2YID A;  3L75 H;  3ABM B;  3OUS A;  2JGD B;  2UU9 B;  4F6E A;  2IJK A;  2QA4 V;  4R8C A;  2R72 A;  3FAV B;  2Q73 A;  1F7Y A;  1KB9 F;  1I5Y A;  4Q20 A;  4EB6 B;  4LFB B;  1HNX B;  5JWP A;  1X59 A;  4MS2 A;  3JYC A;  2ZIN A;  1M1K W;  2JGU A;  5L3F A;  1PV0 A;  1MAB G;  4XDJ A;  1I08 A;  5KHK A;  5KA5 A;  4TV9 A;  5B66 Z;  1MZF A;  3ABK B;  4ZI7 B;  2HHH O;  3CD6 V;  4EFB A;  1PM9 A;  1TAE A;  2JS5 A;  3CPW U;  2WWW A;  3SDL A;  3D8C A;  3CC2 V;  2IM9 A;  3SYP A;  3SJA C;  2WLN A;  2UXC B;  3SPC A;  3RYI A;  3G71 V;  1U97 A;  4PV1 B;  2CTR A;  2Q9L A;  2X6C A;  4GCZ A;  4J11 A;  4FM2 A;  1FPO A;  4LFC B;  2YC0 A;  3T1C A;  1I94 O;  3J81 N;  4E4E A;  3K59 A;  5A9G A;  3TCU A;  1JOY A;  4H44 B;  4OPH A;  2ZR3 A;  3T4Z A;  4IYH A;  2Z0A A;  5B3S B;  2Z3Y A;  1PKX A;  2CGN A;  4KHP B;  4DW0 A;  3EFF K;  4LH6 A;  3VQV A;  4MTX A;  3IC9 A;  2E3C A;  4W4L A;  1Y66 A;  2VS0 A;  3D3I A;  4UFZ A;  2GUZ B;  1KEC A;  1RP3 B;  1XL4 A;  1LUW A;  5H5N A;  5LL6 Y;  2AZ0 A;  1IBL B;  1DTO A;  1TVK A;  5EC1 C;  1KYO F;  4HAM A;  4J10 A;  2Q5Z A;  2KKW A;  2ZM6 O;  1S5H C;  2WLI A;  5IY5 C;  1SKV A;  5JH7 A;  3CE2 A;  2CTW A;  2HR3 A;  4I5S A;  4UB8 Z;  3VQY A;  5E1A C;  1AP5 A;  1GM8 A;  2B1G A;  5LHI A;  3STZ C;  1G8M A;  1Y76 A;  5IJ9 B;  4EB6 A;  4DV6 B;  4JZG A;  4UCU A;  3DXR A;  4JYY A;  2WLL B;  1PL0 A;  4JI2 B;  1BCC H;  3E22 B;  4O4I A;  4DV2 O;  1RM1 B;  4JAU A;  2DQ0 A;  2HKO A;  1S5L Z;  4DR6 O;  1M57 B;  1XHZ A;  2WA4 A;  4TSF G;  2WLL A;  3HPL C;  4PJ0 Z;  4GKJ B;  4NXN O;  2ZT9 B;  1K5S A;  4FLX A;  1ZTE A;  4D7T A;  1PP9 H;  3BY6 A;  4JI8 B;  1XNQ O;  2F95 B;  2UXN A;  1BHA A;  1FS0 G;  2E5L O;  1R3I C;  3W7T A;  2GTA A;  4HBN A;  1AJQ A;  1ZL8 B;  1S3J A;  1NU1 H;  1KMI Z;  1SC5 B;  3J80 N;  2Q67 A;  4U7O A;  1KUQ A;  1GMG A;  2LP7 A;  2HEP A;  5LOV B;  1MNG A;  3LDD A;  4CC5 A;  4X66 B;  1OJH A;  5EIB D;  1ENV A;  4YXW G;  1IDS A;  1B04 A;  3B8N A;  1WA8 B;  3E89 A;  2LFR A;  4OXS A;  1K34 A;  4TQF A;  4LF4 B;  4G27 B;  2N05 A;  4FMT A;  2YIA A;  2VQE O;  4ZBM A;  4MT8 A;  4B3R O;  2GUZ A;  1HDJ A;  4GX2 A;  3MHS C;  3CWB H;  