1XMQO

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xmqO00
3O65A 2VQEO 1HR0O 4K0KO 2UU9O 1XNQO 2N74A 4LF6O 4LFBO 5IT9N 4LF4O 4LF9O 1I94O 4JI1O 4B3SO 2UUCO 3T1YO 4JI7O 4DV6O 1IBLO 1XEQA 4OX9O 4AQYO 2AGAA 3J81N 4DR2O 4JV5O 1DK1A 3SDLA 4DUZO 1HNZO 2UUBO 4DV7O 1N33O 5FLXN 1R1BA 5LMNO 1XNRO 2ZKOA 1D2DA 4JI3O 1KUQA 2LW7A 4JYAO 4DV5O 5A2QN 4B3TO 2E5LO 2UXDO 4B3MO 1N36O 2DJVA 2ZM6O 3F5TA 5H5NA 4JI8O 4X62O 3J80N 4NXMO 1AB3A 4JI0O 4LF5O 4GKKO 2Z0AA 1HNWO 4JI4O 2F4VO 3M8AA 4DV4O 3OTOO 1N34O 4X64O 5BR8O 4X65O 4LFCO 4LF7O 1R6TA 4NXNO 4B3RO 1IBMO 4JI2O 4X66O 4DUYO 4DV2O 2UXBO 1NS1A 4DV0O 1HNXO 5IWAO 5LL6Y 2UUAO 1XMOO 2FKXA 3R66A 3J7AU 1XMQO 5BXZA 4GKJO 1N32O 1G1XB 1FJGO 3RT3C 2HHHO 4DR6O 1YZBA 1F7YA 4DR3O 1FYJA 4OPAA 1J5EO 2VQFO 1IBKO 4DR1O 4KHPO 4OPHA 2DOSA 1A32A 4LFAO 2UXCO 4DR7O 3JAMN 4LF8O 4DR4O 4JI6O 3T1HO 5LMUO 4DR5O 5BY1A 1FKAO 4YY3O 4A5UB 1X59A 2JRIA 4YHHO 4DV1O 4JI5O 1AILA 4DV3O
chains in the Genus database with same CATH superfamily
3DC6A 3AG1B 3ZRSA 3K06A 3L70H 5IJ0A 2LO1A 3FX7A 2CH7B 3QG5A 1TA8A 1R3IC 1CP9A 3ZN0A 1F23A 2Q0AA 3HKEB 5B3SB 2WPDG 4NR1A 2X6BA 1QQCA 3AEIA 1JJ2U 3ZHTA 3WB1A 4BR6A 1CPYA 2ZE7A 3MAQA 3SJBC 1Y67A 1TVKB 1HNZO 1QVFU 1FS0G 1MSDA 5FLXN 3M7MX 2YI8A 4ICGA 3ABMC 3THOA 2LFSA 4J7JA 2UXBB 4MVOA 2M6YA 1VQ8V 4QE7A 4O2AA 1YJ9V 3AG4C 1N36O 2DJVA 5AG2A 1IZ3A 5J2UB 2UU9B 1HW7A 3FAVB 2WLLA 4JI1B 4B3SB 1WA8B 4JI7B 5EBMC 2Y48A 4I55A 1Z5WA 4DV6B 3JARA 4FM2A 3BA9A 1ROPA 3E86A 3ASNC 2Y4UA 4L8JA 3CP1A 4MVRA 2Q69A 2RQ6A 2PI5A 4FIPC 4ZI7B 4TV8A 4JYBA 2IM9A 2OT5A 3IGAC 1GO3F 2AXTZ 2W6IG 2FMLA 4Q20A 4ASUG 2KKWA 1YEWA 4FLTA 1SQGA 3LSUA 2DOSA 4LFAO 3CCMV 2GHYA 2VWJA 2IJHA 1YJWV 4I5SA 1GN6A 4FLXA 1HNWB 1TAEA 3C3TA 2K1EA 5IJ9B 2UU9O 1E1QG 4I0XB 4JI1O 2WWWA 4B3SO 4JI7O 1HNXB 1VF5B 4IIJA 4DV6O 1SZXA 5IYBO 5DM6V 2JS3A 4FK5C 3SDLA 2W6JG 4NYKA 3AG2B 3AK2A 4J7KA 2L35A 1NTKH 4UB6Z 3T4DA 2AZ0A 4DR3B 1WB7A 4WFEA 1HDJA 3EVKA 3OMNB 1VQ7V 1G4YB 5L3CA 2IW5A 1M4UA 1HWYA 2LQTA 4XDLA 3G4SV 1SA0A 2Y4TA 3CHXA 5EK0A 3WU2Z 1Q81W 5KUKA 1HNWO 5B1AB 2H94A 5KX5A 2EIKC 1Q6IA 4I9QA 2X6CA 3K59A 4MTFA 4TSFG 3OE7G 1CEZA 1OHHG 2DN9A 2Q8VA 1Q3EA 2QWQB 3A2FA 2X7RB 4YY3B 1HNXO 2HR3A 3B77A 1M57B 3E89A 1KECA 1QLEB 4KUMA 4GX5A 4X1IB 4H0LB 5LA6A 1GN3A 4I50A 3RT3C 2ITCC 5K1XA 1YHQV 5L3DA 2CGOA 4DR3O 1KP2A 1PM9A 1ZL8A 2VQFO 4OPHA 2Q68A 3JAMN 3ZHQA 1MZFA 4F6RA 2H3OA 1X59A 4YHHO 1WNSA 1OCZC 3OTOB 3UM7A 1V54B 4FM1A 3ETEA 3ICXA 1XNQO 1M5IA 1B04A 4D6TH 4XDJA 4GYCB 2HKOA 3D36C 2XHBA 5H2FZ 3CXCU 4PA4A 3RVYA 2WAMA 4KL1A 1ZAUA 3K03A 1XMQB 2DWDC 2ZE6A 3K5LA 3E22A 4R8CA 4CH3A 3CRRA 5KMGA 2DQ3A 2WLLB 4UCOA 1VQ6V 1J5EB 1PNLA 3E2EA 3OUSA 4IYHA 2DYRC 4LC1A 4WBNB 3WB0A 2CAZC 3CYOA 3K9SA 3ZRXA 1BSMA 3AK3A 1GKFA 5LXTA 1O9GA 3U10A 3OTOO 2B1GA 4PD4F 2OCHA 4X89A 4X65O 3F7YC 5GONB 1FFXA 5CBGA 5C8YB 4EEQA 2W0FC 1QU7A 3H9VA 2WLMA 5IDJA 5LYJA 3B2EE 1XMQO 1BQZA 3ZEDA 5JH7A 5LHIA 3SPIA 2PZSA 1ENVA 1MNGA 1S77D 1R6NA 4Z1MG 1J5EO 5FPRA 1GH6A 3BABA 3ASOB 2FB5A 2DYSC 2YI9A 4WF9V 1AILA 1TGOA 3GWOA 2YEVA 1FXKA 1MZEA 3BA8A 3RWRD 3OGCC 5ITZB 1S72V 1EFRG 2V4DA 2Q9LA 3PJSK 1JPXA 1KKCA 2UUAB 1XBLA 3CMAV 5L3GA 4UXNA 3DGEA 3J81N 1SA0B 1AP5A 1BHAA 4DUZO 4EKWA 5L3BA 1P4RA 3CSXA 4LNUA 1VQPV 5KX5B 2LJ2A 2ITDC 2QWOB 5LOVA 3TXQA 3GB7C 3S3XA 4YJ2A 4NXNB 3DXRB 1Q82W 1K5QA 1QNMA 3SGIA 3NXSA 4PA6A 5A2QN 2Y0IA 4G28B 1XHZA 3DSQA 1ZSPA 1AB3A 1JMKC 2Q67A 4RQFA 2DQ0A 5LA6B 1WAZA 4I50B 4O4LA 4K8XA 1Q6UA 4MW8A 3OW2U 2Q7HA 3JAKA 1Q90D 2CTRA 1ZL8B 2IU0A 3ETDA 3G80A 3K5OA 4EFBA 4E2LA 4DV7B 2QWRB 2UUAO 1RFYA 1XDCA 1VF6A 3H1HH 5FNVA 3E8HA 4YXWG 2EZOA 4JYAB 4U7OA 1GN4A 2Q73A 2QGNA 1XQ8A 4B3MB 2EULA 4KHPO 1A32A 2EINB 4D7TA 5CA3A 2AHYA 2ARHA 3DC5A 3P3PA 4GLXA 1NJIW 4PELA 4UCSA 3FAVA 3O65A 5KMGB 1PD3A 5B66Z 2NN4A 4JTAB 3UT5A 2OWOA 1DF5A 1JA8A 4N23A 2ILMA 3AG3B 3K79A 3SYAA 1NR7A 3I5DA 5IY5C 4K35A 2EIMB 1QR8A 1EZJA 3ZN1A 1PNKA 5K1PA 1OCRB 4NTWA 3W7WA 2EIJB 1NZ6A 2Q6AA 3UKMA 4DV7O 3ABKB 2N04A 4DK1A 1VQ9V 1D5AA 2Q0OC 1SRYA 2P7TC 3CMEV 1PPJH 5CA1A 2HG5C 1D2DA 2LW1A 1B3QA 5LHHA 1FFXB 4WFAV 1NQTA 4JYAO 1YDXA 1KBHA 1LUWA 2HFEC 4DV3B 3B4SA 4B3MO 1IXBA 1EN4A 1HR0B 3F5TA 3VQWA 5LYJB 2V7QG 3K9AA 3WG7C 2ADPA 5IJ9A 5HFMA 5JH7B 2IJKA 3I56V 2UUCB 4I0XA 1FFTB 