2UXDO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxdO00
2AGAA 4DR4O 4LF4O 1R1BA 4OPHA 2LW7A 4DV5O 4AQYO 5IWAO 1KUQA 1A32A 2UXBO 1J5EO 4LF5O 1IBLO 1DK1A 2JRIA 1IBKO 3T1YO 4LF8O 1N32O 4JYAO 1N36O 4LFAO 4OPAA 5BY1A 4DR3O 4NXMO 3RT3C 3M8AA 4A5UB 1HNZO 2DJVA 2UUAO 3T1HO 2E5LO 1N34O 3F5TA 2UUBO 3JAMN 4LF9O 4LF6O 1N33O 1XNQO 1AB3A 4LFBO 4DR5O 4B3RO 1FYJA 4JI0O 4X65O 1HNXO 3J7AU 1XMOO 4JI8O 1YZBA 4DV1O 2VQFO 1IBMO 5BR8O 5LL6Y 1X59A 2VQEO 1AILA 2Z0AA 4X64O 2ZM6O 2ZKOA 4B3MO 1XNRO 5FLXN 4LF7O 2N74A 1FJGO 4DR1O 5IT9N 4DUYO 4DV7O 4X62O 4JI2O 4OX9O 4JI3O 1FKAO 4GKKO 3O65A 4JI6O 2UXCO 4DV2O 4JI4O 2FKXA 4K0KO 2HHHO 1XMQO 2DOSA 5A2QN 4KHPO 1R6TA 3OTOO 2UXDO 4DR2O 1XEQA 1NS1A 5BXZA 3R66A 1F7YA 4X66O 4LFCO 4JI7O 3SDLA 5LMUO 4NXNO 3J81N 4B3SO 4YHHO 4DV0O 4DV4O 1HR0O 2UU9O 4B3TO 2F4VO 5LMNO 4DR7O 1G1XB 2UUCO 4YY3O 1D2DA 4JI5O 1HNWO 3J80N 4DUZO 4DV3O 4DV6O 4DR6O 4JI1O 5H5NA 4GKJO 1I94O 4JV5O
chains in the Genus database with same CATH superfamily
4OPHA 2QWNB 2KB1A 4MW3A 5GW7A 4AILC 2P22C 3WG7C 1OCOC 3BCCH 3K5OA 4D6TH 5GONA 1S5HC 2JRIA 4FVMA 2P90A 5EBLC 1QU7A 1OCZB 4HBNA 4OPAA 4QIWF 1GM9A 4PA6A 1FXKC 1N33O 1CPYA 4UVAA 1JFFB 4LFBO 1GO3F 1H2KA 5LMNB 4FLXA 3JYCA 4I55A 3J7AU 1XMQB 3QO5A 1R3KC 1XI1A 5L3CA 4WBNB 1QBZA 4FZ0A 3OEEG 1QVGU 4G28B 3I55V 4LF4B 4ZKIA 3KKYA 2Q7GA 3CXCU 4LF5B 4K35A 1NR1A 2JEXA 2Q7HA 3JASB 4CC6A 4YHHB 2JS3A 5FLXN 3HKDA 2RQ6A 4MT8A 5J2UB 1VEWA 4DR7B 1GN3A 2NLJC 1SQGA 1W0JG 2R70A 5EZYB 4JI5B 2UUCB 3CC4V 3T4ZA 1S77D 4I4TB 4EKWA 2HVJC 1VQMV 1XMQO 2QM8A 4UVCA 2ADQB 2FYUH 4NR1A 1VQ4V 5J2TB 4UCVA 1NS1A 2ZDIA 5J9PC 3SPGA 3QF7A 5IJ0B 5F2VO 4ZOLA 1TUEB 3ZHUA 4LFAB 5CA1A 1BHAA 2JJ1G 1K5SA 2RJZA 1HDJA 4YHHO 3SPCA 3JD3A 2YUAA 1GKFA 4DR7O 1M5IA 1UJWB 4XDLA 2UUCO 4JI5O 4GLXA 1XNRB 1HNWO 3Q4HB 3E8HA 3RVYA 1XILA 1VMGA 4JI1O 5EC1C 2Q67A 2PTMA 3JD2A 2EINC 4C7UA 1S5JA 2HJDA 2OT5A 1YTFB 3GB7C 3W7TA 3CP1A 5DEDA 4MVSA 5KAFZ 4PA7A 1TUBB 2YEVA 4LFAO 3RFRA 3MDSA 2X7RB 4RUFA 4MVUA 3ZMUA 3PN1A 1JMKC 1Y76A 5IYZB 1XOUA 3ZEDA 1GN4A 4CBCA 5GTIZ 1YITV 2WLNA 4YIOA 4CS2A 1XL6A 3E2EA 4PA3A 4JAVA 1MSWD 2EILB 2GBOA 4YJ2B 3HR0A 4AHCA 2Y4UA 1F51A 4IL6Z 2XNDG 4RWUA 3OGIB 5A9GA 1J5EB 2PY5A 2QKSA 5EYPA 5LYJB 4O4IA 1NQTA 4EB6A 4HYOA 4B3SB 2PF4E 2WAMA 3HKEA 1QLEB 3JAWB 1FJGO 2XAQA 4G27B 4X1YA 1Y66A 5B1BB 2QA4V 1NTZH 1NU1H 1ZX3A 1FAFA 2FKXA 2ZT9B 1Z2GA 1MMMA 1RSOA 1ORQC 1VQ9V 3K0DA 3E8FA 2PGGA 1YEWA 5FNVB 3WB1A 2AHYA 4FFBB 2X6AA 4LCUC 4B3SO 3ZN1A 5HFLA 1W2BU 2HJFC 1X4TA 1ZUQA 1AI5A 4YJ3B 3L70H 2HP8A 5IY5C 3ASOB 4MVZA 1K4CC 1EFRG 1DLBA 2MW2B 3SYPA 4Z2WA 3TXSA 4F6EA 4JV5O 4O4LB 1W59A 2PYLA 1QR9A 3E35A 3B40A 1M1KW 2L6LA 2VWJA 4TUYA 5H9CA 4O4HB 4TSFG 1KKCA 4CH5A 4LBEC 1K9MW 4B3MB 4P9PA 3BABA 2HLDG 1L0LH 4OGQB 4PDRA 1NTKH 4U7OA 2P06A 2CH7A 1N0NA 3E86A 3KCXA 2HVKC 4I5SA 1MG1A 5K1XA 3RYCA 2WLJA 2CK3G 5DN6G 1KD1W 3PJSK 1KC8W 2BE3A 2WLIB 1CXZB 3K08A 1AJNA 5B5EZ 5LMUB 4XDKA 1E1QG 4B3MO 2ZKOA 5CBHA 4DXWA 4MW8A 5L3EA 4LF7O 4TV8B 1FXHA 3BEHA 2OIGA 1V55B 2F93B 3H1KH 1NH2D 5LHIA 4O2BB 5JQGA 2W0FC 2Z3YA 5EIBD 1K33A 5KMGA 3IC7A 4IIJB 1M9NA 1RM1B 1XNQB 3HPLC 3SYAA 4KHPO 2QWRB 2F1MA 3FYIB 3RYIB 4LWSB 3R66A 1SQVH 4MS2A 5EIBC 1N8RW 1H8EG 4G2KA 4GCZA 5LMUO 3ZMZA 1D5AA 3U10A 1PNMA 2DN9A 3A0BZ 2YXLA 1I7FA 4NVPA 1AR4A 1JA8A 1Q86W 4WFEA 5EBMC 4FM0A 1VIBA 3CYOA 4DV6O 1VP7A 3ZMVA 2ZXWB 1R1BA 3DTUB 2WA3A 4DV1B 1A32A 4JI4B 2HHHB 5IJ9A 2Y0IA 2DYSB 3IGAC 4GX1A 1YXBA 3TCUA 1V54B 2R9RB 4H13B 4ZHQB 2O57A 3O9OA 3P30A 4IT5A 1H2LA 2IBZH 5JJEB 2HKOA 3VQXA 2EJ7A 4EFEA 4CS4A 4DK0A 1VF6A 1E79G 2NR5A 1YZBA 4DV1O 2QJ1A 1AJPA 4FZ1A 2WLLB 4TWKA 2A7WA 3BRCA 2QM4A 2RN9A 5E79Z 1XBLA 4WFGA 4PA4A 4YIPA 3VQYA 5C8YA 2FMLA 2Q5ZA 2DYRB 3AEIA 1NTMH 3ZCCA 3SPJA 3UO2A 1V9PA 3E8BA 1FKAO 1XHZA 3ABLB 3DXRA 4K0KO 4CS3A 1YCIA 4F6RB 3CCQV 4Z1VA 3OR6C 1H2GA 4LP8A 4R50A 5BXZA 4IYIA 3WFVA 3UT5B 4PI2A 3TETA 2EIMC 2GV9A 5CB4A 1JJOA 4W4KA 1OCCC 2LQTA 1G1XB 4YY3O 3ZRWA 4KP4A 2LGQA 4JI0B 1AVMA 5LHHA 3HKCB 3P32A 4OXSA 1TVKA 3P3PA 3RW0A 2JS5A 2LFRA 2F23A 4D7TA 3K3WA 2IJJA 4QPKA 4FIPC 2BTQA 2JGUA 5CA0B 3K57A 2OIEA 4DR1B 2K9PA 1O9GA 2DWDC 2X6BA 2ZNIA 4RQFA 2P67A 1FYJA 2OCCC 4JI0O 1HNXO 3TXQA 1WB7A 3JATA 1ZWIC 2A3QA 2K1EA 5AG2A 4X1KB 1WP8A 3K03A 4TV9A 