2UXDO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxdO00
1N33O 4JI1O 2HHHO 5LMNO 4AQYO 1N34O 2UUBO 4NXMO 2ZKOA 1XNQO 1XMQO 4DR3O 1I94O 4DV0O 2UXCO 4JI0O 1FKAO 4LF8O 4OPAA 2JRIA 2F4VO 4LFAO 2E5LO 5BXZA 4JI2O 2DJVA 2VQFO 4X66O 4GKJO 5BR8O 1R6TA 4LF4O 2UXDO 1FJGO 4DUZO 4DV1O 4K0KO 1AILA 4KHPO 4JI5O 2UUCO 4DUYO 4DV7O 4JI8O 4OPHA 1N36O 4GKKO 4DV6O 1A32A 2FKXA 4DV2O 4DR7O 4DV4O 3J7AU 4DR4O 2UXBO 3O65A 5IWAO 4B3MO 1FYJA 1XNRO 4LF6O 1R1BA 3OTOO 1IBMO 3M8AA 5A2QN 2LW7A 3F5TA 1KUQA 4DV3O 4JI6O 1HNZO 3SDLA 2Z0AA 5FLXN 4DR5O 4LF7O 4LFBO 4DR1O 3RT3C 4JYAO 4X65O 1XMOO 1DK1A 1NS1A 4B3TO 4LF5O 4A5UB 3J80N 4DR6O 1AB3A 5H5NA 4X64O 4JI4O 3J81N 2UU9O 4YHHO 5LMUO 2ZM6O 5LL6Y 1HNWO 2VQEO 4LF9O 1YZBA 4X62O 4YY3O 1IBKO 1N32O 1D2DA 5IT9N 2AGAA 5BY1A 4JI7O 4B3RO 1IBLO 3R66A 3T1HO 3T1YO 4LFCO 1G1XB 1X59A 1HNXO 4JI3O 4DR2O 2DOSA 4NXNO 4JV5O 4B3SO 4DV5O 1HR0O 3JAMN 4OX9O 2N74A 2UUAO 1F7YA 1XEQA 1J5EO
chains in the Genus database with same CATH superfamily
1N33B 3ZIAG 2ADPA 5CA1B 1XREA 4TWKA 5GW7A 1XMQO 3G80A 3L71H 1GN6A 2F4VO 3MDSA 2HJFC 3E2EA 4X20B 5BR8O 3SR2C 1SQBH 2Q8VA 1KECA 5HFLA 1H8EG 1QQCA 1GTOA 5CBGA 4DYLA 1XHXA 3X2QC 5IYDO 2OT5A 1VQ5V 2HFEC 4TOIA 3O9OA 4DR3B 2Y0PA 3QO5A 4TV8B 5KX5A 2EULA 4TSFG 3DXRB 4LCUC 2X6BA 5HFMA 1JMKC 3QO8A 1K97A 2YC0A 3HKCB 5FLXN 1U97A 3FAVB 3JAWA 2YXLA 4KUMA 5H5NA 1IZ3A 3J81N 4J7ZA 3L9DA 2K9PA 2P5OA 4IGGA 3FYIB 2CTQA 1B06A 3UM7A 4PI0A 4YY3O 1EZVH 4CH6A 4P9OA 4F6EA 2EIKB 1Q7YW 1NVPB 1Z5VA 2ARHA 2ZCEA 3CXHF 3BFRA 1H2SB 1RPRA 4IIJB 4JI6B 4DV5O 4JYAB 2XAGA 1AI4A 1NR7A 3ZRWA 5EC1C 1F7YA 4KP4A 4TQFA 2X6AA 1F4NA 2JDIG 3N2KB 3ZMZA 3JARA 4NXMB 1FXVA 3P3PA 1AI7A 1JCHA 2CTRA 3CSXA 3LDEA 4E4EA 1YJNV 3E35A 3UT5B 5CA0B 5KUMA 4XBFA 4MVMA 4DUZO 3OFNG 2PGGA 4CH5A 4KHPB 2A0LA 1ZLZA 2Y69B 3GB7C 1RP3B 2KSDA 3CB2A 2UUCO 2IJIA 2EIJB 4X20A 1V54C 2NR5A 4JYCA 2Y48A 2V7QG 1ROPA 3ZMVA 4JI0B 3OGIB 3RYCA 3THOA 1RM1C 2YSUB 1H2LA 4UV9A 3D3QA 4KFMA 3WB1A 3LUTB 3RYHB 5JH7B 2R70A 2P22C 5IYBO 1ORQC 4X1YB 1SQPH 3TCUA 4DK0A 2EZPA 4FLYA 3OTOB 4WFEA 2B1GA 1N0NA 1KUQA 4JZGA 2GTAA 3I55V 4GKKB 2WA3A 3K3WA 1WNSA 5CMUA 3JD2A 1NBMG 2KB1A 2QM8A 5DN6G 4TV9A 1PKXA 4MVSA 2PI4A 1TVKB 4O4HB 3FAVA 4QE9A 2WWWA 4JTCB 1YIJV 3HKDB 2KG7B 2MW2B 5AG2A 4I0XB 2NN4A 2BTQA 5IE9A 4TUYB 2XUMA 4B3SO 4JV5B 1TUEB 1M1KW 1D5NA 4EFEA 2UUAB 4RAIA 1FXKB 4GT1A 4QPKA 5EC2C 3ZRSA 2ATKC 1SA0B 4IIJA 4WCEV 2QWQB 1VF6C 1XHZA 1N34O 3ASOC 4DO2A 2OCHA 1SZTA 4DR3O 3CCJV 1K4DC 5LGTA 1J95A 2PYLA 2GHYA 4U3JB 2FMLA 3N2KA 5KHIA 1HDJA 3U11A 4JZ2A 3WU2Z 3Q4HB 2IBZH 3WG7B 1L0LH 1ZSPA 3BA8A 1XDCA 1Z5WA 4H13B 1S76D 1QLNA 5LOVB 4DV4O 4GLXA 4PI2A 3S3WA 1SQXH 2IJHA 1Y76B 3MAQA 4GCZA 5E1AC 2W6JG 1RFYA 3D3IA 4JI5B 4Z1VA 1Q82W 4CS3A 4EB6B 3CS5A 2Q9LA 2ZINA 5JH7A 3RYHA 1OCZC 1NH2D 4JI6O 2WLLB 2BOCC 2DWEC 1OZ0A 2ZQMA 4X1YA 4JYAO 4X65B 3PJSK 3CRMA 1BGYH 3G71V 2CH7A 4YHHO 2A3QA 1JQ0A 5H2FZ 1K3EA 4LF9B 3EXAA 1L0NH 3K5OA 2EX3A 3OAAG 4H33A 5B1BB 1IBLB 1B04A 1GM9A 1ZTEA 3CMEV 4O2BA 3H1HH 4JI3B 4O4HA 1SQFA 1MABG 4UUJC 1PPJH 1Y74A 1PV0A 2IH1C 4X1KB 4DXWA 3JYCA 1YXBA 1WB8A 2DMXA 3GWKC 1XEQA 5LBQA 2JGDB 2CTPA 3HR0A 4ICGA 1O9GA 4O4LB 4Q6GA 4GUNA 2OCCC 4MVZA 1Q8IA 1FXKA 4JI0O 4LF8B 2JRIA 2Q7GA 2Q0OC 1S5HC 4K0KO 4DV1B 4I5SA 1KC8W 2CDYA 4EEQA 2QM7A 3BCCH 1XL4A 1L1FA 1U96A 1GKFA 1OJHA 1FFXA 3CRRA 3AG7A 1BL8A 2V4DA 4GKKO 1A32A 1GN4A 3QO7A 2O57A 3Q4HA 5IWAO 1KKCA 1WAZA 1SZXA 2P90A 1E1QG 2Q7EA 1VARA 1Q6HA 2XASA 4LWSA 5EBMC 3QVNA 1Y76A 3SDLA 5JQGB 1NTKH 5KUKA 2WLMA 3T4ZA 4LFBB 1THZA 1UFIA 4YJ2B 4FM2A 1HWYA 4B3TB 4U3FH 3CC2V 2ZNJA 2WLIA 4JI4B 4X64B 1UPGA 1QBZA 4MW3A 4FLTA 2PI5A 1QVGU 3SPIA 4O4JA 2BCCH 1SETA 4B3RB 4FPPA 3UO3A 2FL4A 4WBNB 3ETDA 3OR7C 1HR0B 4OX9B 3CYOA 2QWRB 1F23A 1KMIZ 1DLBA 1PD3A 4AILC 2A7WA 1HNWB 2LFRA 1K92A 2AHYA 2UUBB 4X1KA 3M99B 1V54B 5C8YB 1I08A 3SPHA 4DV0O 1EZJA 1SRYA 3SPGA 2DE0X 5CN0A 4GX5A 4NVPA 4O4LA 2E5LO 4LFAB 3F7VC 1GK9A 4YXWG 3UCSC 1WPXA 1EN5A 3IC7A 4JI5O 1K33A 4ZOLB 3SPJA 1Q6IA 2V1DA 4UCUA 3EHBB 1F51A 5JVDA 1XNQB 3JD3A 2ETNA 1IX9A 1CXZB 1Q3EA 4FFBB 5LA6A 2EJ7A 2UXBB 1R6NA 1WLEA 1VQ6V 3OT7A 5KA6A 1XNRO 3SYPA 2LW7A 3UKMA 2PUSA 1VQ4V 3JSLA 2QM4A 4LF7O 1P7GA 4I55A 2QTOA 3F5WC 1NS1A 4D6TH 1SKVA 4LF5B 1E79G 3CCUV 2ZNIA 2H94A 