5DECA 1H8EG 2P6JA 4CZZA 3KG2A 3ZMZA 1V55C 1KB9F 1O9HA 5KHKA 2E3CA 4ABMA 5LL6Y 3ZHSA 2OCCB 2XUMA 1IXMA 3QVNA 4TUYA 3LNMB 1SETA 2QTSA 4O2BA 3CX5F 3N2KA 1VQOV 1JR9A 3FB5C 1FXKB 2JGUA 2QE7G 4JTCB 3D3IA 1YZBA 3HKBB 3FB8C 4PDMA 2ZR2A 2HVJC 2Y69B 1SZTA 4QPKA 2ZE8A 1OCOC 1L8DA 3RBZA 4Z2WA 1FKAO 1Y76A 1RM1B 4DV3O 2QM8A 1HR0O 4LNUB 1JJOA 1K92A 2OTJV 1I5YA 4LBEC 3K57A 2YIDA 1M9NA 4JI2B 3G6EV 2UUCO 4O4HB 4R7CA 3EXAA 4DW1A 1OJHA 2L6LA 1UFIA 2R70A 1LR1A 1H2NA 1YF2A 1S5JA 3HB3B 2CE4A 3RW0A 1R6KA 3LNNA 4O4LB 4DR1B 3JAKB 4K3AA 5B1NA 4UFZA 1S5HC 1NT2B 1MG1A 5CA0A 2IH3C 3B09A 3K3WA 2OYQA 1N0NA 2Z5UA 3H1JH 4IT5A 4UV9A 4UV8A 1UPGA 4O4IA 1MA1A 4JYYA 4MTOA 2RN9A 4PV1B 4CH5A 2XOKG 2Z3YA 2ZE5A 3BY6A 3ZRWA 2XT9A 5FNVB 3ZHVA 1OCCB 4H37A 4FFBB 3BEHA 1WPXA 1GK9A 4LFAB 2P22C 2F23A 4J42A 1G8MA 1IX9A 4JI2O 4RUEA 1H38A 4JGSA 3SPGA 2JS5A 3F5WC 3QF7A 4U7NA 3IC7A 5CN0A 3TK1A 2QDOA 1GM8A 3CPWU 2VS0A 3UT5B 1R73A 4J10A 3CB2A 3RYFB 1JFFB 4WBNA 4B3TB 3JD3A 3LSSA 1IBKO 3JASA 4DR1O 4MVZA 2WLHA 4LR3A 4J80A 2FYUH 4A5UB 3UQ8A 4IHJA 2ZQMA 5LGNA 3CRMA 3ETGA 4CC6A 5CA1B 2RJZA 4CH4A 3AG1C 5GONA 3CRCA 5C8YA 1M56B 3JYCA 1BGYH 1P49A 1URFA 3SYCA 3U0ZA 5B3SC 3HPLC 1Q5OA 3QO8A 1W59A 4MT8A 2A79B 3CC4V 4X20B 3SPCA 1Q6HA 2CTWA 3ZIAG 4WFFA 4UB8Z 1QR9A 3JD2A 1K4CC 2A3QA 2UXCB 1VF6C 4DR7B 2HP8A 4U3FH 1VF7A 3KCXA 2ZCEA 4LWSB 4B3TO 3E8BA 2EZPA 2QJ1A 1YTFD 4TUYB 1L1FA 4O2BB 3Q4HB 4RUFA 1I94B 3N2KB 4QE9A 3UO3A 2A9HA 3C3SA 2WLNA 3D8CA 5ITZA 2VQFB 4MS2A 3TJTA 1FD9A 4TQDA 3BFRA 5JCOC 4B3RO 5L3FA 4X66O 3L75H 4DYLA 1SESA 2PF4E 3RGBA 4YHHB 3R65A 4TQFA 3SPHA 2QWNB 1Y76B 1XNQB 5EYPB 1JOYA 1G6UA 3IAYA 3ABUA 1AI6A 2ZDIA 1ZX3A 3VQVA 1VP7A 3ZMSA 3K04A 3DXRA 3JD1A 3G6BA 2UXCO 4DR7O 3ZMVA 4ZKIA 2PI4A 4YJ3A 4DV4B 2LGWA 3WFVA 3N27A 4JZGA 1YJNV 4R50A 5D5QA 3APQA 5J2TA 5KUMA 5LP6A 2UXXA 2JGDB 1XREA 4MVSA 2YXLA 2OTLV 1WP7A 1I94O 1F51A 4FLVA 4P9OA 5CA0B 1XMOB 4UCUA 1VARA 1W2BU 3OUFA 5JJNB 4TV9A 3ABLB 1K34A 4RAIA 4O4IB 4PHZA 2LFRA 1P7GA 3RFRA 3ZRWB 1SQBH 4X65B 3AG2C 1AI7A 1SQQH 2QM7A 4JAAA 1Y6XA 1N0JA 1WB8A 2HEPA 3X2QB 1FAFA 1PNMA 3CC2V 2QTOA 1E1RG 4LF6B 1OZ0A 3CEIA 4FFKA 3M8AA 4DV4O 3G71V 3BCCH 3JD0A 5B1AC 4U3JB 4PA7A 4BIOA 1R6TA 4ZOLA 3JASB 3UCSC 2HLDG 4DR2B 2QEXV 3JATB 3ZX6A 3OT7A 2Q5ZA 1EN5A 4KP4A 5CBFA 3K58A 1XMOO 4GZRB 1YITV 2PTMA 1WLEA 3A0RA 3BRCA 4JI3B 1M57C 2EILB 4IHJB 1QLEC 3EHBB 4HYOA 3FD9A 2E5LB 4OXSA 4UCRA 3VQYA 2BSKA 1YIJV 4DUZB 3OR7C 2F43G 3RYCA 1H2GA 4BAYA 3ZHUA 3E8FA 1K7DA 5KHIA 4Q6GA 4X88A 4LF6O 5D5PA 1V54C 2AZ2A 2C2AA 5JJJB 1F4NA 1MABG 4PDLA 4CH6A 3OMAB 5CB4A 1SS3A 1VQMV 1S76D 5JJEB 4UCVA 2ZNIA 3CRAA 4DR2O 4GKJB 1BQ0A 1YCIA 4TOIA 3B8MA 4QGPA 2ZXWB 5LHGA 3HKBA 4JI3O 4CS3A 3BAAA 5FPOA 2RCVA 5B1OA 2E5LO 5E79Z 2JVDA 4K0KB 3QNEA 2Q7EA 2KSDA 2F4VO 3HKDA 1H2LA 3P32A 3QTCA 4I9WA 4MW3A 5EBWC 3T1YB 4X1KA 5B1BB 4X64O 4DW0A 3OTFA 5KHGA 1NU1H 4P30A 5F2VO 4KHPB 3CWBH 4O4HA 3PN1A 4IL6Z 4K8ZA 2F1MA 4PA9A 3IJ4A 5JQGA 2UUBB 1JQ0A 4YJ3B 1WP8A 2YS8A 2FKXA 5CBHA 2RDCA 4NVPA 1QVGU 1Q86W 4GX0A 4GKJO 1G1XB 5J2TB 5LP6B 3F7VC 1GAXA 1KU9A 4PDVA 3OEEG 4DV5B 2NR5A 1SQFA 4E4EA 4X62B 1VQNV 4TV9B 3SPJA 3OM3B 1Z5VA 2MK3A 1PL0A 4UUJC 4K0KO 2QA4V 3ASOC 1THZA 4P2ZA 2IU3A 1VIBA 2HJDA 3SYPA 2GUZB 4FFBA 3T1YO 4DV0B 4D7SA 2GTAA 4AILC 4DK0A 3T4ZA 2AGAA 2BTQA 1NBMG 5EC2C 3RYIA 1DK1A 3KCYA 3L74H 2UUBO 1S5LZ 1CXZB 2E74B 3CCEV 1SF9A 2VRZA 3I55V 5CMUA 1JFFA 1KYOF 3RYFA 4DR4B 1NI8A 2ZDIC 4DR5B 4ZOLB 3JAWB 2CUGA 4DV5O 2Y0PA 3JALB 4X62O 5EZYA 2Z0AA 3T2MA 2ZIMA 5EIBD 1JVMA 2O57A 2E76B 1IBLB 2BCCH 1K33A 2P4KA 3STZC 2BSKB 1BHBA 4DV0O 1XI1A 4MTGA 3NR7A 3RYCB 3FB7C 4IGGA 3G67A 1XNRB 1YVWA 4X20A 3OR6C 1ZTEA 2DMXA 2QSAA 4FZ0A 1F7YA 2UXDB 2VWKA 1GM7A 4NB5A 2ZNJA 4FLWA 4RWUA 4LWSA 4DR4O 5GW7A 3SJAC 5CB4B 4LH7A 4DR5O 2LGQA 2OIEA 2EINC 4CBCA 1K5SA 3Q4HA 4EFEA 3CCVV 2YIAA 4LF7B 2QKSA 4LFBO 4H33A 4ZBMA 2NLJC 3RYHB 3OFNG 4B7EA 1AR1B 4DV2B 1ZWIC 1XOUA 1IBLO 4ZHQA 3ZRVA 4JYCA 3AG3C 4N21A 4OX9O 4BW5A 2ETNA 3ABMB 2EIMC 4GX1A 3CJHA 2D3OW 3D36A 5EYPA 1QBZA 2DWEC 1OCRC 3HKDB 4Z1VA 1YTFB 1R1BA 2F93B 2EIJC 3BPZA 1XNRO 4X1KB 1H2KA 3L72H 2R72A 3ABKC 3FYEB 3E35A 3AG4B 3CCSV 3IC9A 4X9QA 1H2SB 3ZMUA 2EJ7A 1KQSU 4J7ZA 5JQGB 1I0HA 2UXDO 1ZLZA 4PA3A 4O4JB 4NXMO 4JI0O 1PP9H 4FJCC 2X6AA 