4DR2B 5KX5A 1XHXA 1NVPB 5JVDB 4IYHA 3CRMA 5ITZA 3OR7C 1S3JA 3T4DA 1YTFD 3CJHB 5B66Z 3AK1A 2UU9B 5KA5A 2A0LA 4UV8A 4DR1O 1JPXA 3CRQA 1VQ6V 1G8MA 3OMIB 4JI6O 2WWWA 2DOSA 2EJRA 4R8CA 2QM7A 4I0XA 3K5LA 2UXDO 4DR2O 1IBLB 1F7YA 2YI9A 4X66O 2YIDA 3ASNB 4X20B 1ENVA 1DGSA 1ZAUA 3T2MA 2QWOB 1HR0O 4QE7A 2UU9O 5LXTA 5JCOA 1WA8A 3EHBB 2EILC 2AXTZ 2B1IA 2M6YA 4JYCA 5IYCO 4ZI7B 4CZZA 4Z1MG 2IJHA 4AQYO 3B2EE 1IBMB 3LUTB 4MVRA 4PELA 3S3XA 3IC9A 3R65A 2L35A 1IBLO 3TK1A 2D2CB 3UM7A 5LGTA 2QWPB 5K1PA 1QLEC 3BY6A 2OYQA 4X64B 4QJFB 1SS3A 3RT3C 1M56C 3OMNB 3RWRD 3CC7V 1GK9A 1NBMG 3LDDA 3OM3B 2RDCA 3SPIA 1KB9F 5GONB 2F66C 2GUZB 4K8ZA 2GTSA 1IBMO 5BMVA 3JARA 4UB6Z 3RYHA 1NZ6A 5BR8O 1JVMA 2FTKA 1FXVA 5KHJA 5B3SC 1X59A 4FLZA 4X64O 1SZXA 3ASOC 3DC5A 1XL4A 1CP9A 4I55B 4FLVA 3STZC 2AW9A 4NXMB 1Q6IA 1Q90D 1WAZA 3O65A 3W7UA 1VQLV 2JJ2G 2ARHA 3EXAA 1S76D 3CC2V 3JSNA 2FL4A 3VBBA 5L3DA 1R6NA 2LO1A 3HKDB 1SZTA 3DC6A 3KCYA 1N32B 3WB2A 1MNGA 2UXXA 1WNSA 3NR7A 1LR1A 1H2SB 5B1AC 1K7DA 2EIJB 3AG3C 5LMNO 1N34B 4J11A 3CRRA 4PA9A 2W0XA 3J80N 5IDJA 5FL7G 2IW5A 4LF4O 4ZOLB 3D36A 5CA1B 1WLEA 1YDXA 1DTOA 5J2UA 2IU3A 3ZIAG 1T5EA 4LF5O 1IVSA 1WPBA 4TT3G 3L9DA 1N32O 4O4JA 1JCHA 3GWOA 1P7GA 3K58A 1YF2A 2DW4A 2VS0A 3K0GA 2IJKA 3OMAB 3U0ZA 3AG2C 1N34O 5EBWC 1RM1C 5BZBA 3D3QA 2CE4A 3OT7A 4J41A 1R3JC 1KECA 4JAUA 4UUJC 5KHGA 1K34A 4PDLA 1THZA 1SQQH 3WU2Z 2XAHA 1GN6A 2IM9A 2XAFA 4JYYA 4DV3B 2YEVB 5DM6V 3OFNG 3C90A 5LP6B 4DW1A 5JJNB 1TAEA 2ZE5A 5GTHZ 1QHTA 1XNRO 2N74A 3ETDA 4H37A 2GTAA 2YXHA 4H0LB 2ZXWC 2EIKB 3T1HB 3RN4A 1I08A 1K97A 2YIBD 4BAYA 4GKJB 2P4KA 1TUBA 1IX9A 4KXRA 5EYPB 4O4IB 3N2GA 2DYSC 2V7QG 1XDCA 2R9AA 2HEPA 2KSDA 1SETA 2JVDA 3N2KA 4JZGA 1IBKB 4X1YB 2YIAA 4UXNA 3CCMV 4JYAB 4JTCB 1YIJV 4ZBMA 3B8NA 1SQBH 3E89A 3ICXA 2UUAB 1K92A 4YJ2A 2E75B 2ZQMA 4MTOA 2ADPA 4H33A 1B6QA 2LW1A 2EBOA 4U3JB 4GKJO 2XAJA 1AI4A 1GM7A 1FFTB 2P7TC 2PUSA 3JAWA 1J5EO 3ZHVA 1YI2V 1QVFU 5LA6A 1IXBA 1DK1A 3FAVA 4FM2A 2BCCH 3EVKA 3P3NA 1IBKO 1KU9A 2KQXA 4JYAO 2DYRC 5TISZ 2JEUA 2ZNJA 1PM9A 4BW9A 3UCSC 4JTAB 3H1JH 1OCOB 3WG7B 4CH3A 2UUAO 3AK2A 3ABLC 1Q8IA 5H6QA 1AI6A 2WPDG 4TUYB 4X8AA 2WLHA 4LH7A 2PZSA 4DR6B 1K8AW 1IURA 1FXKA 4DV5B 4FFKA 2DE0X 4RQEA 3ZRVA 2Z0AA 4PJ0Z 3K79A 5KA6A 1AJQA 2CH7B 1PPJH 3CXHF 3RYCB 2WA4A 2IH1C 1E1RG 3CB2A 2G38A 4BIOA 4ABMA 3L73H 2W6IG 1COWG 3AG1B 2M7WA 1RFYA 4FLUA 3X2QC 1GRJA 3T1CA 2F43G 1LNQA 1XEQA 1P49A 4JI8B 4J7KA 1L0NH 3JCUZ 3SDLA 1YVWA 3ZHRA 2VRZA 5KMGB 2ZIOA 5IYDO 1LUVA 3A2FA 4B08A 4WFFA 3CCSV 2LGWA 1NVPD 4LC1A 1NI8A 2AHZA 1PD3A 2XUMA 1F4MA 3GWKC 1Y74A 2QTOA 3OAAG 3ZHSA 3FB6C 4OX9B 2CTQA 2V4DA 3M7MX 1I0HA 1VQ5V 4WFHA 3IJ4A 3JALA 3LSQA 1NKDA 2Y0PA 3K59A 4I50A 4MTFA 3M8AA 1EM1A 4X9QA 5LBQA 1XNQO 2WLMA 4JI2B 1TA8A 5IJ9B 1YJ9V 3DGEA 3RVZA 2LFSA 4NTXA 4DV2B 3ABMB 2QDOA 1G6UA 4MTXA 4MVMA 1AR1B 2ITCC 3ASNC 2BSKA 3E8GA 2YDEA 2H8PC 1AILA 2ODMA 2V1DA 1B06A 1Y6XA 2Y69B 1N36B 3BVOA 3CSXA 2PYJA 1M57C 2R72A 3CMAV 4JI2O 2E74B 2E5LB 4MVOA 4DV2O 4JI4O 2HHHO 4DR4B 1PP9H 1PV0A 3MHHC 3OW2U 4B3RB 1PL4A 4IGGA 5IWAB 4X1IB 2W6JG 3UQ8A 2JDIG 3JD4A 1VF5B 3QNEA 5C8YB 3BHPA 2HFEC 2ZINA 4DK1A 3APOA 3HKBA 3LDEA 3AG7A 4QPJA 1SF9A 3CEIA 5JH7A 3DXRB 4DRXA 5LGNA 3F7YC 3AG4B 4LF9B 4UVBA 3QG5A 4DR5B 4LNUA 1H2NA 1QQCA 2QE7G 4NYKA 5H5NA 3CCUV 2Q9LA 1K4DC 4DR4O 1BE3H 5IWAO 1ZL8A 3LSSA 3CRAA 3RBZA 5IY5B 1OCZC 4HNAA 4R7CA 3RYFA 4I9QA 1J95A 3ZRWB 1Q43A 1YHQV 2GSMB 4ZIBA 2KG7B 1BHBA 2QKAA 4F6RA 1KBHA 2QKCA 1BT8A 3B4SA 1FFXA 4LF9O 4GYCB 1F4NA 1TVKB 4DUYB 1VQKV 4DR5O 2F4VB 4TOIA 4U3FH 1SKVA 3JSLA 4RO2A 4BR6A 3CX5F 2DMXA 1YJNV 1Z5VA 4UCTA 3BPZA 5DECA 1DF5A 2BTQB 1RPRA 4ICGA 1QLNA 4PHZA 3JD1A 4LH6A 2H94A 2DQ3A 3ETGA 3K9SA 2ZIMA 4JI7B 2EIJC 5KLVH 3BA8A 5LOVB 2YI8A 3WB0A 3T1YB 4DV0B 2CTPA 2ZDIC 3H1HH 4MTGA 4TQFA 1D5NA 4GX2A 1P84F 4TV9B 4DUYO 4R6ZA 2EULA 3QO7A 1OHHG 5KX5B 1MZFA 1I94B 1JJ2U 1YJWV 3E22A 1R3IC 4K8XA 2YICA 4X65B 5CA0A 4JAAA 2Z5UA 4IHJA 3ZRXA 5EC2C 2F95B 1M4UA 4J10A 3STLC 2ZE8A 2BOBC 4LF8B 3JAKA 1VQNV 3ZMSA 1GAXA 4JI7O 3CCVV 3K5MA 3FB5C 3LDCA 1GH6A 4DV0O 2OTLV 1HNZB 4O2AA 2PI5A 2P6JA 5L3GA 4I0XB 2HG5C 4W4LA 5B1OA 2E3CA 1I94O 5LP6C 2P5OA 1UFIA 4JI3B 1SESA 1Q3EA 4UB8Z 4WCEV 3MD0A 2CUGA 3CD6V 4FLWA 4LF8O 3CE2A 4XDJA 4DO2A 2A06H 