1XMQO

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xmqO00
4X66O 2UUAO 4DV5O 4JI7O 1IBKO 3R66A 2VQFO 4AQYO 2DJVA 1FKAO 4JI4O 2FKXA 4JI0O 4B3TO 4JV5O 1I94O 1N33O 4DR5O 4K0KO 2N74A 1N32O 2UXCO 1HNXO 1R1BA 4DV4O 1IBMO 4DR4O 4JYAO 4LF8O 1IBLO 4GKKO 2ZKOA 2E5LO 4DR3O 3M8AA 5LMNO 2ZM6O 1FJGO 2VQEO 2HHHO 4NXMO 3RT3C 4LFCO 3J7AU 3T1YO 1AB3A 2JRIA 4DUYO 1XMOO 4A5UB 1NS1A 3T1HO 4LF7O 4KHPO 4DV7O 4OPAA 4X64O 1XNQO 1XEQA 2Z0AA 4DR1O 4LFBO 5BY1A 4OX9O 1J5EO 5FLXN 2AGAA 4DV6O 3J80N 2UXBO 4X65O 3O65A 1KUQA 1G1XB 1F7YA 4JI5O 1R6TA 4JI1O 4JI8O 3F5TA 4JI3O 1XMQO 4NXNO 4B3SO 4DV2O 2F4VO 5A2QN 2DOSA 4DR2O 2UUBO 4DV0O 4DV3O 4B3RO 4JI6O 1YZBA 1HNZO 4LF6O 4YHHO 4LF4O 2UUCO 4DR7O 1D2DA 1N34O 5IWAO 5IT9N 1FYJA 2UU9O 1XNRO 1A32A 4OPHA 5H5NA 4DV1O 3OTOO 4LF9O 4B3MO 4GKJO 4YY3O 3SDLA 1DK1A 3JAMN 2UXDO 4X62O 4LFAO 5LL6Y 5LMUO 1X59A 4LF5O 5BXZA 5BR8O 4DUZO 2LW7A 1HR0O 3J81N 4DR6O 1HNWO 1AILA 4JI2O 1N36O
chains in the Genus database with same CATH superfamily
3BHPA 4DV5O 2P06A 1KKDA 5IYCO 4XDJA 3SPCA 1J95A 4PV1B 3P32A 1QVGU 4NR1A 1WJZA 4MTOA 1IBMB 2HG5C 1N33O 2ITDC 3E8FA 4FFBA 2LJ2A 4J7KA 5IDJA 4NVPA 2E5LB 1I08A 4L87A 1V55C 4CZZA 5LYJB 5FNVA 4GX2A 5CA1A 5EC1C 4FM1A 1AB3A 4X64B 2R70A 1FXKA 2AZ0A 3T1HO 4NKGB 5D5PA 4DRXB 4PD4F 1K73W 1RM1B 2BTQB 3A0BZ 1YDXA 5EC2C 2ZIMA 1V54B 5KHJA 3A2FA 2V1DA 2XASA 4NXNB 3LDCA 4J41A 4LCUC 3VOUA 3ZN0A 4DR2B 3LUTB 2ZE7A 5LOVA 1SESA 4Z1MG 3R65A 5EZYB 3AG2C 3T4DA 3ZJZA 1TVKB 3E2EA 1KP3A 4DK0A 2F95B 4O2BB 4JZGA 1GN3A 5KX5A 1RSOA 1VF6A 3JAKA 4JYCA 5IWAB 4HNAB 3CCJV 3L75H 3OGCC 1NBMG 2RDCA 1FD9A 2CAZC 4DV1O 1Y76A 2UXDB 2ZE6A 1YSCA 3SDLA 1SZXA 4LFAO 1SQVH 3OR7C 4J9ZB 1SZTA 4JGSA 3N2GB 4KP4A 1P7GA 4I50A 2OWOA 2IH1C 3ZMVA 5CN0A 1SQQH 4DR5B 1FFXB 4UVAA 1O9GA 1HNXB 4LWSA 3SGIA 3AEIA 2N74A 2QA4V 2GUZA 3DC6A 4TV9A 5EYPA 4BIZA 4DV4O 1FJGB 5B66Z 4ABMA 3E22A 5LMNO 1NVPD 1IXBA 4LFCO 3J7AU 1VQPV 5LHIA 1H8EG 1NS1A 3STLC 5JVDB 4X20B 4OPAA 1YITV 4C7UA 5LA6A 2YDEA 1LUVA 4BAYA 4OX9O 3D3IA 3ABKC 5JJJB 3L71H 2N04A 4JI5B 2LFRA 3THOA 4D7SA 3HKBB 4ZOLB 2DWEC 1O9HA 4JAUA 1AP5A 1OJHA 3VBBA 4DXWA 3LDDA 1B3QA 4B7KA 4B3RB 3HKCB 3ZBHA 1HNZB 4I9QA 1XL4A 2EIKC 4X1YB 3LSQA 1IXMA 5CMUA 3N2KA 4QNHB 1N34B 2WA4A 2WWWA 3K04A 3RVYA 2HFEC 1Y6XA 3JD0A 2QTOA 3IC9A 3JSNA 2IJJA 1KECA 1XL6A 5EBMC 5BR8B 2F23A 2WLNA 2EILC 1QU7A 4LH7A 2JK5C 4NTXA 1YEWA 2B1GA 3OUSA 4P9OA 4BW5A 4HYOA 2PI4A 3ABKB 3C90A 4XBFA 1ZLZA 4B3TO 1H2MA 1N0JA 1AR1B 3OE7G 1DGSA 4LF8B 4JYAB 2UXCO 3CRMA 2MW2B 4B08A 1NU1H 2ARHA 1IBLO 5BMVB 1VQ7V 1JA8A 4GX5A 2CTRA 4RUEA 1WB7A 2OYQA 3ZRVA 3DTUB 4W4LA 4I55A 3IC7A 1DTOA 4EEQA 3UO3A 2JJ2G 3UKMA 1S76D 4LNUA 1ZUQA 2RN9A 4H33A 4CBCA 4QIWF 4JTDB 4KXRA 4MTXA 1AI5A 3QG5A 4CH5A 3VQYA 2JEUA 2GDSA 3K58A 1G1XB 3HKEA 1MZEA 2P4KA 5IYZA 4O4JB 1R3IC 4UCVA 5KMGB 5LXTA 3KCXA 4J7JA 2EILB 4DV2O 3QO7A 2XUMA 3ZN1A 3CJHA 4JI6O 1M9NA 2CK3G 4YHHB 5A9GA 2E74B 2Q69A 2EJRA 4K3AA 2WAMA 2HJDA 3B4SA 1SETA 1XUQA 2HJFC 1PL4A 1YJNV 1XNRB 4HBNA 5KUKA 1HWYA 1RP3B 3LDEA 1Q86W 5IT9N 1K4DC 4DO2A 1ORQC 3H1IH 1PD3A 3OTOO 3TGUH 4ZKIA 3FYIB 4WF9V 2WLLA 1JVMA 3ZMTA 3NXSA 2QM8A 4L8JA 1S72V 1OCCB 1TUBB 3B8MA 4J7ZA 5CBGA 4MTFA 2ZQMA 1YI2V 3ZS8C 2RCVA 2NNUA 5IJ0B 1SRYA 2B5UA 5LGUA 2CUGA 1IBMO 1CPYA 3QO8A 3H1KH 2KB1A 2PTMA 2OCHA 4O4LB 1SQGA 2HR3A 2E5LO 4DYLA 3BFRA 4FMTA 5GTIZ 5B5EZ 1K3EA 3K5OA 3L72H 1L1FA 3CS5A 4X1KB 1ENVA 4DRXA 3H1HH 3E35A 1XHZA 4X64O 1H2GA 1BSMA 3P3NA 1ZSPA 2NN4A 1XEQA 1SQFA 1Q6IA 4DV4B 4DV6B 1GK9A 3ICXA 4UV8A 1F4MA 5KHGA 5JCOA 2CE4A 2AGAA 1YVWA 2JDIG 2CTQA 3O65A 1M56B 2Q8VA 3P3PA 3OD4A 1KKCA 4BW9A 1ZL8B 4R6ZA 4ICGA 4ZI7A 2F4VB 2UUBB 2Y0IA 4NXNO 4DV3B 3G67A 4DR2O 4F6RB 1BMFG 1K5QA 1CP9A 1Q6HA 1THZA 3M7MX 4HNAA 2QKCA 1V9PA 2Q0AA 2HKOA 1VQLV 3DXRB 3ABUA 3F7VC 5HFMA 5IWAO 1SERA 4ZIBA 4LF9B 4GKJB 3K59A 3JASB 3N2GA 2UXDO 1R3JC 4TQFA 1I0HA 5BXZA 2FB5A 2P22C 5DECA 2W0FC 1AILA 1VMGA 4FLZA 3SPIA 4P2ZA 3UT5B 3RBZA 2VQFO 1Q81W 1N32B 1GN6A 3MD0A 3U0ZA 2DW4A 5KHKA 1WN7A 4DR5O 4DR4B 4IYHA 2X0LA 1HNXO 3OAAG 3CCVV 2HHHB 1HDJA 3B77A 4MVUA 1FJGO 3ABLC 1OCZC 5IJ9B 3OM3B 4ZBMA 3M99B 5JVDA 1QR9A 4ZHQA 2IBZH 3K0GA 3ZRSA 3G6EV 4N21A 2ADPA 2F1MA 3X2QC 4EB6A 4R50A 