4XBFA 4HZ3A 3ZHRA 2JGDA 3ASNB 1SC5B 5GTIZ 3AG7A 1IBKB 3A0HZ 3OMIB 4JAVA 4LF7O 4DV2O 1N8RW 1H2MA 1RSOA 3H01A 5H6QA 5BXZA 4EB6B 1TUBA 2OCCC 2XAJA 5BZBA 1ZUQA 2OIGA 4W4LA 1FPOA 2F66C 2XASA 4KXRA 4OPAA 4RO2A 1FXKC 5IE9A 3B8NA 3K5NA 4GX2A 5A9GA 2ZM6B 4B08A 4TT3G 4JI6O 3T1HO 2Y69C 2BTQB 2WLIB 2JRIA 3RYIB 4BW9A 2WLJA 4JPRA 3A8TA 5L3EA 5LGUA 4LFCB 2CTPA 1RM1C 4U3JA 2Q4PA 4H13B 3OEHG 4HAMA 3FB6C 2R9IA 1BE3H 3JATA 1XEQA 1MSWD 3W7XA 1DLBA 2XAQA 2JIZG 3ZJZA 1BCCH 4QPJA 1GRJA 1EM1A 2JJ2G 4WFHA 5EZYB 2YIBD 4W4KA 1XUQA 3QO5A 3OGIB 4NKGB 5KAIZ 4B3RB 4X66B 1US6A 2GSMB 3RVZA 2PY5A 5LMUB 2Q7GA 1BZKA 4J9YB 2LW7A 3TCUA 2YICA 2EIKB 1YXBA 4L87A 1S0VA 2ZM6O 1FXHA 1KP3A 3H1LH 2JDIG 3K5MA 1VEWA 3BHPA 1PV0A 5KA5A 4LFCO 3APOA 3LDEA 3SJQC 4AQYB 1LNQA 1OCCC 4JV5B 2UXBO 4IYIA 1RP3B 2AHZA 5E1AC 1KD1W 2JK5C 2ATKC 2B5UA 3R66A 3OD4A 5FL7G 2HVKC 2P4VA 1EZVH 2V1DA 3CE2A 1K8AW 2DW4A 5IYDO 3D3QA 5GTHZ 1OCZB 4ZHQB 2QKCA 2P90A 4CC5A 5LMUO 5IYZB 1EN6A 1ORQC 1KC8W 1K73W 1N34B 5JWPA 3W7SA 3CJHB 1UJWB 2WSSG 1W0JG 2R9RB 3K0GA 5BR8B 4TWKA 4UVBA 1AVMA 1GMGA 3A0BZ 3MHSC 1RPOA 3M99B 1GN2A 1I5XA 1QCEA 1MOFA 1AJQA 1VMGA 2RNBA 4B7KA 3TETA 2P5OA 1K97A 1DGSA 3QO7A 4AQYO 4LH6A 1M56C 4H44B 4JV5O 3HKCA 4CS2A 3LUTB 2DE0X 1LUVA 2DYRB 1PKXA 1AJNA 2LP7A 4YIOA 5IYCO 2BTOA 1IURA 1VQ4V 1YI2V 4JZ2A 1EBOA 2CK3G 3MDSA 2H8PC 1FXVA 3KKYA 3H1KH 1AROP 3J80N 1RSOB 5DEDA 2HJFC 4F4LA 2ZD9A 5IJ0B 1TUBB 4P9PA 1N34O 5BMVA 4AI8A 5BR8O 5KLVH 2GUZA 1IVSA 3N2GA 3SYQA 4BIUA 4RQEA 1U97A 1QHTA 3L9DA 3CXHF 2QM4A 1AJPA 3J7AU 1NH2B 4UVAA 5LMNB 4HNAA 5C93A 2UXNA 4ZIBA 4J9ZB 1Y74A 3LDDA 1H8HG 5KAFZ 1S3JA 2DYSB 3P3NA 3P30A 4HBNA 3JAWA 4O2AB 1TUEB 1NKDA 3LDCA 3VOUA 4GKKB 4YY3O 3JALA 4QNHB 3ZMTA 3CD6V 3JD4A 2WA4A 1QLNA 1XILA 1I7FA 1K4DC 3L73H 1NTZH 3S3WA 4I55B 1I08A 1Z2GA 3EFFK 3JARB 1IBMB 4DUYB 3CCUV 3JCZA 4WFGA 4X1YA 4FLUA 1Q8IA 4NTXA 5LBQA 4BWAA 4TV8B 1MMMA 4CS4A 2PYJA 1L0LH 2F4VB 1N32B 2GDSA 4NTYA 1XL6A 2PYLA 3UO2A 1T5EA 2MW2B 4X64B 3ABLC 1NVPB 5LMNO 2YIBA 3ETQA 1NTMH 2XTAA 2ZKOA 2BOBC 2RMKB 3STLC 4PI2A 2A7WA 2YC0A 2ZR3A 1V9PA 4J41A 4UCTA 4FMTA 3VBBA 4JI5B 4DV1B 3W7TA 3MHHC 2W0XA 1SQXH 4DO2A 1GTOA 1SQPH 2VQEB 5H5NA 2CDYA 4I4TA 3X2QC 2ADQB 4QJFB 4LF4B 3CCJV 4GKKO 5EC1C 5HFLA 1BS3A 3C90A 1RPRA 1N4CA 4MTXA 4DRXA 1BL8A 3RYHA 1BMFG 2IH1C 5JVDA 2YXYA 4C7UA 4IIJB 1K9MW 4FLZA 1IBMO 4DUYO 1COWG 1NS1A 2GTSA 1Q7YW 1N33B 1KMIZ 1VQKV 1BT8A 5H9CA 4FM0A 1N32O 4MVMA 1KKDA 1XL4A 3JSNA 1X4TA 1FYJA 2EILC 2PUSA 5EBLC 2CTQA 2XAHA 4JASA 2EX3A 4LF5B 2CGNA 2XAFA 3ZBHA 4O4JA 1XHXA 5BY1A 1AI5A 3CCQV 4JI5O 3U11A 4DV1O 3HKCB 4BIZA 2VQEO 5IY5B 4MVQA 3TGUH 3ZS8C 3FFQA 4LF4O 3SJCC 4GUNA 2KQXA 1WN7A 1SERA 3ZCCA 2R9AA 4FPPA 2KG7A 4FVMA 4OGQB 3E8GA 3ML0A 5EIBC 3CCLV 2FTKA 2NNUA 1M1KW 1D5NA 1NH2D 1IDSA 1GM9A 2HHHB 4EB6A 1N33O 4DR6B 3JSLA 1J95A 1AR5A 4JF3A 2F95B 2CH7A 5BMVB 1M90W 4FLYA 1U96A 1R3KC 4I7ZB 1R3LC 3HKEA 1OV9A 4UVCA 2WLKA 2AW9A 2GV9A 3N2GB 2QKAA 2ZXWC 3B40A 2B9ZA 3O9OA 3WG7B 2BE3A 1AP6A 4F6RB 1TVKA 3K0DA 2WA3A 1Q43A 2M7WA 2WLIA 2IJJA 4LF5O 4LF9B 4GCZA 4HNAB 4KFMA 1WJZA 1AI4A 4X8AA 1V55B 2ODMA 3IFXA 4QIWF 1Y74B 5KHHA 1WPBA 4DXWA 4NXNO 3GVMA 4G27B 5LGTA 5B1BC 4J11A 3RN4A 2YXHA 2A06H 3OAAG 2JEXA 2JJ1G 4GT1A 3E22B 4G2KA 5J2UA 2ZIOA 4XDKA 2ZT9B 1NVPD 4LFBB 2P06A 2IBZH 5KHJA 2G38A 2PGGA 2HHHO 1WA8A 4DR6O 3E83A 1P84F 5JCOA 4WCEV 1JX9A 1OCOB 5LP6C 3CRQA 2N05A 2IJIA 4OX9B 4PJ0Z 2EBOA 4X1YB 2YUAA 4JI8B 1P7BA 4ZI7A 2QWPB 1VQLV 4PI0A 2X0LA 3GWKC 4JI4B 3CCRV 4WFBV 1HP8A 5DN6G 5LXTB 3L71H 2XAGA 2N74A 1W0KG 5IT9N 4LF9O 2ZINA 2D2CB 5IWAB 3AK1A 2JEUA 4F6EA 5J9PC 1B06A 4YIPA 3WB2A 4NXMB 4JI0B 1B6QA 3VQXA 1FJGB 1NR1A 4I4TB 1AR4A 2BOCC 5B5EZ 4PDRA 3SR2C 1R3JC 3H1IH 3K08A 1Y4MA 1M93A 3LSQA 3HR0A 3T1CA 4DRXB 3ABTA 1KUQA 4LF8B 3CC7V 5JVDB 3SYOA 1K3EA 2K9PA 2XNDG 4JTDB 1DTOA 5IYZA 3MD0A 2YSUB 2FL4A 4JI8O 2GBOA 2YEVB 3W7UA 4JI4O 3BVOA 2A0LA 3KZIZ 3FYIB 4LCUC 1SKVA 3DTUB 1E79G 2B1IA 4JI6B 3T1HB 1VQ5V 5IWAO 1HNZB 1SQVH 3CS5A 1PL4A 4LP8A 2KB1A 2E75B 5TISZ 4FZ1A 4AHCA 1FJGO 3FKSG 4MVUA 5H6RA 4MSWC 5LOVB 1DF4A 1Y66A 4JAUA 4YJ2B 1F4MA 3JCUZ 2EJRA 2KG7B 4R6ZA 2YDEA 2P67A 5KA6A 1N36B 1YSCA 3TXSA 4LF8O 1JCHA 1L0NH 4X1IA 2QR4A
chains in the Genus database with same CATH topology