3Q4H A;  3HKC A;  2YDE A;  3K5M A;  3DTU B;  5LYJ A;  4FM1 A;  3F5W C;  2ADQ B;  2JJ2 G;  4PI2 A;  3E8F A;  3T2M A;  4PDL A;  2E75 B;  5IT9 N;  2RDC A;  4JI6 B;  1LNQ A;  5IWA B;  3CME V;  4QPJ A;  1WB8 A;  4H33 A;  1RPO A;  2KG7 B;  3TGU H;  1DGS A;  1FXV A;  4X62 B;  4CS4 A;  2DMX A;  2EIM B;  4ZI7 A;  3L9D A;  4I4T B;  3ZRS A;  1FXH A;  4LF8 B;  3B09 A;  4IHJ B;  4DUZ B;  5B1O A;  4PA4 A;  2RMK B;  2P06 A;  5LP6 A;  3P30 A;  1J95 A;  2QM7 A;  3NR7 A;  1AI7 A;  4G28 B;  3CXH F;  4JI0 B;  1IZ3 A;  3CYO A;  3ZHV A;  1OZ0 A;  3CEI A;  5B1A B;  3CCV V;  1FD9 A;  1ZWI C;  1OHH G;  1RM1 C;  3SGI A;  1XIL A;  3G6B A;  4FZ1 A;  3K5L A;  3HKD B;  1B3Q A;  4DUY B;  2Y4T A;  2QR4 A;  3ML0 A;  2YS8 A;  3OMI B;  3BCC H;  3DSQ A;  4YJ3 A;  3OD4 A;  1NR7 A;  1ZX3 A;  2ATK C;  1N8R W;  2ZIM A;  1GN2 A;  4BIO A;  4EKW A;  4DR5 O;  2CTQ A;  1G1X B;  3W7S A;  2ZXW B;  5GON B;  4DV3 O;  4MVZ A;  1PD3 A;  3AK2 A;  1SET A;  1BGY H;  4BWA A;  1KP2 A;  4OX9 B;  5FL7 G;  3QVN A;  5JJJ B;  5LMN B;  3CB2 A;  2BTQ A;  2JK5 C;  1HNX O;  1G6U A;  1BE3 H;  1NT2 B;  2IU3 A;  1Q90 D;  2A06 H;  2QWR B;  1EN5 A;  2QTS A;  4LNU A;  3CS5 A;  3UO2 A;  4ZHQ A;  2P22 C;  4CS3 A;  4DXW A;  1KC8 W;  2EIJ B;  3JAR B;  4UXN A;  4DRX A;  4RAI A;  4IIJ B;  4JI1 B;  4GYC B;  5IYD O;  3OEH G;  2ZNI A;  2NLJ C;  3K0D A;  1TUE B;  2D3O W;  4OPA A;  5BZB A;  2P4K A;  1JR9 A;  2EIN C;  1JCH A;  2NR5 A;  4LNU B;  5A2Q N;  2EUL A;  3AG2 B;  3M99 B;  1KKC A;  4X1I B;  2Q0O C;  2ITC C;  4TUY A;  3SJC C;  1UPG A;  4NXM O;  3ZHR A;  2PUS A;  4QE9 A;  1MA1 A;  5CA1 B;  3APQ A;  2Y4U A;  2DJV A;  1XMQ O;  3E8G A;  2G38 A;  2CUG A;  4YHH B;  4JI2 O;  4DV1 O;  4UV9 A;  3CRC A;  2AGA A;  2JS3 A;  4CBC A;  4NR1 A;  4X8A A;  4LF5 B;  3HKB B;  2Y0P A;  1VP7 A;  2ZE5 A;  3RVY A;  5LP6 B;  1Z2G A;  3UM7 A;  2A0L A;  2EJR A;  3CJH B;  4DR6 B;  1KBH A;  3MD0 A;  4DK0 A;  2HLD G;  4FLY A;  2WLJ A;  3N2G B;  2EIM C;  4GKJ O;  4DR4 B;  3B77 A;  3CC7 V;  4JI8 O;  3M7M X;  1EZV H;  2EZO A;  2XAQ A;  1VF7 A;  2KG7 A;  1F51 A;  2E5L B;  4LF6 B;  1EN6 A;  3HR0 A;  3QG5 A;  1I7F A;  2FTK A;  4JAV A;  