2ITCC 4J80A 5KHJA 4UCTA 5LMUB 3RGBA 1BQ0A 2P4VA 1IURA 3OMNB 1WA8A 5BMVA 3WB2A 1KP3A 3JAWB 4PDVA 2G38A 3ASOB 3K58A 4JI7O 1CPYA 1HW7A 3DSQA 3H1LH 4NB5A 4DR2B 4ZHQA 1YJ9V 3KKYA 2QWNB 5JWPA 4RWUA 2ZIOA 3SJAC 1XL6A 4X62B 4JI1B 2HHHB 3SPCA 5LMNB 2AW9A 4QE7A 2QDOA 1LUVA 1KQSU 3ZRWB 2XOKG 3L72H 3RN4A 3AK3A 2QTSA 3M7MX 4OPAA 3ZBHA 1D5AA 2RNBA 2Y4UA 3OMIB 2ZXWC 1MSDA 3JARB 4GKJB 1SQQH 2YDEA 4YIPA 2F43G 1PM9A 5C8YA 2ZE8A 5DECA 2JEUA 3FD9A 2Q5ZA 3E22B 1FD9A 4DV7B 1H38A 1ZL8A 3AG3C 1YTFB 1OCZB 5L3FA 1VF7A 2UXCB 1M4UA 5EYPB 4ZOLA 4X88A 5B5EZ 2XAQA 3TJTA 4DR7O 3HPLC 3J7AU 4X66B 5IJ9B 2X6CA 2UXDB 1OCOC 3JATA 3FKSG 3RYCB 4LP8A 4FFBA 4IHJA 4PD4F 2HJDA 4UB6Z 4CS4A 2QKAA 3JAKA 4BWAA 4DR5B 1Y66A 2HR3A 1JJ2U 3CMAV 3LNNA 1PL0A 1Y6XA 4DR6O 5KHHA 5D5QA 4ZI7A 4L8JA 4H37A 4W4LA 2YIBA 1HNWO 1W0JG 3AK1A 4UB8Z 4PDRA 2DN9A 2OCCB 2D3OW 4PA7A 4TV9B 5KHKA 3G6EV 4OGQB 4P30A 5IYCO 4NXNO 1VF6A 2CE4A 4YIOA 1G6UA 1KD1W 1YSCA 3N2GB 1GMGA 5B1NA 5IJ0A 2BTQB 4AHCA 1ZAUA 4ZBMA 1M5IA 3K06A 4O4IB 3SYAA 4AQYO 1WPBA 4JF3A 1IBKB 1XNQO 2UXNA 4FM0A 1KU9A 1QLEC 3CEIA 5CBFA 2M7WA 4RO2A 2YEVB 2OWOA 1W59A 2DJVA 3E8HA 2XAHA 4GZRB 1AILA 2RCVA 1SESA 3ASNC 2PZSA 1NU1H 5K1XA 1VQOV 1N36B 2RN9A 3MHSC 2EIMC 4FLZA 2B9ZA 4DV2B 3E22A 2OIGA 4CH3A 4DW1A 1NTMH 3P3NA 4JI2B 3O65A 4TQDA 3L70H 4F6RA 1FJGB 4R50A 1EBOA 3FX7A 5EYPA 4LF6O 1TUBB 2ZR3A 1GN3A 1IBMB 3A2FA 1K7DA 4O2AA 4DV3O 4I9WA 5IJ9A 5B3SC 2GUZA 4FZ1A 5J2TB 4H44B 2RQ6A 2LJ2A 4DR1B 4FLVA 1W0KG 5LGNA 4FLUA 2F66C 4G28B 1XBLA 2UXXA 3VQYA 2VQEB 4X62O 3B4SA 4LBEC 3MHHC 4U7NA 3CCLV 2R72A 1LR1A 2RMKB 4UVCA 1P4RA 1YF2A 2WLNA 5BY1A 3B8MA 2CH7B 1GM8A 4MTOA 2Q73A 2VRZA 4XDLA 3T1YO 4LFCO 4UVAA 3PN1A 1K9MW 3E83A 3WB0A 1Z2GA 5FNVA 1QU7A 4WFFA 5CA3A 1LNQA 1QCEA 4QPJA 3H9VA 1ZX3A 5J9PC 3BPZA 4O2BB 5LHGA 5H9CA 1AR5A 2FB5A 3ABLC 1N33O 3D8CA 1B6QA 1Y74B 1S0VA 2H3OA 2W0XA 3A8TA 2JS5A 3N2GA 3JSNA 1AI5A 2UXCO 4ZKIA 5B1AC 4O4IA 3CC4V 1FXHA 4X66O 2UXDO 1FAFA 1SQGA 1NT2B 1SQVH 1XUQA 2VWKA 4DUYB 2YEVA 4NKGB 1BCCH 5B1OA 4MT8A 3QG5A 1W2BU 3CCVV 2QWPB 4BAYA 3AG2C 4FLXA 4DK1A 3VQWA 4LH6A 2OTJV 1FFXB 4DR4B 3K57A 3BEHA 2RJZA 3IJ4A 2P67A 4G27B 4HYOA 4UFZA 3JD0A 1AJPA 1VEWA 2LFSA 2HKOA 5LP6C 2P7TC 4NR1A 2ODMA 4UCOA 2EJRA 2LQTA 1NI8A 1RSOA 5CB4B 1FPOA 5IY5C 1TUBA 5LXTA 4W4KA 5FPRA 1GO3F 1NZ6A 4MVOA 3CJHA 4LWSB 4MVUA 3ZMSA 4JTAB 3BHPA 5J2TA 4B3MB 3HKBB 2HLDG 1IBKO 2XT9A 2WLIB 2QA4V 1M57C 3FB6C 1IDSA 4JYBA 4OXSA 1S72V 1K4CC 2CAZC 4QIWF 3AG1C 4O4JB 4MW8A 2CGNA 3CRCA 3IFXA 2A9HA 3WFVA 1J5EB 3OD4A 4JTDB 4NXMO 4JPRA 1QR9A 3AG3B 4AI8A 1BHBA 4Q20A 1PL4A 4J9ZB 1KYOF 4MVRA 3ETGA 4JI2O 2VQFB 1PNKA 1WP7A 1WN7A 1O9HA 1FJGO 3TGUH 4LF4B 4KHPO 1OCOB 2ZT9B 3C3SA 2EZOA 4WF9V 1JA8A 4OPHA 1YHQV 3P32A 3APQA 3ZCCA 4J11A 3T4DA 3X2QB 1VIBA 2IH3C 2Y0IA 3JALA 1I94B 3AEIA 1YEWA 4BIOA 3W7TA 5GONB 3DGEA 5JVDB 2X0LA 3KCXA 2IU3A 2ZDIC 4FVMA 2QSAA 2Q6AA 4RUEA 1FYJA 2KQXA 3OTOO 1JFFA 4K8ZA 5LA6B 4UCSA 5KAFZ 1YDXA 1Y4MA 2YI8A 3ABUA 3TK1A 2HP8A 1H2NA 3B2EE 1M56C 2UU9B 2ZM6B 1NTZH 4I55B 1AVMA 5CB4A 2XTAA 1N32B 2QJ1A 3ZHSA 2M6YA 1WA8B 2YIDA 5BMVB 4JV5O 1VQPV 1I5YA 4WFGA 3HKBA 4MTGA 2UUAO 1T5EA 3ASNB 1VQ9V 2OTLV 3OUSA 2IJJA 4ZHQB 1QHTA 1AI6A 3SJBC 4D7SA 1DTOA 1BS3A 2JGUA 1ZUQA 2GBOA 2EIMB 3ZHQA 3E89A 1FKAO 4FJCC 2JIZG 3CC7V 3L74H 2F4VB 3ABKC 4JAUA 1BMFG 3U10A 2D2CB 4RQEA 2Y4TA 2JVDA 1VP7A 2Q0AA 1KB9F 2YIAA 1GM7A 2QKCA 3VBBA 4JGSA 2F93B 3BY6A 3ZHUA 4JASA 3UO2A 1JX9A 2QE7G 5B3SB 5D5PA 3G67A 2A06H 2HVKC 2A79B 1YVWA 4Z2WA 2Z5UA 1RM1B 1ZL8B 1MNGA 1HP8A 2QGNA 4B3MO 2ITDC 5A2QN 5FPOA 5GONA 4RQFA 4PV1B 2GSMB 2GTSA 3U0ZA 1BQZA 3JATB 1S5LZ 3A0RA 5L3CA 4X65O 1XQ8A 4IHJB 4J42A 4PJ0Z 1MZEA 1GN2A 3JAKB 4LF9O 4DRXB 4YY3B 1GRJA 4BIZA 4WFHA 2EILC 1EN6A 3AG4C 4ZI7B 1IBLO 2DWDC 1WJZA 1JJOA 1G1XB 4JI3O 3CRQA 1SERA 5B1AB 3K9AA 3JAMN 2NNUA 4DV5B 5B66Z 1MMMA 2ZE7A 3JCUZ 3FB7C 3DC5A 3G6BA 2EBOA 4X1IB 1MA1A 4FZ0A 5CBHA 3CCMV 5IJ0B 2WSSG 4N23A 3EFFK 1I94O 1ENVA 3T1HB 1AP5A 4LF8O 1IVSA 1K34A 1Q43A 2X7RB 5JCOC 3CHXA 5L3EA 2ZD9A 2DW4A 4DV1O 4DUZB 1QVFU 4IL6Z 1X4TA 5IYZB 3RWRD 5LP6B 2E75B 4J7JA 4JAVA 3S3XA 5C93A 2UUCB 4LR3A 1BHAA 3STZC 2F1MA 1PP9H 4IT5A 3E8GA 3I5DA 2AHZA 4J9YB 1FS0G 4CC5A 3H1IH 2AZ2A 2JJ2G 1MOFA 5K1PA 5IY5B 2EINC 4QJFB 1KBHA 2CK3G 