1WA8B 4XBFA 3B09A 3L71H 1F23A 4WFAV 1S72V 2YS8A 1HNZO 1BQ0A 2EIKC 1BCCH 3ETQA 1AP5A 3JAMN 5KHIA 3I5DA 4B3TB 1US6A 3W7WA 3CRCA 1Q6HA 5FPRA 4UFZA 4FLTA 3BA9A 5CMUA 3VQVA 5FPOA 2GDSA 3L75H 5LL6Y 4JTDB 3CMEV 1EN6A 5B1BC 2Q7EA 1SA0B 4NXNB 1Q7YW 2JGDA 2LJ2A 4ZI7A 2OWOA 3MAQA 1OCRB 2RNBA 3JCZA 1WP7A 3AK3A 3CHXA 5BMVB 3JARB 3RYHB 1U96A 1N33B 4LFBB 5A2QN 4X88A 3H01A 3OEHG 1EN5A 3CS5A 2UXBB 5L3BA 5HFMA 1Q81W 3OGCC 3SYQA 1BS3A 1VQ8V 2DWEC 1AROP 1KP3A 1VQ7V 4NXNO 3CCJV 1O9HA 2ZD9A 2GUZA 4DW0A 1UPGA 3G67A 1KQSU 4CC5A 1VQOV 2EIMB 4D7SA 3OUSA 2RMKB 4FJCC 3ABKB 1OCCB 2LW7A 1BMFG 1JFFA 2UXBO 1BQZA 1AI7A 1OV9A 1ZSPA 3F7VC 1I5YA 4WBNA 2CGOA 1PL0A 3G6EV 2EZPA 4JYBA 1GM8A 3ABUA 4NXMO 1KYOF 4RAIA 5H6RA 5KUKA 4DV7B 2Q6AA 3JASA 3AG1C 4JASA 4WFBV 1GMGA 4WF9V 2ZE7A 3ZS8C 2JK5C 1HNWB 2ITDC 4O4JB 5EZYA 5B1NA 4JGSA 4JI1B 3OTOB 1R3LC 4I4TA 3IAYA 3ZHTA 1V55C 2B9ZA 2OCCB 3OUFA 2LP7A 4N21A 3GVMA 3QVNA 2XHBA 1BL8A 3G4SV 5J2TA 1JR9A 3ML0A 1IDSA 4HZ3A 5CBFA 5IJ0A 4U7NA 1QNMA 1VQPV 4DV7O 2FB5A 3CPWU 2H3OA 1I5XA 5LHGA 3U11A 2Y48A 1Y76B 3FD9A 1WN7A 2VWKA 3OTOO 3G80A 3Q4HA 2PI4A 2ZR2A 3FB7C 4TQDA 4QNHB 4GUNA 4QGPA 2ZE6A 1WJZA 2BTOA 4J7JA 5LP6A 4FM1A 3ABMC 1RPOA 3N2GB 4GZRB 4YXWG 1M93A 2A9HA 4GT1A 5JWPA 2QR4A 1FJGB 4DV3O 3N2KB 3LSUA 4EB6B 2P4VA 2AGAA 3HKEB 1V54C 5IYZA 1XMOB 1H38A 1H8HG 4FLYA 1RP3B 4P30A 1TGOA 1AP6A 3JD0A 2VQEB 5CBGA 2Y69C 3ABTA 1BSMA 2ZM6B 4N23A 4B7EA 4RUEA 1EZVH 1RSOB 1VF6C 1CEZA 1KKDA 1HWYA 2A79B 2ZCEA 3T1HO 5KUMA 3F5TA 5LYJA 3SGIA 1EZJA 3A0RA 5LA6B 2CAZC 2UXCB 3FAVB 1XQ8A 5JJJB 1Z5WA 2B5UA 1MOFA 4PV1B 1XMOO 1M56B 3A0HZ 1KMIZ 1IZ3A 4JV5B 1YSCA 2ETNA 1MZEA 2VQEO 1VF7A 3SYOA 3APQA 4KL1A 1NR7A 2ZM6O 2IH3C 3NXSA 3HB3B 4U3JA 3AG4C 3OTFA 2Q0AA 4E2LA 2QSAA 5B3SB 4AI8A 5FNVA 5IT9N 4KFMA 4FFBA 2QTSA 2ZR3A 1FXKB 2D3OW 2UXCO 4PI0A 2XT9A 1MSDA 4YJ3A 3C3TA 1R6KA 4X89A 3B8MA 4H44B 3TGUH 5CN0A 3UKMA 3EFFK 3SYCA 4Q6GA 4CH6A 1SQXH 4O4LA 1P4RA 4I9WA 5LGUA 4O4HA 4UCUA 1BZKA 3ZN0A 1M90W 4LF7B 1S5LZ 4DR6O 5B1AB 4DYLA 4L87A 3FFQA 4DV5O 3AG3B 5IE9A 2XTAA 2VQFB 2X6CA 5JQGB 4KHPB 2R9IA 3ZRSA 4EEQA 3OD4A 1AR5A 3LNNA 3FB8C 1Y74B 1NJIW 2WLIA 1JX9A 1SQFA 3QTCA 3D3IA 1AB3A 1OZ0A 4JF3A 3KZIZ 4J80A 1GTOA 4TV8A 3JALB 5D5QA 4Q20A 2Q68A 4CH4A 4O2BA 4DV6B 4JI8O 2VQFO 3AG2B 4I50B 2EINB 4IIJA 2MK3A 3OE7G 3VQWA 1IXMA 1K5QA 4P9OA 4UCSA 4PD4F 1Y67A 2IU0A 3RYIA 4LWSA 2Q69A 3L72H 2YSUB 3I56V 2QWQB 5KHKA 1G4YB 1FPOA 2NNUA 3MHSC 2CTWA 4OX9O 1XUQA 3ZMTA 2Q0OC 2NN4A 2BSKB 1FS0G 3D8CA 3M99B 4NTWA 1R6TA 2E76B 3SPHA 5JCOC 1NT2B 4JZ2A 5D5PA 2WLKA 5IYBO 2WSSG 2XAGA 3RGBA 1QR8A 3A8TA 2X0LA 3J81N 1Q82W 1WPXA 4UV9A 1OJHA 2QGNA 1U97A 3CCEV 2UUBB 1EN4A 2QEXV 2GHYA 4ZHQA 2YIBA 3E83A 2YXYA 3HKBB 1LUWA 1SRYA 1DF4A 1VARA 1ZTEA 4K0KB 1GN2A 3IFXA 2AZ0A 5JH7B 1BGYH 2RCVA 3G71V 4DRXB 3C3SA 3CWBH 4QE9A 1OCRC 1Y4MA 3BFRA 3ZX6A 1N36O 4LNUB 5L3FA 2CTRA 5BY1A 1Q5OA 3KG2A 2WLLA 3SJBC 1PNLA 4X1IA 3UO3A 4A5UB 3LNMB 5KHHA 2E5LO 2UUBO 1ZL8B 1MABG 3FX7A 4J7ZA 4X62B 5H2FZ 4B3RO 3H1IH 4JPRA 4HNAB 3ZHQA 5CB4B 4FPPA 4YY3B 3RYFB 2CDYA 2Q8VA 1JQ0A 3THOA 2IJIA 4LFCB 1FFXB 1PKXA 1XREA 2Q4PA 1R73A 3K9AA 3ZBHA 3F5WC 2HR3A 4MSWC 3UT5A 4EFBA 3ABKC 1MA1A 4BIZA 4X62O 4UCOA 4DUZB 4F4LA 2Y4TA 4ASUG 2Q73A 3TJTA 2N05A 3SJAC 4J9YB 1Q6UA 1B3QA 2ATKC 4UCRA 2KG7A 1HNXB 1HW7A 1ROPA 1W0KG 2XASA 3ETEA 4LFCO 3H1LH 3HKCA 3JATB 2N04A 1HP8A 3B77A 3X2QB 3D36C 5C93A 4DR3B 2F4VO 3E22B 1PNKA 3CCRV 3S3WA 2XOKG 4LF6B 1D2DA 2EX3A 4DUZO 4NB5A 4IHJB 1K73W 4J42A 5ITZB 3VOUA 3JAKB 1P7BA 5LOVA 1ZLZA 4JI6B 4MVQA 1KUQA 1EBOA 1H2MA 2OTJV 4J9ZB 1SQPH 1NH2B 2ILMA 4O2AB 1L8DA 3H9VA 3T1YO 1S0VA 2UXDB 4X1KA 1SERA 2OCHA 3SJQC 4X66B 3FYEB 2DQ0A 4BW5A 4DR3O 2DJVA 3QO8A 4GX0A 5JVDA 4LF6O 3CCLV 1HR0B 1K3EA 4GKKB 3CJHA 4X65O 4FK5C 1URFA 2B1GA 3SR2C 5LXTB 4BIUA 3SJCC 5CA3A 3K04A 4AQYB 1FD9A 2JIZG 4PDVA 4BWAA 1SC5B 4DV4B 2BOCC 2YC0A 3ZJZA 1N0JA 4PDMA 4LR3A 4X20A 4JI3O 4NTYA 4GKKO 4B7KA 4I7ZB 1WB8A 2KKWA 5KAIZ 3DSQA 4E4EA 1B04A 3BAAA 3N27A 2CGNA 2JGDB 1M57B 4KUMA 4FMTA 1KP2A 2EZOA 4K3AA 3L74H 5EK0A 1JOYA 4L8JA 1L1FA 5BR8B 5E1AC 3W7XA 4DV4O 3FKSG 4B3TO 3K5NA 2UXNA 4P2ZA 1N4CA 4HAMA 3G6BA 1QCEA 2AZ2A 4NKGB 3K06A 4GX5A 3W7SA 2C2AA 1SA0A
chains in the Genus database with same CATH topology