4BWAA 1Q43A 4ZOLA 3W7SA 3K9AA 4WFEA 5H2FZ 5CA3A 1NTZH 2Y69C 4JI5O 1EBOA 1M57B 4NYKA 1OCOB 1VEWA 2LFSA 2B1IA 1TA8A 4CH4A 2LGQA 3HKCA 1RPRA 1E1QG 2LP7A 4WBNB 4X1YA 1YHQV 2XAFA 4B3RO 4FZ0A 2HP8A 4KUMA 1UJWB 1HNZO 5JQGB 1IDSA 1WLEA 3JD3A 2P7TC 5B3SC 1N34O 5JH7B 2Q73A 5LHGA 2M6YA 1P7BA 3ABLB 1OCZB 1YJWV 3KG2A 5L3BA 1TUEB 1SQBH 1FAFA 2YXLA 2BOCC 5BR8O 1SF9A 1MABG 3X2QB 3FKSG 1YF2A 4IL6Z 4K0KB 3CC4V 5KA5A 4O4IB 2Y69B 2YIBD 4GKKB 4JYAO 4LF8O 3CMAV 4X89A 3OMAB 4U3FH 3RYCB 3JARB 4NTYA 1VQMV 2LQTA 1QQCA 2V4DA 1ROPA 5F2VO 4D7TA 4EFBA 5C93A 2R9IA 2OIGA 1PV0A 3E8GA 5B3SB 2X7RB 4BIOA 3E8BA 4AI8A 2ZXWC 2FTKA 2QE7G 4O4JA 1BCCH 3CXCU 2CTWA 5KMGA 1B06A 1EN6A 2YIBA 3JALB 3SR2C 4K8XA 3CYOA 1EM1A 3T1CA 4Z2WA 1F51A 1E1RG 2Q68A 1KC8W 4JYBA 3QO5A 1GKFA 2DQ0A 3MHHC 1BT8A 3L74H 3K5LA 5E1AC 1LR1A 4YHHO 4JAAA 2PF4E 3FB7C 3ZEDA 4HAMA 1PNKA 2WLMA 3B8NA 3CPWU 3PN1A 2AHZA 2PY5A 4R7CA 1FYJA 2BTOA 1XNRO 2VRZA 3BCCH 1Y4MA 1YIJV 1K33A 1SQXH 5EIBC 4X62B 2DYSC 2NR5A 5LMUB 4FFKA 4DUZB 1X59A 2Q7GA 4DW1A 4FPPA 4P9PA 3T4ZA 4I0XB 4MVSA 5D5QA 5KLVH 2CH7B 2QKSA 5JJEB 4TT3G 2JGDA 4JV5B 2DJVA 1I94B 3ASOC 4MW3A 2ZXWB 1MZFA 1V55B 5KUMA 5J2UB 2F43G 4E4EA 4H0LB 1R1BA 1NH2B 1N8RW 5IYDO 4O4LA 3U11A 1YTFB 5B1BC 2ZKOA 4DK1A 4X1KA 1S0VA 2H8PC 3RT3C 2VQFB 4KHPB 4EKWA 2D2CB 4DR1B 2ITCC 5GONA 4YJ3B 2C2AA 3SJQC 1J5EB 3H9VA 3ETDA 3HKDB 4UCSA 2H94A 4X65B 2ZNJA 3K06A 3RYIB 2OCCC 3D8CA 4DV6O 4UB6Z 1M5IA 1ZL8A 2ZD9A 3K5NA 4G27B 3F7YC 4TUYB 3AG2B 2XNDG 2YUAA 3IJ4A 2DYSB 3ZMZA 1XI1A 3JD2A 5CA0B 1VARA 4F6RA 4O4HB 2Q5ZA 3L9DA 2F4VO 4E2LA 2UUBO 4DV3O 3KKYA 3S3WA 5CB4B 4LF6B 4JASA 3ASOB 1OV9A 3DXRA 2IM9A 3N27A 4MSWC 5BZBA 4PJ0Z 1Y66A 1VQKV 4JAVA 2R72A 3WB0A 2LO1A 5B1BB 3ZRWA 3ZRXA 2NLJC 4LF9O 4GKJO 4WFFA 2FYUH 2P4VA 3WU2Z 2KQXA 4BIUA 1LUWA 2ATKC 4TV8B 2RQ6A 1VF7A 2BSKB 5C8YB 3J81N 2ZT9B 3NR7A 1VQNV 2DYRC 4WFHA 3R66A 1R6KA 2IJKA 5H6RA 3VQWA 3K5MA 2ZDIC 2WLIB 3ZCCA 1NR1A 1N32O 3Q4HA 1NZ6A 3A0HZ 4DR4O 2VQEB 4UCRA 1S5LZ 2BCCH 4DUYB 4H44B 5ITZB 2DN9A 4I5SA 5KHHA 2HHHO 2A9HA 3VQVA 2JRIA 3RYFB 1L8DA 2YS8A 3RGBA 3RYHA 3CXHF 1JFFB 4RWUA 1H38A 3UO2A 1GTOA 3K57A 2Q67A 1R6NA 3EXAA 4X8AA 2Z0AA 4FLTA 3CRRA 2Q4PA 2KG7B 3EFFK 4RQEA 2UXBB 4UVBA 4UCOA 2WLJA 3BEHA 1FXKC 2GSMB 1NJIW 2GV9A 4JI8B 1IURA 2YEVA 1KD1W 1U97A 2A3QA 5J9PC 1WA8B 3G4SV 1PM9A 2EIKB 4WBNA 4FLVA 3BVOA 3WB1A 2UXNA 3I5DA 5LP6C 2YICA 1Y74B 2DYRB 1P4RA 2QSAA 2DE0X 4DR7B 1N0NA 1FXHA 1IVSA 1FPOA 5JH7A 1M4UA 1QLNA 1MMMA 1WB8A 3IGAC 1R73A 2Q7EA 2DMXA 4FFBB 2QEXV 2AW9A 4UV9A 4JI2B 5KA6A 4I9WA 4X66B 3SYCA 1QHTA 1YZBA 1Y67A 4JI0B 2YI8A 5CA1B 1GM7A 3MHSC 4I7ZB 4I4TA 4O4IA 3HPLC 4GX0A 5IYBO 1NQTA 1AVMA 3BY6A 4K0KO 1R3KC 4JZ2A 2FMLA 1AR4A 4GKKO 2PZSA 1R3LC 1W2BU 2E75B 3JARA 3B09A 4PA4A 2CGNA 3E8HA 5LP6B 4FLXA 2A06H 3FB5C 4MVMA 1M93A 2RJZA 5LOVB 1QR8A 3CRAA 2K9PA 1H2LA 1H8HG 5BY1A 3OEHG 2KKWA 3ETQA 1GAXA 5LYJA 2G38A 3JALA 4JYYA 5KX5B 3DC5A 3QF7A 2Q0OC 3G6BA 4B3SB 4MVRA 3K0DA 4DV0B 1PPJH 2ZNIA 1ZTEA 4LC1A 3CCUV 2DOSA 2BTQA 4MS2A 1WP7A 1URFA 2EIMC 4FJCC 2VWJA 2XAGA 4F4LA 2LW1A 3LNMB 4GCZA 4GLXA 4LF4B 2JVDA 1JCHA 1SKVA 5CBHA 1NH2D 2ZR2A 1U96A 2B9ZA 1K9MW 5EZYA 3CCQV 1FFTB 5L3EA 4GUNA 2HLDG 5FL7G 1TVKA 4OGQB 2CDYA 5KHIA 4LWSB 4O2BA 4PI2A 1BHAA 3AK3A 3SYAA 2QWOB 3AG7A 1HR0B 4X62O 4YIPA 4I0XA 5EYPB 5LMUO 4FM2A 3FYEB 2CH7A 3ML0A 4G2KA 3FFQA 2QKAA 3O9OA 4DUZO 3QTCA 1KP2A 2OT5A 2XT9A 1JX9A 4GYCB 3E83A 1OZ0A 1NTMH 3CE2A 2ZR3A 3TETA 1QLEC 2PUSA 5J2UA 4JV5O 1I94O 4X1IB 1K97A 5LA6B 1Q3EA 3MAQA 2XHBA 1AI7A 5EBWC 3T1YB 2HVKC 3CCSV 1XMOB 2Z5UA 2LGWA 4J80A 4UFZA 4DV7B 4K35A 4YJ3A 1FFXA 3CCLV 4TWKA 3STZC 4KHPO 2GHYA 3FX7A 4UXNA 3SYPA 3HKDA 4DR1O 1NVPB 4NB5A 5TISZ 1J5EO 3B2EE 3CCEV 3OGIB 3J80N 1OHHG 4X65O 3OEEG 4JI3B 1F23A 4JPRA 3FB8C 1Q90D 1F7YA 1JJOA 1R6TA 5CA0A 1WNSA 4QGPA 2HVJC 4OXSA 4QPJA 4X20A 1XILA 4XDKA 3JD4A 5LGTA 4PHZA 3DGEA 1WPBA 3ABMC 2KSDA 3CMEV 2E3CA 1WP8A 2F66C 4U7OA 4UUJC 4IHJB 3WB2A 2P67A 1QLEB 2QR4A 3HKBA 5K1PA 4LF6O 2UUCB 3AK2A 3DSQA 3LSUA 2ETNA 4MVOA 5CBFA 3A8TA 1AJNA 3BPZA 1Q6UA 5IY5C 3ZHQA 1G8MA 4YY3B 1BE3H 2PYLA 2ZIOA 5J2TB 4TV8A 1M90W 1BQ0A 1BS3A 3QVNA 3JAMN 2BSKA 5C8YA 1N4CA 2EZPA 4CS4A 5B1NA 3SJCC 2QGNA 4J42A 