4MVQA 4I9QA 4FIPC 5DEDA 5JJEB 3KZIZ 5EIBD 2CGOA 4LC1A 3ZHVA 1S3JA 5LHHA 1NJIW 3ICXA 4F6RB 3K5LA 4LFBO 4UVBA 4CC6A 3K0DA 1DK1A 4B3TO 1CEZA 2IJKA 1AB3A 3AG1B 4JI4O 4X64O 3W7UA 4J10A 4UCVA 1V55C 4O2AB 3K59A 5LL6Y 2LGQA 4PA4A 4FLWA 2GUZB 4B7EA 4C7UA 3OGCC 3FB8C 1D2DA 5TISZ 1NVPD 3RBZA 5KA5A 5B1BC 4B3RO 5KMGB 1R6KA 4CH4A 2QWOB 2W0FC 3HB3B 2E74B 3ZN1A 4DRXA 1HR0O 1K5QA 4B3SB 4OX9O 2OIEA 1XMOB 2LW1A 4CZZA 2QKSA 2N04A 3GVMA 3E8BA 3JCZA 1BSMA 5FNVB 2UUBO 1N34B 4J7KA 3RVZA 1FFTB 4YJ3B 4G2KA 1HNXB 2R9AA 2Q67A 4LFAO 3OM3B 5BXZA 4H0LB 4X1IA 4R8CA 3CPWU 2WLJA 1P7BA 2YUAA 3K08A 1G8MA 1WP8A 1B3QA 1AJQA 3SJQC 1JVMA 2JK5C 1Q5OA 3BRCA 3TETA 2R9RB 1VMGA 4HBNA 2NLJC 5IYZA 5LP6A 2YICA 4PA3A 2GV9A 4Z1MG 4DV4B 3VQVA 2AXTZ 2UXBO 1M56B 2DYSC 3B77A 2F95B 1JPXA 2ZE5A 2QR4A 1Q81W 2Q7HA 3F5TA 3RW0A 2IU0A 2JS3A 4L87A 2CTWA 3OEEG 3RT3C 2LP7A 5L3BA 4LF5O 2Q68A 4A5UB 3IAYA 2IW5A 1AROP 4U7OA 2XNDG 5LMUO 4YHHB 4I50A 4LH7A 4LNUA 5ITZA 4CS2A 3RFRA 1RSOB 3R65A 2XHBA 2BSKA 4P2ZA 1PNMA 5LXTB 5IT9N 3OE7G 4MTXA 3K04A 2B1IA 3CJHB 1PNLA 2B5UA 3ABMC 3T1HO 1X59A 1P49A 4NTXA 5LYJA 4DR2O 3OMAB 1BE3H 3ETEA 5GTHZ 3ABKB 2RDCA 1R3JC 1BT8A 3ZJZA 2ZIMA 5CA1A 2PYJA 1VF5B 3G4SV 1LUWA 3H1KH 5KMGA 3CX5F 3W7XA 1M9NA 4JI1O 2HHHO 2ILMA 5LMNO 4NYKA 1AR1B 3SGIA 3H1JH 4XDJA 3CCEV 3QF7A 1EN4A 4HZ3A 3A0HZ 2YS8A 1JOYA 2LO1A 1XOUA 3LSSA 3C90A 1K8AW 1OCRC 4BW5A 4GKJO 1R6TA 3JD4A 1TAEA 2BTOA 5JJNB 4K0KB 3VQXA 4YJ3A 1M90W 3CP1A 1OCCC 4DV7O 4TV8A 3K5NA 3E8FA 3P30A 3IGAC 4X8AA 3K5MA 4HAMA 4MTFA 5A9GA 2ZDIA 1SC5B 3DXRA 2FKXA 2WPDG 1TGOA 2VS0A 3BA9A 3JASB 5FL7G 3HKCA 5IWAB 2P4KA 3TXQA 3JALB 2OYQA 5DM6V 1K73W 3GWOA 4JI8B 1G4YB 2EILB 3AG4B 2Q69A 2Z0AA 1R3IC 4DR5O 4DV6B 1AP6A 1XMOO 4UXNA 1JFFB 4XDKA 2JEXA 3CE2A 3FB5C 3UQ8A 4FM1A 5J2UB 5L3DA 1N4CA 1R73A 1SS3A 1VQMV 4QGPA 3ETQA 1KKDA 4I7ZB 1XI1A 3LSUA 4UV8A 1QR8A 3JD1A 4PDLA 2DYRC 3K9SA 3SJCC 4FK5C 4QNHB 2CUGA 4JAAA 1HNXO 4ZIBA 3OEHG 1HNZB 3LDCA 4NTYA 1N0JA 1Q6UA 1Y67A 5LHIA 3CD6V 3BAAA 3VOUA 4X9QA 4MSWC 3UT5A 5CA0A 3ZN0A 3L75H 3MD0A 1YI2V 3ZMUA 4ABMA 3ZEDA 3HKEB 1QNMA 4DV0B 4PA9A 4J41A 2E5LB 2ZXWB 2EINB 1E1RG 2YXHA 4K35A 3T2MA 2PY5A 3SYQA 1I7FA 2YI9A 5GTIZ 2XAFA 5BZBA 3FYEB 4WFAV 1N36O 1S77D 5LGUA 1AR4A 1AJNA 5EK0A 4DV2O 2QEXV 2LGWA 4F4LA 2C2AA 3SYCA 3K03A 1V55B 4EKWA 3RVYA 4P9PA 2KKWA 1VQ8V 1GAXA 1XNRB 2F23A 1IBMO 3CCQV 1WB7A 3JASA 3BVOA 1TVKA 1K5SA 2H8PC 3CXCU 4LF7B 4DR1O 4IYIA 3ZHRA 3I56V 3HKDA 1ZWIC 2KG7A 3IC9A 3STLC 4I0XA 3F7YC 3W7WA 2E3CA 4B7KA 3CCRV 5E79Z 4JYYA 4TUYA 3LSQA 2VQEO 1KP2A 4FFKA 5EIBC 1DGSA 2AGAA 4JI7B 3APOA 3R66A 5J2UA 2N05A 1N8RW 1SA0A 1NH2B 3N27A 3LDDA 1OV9A 1VQLV 2DOSA 3ZMTA 3TXSA 2N74A 3ZRXA 1F4MA 2WLHA 4BR6A 5EZYB 4D7TA 3D36A 2ZR2A 1S5JA 1EFRG 4PA6A 4U3JA 4E2LA 2ZKOA 5JCOA 4BIUA 1DF4A 2EIKC 5EBWC 3ZRVA 3B8NA 2IM9A 4GX1A 1NKDA 2ZE6A 2DQ3A 4K8XA 1QLEB 1H2MA 4HNAB 1VQ7V 3RYFB 4R7CA 3SYOA 3OR6C 2DYSB 1H2GA 3HKEA 1NQTA 3BABA 5LOVA 4DUYO 4JI8O 5EBLC 4MS2A 1I5XA 3CCSV 3NR7A 3QNEA 4IYHA 1SF9A 2P6JA 4DV6O 1XMQB 1RPOA 1COWG 4KL1A 4DR7B 4DR4O 2L6LA 4EB6A 5JJJB 1Q86W 1MSWD 3H01A 5BR8B 2WLLA 2WLKA 2BOBC 3OTFA 2Y69C 4FMTA 5H6RA 2E76B 1R1BA 1R3KC 3K0GA 3M8AA 3DC6A 4ASUG 4N21A 2EIJC 2YIBD 3ML0A 3ZX6A 3ABMB 4B08A 1HNZO 4X89A 5L3GA 3AK2A 3OW2U 2ADQB 1VQNV 3DTUB 2MK3A 3QTCA 4TT3G 2FTKA 3J80N 2P06A 4DR6B 3CRAA 2PF4E 5F2VO 2K1EA 1US6A 1YCIA 1NR1A 3E86A 1YZBA 4K3AA 2AZ0A 1URFA 1L8DA 2VWJA 3T1CA 1XILA 1GH6A 3ZHTA 2JGDA 3RYIB 4I4TB 2YXYA 4NXNB 1OCRB 2L35A 1V9PA 2PTMA 2XAJA 4PHZA 3NXSA 1J5EO 1IXMA 3A0BZ 3CWBH 1OCCB 3ABLB 1R3LC 3B09A 4PDMA 4AQYB 4RUFA 1P84F 2Z3YA 5EZYA 2DQ0A 2GDSA 3C3TA 2HG5C 4GX0A 1JR9A 3LNMB 2VQFO 4LF4O 4EFBA 1Q90D 1FXKC 2R9IA 2Q4PA 1MZFA 5KX5B 4HNAA 3RYFA 3K79A 1YTFD 5KHGA 1TA8A 2WAMA 1UJWB 3D36C 3AG2B 3KG2A 4KXRA 3ABTA 3W7SA 1H8HG 2FYUH 1EM1A 4WFBV 1YITV 5JQGA 3OUFA 4CBCA 4YJ2A 4LF6B 1M93A 4NTWA 3WG7C 2DYRB 4GYCB 4DV3B 2W6IG 2BE3A 5IDJA 1I0HA 1MG1A 2JJ1G 2WA4A 4PELA 1CP9A 2UU9O 1IXBA 1DF5A 2ZM6O 3ZS8C 1YJWV 5KAIZ 4GX2A 4UCRA 4WBNA 3L73H 4R6ZA 1N32O 4BW9A 2HEPA 5KLVH 3FFQA 4I50B 1BZKA 4LNUB 4LFCB 3T1YB 1H2KA 5ITZB 1M57B 3EVKA 5H6QA 2BSKB 1OHHG 2HVJC 1VQKV 4DW0A 3B40A 3KCYA 5LYJB 3RYIA 4I4TA
chains in the Genus database with same CATH topology
