2UXDO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxdO00
4DR2O 4DV3O 1DK1A 2VQEO 1I94O 5IT9N 4DR4O 1R6TA 5A2QN 3M8AA 4B3SO 1HNWO 3J81N 5LMNO 1IBKO 2UUBO 4A5UB 4JI2O 5BXZA 4DV7O 1XNQO 4JI6O 4JI1O 1HNZO 1YZBA 2Z0AA 5IWAO 4X66O 4JI7O 2UXBO 4JV5O 4JI4O 3RT3C 1XEQA 2LW7A 1XMQO 2F4VO 4OPHA 4DR5O 2JRIA 2UUAO 4AQYO 1N34O 1KUQA 2E5LO 4JI3O 1IBMO 4NXMO 1R1BA 3OTOO 4DV5O 2FKXA 3T1YO 4JI8O 4B3RO 4JI0O 1XMOO 2UXCO 5BR8O 4LF6O 4B3TO 4DV6O 4DR6O 1IBLO 4DV2O 4KHPO 3F5TA 4X62O 4DUZO 4LF8O 1AILA 4OPAA 4X64O 2ZM6O 2AGAA 1N33O 4GKJO 4GKKO 1XNRO 2ZKOA 3R66A 1N36O 4LFAO 1A32A 1NS1A 4YHHO 1FYJA 5LL6Y 2DOSA 3J7AU 4JYAO 4YY3O 1FKAO 5LMUO 3J80N 3T1HO 2DJVA 3JAMN 1F7YA 2UXDO 1D2DA 1N32O 1J5EO 4B3MO 5BY1A 4LF9O 4DR3O 5H5NA 4X65O 4DUYO 1HNXO 1AB3A 1HR0O 4DR1O 4LF5O 1X59A 4LFBO 4JI5O 4LF4O 3SDLA 4LF7O 4DV1O 4OX9O 4DR7O 2VQFO 1G1XB 1FJGO 5FLXN 2N74A 2UUCO 2HHHO 4NXNO 4DV4O 2UU9O 3O65A 4K0KO 4DV0O 4LFCO
chains in the Genus database with same CATH superfamily
5JJJB 4B7EA 3ZS8C 4N23A 3FB7C 1Q82W 5GW7A 4DV3O 1N4CA 1GN4A 2VQEO 1TUBA 2ILMA 5CBHA 3CC2V 3CSXA 2FB5A 3DSQA 4YJ2B 3J81N 1IBKO 1ENVA 2MK3A 1GH6A 2AHZA 1R3LC 4UCOA 4LR3A 3X2QB 1YJ9V 2CGNA 1S3JA 4OPHA 2E3CA 4R6ZA 3OTOB 4DV5B 1GRJA 3ZMUA 3MHSC 1YXBA 5FNVB 3CCLV 2R72A 5IE9A 3CC4V 1Y4MA 2LW1A 3OGIB 3RYIA 3NXSA 3T2MA 4B3RO 1XMOO 1BMFG 4E4EA 2HFEC 1N33B 4DV6O 2VWKA 1MA1A 3AG1C 1H2MA 4PA6A 1U97A 4KP4A 4DR6O 1MNGA 5KHHA 3ZHSA 2WLNA 5LGNA 3L9DA 3JARA 3N2KA 4I9WA 3B8MA 4FPPA 2RMKB 3AK1A 1XNRO 3CRMA 3KCXA 3IGAC 4RO2A 1JX9A 2Y4UA 2BCCH 4YY3O 3FYIB 1M90W 1YCIA 1XL4A 2YC0A 1YTFB 1IX9A 1WLEA 4MVZA 3D36C 4LF7B 3G67A 4JGSA 3CJHA 4LFBO 3ZHVA 2UU9B 5J2TA 4LF4O 1KBHA 1N0NA 4NVPA 2ZXWB 3ZRXA 4D7TA 3ZN0A 4B3MB 4IHJA 1NKDA 1HW7A 3N27A 4X20B 3VQYA 3RW0A 4K0KO 4DV0O 2PTMA 2Q0AA 4IL6Z 5LP6C 3JAWA 2YIBD 1OCCB 3PN1A 5LBQA 5CA3A 4RQFA 4J11A 1AI7A 1AJQA 1ROPA 4QE9A 2QKSA 3B40A 4JASA 4O2AA 1YSCA 1LUVA 5EBLC 1NR7A 4JPRA 5C93A 4IIJB 2QA4V 3CCQV 5LA6A 1YF2A 2NR5A 2EILC 4P9OA 3D36A 5CN0A 5EC2C 1YIJV 2H3OA 4MW8A 1XMQO 2IW5A 4AQYO 3CYOA 4UCSA 3G80A 5IYBO 2KSDA 1VQ7V 3CCEV 4I55B 2EZOA 1SF9A 1KKCA 3T4ZA 2B5UA 5H9CA 3E35A 4LF8B 4JAUA 3KZIZ 2Q0OC 2W0FC 4B3TO 5L3EA 3P30A 3E8GA 3TXQA 1R6NA 5B66Z 3B77A 1NBMG 3E22B 2DWDC 2JGDB 1BE3H 3H1LH 1O9GA 1WNSA 4C7UA 3HKCA 3JSNA 4KL1A 4JYBA 4X1YA 4WFAV 2QEXV 4DR1B 3JD4A 3CCJV 4DR3O 1ZTEA 3CE2A 3DC6A 3K3WA 2A06H 2E76B 1GN2A 1FFXA 3AEIA 3CRAA 5H2FZ 1Q5OA 3SDLA 4DV1O 3KCYA 3I5DA 1LNQA 2BOCC 3OMNB 1W59A 2YEVB 3UT5B 2A7WA 4RWUA 3H1KH 4FFKA 2K1EA 1MMMA 1CXZB 5B1BC 1WJZA 5JJNB 3CS5A 4LNUB 2OTJV 2LP7A 1ZSPA 1NR1A 1NTKH 2XOKG 4F6RA 3AG2B 1SERA 3SPCA 2IJIA 3APOA 4UCRA 1NH2D 5LHIA 3CCUV 1VARA 2AZ0A 3TCUA 3B4SA 4O2BB 3RYCA 2H8PC 2VRZA 1TA8A 1R73A 4JI0B 2Q8VA 1JVMA 2V1DA 3RN4A 2EIMB 1BQ0A 1MZFA 3QG5A 1R1BA 3OTOO 4DV5O 2FKXA 3ZRVA 5L3BA 2OCHA 3EVKA 3ZX6A 2EIJB 1G6UA 1O9HA 1FXKC 4J7KA 3LDCA 1P7BA 2AGAA 2KB1A 1N33O 1VQ9V 4XDKA 3X2QC 2QWOB 3RGBA 1Z5VA 3IC7A 1NVPB 1RM1B 1JFFB 2CAZC 4NB5A 5LXTA 1OCZC 4JI5B 1YEWA 1EN5A 2CDYA 2DQ0A 3LSQA 4CBCA 2YI9A 1R3JC 3UQ8A 4MW3A 1K8AW 2YIDA 1TVKB 1ZWIC 4FZ0A 3S3XA 3MAQA 1B3QA 2Q9LA 4FM0A 4O4JB 4JTDB 4LF7O 1VF5B 4FLTA 4R8CA 2ZD9A 5C8YB 1Y76B 2UU9O 4W4KA 5EC1C 4DW1A 4TT3G 1H8EG 3UM7A 1YHQV 5IT9N 2HJDA 2QTSA 4G28B 3K58A 1MSWD 2CTRA 1KB9F 2CGOA 1M57B 4LBEC 4JV5B 1Y67A 4TWKA 1D5AA 2OCCC 3FB8C 5FNVA 1W2BU 1JMKC 2ZQMA 4YXWG 1N34B 3APQA 1SQPH 4FM2A 4JI3B 3ML0A 3STZC 2BOBC 3DXRB 1GM8A 3RFRA 4I9QA 5AG2A 2CTPA 3ABMB 4JI8B 4ZHQA 1H2LA 1OCRB 2BSKA 2Y69B 1IBLB 4DV2B 1B6QA 3A0RA 4UFZA 1L8DA 3E89A 1V55C 3WG7B 4H13B 3M7MX 4GX2A 3OTFA 3DTUB 1VF6C 2ETNA 4PD4F 3STLC 4LF8O 3G6EV 1M5IA 1AILA 2M7WA 2Q7EA 1QNMA 4JYCA 4R50A 4XBFA 4JYAB 4BWAA 1W0JG 2FYUH 2X6AA 2WAMA 2JK5C 1XUQA 2DOSA 2YI8A 2Q5ZA 2LFRA 4J7JA 2ZE5A 5BY1A 2QM7A 4UB6Z 4NR1A 1WA8A 4X20A 3P3PA 4DR1O 3ZRSA 1IZ3A 3RVZA 1UJWB 4WFBV 1AR1B 1GTOA 4KXRA 4JTCB 3QNEA 5IY5B 3HKEB 2HG5C 3ZHUA 4FVMA 5KMGA 1VF6A 4DR4B 1NTZH 4IIJA 4MVSA 2EJ7A 2XASA 1R6KA 3H01A 4ZBMA 4JI2B 4MVRA 1M9NA 5IJ9B 2H94A 4JI1B 2Q7HA 2WA3A 1FD9A 3AG3C 4IYIA 3P32A 3I56V 4I55A 4DW0A 4JZ2A 2WLKA 1IBMB 1AI6A 3ETDA 4K3AA 2EX3A 3CP1A 1MG1A 1LR1A 4PELA 2QDOA 4LF6B 2A9HA 4KHPB 4LWSA 3E22A 4RUEA 2GV9A 4U3JB 1OZ0A 