3SPHA 2UUAB 3RVZA 4PDRA 3AK1A 4JI7B 4AQYB 4JI4B 1RPOA 1NKDA 2WLIA 3JAWB 3WFVA 3FAVB 4RO2A 1LNQA 2R9AA 4F6EA 1PNLA 1VQOV 4EFEA 4YJ2B 3AG3C 5ITZA 4WFBV 2VQEO 3ABMB 2D3OW 3RYFA 3W7UA 4PDLA 3HKEB 3KZIZ 1JFFA 4DUYO 3CRQA 2OIEA 3P30A 1XNQB 4WFGA 3KCYA 4LFBB 4GX1A 2KG7A 3AG4C 3OFNG 1B04A 1JQ0A 3RN4A 1MNGA 5BMVA 1W0JG 3C3TA 2L35A 3ZMUA 5IY5B 2UXBO 2N05A 4CC5A 3JD1A 4X88A 2WLKA 2PI5A 2ZINA 4JI8O 1SA0B 2QWNB 5JCOC 1AJQA 4BR6A 2IH3C 1PNMA 2EBOA 2DQ3A 3BAAA 1JPXA 1GH6A 2GTSA 1MSDA 2F93B 4PA6A 1HW7A 2Q7HA 2VS0A 4W4KA 3FB6C 5DEDA 4DR7O 4PI0A 3CP1A 3JATB 1IZ3A 3AG3B 2PGGA 2QM7A 2O57A 3BA9A 3CC7V 2VWKA 1AJPA 3ETGA 1EFRG 3LNNA 1DK1A 4UVCA 1CXZB 5LL6Y 4DR6B 1HNWB 1N36B 1H2NA 2LW7A 4JI2O 2RNBA 3AG4B 4YIOA 4X66O 4H13B 3F5WC 2ZE5A 2IU3A 4JF3A 3ZHSA 1YXBA 2FKXA 4JI0O 3D36C 2BOBC 3BRCA 2K1EA 4B7EA 2WSSG 4TOIA 4DR3B 1S77D 1Q8IA 1PP9H 3K03A 2EULA 1EZVH 5LP6A 4LF7B 1TUBA 3CCMV 4YXWG 4K8ZA 4A5UB 2H3OA 3ZHTA 4ZI7B 2L6LA 4QE9A 5IJ0A 3TCUA 1L0NH 3K9SA 2WLHA 3EVKA 4QJFB 4FIPC 2EZOA 3SYOA 4JI1B 4RAIA 2ZE8A 3OMIB 1KUQA 1XMQB 2ZCEA 4LR3A 1NT2B 2XAHA 2ILMA 4B3SO 3A0RA 4DV0O 1XBLA 3CD6V 4LH6A 1KBHA 3PJSK 1Q5OA 1B6QA 4Q20A 1GO3F 5IE9A 2Z3YA 4LF4O 5FPRA 3G71V 3RW0A 1K5SA 4PA9A 4N23A 1M1KW 1ZX3A 3ETEA 4PELA 3K3WA 5GTHZ 2HEPA 3CSXA 4O2AB 1ZWIC 4U3JB 1CEZA 1HR0O 1AI4A 2MK3A 1IBKB 1MSWD 1NTKH 4IT5A 1DF5A 3OUFA 4ZHQB 4X1IA 4IGGA 3SPGA 1G6UA 5H6QA 2A79B 3JASA 5JWPA 3E86A 1VF5B 3OTFA 4EB6B 3JSLA 1AROP 2Y0PA 4AHCA 3TK1A 1DF4A 2ZM6B 4NXMB 3EHBB 4J10A 3UT5A 3CEIA 1YCIA 1IX9A 3ABTA 1US6A 3I56V 3T1YO 1XMOO 2CTPA 1P84F 4KFMA 1XDCA 5H9CA 1YJ9V 3QNEA 1W0KG 4DV7O 1GMGA 2OCCB 4CH3A 4DW0A 1GRJA 2ODMA 2IJIA 3OT7A 3I55V 2FL4A 1KU9A 5IJ9A 3F5TA 2YIDA 4JI3O 2Y4TA 1S3JA 3CWBH 4IIJB 3ASNC 4IHJA 4RQFA 2YXYA 5B1OA 2UXXA 3LSSA 5L3CA 2P90A 4WCEV 4PDMA 3GVMA 1Z2GA 5KAFZ 2UUCO 2UU9B 2YXHA 4P30A 5HFLA 4JTAB 2JS3A 1D2DA 4U7NA 1I5YA 4B3MB 5J2TA 3H1JH 1DLBA 2IU0A 4YY3O 4MTGA 3GB7C 5JQGA 3APOA 2AHYA 3RFRA 4LF5O 5EBLC 2QWQB 4J9YB 4UCTA 2QM4A 4DV5B 1Q82W 3JAWA 3K08A 2UUAO 3U10A 4JI7O 4AQYO 3L70H 3JCUZ 3FAVA 1N33B 4JI4O 1KMIZ 1VF6C 4FK5C 2JIZG 1SC5B 1XHXA 3GWKC 5LBQA 3OW2U 1OCCC 1SQPH 4FVMA 4YJ2A 1EN5A 1VQ9V 3FD9A 3CX5F 1K4CC 1E79G 2EX3A 2X6CA 2W0XA 2P6JA 4CH6A 1KQSU 3T1HB 3C3SA 5KAIZ 5FNVB 3TXSA 3ASNB 2Y48A 3UCSC 2PYJA 2IW5A 1OCRC 4FLYA 1K34A 4GT1A 1XNQO 1FXKB 3B40A 4IYIA 1L0LH 4HZ3A 4LFBO 4RUFA 1RFYA 1I7FA 5AG2A 1XQ8A 1Z5WA 3CB2A 1K8AW 3L73H 2V7QG 3RYCA 1SA0A 1AI6A 1FXVA 4MVZA 3S3XA 3SPJA 4TSFG 1K7DA 1M56C 2JGUA 4LP8A 5DM6V 1Z5VA 2W6IG 1COWG 1AP6A 2AZ2A 2YC0A 2QDOA 2QJ1A 4NTWA 1RSOB 3JAKB 1BHBA 1F4NA 3JATA 1GN2A 1I5XA 3RWRD 4DV1B 2JGDB 4OPHA 1H2SB 4PA7A 4TQDA 1MA1A 2CGOA 4LFAB 2E76B 3APQA 4GZRB 1Y76B 3TJTA 5LGNA 1OCRB 3T2MA 3W7WA 2JJ1G 4DR6O 1HNWO 1N36O 3W7XA 4I50B 2X6BA 2EINC 1YTFD 1KB9F 1TAEA 2QWPB 1HP8A 1H2KA 1VIBA 2XOKG 5GONB 3UM7A 1VQ8V 1VP7A 4MVQA 3CC2V 4QE7A 1XOUA 4G28B 5DN6G 1UPGA 5LMNB 2GUZB 4TV9B 2QWRB 2BE3A 2Q6AA 4LFCB 3ZHVA 4DR3O 1QNMA 2XAQA 1BZKA 1BL8A 3E22B 3SJBC 5EK0A 4LF7O 3AG1C 3OR6C 2DWDC 4PDVA 3WG7C 4AILC 3CRCA 4OX9B 5EIBD 3OMNB 3IAYA 2JS5A 3GWOA 1FS0G 4LBEC 2YIAA 1X4TA 1QVFU 2A0LA 3ZMSA 1WPXA 4JI1O 4J11A 4D6TH 1P49A 2EIMB 1XMQO 2YI9A 1QBZA 1VQ4V 1PL0A 4XDLA 1M57C 2ADQB 1OCOC 4FLUA 1G4YB 3ZRWB 1VQ6V 1BQZA 3RYIA 2IJHA 1NI8A 2EINB 4Z1VA 4FM0A 4TUYA 1K92A 3H1LH 3D36A 2WPDG 3W7TA 4FZ1A 3HR0A 3N2KB 1JJ2U 3D3QA 3JYCA 1EZJA 3IFXA 1T5EA 4O4HA 4WFAV 4PA3A 5B1AC 1A32A 2P5OA 1EN4A 3G80A 5H5NA 2YSUB 3BABA 5CB4A 4O2AA 5L3FA 4KL1A 1ZAUA 4U3JA 2Q9LA 3Q4HB 3CHXA 4R8CA 3AG1B 4UB8Z 3WG7B 3H01A 4JTCB 1KYOF 1Q7YW 1IBKO 2QTSA 3E89A 4B3TB 1FKAO 3RYHB 4CS3A 2UXCB 1W59A 3MDSA 1IBLB 1JOYA 2AXTZ 4QPKA 4MT8A 2M7WA 4LF5B 4CS2A 1VQ5V 3VQXA 5FPOA 1BGYH 1XREA 2JEXA 3M8AA 3HB3B 2A7WA 2ZM6O 4MW8A 4NXMO 2YEVB 3SJAC 3ZIAG 4H37A 3ZHUA 5L3GA 4ASUG 3BA8A 4FLWA 1TGOA 4I55B 5E79Z 5L3DA 2EIJC 5GW7A 4LNUB 2WA3A 3UQ8A 5FLXN 2R9RB 4UCUA 1QCEA 5B1AB 2EJ7A 1GN4A 2RMKB 4DV2B 2XTAA 5IYZB 3TXQA 3K79A 1GM8A 3ZHRA 5LXTB 4IIJA 2OTJV 1PKXA 2OTLV 4JI6B 5A2QN 1NR7A 5K1XA 1SS3A 3JCZA 3CCRV 3CJHB 3SYQA 1RM1C 1MOFA 4X9QA 1MG1A 1S5JA 1WA8A 4Q6GA 4CC6A 2Y4UA 2XAJA 2W6JG 3OTOB 2UU9O 5JJNB 3ZX6A 1V54C 4I4TB 1GM9A 2X6AA 1UFIA 2GTAA 4B3MO 2GBOA 1Y74A 1WAZA 1AR5A 5LHHA 1D5NA 1S5HC 1D5AA 2WLLB 2ZDIA 1JMKC 2EIJB 1JR9A