2AGAA 4DR4O 4LF4O 1R1BA 4OPHA 2LW7A 4DV5O 4AQYO 5IWAO 1KUQA 1A32A 2UXBO 1J5EO 4LF5O 1IBLO 1DK1A 2JRIA 1IBKO 3T1YO 4LF8O 1N32O 4JYAO 1N36O 4LFAO 4OPAA 5BY1A 4DR3O 4NXMO 3RT3C 3M8AA 4A5UB 1HNZO 2DJVA 2UUAO 3T1HO 2E5LO 1N34O 3F5TA 2UUBO 3JAMN 4LF9O 4LF6O 1N33O 1XNQO 1AB3A 4LFBO 4DR5O 4B3RO 1FYJA 4JI0O 4X65O 1HNXO 3J7AU 1XMOO 4JI8O 1YZBA 4DV1O 2VQFO 1IBMO 5BR8O 5LL6Y 1X59A 2VQEO 1AILA 2Z0AA 4X64O 2ZM6O 2ZKOA 4B3MO 1XNRO 5FLXN 4LF7O 2N74A 1FJGO 4DR1O 5IT9N 4DUYO 4DV7O 4X62O 4JI2O 4OX9O 4JI3O 1FKAO 4GKKO 3O65A 4JI6O 2UXCO 4DV2O 4JI4O 2FKXA 4K0KO 2HHHO 1XMQO 2DOSA 5A2QN 4KHPO 1R6TA 3OTOO 2UXDO 4DR2O 1XEQA 1NS1A 5BXZA 3R66A 1F7YA 4X66O 4LFCO 4JI7O 3SDLA 5LMUO 4NXNO 3J81N 4B3SO 4YHHO 4DV0O 4DV4O 1HR0O 2UU9O 4B3TO 2F4VO 5LMNO 4DR7O 1G1XB 2UUCO 4YY3O 1D2DA 4JI5O 1HNWO 3J80N 4DUZO 4DV3O 4DV6O 4DR6O 4JI1O 5H5NA 4GKJO 1I94O 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  4DR4 O;  4LF4 O;  1R1B A;  4OPH A;  2LW7 A;  4DV5 O;  4AQY O;  5IWA O;  1KUQ A;  1A32 A;  2UXB O;  1J5E O;  4LF5 O;  1IBL O;  1DK1 A;  2JRI A;  1IBK O;  3T1Y O;  4LF8 O;  1N32 O;  4JYA O;  1N36 O;  4LFA O;  4OPA A;  5BY1 A;  4DR3 O;  4NXM O;  3RT3 C;  3M8A A;  4A5U B;  1HNZ O;  2DJV A;  2UUA O;  3T1H O;  2E5L O;  1N34 O;  3F5T A;  2UUB O;  3JAM N;  4LF9 O;  4LF6 O;  1N33 O;  1XNQ O;  1AB3 A;  4LFB O;  4DR5 O;  4B3R O;  1FYJ A;  4JI0 O;  4X65 O;  1HNX O;  3J7A U;  1XMO O;  4JI8 O;  1YZB A;  4DV1 O;  2VQF O;  1IBM O;  5BR8 O;  5LL6 Y;  1X59 A;  2VQE O;  1AIL A;  2Z0A A;  4X64 O;  2ZM6 O;  2ZKO A;  4B3M O;  1XNR O;  5FLX N;  4LF7 O;  2N74 A;  1FJG O;  4DR1 O;  5IT9 N;  4DUY O;  4DV7 O;  4X62 O;  4JI2 O;  4OX9 O;  4JI3 O;  1FKA O;  4GKK O;  3O65 A;  4JI6 O;  2UXC O;  4DV2 O;  4JI4 O;  2FKX A;  4K0K O;  2HHH O;  1XMQ O;  2DOS A;  5A2Q N;  4KHP O;  1R6T A;  3OTO O;  2UXD O;  4DR2 O;  1XEQ A;  1NS1 A;  5BXZ A;  3R66 A;  1F7Y A;  4X66 O;  4LFC O;  4JI7 O;  3SDL A;  5LMU O;  4NXN O;  3J81 N;  4B3S O;  4YHH O;  4DV0 O;  4DV4 O;  1HR0 O;  2UU9 O;  4B3T O;  2F4V O;  5LMN O;  4DR7 O;  1G1X B;  2UUC O;  4YY3 O;  1D2D A;  4JI5 O;  1HNW O;  3J80 N;  4DUZ O;  4DV3 O;  4DV6 O;  4DR6 O;  4JI1 O;  5H5N A;  4GKJ O;  1I94 O;  4JV5 O; 
#chains in the Genus database with same CATH topology
 4OPH A;  2QWN B;  2KB1 A;  4MW3 A;  5GW7 A;  4AIL C;  2P22 C;  3WG7 C;  1OCO C;  3BCC H;  3K5O A;  4D6T H;  5GON A;  1S5H C;  2JRI A;  4FVM A;  2P90 A;  5EBL C;  1QU7 A;  1OCZ B;  4HBN A;  4OPA A;  4QIW F;  1GM9 A;  4PA6 A;  1FXK C;  1N33 O;  1CPY A;  4UVA A;  1JFF B;  4LFB O;  1GO3 F;  1H2K A;  5LMN B;  4FLX A;  3JYC A;  4I55 A;  3J7A U;  1XMQ B;  3QO5 A;  1R3K C;  1XI1 A;  5L3C A;  4WBN B;  1QBZ A;  4FZ0 A;  3OEE G;  1QVG U;  4G28 B;  3I55 V;  4LF4 B;  4ZKI A;  3KKY A;  2Q7G A;  3CXC U;  4LF5 B;  4K35 A;  1NR1 A;  2JEX A;  2Q7H A;  3JAS B;  4CC6 A;  4YHH B;  2JS3 A;  5FLX N;  3HKD A;  2RQ6 A;  4MT8 A;  5J2U B;  1VEW A;  4DR7 B;  1GN3 A;  2NLJ C;  1SQG A;  1W0J G;  2R70 A;  5EZY B;  4JI5 B;  2UUC B;  3CC4 V;  3T4Z A;  1S77 D;  4I4T B;  4EKW A;  2HVJ C;  1VQM V;  1XMQ O;  2QM8 A;  4UVC A;  2ADQ B;  2FYU H;  4NR1 A;  1VQ4 V;  5J2T B;  4UCV A;  1NS1 A;  2ZDI A;  5J9P C;  3SPG A;  3QF7 A;  5IJ0 B;  5F2V O;  4ZOL A;  1TUE B;  3ZHU A;  4LFA B;  5CA1 A;  1BHA A;  2JJ1 G;  1K5S A;  2RJZ A;  1HDJ A;  4YHH O;  3SPC A;  3JD3 A;  2YUA A;  1GKF A;  4DR7 O;  1M5I A;  1UJW B;  4XDL A;  2UUC O;  4JI5 O;  4GLX A;  1XNR B;  1HNW O;  3Q4H B;  3E8H A;  3RVY A;  1XIL A;  1VMG A;  4JI1 O;  5EC1 C;  2Q67 A;  2PTM A;  3JD2 A;  2EIN C;  4C7U A;  1S5J A;  2HJD A;  2OT5 A;  1YTF B;  3GB7 C;  3W7T A;  3CP1 A;  5DED A;  4MVS A;  5KAF Z;  4PA7 A;  1TUB B;  2YEV A;  4LFA O;  3RFR A;  3MDS A;  2X7R B;  4RUF A;  4MVU A;  3ZMU A;  3PN1 A;  1JMK C;  1Y76 A;  5IYZ B;  1XOU A;  3ZED A;  1GN4 A;  4CBC A;  5GTI Z;  1YIT V;  2WLN A;  4YIO A;  4CS2 A;  1XL6 A;  3E2E A;  4PA3 A;  4JAV A;  1MSW D;  2EIL B;  2GBO A;  4YJ2 B;  3HR0 A;  4AHC A;  2Y4U A;  1F51 A;  4IL6 Z;  2XND G;  4RWU A;  3OGI B;  5A9G A;  1J5E B;  2PY5 A;  2QKS A;  5EYP A;  5LYJ B;  4O4I A;  1NQT A;  4EB6 A;  4HYO A;  4B3S B;  2PF4 E;  2WAM A;  3HKE A;  1QLE B;  3JAW B;  1FJG O;  2XAQ A;  