2JGDA 3S3WA 3E8BA 4I0XA 3SPGA 1XMQB 4JI0O 1GK9A 5JCOC 3K57A 3BAAA 4H33A 2UXCO 2ATKC 4I50B 5EYPB 2WSSG 4BW9A 3SJAC 1BQZA 3U10A 2GTSA 3E83A 4J7ZA 4X8AA 5LMUB 1MZEA 2JS3A 1RPOA 2ZKOA 2K9PA 3R66A 1N32B 1PPJH 5JWPA 1S0VA 3HKBB 3JD1A 1U96A 4QNHB 2QSAA 5CA1B 3VQWA 1FXHA 1OCOB 3FX7A 4GUNA 2EIMC 4GX1A 2V4DA 1ZX3A 3UT5A 5KHKA 1K4CC 1QHTA 1S77D 2Q69A 4J9ZB 4E2LA 4GLXA 4JI5O 1KMIZ 2BTQB 2P4VA 2XAQA 2P6JA 5JCOA 1Q3EA 1I94B 2F43G 4PA7A 4LNUA 3RYHB 1K34A 4B3SB 3ZN1A 3T4DA 1PNKA 1MABG 1AP6A 1KKDA 2X6BA 1NZ6A 4O2BA 2GDSA 2E75B 1K7DA 4O4IB 5D5QA 4ZKIA 5EZYB 2BTOA 4JV5O 3CX5F 2E5LB 4TSFG 1BS3A 3K5LA 4FLVA 1N34O 1ZAUA 3ZMSA 3HKDA 4QPJA 3OE7G 4TV8A 4JI3O 4H0LB 1NJIW 5GONB 4TQFA 4JI8O 2ZE6A 2ZM6B 4AHCA 1EZJA 4MVOA 1F4NA 1IBLO 2FMLA 4DV2O 4LFAB 4GX0A 1JPXA 2PYLA 4O4LB 4PHZA 2ADQB 1EN6A 3MHHC 4ZI7B 2HKOA 5B3SC 3G6BA 3CXHF 5E79Z 1FYJA 1WPXA 3LSUA 3W7SA 4JYAO 3W7WA 3OMIB 3J80N 4X1KB 4LF5B 3L72H 2ZT9B 1OCRC 5L3CA 5C8YA 1P4RA 4CS3A 2QWNB 1JJ2U 1F4MA 4PV1B 2OYQA 3BRCA 5KUKA 4DV4B 4RUFA 5H6QA 1H2GA 4HZ3A 2CTWA 5K1PA 1VP7A 2EINC 1N0JA 2UXNA 3SPJA 5GTHZ 1GAXA 3ETQA 3MDSA 2Y0IA 4Z1MG 3N2GB 4L8JA 3BPZA 4PJ0Z 4DV7B 4FK5C 1S72V 4DR4O 1R6TA 5IWAB 3W7TA 4X66B 4TOIA 4ZIBA 4JI7B 4PDVA 4A5UB 3BCCH 1Z5WA 4JI2O 3EFFK 1WB7A 1QBZA 1VQKV 2JEXA 3GWKC 3JAKB 4JI1O 2WLLB 3ZHQA 1XOUA 4YJ3B 3GVMA 4ABMA 1K5QA 1LUWA 5CA0B 5IY5C 1RSOB 4FMTA 2PF4E 2JRIA 2GUZB 1Q90D 2WPDG 5KUMA 4J41A 2F23A 5CBGA 4L87A 5B1OA 3SJBC 3OW2U 1IBMO 4MTOA 1E1RG 1XBLA 2PI4A 1SRYA 1YDXA 3OMAB 2PGGA 2WLIB 3Q4HA 2DQ3A 1AI4A 5ITZB 3L75H 1CPYA 4EFEA 4LF6O 3ASOB 4GKKB 4KHPO 2WLMA 4EEQA 1K92A 2FL4A 2KKWA 1ZL8A 3AK2A 4BIZA 4PDRA 3CD6V 1Q6IA 4QJFB 5LYJB 4OPAA 3TGUH 4JF3A 1VQLV 4PA4A 3RVYA 1I5YA 5J2UB 2ZE8A 3SYPA 1P49A 4LF9B 3CXCU 1HNXB 1VF7A 5LMUO 4NTYA 2L6LA 3K0DA 2DJVA 4RAIA 1N32O 4HNAB 3IC9A 3BHPA 3K08A 3A8TA 2LGQA 2DW4A 4QE7A 1KYOF 1VEWA 4OX9B 4JAAA 2UUCB 2V7QG 3RYFA 4NXNB 4G2KA 4B7KA 3JASB 4TUYB 4UV8A 1PNMA 3C90A 4EKWA 2ZNIA 5KA5A 1VIBA 5FPRA 5LHGA 2Y4TA 4BR6A 1Q43A 5IJ9A 4DR2B 1UFIA 5JH7B 5FL7G 1HNWB 4H44B 3LDEA 3ABLB 3JATB 5TISZ 3THOA 2B9ZA 3CCVV 2JJ1G 3K9SA 1KQSU 1I94O 1XNQB 4EB6B 3L74H 4B3SO 3U11A 2DYSB 1GM9A 4LC1A 3JSLA 2YXHA 4MSWC 2DYRB 3ETEA 1YZBA 4CH4A 2JJ2G 3OFNG 1ZLZA 2QJ1A 2WLJA 1XHZA 2ITCC 2M6YA 1YI2V 4WBNA 4NXMB 2X0LA 4I50A 1IXMA 4OGQB 3F7YC 3ZIAG 2E5LO 3K5MA 3ZBHA 3ABUA 3IFXA 1NI8A 3ZMTA 3SJCC 3H1HH 4DUZB 3HPLC 4BIOA 3B09A 2Q7GA 3HKBA 1SS3A 1T5EA 5CA1A 4I5SA 3KG2A 2ZM6O 2LGWA 2F66C 2UXCB 4LFAO 2B1GA 1Y66A 5FPOA 3E8HA 5EK0A 1YJWV 1ZUQA 3ABKB 4DUYB 3J7AU 4DRXB 3FYEB 1KP3A 4O4HB 1FFTB 1F7YA 2BTQA 1BL8A 2RDCA 2XTAA 1M4UA 5H5NA 1JR9A 2CUGA 3GWOA 2ADPA 1FJGB 4LF5O 2HHHB 5LGUA 1FXVA 4ZOLB 5JVDB 5IYZA 3W7UA 2W6IG 2NN4A 3FB5C 3C3SA 1F51A 4DV4O 4YIPA 4Z2WA 5LMNB 4Q6GA 2LJ2A 4O4IA 4N21A 4JI6B 5BMVA 1GN6A 3ZEDA 1SZTA 1CEZA 2ZNJA 2IJHA 4UCUA 2RCVA 4P2ZA 2HR3A 1MSDA 4DV7O 1NQTA 5KX5B 3CHXA 5LGTA 2D2CB 4YJ2A 5IWAO 3OUSA 4X66O 4JI7O 2IBZH 4TV9B 3BFRA 1I5XA 3QVNA 5GONA 5EBMC 2VWJA 2ZIMA 2X7RB 4MT8A 2LW7A 1AROP 3RYIB 1H38A 2Q68A 3CRQA 1N8RW 4MTGA 1SZXA 3ASNB 4O4LA 4X64B 1X4TA 4ZI7A 1SA0B 3BEHA 3BA8A 1Q6HA 4ICGA 1WPBA 4R7CA 2ZXWC 1URFA 4PA3A 3SPIA 4GKKO 2ARHA 3CCRV 4DO2A 3T1HB 5H6RA 1K73W 2UXDB 1OCCC 3L73H 5LL6Y 3L71H 4U7NA 2O57A 2WWWA 1OHHG 4LF9O 1Z2GA 5J2TB 1HNXO 4LH6A 1HDJA 1SQGA 4X89A 1XL6A 4F6EA 3ASOC 1SKVA 4GT1A 4OX9O 2GSMB 4Q20A 3K79A 3F5WC 2UUCO 3OUFA 2RN9A 4NXNO 1GMGA 1PM9A 4QGPA 2UUBB 1BCCH 2WA4A 3JAKA 4DR2O 1DK1A 2IU3A 1BHAA 2CH7B 1THZA 2Y0PA 3UCSC 4UV9A 1HNWO 2ZCEA 1M56B 3DC5A 3U0ZA 1XNQO 2CTQA 2GUZA 1D5NA 2QE7G 1Y6XA 3JYCA 4DR5B 3JD0A 3OD4A 4LCUC 2UUAB 1K3EA 5B1NA 2FTKA 3QTCA 1XHXA 2DWEC 2XNDG 4GZRB 4WF9V 3RBZA 5A9GA 2YDEA 5LP6B 1V9PA 4J10A 4NXMO 5LYJA 3ABLC 4IGGA 4OXSA 3SGIA 2IJJA 4GKJB 1F23A 3D8CA 3LDDA 4NTWA 2RJZA 4XDJA 2YXLA 3OEEG 4DUZO 5HFMA 3M99B 2QGNA 4X88A 1OJHA 4DK1A 4WFHA 2QWRB 4HNAA 3SJQC 1GKFA 2IM9A 2VS0A 4WCEV 3UO2A 4D7SA 3H1JH 1K97A 1NS1A 4X65B 1FS0G 3QF7A 4FM1A 1KU9A 4TUYA 1FFXB 2YUAA 3LUTB 3P3NA 1Q81W 3ZRWB 1XI1A 4DUYO 1AR5A 5EBWC 2R9RB 3AG2C 4MVUA 5CBFA 2XHBA 1DF4A 4WFEA 4CH3A 1PNLA 1EM1A 2LO1A 4GX5A 1FJGO 2MW2B 2Z5UA 5CB4B 2L35A 2HHHO 1JCHA 4U7OA 3O65A 4MTXA 5KHIA 1VQ4V 4Z1VA 4FFBB 2XAFA 2YEVA 