chains in the Genus database with same CATH topology
4X66O 2UUAO 4DV5O 4JI7O 1IBKO 3R66A 2VQFO 4AQYO 2DJVA 1FKAO 4JI4O 2FKXA 4JI0O 4B3TO 4JV5O 1I94O 1N33O 4DR5O 4K0KO 2N74A 1N32O 2UXCO 1HNXO 1R1BA 4DV4O 1IBMO 4DR4O 4JYAO 4LF8O 1IBLO 4GKKO 2ZKOA 2E5LO 4DR3O 3M8AA 5LMNO 2ZM6O 1FJGO 2VQEO 2HHHO 4NXMO 3RT3C 4LFCO 3J7AU 3T1YO 1AB3A 2JRIA 4DUYO 1XMOO 4A5UB 1NS1A 3T1HO 4LF7O 4KHPO 4DV7O 4OPAA 4X64O 1XNQO 1XEQA 2Z0AA 4DR1O 4LFBO 5BY1A 4OX9O 1J5EO 5FLXN 2AGAA 4DV6O 3J80N 2UXBO 4X65O 3O65A 1KUQA 1G1XB 1F7YA 4JI5O 1R6TA 4JI1O 4JI8O 3F5TA 4JI3O 1XMQO 4NXNO 4B3SO 4DV2O 2F4VO 5A2QN 2DOSA 4DR2O 2UUBO 4DV0O 4DV3O 4B3RO 4JI6O 1YZBA 1HNZO 4LF6O 4YHHO 4LF4O 2UUCO 4DR7O 1D2DA 1N34O 5IWAO 5IT9N 1FYJA 2UU9O 1XNRO 1A32A 4OPHA 5H5NA 4DV1O 3OTOO 4LF9O 4B3MO 4GKJO 4YY3O 3SDLA 1DK1A 3JAMN 2UXDO 4X62O 4LFAO 5LL6Y 5LMUO 1X59A 4LF5O 5BXZA 5BR8O 4DUZO 2LW7A 1HR0O 3J81N 4DR6O 1HNWO 1AILA 4JI2O 1N36O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 O;  2UUA O;  4DV5 O;  4JI7 O;  1IBK O;  3R66 A;  2VQF O;  4AQY O;  2DJV A;  1FKA O;  4JI4 O;  2FKX A;  4JI0 O;  4B3T O;  4JV5 O;  1I94 O;  1N33 O;  4DR5 O;  4K0K O;  2N74 A;  1N32 O;  2UXC O;  1HNX O;  1R1B A;  4DV4 O;  1IBM O;  4DR4 O;  4JYA O;  4LF8 O;  1IBL O;  4GKK O;  2ZKO A;  2E5L O;  4DR3 O;  3M8A A;  5LMN O;  2ZM6 O;  1FJG O;  2VQE O;  2HHH O;  4NXM O;  3RT3 C;  4LFC O;  3J7A U;  3T1Y O;  1AB3 A;  2JRI A;  4DUY O;  1XMO O;  4A5U B;  1NS1 A;  3T1H O;  4LF7 O;  4KHP O;  4DV7 O;  4OPA A;  4X64 O;  1XNQ O;  1XEQ A;  2Z0A A;  4DR1 O;  4LFB O;  5BY1 A;  4OX9 O;  1J5E O;  5FLX N;  2AGA A;  4DV6 O;  3J80 N;  2UXB O;  4X65 O;  3O65 A;  1KUQ A;  1G1X B;  1F7Y A;  4JI5 O;  1R6T A;  4JI1 O;  4JI8 O;  3F5T A;  4JI3 O;  1XMQ O;  4NXN O;  4B3S O;  4DV2 O;  2F4V O;  5A2Q N;  2DOS A;  4DR2 O;  2UUB O;  4DV0 O;  4DV3 O;  4B3R O;  4JI6 O;  1YZB A;  1HNZ O;  4LF6 O;  4YHH O;  4LF4 O;  2UUC O;  4DR7 O;  1D2D A;  1N34 O;  5IWA O;  5IT9 N;  1FYJ A;  2UU9 O;  1XNR O;  1A32 A;  4OPH A;  5H5N A;  4DV1 O;  3OTO O;  4LF9 O;  4B3M O;  4GKJ O;  4YY3 O;  3SDL A;  1DK1 A;  3JAM N;  2UXD O;  4X62 O;  4LFA O;  5LL6 Y;  5LMU O;  1X59 A;  4LF5 O;  5BXZ A;  5BR8 O;  4DUZ O;  2LW7 A;  1HR0 O;  3J81 N;  4DR6 O;  1HNW O;  1AIL A;  4JI2 O;  1N36 O; 
#chains in the Genus database with same CATH topology
 3BHP A;  4DV5 O;  2P06 A;  1KKD A;  5IYC O;  4XDJ A;  3SPC A;  1J95 A;  4PV1 B;  3P32 A;  1QVG U;  4NR1 A;  1WJZ A;  4MTO A;  1IBM B;  2HG5 C;  1N33 O;  2ITD C;  3E8F A;  4FFB A;  2LJ2 A;  4J7K A;  5IDJ A;  4NVP A;  2E5L B;  1I08 A;  4L87 A;  1V55 C;  4CZZ A;  5LYJ B;  5FNV A;  4GX2 A;  5CA1 A;  5EC1 C;  4FM1 A;  1AB3 A;  4X64 B;  2R70 A;  1FXK A;  2AZ0 A;  3T1H O;  4NKG B;  5D5P A;  4DRX B;  4PD4 F;  1K73 W;  1RM1 B;  2BTQ B;  3A0B Z;  1YDX A;  5EC2 C;  2ZIM A;  1V54 B;  5KHJ A;  3A2F A;  2V1D A;  2XAS A;  4NXN B;  3LDC A;  4J41 A;  4LCU C;  3VOU A;  3ZN0 A;  4DR2 B;  3LUT B;  2ZE7 A;  5LOV A;  1SES A;  4Z1M G;  3R65 A;  5EZY B;  3AG2 C;  3T4D A;  3ZJZ A;  1TVK B;  3E2E A;  1KP3 A;  4DK0 A;  2F95 B;  4O2B B;  4JZG A;  1GN3 A;  5KX5 A;  1RSO A;  1VF6 A;  3JAK A;  4JYC A;  5IWA B;  4HNA B;  3CCJ V;  3L75 H;  3OGC C;  1NBM G;  2RDC A;  1FD9 A;  2CAZ C;  4DV1 O;  1Y76 A;  2UXD B;  2ZE6 A;  1YSC A;  3SDL A;  1SZX A;  4LFA O;  1SQV H;  3OR7 C;  4J9Z B;  1SZT A;  4JGS A;  3N2G B;  4KP4 A;  1P7G A;  4I50 A;  2OWO A;  2IH1 C;  3ZMV A;  5CN0 A;  1SQQ H;  4DR5 B;  1FFX B;  4UVA A;  1O9G A;  1HNX B;  4LWS A;  3SGI A;  3AEI A;  2N74 A;  2QA4 V;  2GUZ A;  3DC6 A;  4TV9 A;  5EYP A;  4BIZ A;  4DV4 O;  1FJG B;  5B66 Z;  4ABM A;  3E22 A;  5LMN O;  1NVP D;  1IXB A;  4LFC O;  3J7A U;  1VQP V;  5LHI A;  1H8E G;  1NS1 A;  3STL C;  5JVD B;  4X20 B;  4OPA A;  1YIT V;  4C7U A;  5LA6 A;  2YDE A;  1LUV A;  4BAY A;  4OX9 O;  3D3I A;  3ABK C;  5JJJ B;  3L71 H;  2N04 A;  4JI5 B;  2LFR A;  3THO A;  4D7S A;  3HKB B;  4ZOL B;  2DWE C;  1O9H A;  4JAU A;  1AP5 A;  1OJH A;  3VBB A;  4DXW A;  3LDD A;  1B3Q