3ZHS A;  1VQK V;  4P30 A;  2LW7 A;  1K33 A;  1Q43 A;  3KKY A;  3K5N A;  4B3T O;  5H6R A;  2EZP A;  1Y76 B;  4JF3 A;  3IC7 A;  1QNM A;  1QVF U;  3JD0 A;  1IUR A;  2WPD G;  4JTC B;  5GTH Z;  4F6R B;  2ZD9 A;  2Q0A A;  3A8T A;  5J2T A;  4H37 A;  3ZN1 A;  2F23 A;  5J2U A;  4LF9 O;  2UUC B;  4BIU A;  2Q7E A;  1FKA O;  1GK9 A;  4DV5 O;  4I0X A;  2IU0 A;  4I50 B;  3RVZ A;  2VQE B;  3CP1 A;  4BAY A;  3CMA V;  5LGT A;  3KCX A;  3JAM N;  1V9P A;  5DEC A;  3WU2 Z;  3ETG A;  4UVC A;  1X4T A;  3AEI A;  5IYB O;  3ABL C;  4DR1 B;  1RSO B;  3OGI B;  4JPR A;  2EIK C;  1SQQ H;  2DWD C;  4GKK B;  3K3W A;  3ZRW A;  3L71 H;  1YIJ V;  1VQL V;  3H1J H;  4HNA A;  3TET A;  2LW1 A;  4DR7 B;  4UCT A;  1MZE A;  2CK3 G;  2Q6A A;  2LQT A;  2V4D A;  1SA0 A;  3ZRX A;  1TA8 A;  2YUA A;  1BSM A;  1Y4M A;  2WAM A;  2YIB A;  1TUB B;  1SES A;  3HKE B;  1XMO B;  3BEH A;  1EM1 A;  5IYC O;  2XAH A;  2MW2 B;  4PD4 F;  3CCM V;  4DR2 B;  1YJW V;  1N4C A;  3FYE B;  2EX3 A;  1GO3 F;  3ZMT A;  2ILM A;  2BCC H;  3JD3 A;  1ZSP A;  1QR8 A;  4BIZ A;  3AG3 B;  4X20 A;  1E79 G;  4RQF A;  1EFR G;  3OW2 U;  4ZIB A;  4O2A A;  3SPG A;  2JJ1 G;  3RW0 A;  4MTG A;  4O4J A;  4P9O A;  2Q7H A;  4KL1 A;  4FFB A;  3SYO A;  4F6R A;  2IH1 C;  1SQB H;  4DV3 B;  1HR0 O;  3ABL B;  4FIP C;  2CH7 A;  3JAT B;  3THO A;  3AG7 A;  1B06 A;  2M6Y A;  4DK1 A;  4OX9 O;  4IHJ A;  5BY1 A;  3F7V C;  5FPR A;  3LDE A;  1V55 C;  1K92 A;  4Z1V A;  2C2A A;  4MVR A;  4JI5 O;  3B4S A;  4DUZ O;  2UXD O;  4FLU A;  1DF5 A;  4GX0 A;  1IBK B;  5EBM C;  3SPH A;  4JGS A;  1ZAU A;  1Q82 W;  4WFF A;  3CRR A;  2N04 A;  1OCO B;  3GVM A;  2NNU A;  1N32 O;  1IXM A;  1Q81 W;  3PN1 A;  2IJH A;  2W6I G;  1F23 A;  4B3S B;  1XDC A;  2OT5 A;  4W4K A;  3HKB A;  1W0K G;  2UXB O;  2ITD C;  2QWO B;  3DGE A;  2WLI B;  3H9V A;  5B3S C;  4CC6 A;  2UUB O;  1MMM A;  1VQN V;  1GAX A;  5KAI Z;  2K1E A;  1Q86 W;  4JZ2 A;  2P67 A;  4PDM A;  1THZ A;  2NN4 A;  4A5U B;  3CCU V;  1AI6 A;  5LMN O;  1QU7 A;  3CCS V;  4LWS B;  1KKD A;  3WB0 A;  5LXT B;  4I55 B;  2XT9 A;  3TK1 A;  2YEV A;  2BTO A;  4X89 A;  1WN7 A;  3OUF A;  2A79 B;  4FVM A;  3N2K A;  2Z5U