4NKGB 1FAFA 1RFYA 4F6RB 3M8AA 4LH7A 5LMNO 3CCMV 2EIJC 1KC8W 1AVMA 3LNNA 2KG7B 2Q6AA 4JI4B 1L0LH 4JI6O 3LNMB 2F4VB 4W4LA 4DYLA 4P9PA 4HYOA 2EIKB 4GCZA 2DN9A 5B5EZ 5HFLA 2YXYA 3CPWU 3RT3C 1GO3F 2Z3YA 4I4TB 1RM1C 3L70H 3K5OA 5EIBC 1WP8A 1P7GA 4JTAB 4J80A 2PI5A 2EJRA 1DLBA 1GN3A 4PI0A 5DM6V 4JAVA 1BGYH 3OEHG 1E79G 1YITV 1SQQH 3EXAA 1N36B 4ASUG 2GHYA 4X64O 4YHHB 1QQCA 2P7TC 4UXNA 5IJ0B 1K9MW 5LXTB 1J95A 1I08A 1L0NH 2N04A 2C2AA 2ZIOA 1WB8A 4ZOLA 3CMAV 3T1HO 1Q86W 2UXDO 3HB3B 2LFSA 1PL0A 1M57C 1PD3A 1VQ6V 1AB3A 3ASNC 4FLXA 1JFFA 2HEPA 3C3TA 4IYHA 3K9AA 1VQMV 4UCVA 1E1QG 2LQTA 1COWG 1FXKB 2VQFO 1TVKA 2P4KA 3FFQA 1IURA 1Y74B 5J9PC 4O4JA 1SQFA 3ABMC 1RP3B 1Q7YW 4MVQA 1SETA 3TETA 5KX5A 2Y69C 5B1AB 2XT9A 3LSSA 4FZ1A 1Y76A 4X9QA 1AR4A 4TV9A 1SESA 1SC5B 1SQXH 5E1AC 3WG7C 3NR7A 1HNZB 1VQ5V 1OCZB 2UXBB 2UUBO 4CC6A 4FLWA 3IJ4A 3UO3A 5KAIZ 4MVMA 3FB6C 1HWYA 2Z0AA 1Q6UA 4ZHQB 2BSKB 4DR5O 3WU2Z 3BABA 1SA0A 2UUAO 4KUMA 3T1YB 1SQVH 3HR0A 2PZSA 3K04A 5BR8B 1PKXA 1BHBA 1UPGA 3DXRA 4X62B 3EHBB 3CWBH 1EN4A 5L3FA 1M56C 3CRCA 2F93B 2A3QA 1AJNA 4CZZA 2OCCB 1YVWA 1XILA 2A79B 3E2EA 2PUSA 2IH3C 4GKJO 1NH2B 1PL4A 3VBBA 3PJSK 2JIZG 5LOVB 1J5EB 4HBNA 1BZKA 1WA8B 4I7ZB 1HR0B 1DGSA 2AW9A 3SYOA 4X1IB 4X65O 1QLNA 1KD1W 1V55B 2QM4A 2Q73A 3JD2A 2OTLV 3JCUZ 2DMXA 1MOFA 5KMGB 2QWPB 3BY6A 4LFCB 3CB2A 2CH7A 3H9VA 3JCZA 1G1XB 1WAZA 2W6JG 4K8ZA 2R9AA 2WLHA 3I55V 2HVJC 3HKEA 2XAHA 2JEUA 2QR4A 4JYYA 2QKCA 3JALB 1QLEB 4J9YB 5IYDO 1AI5A 4DXWA 5BXZA 2QTOA 3G4SV 5KLVH 1JQ0A 5LP6A 3QO7A 1IXBA 1IDSA 2X6CA 4JI4O 3SPHA 3GB7C 3FKSG 4BW5A 4LWSB 2F4VO 4FLZA 3D3QA 2NLJC 2JVDA 3VOUA 2B1IA 4I0XB 1BSMA 3QO5A 1OCOC 4QPKA 1EZVH 2GTAA 1K5SA 4DK0A 2HVKC 3BA9A 1QU7A 1VQ8V 3B2EE 3SYQA 2Q67A 1XDCA 1WN7A 2PY5A 3AG3B 4U3JA 1PP9H 2R70A 3A0HZ 2HJFC 4QIWF 2EIKC 2AZ2A 5EYPA 2ZINA 1AP5A 3ZRWA 2HP8A 1N36O 1YTFD 1A32A 3FD9A 4YHHO 3K03A 1BT8A 4CC5A 4CS4A 2Q4PA 3AG4B 4XDLA 3OR7C 2CE4A 5CB4A 5KA6A 1AJPA 2OT5A 1G4YB 2W0XA 4FFBA 1TAEA 1ORQC 3CCSV 3T1CA 4F4LA 3BVOA 3DGEA 1DF5A 2KG7A 3FAVB 4CS2A 1KP2A 3CMEV 5JJEB 2F95B 5GTIZ 5JQGB 4PA9A 3RYHA 3ZHTA 2P67A 3E86A 2D3OW 4I4TA 4UCTA 1JA8A 4JZGA 2PYJA 3QO8A 3CC7V 1HNZO 2YIBA 1S5LZ 1TUBB 2R9IA 5L3DA 2UXBO 2F1MA 3HKDB 4TV8B 1TGOA 1IVSA 5IYCO 1KUQA 2P22C 5EZYA 2AXTZ 4UVCA 1RPRA 2GBOA 2G38A 1DTOA 5B1AC 1TUEB 3T1YO 2JGUA 5IJ0A 2EULA 2ZR2A 4BIUA 5BR8O 2NNUA 3ZHRA 3OT7A 5CMUA 2YS8A 3F5TA 1V54B 4X62O 2YIAA 2QWQB 1K4DC 1WP7A 4RQEA 3ABTA 3TXSA 3A2FA 4FLYA 1SQBH 3UKMA 1R3KC 4B08A 4WFFA 4KFMA 4EFBA 1M93A 2XAJA 4P30A 1M1KW 4IT5A 1XREA 3IAYA 3F7VC 1D2DA 2P06A 1FXKA 3JARB 1J5EO 4B3MO 3N2KB 5D5PA 3ETGA 2OIEA 1Y74A 3K0GA 5IDJA 1HR0O 1QCEA 4DR7B 3K5NA 4X1KA 1GM7A 1PV0A 3TJTA 4DV3B 3CJHB 3ZJZA 2VQEB 1NTMH 3ZMVA 4LFCO 5B3SB 1IBKB 3K59A 4D6TH 3KKYA 1I7FA 3G71V 3RWRD 4IHJB 2VQFB 4YIOA 3AG1B 3D3IA 3N2GA 1H2KA 2YSUB 3JAWB 3CRRA 4FJCC 1QVGU 3H1IH 4J42A 1FPOA 4O2AB 1XEQA 3JD3A 2RQ6A 2ZDIC 2IU0A 1EFRG 4MTFA 2WLLA 4UB8Z 2EINB 3Q4HB 4YJ3A 3A0BZ 5LA6B 3WB0A 1XMOB 4B3RB 5CA0A 3SYAA 1US6A 4DV6B 4DR6B 3TK1A 1RSOA 2HLDG 1ZL8B 1XQ8A 2OIGA 1K33A 4BAYA 1QLEC 1H2NA 4NTXA 5LOVA 2E74B 1W0KG 2AHYA 2CK3G 1XNRB 2JS5A 2WLIA 1NVPD 2N05A 5ITZA 5KHGA 1JOYA 5KHJA 4YY3B 5EIBD 4GYCB 1HP8A 4MS2A 4X1IA 1YJNV 4CH6A 2Y48A 4U3FH 2XUMA 1VQOV 1S5JA 2RNBA 3W7XA 1NU1H 1FKAO 5KAFZ 1R3IC 3JAMN 3VQVA 4H37A 3RYFB 5J2UA 4LFBB 2ZDIA 4LF4B 4UUJC 2DYSC 2EBOA 1Q8IA 1OV9A 2IH1C 3HKCB 3E8FA 3MD0A 4X1YB 2DE0X 2EILB 2DYRC 1I0HA 3AK3A 5BZBA 4K0KB 4DV0B 1QR8A 2EZPA 5K1XA 4TQDA 3ZCCA 3JALA 5FLXN 3JASA 3K06A 2P5OA 3SYCA 1JJOA 5DEDA 4LP8A 5JH7A 3VQXA 4HAMA 3WB1A 3SR2C 3AG4C 5A2QN 4UVAA 4FLUA 3JATA 2ZR3A 2XAGA 2A0LA 4EB6A 3WFVA 4WBNB 2QKAA 1B04A 1VMGA 4AQYB 1VQNV 3ICXA 2KQXA 4UVBA 5LHHA 1S76D 2QM8A 3ABKC 1QVFU 4AILC 2ZE7A 4B3TB 4NYKA 4PDLA 1H2SB 3ZMZA 4PDMA 1QR9A 3WB2A 3RYCB 1G8MA 2P90A 2OWOA 4G27B 4K8XA 2JDIG 3AG7A 2BE3A 2UXXA 3R65A 1S5HC 1EBOA 4AI8A 1VQPV 1L1FA 2YICA 2IJKA 3O9OA 4K35A 4DR3B 3OGCC 2ODMA 5L3GA 1B06A 3OAAG 5B1BB 3OM3B 1CP9A 5F2VO 4CH5A 1KECA 5DECA 1P84F 5IYZB 4DV1B 4DRXA 4WFGA 4O4HA 5DN6G 3OR6C 1X59A 3FAVA 3CEIA 2ITDC 1V54C 4FIPC 5JQGA 4DR7O 4PI2A 2N74A 1NT2B 3B8NA 5BMVB 5JVDA 1H8HG
chains in the Genus database with same CATH topology