3O65A 2VQEO 1HR0O 4K0KO 2UU9O 1XNQO 2N74A 4LF6O 4LFBO 5IT9N 4LF4O 4LF9O 1I94O 4JI1O 4B3SO 2UUCO 3T1YO 4JI7O 4DV6O 1IBLO 1XEQA 4OX9O 4AQYO 2AGAA 3J81N 4DR2O 4JV5O 1DK1A 3SDLA 4DUZO 1HNZO 2UUBO 4DV7O 1N33O 5FLXN 1R1BA 5LMNO 1XNRO 2ZKOA 1D2DA 4JI3O 1KUQA 2LW7A 4JYAO 4DV5O 5A2QN 4B3TO 2E5LO 2UXDO 4B3MO 1N36O 2DJVA 2ZM6O 3F5TA 5H5NA 4JI8O 4X62O 3J80N 4NXMO 1AB3A 4JI0O 4LF5O 4GKKO 2Z0AA 1HNWO 4JI4O 2F4VO 3M8AA 4DV4O 3OTOO 1N34O 4X64O 5BR8O 4X65O 4LFCO 4LF7O 1R6TA 4NXNO 4B3RO 1IBMO 4JI2O 4X66O 4DUYO 4DV2O 2UXBO 1NS1A 4DV0O 1HNXO 5IWAO 5LL6Y 2UUAO 1XMOO 2FKXA 3R66A 3J7AU 1XMQO 5BXZA 4GKJO 1N32O 1G1XB 1FJGO 3RT3C 2HHHO 4DR6O 1YZBA 1F7YA 4DR3O 1FYJA 4OPAA 1J5EO 2VQFO 1IBKO 4DR1O 4KHPO 4OPHA 2DOSA 1A32A 4LFAO 2UXCO 4DR7O 3JAMN 4LF8O 4DR4O 4JI6O 3T1HO 5LMUO 4DR5O 5BY1A 1FKAO 4YY3O 4A5UB 1X59A 2JRIA 4YHHO 4DV1O 4JI5O 1AILA 4DV3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O65 A;  2VQE O;  1HR0 O;  4K0K O;  2UU9 O;  1XNQ O;  2N74 A;  4LF6 O;  4LFB O;  5IT9 N;  4LF4 O;  4LF9 O;  1I94 O;  4JI1 O;  4B3S O;  2UUC O;  3T1Y O;  4JI7 O;  4DV6 O;  1IBL O;  1XEQ A;  4OX9 O;  4AQY O;  2AGA A;  3J81 N;  4DR2 O;  4JV5 O;  1DK1 A;  3SDL A;  4DUZ O;  1HNZ O;  2UUB O;  4DV7 O;  1N33 O;  5FLX N;  1R1B A;  5LMN O;  1XNR O;  2ZKO A;  1D2D A;  4JI3 O;  1KUQ A;  2LW7 A;  4JYA O;  4DV5 O;  5A2Q N;  4B3T O;  2E5L O;  2UXD O;  4B3M O;  1N36 O;  2DJV A;  2ZM6 O;  3F5T A;  5H5N A;  4JI8 O;  4X62 O;  3J80 N;  4NXM O;  1AB3 A;  4JI0 O;  4LF5 O;  4GKK O;  2Z0A A;  1HNW O;  4JI4 O;  2F4V O;  3M8A A;  4DV4 O;  3OTO O;  1N34 O;  4X64 O;  5BR8 O;  4X65 O;  4LFC O;  4LF7 O;  1R6T A;  4NXN O;  4B3R O;  1IBM O;  4JI2 O;  4X66 O;  4DUY O;  4DV2 O;  2UXB O;  1NS1 A;  4DV0 O;  1HNX O;  5IWA O;  5LL6 Y;  2UUA O;  1XMO O;  2FKX A;  3R66 A;  3J7A U;  1XMQ O;  5BXZ A;  4GKJ O;  1N32 O;  1G1X B;  1FJG O;  3RT3 C;  2HHH O;  4DR6 O;  1YZB A;  1F7Y A;  4DR3 O;  1FYJ A;  4OPA A;  1J5E O;  2VQF O;  1IBK O;  4DR1 O;  4KHP O;  4OPH A;  2DOS A;  1A32 A;  4LFA O;  2UXC O;  4DR7 O;  3JAM N;  4LF8 O;  4DR4 O;  4JI6 O;  3T1H O;  5LMU O;  4DR5 O;  5BY1 A;  1FKA O;  4YY3 O;  4A5U B;  1X59 A;  2JRI A;  4YHH O;  4DV1 O;  4JI5 O;  1AIL A;  4DV3 O; 
#chains in the Genus database with same CATH topology
 3DC6 A;  3AG1 B;  3ZRS A;  3K06 A;  3L70 H;  5IJ0 A;  2LO1 A;  3FX7 A;  2CH7 B;  3QG5 A;  1TA8 A;  1R3I C;  1CP9 A;  3ZN0 A;  1F23 A;  2Q0A A;  3HKE B;  5B3S B;  2WPD G;  4NR1 A;  2X6B A;  1QQC A;  3AEI A;  1JJ2 U;  3ZHT A;  3WB1 A;  4BR6 A;  1CPY A;  2ZE7 A;  3MAQ A;  3SJB C;  1Y67 A;  1TVK B;  1HNZ O;  1QVF U;  1FS0 G;  1MSD A;  5FLX N;  3M7M X;  2YI8 A;  4ICG A;  3ABM C;  3THO A;  2LFS A;  4J7J A;  2UXB B;  4MVO A;  2M6Y A;  1VQ8 V;  4QE7 A;  4O2A A;  1YJ9 V;  3AG4 C;  1N36 O;  2DJV A;  5AG2 A;  1IZ3 A;  5J2U B;  2UU9 B;  1HW7 A;  3FAV B;  2WLL A;  4JI1 B;  4B3S B;  1WA8 B;  4JI7 B;  5EBM C;  2Y48 A;  4I55 A;  1Z5W A;  4DV6 B;  3JAR A;  4FM2 A;  3BA9 A;  1ROP A;  3E86 A;  3ASN C;  2Y4U A;  4L8J A;  3CP1 A;  4MVR A;  2Q69 A;  2RQ6 A;  2PI5 A;  4FIP C;  4ZI7 B;  4TV8 A;  4JYB A;  2IM9 A;  2OT5 A;  3IGA C;  1GO3 F;  2AXT Z;  2W6I G;  2FML A;  4Q20 A;  4ASU G;  2KKW A;  1YEW A;  4FLT A;  1SQG A;  3LSU A;  2DOS A;  4LFA O;  3CCM V;  2GHY A;  2VWJ A;  2IJH A;  1YJW V;  4I5S A;  1GN6 A;  4FLX A;  1HNW B;  1TAE A;  3C3T A;  2K1E A;  5IJ9 B;  2UU9 O;  1E1Q G;  4I0X B;  4JI1 O;  2WWW A;  4B3S O;  4JI7 O;  1HNX B;  1VF5 B;  4IIJ A;  4DV6 O;  1SZX A;  5IYB O;  5DM6 V;  2JS3 A;  4FK5 C;  3SDL A;  2W6J G;  4NYK A;  3AG2 B;  3AK2 A;  4J7K A;  2L35 A;  1NTK H;  4UB6 Z;  3T4D A;  2AZ0 A;  4DR3 B;  1WB7 A;  4WFE A;  1HDJ A;  3EVK A;  3OMN B;  1VQ7 V;  1G4Y B;  5L3C A;  2IW5 A;  1M4U A;  1HWY A;  2LQT A;  4XDL A;  3G4S V;  1SA0 A;  2Y4T A;  3CHX A;  5EK0 A;  3WU2 Z;  1Q81 W;  5KUK A;  1HNW O;  5B1A B;  2H94 A;  5KX5 A;  2EIK C;  1Q6I A;  4I9Q A;  2X6C A;  3K59 A;  4MTF A;  4TSF G;  3OE7 G;  1CEZ A;  1OHH G;  2DN9 A;  2Q8V A;  1Q3E A;  2QWQ B;  3A2F A;  2X7R B;  4YY3 B;  1HNX O;  2HR3 A;  3B77 A;  1M57 B;  3E89 A;  1KEC A;  1QLE B;  4KUM A;  4GX5 A;  4X1I B;  4H0L B;  5LA6 A;  1GN3 A;  4I50 A;  3RT3 C;  2ITC C;  5K1X A;  1YHQ V;  5L3D A;  2CGO A;  4DR3 O;  1KP2 A;  1PM9 A;  1ZL8 A;  2VQF O;  4OPH A;  2Q68 A;  3JAM N;  3ZHQ A;  1MZF A;  4F6R A;  2H3O A;  1X59 A;  4YHH O;  1WNS A;  1OCZ C;  3OTO B;  3UM7 A;  1V54 B;  4FM1 A;  3ETE A;  3ICX A;  1XNQ O;  1M5I A;  1B04 A;  4D6T H;  4XDJ A;  4GYC B;  2HKO A;  3D36 C;  2XHB A;  5H2F Z;  3CXC U;  4PA4 A;  3RVY A;  2WAM A;  4KL1 A;  1ZAU A;  3K03 A;  1XMQ B;  2DWD C;  2ZE6 A;  3K5L A;  3E22 A;  4R8C A;  4CH3 A;  3CRR A;  5KMG A;  2DQ3 A;  2WLL B;  4UCO A;  1VQ6 V;  1J5E B;  1PNL A;  3E2E A;  3OUS A;  4IYH A;  2DYR C;  4LC1 A;  4WBN B;  3WB0 A;  2CAZ C;  3CYO A;  3K9S A;  3ZRX A;  1BSM A;  3AK3 A;  1GKF A;  5LXT A;  1O9G A;  3U10 A;  3OTO O;  2B1G A;  4PD4 F;  2OCH A;  4X89 A;  4X65 O;  3F7Y C;  5GON B;  1FFX A;  5CBG A;  5C8Y B;  4EEQ A;  2W0F C;  1QU7 A;  3H9V A;  2WLM A;  5IDJ A;  5LYJ A;  3B2E E;  1XMQ O;  1BQZ A;  3ZED A;  5JH7 A;  5LHI A;  3SPI A;  2PZS A;  1ENV A;  1MNG A;  1S77 D;  1R6N A;  4Z1M G;  1J5E O;  5FPR A;  1GH6 A;  3BAB A;  3ASO B;  2FB5 A;  2DYS C;  2YI9 A;  4WF9 V;  1AIL A;  1TGO A;  3GWO A;  2YEV A;  1FXK A;  1MZE A;  3BA8 A;  3RWR D;  3OGC C;  5ITZ B;  1S72 V;  1EFR G;  2V4D A;  2Q9L A;  3PJS K;  1JPX A;  1KKC A;  2UUA B;  1XBL A;  3CMA V;  5L3G A;  4UXN A;  3DGE A;  3J81 N;  1SA0 B;  1AP5 A;  1BHA A;  4DUZ O;  4EKW A;  5L3B A;  1P4R A;  3CSX A;  4LNU A;  1VQP V;  5KX5 B;  2LJ2 A;  2ITD C;  2QWO B;  5LOV A;  3TXQ A;  3GB7 C;  3S3X A;  4YJ2 A;  4NXN B;  3DXR B;  1Q82 W;  1K5Q A;  1QNM A;  3SGI A;  3NXS A;  4PA6 A;  5A2Q N;  2Y0I A;  4G28 B;  1XHZ A;  3DSQ A;  1ZSP A;  1AB3 A;  1JMK C;  2Q67 A;  4RQF A;  2DQ0 A;  5LA6 B;  1WAZ A;  4I50 B;  4O4L A;  4K8X A;  1Q6U A;  4MW8 A;  3OW2 U;  2Q7H A;  3JAK A;  1Q90 D;  2CTR A;  1ZL8 B;  2IU0 A;  3ETD A;  3G80 A;  3K5O A;  4EFB A;  4E2L A;  4DV7 B;  2QWR B;  2UUA O;  1RFY A;  1XDC A;  1VF6 A;  3H1H H;  5FNV A;  3E8H A;  4YXW G;  2EZO A;  4JYA B;  4U7O A;  1GN4 A;  2Q73 A;  2QGN A;  1XQ8 A;  4B3M B;  2EUL A;  4KHP O;  1A32 A;  2EIN B;  4D7T A;  5CA3 A;  2AHY A;  2ARH A;  3DC5 A;  3P3P A;  4GLX A;  1NJI W;  4PEL A;  4UCS A;  3FAV A;  3O65 A;  5KMG B;  1PD3 A;  5B66 Z;  2NN4 A;  4JTA B;  3UT5 A;  2OWO A;  1DF5 A;  1JA8 A;  4N23 A;  2ILM A;  3AG3 B;  3K79 A;  3SYA A;  1NR7 A;  3I5D A;  5IY5 C;  4K35 A;  2EIM B;  1QR8 A;  1EZJ A;  3ZN1 A;  1PNK A;  5K1P A;  1OCR B;  4NTW A;  3W7W A;  2EIJ B;  1NZ6 A;  2Q6A A;  3UKM A;  4DV7 O;  3ABK B;  2N04 A;  4DK1 A;  1VQ9 V;  1D5A A;  2Q0O C;  1SRY A;  2P7T C;  3CME V;  1PPJ H;  5CA1 A;  2HG5 C;  1D2D A;  2LW1 A;  1B3Q A;  5LHH A;  1FFX B;  4WFA V;  1NQT A;  4JYA O;  1YDX A;  1KBH A;  1LUW A;  2HFE C;  4DV3 B;  3B4S A;  4B3M O;  1IXB A;  1EN4 A;  1HR0 B;  3F5T A;  3VQW A;  5LYJ B;  2V7Q G;  3K9A A;  3WG7 C;  2ADP A;  5IJ9 A;  5HFM A;  5JH7 B;  2IJK A;  3I56 V;  2UUC B;  4I0X A;  1FFT B;  5DEC A;  1H8E G;  2P6J A;  4CZZ A;  3KG2 A;  3ZMZ A;  1V55 C;  1KB9 F;  1O9H A;  5KHK A;  2E3C A;  4ABM A;  5LL6 Y;  3ZHS A;  2OCC B;  2XUM A;  1IXM A;  3QVN A;  4TUY A;  3LNM B;  1SET A;  2QTS A;  4O2B A;  3CX5 F;  3N2K A;  1VQO V;  1JR9 A;  3FB5 C;  1FXK B;  2JGU A;  2QE7 G;  4JTC B;  3D3I A;  1YZB A;  3HKB B;  3FB8 C;  4PDM A;  2ZR2 A;  2HVJ C;  2Y69 B;  1SZT A;  4QPK A;  2ZE8 A;  1OCO C;  1L8D A;  3RBZ A;  4Z2W A;  1FKA O;  1Y76 A;  1RM1 B;  4DV3 O;  2QM8 A;  1HR0 O;  4LNU B;  1JJO A;  1K92 A;  2OTJ V;  1I5Y A;  4LBE C;  3K57 A;  2YID A;  1M9N A;  4JI2 B;  3G6E V;  2UUC O;  4O4H B;  4R7C A;  3EXA A;  4DW1 A;  1OJH A;  2L6L A;  1UFI A;  2R70 A;  1LR1 A;  1H2N A;  1YF2 A;  1S5J A;  3HB3 B;  2CE4 A;  3RW0 A;  1R6K A;  3LNN A;  4O4L B;  4DR1 B;  3JAK B;  4K3A A;  5B1N A;  4UFZ A;  1S5H C;  1NT2 B;  1MG1 A;  5CA0 A;  2IH3 C;  3B09 A;  3K3W A;  2OYQ A;  1N0N A;  2Z5U A;  3H1J H;  4IT5 A;  4UV9 A;  4UV8 A;  1UPG A;  4O4I A;  1MA1 A;  4JYY A;  4MTO A;  2RN9 A;  4PV1 B;  4CH5 A;  2XOK G;  2Z3Y A;  2ZE5 A;  3BY6 A;  3ZRW A;  2XT9 A;  5FNV B;  3ZHV A;  1OCC B;  4H37 A;  4FFB B;  3BEH A;  1WPX A;  1GK9 A;  4LFA B;  2P22 C;  2F23 A;  4J42 A;  1G8M A;  1IX9 A;  4JI2 O;  4RUE A;  1H38 A;  4JGS A;  3SPG A;  2JS5 A;  3F5W C;  3QF7 A;  4U7N A;  3IC7 A;  5CN0 