A;  2FL4 A;  2W0X A;  4CS2 A;  3BA8 A;  4TV8 B;  1N33 O;  2WLH A;  3OFN G;  5LXT A;  1M5I A;  1JFF B;  3KCY A;  5J2U B;  3DC5 A;  5DED A;  3L74 H;  3A0B Z;  5E79 Z;  3JAT A;  5EYP B;  5IE9 A;  1QBZ A;  5LOV A;  2RCV A;  4O4I B;  1FJG B;  4NYK A;  2H94 A;  3IGA C;  4JV5 B;  5EIB C;  2P4V A;  3ETD A;  4K0K O;  1S76 D;  4Q6G A;  1VQ9 V;  2DWE C;  5EYP A;  2H8P C;  2QGN A;  2YXL A;  3C3S A;  1S77 D;  4YIO A;  5IY5 B;  1YTF B;  1E1Q G;  2OTJ V;  3N27 A;  4DR4 O;  3OAA G;  1YDX A;  4DR1 O;  4LF8 O;  1H8H G;  3BPZ A;  3WB1 A;  4AQY O;  4DV4 B;  3T1Y B;  2ZIO A;  3LNN A;  2QWN B;  5LGN A;  1EZJ A;  5DN6 G;  1U96 A;  1HNZ O;  1K4D C;  3EHB B;  4NB5 A;  5CMU A;  3CXC U;  4FLW A;  2OTL V;  3HB3 B;  3OTO B;  2QM8 A;  3ZMU A;  1OCC C;  2X7R B;  4HNA B;  2YXY A;  5JH7 B;  4NTW A;  2FKX A;  5KUM A;  4ICG A;  4DR2 O;  1O9G A;  1SA0 B;  1BQ0 A;  1VAR A;  5AG2 A;  5H6Q A;  1JQ0 A;  3ZX6 A;  3ZIA G;  3W7X A;  2D2C B;  1BT8 A;  3AK1 A;  2LJ2 A;  1A32 A;  1K4C C;  3OMA B;  4YIP A;  4JYA B;  4J7J A;  4Z1M G;  3ZRW B;  4F4L A;  1AI4 A;  1V54 C;  2AHY A;  2YI9 A;  2XTA A;  1F4M A;  1SS3 A;  3RYC B;  4WFE A;  4B7E A;  3ETQ A;  4B08 A;  1AIL A;  1XQ8 A;  4YJ3 B;  4LF7 O;  3G6E V;  3K5O A;  3JAL A;  5FPO A;  1ARO P;  2Y0I A;  3E83 A;  5KHJ A;  1YCI A;  1HNW B;  2AXT Z;  1NTM H;  2PF4 E;  4ABM A;  1SER A;  4X65 B;  2ODM A;  4NXM B;  1OCO C;  5K1X A;  4X1K A;  1XRE A;  3UKM A;  2CGO A;  1SQP H;  4MTF A;  1IVS A;  3KZI Z;  1XHX A;  5ITZ A;  3O9O A;  2F1M A;  1PNK A;  2QDO A;  1D5N A;  2VRZ A;  1SZX A;  5KAF Z;  4DV1 B;  3JAK A;  3I5D A;  5F2V O;  4CZZ A;  1N32 B;  4FLV A;  2P6J A;  4GT1 A;  4ZKI A;  1OCR C;  3QNE A;  2VWK A;  3VOU A;  1Z5V A;  3K04 A;  4O4J B;  1N0N A;  4X64 O;  5BR8 O;  3CCR V;  4CH6 A;  5GTI Z;  3WB2 A;  1EBO A;  3H1H H;  2BOC C;  3J7A U;  3ZBH A;  1PL4 A;  1I94 B;  3I55 V;  1HR0 B;  1XL6 A;  3JD4 A;  3UQ8 A;  1Z5W A;  5CA1 A;  5C8Y A;  2WSS G;  1WJZ A;  4J41 A;  4LC1 A;  4G2K A;  5GW7 A;  1N34 O;  1V55 B;  4KHP O;  4B3T B;  3BRC A;  3WG7 C;  2PTM A;  3G4S V;  2DQ3 A;  1WPB A;  3OE7 G;  4MVQ A;  4YJ2 A;  4X9Q A;  1L8D A;  1FYJ A;  4R6Z