4DR2O 4DV3O 1DK1A 2VQEO 1I94O 5IT9N 4DR4O 1R6TA 5A2QN 3M8AA 4B3SO 1HNWO 3J81N 5LMNO 1IBKO 2UUBO 4A5UB 4JI2O 5BXZA 4DV7O 1XNQO 4JI6O 4JI1O 1HNZO 1YZBA 2Z0AA 5IWAO 4X66O 4JI7O 2UXBO 4JV5O 4JI4O 3RT3C 1XEQA 2LW7A 1XMQO 2F4VO 4OPHA 4DR5O 2JRIA 2UUAO 4AQYO 1N34O 1KUQA 2E5LO 4JI3O 1IBMO 4NXMO 1R1BA 3OTOO 4DV5O 2FKXA 3T1YO 4JI8O 4B3RO 4JI0O 1XMOO 2UXCO 5BR8O 4LF6O 4B3TO 4DV6O 4DR6O 1IBLO 4DV2O 4KHPO 3F5TA 4X62O 4DUZO 4LF8O 1AILA 4OPAA 4X64O 2ZM6O 2AGAA 1N33O 4GKJO 4GKKO 1XNRO 2ZKOA 3R66A 1N36O 4LFAO 1A32A 1NS1A 4YHHO 1FYJA 5LL6Y 2DOSA 3J7AU 4JYAO 4YY3O 1FKAO 5LMUO 3J80N 3T1HO 2DJVA 3JAMN 1F7YA 2UXDO 1D2DA 1N32O 1J5EO 4B3MO 5BY1A 4LF9O 4DR3O 5H5NA 4X65O 4DUYO 1HNXO 1AB3A 1HR0O 4DR1O 4LF5O 1X59A 4LFBO 4JI5O 4LF4O 3SDLA 4LF7O 4DV1O 4OX9O 4DR7O 2VQFO 1G1XB 1FJGO 5FLXN 2N74A 2UUCO 2HHHO 4NXNO 4DV4O 2UU9O 3O65A 4K0KO 4DV0O 4LFCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 O;  4DV3 O;  1DK1 A;  2VQE O;  1I94 O;  5IT9 N;  4DR4 O;  1R6T A;  5A2Q N;  3M8A A;  4B3S O;  1HNW O;  3J81 N;  5LMN O;  1IBK O;  2UUB O;  4A5U B;  4JI2 O;  5BXZ A;  4DV7 O;  1XNQ O;  4JI6 O;  4JI1 O;  1HNZ O;  1YZB A;  2Z0A A;  5IWA O;  4X66 O;  4JI7 O;  2UXB O;  4JV5 O;  4JI4 O;  3RT3 C;  1XEQ A;  2LW7 A;  1XMQ O;  2F4V O;  4OPH A;  4DR5 O;  2JRI A;  2UUA O;  4AQY O;  1N34 O;  1KUQ A;  2E5L O;  4JI3 O;  1IBM O;  4NXM O;  1R1B A;  3OTO O;  4DV5 O;  2FKX A;  3T1Y O;  4JI8 O;  4B3R O;  4JI0 O;  1XMO O;  2UXC O;  5BR8 O;  4LF6 O;  4B3T O;  4DV6 O;  4DR6 O;  1IBL O;  4DV2 O;  4KHP O;  3F5T A;  4X62 O;  4DUZ O;  4LF8 O;  1AIL A;  4OPA A;  4X64 O;  2ZM6 O;  2AGA A;  1N33 O;  4GKJ O;  4GKK O;  1XNR O;  2ZKO A;  3R66 A;  1N36 O;  4LFA O;  1A32 A;  1NS1 A;  4YHH O;  1FYJ A;  5LL6 Y;  2DOS A;  3J7A U;  4JYA O;  4YY3 O;  1FKA O;  5LMU O;  3J80 N;  3T1H O;  2DJV A;  3JAM N;  1F7Y A;  2UXD O;  1D2D A;  1N32 O;  1J5E O;  4B3M O;  5BY1 A;  4LF9 O;  4DR3 O;  5H5N A;  4X65 O;  4DUY O;  1HNX O;  1AB3 A;  1HR0 O;  4DR1 O;  4LF5 O;  1X59 A;  4LFB O;  4JI5 O;  4LF4 O;  3SDL A;  4LF7 O;  4DV1 O;  4OX9 O;  4DR7 O;  2VQF O;  1G1X B;  1FJG O;  5FLX N;  2N74 A;  2UUC O;  2HHH O;  4NXN O;  4DV4 O;  2UU9 O;  3O65 A;  4K0K O;  4DV0 O;  4LFC O; 
#chains in the Genus database with same CATH topology
 5JJJ B;  4B7E A;  3ZS8 C;  4N23 A;  3FB7 C;  1Q82 W;  5GW7 A;  4DV3 O;  1N4C A;  1GN4 A;  2VQE O;  1TUB A;  2ILM A;  5CBH A;  3CC2 V;  3CSX A;  2FB5 A;  3DSQ A;  4YJ2 B;  3J81 N;  1IBK O;  1ENV A;  2MK3 A;  1GH6 A;  2AHZ A;  1R3L C;  4UCO A;  4LR3 A;  3X2Q B;  1YJ9 V;  2CGN A;  1S3J A;  4OPH A;  2E3C A;  4R6Z A;  3OTO B;  4DV5 B;  1GRJ A;  3ZMU A;  3MHS C;  1YXB A;  5FNV B;  3CCL V;  2R72 A;  5IE9 A;  3CC4 V;  1Y4M A;  2LW1 A;  3OGI B;  3RYI A;  3NXS A;  3T2M A;  4B3R O;  1XMO O;  1BMF G;  4E4E A;  2HFE C;  1N33 B;  4DV6 O;  2VWK A;  1MA1 A;  3AG1 C;  1H2M A;  4PA6 A;  1U97 A;  4KP4 A;  4DR6 O;  1MNG A;  5KHH A;  3ZHS A;  2WLN A;  5LGN A;  3L9D A;  3JAR A;  3N2K A;  4I9W A;  3B8M A;  4FPP A;  2RMK B;  3AK1 A;  1XNR O;  3CRM A;  3KCX A;  3IGA C;  4RO2 A;  1JX9 A;  2Y4U A;  2BCC H;  4YY3 O;  3FYI B;  1M90 W;  1YCI A;  1XL4 A;  2YC0 A;  1YTF B;  1IX9 A;  1WLE A;  4MVZ A;  3D36 C;  4LF7 B;  3G67 A;  4JGS A;  3CJH A;  4LFB O;  3ZHV A;  2UU9 B;  5J2T A;  4LF4 O;  1KBH A;  1N0N A;  4NVP A;  2ZXW B;  3ZRX A;  4D7T A;  3ZN0 A;  4B3M B;  4IHJ A;  1NKD A;  1HW7 A;  3N27 A;  4X20 B;  3VQY A;  3RW0 A;  4K0K O;  4DV0 O;  2PTM A;  2Q0A A;  4IL6 Z;  5LP6 C;  3JAW A;  2YIB D;  1OCC B;  3PN1 A;  5LBQ A;  5CA3 A;  4RQF A;  4J11 A;  1AI7 A;  1AJQ A;  1ROP A;  4QE9 A;  2QKS A;  3B40 A;  4JAS A;  4O2A A;  1YSC A;  1LUV A;  5EBL C;  1NR7 A;  4JPR A;  5C93 A;  4IIJ B;  2QA4 V;  3CCQ V;  5LA6 A;  1YF2 A;  2NR5 A;  2EIL C;  4P9O A;  3D36 A;  5CN0 A;  5EC2 C;  1YIJ V;  2H3O A;  4MW8 A;  1XMQ O;  2IW5 A;  4AQY O;  3CYO A;  4UCS A;  3G80 A;  5IYB O;  2KSD A;  1VQ7 V;  3CCE V;  4I55 B;  2EZO A;  1SF9 A;  1KKC A;  3T4Z A;  2B5U A;  5H9C A;  3E35 A;  4LF8 B;  4JAU A;  3KZI Z;  2Q0O C;  2W0F C;  4B3T O;  5L3E A;  3P30 A;  3E8G A;  3TXQ A;  1R6N A;  5B66 Z;  3B77 A;  1NBM G;  3E22 B;  2DWD C;  2JGD B;  1BE3 H;  3H1L H;  1O9G A;  1WNS A;  4C7U A;  