A;  4B7K A;  4B3R B;  3HKC B;  3ZBH A;  1HNZ B;  4I9Q A;  1XL4 A;  2EIK C;  4X1Y B;  3LSQ A;  1IXM A;  5CMU A;  3N2K A;  4QNH B;  1N34 B;  2WA4 A;  2WWW A;  3K04 A;  3RVY A;  2HFE C;  1Y6X A;  3JD0 A;  2QTO A;  3IC9 A;  3JSN A;  2IJJ A;  1KEC A;  1XL6 A;  5EBM C;  5BR8 B;  2F23 A;  2WLN A;  2EIL C;  1QU7 A;  4LH7 A;  2JK5 C;  4NTX A;  1YEW A;  2B1G A;  3OUS A;  4P9O A;  4BW5 A;  4HYO A;  2PI4 A;  3ABK B;  3C90 A;  4XBF A;  1ZLZ A;  4B3T O;  1H2M A;  1N0J A;  1AR1 B;  3OE7 G;  1DGS A;  4LF8 B;  4JYA B;  2UXC O;  3CRM A;  2MW2 B;  4B08 A;  1NU1 H;  2ARH A;  1IBL O;  5BMV B;  1VQ7 V;  1JA8 A;  4GX5 A;  2CTR A;  4RUE A;  1WB7 A;  2OYQ A;  3ZRV A;  3DTU B;  4W4L A;  4I55 A;  3IC7 A;  1DTO A;  4EEQ A;  3UO3 A;  2JJ2 G;  3UKM A;  1S76 D;  4LNU A;  1ZUQ A;  2RN9 A;  4H33 A;  4CBC A;  4QIW F;  4JTD B;  4KXR A;  4MTX A;  1AI5 A;  3QG5 A;  4CH5 A;  3VQY A;  2JEU A;  2GDS A;  3K58 A;  1G1X B;  3HKE A;  1MZE A;  2P4K A;  5IYZ A;  4O4J B;  1R3I C;  4UCV A;  5KMG B;  5LXT A;  3KCX A;  4J7J A;  2EIL B;  4DV2 O;  3QO7 A;  2XUM A;  3ZN1 A;  3CJH A;  4JI6 O;  1M9N A;  2CK3 G;  4YHH B;  5A9G A;  2E74 B;  2Q69 A;  2EJR A;  4K3A A;  2WAM A;  2HJD A;  3B4S A;  1SET A;  1XUQ A;  2HJF C;  1PL4 A;  1YJN V;  1XNR B;  4HBN A;  5KUK A;  1HWY A;  1RP3 B;  3LDE A;  1Q86 W;  5IT9 N;  1K4D C;  4DO2 A;  1ORQ C;  3H1I H;  1PD3 A;  3OTO O;  3TGU H;  4ZKI A;  3FYI B;  4WF9 V;  2WLL A;  1JVM A;  3ZMT A;  3NXS A;  2QM8 A;  4L8J A;  1S72 V;  1OCC B;  1TUB B;  3B8M A;  4J7Z A;  5CBG A;  4MTF A;  2ZQM A;  1YI2 V;  3ZS8 C;  2RCV A;  2NNU A;  5IJ0 B;  1SRY A;  2B5U A;  5LGU A;  2CUG A;  1IBM O;  1CPY A;  3QO8 A;  3H1K H;  2KB1 A;  2PTM A;  2OCH A;  4O4L B;  1SQG A;  2HR3 A;  2E5L O;  4DYL A;  3BFR A;  4FMT A;  5GTI Z;  5B5E Z;  1K3E A;  3K5O A;  3L72 H;  1L1F A;  3CS5 A;  4X1K B;  1ENV A;  4DRX A;  3H1H H;  3E35 A;  1XHZ A;  4X64 O;  1H2G A;  1BSM A;  3P3N A;  1ZSP A;  2NN4 A;  1XEQ A;  1SQF A;  1Q6I A;  4DV4 B;  4DV6 B;  1GK9 A;  3ICX A;  4UV8 A;  1F4M A;  5KHG A;  5JCO A;  2CE4 A;  2AGA A;  1YVW A;  2JDI G;  2CTQ A;  3O65 A;  1M56 B;  2Q8V A;  3P3P A;  3OD4 A;  1KKC A;  4BW9 A;  1ZL8 B;  4R6Z A;  4ICG A;  4ZI7 A;  2F4V B;  2UUB B;  2Y0I A;  4NXN O;  4DV3 B;  3G67 A;  4DR2 O;  4F6R B;  1BMF G;  1K5Q A;  1CP9 A;  1Q6H A;  1THZ A;  3M7M X;  4HNA A;  2QKC A;  1V9P A;  2Q0A A;  2HKO A;  1VQL V;  3DXR B;  3ABU A;  3F7V C;  5HFM A;  5IWA O;  1SER A;  4ZIB A;  4LF9 B;  4GKJ B;  3K59 A;  3JAS B;  3N2G A;  2UXD O;  1R3J C;  4TQF A;  1I0H A;  5BXZ A;  2FB5 A;  2P22 C;  5DEC A;  2W0F C;  1AIL A;  1VMG A;  4FLZ A;  3SPI A;  4P2Z A;  3UT5 B;  3RBZ A;  2VQF O;  1Q81 W;  1N32 B;  1GN6 A;  3MD0 A;  3U0Z A;  2DW4 A;  5KHK A;  1WN7 A;  4DR5 O;  4DR4 B;  4IYH A;  2X0L A;  1HNX O;  3OAA G;  3CCV V;  2HHH B;  1HDJ A;  3B77 A;  4MVU A;  1FJG O;  3ABL C;  1OCZ C;  5IJ9 B;  3OM3 B;  4ZBM A;  3M99 B;  5JVD A;  1QR9 A;  4ZHQ A;  2IBZ H;  3K0G A;  3ZRS A;  3G6E V;  4N21 A;  2ADP A;  2F1M A;  3X2Q C;  4EB6 A;  4R50 A;  4BWA A;  1Q43 A;  4ZOL A;  3W7S A;  3K9A A;  4WFE A;  5H2F Z;  5CA3 A;  1NTZ H;  2Y69 C;  4JI5 O;  1EBO A;  1M57 B;  4NYK A;  1OCO B;  1VEW A;  2LFS A;  2B1I A;  1TA8 A;  4CH4 A;  2LGQ A;  3HKC A;  1RPR A;  1E1Q G;  2LP7 A;  4WBN B;  4X1Y A;  1YHQ V;  2XAF A;  4B3R O;  4FZ0 A;  2HP8 A;  4KUM A;  1UJW B;  1HNZ O;  5JQG B;  1IDS A;  1WLE A;  3JD3 A;  2P7T C;  5B3S C;  1N34 O;  5JH7 B;  2Q73 A;  5LHG A;  2M6Y A;  1P7B A;  3ABL B;  1OCZ B;  1YJW V;  3KG2 A;  5L3B A;  1TUE B;  1SQB H;  1FAF A;  2YXL A;  2BOC C;  5BR8 O;  1SF9 A;  1MAB G;  3X2Q B;  3FKS G;  1YF2 A;  4IL6 Z;  4K0K B;  3CC4 V;  5KA5 A;  4O4I B;  2Y69 B;  2YIB D;  4GKK B;  4JYA O;  4LF8 O;  3CMA V;  4X89 A;  3OMA B;  4U3F H;  3RYC B;  3JAR B;  4NTY A;  1VQM V;  2LQT A;  1QQC A;  2V4D A;  1ROP A;  5F2V O;  4D7T A;  4EFB A;  5C93 A;  2R9I A;  2OIG A;  1PV0 A;  3E8G A;  5B3S B;  2X7R B;  4BIO A;  3E8B A;  4AI8 A;  2ZXW C;  2FTK A;  2QE7 G;  4O4J A;  1BCC H;  3CXC U;  2CTW A;  5KMG A;  1B06 A;  1EN6 A;  2YIB A;  3JAL B;  3SR2 C;  4K8X A;  3CYO A;  1EM1 A;  3T1C A;  4Z2W A;  1F51 A;  