4G27 B;  4X1Y A;  1Y66 A;  5B1B B;  2QA4 V;  1NTZ H;  1NU1 H;  1ZX3 A;  1FAF A;  2FKX A;  2ZT9 B;  1Z2G A;  1MMM A;  1RSO A;  1ORQ C;  1VQ9 V;  3K0D A;  3E8F A;  2PGG A;  1YEW A;  5FNV B;  3WB1 A;  2AHY A;  4FFB B;  2X6A A;  4LCU C;  4B3S O;  3ZN1 A;  5HFL A;  1W2B U;  2HJF C;  1X4T A;  1ZUQ A;  1AI5 A;  4YJ3 B;  3L70 H;  2HP8 A;  5IY5 C;  3ASO B;  4MVZ A;  1K4C C;  1EFR G;  1DLB A;  2MW2 B;  3SYP A;  4Z2W A;  3TXS A;  4F6E A;  4JV5 O;  4O4L B;  1W59 A;  2PYL A;  1QR9 A;  3E35 A;  3B40 A;  1M1K W;  2L6L A;  2VWJ A;  4TUY A;  5H9C A;  4O4H B;  4TSF G;  1KKC A;  4CH5 A;  4LBE C;  1K9M W;  4B3M B;  4P9P A;  3BAB A;  2HLD G;  1L0L H;  4OGQ B;  4PDR A;  1NTK H;  4U7O A;  2P06 A;  2CH7 A;  1N0N A;  3E86 A;  3KCX A;  2HVK C;  4I5S A;  1MG1 A;  5K1X A;  3RYC A;  2WLJ A;  2CK3 G;  5DN6 G;  1KD1 W;  3PJS K;  1KC8 W;  2BE3 A;  2WLI B;  1CXZ B;  3K08 A;  1AJN A;  5B5E Z;  5LMU B;  4XDK A;  1E1Q G;  4B3M O;  2ZKO A;  5CBH A;  4DXW A;  4MW8 A;  5L3E A;  4LF7 O;  4TV8 B;  1FXH A;  3BEH A;  2OIG A;  1V55 B;  2F93 B;  3H1K H;  1NH2 D;  5LHI A;  4O2B B;  5JQG A;  2W0F C;  2Z3Y A;  5EIB D;  1K33 A;  5KMG A;  3IC7 A;  4IIJ B;  1M9N A;  1RM1 B;  1XNQ B;  3HPL C;  3SYA A;  4KHP O;  2QWR B;  2F1M A;  3FYI B;  3RYI B;  4LWS B;  3R66 A;  1SQV H;  4MS2 A;  5EIB C;  1N8R W;  1H8E G;  4G2K A;  4GCZ A;  5LMU O;  3ZMZ A;  1D5A A;  3U10 A;  1PNM A;  2DN9 A;  3A0B Z;  2YXL A;  1I7F A;  4NVP A;  1AR4 A;  1JA8 A;  1Q86 W;  4WFE A;  5EBM C;  4FM0 A;  1VIB A;  3CYO A;  4DV6 O;  1VP7 A;  3ZMV A;  2ZXW B;  1R1B A;  3DTU B;  2WA3 A;  4DV1 B;  1A32 A;  4JI4 B;  2HHH B;  5IJ9 A;  2Y0I A;  2DYS B;  3IGA C;  4GX1 A;  1YXB A;  3TCU A;  1V54 B;  2R9R B;  4H13 B;  4ZHQ B;  2O57 A;  3O9O A;  3P30 A;  4IT5 A;  1H2L A;  2IBZ H;  5JJE B;  2HKO A;  3VQX A;  2EJ7 A;  4EFE A;  4CS4 A;  4DK0 A;  1VF6 A;  1E79 G;  2NR5 A;  1YZB A;  4DV1 O;  2QJ1 A;  1AJP A;  4FZ1 A;  2WLL B;  4TWK A;  2A7W A;  3BRC A;  2QM4 A;  2RN9 A;  5E79 Z;  1XBL A;  4WFG A;  4PA4 A;  4YIP A;  3VQY A;  5C8Y A;  2FML A;  2Q5Z A;  2DYR B;  3AEI A;  1NTM H;  3ZCC A;  3SPJ A;  3UO2 A;  1V9P A;  3E8B A;  1FKA O;  1XHZ A;  3ABL B;  3DXR A;  4K0K O;  4CS3 A;  1YCI A;  4F6R B;  3CCQ V;  4Z1V A;  3OR6 C;  1H2G A;  4LP8 A;  4R50 A;  5BXZ A;  4IYI A;  3WFV A;  3UT5 B;  4PI2 A;  3TET A;  2EIM C;  2GV9 A;  5CB4 A;  1JJO A;  4W4K A;  1OCC C;  2LQT A;  1G1X B;  4YY3 O;  3ZRW A;  4KP4 A;  2LGQ A;  4JI0 B;  1AVM A;  5LHH A;  3HKC B;  3P32 A;  4OXS A;  1TVK A;  3P3P A;  3RW0 A;  2JS5 A;  2LFR A;  2F23 A;  4D7T A;  3K3W A;  2IJJ A;  4QPK A;  4FIP C;  2BTQ A;  2JGU A;  5CA0 B;  3K57 A;  2OIE A;  4DR1 B;  2K9P A;  1O9G A;  2DWD C;  2X6B A;  2ZNI A;  4RQF A;  2P67 A;  1FYJ A;  2OCC C;  4JI0 O;  1HNX O;  3TXQ A;  1WB7 A;  3JAT A;  1ZWI C;  2A3Q A;  2K1E A;  5AG2 A;  4X1K B;  1WP8 A;  3K03 A;  4TV9 A;  4DR2 B;  5KX5 A;  1XHX A;  1NVP B;  5JVD B;  4IYH A;  3CRM A;  5ITZ A;  3OR7 C;  1S3J A;  3T4D A;  1YTF D;  3CJH B;  5B66 Z;  3AK1 A;  2UU9 B;  5KA5 A;  2A0L A;  4UV8 A;  4DR1 O;  1JPX A;  3CRQ A;  1VQ6 V;  1G8M A;  3OMI B;  4JI6 O;  2WWW A;  2DOS A;  2EJR A;  4R8C A;  2QM7 A;  4I0X A;  3K5L A;  2UXD O;  4DR2 O;  1IBL B;  1F7Y A;  2YI9 A;  4X66 O;  2YID A;  3ASN B;  4X20 B;  1ENV A;  1DGS A;  1ZAU A;  3T2M A;  2QWO B;  1HR0 O;  4QE7 A;  2UU9 O;  5LXT A;  5JCO A;  1WA8 A;  3EHB B;  2EIL C;  2AXT Z;  2B1I A;  2M6Y A;  4JYC A;  5IYC O;  4ZI7 B;  4CZZ A;  4Z1M G;  2IJH A;  4AQY O;  3B2E E;  1IBM B;  3LUT B;  4MVR A;  4PEL A;  3S3X A;  3IC9 A;  3R65 A;  2L35 A;  1IBL O;  3TK1 A;  2D2C B;  3UM7 A;  5LGT A;  2QWP B;  5K1P A;  1QLE C;  3BY6 A;  2OYQ A;  4X64 B;  4QJF B;  1SS3 A;  3RT3 C;  1M56 C;  3OMN B;  3RWR D;  3CC7 V;  1GK9 A;  1NBM G;  3LDD A;  3OM3 B;  2RDC A;  3SPI A;  1KB9 F;  5GON B;  2F66 C;  2GUZ B;  4K8Z A;  2GTS A;  1IBM O;  5BMV A;  3JAR A;  4UB6 Z;  3RYH A;  1NZ6 A;  5BR8 O;  1JVM A;  2FTK A;  1FXV A;  5KHJ A;  5B3S C;  1X59 A;  4FLZ A;  4X64 O;  1SZX A;  3ASO C;  3DC5 A;  1XL4 A;  1CP9 A;  4I55 B;  4FLV A;  3STZ C;  2AW9 A;  4NXM B;  1Q6I A;  1Q90 D;  1WAZ A;  3O65 A;  3W7U A;  1VQL V;  2JJ2 G;  2ARH A;  3EXA A;  1S76 D;  3CC2 V;  3JSN