1N33O 4JI1O 2HHHO 5LMNO 4AQYO 1N34O 2UUBO 4NXMO 2ZKOA 1XNQO 1XMQO 4DR3O 1I94O 4DV0O 2UXCO 4JI0O 1FKAO 4LF8O 4OPAA 2JRIA 2F4VO 4LFAO 2E5LO 5BXZA 4JI2O 2DJVA 2VQFO 4X66O 4GKJO 5BR8O 1R6TA 4LF4O 2UXDO 1FJGO 4DUZO 4DV1O 4K0KO 1AILA 4KHPO 4JI5O 2UUCO 4DUYO 4DV7O 4JI8O 4OPHA 1N36O 4GKKO 4DV6O 1A32A 2FKXA 4DV2O 4DR7O 4DV4O 3J7AU 4DR4O 2UXBO 3O65A 5IWAO 4B3MO 1FYJA 1XNRO 4LF6O 1R1BA 3OTOO 1IBMO 3M8AA 5A2QN 2LW7A 3F5TA 1KUQA 4DV3O 4JI6O 1HNZO 3SDLA 2Z0AA 5FLXN 4DR5O 4LF7O 4LFBO 4DR1O 3RT3C 4JYAO 4X65O 1XMOO 1DK1A 1NS1A 4B3TO 4LF5O 4A5UB 3J80N 4DR6O 1AB3A 5H5NA 4X64O 4JI4O 3J81N 2UU9O 4YHHO 5LMUO 2ZM6O 5LL6Y 1HNWO 2VQEO 4LF9O 1YZBA 4X62O 4YY3O 1IBKO 1N32O 1D2DA 5IT9N 2AGAA 5BY1A 4JI7O 4B3RO 1IBLO 3R66A 3T1HO 3T1YO 4LFCO 1G1XB 1X59A 1HNXO 4JI3O 4DR2O 2DOSA 4NXNO 4JV5O 4B3SO 4DV5O 1HR0O 3JAMN 4OX9O 2N74A 2UUAO 1F7YA 1XEQA 1J5EO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 O;  4JI1 O;  2HHH O;  5LMN O;  4AQY O;  1N34 O;  2UUB O;  4NXM O;  2ZKO A;  1XNQ O;  1XMQ O;  4DR3 O;  1I94 O;  4DV0 O;  2UXC O;  4JI0 O;  1FKA O;  4LF8 O;  4OPA A;  2JRI A;  2F4V O;  4LFA O;  2E5L O;  5BXZ A;  4JI2 O;  2DJV A;  2VQF O;  4X66 O;  4GKJ O;  5BR8 O;  1R6T A;  4LF4 O;  2UXD O;  1FJG O;  4DUZ O;  4DV1 O;  4K0K O;  1AIL A;  4KHP O;  4JI5 O;  2UUC O;  4DUY O;  4DV7 O;  4JI8 O;  4OPH A;  1N36 O;  4GKK O;  4DV6 O;  1A32 A;  2FKX A;  4DV2 O;  4DR7 O;  4DV4 O;  3J7A U;  4DR4 O;  2UXB O;  3O65 A;  5IWA O;  4B3M O;  1FYJ A;  1XNR O;  4LF6 O;  1R1B A;  3OTO O;  1IBM O;  3M8A A;  5A2Q N;  2LW7 A;  3F5T A;  1KUQ A;  4DV3 O;  4JI6 O;  1HNZ O;  3SDL A;  2Z0A A;  5FLX N;  4DR5 O;  4LF7 O;  4LFB O;  4DR1 O;  3RT3 C;  4JYA O;  4X65 O;  1XMO O;  1DK1 A;  1NS1 A;  4B3T O;  4LF5 O;  4A5U B;  3J80 N;  4DR6 O;  1AB3 A;  5H5N A;  4X64 O;  4JI4 O;  3J81 N;  2UU9 O;  4YHH O;  5LMU O;  2ZM6 O;  5LL6 Y;  1HNW O;  2VQE O;  4LF9 O;  1YZB A;  4X62 O;  4YY3 O;  1IBK O;  1N32 O;  1D2D A;  5IT9 N;  2AGA A;  5BY1 A;  4JI7 O;  4B3R O;  1IBL O;  3R66 A;  3T1H O;  3T1Y O;  4LFC O;  1G1X B;  1X59 A;  1HNX O;  4JI3 O;  4DR2 O;  2DOS A;  4NXN O;  4JV5 O;  4B3S O;  4DV5 O;  1HR0 O;  3JAM N;  4OX9 O;  2N74 A;  2UUA O;  1F7Y A;  1XEQ A;  1J5E O; 
#chains in the Genus database with same CATH topology
 1N33 B;  3ZIA G;  2ADP A;  5CA1 B;  1XRE A;  4TWK A;  5GW7 A;  1XMQ O;  3G80 A;  3L71 H;  1GN6 A;  2F4V O;  3MDS A;  2HJF C;  3E2E A;  4X20 B;  5BR8 O;  3SR2 C;  1SQB H;  2Q8V A;  1KEC A;  5HFL A;  1H8E G;  1QQC A;  1GTO A;  5CBG A;  4DYL A;  1XHX A;  3X2Q C;  5IYD O;  2OT5 A;  1VQ5 V;  2HFE C;  4TOI A;  3O9O A;  4DR3 B;  2Y0P A;  3QO5 A;  4TV8 B;  5KX5 A;  2EUL A;  4TSF G;  3DXR B;  4LCU C;  2X6B A;  5HFM A;  1JMK C;  3QO8 A;  1K97 A;  2YC0 A;  3HKC B;  5FLX N;  1U97 A;  3FAV B;  3JAW A;  2YXL A;  4KUM A;  5H5N A;  1IZ3 A;  3J81 N;  4J7Z A;  3L9D A;  2K9P A;  2P5O A;  4IGG A;  3FYI B;  2CTQ A;  1B06 A;  3UM7 A;  4PI0 A;  4YY3 O;  1EZV H;  4CH6 A;  4P9O A;  4F6E A;  2EIK B;  1Q7Y W;  1NVP B;  1Z5V A;  2ARH A;  2ZCE A;  3CXH F;  3BFR A;  1H2S B;  1RPR A;  4IIJ B;  4JI6 B;  4DV5 O;  4JYA B;  2XAG A;  1AI4 A;  1NR7 A;  3ZRW A;  5EC1 C;  1F7Y A;  4KP4 A;  4TQF A;  2X6A A;  1F4N A;  2JDI G;  3N2K B;  3ZMZ A;  3JAR A;  4NXM B;  1FXV A;  3P3P A;  1AI7 A;  1JCH A;  2CTR A;  3CSX A;  3LDE A;  4E4E A;  1YJN V;  3E35 A;  3UT5 B;  5CA0 B;  5KUM A;  4XBF A;  4MVM A;  4DUZ O;  3OFN G;  2PGG A;  4CH5 A;  4KHP B;  2A0L A;  1ZLZ A;  2Y69 B;  3GB7 C;  1RP3 B;  2KSD A;  3CB2 A;  2UUC O;  2IJI A;  2EIJ B;  4X20 A;  1V54 C;  2NR5 A;  4JYC A;  2Y48 A;  2V7Q G;  1ROP A;  3ZMV A;  4JI0 B;  3OGI B;  3RYC A;  3THO A;  1RM1 C;  2YSU B;  1H2L A;  4UV9 A;  3D3Q A;  4KFM A;  3WB1 A;  3LUT B;  3RYH B;  5JH7 B;  2R70 A;  2P22 C;  5IYB O;  1ORQ C;  4X1Y B;  1SQP H;  3TCU A;  4DK0 A;  2EZP A;  4FLY A;  3OTO B;  4WFE A;  2B1G A;  1N0N A;  1KUQ A;  4JZG A;  2GTA A;  3I55 V;  4GKK B;  2WA3 A;  3K3W A;  1WNS A;  5CMU A;  3JD2 A;  1NBM G;  2KB1 A;  2QM8 A;  5DN6 G;  4TV9 A;  1PKX A;  4MVS A;  2PI4 A;  1TVK B;  4O4H B;  3FAV A;  4QE9 A;  2WWW A;  4JTC B;  1YIJ V;  3HKD B;  2KG7 B;  2MW2 B;  5AG2 A;  4I0X B;  2NN4 A;  2BTQ A;  5IE9 A;  4TUY B;  2XUM A;  