A;  4I4T A;  1I5X A;  4LF9 B;  3BA9 A;  4FZ0 A;  3RYC A;  2WLM A;  2IJI A;  1YVW A;  3CRQ A;  2XAF A;  2ZM6 B;  1K8A W;  3IAY A;  2WLK A;  5L3E A;  1URF A;  4MTO A;  4B3S O;  3IJ4 A;  5LHG A;  4MSW C;  2L6L A;  3L73 H;  4LR3 A;  4CH5 A;  2A9H A;  1XUQ A;  2FML A;  3SJB C;  3ETE A;  2HFE C;  3JSN A;  2ZKO A;  1NH2 B;  3RYH B;  1L0N H;  4DV6 O;  4E2L A;  3ZHU A;  3LUT B;  4GKK O;  3FAV A;  5CB4 B;  4LCU C;  3B8M A;  4JYB A;  2E76 B;  1MOF A;  4R7C A;  3SYQ A;  4DR7 O;  2RN9 A;  2KQX A;  4J42 A;  5KHH A;  2K9P A;  3K58 A;  1W0J G;  2YXH A;  1K73 W;  3QTC A;  5D5Q A;  2OCH A;  1FXK A;  1P49 A;  4H0L B;  2OIG A;  4AQY B;  3LSU A;  2QM4 A;  2W0F C;  3HKD A;  4EEQ A;  1M57 C;  3LNM B;  3U0Z A;  4LBE C;  2DYR B;  1FXK B;  4PI0 A;  2PYJ A;  3RFR A;  1GN3 A;  1ROP A;  1HP8 A;  3K9S A;  5C8Y B;  5KX5 A;  2JEX A;  3QO5 A;  1AI5 A;  4ZOL A;  4I50 A;  3JAK B;  4NVP A;  1Q6H A;  5IJ0 A;  1IXB A;  3A0H Z;  4I55 A;  4MVU A;  4BW9 A;  1G4Y B;  4K35 A;  5KX5 B;  1AVM A;  1H2K A;  4TV8 A;  4JI4 O;  1Y67 A;  2Q69 A;  3LDC A;  4IL6 Z;  4NTX A;  4J80 A;  5CBH A;  4UCS A;  2R9A A;  2GV9 A;  4JYA O;  1NH2 D;  3VBB A;  3WG7 B;  3BFR A;  3SJQ C;  1NBM G;  1W59 A;  1XBL A;  3AG2 C;  3R65 A;  2GDS A;  4JI6 O;  2OCC B;  4GUN A;  1NR1 A;  4GX1 A;  5JVD B;  4X1I A;  1GM7 A;  4TUY B;  3P3P A;  1NVP B;  1CEZ A;  3JSL A;  1QHT A;  1OV9 A;  1SZT A;  4JI7 O;  5KHI A;  1VQ8 V;  1LR1 A;  3N2K B;  4TT3 G;  1AJP A;  3RGB A;  5LMU B;  5IDJ A;  3JCU Z;  2DYR C;  3FD9 A;  2UXB B;  1Q3E A;  4IGG A;  2QWP B;  2JDI G;  4TOI A;  4K8X A;  1VQO V;  4QJF B;  5FNV A;  3S3X A;  3N2G A;  1ZUQ A;  1Q8I A;  3CRA A;  4DYL A;  1YJN V;  4B7K A;  1R6K A;  3VQX A;  1XOU A;  5BR8 B;  1XNR O;  3OGC C;  3ABT A;  2V7Q G;  3GWK C;  4UV8 A;  3OEE G;  5CA3 A;  1UJW B;  3OT7 A;  4I7Z B;  3TXS A;  2OWO A;  2BSK B;  1GN6 A;  2P90 A;  1M93 A;  1VQP V;  3R66 A;  3OM3 B;  1IBL O;  1QR9 A;  1Q6U A;  4X1K B;  3UO3 A;  2AW9 A;  2UXX A;  5IYZ A;  1NTZ H;  2R70 A;  2B1I A;  4J9Y B;  5JCO A;  2FYU H;  2ARH A;  2HVK C;  4HYO A;  1KP3 A;  2QTO A;  3O65 A;  3MHH C;  1JX9 A;  3BVO A;  2PI4 A;  1M4U A;  4H13 