A;  2FL4 A;  3VBB A;  5L3D A;  1R6N A;  2LO1 A;  3HKD B;  1SZT A;  3DC6 A;  3KCY A;  1N32 B;  3WB2 A;  1MNG A;  2UXX A;  1WNS A;  3NR7 A;  1LR1 A;  1H2S B;  5B1A C;  1K7D A;  2EIJ B;  3AG3 C;  5LMN O;  1N34 B;  4J11 A;  3CRR A;  4PA9 A;  2W0X A;  3J80 N;  5IDJ A;  5FL7 G;  2IW5 A;  4LF4 O;  4ZOL B;  3D36 A;  5CA1 B;  1WLE A;  1YDX A;  1DTO A;  5J2U A;  2IU3 A;  3ZIA G;  1T5E A;  4LF5 O;  1IVS A;  1WPB A;  4TT3 G;  3L9D A;  1N32 O;  4O4J A;  1JCH A;  3GWO A;  1P7G A;  3K58 A;  1YF2 A;  2DW4 A;  2VS0 A;  3K0G A;  2IJK A;  3OMA B;  3U0Z A;  3AG2 C;  1N34 O;  5EBW C;  1RM1 C;  5BZB A;  3D3Q A;  2CE4 A;  3OT7 A;  4J41 A;  1R3J C;  1KEC A;  4JAU A;  4UUJ C;  5KHG A;  1K34 A;  4PDL A;  1THZ A;  1SQQ H;  3WU2 Z;  2XAH A;  1GN6 A;  2IM9 A;  2XAF A;  4JYY A;  4DV3 B;  2YEV B;  5DM6 V;  3OFN G;  3C90 A;  5LP6 B;  4DW1 A;  5JJN B;  1TAE A;  2ZE5 A;  5GTH Z;  1QHT A;  1XNR O;  2N74 A;  3ETD A;  4H37 A;  2GTA A;  2YXH A;  4H0L B;  2ZXW C;  2EIK B;  3T1H B;  3RN4 A;  1I08 A;  1K97 A;  2YIB D;  4BAY A;  4GKJ B;  2P4K A;  1TUB A;  1IX9 A;  4KXR A;  5EYP B;  4O4I B;  3N2G A;  2DYS C;  2V7Q G;  1XDC A;  2R9A A;  2HEP A;  2KSD A;  1SET A;  2JVD A;  3N2K A;  4JZG A;  1IBK B;  4X1Y B;  2YIA A;  4UXN A;  3CCM V;  4JYA B;  4JTC B;  1YIJ V;  4ZBM A;  3B8N A;  1SQB H;  3E89 A;  3ICX A;  2UUA B;  1K92 A;  4YJ2 A;  2E75 B;  2ZQM A;  4MTO A;  2ADP A;  4H33 A;  1B6Q A;  2LW1 A;  2EBO A;  4U3J B;  4GKJ O;  2XAJ A;  1AI4 A;  1GM7 A;  1FFT B;  2P7T C;  2PUS A;  3JAW A;  1J5E O;  3ZHV A;  1YI2 V;  1QVF U;  5LA6 A;  1IXB A;  1DK1 A;  3FAV A;  4FM2 A;  2BCC H;  3EVK A;  3P3N A;  1IBK O;  1KU9 A;  2KQX A;  4JYA O;  2DYR C;  5TIS Z;  2JEU A;  2ZNJ A;  1PM9 A;  4BW9 A;  3UCS C;  4JTA B;  3H1J H;  1OCO B;  3WG7 B;  4CH3 A;  2UUA O;  3AK2 A;  3ABL C;  1Q8I A;  5H6Q A;  1AI6 A;  2WPD G;  4TUY B;  4X8A A;  2WLH A;  4LH7 A;  2PZS A;  4DR6 B;  1K8A W;  1IUR A;  1FXK A;  4DV5 B;  4FFK A;  2DE0 X;  4RQE A;  3ZRV A;  2Z0A A;  4PJ0 Z;  3K79 A;  5KA6 A;  1AJQ A;  2CH7 B;  1PPJ H;  3CXH F;  3RYC B;  2WA4 A;  2IH1 C;  1E1R G;  3CB2 A;  2G38 A;  4BIO A;  4ABM A;  3L73 H;  2W6I G;  1COW G;  3AG1 B;  2M7W A;  1RFY A;  4FLU A;  3X2Q C;  1GRJ A;  3T1C A;  2F43 G;  1LNQ A;  1XEQ A;  1P49 A;  4JI8 B;  4J7K A;  1L0N H;  3JCU Z;  3SDL A;  1YVW A;  3ZHR A;  2VRZ A;  5KMG B;  2ZIO A;  5IYD O;  1LUV A;  3A2F A;  4B08 A;  4WFF A;  3CCS V;  2LGW A;  1NVP D;  4LC1 A;  1NI8 A;  2AHZ A;  1PD3 A;  2XUM A;  1F4M A;  3GWK C;  1Y74 A;  2QTO A;  3OAA G;  3ZHS A;  3FB6 C;  4OX9 B;  2CTQ A;  2V4D A;  3M7M X;  1I0H A;  1VQ5 V;  4WFH A;  3IJ4 A;  3JAL A;  3LSQ A;  1NKD A;  2Y0P A;  3K59 A;  4I50 A;  4MTF A;  3M8A A;  1EM1 A;  4X9Q A;  5LBQ A;  1XNQ O;  2WLM A;  4JI2 B;  1TA8 A;  5IJ9 B;  1YJ9 V;  3DGE A;  3RVZ A;  2LFS A;  4NTX A;  4DV2 B;  3ABM B;  2QDO A;  1G6U A;  4MTX A;  4MVM A;  1AR1 B;  2ITC C;  3ASN C;  2BSK A;  3E8G A;  2YDE A;  2H8P C;  1AIL A;  2ODM A;  2V1D A;  1B06 A;  1Y6X A;  2Y69 B;  1N36 B;  3BVO A;  3CSX A;  2PYJ A;  1M57 C;  2R72 A;  3CMA V;  4JI2 O;  2E74 B;  2E5L B;  4MVO A;  4DV2 O;  4JI4 O;  2HHH O;  4DR4 B;  1PP9 H;  1PV0 A;  3MHH C;  3OW2 U;  4B3R B;  1PL4 A;  4IGG A;  5IWA B;  4X1I B;  2W6J G;  3UQ8 A;  2JDI G;  3JD4 A;  1VF5 B;  3QNE A;  5C8Y B;  3BHP A;  2HFE C;  2ZIN A;  4DK1 A;  3APO A;  3HKB A;  3LDE A;  3AG7 A;  4QPJ A;  1SF9 A;  3CEI A;  5JH7 A;  3DXR B;  4DRX A;  5LGN A;  3F7Y C;  3AG4 B;  4LF9 B;  4UVB A;  3QG5 A;  4DR5 B;  4LNU A;  1H2N A;  1QQC A;  2QE7 G;  4NYK A;  5H5N A;  3CCU V;  2Q9L A;  1K4D C;  4DR4 O;  1BE3 H;  5IWA O;  1ZL8 A;  3LSS A;  3CRA A;  3RBZ A;  5IY5 B;  1OCZ C;  4HNA A;  4R7C A;  3RYF A;  4I9Q A;  1J95 A;  3ZRW B;  1Q43 A;  1YHQ V;  2GSM B;  4ZIB A;  2KG7 B;  1BHB A;  2QKA A;  4F6R A;  1KBH A;  2QKC A;  1BT8 A;  3B4S A;  1FFX A;  4LF9 O;  4GYC B;  1F4N A;  1TVK B;  4DUY B;  1VQK V;  4DR5 O;  2F4V B;  4TOI A;  4U3F H;  1SKV A;  3JSL A;  4RO2 A;  4BR6 A;  3CX5 F;  2DMX A;  1YJN V;  1Z5V A;  4UCT A;  3BPZ A;  5DEC A;  1DF5 A;  2BTQ B;  1RPR A;  4ICG A;  1QLN A;  4PHZ A;  3JD1 A;  4LH6 A;  2H94 A;  2DQ3 A;  3ETG A;  3K9S A;  2ZIM A;  4JI7 B;  2EIJ C;  5KLV H;  