4B3S O;  4JV5 B;  1TUE B;  1M1K W;  1D5N A;  4EFE A;  2UUA B;  4RAI A;  1FXK B;  4GT1 A;  4QPK A;  5EC2 C;  3ZRS A;  2ATK C;  1SA0 B;  4IIJ A;  4WCE V;  2QWQ B;  1VF6 C;  1XHZ A;  1N34 O;  3ASO C;  4DO2 A;  2OCH A;  1SZT A;  4DR3 O;  3CCJ V;  1K4D C;  5LGT A;  1J95 A;  2PYL A;  2GHY A;  4U3J B;  2FML A;  3N2K A;  5KHI A;  1HDJ A;  3U11 A;  4JZ2 A;  3WU2 Z;  3Q4H B;  2IBZ H;  3WG7 B;  1L0L H;  1ZSP A;  3BA8 A;  1XDC A;  1Z5W A;  4H13 B;  1S76 D;  1QLN A;  5LOV B;  4DV4 O;  4GLX A;  4PI2 A;  3S3W A;  1SQX H;  2IJH A;  1Y76 B;  3MAQ A;  4GCZ A;  5E1A C;  2W6J G;  1RFY A;  3D3I A;  4JI5 B;  4Z1V A;  1Q82 W;  4CS3 A;  4EB6 B;  3CS5 A;  2Q9L A;  2ZIN A;  5JH7 A;  3RYH A;  1OCZ C;  1NH2 D;  4JI6 O;  2WLL B;  2BOC C;  2DWE C;  1OZ0 A;  2ZQM A;  4X1Y A;  4JYA O;  4X65 B;  3PJS K;  3CRM A;  1BGY H;  3G71 V;  2CH7 A;  4YHH O;  2A3Q A;  1JQ0 A;  5H2F Z;  1K3E A;  4LF9 B;  3EXA A;  1L0N H;  3K5O A;  2EX3 A;  3OAA G;  4H33 A;  5B1B B;  1IBL B;  1B04 A;  1GM9 A;  1ZTE A;  3CME V;  4O2B A;  3H1H H;  4JI3 B;  4O4H A;  1SQF A;  1MAB G;  4UUJ C;  1PPJ H;  1Y74 A;  1PV0 A;  2IH1 C;  4X1K B;  4DXW A;  3JYC A;  1YXB A;  1WB8 A;  2DMX A;  3GWK C;  1XEQ A;  5LBQ A;  2JGD B;  2CTP A;  3HR0 A;  4ICG A;  1O9G A;  4O4L B;  4Q6G A;  4GUN A;  2OCC C;  4MVZ A;  1Q8I A;  1FXK A;  4JI0 O;  4LF8 B;  2JRI A;  2Q7G A;  2Q0O C;  1S5H C;  4K0K O;  4DV1 B;  4I5S A;  1KC8 W;  2CDY A;  4EEQ A;  2QM7 A;  3BCC H;  1XL4 A;  1L1F A;  1U96 A;  1GKF A;  1OJH A;  1FFX A;  3CRR A;  3AG7 A;  1BL8 A;  2V4D A;  4GKK O;  1A32 A;  1GN4 A;  3QO7 A;  2O57 A;  3Q4H A;  5IWA O;  1KKC A;  1WAZ A;  1SZX A;  2P90 A;  1E1Q G;  2Q7E A;  1VAR A;  1Q6H A;  2XAS A;  4LWS A;  5EBM C;  3QVN A;  1Y76 A;  3SDL A;  5JQG B;  1NTK H;  5KUK A;  2WLM A;  3T4Z A;  4LFB B;  1THZ A;  1UFI A;  4YJ2 B;  4FM2 A;  1HWY A;  4B3T B;  4U3F H;  3CC2 V;  2ZNJ A;  2WLI A;  4JI4 B;  4X64 B;  1UPG A;  1QBZ A;  4MW3 A;  4FLT A;  2PI5 A;  1QVG U;  3SPI A;  4O4J A;  2BCC H;  1SET A;  4B3R B;  4FPP A;  3UO3 A;  2FL4 A;  4WBN B;  3ETD A;  3OR7 C;  1HR0 B;  4OX9 B;  3CYO A;  2QWR B;  1F23 A;  1KMI Z;  1DLB A;  1PD3 A;  4AIL C;  2A7W A;  1HNW B;  2LFR A;  1K92 A;  2AHY A;  2UUB B;  4X1K A;  3M99 B;  1V54 B;  5C8Y B;  1I08 A;  3SPH A;  4DV0 O;  1EZJ A;  1SRY A;  3SPG A;  2DE0 X;  5CN0 A;  4GX5 A;  4NVP A;  4O4L A;  2E5L O;  4LFA B;  3F7V C;  1GK9 A;  4YXW G;  3UCS C;  1WPX A;  1EN5 A;  3IC7 A;  4JI5 O;  1K33 A;  4ZOL B;  3SPJ A;  1Q6I A;  2V1D A;  4UCU A;  3EHB B;  1F51 A;  5JVD A;  1XNQ B;  3JD3 A;  2ETN A;  1IX9 A;  1CXZ B;  1Q3E A;  4FFB B;  5LA6 A;  2EJ7 A;  2UXB B;  1R6N A;  1WLE A;  1VQ6 V;  3OT7 A;  5KA6 A;  1XNR O;  3SYP A;  2LW7 A;  3UKM A;  2PUS A;  1VQ4 V;  3JSL A;  2QM4 A;  4LF7 O;  1P7G A;  4I55 A;  2QTO A;  3F5W C;  1NS1 A;  4D6T H;  1SKV A;  4LF5 B;  1E79 G;  3CCU V;  2ZNI A;  2H94 A;  2ITC C;  4J80 A;  5KHJ A;  4UCT A;  5LMU B;  3RGB A;  1BQ0 A;  2P4V A;  1IUR A;  3OMN B;  1WA8 A;  5BMV A;  3WB2 A;  1KP3 A;  3JAW B;  4PDV A;  2G38 A;  3ASO B;  3K58 A;  4JI7 O;  1CPY A;  1HW7 A;  3DSQ A;  3H1L H;  4NB5 A;  4DR2 B;  4ZHQ A;  1YJ9 V;  3KKY A;  2QWN B;  5JWP A;  4RWU A;  2ZIO A;  3SJA C;  1XL6 A;  4X62 B;  4JI1 B;  2HHH B;  3SPC A;  5LMN B;  2AW9 A;  4QE7 A;  2QDO A;  1LUV A;  1KQS U;  3ZRW B;  2XOK G;  3L72 H;  3RN4 A;  3AK3 A;  2QTS A;  3M7M X;  4OPA A;  3ZBH A;  1D5A A;  2RNB A;  2Y4U A;  3OMI B;  2ZXW C;  1MSD A;  3JAR B;  4GKJ B;  1SQQ H;  2YDE A;  4YIP A;  2F43 G;  1PM9 A;  5C8Y A;  2ZE8 A;  5DEC A;  2JEU A;  3FD9 A;  2Q5Z A;  3E22 B;  1FD9 A;  4DV7 B;  1H38 A;  1ZL8 A;  3AG3 C;  1YTF B;  1OCZ B;  5L3F A;  1VF7 A;  2UXC B;  1M4U A;  5EYP B;  4ZOL A;  4X88 A;  5B5E Z;  2XAQ A;  3TJT A;  4DR7 O;  3HPL C;  3J7A U;  4X66 B;  5IJ9 B;  2X6C A;  2UXD B;  1OCO C;  3JAT A;  3FKS G;  3RYC B;  4LP8 A;  4FFB A;  4IHJ A;  4PD4 F;  2HJD A;  4UB6 Z;  4CS4 A;  2QKA A;  3JAK A;  4BWA A;  4DR5 B;  1Y66 A;  2HR3 A;  1JJ2 U;  3CMA V;  3LNN A;  1PL0 A;  1Y6X A;  4DR6 O;  5KHH A;  5D5Q A;  4ZI7 A;  4L8J A;  4H37 A;  4W4L A;  2YIB A;  1HNW O;  1W0J G;  3AK1 A;  4UB8 Z;  4PDR A;  2DN9 A;  2OCC B;  2D3O W;  4PA7 A;  4TV9 B;  5KHK A;  3G6E