3HKC A;  3JSN A;  4KL1 A;  4JYB A;  4X1Y A;  4WFA V;  2QEX V;  4DR1 B;  3JD4 A;  3CCJ V;  4DR3 O;  1ZTE A;  3CE2 A;  3DC6 A;  3K3W A;  2A06 H;  2E76 B;  1GN2 A;  1FFX A;  3AEI A;  3CRA A;  5H2F Z;  1Q5O A;  3SDL A;  4DV1 O;  3KCY A;  3I5D A;  1LNQ A;  2BOC C;  3OMN B;  1W59 A;  2YEV B;  3UT5 B;  2A7W A;  4RWU A;  3H1K H;  4FFK A;  2K1E A;  1MMM A;  1CXZ B;  5B1B C;  1WJZ A;  5JJN B;  3CS5 A;  4LNU B;  2OTJ V;  2LP7 A;  1ZSP A;  1NR1 A;  1NTK H;  2XOK G;  4F6R A;  3AG2 B;  1SER A;  3SPC A;  2IJI A;  3APO A;  4UCR A;  1NH2 D;  5LHI A;  3CCU V;  1VAR A;  2AZ0 A;  3TCU A;  3B4S A;  4O2B B;  3RYC A;  2H8P C;  2VRZ A;  1TA8 A;  1R73 A;  4JI0 B;  2Q8V A;  1JVM A;  2V1D A;  3RN4 A;  2EIM B;  1BQ0 A;  1MZF A;  3QG5 A;  1R1B A;  3OTO O;  4DV5 O;  2FKX A;  3ZRV A;  5L3B A;  2OCH A;  3EVK A;  3ZX6 A;  2EIJ B;  1G6U A;  1O9H A;  1FXK C;  4J7K A;  3LDC A;  1P7B A;  2AGA A;  2KB1 A;  1N33 O;  1VQ9 V;  4XDK A;  3X2Q C;  2QWO B;  3RGB A;  1Z5V A;  3IC7 A;  1NVP B;  1RM1 B;  1JFF B;  2CAZ C;  4NB5 A;  5LXT A;  1OCZ C;  4JI5 B;  1YEW A;  1EN5 A;  2CDY A;  2DQ0 A;  3LSQ A;  4CBC A;  2YI9 A;  1R3J C;  3UQ8 A;  4MW3 A;  1K8A W;  2YID A;  1TVK B;  1ZWI C;  4FZ0 A;  3S3X A;  3MAQ A;  1B3Q A;  2Q9L A;  4FM0 A;  4O4J B;  4JTD B;  4LF7 O;  1VF5 B;  4FLT A;  4R8C A;  2ZD9 A;  5C8Y B;  1Y76 B;  2UU9 O;  4W4K A;  5EC1 C;  4DW1 A;  4TT3 G;  1H8E G;  3UM7 A;  1YHQ V;  5IT9 N;  2HJD A;  2QTS A;  4G28 B;  3K58 A;  1MSW D;  2CTR A;  1KB9 F;  2CGO A;  1M57 B;  4LBE C;  4JV5 B;  1Y67 A;  4TWK A;  1D5A A;  2OCC C;  3FB8 C;  5FNV A;  1W2B U;  1JMK C;  2ZQM A;  4YXW G;  1N34 B;  3APQ A;  1SQP H;  4FM2 A;  4JI3 B;  3ML0 A;  3STZ C;  2BOB C;  3DXR B;  1GM8 A;  3RFR A;  4I9Q A;  5AG2 A;  2CTP A;  3ABM B;  4JI8 B;  4ZHQ A;  1H2L A;  1OCR B;  2BSK A;  2Y69 B;  1IBL B;  4DV2 B;  1B6Q A;  3A0R A;  4UFZ A;  1L8D A;  3E89 A;  1V55 C;  3WG7 B;  4H13 B;  3M7M X;  4GX2 A;  3OTF A;  3DTU B;  1VF6 C;  2ETN A;  4PD4 F;  3STL C;  4LF8 O;  3G6E V;  1M5I A;  1AIL A;  2M7W A;  2Q7E A;  1QNM A;  4JYC A;  4R50 A;  4XBF A;  4JYA B;  4BWA A;  1W0J G;  2FYU H;  2X6A A;  2WAM A;  2JK5 C;  1XUQ A;  2DOS A;  2YI8 A;  2Q5Z A;  2LFR A;  4J7J A;  2ZE5 A;  5BY1 A;  2QM7 A;  4UB6 Z;  4NR1 A;  1WA8 A;  4X20 A;  3P3P A;  4DR1 O;  3ZRS A;  1IZ3 A;  3RVZ A;  1UJW B;  4WFB V;  1AR1 B;  1GTO A;  4KXR A;  4JTC B;  3QNE A;  5IY5 B;  3HKE B;  2HG5 C;  3ZHU A;  4FVM A;  5KMG A;  1VF6 A;  4DR4 B;  1NTZ H;  4IIJ A;  4MVS A;  2EJ7 A;  2XAS A;  1R6K A;  3H01 A;  4ZBM A;  4JI2 B;  4MVR A;  1M9N A;  5IJ9 B;  2H94 A;  4JI1 B;  2Q7H A;  2WA3 A;  1FD9 A;  3AG3 C;  4IYI A;  3P32 A;  3I56 V;  4I55 A;  4DW0 A;  4JZ2 A;  2WLK A;  1IBM B;  1AI6 A;  3ETD A;  4K3A A;  2EX3 A;  3CP1 A;  1MG1 A;  1LR1 A;  4PEL A;  2QDO A;  4LF6 B;  2A9H A;  4KHP B;  4LWS A;  3E22 A;  4RUE A;  2GV9 A;  4U3J B;  1OZ0 A;  2JGD A;  3S3W A;  3E8B A;  4I0X A;  3SPG A;  1XMQ B;  4JI0 O;  1GK9 A;  5JCO C;  3K57 A;  3BAA A;  4H33 A;  2UXC O;  2ATK C;  4I50 B;  5EYP B;  2WSS G;  4BW9 A;  3SJA C;  1BQZ A;  3U10 A;  2GTS A;  3E83 A;  4J7Z A;  4X8A A;  5LMU B;  1MZE A;  2JS3 A;  1RPO A;  2ZKO A;  2K9P A;  3R66 A;  1N32 B;  1PPJ H;  5JWP A;  1S0V A;  3HKB B;  3JD1 A;  1U96 A;  4QNH B;  2QSA A;  5CA1 B;  3VQW A;  1FXH A;  1OCO B;  3FX7 A;  4GUN A;  2EIM C;  4GX1 A;  2V4D A;  1ZX3 A;  3UT5 A;  5KHK A;  1K4C C;  1QHT A;  1S77 D;  2Q69 A;  4J9Z B;  4E2L A;  4GLX A;  4JI5 O;  1KMI Z;  2BTQ B;  2P4V A;  2XAQ A;  2P6J A;  5JCO A;  1Q3E A;  1I94 B;  2F43 G;  4PA7 A;  4LNU A;  3RYH B;  1K34 A;  4B3S B;  3ZN1 A;  3T4D A;  1PNK A;  1MAB G;  1AP6 A;  1KKD A;  2X6B A;  1NZ6 A;  4O2B A;  2GDS A;  2E75 B;  1K7D A;  4O4I B;  5D5Q A;  4ZKI A;  5EZY B;  2BTO A;  4JV5 O;  3CX5 F;  2E5L B;  4TSF G;  1BS3 A;  3K5L A;  4FLV A;  1N34 O;  1ZAU A;  3ZMS A;  3HKD A;  4QPJ A;  3OE7 G;  4TV8 A;  4JI3 O;  4H0L B;  1NJI W;  5GON B;  4TQF A;  4JI8 O;  2ZE6 A;  2ZM6 B;  4AHC A;  1EZJ A;  4MVO A;  1F4N A;  1IBL O;  2FML A;  4DV2 O;  4LFA B;  4GX0 A;  1JPX A;  2PYL A;  4O4L B;  4PHZ A;  2ADQ B;  1EN6 A;  3MHH C;  4ZI7 B;  2HKO A;  5B3S C;  3G6B A;  3CXH F;  5E79 Z;  1FYJ A;  1WPX A;  3LSU A;  3W7S