3BA8 A;  5LOV B;  2YI8 A;  3WB0 A;  3T1Y B;  4DV0 B;  2CTP A;  2ZDI C;  3H1H H;  4MTG A;  4TQF A;  1D5N A;  4GX2 A;  1P84 F;  4TV9 B;  4DUY O;  4R6Z A;  2EUL A;  3QO7 A;  1OHH G;  5KX5 B;  1MZF A;  1I94 B;  1JJ2 U;  1YJW V;  3E22 A;  1R3I C;  4K8X A;  2YIC A;  4X65 B;  5CA0 A;  4JAA A;  2Z5U A;  4IHJ A;  3ZRX A;  5EC2 C;  2F95 B;  1M4U A;  4J10 A;  3STL C;  2ZE8 A;  2BOB C;  4LF8 B;  3JAK A;  1VQN V;  3ZMS A;  1GAX A;  4JI7 O;  3CCV V;  3K5M A;  3FB5 C;  3LDC A;  1GH6 A;  4DV0 O;  2OTL V;  1HNZ B;  4O2A A;  2PI5 A;  2P6J A;  5L3G A;  4I0X B;  2HG5 C;  4W4L A;  5B1O A;  2E3C A;  1I94 O;  5LP6 C;  2P5O A;  1UFI A;  4JI3 B;  1SES A;  1Q3E A;  4UB8 Z;  4WCE V;  3MD0 A;  2CUG A;  3CD6 V;  4FLW A;  4LF8 O;  3CE2 A;  4XDJ A;  4DO2 A;  2A06 H;  1WA8 B;  4XBF A;  3B09 A;  3L71 H;  1F23 A;  4WFA V;  1S72 V;  2YS8 A;  1HNZ O;  1BQ0 A;  2EIK C;  1BCC H;  3ETQ A;  1AP5 A;  3JAM N;  5KHI A;  3I5D A;  4B3T B;  1US6 A;  3W7W A;  3CRC A;  1Q6H A;  5FPR A;  4UFZ A;  4FLT A;  3BA9 A;  5CMU A;  3VQV A;  5FPO A;  2GDS A;  3L75 H;  5LL6 Y;  4JTD B;  3CME V;  1EN6 A;  5B1B C;  2Q7E A;  1SA0 B;  4NXN B;  1Q7Y W;  2JGD A;  2LJ2 A;  4ZI7 A;  2OWO A;  3MAQ A;  1OCR B;  2RNB A;  3JCZ A;  1WP7 A;  3AK3 A;  3CHX A;  5BMV B;  3JAR B;  3RYH B;  1U96 A;  1N33 B;  4LFB B;  5A2Q N;  4X88 A;  3H01 A;  3OEH G;  1EN5 A;  3CS5 A;  2UXB B;  5L3B A;  5HFM A;  1Q81 W;  3OGC C;  3SYQ A;  1BS3 A;  1VQ8 V;  2DWE C;  1ARO P;  1KP3 A;  1VQ7 V;  4NXN O;  3CCJ V;  1O9H A;  2ZD9 A;  2GUZ A;  4DW0 A;  1UPG A;  3G67 A;  1KQS U;  4CC5 A;  1VQO V;  2EIM B;  4D7S A;  3OUS A;  2RMK B;  4FJC C;  3ABK B;  1OCC B;  2LW7 A;  1BMF G;  1JFF A;  2UXB O;  1BQZ A;  1AI7 A;  1OV9 A;  1ZSP A;  3F7V C;  1I5Y A;  4WBN A;  2CGO A;  1PL0 A;  3G6E V;  2EZP A;  4JYB A;  1GM8 A;  3ABU A;  4NXM O;  1KYO F;  4RAI A;  5H6R A;  5KUK A;  4DV7 B;  2Q6A A;  3JAS A;  3AG1 C;  4JAS A;  4WFB V;  1GMG A;  4WF9 V;  2ZE7 A;  3ZS8 C;  2JK5 C;  1HNW B;  2ITD C;  4O4J B;  5EZY A;  5B1N A;  4JGS A;  4JI1 B;  3OTO B;  1R3L C;  4I4T A;  3IAY A;  3ZHT A;  1V55 C;  2B9Z A;  2OCC B;  3OUF A;  2LP7 A;  4N21 A;  3GVM A;  3QVN A;  2XHB A;  1BL8 A;  3G4S V;  5J2T A;  1JR9 A;  3ML0 A;  1IDS A;  4HZ3 A;  5CBF A;  5IJ0 A;  4U7N A;  1QNM A;  1VQP V;  4DV7 O;  2FB5 A;  3CPW U;  2H3O A;  1I5X A;  5LHG A;  3U11 A;  2Y48 A;  1Y76 B;  3FD9 A;  1WN7 A;  2VWK A;  3OTO O;  3G80 A;  3Q4H A;  2PI4 A;  2ZR2 A;  3FB7 C;  4TQD A;  4QNH B;  4GUN A;  4QGP A;  2ZE6 A;  1WJZ A;  2BTO A;  4J7J A;  5LP6 A;  4FM1 A;  3ABM C;  1RPO A;  3N2G B;  4GZR B;  4YXW G;  1M93 A;  2A9H A;  4GT1 A;  5JWP A;  2QR4 A;  1FJG B;  4DV3 O;  3N2K B;  3LSU A;  4EB6 B;  2P4V A;  2AGA A;  3HKE B;  1V54 C;  5IYZ A;  1XMO B;  1H38 A;  1H8H G;  4FLY A;  1RP3 B;  4P30 A;  1TGO A;  1AP6 A;  3JD0 A;  2VQE B;  5CBG A;  2Y69 C;  3ABT A;  1BSM A;  2ZM6 B;  4N23 A;  4B7E A;  4RUE A;  1EZV H;  1RSO B;  1VF6 C;  1CEZ A;  1KKD A;  1HWY A;  2A79 B;  2ZCE A;  3T1H O;  5KUM A;  3F5T A;  5LYJ A;  3SGI A;  1EZJ A;  3A0R A;  5LA6 B;  2CAZ C;  2UXC B;  3FAV B;  1XQ8 A;  5JJJ B;  1Z5W A;  2B5U A;  1MOF A;  4PV1 B;  1XMO O;  1M56 B;  3A0H Z;  1KMI Z;  1IZ3 A;  4JV5 B;  1YSC A;  2ETN A;  1MZE A;  2VQE O;  1VF7 A;  3SYO A;  3APQ A;  4KL1 A;  1NR7 A;  2ZM6 O;  2IH3 C;  3NXS A;  3HB3 B;  4U3J A;  3AG4 C;  3OTF A;  2Q0A A;  4E2L A;  2QSA A;  5B3S B;  4AI8 A;  5FNV A;  5IT9 N;  4KFM A;  4FFB A;  2QTS A;  2ZR3 A;  1FXK B;  2D3O W;  2UXC O;  4PI0 A;  2XT9 A;  1MSD A;  4YJ3 A;  3C3T A;  1R6K A;  4X89 A;  3B8M A;  4H44 B;  3TGU H;  5CN0 A;  3UKM A;  3EFF K;  3SYC A;  4Q6G A;  4CH6 A;  1SQX H;  4O4L A;  1P4R A;  4I9W A;  5LGU A;  4O4H A;  4UCU A;  1BZK A;  3ZN0 A;  1M90 W;  4LF7 B;  1S5L Z;  4DR6 O;  5B1A B;  4DYL A;  4L87 A;  3FFQ A;  4DV5 O;  3AG3 B;  5IE9 A;  2XTA A;  2VQF B;  2X6C A;  5JQG B;  4KHP B;  2R9I A;  3ZRS A;  4EEQ A;  3OD4 A;  1AR5 A;  3LNN A;  3FB8 C;  1Y74 B;  1NJI W;  2WLI A;  1JX9 A;  1SQF A;  3QTC A;  3D3I A;  1AB3 A;  1OZ0 A;  4JF3 A;  3KZI Z;  4J80 A;  1GTO A;  4TV8 A;  3JAL B;  5D5Q A;  4Q20 A;  2Q68 A;  4CH4 A;  4O2B A;  4DV6 B;  4JI8 O;  2VQF O;  3AG2 B;  4I50 B;  2EIN B;  4IIJ A;  2MK3 