V;  4OGQ B;  4P30 A;  5IYC O;  4NXN O;  1VF6 A;  2CE4 A;  4YIO A;  1G6U A;  1KD1 W;  1YSC A;  3N2G B;  1GMG A;  5B1N A;  5IJ0 A;  2BTQ B;  4AHC A;  1ZAU A;  4ZBM A;  1M5I A;  3K06 A;  4O4I B;  3SYA A;  4AQY O;  1WPB A;  4JF3 A;  1IBK B;  1XNQ O;  2UXN A;  4FM0 A;  1KU9 A;  1QLE C;  3CEI A;  5CBF A;  2M7W A;  4RO2 A;  2YEV B;  2OWO A;  1W59 A;  2DJV A;  3E8H A;  2XAH A;  4GZR B;  1AIL A;  2RCV A;  1SES A;  3ASN C;  2PZS A;  1NU1 H;  5K1X A;  1VQO V;  1N36 B;  2RN9 A;  3MHS C;  2EIM C;  4FLZ A;  2B9Z A;  4DV2 B;  3E22 A;  2OIG A;  4CH3 A;  4DW1 A;  1NTM H;  3P3N A;  4JI2 B;  3O65 A;  4TQD A;  3L70 H;  4F6R A;  1FJG B;  4R50 A;  1EBO A;  3FX7 A;  5EYP A;  4LF6 O;  1TUB B;  2ZR3 A;  1GN3 A;  1IBM B;  3A2F A;  1K7D A;  4O2A A;  4DV3 O;  4I9W A;  5IJ9 A;  5B3S C;  2GUZ A;  4FZ1 A;  5J2T B;  4H44 B;  2RQ6 A;  2LJ2 A;  4DR1 B;  4FLV A;  1W0K G;  5LGN A;  4FLU A;  2F66 C;  4G28 B;  1XBL A;  2UXX A;  3VQY A;  2VQE B;  4X62 O;  3B4S A;  4LBE C;  3MHH C;  4U7N A;  3CCL V;  2R72 A;  1LR1 A;  2RMK B;  4UVC A;  1P4R A;  1YF2 A;  2WLN A;  5BY1 A;  3B8M A;  2CH7 B;  1GM8 A;  4MTO A;  2Q73 A;  2VRZ A;  4XDL A;  3T1Y O;  4LFC O;  4UVA A;  3PN1 A;  1K9M W;  3E83 A;  3WB0 A;  1Z2G A;  5FNV A;  1QU7 A;  4WFF A;  5CA3 A;  1LNQ A;  1QCE A;  4QPJ A;  3H9V A;  1ZX3 A;  5J9P C;  3BPZ A;  4O2B B;  5LHG A;  5H9C A;  1AR5 A;  2FB5 A;  3ABL C;  1N33 O;  3D8C A;  1B6Q A;  1Y74 B;  1S0V A;  2H3O A;  2W0X A;  3A8T A;  2JS5 A;  3N2G A;  3JSN A;  1AI5 A;  2UXC O;  4ZKI A;  5B1A C;  4O4I A;  3CC4 V;  1FXH A;  4X66 O;  2UXD O;  1FAF A;  1SQG A;  1NT2 B;  1SQV H;  1XUQ A;  2VWK A;  4DUY B;  2YEV A;  4NKG B;  1BCC H;  5B1O A;  4MT8 A;  3QG5 A;  1W2B U;  3CCV V;  2QWP B;  4BAY A;  3AG2 C;  4FLX A;  4DK1 A;  3VQW A;  4LH6 A;  2OTJ V;  1FFX B;  4DR4 B;  3K57 A;  3BEH A;  2RJZ A;  3IJ4 A;  2P67 A;  4G27 B;  4HYO A;  4UFZ A;  3JD0 A;  1AJP A;  1VEW A;  2LFS A;  2HKO A;  5LP6 C;  2P7T C;  4NR1 A;  2ODM A;  4UCO A;  2EJR A;  2LQT A;  1NI8 A;  1RSO A;  5CB4 B;  1FPO A;  5IY5 C;  1TUB A;  5LXT A;  4W4K A;  5FPR A;  1GO3 F;  1NZ6 A;  4MVO A;  3CJH A;  4LWS B;  4MVU A;  3ZMS A;  4JTA B;  3BHP A;  5J2T A;  4B3M B;  3HKB B;  2HLD G;  1IBK O;  2XT9 A;  2WLI B;  2QA4 V;  1M57 C;  3FB6 C;  1IDS A;  4JYB A;  4OXS A;  1S72 V;  1K4C C;  2CAZ C;  4QIW F;  3AG1 C;  4O4J B;  4MW8 A;  2CGN A;  3CRC A;  3IFX A;  2A9H A;  3WFV A;  1J5E B;  3OD4 A;  4JTD B;  4NXM O;  4JPR A;  1QR9 A;  3AG3 B;  4AI8 A;  1BHB A;  4Q20 A;  1PL4 A;  4J9Z B;  1KYO F;  4MVR A;  3ETG A;  4JI2 O;  2VQF B;  1PNK A;  1WP7 A;  1WN7 A;  1O9H A;  1FJG O;  3TGU H;  4LF4 B;  4KHP O;  1OCO B;  2ZT9 B;  3C3S A;  2EZO A;  4WF9 V;  1JA8 A;  4OPH A;  1YHQ V;  3P32 A;  3APQ A;  3ZCC A;  4J11 A;  3T4D A;  3X2Q B;  1VIB A;  2IH3 C;  2Y0I A;  3JAL A;  1I94 B;  3AEI A;  1YEW A;  4BIO A;  3W7T A;  5GON B;  3DGE A;  5JVD B;  2X0L A;  3KCX A;  2IU3 A;  2ZDI C;  4FVM A;  2QSA A;  2Q6A A;  4RUE A;  1FYJ A;  2KQX A;  3OTO O;  1JFF A;  4K8Z A;  5LA6 B;  4UCS A;  5KAF Z;  1YDX A;  1Y4M A;  2YI8 A;  3ABU A;  3TK1 A;  2HP8 A;  1H2N A;  3B2E E;  1M56 C;  2UU9 B;  2ZM6 B;  1NTZ H;  4I55 B;  1AVM A;  5CB4 A;  2XTA A;  1N32 B;  2QJ1 A;  3ZHS A;  2M6Y A;  1WA8 B;  2YID A;  5BMV B;  4JV5 O;  1VQP V;  1I5Y A;  4WFG A;  3HKB A;  4MTG A;  2UUA O;  1T5E A;  3ASN B;  1VQ9 V;  2OTL V;  3OUS A;  2IJJ A;  4ZHQ B;  1QHT A;  1AI6 A;  3SJB C;  4D7S A;  1DTO A;  1BS3 A;  2JGU A;  1ZUQ A;  2GBO A;  2EIM B;  3ZHQ A;  3E89 A;  1FKA O;  4FJC C;  2JIZ G;  3CC7 V;  3L74 H;  2F4V B;  3ABK C;  4JAU A;  1BMF G;  3U10 A;  2D2C B;  4RQE A;  2Y4T A;  2JVD A;  1VP7 A;  2Q0A A;  1KB9 F;  2YIA A;  1GM7 A;  2QKC A;  3VBB A;  4JGS A;  2F93 B;  3BY6 A;  3ZHU A;  4JAS A;  3UO2 A;  1JX9 A;  2QE7 G;  5B3S B;  5D5P A;  3G67 A;  2A06 H;  2HVK C;  2A79 B;  1YVW A;  4Z2W A;  2Z5U A;  1RM1 B;  1ZL8 B;  1MNG A;  1HP8 A;  2QGN A;  4B3M O;  2ITD C;  5A2Q N;  5FPO A;  5GON A;  4RQF A;  4PV1 B;  2GSM B;  2GTS A;  3U0Z A;  1BQZ A;  3JAT B;  1S5L Z;  3A0R A;  5L3C A;  4X65 O;  1XQ8 A;  4IHJ B;  4J42 A;  4PJ0 Z;  1MZE A;  1GN2 A;  3JAK B;  4LF9 O;  4DRX B;  4YY3 B;  1GRJ A;  4BIZ A;  4WFH A;  2EIL C;  1EN6 A;  3AG4 C;  4ZI7 B;  1IBL O;  2DWD C;  1WJZ A;  1JJO A;  1G1X B;  4JI3 O;  3CRQ A;  1SER A;  5B1A B;  3K9A A;  3JAM N;  2NNU A;  4DV5 B;  5B66 Z;  1MMM A;  2ZE7 A;  3JCU Z;  3FB7 C;  3DC5 A;  3G6B A;  2EBO A;  4X1I B;  1MA1 A;  4FZ0 A;  5CBH A;  3CCM V;  5IJ0 B;  2WSS G;  4N23 A;  3EFF K;  1I94 O;  1ENV A;  3T1H B;  1AP5 A;  4LF8 O;  1IVS A;  1K34 A;  1Q43 A;  2X7R B;  5JCO C;  3CHX A;  5L3E A;  2ZD9 A;  2DW4 A;  4DV1 O;  4DUZ B;  1QVF U;  4IL6 Z;  1X4T A;  5IYZ B;  3RWR D;  5LP6 B;  2E75 B;  4J7J A;  4JAV A;  3S3X A;  5C93 A;  2UUC B;  4LR3 A;  1BHA A;  3STZ C;  2F1M A;  1PP9 H;  4IT5 A;  3E8G A;  3I5D A;  2AHZ A;  4J9Y B;  1FS0 G;  4CC5 A;  3H1I H;  2AZ2 A;  2JJ2 G;  1MOF A;  5K1P A;  5IY5 B;  2EIN C;  4QJF B;  1KBH A;  2CK3 G;  4MVQ A;  4I9Q A;  4FIP C;  5DED A;  5JJE B;  3KZI Z;  5EIB D;  2CGO A;  4LC1 A;  3ZHV A;  1S3J A;  5LHH A;  1NJI W;  3ICX A;  4F6R B;  3K5L A;  4LFB O;  4UVB A;  4CC6 A;  3K0D A;  1DK1 A;  4B3T O;  1CEZ A;  2IJK A;  1AB3 A;  3AG1 B;  4JI4 O;  4X64 O;  3W7U A;  4J10 A;  4UCV A;  1V55 C;  4O2A B;  3K59 A;  5LL6 Y;  2LGQ A;  4PA4 A;  4FLW A;  2GUZ B;  4B7E A;  4C7U A;  3OGC C;  3FB8 C;  1D2D A;  5TIS Z;  1NVP D;  3RBZ A;  5KA5 A;  5B1B C;  4B3R O;  5KMG B;  1R6K A;  4CH4 A;  2QWO B;  2W0F C;  3HB3 B;  2E74 B;  3ZN1 A;  4DRX A;  1HR0 O;  1K5Q A;  4B3S B;  4OX9 O;  2OIE A;  1XMO B;  2LW1 A;  4CZZ A;  2QKS A;  2N04 A;  3GVM A;  3E8B A;  3JCZ A;  1BSM A;  5FNV B;  2UUB O;  1N34 B;  4J7K A;  3RVZ A;  1FFT B;  4YJ3 B;  4G2K A;  1HNX B;  2R9A A;  2Q67 A;  4LFA O;  3OM3 B;  5BXZ A;  4H0L B;  4X1I A;  4R8C A;  3CPW U;  2WLJ A;  1P7B A;  2YUA A;  3K08 A;  1G8M A;  1WP8 A;  1B3Q A;  1AJQ A;  3SJQ C;  1JVM A;  2JK5 C;  1Q5O A;  3BRC A;  3TET A;  2R9R B;  1VMG A;  4HBN A;  2NLJ C;  5IYZ A;  5LP6 A;  2YIC A;  4PA3 A;  2GV9 A;  4Z1M G;  4DV4 B;  3VQV A;  2AXT Z;  2UXB O;  1M56 B;  2DYS C;  3B77 A;  2F95 B;  1JPX A;  2ZE5 A;  2QR4 A;  1Q81 W;  2Q7H A;  3F5T A;  3RW0 A;  2IU0 A;  2JS3 A;  4L87 A;  2CTW A;  3OEE G;  3RT3 C;  2LP7 A;  5L3B A;  4LF5 O;  2Q68 A;  4A5U B;  3IAY A;  2IW5 A;  1ARO P;  4U7O A;  2XND G;  5LMU O;  4YHH B;  4I50 A;  4LH7 A;  4LNU A;  5ITZ A;  4CS2 A;  3RFR A;  1RSO B;  3R65 A;  2XHB A;  2BSK A;  4P2Z A;  1PNM A;  5LXT B;  5IT9 N;  3OE7 G;  4MTX A;  3K04 A;  2B1I A;  3CJH B;  1PNL A;  2B5U A;  3ABM C;  3T1H O;  1X59 A;  1P49 A;  4NTX A;  5LYJ A;  4DR2 O;  3OMA B;  1BE3 H;  3ETE A;  5GTH Z;  3ABK B;  2RDC A;  1R3J C;  1BT8 A;  3ZJZ A;  2ZIM A;  5CA1 A;  2PYJ A;  1VF5 B;  3G4S V;  1LUW A;  3H1K H;  5KMG A;  3CX5 F;  3W7X A;  1M9N A;  4JI1 O;  2HHH O;  2ILM A;  5LMN O;  4NYK A;  1AR1 B;  3SGI A;  3H1J H;  4XDJ A;  3CCE V;  3QF7 A;  1EN4 A;  4HZ3 A;  3A0H Z;  2YS8 A;  1JOY A;  2LO1 A;  1XOU A;  3LSS A;  3C90 A;  1K8A W;  1OCR C;  4BW5 A;  4GKJ O;  1R6T A;  3JD4 A;  1TAE A;  2BTO A;  5JJN B;  4K0K B;  3VQX A;  4YJ3 A;  1M90 W;  3CP1 A;  1OCC C;  4DV7 O;  4TV8 A;  3K5N A;  3E8F A;  3P30 A;  3IGA C;  4X8A A;  3K5M A;  4HAM A;  4MTF A;  5A9G A;  2ZDI A;  1SC5 B;  3DXR A;  2FKX A;  2WPD G;  1TGO A;  2VS0 A;  3BA9 A;  3JAS B;  5FL7 G;  3HKC A;  5IWA B;  2P4K A;  3TXQ A;  3JAL B;  2OYQ A;  5DM6 V;  1K73 W;  3GWO A;  4JI8 B;  1G4Y B;  2EIL B;  3AG4 B;  2Q69 A;  2Z0A A;  1R3I C;  4DR5 O;  4DV6 B;  1AP6 A;  1XMO O;  4UXN A;  1JFF B;  4XDK A;  2JEX A;  3CE2 A;  3FB5 C;  3UQ8 A;  4FM1 A;  5J2U B;  5L3D A;  1N4C A;  1R73 A;  1SS3 A;  1VQM V;  4QGP A;  3ETQ A;  1KKD A;  4I7Z B;  1XI1 A;  3LSU A;  4UV8 A;  1QR8 A;  3JD1 A;  4PDL A;  2DYR C;  3K9S A;  3SJC C;  4FK5 C;  4QNH B;  2CUG A;  4JAA A;  1HNX O;  4ZIB A;  3OEH G;  1HNZ B;  3LDC A;  4NTY A;  1N0J A;  1Q6U A;  1Y67 A;  5LHI A;  3CD6 V;  3BAA A;  3VOU A;  4X9Q A;  4MSW C;  3UT5 A;  5CA0 A;  3ZN0 A;  3L75 H;  3MD0 A;  1YI2 V;  3ZMU A;  4ABM A;  3ZED A;  3HKE B;  1QNM A;  4DV0 B;  4PA9 A;  4J41 A;  2E5L B;  2ZXW B;  2EIN B;  1E1R G;  2YXH A;  4K35 A;  3T2M A;  2PY5 A;  3SYQ A;  1I7F A;  2YI9 A;  5GTI Z;  2XAF A;  5BZB A;  3FYE B;  4WFA V;  1N36 O;  1S77 D;  5LGU A;  1AR4 A;  1AJN A;  5EK0 A;  4DV2 O;  2QEX V;  2LGW A;  4F4L A;  2C2A A;  3SYC A;  3K03 A;  1V55 B;  4EKW A;  