A;  3TK1 A;  2QDO A;  1GM8 A;  3CPW U;  2VS0 A;  3UT5 B;  1R73 A;  4J10 A;  3CB2 A;  3RYF B;  1JFF B;  4WBN A;  4B3T B;  3JD3 A;  3LSS A;  1IBK O;  3JAS A;  4DR1 O;  4MVZ A;  2WLH A;  4LR3 A;  4J80 A;  2FYU H;  4A5U B;  3UQ8 A;  4IHJ A;  2ZQM A;  5LGN A;  3CRM A;  3ETG A;  4CC6 A;  5CA1 B;  2RJZ A;  4CH4 A;  3AG1 C;  5GON A;  3CRC A;  5C8Y A;  1M56 B;  3JYC A;  1BGY H;  1P49 A;  1URF A;  3SYC A;  3U0Z A;  5B3S C;  3HPL C;  1Q5O A;  3QO8 A;  1W59 A;  4MT8 A;  2A79 B;  3CC4 V;  4X20 B;  3SPC A;  1Q6H A;  2CTW A;  3ZIA G;  4WFF A;  4UB8 Z;  1QR9 A;  3JD2 A;  1K4C C;  2A3Q A;  2UXC B;  1VF6 C;  4DR7 B;  2HP8 A;  4U3F H;  1VF7 A;  3KCX A;  2ZCE A;  4LWS B;  4B3T O;  3E8B A;  2EZP A;  2QJ1 A;  1YTF D;  4TUY B;  1L1F A;  4O2B B;  3Q4H B;  4RUF A;  1I94 B;  3N2K B;  4QE9 A;  3UO3 A;  2A9H A;  3C3S A;  2WLN A;  3D8C A;  5ITZ A;  2VQF B;  4MS2 A;  3TJT A;  1FD9 A;  4TQD A;  3BFR A;  5JCO C;  4B3R O;  5L3F A;  4X66 O;  3L75 H;  4DYL A;  1SES A;  2PF4 E;  3RGB A;  4YHH B;  3R65 A;  4TQF A;  3SPH A;  2QWN B;  1Y76 B;  1XNQ B;  5EYP B;  1JOY A;  1G6U A;  3IAY A;  3ABU A;  1AI6 A;  2ZDI A;  1ZX3 A;  3VQV A;  1VP7 A;  3ZMS A;  3K04 A;  3DXR A;  3JD1 A;  3G6B A;  2UXC O;  4DR7 O;  3ZMV A;  4ZKI A;  2PI4 A;  4YJ3 A;  4DV4 B;  2LGW A;  3WFV A;  3N27 A;  4JZG A;  1YJN V;  4R50 A;  5D5Q A;  3APQ A;  5J2T A;  5KUM A;  5LP6 A;  2UXX A;  2JGD B;  1XRE A;  4MVS A;  2YXL A;  2OTL V;  1WP7 A;  1I94 O;  1F51 A;  4FLV A;  4P9O A;  5CA0 B;  1XMO B;  4UCU A;  1VAR A;  1W2B U;  3OUF A;  5JJN B;  4TV9 A;  3ABL B;  1K34 A;  4RAI A;  4O4I B;  4PHZ A;  2LFR A;  1P7G A;  3RFR A;  3ZRW B;  1SQB H;  4X65 B;  3AG2 C;  1AI7 A;  1SQQ H;  2QM7 A;  4JAA A;  1Y6X A;  1N0J A;  1WB8 A;  2HEP A;  3X2Q B;  1FAF A;  1PNM A;  3CC2 V;  2QTO A;  1E1R G;  4LF6 B;  1OZ0 A;  3CEI A;  4FFK A;  3M8A A;  4DV4 O;  3G71 V;  3BCC H;  3JD0 A;  5B1A C;  4U3J B;  4PA7 A;  4BIO A;  1R6T A;  4ZOL A;  3JAS B;  3UCS C;  2HLD G;  4DR2 B;  2QEX V;  3JAT B;  3ZX6 A;  3OT7 A;  2Q5Z A;  1EN5 A;  4KP4 A;  5CBF A;  3K58 A;  1XMO O;  4GZR B;  1YIT V;  2PTM A;  1WLE A;  3A0R A;  3BRC A;  4JI3 B;  1M57 C;  2EIL B;  4IHJ B;  1QLE C;  3EHB B;  4HYO A;  3FD9 A;  2E5L B;  4OXS A;  4UCR A;  3VQY A;  2BSK A;  1YIJ V;  4DUZ B;  3OR7 C;  2F43 G;  3RYC A;  1H2G A;  4BAY A;  3ZHU A;  3E8F A;  1K7D A;  5KHI A;  4Q6G A;  4X88 A;  4LF6 O;  5D5P A;  1V54 C;  2AZ2 A;  2C2A A;  5JJJ B;  1F4N A;  1MAB G;  4PDL A;  4CH6 A;  3OMA B;  5CB4 A;  1SS3 A;  1VQM V;  1S76 D;  5JJE B;  4UCV A;  2ZNI A;  3CRA A;  4DR2 O;  4GKJ B;  1BQ0 A;  1YCI A;  4TOI A;  3B8M A;  4QGP A;  2ZXW B;  5LHG A;  3HKB A;  4JI3 O;  4CS3 A;  3BAA A;  5FPO A;  2RCV A;  5B1O A;  2E5L O;  5E79 Z;  2JVD A;  4K0K B;  3QNE A;  2Q7E A;  2KSD A;  2F4V O;  3HKD A;  1H2L A;  3P32 A;  3QTC A;  4I9W A;  4MW3 A;  5EBW C;  3T1Y B;  4X1K A;  5B1B B;  4X64 O;  4DW0 A;  3OTF A;  5KHG A;  1NU1 H;  4P30 A;  5F2V O;  4KHP B;  3CWB H;  4O4H A;  3PN1 A;  4IL6 Z;  4K8Z A;  2F1M A;  4PA9 A;  3IJ4 A;  5JQG A;  2UUB B;  1JQ0 A;  4YJ3 B;  1WP8 A;  2YS8 A;  2FKX A;  5CBH A;  2RDC A;  4NVP A;  1QVG U;  1Q86 W;  4GX0 A;  4GKJ O;  1G1X B;  5J2T B;  5LP6 B;  3F7V C;  1GAX A;  1KU9 A;  4PDV A;  3OEE G;  4DV5 B;  2NR5 A;  1SQF A;  4E4E A;  4X62 B;  1VQN V;  4TV9 B;  3SPJ A;  3OM3 B;  1Z5V A;  2MK3 A;  1PL0 A;  4UUJ C;  4K0K O;  2QA4 V;  3ASO C;  1THZ A;  4P2Z A;  2IU3 A;  1VIB A;  2HJD A;  3SYP A;  2GUZ B;  4FFB A;  3T1Y O;  4DV0 B;  4D7S A;  2GTA A;  4AIL C;  4DK0 A;  3T4Z A;  2AGA A;  2BTQ A;  1NBM G;  5EC2 C;  3RYI A;  1DK1 A;  3KCY A;  3L74 H;  2UUB O;  1S5L Z;  1CXZ B;  2E74 B;  3CCE V;  1SF9 A;  2VRZ A;  3I55 V;  5CMU A;  1JFF A;  1KYO F;  3RYF A;  4DR4 B;  1NI8 A;  2ZDI C;  4DR5 B;  4ZOL B;  3JAW B;  2CUG A;  4DV5 O;  2Y0P A;  3JAL B;  4X62 O;  5EZY A;  2Z0A A;  3T2M A;  2ZIM A;  5EIB D;  1JVM A;  2O57 A;  2E76 B;  1IBL B;  2BCC H;  1K33 A;  2P4K A;  3STZ C;  2BSK B;  1BHB A;  4DV0 O;  1XI1 A;  4MTG A;  3NR7 A;  3RYC B;  3FB7 C;  4IGG A;  3G67 A;  1XNR B;  1YVW A;  4X20 A;  3OR6 C;  1ZTE A;  2DMX A;  2QSA A;  4FZ0 A;  1F7Y A;  2UXD B;  2VWK A;  1GM7 A;  4NB5 A;  2ZNJ A;  4FLW A;  4RWU A;  