1E1R G;  2Q68 A;  1KC8 W;  4JYB A;  3QO5 A;  1GKF A;  2DQ0 A;  3MHH C;  1BT8 A;  3L74 H;  3K5L A;  5E1A C;  1LR1 A;  4YHH O;  4JAA A;  2PF4 E;  3FB7 C;  3ZED A;  4HAM A;  1PNK A;  2WLM A;  3B8N A;  3CPW U;  3PN1 A;  2AHZ A;  2PY5 A;  4R7C A;  1FYJ A;  2BTO A;  1XNR O;  2VRZ A;  3BCC H;  1Y4M A;  1YIJ V;  1K33 A;  1SQX H;  5EIB C;  4X62 B;  2DYS C;  2NR5 A;  5LMU B;  4FFK A;  4DUZ B;  1X59 A;  2Q7G A;  4DW1 A;  4FPP A;  4P9P A;  3T4Z A;  4I0X B;  4MVS A;  5D5Q A;  5KLV H;  2CH7 B;  2QKS A;  5JJE B;  4TT3 G;  2JGD A;  4JV5 B;  2DJV A;  1I94 B;  3ASO C;  4MW3 A;  2ZXW B;  1MZF A;  1V55 B;  5KUM A;  5J2U B;  2F43 G;  4E4E A;  4H0L B;  1R1B A;  1NH2 B;  1N8R W;  5IYD O;  4O4L A;  3U11 A;  1YTF B;  5B1B C;  2ZKO A;  4DK1 A;  4X1K A;  1S0V A;  2H8P C;  3RT3 C;  2VQF B;  4KHP B;  4EKW A;  2D2C B;  4DR1 B;  2ITC C;  5GON A;  4YJ3 B;  2C2A A;  3SJQ C;  1J5E B;  3H9V A;  3ETD A;  3HKD B;  4UCS A;  2H94 A;  4X65 B;  2ZNJ A;  3K06 A;  3RYI B;  2OCC C;  3D8C A;  4DV6 O;  4UB6 Z;  1M5I A;  1ZL8 A;  2ZD9 A;  3K5N A;  4G27 B;  3F7Y C;  4TUY B;  3AG2 B;  2XND G;  2YUA A;  3IJ4 A;  2DYS B;  3ZMZ A;  1XI1 A;  3JD2 A;  5CA0 B;  1VAR A;  4F6R A;  4O4H B;  2Q5Z A;  3L9D A;  2F4V O;  4E2L A;  2UUB O;  4DV3 O;  3KKY A;  3S3W A;  5CB4 B;  4LF6 B;  4JAS A;  3ASO B;  1OV9 A;  3DXR A;  2IM9 A;  3N27 A;  4MSW C;  5BZB A;  4PJ0 Z;  1Y66 A;  1VQK V;  4JAV A;  2R72 A;  3WB0 A;  2LO1 A;  5B1B B;  3ZRW A;  3ZRX A;  2NLJ C;  4LF9 O;  4GKJ O;  4WFF A;  2FYU H;  2P4V A;  3WU2 Z;  2KQX A;  4BIU A;  1LUW A;  2ATK C;  4TV8 B;  2RQ6 A;  1VF7 A;  2BSK B;  5C8Y B;  3J81 N;  2ZT9 B;  3NR7 A;  1VQN V;  2DYR C;  4WFH A;  3R66 A;  1R6K A;  2IJK A;  5H6R A;  3VQW A;  3K5M A;  2ZDI C;  2WLI B;  3ZCC A;  1NR1 A;  1N32 O;  3Q4H A;  1NZ6 A;  3A0H Z;  4DR4 O;  2VQE B;  4UCR A;  1S5L Z;  2BCC H;  4DUY B;  4H44 B;  5ITZ B;  2DN9 A;  4I5S A;  5KHH A;  2HHH O;  2A9H A;  3VQV A;  2JRI A;  3RYF B;  1L8D A;  2YS8 A;  3RGB A;  3RYH A;  3CXH F;  1JFF B;  4RWU A;  1H38 A;  3UO2 A;  1GTO A;  3K57 A;  2Q67 A;  1R6N A;  3EXA A;  4X8A A;  2Z0A A;  4FLT A;  3CRR A;  2Q4P A;  2KG7 B;  3EFF K;  4RQE A;  2UXB B;  4UVB A;  4UCO A;  2WLJ A;  3BEH A;  1FXK C;  2GSM B;  1NJI W;  2GV9 A;  4JI8 B;  1IUR A;  2YEV A;  1KD1 W;  1U97 A;  2A3Q A;  5J9P C;  1WA8 B;  3G4S V;  1PM9 A;  2EIK B;  4WBN A;  4FLV A;  3BVO A;  3WB1 A;  2UXN A;  3I5D A;  5LP6 C;  2YIC A;  1Y74 B;  2DYR B;  1P4R A;  2QSA A;  2DE0 X;  4DR7 B;  1N0N A;  1FXH A;  1IVS A;  1FPO A;  5JH7 A;  1M4U A;  1QLN A;  1MMM A;  1WB8 A;  3IGA C;  1R73 A;  2Q7E A;  2DMX A;  4FFB B;  2QEX V;  2AW9 A;  4UV9 A;  4JI2 B;  5KA6 A;  4I9W A;  4X66 B;  3SYC A;  1QHT A;  1YZB A;  1Y67 A;  4JI0 B;  2YI8 A;  5CA1 B;  1GM7 A;  3MHS C;  4I7Z B;  4I4T A;  4O4I A;  3HPL C;  4GX0 A;  5IYB O;  1NQT A;  1AVM A;  3BY6 A;  4K0K O;  1R3K C;  4JZ2 A;  2FML A;  1AR4 A;  4GKK O;  2PZS A;  1R3L C;  1W2B U;  2E75 B;  3JAR A;  3B09 A;  4PA4 A;  2CGN A;  3E8H A;  5LP6 B;  4FLX A;  2A06 H;  3FB5 C;  4MVM A;  1M93 A;  2RJZ A;  5LOV B;  1QR8 A;  3CRA A;  2K9P A;  1H2L A;  1H8H G;  5BY1 A;  3OEH G;  2KKW A;  3ETQ A;  1GAX A;  5LYJ A;  2G38 A;  3JAL A;  4JYY A;  5KX5 B;  3DC5 A;  3QF7 A;  2Q0O C;  3G6B A;  4B3S B;  4MVR A;  3K0D A;  4DV0 B;  1PPJ H;  2ZNI A;  1ZTE A;  4LC1 A;  3CCU V;  2DOS A;  2BTQ A;  4MS2 A;  1WP7 A;  1URF A;  2EIM C;  4FJC C;  2VWJ A;  2XAG A;  4F4L A;  2LW1 A;  3LNM B;  4GCZ A;  4GLX A;  4LF4 B;  2JVD A;  1JCH A;  1SKV A;  5CBH A;  1NH2 D;  2ZR2 A;  1U96 A;  2B9Z A;  1K9M W;  5EZY A;  3CCQ V;  1FFT B;  5L3E A;  4GUN A;  2HLD G;  5FL7 G;  1TVK A;  4OGQ B;  2CDY A;  5KHI A;  4LWS B;  4O2B A;  4PI2 A;  1BHA A;  3AK3 A;  3SYA A;  2QWO B;  3AG7 A;  1HR0 B;  4X62 O;  4YIP A;  4I0X A;  5EYP B;  5LMU O;  4FM2 A;  3FYE B;  2CH7 A;  3ML0 A;  4G2K A;  3FFQ A;  2QKA A;  3O9O A;  4DUZ O;  3QTC A;  1KP2 A;  2OT5 A;  2XT9 A;  1JX9 A;  4GYC B;  3E83 A;  1OZ0 A;  1NTM H;  3CE2 A;  2ZR3 A;  3TET A;  1QLE C;  2PUS A;  5J2U A;  4JV5 O;  1I94 O;  4X1I B;  1K97 A;  5LA6 B;  1Q3E A;  3MAQ A;  2XHB A;  1AI7 A;  5EBW C;  3T1Y B;  2HVK C;  