B;  4I9Q A;  3CCQ V;  1M9N A;  1H38 A;  1O9H A;  3T1H B;  3E86 A;  3HKE A;  2IBZ H;  1M56 B;  2Q68 A;  1YZB A;  4K8Z A;  4WFH A;  2IH3 C;  1JMK C;  2LGQ A;  3FKS G;  1YEW A;  1OCR B;  3WFV A;  2PGG A;  3RYF A;  1S5J A;  4MVM A;  3SPJ A;  5LYJ B;  2EJ7 A;  4O4L A;  5D5P A;  2VQF O;  4PDR A;  1M90 W;  4B3M O;  2N74 A;  3QO7 A;  1COW G;  2X6A A;  3SYC A;  4N23 A;  1MSW D;  1NQT A;  1N36 O;  2F93 B;  3AK3 A;  2EIN B;  1XNQ B;  1K9M W;  4QGP A;  4DV7 O;  1YSC A;  3ZHQ A;  1WB7 A;  3JAS B;  1PNM A;  4LF5 O;  2EIJ C;  1D5A A;  2YEV B;  4YJ2 B;  2AHZ A;  1HNZ B;  1BL8 A;  4I0X B;  3RYH A;  1BMF G;  3ZMV A;  1GRJ A;  3RT3 C;  4JI3 O;  3B40 A;  3CX5 F;  1E1R G;  4FFK A;  1KD1 W;  4TV9 B;  1UFI A;  3FB5 C;  4NTY A; 
#chains in the Genus database with same CATH homology
 4DR5 O;  4JI0 O;  1G1X B;  4DR2 O;  1XNR O;  2LW7 A;  4DV3 O;  4LF4 O;  4B3T O;  1N34 O;  4LFC O;  4KHP O;  3M8A A;  1N33 O;  4DUY O;  3T1H O;  1A32 A;  5BXZ A;  3R66 A;  2VQE O;  1IBL O;  1HNX O;  4B3R O;  4LFA O;  1R1B A;  1HR0 O;  5H5N A;  5LL6 Y;  2DOS A;  2UUC O;  1FYJ A;  4YY3 O;  1D2D A;  4JI1 O;  4LF9 O;  1IBM O;  1FKA O;  4DV5 O;  4OX9 O;  3O65 A;  2ZM6 O;  5BY1 A;  4JI4 O;  1AIL A;  5IWA O;  2JRI A;  4JYA O;  4LF7 O;  1IBK O;  4JI5 O;  1AB3 A;  4OPA A;  3JAM N;  1F7Y A;  5IT9 N;  4DUZ O;  4B3S O;  2UXD O;  1XEQ A;  5A2Q N;  1FJG O;  1YZB A;  1J5E O;  1X59 A;  4JI6 O;  4K0K O;  4JV5 O;  4NXM O;  2ZKO A;  4X62 O;  1HNW O;  4X65 O;  4DV6 O;  2VQF O;  1N32 O;  4DV2 O;  4GKK O;  2UU9 O;  4B3M O;  2N74 A;  2UXC O;  4DR4 O;  2F4V O;  1R6T A;  1NS1 A;  1XMQ O;  2DJV A;  4YHH O;  1N36 O;  2HHH O;  4DR1 O;  4JI7 O;  4DR6 O;  4DR7 O;  4LF8 O;  4JI2 O;  4DV1 O;  4AQY O;  4LFB O;  4DV7 O;  2UXB O;  4NXN O;  2AGA A;  3SDL A;  2UUB O;  1XNQ O;  4DV4 O;  3T1Y O;  4LF5 O;  2E5L O;  4X66 O;  1HNZ O;  4X64 O;  3OTO O;  4DR3 O;  1XMO O;  5BR8 O;  5LMU O;  3J80 N;  4GKJ O;  1I94 O;  4DV0 O;  3J81 N;  1DK1 A;  1KUQ A;  4A5U B;  4JI8 O;  5LMN O;  4JI3 O;  4OPH A;  3RT3 C;  4LF6 O;  3J7A U;  5FLX N;  2Z0A A;  2FKX A;  3F5T A;  2UUA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...