4LWS A;  4DR4 O;  5GW7 A;  3SJA C;  5CB4 B;  4LH7 A;  4DR5 O;  2LGQ A;  2OIE A;  2EIN C;  4CBC A;  1K5S A;  3Q4H A;  4EFE A;  3CCV V;  2YIA A;  4LF7 B;  2QKS A;  4LFB O;  4H33 A;  4ZBM A;  2NLJ C;  3RYH B;  3OFN G;  4B7E A;  1AR1 B;  4DV2 B;  1ZWI C;  1XOU A;  1IBL O;  4ZHQ A;  3ZRV A;  4JYC A;  3AG3 C;  4N21 A;  4OX9 O;  4BW5 A;  2ETN A;  3ABM B;  2EIM C;  4GX1 A;  3CJH A;  2D3O W;  3D36 A;  5EYP A;  1QBZ A;  2DWE C;  1OCR C;  3HKD B;  4Z1V A;  1YTF B;  1R1B A;  2F93 B;  2EIJ C;  3BPZ A;  1XNR O;  4X1K B;  1H2K A;  3L72 H;  2R72 A;  3ABK C;  3FYE B;  3E35 A;  3AG4 B;  3CCS V;  3IC9 A;  4X9Q A;  1H2S B;  3ZMU A;  2EJ7 A;  1KQS U;  4J7Z A;  5JQG B;  1I0H A;  2UXD O;  1ZLZ A;  4PA3 A;  4O4J B;  4NXM O;  4JI0 O;  1PP9 H;  4FJC C;  2X6A A;  4XBF A;  4HZ3 A;  3ZHR A;  2JGD A;  3ASN B;  1SC5 B;  5GTI Z;  3AG7 A;  1IBK B;  3A0H Z;  3OMI B;  4JAV A;  4LF7 O;  4DV2 O;  1N8R W;  1H2M A;  1RSO A;  3H01 A;  5H6Q A;  5BXZ A;  4EB6 B;  1TUB A;  2OCC C;  2XAJ A;  5BZB A;  1ZUQ A;  2OIG A;  4W4L A;  1FPO A;  2F66 C;  2XAS A;  4KXR A;  4OPA A;  4RO2 A;  1FXK C;  5IE9 A;  3B8N A;  3K5N A;  4GX2 A;  5A9G A;  2ZM6 B;  4B08 A;  4TT3 G;  4JI6 O;  3T1H O;  2Y69 C;  2BTQ B;  2WLI B;  2JRI A;  3RYI B;  4BW9 A;  2WLJ A;  4JPR A;  3A8T A;  5L3E A;  5LGU A;  4LFC B;  2CTP A;  1RM1 C;  4U3J A;  2Q4P A;  4H13 B;  3OEH G;  4HAM A;  3FB6 C;  2R9I A;  1BE3 H;  3JAT A;  1XEQ A;  1MSW D;  3W7X A;  1DLB A;  2XAQ A;  2JIZ G;  3ZJZ A;  1BCC H;  4QPJ A;  1GRJ A;  1EM1 A;  2JJ2 G;  4WFH A;  5EZY B;  2YIB D;  4W4K A;  1XUQ A;  3QO5 A;  3OGI B;  4NKG B;  5KAI Z;  4B3R B;  4X66 B;  1US6 A;  2GSM B;  3RVZ A;  2PY5 A;  5LMU B;  2Q7G A;  1BZK A;  4J9Y B;  2LW7 A;  3TCU A;  2YIC A;  2EIK B;  1YXB A;  4L87 A;  1S0V A;  2ZM6 O;  1FXH A;  1KP3 A;  3H1L H;  2JDI G;  3K5M A;  1VEW A;  3BHP A;  1PV0 A;  5KA5 A;  4LFC O;  3APO A;  3LDE A;  3SJQ C;  4AQY B;  1LNQ A;  1OCC C;  4JV5 B;  2UXB O;  4IYI A;  1RP3 B;  2AHZ A;  5E1A C;  1KD1 W;  2JK5 C;  2ATK C;  2B5U A;  3R66 A;  3OD4 A;  5FL7 G;  2HVK C;  2P4V A;  1EZV H;  2V1D A;  3CE2 A;  1K8A W;  2DW4 A;  5IYD O;  3D3Q A;  5GTH Z;  1OCZ B;  4ZHQ B;  2QKC A;  2P90 A;  4CC5 A;  5LMU O;  5IYZ B;  1EN6 A;  1ORQ C;  1KC8 W;  1K73 W;  1N34 B;  5JWP A;  3W7S A;  3CJH B;  1UJW B;  2WSS G;  1W0J G;  2R9R B;  3K0G A;  5BR8 B;  4TWK A;  4UVB A;  1AVM A;  1GMG A;  3A0B Z;  3MHS C;  1RPO A;  3M99 B;  1GN2 A;  1I5X A;  1QCE A;  1MOF A;  1AJQ A;  1VMG A;  2RNB A;  4B7K A;  3TET A;  2P5O A;  1K97 A;  1DGS A;  3QO7 A;  4AQY O;  4LH6 A;  1M56 C;  4H44 B;  4JV5 O;  3HKC A;  4CS2 A;  3LUT B;  2DE0 X;  1LUV A;  2DYR B;  1PKX A;  1AJN A;  2LP7 A;  4YIO A;  5IYC O;  2BTO A;  1IUR A;  1VQ4 V;  1YI2 V;  4JZ2 A;  1EBO A;  2CK3 G;  3MDS A;  2H8P C;  1FXV A;  3KKY A;  3H1K H;  1ARO P;  3J80 N;  1RSO B;  5DED A;  2HJF C;  4F4L A;  2ZD9 A;  5IJ0 B;  1TUB B;  4P9P A;  1N34 O;  5BMV A;  4AI8 A;  5BR8 O;  5KLV H;  2GUZ A;  1IVS A;  3N2G A;  3SYQ A;  4BIU A;  4RQE A;  1U97 A;  1QHT A;  3L9D A;  3CXH F;  2QM4 A;  1AJP A;  3J7A U;  1NH2 B;  4UVA A;  5LMN B;  4HNA A;  5C93 A;  2UXN A;  4ZIB A;  4J9Z B;  1Y74 A;  3LDD A;  1H8H G;  5KAF Z;  1S3J A;  2DYS B;  3P3N A;  3P30 A;  4HBN A;  3JAW A;  4O2A B;  1TUE B;  1NKD A;  3LDC A;  3VOU A;  4GKK B;  4YY3 O;  3JAL A;  4QNH B;  3ZMT A;  3CD6 V;  3JD4 A;  2WA4 A;  1QLN A;  1XIL A;  1I7F A;  1K4D C;  3L73 H;  1NTZ H;  3S3W A;  4I55 B;  1I08 A;  1Z2G A;  3EFF K;  3JAR B;  1IBM B;  4DUY B;  3CCU V;  3JCZ A;  4WFG A;  4X1Y A;  4FLU A;  1Q8I A;  4NTX A;  5LBQ A;  4BWA A;  4TV8 B;  1MMM A;  4CS4 A;  2PYJ A;  1L0L H;  2F4V B;  1N32 B;  2GDS A;  4NTY A;  1XL6 A;  2PYL A;  3UO2 A;  1T5E A;  2MW2 B;  4X64 B;  3ABL C;  1NVP B;  5LMN O;  2YIB A;  3ETQ A;  1NTM H;  2XTA A;  2ZKO A;  2BOB C;  2RMK B;  3STL C;  4PI2 A;  2A7W A;  2YC0 A;  2ZR3 A;  1V9P A;  4J41 A;  4UCT A;  4FMT A;  3VBB A;  4JI5 B;  4DV1 B;  3W7T A;  3MHH C;  2W0X A;  1SQX H;  4DO2 A;  1GTO A;  1SQP H;  2VQE B;  5H5N A;  2CDY A;  4I4T A;  3X2Q C;  2ADQ B;  4QJF B;  4LF4 B;  3CCJ V;  4GKK O;  5EC1 C;  5HFL A;  1BS3 A;  3C90 A;  1RPR A;  1N4C A;  4MTX A;  4DRX A;  1BL8 A;  3RYH A;  1BMF G;  