3CCS V;  1XMO B;  2Z5U A;  2LGW A;  4J80 A;  4UFZ A;  4DV7 B;  4K35 A;  4YJ3 A;  1FFX A;  3CCL V;  4TWK A;  3STZ C;  4KHP O;  2GHY A;  3FX7 A;  4UXN A;  3SYP A;  3HKD A;  4DR1 O;  1NVP B;  4NB5 A;  5TIS Z;  1J5E O;  3B2E E;  3CCE V;  3OGI B;  3J80 N;  1OHH G;  4X65 O;  3OEE G;  4JI3 B;  1F23 A;  4JPR A;  3FB8 C;  1Q90 D;  1F7Y A;  1JJO A;  1R6T A;  5CA0 A;  1WNS A;  4QGP A;  2HVJ C;  4OXS A;  4QPJ A;  4X20 A;  1XIL A;  4XDK A;  3JD4 A;  5LGT A;  4PHZ A;  3DGE A;  1WPB A;  3ABM C;  2KSD A;  3CME V;  2E3C A;  1WP8 A;  2F66 C;  4U7O A;  4UUJ C;  4IHJ B;  3WB2 A;  2P67 A;  1QLE B;  2QR4 A;  3HKB A;  5K1P A;  4LF6 O;  2UUC B;  3AK2 A;  3DSQ A;  3LSU A;  2ETN A;  4MVO A;  5CBF A;  3A8T A;  1AJN A;  3BPZ A;  1Q6U A;  5IY5 C;  3ZHQ A;  1G8M A;  4YY3 B;  1BE3 H;  2PYL A;  2ZIO A;  5J2T B;  4TV8 A;  1M90 W;  1BQ0 A;  1BS3 A;  3QVN A;  3JAM N;  2BSK A;  5C8Y A;  1N4C A;  2EZP A;  4CS4 A;  5B1N A;  3SJC C;  2QGN A;  4J42 A;  3SPH A;  2UUA B;  3RVZ A;  4PDR A;  3AK1 A;  4JI7 B;  4AQY B;  4JI4 B;  1RPO A;  1NKD A;  2WLI A;  3JAW B;  3WFV A;  3FAV B;  4RO2 A;  1LNQ A;  2R9A A;  4F6E A;  1PNL A;  1VQO V;  4EFE A;  4YJ2 B;  3AG3 C;  5ITZ A;  4WFB V;  2VQE O;  3ABM B;  2D3O W;  3RYF A;  3W7U A;  4PDL A;  3HKE B;  3KZI Z;  1JFF A;  4DUY O;  3CRQ A;  2OIE A;  3P30 A;  1XNQ B;  4WFG A;  3KCY A;  4LFB B;  4GX1 A;  2KG7 A;  3AG4 C;  3OFN G;  1B04 A;  1JQ0 A;  3RN4 A;  1MNG A;  5BMV A;  1W0J G;  3C3T A;  2L35 A;  3ZMU A;  5IY5 B;  2UXB O;  2N05 A;  4CC5 A;  3JD1 A;  4X88 A;  2WLK A;  2PI5 A;  2ZIN A;  4JI8 O;  1SA0 B;  2QWN B;  5JCO C;  1AJQ A;  4BR6 A;  2IH3 C;  1PNM A;  2EBO A;  2DQ3 A;  3BAA A;  1JPX A;  1GH6 A;  2GTS A;  1MSD A;  2F93 B;  4PA6 A;  1HW7 A;  2Q7H A;  2VS0 A;  4W4K A;  3FB6 C;  5DED A;  4DR7 O;  4PI0 A;  3CP1 A;  3JAT B;  1IZ3 A;  3AG3 B;  2PGG A;  2QM7 A;  2O57 A;  3BA9 A;  3CC7 V;  2VWK A;  1AJP A;  3ETG A;  1EFR G;  3LNN A;  1DK1 A;  4UVC A;  1CXZ B;  5LL6 Y;  4DR6 B;  1HNW B;  1N36 B;  1H2N A;  2LW7 A;  4JI2 O;  2RNB A;  3AG4 B;  4YIO A;  4X66 O;  4H13 B;  3F5W C;  2ZE5 A;  2IU3 A;  4JF3 A;  3ZHS A;  1YXB A;  2FKX A;  4JI0 O;  3D36 C;  2BOB C;  3BRC A;  2K1E A;  4B7E A;  2WSS G;  4TOI A;  4DR3 B;  1S77 D;  1Q8I A;  1PP9 H;  3K03 A;  2EUL A;  1EZV H;  5LP6 A;  4LF7 B;  1TUB A;  3CCM V;  4YXW G;  4K8Z A;  4A5U B;  2H3O A;  3ZHT A;  4ZI7 B;  2L6L A;  4QE9 A;  5IJ0 A;  3TCU A;  1L0N H;  3K9S A;  2WLH A;  3EVK A;  4QJF B;  4FIP C;  2EZO A;  3SYO A;  4JI1 B;  4RAI A;  2ZE8 A;  3OMI B;  1KUQ A;  1XMQ B;  2ZCE A;  4LR3 A;  1NT2 B;  2XAH A;  2ILM A;  4B3S O;  3A0R A;  4DV0 O;  1XBL A;  3CD6 V;  4LH6 A;  1KBH A;  3PJS K;  1Q5O A;  1B6Q A;  4Q20 A;  1GO3 F;  5IE9 A;  2Z3Y A;  4LF4 O;  5FPR A;  3G71 V;  3RW0 A;  1K5S A;  4PA9 A;  4N23 A;  1M1K W;  1ZX3 A;  3ETE A;  4PEL A;  3K3W A;  5GTH Z;  2HEP A;  3CSX A;  4O2A B;  1ZWI C;  4U3J B;  1CEZ A;  1HR0 O;  1AI4 A;  2MK3 A;  1IBK B;  1MSW D;  1NTK H;  4IT5 A;  1DF5 A;  3OUF A;  4ZHQ B;  4X1I A;  4IGG A;  3SPG A;  1G6U A;  5H6Q A;  2A79 B;  3JAS A;  5JWP A;  3E86 A;  1VF5 B;  3OTF A;  4EB6 B;  3JSL A;  1ARO P;  2Y0P A;  4AHC A;  3TK1 A;  1DF4 A;  2ZM6 B;  4NXM B;  3EHB B;  4J10 A;  3UT5 A;  3CEI A;  1YCI A;  1IX9 A;  3ABT A;  1US6 A;  3I56 V;  3T1Y O;  1XMO O;  2CTP A;  1P84 F;  4KFM A;  1XDC A;  5H9C A;  1YJ9 V;  3QNE A;  1W0K G;  4DV7 O;  1GMG A;  2OCC B;  4CH3 A;  4DW0 A;  1GRJ A;  2ODM A;  2IJI A;  3OT7 A;  3I55 V;  2FL4 A;  1KU9 A;  5IJ9 A;  3F5T A;  2YID A;  4JI3 O;  2Y4T A;  1S3J A;  3CWB H;  4IIJ B;  3ASN C;  4IHJ A;  4RQF A;  2YXY A;  5B1O A;  2UXX A;  3LSS A;  5L3C A;  2P90 A;  4WCE V;  4PDM A;  3GVM A;  1Z2G A;  5KAF Z;  2UUC O;  2UU9 B;  2YXH A;  4P30 A;  5HFL A;  4JTA B;  2JS3 A;  1D2D A;  4U7N A;  1I5Y A;  4B3M B;  5J2T A;  3H1J H;  1DLB A;  2IU0 A;  4YY3 O;  4MTG A;  3GB7 C;  5JQG A;  3APO A;  2AHY A;  3RFR A;  4LF5 O;  5EBL C;  2QWQ B;  4J9Y B;  4UCT A;  2QM4 A;  4DV5 B;  1Q82 W;  3JAW A;  3K08 A;  2UUA O;  3U10 A;  4JI7 O;  4AQY O;  3L70 H;  3JCU Z;  3FAV A;  1N33 B;  4JI4 O;  1KMI Z;  1VF6 C;  4FK5 C;  2JIZ G;  1SC5 B;  1XHX A;  