A;  4JYA O;  3W7W A;  3OMI B;  3J80 N;  4X1K B;  4LF5 B;  3L72 H;  2ZT9 B;  1OCR C;  5L3C A;  5C8Y A;  1P4R A;  4CS3 A;  2QWN B;  1JJ2 U;  1F4M A;  4PV1 B;  2OYQ A;  3BRC A;  5KUK A;  4DV4 B;  4RUF A;  5H6Q A;  1H2G A;  4HZ3 A;  2CTW A;  5K1P A;  1VP7 A;  2EIN C;  1N0J A;  2UXN A;  3SPJ A;  5GTH Z;  1GAX A;  3ETQ A;  3MDS A;  2Y0I A;  4Z1M G;  3N2G B;  4L8J A;  3BPZ A;  4PJ0 Z;  4DV7 B;  4FK5 C;  1S72 V;  4DR4 O;  1R6T A;  5IWA B;  3W7T A;  4X66 B;  4TOI A;  4ZIB A;  4JI7 B;  4PDV A;  4A5U B;  3BCC H;  1Z5W A;  4JI2 O;  3EFF K;  1WB7 A;  1QBZ A;  1VQK V;  2JEX A;  3GWK C;  3JAK B;  4JI1 O;  2WLL B;  3ZHQ A;  1XOU A;  4YJ3 B;  3GVM A;  4ABM A;  1K5Q A;  1LUW A;  5CA0 B;  5IY5 C;  1RSO B;  4FMT A;  2PF4 E;  2JRI A;  2GUZ B;  1Q90 D;  2WPD G;  5KUM A;  4J41 A;  2F23 A;  5CBG A;  4L87 A;  5B1O A;  3SJB C;  3OW2 U;  1IBM O;  4MTO A;  1E1R G;  1XBL A;  2PI4 A;  1SRY A;  1YDX A;  3OMA B;  2PGG A;  2WLI B;  3Q4H A;  2DQ3 A;  1AI4 A;  5ITZ B;  3L75 H;  1CPY A;  4EFE A;  4LF6 O;  3ASO B;  4GKK B;  4KHP O;  2WLM A;  4EEQ A;  1K92 A;  2FL4 A;  2KKW A;  1ZL8 A;  3AK2 A;  4BIZ A;  4PDR A;  3CD6 V;  1Q6I A;  4QJF B;  5LYJ B;  4OPA A;  3TGU H;  4JF3 A;  1VQL V;  4PA4 A;  3RVY A;  1I5Y A;  5J2U B;  2ZE8 A;  3SYP A;  1P49 A;  4LF9 B;  3CXC U;  1HNX B;  1VF7 A;  5LMU O;  4NTY A;  2L6L A;  3K0D A;  2DJV A;  4RAI A;  1N32 O;  4HNA B;  3IC9 A;  3BHP A;  3K08 A;  3A8T A;  2LGQ A;  2DW4 A;  4QE7 A;  1KYO F;  1VEW A;  4OX9 B;  4JAA A;  2UUC B;  2V7Q G;  3RYF A;  4NXN B;  4G2K A;  4B7K A;  3JAS B;  4TUY B;  4UV8 A;  1PNM A;  3C90 A;  4EKW A;  2ZNI A;  5KA5 A;  1VIB A;  5FPR A;  5LHG A;  2Y4T A;  4BR6 A;  1Q43 A;  5IJ9 A;  4DR2 B;  1UFI A;  5JH7 B;  5FL7 G;  1HNW B;  4H44 B;  3LDE A;  3ABL B;  3JAT B;  5TIS Z;  3THO A;  2B9Z A;  3CCV V;  2JJ1 G;  3K9S A;  1KQS U;  1I94 O;  1XNQ B;  4EB6 B;  3L74 H;  4B3S O;  3U11 A;  2DYS B;  1GM9 A;  4LC1 A;  3JSL A;  2YXH A;  4MSW C;  2DYR B;  3ETE A;  1YZB A;  4CH4 A;  2JJ2 G;  3OFN G;  1ZLZ A;  2QJ1 A;  2WLJ A;  1XHZ A;  2ITC C;  2M6Y A;  1YI2 V;  4WBN A;  4NXM B;  2X0L A;  4I50 A;  1IXM A;  4OGQ B;  3F7Y C;  3ZIA G;  2E5L O;  3K5M A;  3ZBH A;  3ABU A;  3IFX A;  1NI8 A;  3ZMT A;  3SJC C;  3H1H H;  4DUZ B;  3HPL C;  4BIO A;  3B09 A;  2Q7G A;  3HKB A;  1SS3 A;  1T5E A;  5CA1 A;  4I5S A;  3KG2 A;  2ZM6 O;  2LGW A;  2F66 C;  2UXC B;  4LFA O;  2B1G A;  1Y66 A;  5FPO A;  3E8H A;  5EK0 A;  1YJW V;  1ZUQ A;  3ABK B;  4DUY B;  3J7A U;  4DRX B;  3FYE B;  1KP3 A;  4O4H B;  1FFT B;  1F7Y A;  2BTQ A;  1BL8 A;  2RDC A;  2XTA A;  1M4U A;  5H5N A;  1JR9 A;  2CUG A;  3GWO A;  2ADP A;  1FJG B;  4LF5 O;  2HHH B;  5LGU A;  1FXV A;  4ZOL B;  5JVD B;  5IYZ A;  3W7U A;  2W6I G;  2NN4 A;  3FB5 C;  3C3S A;  1F51 A;  4DV4 O;  4YIP A;  4Z2W A;  5LMN B;  4Q6G A;  2LJ2 A;  4O4I A;  4N21 A;  4JI6 B;  5BMV A;  1GN6 A;  3ZED A;  1SZT A;  1CEZ A;  2ZNJ A;  2IJH A;  4UCU A;  2RCV A;  4P2Z A;  2HR3 A;  1MSD A;  4DV7 O;  1NQT A;  5KX5 B;  3CHX A;  5LGT A;  2D2C B;  4YJ2 A;  5IWA O;  3OUS A;  4X66 O;  4JI7 O;  2IBZ H;  4TV9 B;  3BFR A;  1I5X A;  3QVN A;  5GON A;  5EBM C;  2VWJ A;  2ZIM A;  2X7R B;  4MT8 A;  2LW7 A;  1ARO P;  3RYI B;  1H38 A;  2Q68 A;  3CRQ A;  1N8R W;  4MTG A;  1SZX A;  3ASN B;  4O4L A;  4X64 B;  1X4T A;  4ZI7 A;  1SA0 B;  3BEH A;  3BA8 A;  1Q6H A;  4ICG A;  1WPB A;  4R7C A;  2ZXW C;  1URF A;  4PA3 A;  3SPI A;  4GKK O;  2ARH A;  3CCR V;  4DO2 A;  3T1H B;  5H6R A;  1K73 W;  2UXD B;  1OCC C;  3L73 H;  5LL6 Y;  3L71 H;  4U7N A;  2O57 A;  2WWW A;  1OHH G;  4LF9 O;  1Z2G A;  5J2T B;  1HNX O;  4LH6 A;  1HDJ A;  1SQG A;  4X89 A;  1XL6 A;  4F6E A;  3ASO C;  1SKV A;  4GT1 A;  4OX9 O;  2GSM B;  4Q20 A;  3K79 A;  3F5W C;  2UUC O;  3OUF A;  2RN9 A;  4NXN O;  1GMG A;  1PM9 A;  4QGP A;  2UUB B;  1BCC H;  2WA4 A;  3JAK A;  4DR2 O;  1DK1 A;  2IU3 A;  1BHA A;  2CH7 B;  1THZ A;  2Y0P A;  3UCS C;  4UV9 A;  1HNW O;  2ZCE A;  1M56 B;  3DC5 A;  3U0Z A;  1XNQ O;  2CTQ A;  2GUZ A;  1D5N A;  2QE7 G;  1Y6X A;  3JYC A;  4DR5 B;  3JD0 A;  3OD4 A;  4LCU C;  2UUA B;  1K3E A;  5B1N A;  2FTK A;  3QTC A;  1XHX A;  2DWE C;  2XND G;  4GZR B;  4WF9 V;  3RBZ A;  5A9G A;  2YDE A;  5LP6 