3RVY A;  4P9P A;  2KKW A;  1VQ8 V;  1GAX A;  1XNR B;  2F23 A;  1IBM O;  3CCQ V;  1WB7 A;  3JAS A;  3BVO A;  1TVK A;  1K5S A;  2H8P C;  3CXC U;  4LF7 B;  4DR1 O;  4IYI A;  3ZHR A;  3I56 V;  3HKD A;  1ZWI C;  2KG7 A;  3IC9 A;  3STL C;  4I0X A;  3F7Y C;  3W7W A;  2E3C A;  4B7K A;  3CCR V;  5E79 Z;  4JYY A;  4TUY A;  3LSQ A;  2VQE O;  1KP2 A;  4FFK A;  5EIB C;  1DGS A;  2AGA A;  4JI7 B;  3APO A;  3R66 A;  5J2U A;  2N05 A;  1N8R W;  1SA0 A;  1NH2 B;  3N27 A;  3LDD A;  1OV9 A;  1VQL V;  2DOS A;  3ZMT A;  3TXS A;  2N74 A;  3ZRX A;  1F4M A;  2WLH A;  4BR6 A;  5EZY B;  4D7T A;  3D36 A;  2ZR2 A;  1S5J A;  1EFR G;  4PA6 A;  4U3J A;  4E2L A;  2ZKO A;  5JCO A;  4BIU A;  1DF4 A;  2EIK C;  5EBW C;  3ZRV A;  3B8N A;  2IM9 A;  4GX1 A;  1NKD A;  2ZE6 A;  2DQ3 A;  4K8X A;  1QLE B;  1H2M A;  4HNA B;  1VQ7 V;  3RYF B;  4R7C A;  3SYO A;  3OR6 C;  2DYS B;  1H2G A;  3HKE A;  1NQT A;  3BAB A;  5LOV A;  4DUY O;  4JI8 O;  5EBL C;  4MS2 A;  1I5X A;  3CCS V;  3NR7 A;  3QNE A;  4IYH A;  1SF9 A;  2P6J A;  4DV6 O;  1XMQ B;  1RPO A;  1COW G;  4KL1 A;  4DR7 B;  4DR4 O;  2L6L A;  4EB6 A;  5JJJ B;  1Q86 W;  1MSW D;  3H01 A;  5BR8 B;  2WLL A;  2WLK A;  2BOB C;  3OTF A;  2Y69 C;  4FMT A;  5H6R A;  2E76 B;  1R1B A;  1R3K C;  3K0G A;  3M8A A;  3DC6 A;  4ASU G;  4N21 A;  2EIJ C;  2YIB D;  3ML0 A;  3ZX6 A;  3ABM B;  4B08 A;  1HNZ O;  4X89 A;  5L3G A;  3AK2 A;  3OW2 U;  2ADQ B;  1VQN V;  3DTU B;  2MK3 A;  3QTC A;  4TT3 G;  2FTK A;  3J80 N;  2P06 A;  4DR6 B;  3CRA A;  2PF4 E;  5F2V O;  2K1E A;  1US6 A;  1YCI A;  1NR1 A;  3E86 A;  1YZB A;  4K3A A;  2AZ0 A;  1URF A;  1L8D A;  2VWJ A;  3T1C A;  1XIL A;  1GH6 A;  3ZHT A;  2JGD A;  3RYI B;  4I4T B;  2YXY A;  4NXN B;  1OCR B;  2L35 A;  1V9P A;  2PTM A;  2XAJ A;  4PHZ A;  3NXS A;  1J5E O;  1IXM A;  3A0B Z;  3CWB H;  1OCC B;  3ABL B;  1R3L C;  3B09 A;  4PDM A;  4AQY B;  4RUF A;  1P84 F;  2Z3Y A;  5EZY A;  2DQ0 A;  2GDS A;  3C3T A;  2HG5 C;  4GX0 A;  1JR9 A;  3LNM B;  2VQF O;  4LF4 O;  4EFB A;  1Q90 D;  1FXK C;  2R9I A;  2Q4P A;  1MZF A;  5KX5 B;  4HNA A;  3RYF A;  3K79 A;  1YTF D;  5KHG A;  1TA8 A;  2WAM A;  1UJW B;  3D36 C;  3AG2 B;  3KG2 A;  4KXR A;  3ABT A;  3W7S A;  1H8H G;  2FYU H;  1EM1 A;  4WFB V;  1YIT V;  5JQG A;  3OUF A;  4CBC A;  4YJ2 A;  4LF6 B;  1M93 A;  4NTW A;  3WG7 C;  2DYR B;  4GYC B;  4DV3 B;  2W6I G;  2BE3 A;  5IDJ A;  1I0H A;  1MG1 A;  2JJ1 G;  2WA4 A;  4PEL A;  1CP9 A;  2UU9 O;  1IXB A;  1DF5 A;  2ZM6 O;  3ZS8 C;  1YJW V;  5KAI Z;  4GX2 A;  4UCR A;  4WBN A;  3L73 H;  4R6Z A;  1N32 O;  4BW9 A;  2HEP A;  5KLV H;  3FFQ A;  4I50 B;  1BZK A;  4LNU B;  4LFC B;  3T1Y B;  1H2K A;  5ITZ B;  1M57 B;  3EVK A;  5H6Q A;  2BSK B;  1OHH G;  2HVJ C;  1VQK V;  4DW0 A;  3B40 A;  3KCY A;  5LYJ B;  3RYI A;  4I4T A; 
#chains in the Genus database with same CATH homology
 1N33 O;  4JI1 O;  2HHH O;  5LMN O;  4AQY O;  1N34 O;  2UUB O;  4NXM O;  2ZKO A;  1XNQ O;  1XMQ O;  4DR3 O;  1I94 O;  4DV0 O;  2UXC O;  4JI0 O;  1FKA O;  4LF8 O;  4OPA A;  2JRI A;  2F4V O;  4LFA O;  2E5L O;  5BXZ A;  4JI2 O;  2DJV A;  2VQF O;  4X66 O;  4GKJ O;  5BR8 O;  1R6T A;  4LF4 O;  2UXD O;  1FJG O;  4DUZ O;  4DV1 O;  4K0K O;  1AIL A;  4KHP O;  4JI5 O;  2UUC O;  4DUY O;  4DV7 O;  4JI8 O;  4OPH A;  1N36 O;  4GKK O;  4DV6 O;  1A32 A;  2FKX A;  4DV2 O;  4DR7 O;  4DV4 O;  3J7A U;  4DR4 O;  2UXB O;  3O65 A;  5IWA O;  4B3M O;  1FYJ A;  1XNR O;  4LF6 O;  1R1B A;  3OTO O;  1IBM O;  3M8A A;  5A2Q N;  2LW7 A;  3F5T A;  1KUQ A;  4DV3 O;  4JI6 O;  1HNZ O;  3SDL A;  2Z0A A;  5FLX N;  4DR5 O;  4LF7 O;  4LFB O;  4DR1 O;  3RT3 C;  4JYA O;  4X65 O;  1XMO O;  1DK1 A;  1NS1 A;  4B3T O;  4LF5 O;  4A5U B;  3J80 N;  4DR6 O;  1AB3 A;  5H5N A;  4X64 O;  4JI4 O;  3J81 N;  2UU9 O;  4YHH O;  5LMU O;  2ZM6 O;  5LL6 Y;  1HNW O;  2VQE O;  4LF9 O;  1YZB A;  4X62 O;  4YY3 O;  1IBK O;  1N32 O;  1D2D A;  5IT9 N;  2AGA A;  5BY1 A;  4JI7 O;  4B3R O;  1IBL O;  3R66 A;  3T1H O;  3T1Y O;  4LFC O;  1G1X B;  1X59 A;  1HNX O;  4JI3 O;  4DR2 O;  2DOS A;  4NXN O;  4JV5 O;  4B3S O;  4DV5 O;  1HR0 O;  3JAM N;  4OX9 O;  2N74 A;  2UUA O;  1F7Y A;  1XEQ A;  1J5E O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...