2IH1 C;  5JVD A;  2YXY A;  4C7U A;  4IIJ B;  1K9M W;  4FLZ A;  1IBM O;  4DUY O;  1COW G;  1NS1 A;  2GTS A;  1Q7Y W;  1N33 B;  1KMI Z;  1VQK V;  1BT8 A;  5H9C A;  4FM0 A;  1N32 O;  4MVM A;  1KKD A;  1XL4 A;  3JSN A;  1X4T A;  1FYJ A;  2EIL C;  2PUS A;  5EBL C;  2CTQ A;  2XAH A;  4JAS A;  2EX3 A;  4LF5 B;  2CGN A;  2XAF A;  3ZBH A;  4O4J A;  1XHX A;  5BY1 A;  1AI5 A;  3CCQ V;  4JI5 O;  3U11 A;  4DV1 O;  3HKC B;  4BIZ A;  2VQE O;  5IY5 B;  4MVQ A;  3TGU H;  3ZS8 C;  3FFQ A;  4LF4 O;  3SJC C;  4GUN A;  2KQX A;  1WN7 A;  1SER A;  3ZCC A;  2R9A A;  4FPP A;  2KG7 A;  4FVM A;  4OGQ B;  3E8G A;  3ML0 A;  5EIB C;  3CCL V;  2FTK A;  2NNU A;  1M1K W;  1D5N A;  1NH2 D;  1IDS A;  1GM9 A;  2HHH B;  4EB6 A;  1N33 O;  4DR6 B;  3JSL A;  1J95 A;  1AR5 A;  4JF3 A;  2F95 B;  2CH7 A;  5BMV B;  1M90 W;  4FLY A;  1U96 A;  1R3K C;  4I7Z B;  1R3L C;  3HKE A;  1OV9 A;  4UVC A;  2WLK A;  2AW9 A;  2GV9 A;  3N2G B;  2QKA A;  2ZXW C;  3B40 A;  2B9Z A;  3O9O A;  3WG7 B;  2BE3 A;  1AP6 A;  4F6R B;  1TVK A;  3K0D A;  2WA3 A;  1Q43 A;  2M7W A;  2WLI A;  2IJJ A;  4LF5 O;  4LF9 B;  4GCZ A;  4HNA B;  4KFM A;  1WJZ A;  1AI4 A;  4X8A A;  1V55 B;  2ODM A;  3IFX A;  4QIW F;  1Y74 B;  5KHH A;  1WPB A;  4DXW A;  4NXN O;  3GVM A;  4G27 B;  5LGT A;  5B1B C;  4J11 A;  3RN4 A;  2YXH A;  2A06 H;  3OAA G;  2JEX A;  2JJ1 G;  4GT1 A;  3E22 B;  4G2K A;  5J2U A;  2ZIO A;  4XDK A;  2ZT9 B;  1NVP D;  4LFB B;  2P06 A;  2IBZ H;  5KHJ A;  2G38 A;  2PGG A;  2HHH O;  1WA8 A;  4DR6 O;  3E83 A;  1P84 F;  5JCO A;  4WCE V;  1JX9 A;  1OCO B;  5LP6 C;  3CRQ A;  2N05 A;  2IJI A;  4OX9 B;  4PJ0 Z;  2EBO A;  4X1Y B;  2YUA A;  4JI8 B;  1P7B A;  4ZI7 A;  2QWP B;  1VQL V;  4PI0 A;  2X0L A;  3GWK C;  4JI4 B;  3CCR V;  4WFB V;  1HP8 A;  5DN6 G;  5LXT B;  3L71 H;  2XAG A;  2N74 A;  1W0K G;  5IT9 N;  4LF9 O;  2ZIN A;  2D2C B;  5IWA B;  3AK1 A;  2JEU A;  4F6E A;  5J9P C;  1B06 A;  4YIP A;  3WB2 A;  4NXM B;  4JI0 B;  1B6Q A;  3VQX A;  1FJG B;  1NR1 A;  4I4T B;  1AR4 A;  2BOC C;  5B5E Z;  4PDR A;  3SR2 C;  1R3J C;  3H1I H;  3K08 A;  1Y4M A;  1M93 A;  3LSQ A;  3HR0 A;  3T1C A;  4DRX B;  3ABT A;  1KUQ A;  4LF8 B;  3CC7 V;  5JVD B;  3SYO A;  1K3E A;  2K9P A;  2XND G;  4JTD B;  1DTO A;  5IYZ A;  3MD0 A;  2YSU B;  2FL4 A;  4JI8 O;  2GBO A;  2YEV B;  3W7U A;  4JI4 O;  3BVO A;  2A0L A;  3KZI Z;  3FYI B;  4LCU C;  1SKV A;  3DTU B;  1E79 G;  2B1I A;  4JI6 B;  3T1H B;  1VQ5 V;  5IWA O;  1HNZ B;  1SQV H;  3CS5 A;  1PL4 A;  4LP8 A;  2KB1 A;  2E75 B;  5TIS Z;  4FZ1 A;  4AHC A;  1FJG O;  3FKS G;  4MVU A;  5H6R A;  4MSW C;  5LOV B;  1DF4 A;  1Y66 A;  4JAU A;  4YJ2 B;  1F4M A;  3JCU Z;  2EJR A;  2KG7 B;  4R6Z A;  2YDE A;  2P67 A;  5KA6 A;  1N36 B;  1YSC A;  3TXS A;  4LF8 O;  1JCH A;  1L0N H;  4X1I A;  2QR4 A; 
#chains in the Genus database with same CATH homology
 3O65 A;  2VQE O;  1HR0 O;  4K0K O;  2UU9 O;  1XNQ O;  2N74 A;  4LF6 O;  4LFB O;  5IT9 N;  4LF4 O;  4LF9 O;  1I94 O;  4JI1 O;  4B3S O;  2UUC O;  3T1Y O;  4JI7 O;  4DV6 O;  1IBL O;  1XEQ A;  4OX9 O;  4AQY O;  2AGA A;  3J81 N;  4DR2 O;  4JV5 O;  1DK1 A;  3SDL A;  4DUZ O;  1HNZ O;  2UUB O;  4DV7 O;  1N33 O;  5FLX N;  1R1B A;  5LMN O;  1XNR O;  2ZKO A;  1D2D A;  4JI3 O;  1KUQ A;  2LW7 A;  4JYA O;  4DV5 O;  5A2Q N;  4B3T O;  2E5L O;  2UXD O;  4B3M O;  1N36 O;  2DJV A;  2ZM6 O;  3F5T A;  5H5N A;  4JI8 O;  4X62 O;  3J80 N;  4NXM O;  1AB3 A;  4JI0 O;  4LF5 O;  4GKK O;  2Z0A A;  1HNW O;  4JI4 O;  2F4V O;  3M8A A;  4DV4 O;  3OTO O;  1N34 O;  4X64 O;  5BR8 O;  4X65 O;  4LFC O;  4LF7 O;  1R6T A;  4NXN O;  4B3R O;  1IBM O;  4JI2 O;  4X66 O;  4DUY O;  4DV2 O;  2UXB O;  1NS1 A;  4DV0 O;  1HNX O;  5IWA O;  5LL6 Y;  2UUA O;  1XMO O;  2FKX A;  3R66 A;  3J7A U;  1XMQ O;  5BXZ A;  4GKJ O;  1N32 O;  1G1X B;  1FJG O;  3RT3 C;  2HHH O;  4DR6 O;  1YZB A;  1F7Y A;  4DR3 O;  1FYJ A;  4OPA A;  1J5E O;  2VQF O;  1IBK O;  4DR1 O;  4KHP O;  4OPH A;  2DOS A;  1A32 A;  4LFA O;  2UXC O;  4DR7 O;  3JAM N;  4LF8 O;  4DR4 O;  4JI6 O;  3T1H O;  5LMU O;  4DR5 O;  5BY1 A;  1FKA O;  4YY3 O;  4A5U B;  1X59 A;  2JRI A;  4YHH O;  4DV1 O;  4JI5 O;  1AIL A;  4DV3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...