B;  1V9P A;  4J10 A;  4NXM O;  5LYJ A;  3ABL C;  4IGG A;  4OXS A;  3SGI A;  2IJJ A;  4GKJ B;  1F23 A;  3D8C A;  3LDD A;  4NTW A;  2RJZ A;  4XDJ A;  2YXL A;  3OEE G;  4DUZ O;  5HFM A;  3M99 B;  2QGN A;  4X88 A;  1OJH A;  4DK1 A;  4WFH A;  2QWR B;  4HNA A;  3SJQ C;  1GKF A;  2IM9 A;  2VS0 A;  4WCE V;  3UO2 A;  4D7S A;  3H1J H;  1K97 A;  1NS1 A;  4X65 B;  1FS0 G;  3QF7 A;  4FM1 A;  1KU9 A;  4TUY A;  1FFX B;  2YUA A;  3LUT B;  3P3N A;  1Q81 W;  3ZRW B;  1XI1 A;  4DUY O;  1AR5 A;  5EBW C;  2R9R B;  3AG2 C;  4MVU A;  5CBF A;  2XHB A;  1DF4 A;  4WFE A;  4CH3 A;  1PNL A;  1EM1 A;  2LO1 A;  4GX5 A;  1FJG O;  2MW2 B;  2Z5U A;  5CB4 B;  2L35 A;  2HHH O;  1JCH A;  4U7O A;  3O65 A;  4MTX A;  5KHI A;  1VQ4 V;  4Z1V A;  4FFB B;  2XAF A;  2YEV A;  4NKG B;  1FAF A;  1RFY A;  4F6R B;  3M8A A;  4LH7 A;  5LMN O;  3CCM V;  2EIJ C;  1KC8 W;  1AVM A;  3LNN A;  2KG7 B;  2Q6A A;  4JI4 B;  1L0L H;  4JI6 O;  3LNM B;  2F4V B;  4W4L A;  4DYL A;  4P9P A;  4HYO A;  2EIK B;  4GCZ A;  2DN9 A;  5B5E Z;  5HFL A;  2YXY A;  3CPW U;  3RT3 C;  1GO3 F;  2Z3Y A;  4I4T B;  1RM1 C;  3L70 H;  3K5O A;  5EIB C;  1WP8 A;  1P7G A;  4JTA B;  4J80 A;  2PI5 A;  2EJR A;  1DLB A;  1GN3 A;  4PI0 A;  5DM6 V;  4JAV A;  1BGY H;  3OEH G;  1E79 G;  1YIT V;  1SQQ H;  3EXA A;  1N36 B;  4ASU G;  2GHY A;  4X64 O;  4YHH B;  1QQC A;  2P7T C;  4UXN A;  5IJ0 B;  1K9M W;  5LXT B;  1J95 A;  1I08 A;  1L0N H;  2N04 A;  2C2A A;  2ZIO A;  1WB8 A;  4ZOL A;  3CMA V;  3T1H O;  1Q86 W;  2UXD O;  3HB3 B;  2LFS A;  1PL0 A;  1M57 C;  1PD3 A;  1VQ6 V;  1AB3 A;  3ASN C;  4FLX A;  1JFF A;  2HEP A;  3C3T A;  4IYH A;  3K9A A;  1VQM V;  4UCV A;  1E1Q G;  2LQT A;  1COW G;  1FXK B;  2VQF O;  1TVK A;  2P4K A;  3FFQ A;  1IUR A;  1Y74 B;  5J9P C;  4O4J A;  1SQF A;  3ABM C;  1RP3 B;  1Q7Y W;  4MVQ A;  1SET A;  3TET A;  5KX5 A;  2Y69 C;  5B1A B;  2XT9 A;  3LSS A;  4FZ1 A;  1Y76 A;  4X9Q A;  1AR4 A;  4TV9 A;  1SES A;  1SC5 B;  1SQX H;  5E1A C;  3WG7 C;  3NR7 A;  1HNZ B;  1VQ5 V;  1OCZ B;  2UXB B;  2UUB O;  4CC6 A;  4FLW A;  3IJ4 A;  3UO3 A;  5KAI Z;  4MVM A;  3FB6 C;  1HWY A;  2Z0A A;  1Q6U A;  4ZHQ B;  2BSK B;  4DR5 O;  3WU2 Z;  3BAB A;  1SA0 A;  2UUA O;  4KUM A;  3T1Y B;  1SQV H;  3HR0 A;  2PZS A;  3K04 A;  5BR8 B;  1PKX A;  1BHB A;  1UPG A;  3DXR A;  4X62 B;  3EHB B;  3CWB H;  1EN4 A;  5L3F A;  1M56 C;  3CRC A;  2F93 B;  2A3Q A;  1AJN A;  4CZZ A;  2OCC B;  1YVW A;  1XIL A;  2A79 B;  3E2E A;  2PUS A;  2IH3 C;  4GKJ O;  1NH2 B;  1PL4 A;  3VBB A;  3PJS K;  2JIZ G;  5LOV B;  1J5E B;  4HBN A;  1BZK A;  1WA8 B;  4I7Z B;  1HR0 B;  1DGS A;  2AW9 A;  3SYO A;  4X1I B;  4X65 O;  1QLN A;  1KD1 W;  1V55 B;  2QM4 A;  2Q73 A;  3JD2 A;  2OTL V;  3JCU Z;  2DMX A;  1MOF A;  5KMG B;  2QWP B;  3BY6 A;  4LFC B;  3CB2 A;  2CH7 A;  3H9V A;  3JCZ A;  1G1X B;  1WAZ A;  2W6J G;  4K8Z A;  2R9A A;  2WLH A;  3I55 V;  2HVJ C;  3HKE A;  2XAH A;  2JEU A;  2QR4 A;  4JYY A;  2QKC A;  3JAL B;  1QLE B;  4J9Y B;  5IYD O;  1AI5 A;  4DXW A;  5BXZ A;  2QTO A;  3G4S V;  5KLV H;  1JQ0 A;  5LP6 A;  3QO7 A;  1IXB A;  1IDS A;  2X6C A;  4JI4 O;  3SPH A;  3GB7 C;  3FKS G;  4BW5 A;  4LWS B;  2F4V O;  4FLZ A;  3D3Q A;  2NLJ C;  2JVD A;  3VOU A;  2B1I A;  4I0X B;  1BSM A;  3QO5 A;  1OCO C;  4QPK A;  1EZV H;  2GTA A;  1K5S A;  4DK0 A;  2HVK C;  3BA9 A;  1QU7 A;  1VQ8 V;  3B2E E;  3SYQ A;  2Q67 A;  1XDC A;  1WN7 A;  2PY5 A;  3AG3 B;  4U3J A;  1PP9 H;  2R70 A;  3A0H Z;  2HJF C;  4QIW F;  2EIK C;  2AZ2 A;  5EYP A;  2ZIN A;  1AP5 A;  3ZRW A;  2HP8 A;  1N36 O;  1YTF D;  1A32 A;  3FD9 A;  4YHH O;  3K03 A;  1BT8 A;  4CC5 A;  4CS4 A;  2Q4P A;  3AG4 B;  4XDL A;  3OR7 C;  2CE4 A;  5CB4 A;  5KA6 A;  1AJP A;  2OT5 A;  1G4Y B;  2W0X A;  4FFB A;  1TAE A;  1ORQ C;  3CCS V;  3T1C A;  4F4L A;  3BVO A;  3DGE A;  1DF5 A;  2KG7 A;  3FAV B;  4CS2 A;  1KP2 A;  3CME V;  5JJE B;  2F95 B;  5GTI Z;  5JQG B;  4PA9 A;  3RYH A;  3ZHT A;  2P67 A;  3E86 A;  2D3O W;  4I4T A;  4UCT A;  1JA8 A;  4JZG A;  2PYJ A;  3QO8 A;  3CC7 V;  1HNZ O;  2YIB A;  1S5L Z;  1TUB B;  2R9I A;  5L3D A;  2UXB O;  2F1M A;  3HKD B;  4TV8 B;  1TGO A;  1IVS A;  5IYC O;  1KUQ A;  2P22 C;  5EZY A;  2AXT Z;  4UVC A;  1RPR A;  2GBO A;  