A;  3OE7 G;  3VQW A;  1IXM A;  1K5Q A;  4P9O A;  4UCS A;  4PD4 F;  1Y67 A;  2IU0 A;  3RYI A;  4LWS A;  2Q69 A;  3L72 H;  2YSU B;  3I56 V;  2QWQ B;  5KHK A;  1G4Y B;  1FPO A;  2NNU A;  3MHS C;  2CTW A;  4OX9 O;  1XUQ A;  3ZMT A;  2Q0O C;  2NN4 A;  2BSK B;  1FS0 G;  3D8C A;  3M99 B;  4NTW A;  1R6T A;  2E76 B;  3SPH A;  5JCO C;  1NT2 B;  4JZ2 A;  5D5P A;  2WLK A;  5IYB O;  2WSS G;  2XAG A;  3RGB A;  1QR8 A;  3A8T A;  2X0L A;  3J81 N;  1Q82 W;  1WPX A;  4UV9 A;  1OJH A;  2QGN A;  1U97 A;  3CCE V;  2UUB B;  1EN4 A;  2QEX V;  2GHY A;  4ZHQ A;  2YIB A;  3E83 A;  2YXY A;  3HKB B;  1LUW A;  1SRY A;  1DF4 A;  1VAR A;  1ZTE A;  4K0K B;  1GN2 A;  3IFX A;  2AZ0 A;  5JH7 B;  1BGY H;  2RCV A;  3G71 V;  4DRX B;  3C3S A;  3CWB H;  4QE9 A;  1OCR C;  1Y4M A;  3BFR A;  3ZX6 A;  1N36 O;  4LNU B;  5L3F A;  2CTR A;  5BY1 A;  1Q5O A;  3KG2 A;  2WLL A;  3SJB C;  1PNL A;  4X1I A;  3UO3 A;  4A5U B;  3LNM B;  5KHH A;  2E5L O;  2UUB O;  1ZL8 B;  1MAB G;  3FX7 A;  4J7Z A;  4X62 B;  5H2F Z;  4B3R O;  3H1I H;  4JPR A;  4HNA B;  3ZHQ A;  5CB4 B;  4FPP A;  4YY3 B;  3RYF B;  2CDY A;  2Q8V A;  1JQ0 A;  3THO A;  2IJI A;  4LFC B;  1FFX B;  1PKX A;  1XRE A;  2Q4P A;  1R73 A;  3K9A A;  3ZBH A;  3F5W C;  2HR3 A;  4MSW C;  3UT5 A;  4EFB A;  3ABK C;  1MA1 A;  4BIZ A;  4X62 O;  4UCO A;  4DUZ B;  4F4L A;  2Y4T A;  4ASU G;  2Q73 A;  3TJT A;  2N05 A;  3SJA C;  4J9Y B;  1Q6U A;  1B3Q A;  2ATK C;  4UCR A;  2KG7 A;  1HNX B;  1HW7 A;  1ROP A;  1W0K G;  2XAS A;  3ETE A;  4LFC O;  3H1L H;  3HKC A;  3JAT B;  2N04 A;  1HP8 A;  3B77 A;  3X2Q B;  3D36 C;  5C93 A;  4DR3 B;  2F4V O;  3E22 B;  1PNK A;  3CCR V;  3S3W A;  2XOK G;  4LF6 B;  1D2D A;  2EX3 A;  4DUZ O;  4NB5 A;  4IHJ B;  1K73 W;  4J42 A;  5ITZ B;  3VOU A;  3JAK B;  1P7B A;  5LOV A;  1ZLZ A;  4JI6 B;  4MVQ A;  1KUQ A;  1EBO A;  1H2M A;  2OTJ V;  4J9Z B;  1SQP H;  1NH2 B;  2ILM A;  4O2A B;  1L8D A;  3H9V A;  3T1Y O;  1S0V A;  2UXD B;  4X1K A;  1SER A;  2OCH A;  3SJQ C;  4X66 B;  3FYE B;  2DQ0 A;  4BW5 A;  4DR3 O;  2DJV A;  3QO8 A;  4GX0 A;  5JVD A;  4LF6 O;  3CCL V;  1HR0 B;  1K3E A;  4GKK B;  3CJH A;  4X65 O;  4FK5 C;  1URF A;  2B1G A;  3SR2 C;  5LXT B;  4BIU A;  3SJC C;  5CA3 A;  3K04 A;  4AQY B;  1FD9 A;  2JIZ G;  4PDV A;  4BWA A;  1SC5 B;  4DV4 B;  2BOC C;  2YC0 A;  3ZJZ A;  1N0J A;  4PDM A;  4LR3 A;  4X20 A;  4JI3 O;  4NTY A;  4GKK O;  4B7K A;  4I7Z B;  1WB8 A;  2KKW A;  5KAI Z;  3DSQ A;  4E4E A;  1B04 A;  3BAA A;  3N27 A;  2CGN A;  2JGD B;  1M57 B;  4KUM A;  4FMT A;  1KP2 A;  2EZO A;  4K3A A;  3L74 H;  5EK0 A;  1JOY A;  4L8J A;  1L1F A;  5BR8 B;  5E1A C;  3W7X A;  4DV4 O;  3FKS G;  4B3T O;  3K5N A;  2UXN A;  4P2Z A;  1N4C A;  4HAM A;  3G6B A;  1QCE A;  2AZ2 A;  4NKG B;  3K06 A;  4GX5 A;  3W7S A;  2C2A A;  1SA0 A; 
#chains in the Genus database with same CATH homology
 2AGA A;  4DR4 O;  4LF4 O;  1R1B A;  4OPH A;  2LW7 A;  4DV5 O;  4AQY O;  5IWA O;  1KUQ A;  1A32 A;  2UXB O;  1J5E O;  4LF5 O;  1IBL O;  1DK1 A;  2JRI A;  1IBK O;  3T1Y O;  4LF8 O;  1N32 O;  4JYA O;  1N36 O;  4LFA O;  4OPA A;  5BY1 A;  4DR3 O;  4NXM O;  3RT3 C;  3M8A A;  4A5U B;  1HNZ O;  2DJV A;  2UUA O;  3T1H O;  2E5L O;  1N34 O;  3F5T A;  2UUB O;  3JAM N;  4LF9 O;  4LF6 O;  1N33 O;  1XNQ O;  1AB3 A;  4LFB O;  4DR5 O;  4B3R O;  1FYJ A;  4JI0 O;  4X65 O;  1HNX O;  3J7A U;  1XMO O;  4JI8 O;  1YZB A;  4DV1 O;  2VQF O;  1IBM O;  5BR8 O;  5LL6 Y;  1X59 A;  2VQE O;  1AIL A;  2Z0A A;  4X64 O;  2ZM6 O;  2ZKO A;  4B3M O;  1XNR O;  5FLX N;  4LF7 O;  2N74 A;  1FJG O;  4DR1 O;  5IT9 N;  4DUY O;  4DV7 O;  4X62 O;  4JI2 O;  4OX9 O;  4JI3 O;  1FKA O;  4GKK O;  3O65 A;  4JI6 O;  2UXC O;  4DV2 O;  4JI4 O;  2FKX A;  4K0K O;  2HHH O;  1XMQ O;  2DOS A;  5A2Q N;  4KHP O;  1R6T A;  3OTO O;  2UXD O;  4DR2 O;  1XEQ A;  1NS1 A;  5BXZ A;  3R66 A;  1F7Y A;  4X66 O;  4LFC O;  4JI7 O;  3SDL A;  5LMU O;  4NXN O;  3J81 N;  4B3S O;  4YHH O;  4DV0 O;  4DV4 O;  1HR0 O;  2UU9 O;  4B3T O;  2F4V O;  5LMN O;  4DR7 O;  1G1X B;  2UUC O;  4YY3 O;  1D2D A;  4JI5 O;  1HNW O;  3J80 N;  4DUZ O;  4DV3 O;  4DV6 O;  4DR6 O;  4JI1 O;  5H5N A;  4GKJ O;  1I94 O;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...