2G38 A;  1DTO A;  5B1A C;  1TUE B;  3T1Y O;  2JGU A;  5IJ0 A;  2EUL A;  2ZR2 A;  4BIU A;  5BR8 O;  2NNU A;  3ZHR A;  3OT7 A;  5CMU A;  2YS8 A;  3F5T A;  1V54 B;  4X62 O;  2YIA A;  2QWQ B;  1K4D C;  1WP7 A;  4RQE A;  3ABT A;  3TXS A;  3A2F A;  4FLY A;  1SQB H;  3UKM A;  1R3K C;  4B08 A;  4WFF A;  4KFM A;  4EFB A;  1M93 A;  2XAJ A;  4P30 A;  1M1K W;  4IT5 A;  1XRE A;  3IAY A;  3F7V C;  1D2D A;  2P06 A;  1FXK A;  3JAR B;  1J5E O;  4B3M O;  3N2K B;  5D5P A;  3ETG A;  2OIE A;  1Y74 A;  3K0G A;  5IDJ A;  1HR0 O;  1QCE A;  4DR7 B;  3K5N A;  4X1K A;  1GM7 A;  1PV0 A;  3TJT A;  4DV3 B;  3CJH B;  3ZJZ A;  2VQE B;  1NTM H;  3ZMV A;  4LFC O;  5B3S B;  1IBK B;  3K59 A;  4D6T H;  3KKY A;  1I7F A;  3G71 V;  3RWR D;  4IHJ B;  2VQF B;  4YIO A;  3AG1 B;  3D3I A;  3N2G A;  1H2K A;  2YSU B;  3JAW B;  3CRR A;  4FJC C;  1QVG U;  3H1I H;  4J42 A;  1FPO A;  4O2A B;  1XEQ A;  3JD3 A;  2RQ6 A;  2ZDI C;  2IU0 A;  1EFR G;  4MTF A;  2WLL A;  4UB8 Z;  2EIN B;  3Q4H B;  4YJ3 A;  3A0B Z;  5LA6 B;  3WB0 A;  1XMO B;  4B3R B;  5CA0 A;  3SYA A;  1US6 A;  4DV6 B;  4DR6 B;  3TK1 A;  1RSO A;  2HLD G;  1ZL8 B;  1XQ8 A;  2OIG A;  1K33 A;  4BAY A;  1QLE C;  1H2N A;  4NTX A;  5LOV A;  2E74 B;  1W0K G;  2AHY A;  2CK3 G;  1XNR B;  2JS5 A;  2WLI A;  1NVP D;  2N05 A;  5ITZ A;  5KHG A;  1JOY A;  5KHJ A;  4YY3 B;  5EIB D;  4GYC B;  1HP8 A;  4MS2 A;  4X1I A;  1YJN V;  4CH6 A;  2Y48 A;  4U3F H;  2XUM A;  1VQO V;  1S5J A;  2RNB A;  3W7X A;  1NU1 H;  1FKA O;  5KAF Z;  1R3I C;  3JAM N;  3VQV A;  4H37 A;  3RYF B;  5J2U A;  4LFB B;  2ZDI A;  4LF4 B;  4UUJ C;  2DYS C;  2EBO A;  1Q8I A;  1OV9 A;  2IH1 C;  3HKC B;  3E8F A;  3MD0 A;  4X1Y B;  2DE0 X;  2EIL B;  2DYR C;  1I0H A;  3AK3 A;  5BZB A;  4K0K B;  4DV0 B;  1QR8 A;  2EZP A;  5K1X A;  4TQD A;  3ZCC A;  3JAL A;  5FLX N;  3JAS A;  3K06 A;  2P5O A;  3SYC A;  1JJO A;  5DED A;  4LP8 A;  5JH7 A;  3VQX A;  4HAM A;  3WB1 A;  3SR2 C;  3AG4 C;  5A2Q N;  4UVA A;  4FLU A;  3JAT A;  2ZR3 A;  2XAG A;  2A0L A;  4EB6 A;  3WFV A;  4WBN B;  2QKA A;  1B04 A;  1VMG A;  4AQY B;  1VQN V;  3ICX A;  2KQX A;  4UVB A;  5LHH A;  1S76 D;  2QM8 A;  3ABK C;  1QVF U;  4AIL C;  2ZE7 A;  4B3T B;  4NYK A;  4PDL A;  1H2S B;  3ZMZ A;  4PDM A;  1QR9 A;  3WB2 A;  3RYC B;  1G8M A;  2P90 A;  2OWO A;  4G27 B;  4K8X A;  2JDI G;  3AG7 A;  2BE3 A;  2UXX A;  3R65 A;  1S5H C;  1EBO A;  4AI8 A;  1VQP V;  1L1F A;  2YIC A;  2IJK A;  3O9O A;  4K35 A;  4DR3 B;  3OGC C;  2ODM A;  5L3G A;  1B06 A;  3OAA G;  5B1B B;  3OM3 B;  1CP9 A;  5F2V O;  4CH5 A;  1KEC A;  5DEC A;  1P84 F;  5IYZ B;  4DV1 B;  4DRX A;  4WFG A;  4O4H A;  5DN6 G;  3OR6 C;  1X59 A;  3FAV A;  3CEI A;  2ITD C;  1V54 C;  4FIP C;  5JQG A;  4DR7 O;  4PI2 A;  2N74 A;  1NT2 B;  3B8N A;  5BMV B;  5JVD A;  1H8H G; 
#chains in the Genus database with same CATH homology
 4DR2 O;  4DV3 O;  1DK1 A;  2VQE O;  1I94 O;  5IT9 N;  4DR4 O;  1R6T A;  5A2Q N;  3M8A A;  4B3S O;  1HNW O;  3J81 N;  5LMN O;  1IBK O;  2UUB O;  4A5U B;  4JI2 O;  5BXZ A;  4DV7 O;  1XNQ O;  4JI6 O;  4JI1 O;  1HNZ O;  1YZB A;  2Z0A A;  5IWA O;  4X66 O;  4JI7 O;  2UXB O;  4JV5 O;  4JI4 O;  3RT3 C;  1XEQ A;  2LW7 A;  1XMQ O;  2F4V O;  4OPH A;  4DR5 O;  2JRI A;  2UUA O;  4AQY O;  1N34 O;  1KUQ A;  2E5L O;  4JI3 O;  1IBM O;  4NXM O;  1R1B A;  3OTO O;  4DV5 O;  2FKX A;  3T1Y O;  4JI8 O;  4B3R O;  4JI0 O;  1XMO O;  2UXC O;  5BR8 O;  4LF6 O;  4B3T O;  4DV6 O;  4DR6 O;  1IBL O;  4DV2 O;  4KHP O;  3F5T A;  4X62 O;  4DUZ O;  4LF8 O;  1AIL A;  4OPA A;  4X64 O;  2ZM6 O;  2AGA A;  1N33 O;  4GKJ O;  4GKK O;  1XNR O;  2ZKO A;  3R66 A;  1N36 O;  4LFA O;  1A32 A;  1NS1 A;  4YHH O;  1FYJ A;  5LL6 Y;  2DOS A;  3J7A U;  4JYA O;  4YY3 O;  1FKA O;  5LMU O;  3J80 N;  3T1H O;  2DJV A;  3JAM N;  1F7Y A;  2UXD O;  1D2D A;  1N32 O;  1J5E O;  4B3M O;  5BY1 A;  4LF9 O;  4DR3 O;  5H5N A;  4X65 O;  4DUY O;  1HNX O;  1AB3 A;  1HR0 O;  4DR1 O;  4LF5 O;  1X59 A;  4LFB O;  4JI5 O;  4LF4 O;  3SDL A;  4LF7 O;  4DV1 O;  4OX9 O;  4DR7 O;  2VQF O;  1G1X B;  1FJG O;  5FLX N;  2N74 A;  2UUC O;  2HHH O;  4NXN O;  4DV4 O;  2UU9 O;  3O65 A;  4K0K O;  4DV0 O;  4LFC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...