3GWK C;  5LBQ A;  3OW2 U;  1OCC C;  1SQP H;  4FVM A;  4YJ2 A;  1EN5 A;  1VQ9 V;  3FD9 A;  3CX5 F;  1K4C C;  1E79 G;  2EX3 A;  2X6C A;  2W0X A;  2P6J A;  4CH6 A;  1KQS U;  3T1H B;  3C3S A;  5KAI Z;  5FNV B;  3TXS A;  3ASN B;  2Y48 A;  3UCS C;  2PYJ A;  2IW5 A;  1OCR C;  4FLY A;  1K34 A;  4GT1 A;  1XNQ O;  1FXK B;  3B40 A;  4IYI A;  1L0L H;  4HZ3 A;  4LFB O;  4RUF A;  1RFY A;  1I7F A;  5AG2 A;  1XQ8 A;  1Z5W A;  3CB2 A;  1K8A W;  3L73 H;  2V7Q G;  3RYC A;  1SA0 A;  1AI6 A;  1FXV A;  4MVZ A;  3S3X A;  3SPJ A;  4TSF G;  1K7D A;  1M56 C;  2JGU A;  4LP8 A;  5DM6 V;  1Z5V A;  2W6I G;  1COW G;  1AP6 A;  2AZ2 A;  2YC0 A;  2QDO A;  2QJ1 A;  4NTW A;  1RSO B;  3JAK B;  1BHB A;  1F4N A;  3JAT A;  1GN2 A;  1I5X A;  3RWR D;  4DV1 B;  2JGD B;  4OPH A;  1H2S B;  4PA7 A;  4TQD A;  1MA1 A;  2CGO A;  4LFA B;  2E76 B;  3APQ A;  4GZR B;  1Y76 B;  3TJT A;  5LGN A;  1OCR B;  3T2M A;  3W7W A;  2JJ1 G;  4DR6 O;  1HNW O;  1N36 O;  3W7X A;  4I50 B;  2X6B A;  2EIN C;  1YTF D;  1KB9 F;  1TAE A;  2QWP B;  1HP8 A;  1H2K A;  1VIB A;  2XOK G;  5GON B;  3UM7 A;  1VQ8 V;  1VP7 A;  4MVQ A;  3CC2 V;  4QE7 A;  1XOU A;  4G28 B;  5DN6 G;  1UPG A;  5LMN B;  2GUZ B;  4TV9 B;  2QWR B;  2BE3 A;  2Q6A A;  4LFC B;  3ZHV A;  4DR3 O;  1QNM A;  2XAQ A;  1BZK A;  1BL8 A;  3E22 B;  3SJB C;  5EK0 A;  4LF7 O;  3AG1 C;  3OR6 C;  2DWD C;  4PDV A;  3WG7 C;  4AIL C;  3CRC A;  4OX9 B;  5EIB D;  3OMN B;  3IAY A;  2JS5 A;  3GWO A;  1FS0 G;  4LBE C;  2YIA A;  1X4T A;  1QVF U;  2A0L A;  3ZMS A;  1WPX A;  4JI1 O;  4J11 A;  4D6T H;  1P49 A;  2EIM B;  1XMQ O;  2YI9 A;  1QBZ A;  1VQ4 V;  1PL0 A;  4XDL A;  1M57 C;  2ADQ B;  1OCO C;  4FLU A;  1G4Y B;  3ZRW B;  1VQ6 V;  1BQZ A;  3RYI A;  2IJH A;  1NI8 A;  2EIN B;  4Z1V A;  4FM0 A;  4TUY A;  1K92 A;  3H1L H;  3D36 A;  2WPD G;  3W7T A;  4FZ1 A;  3HR0 A;  3N2K B;  1JJ2 U;  3D3Q A;  3JYC A;  1EZJ A;  3IFX A;  1T5E A;  4O4H A;  4WFA V;  4PA3 A;  5B1A C;  1A32 A;  2P5O A;  1EN4 A;  3G80 A;  5H5N A;  2YSU B;  3BAB A;  5CB4 A;  4O2A A;  5L3F A;  4KL1 A;  1ZAU A;  4U3J A;  2Q9L A;  3Q4H B;  3CHX A;  4R8C A;  3AG1 B;  4UB8 Z;  3WG7 B;  3H01 A;  4JTC B;  1KYO F;  1Q7Y W;  1IBK O;  2QTS A;  3E89 A;  4B3T B;  1FKA O;  3RYH B;  4CS3 A;  2UXC B;  1W59 A;  3MDS A;  1IBL B;  1JOY A;  2AXT Z;  4QPK A;  4MT8 A;  2M7W A;  4LF5 B;  4CS2 A;  1VQ5 V;  3VQX A;  5FPO A;  1BGY H;  1XRE A;  2JEX A;  3M8A A;  3HB3 B;  2A7W A;  2ZM6 O;  4MW8 A;  4NXM O;  2YEV B;  3SJA C;  3ZIA G;  4H37 A;  3ZHU A;  5L3G A;  4ASU G;  3BA8 A;  4FLW A;  1TGO A;  4I55 B;  5E79 Z;  5L3D A;  2EIJ C;  5GW7 A;  4LNU B;  2WA3 A;  3UQ8 A;  5FLX N;  2R9R B;  4UCU A;  1QCE A;  5B1A B;  2EJ7 A;  1GN4 A;  2RMK B;  4DV2 B;  2XTA A;  5IYZ B;  3TXQ A;  3K79 A;  1GM8 A;  3ZHR A;  5LXT B;  4IIJ A;  2OTJ V;  1PKX A;  2OTL V;  4JI6 B;  5A2Q N;  1NR7 A;  5K1X A;  1SS3 A;  3JCZ A;  3CCR V;  3CJH B;  3SYQ A;  1RM1 C;  1MOF A;  4X9Q A;  1MG1 A;  1S5J A;  1WA8 A;  4Q6G A;  4CC6 A;  2Y4U A;  2XAJ A;  2W6J G;  3OTO B;  2UU9 O;  5JJN B;  3ZX6 A;  1V54 C;  4I4T B;  1GM9 A;  2X6A A;  1UFI A;  2GTA A;  4B3M O;  2GBO A;  1Y74 A;  1WAZ A;  1AR5 A;  5LHH A;  1D5N A;  1S5H C;  1D5A A;  2WLL B;  2ZDI A;  1JMK C;  2EIJ B;  1JR9 A; 
#chains in the Genus database with same CATH homology
 4X66 O;  2UUA O;  4DV5 O;  4JI7 O;  1IBK O;  3R66 A;  2VQF O;  4AQY O;  2DJV A;  1FKA O;  4JI4 O;  2FKX A;  4JI0 O;  4B3T O;  4JV5 O;  1I94 O;  1N33 O;  4DR5 O;  4K0K O;  2N74 A;  1N32 O;  2UXC O;  1HNX O;  1R1B A;  4DV4 O;  1IBM O;  4DR4 O;  4JYA O;  4LF8 O;  1IBL O;  4GKK O;  2ZKO A;  2E5L O;  4DR3 O;  3M8A A;  5LMN O;  2ZM6 O;  1FJG O;  2VQE O;  2HHH O;  4NXM O;  3RT3 C;  4LFC O;  3J7A U;  3T1Y O;  1AB3 A;  2JRI A;  4DUY O;  1XMO O;  4A5U B;  1NS1 A;  3T1H O;  4LF7 O;  4KHP O;  4DV7 O;  4OPA A;  4X64 O;  1XNQ O;  1XEQ A;  2Z0A A;  4DR1 O;  4LFB O;  5BY1 A;  4OX9 O;  1J5E O;  5FLX N;  2AGA A;  4DV6 O;  3J80 N;  2UXB O;  4X65 O;  3O65 A;  1KUQ A;  1G1X B;  1F7Y A;  4JI5 O;  1R6T A;  4JI1 O;  4JI8 O;  3F5T A;  4JI3 O;  1XMQ O;  4NXN O;  4B3S O;  4DV2 O;  2F4V O;  5A2Q N;  2DOS A;  4DR2 O;  2UUB O;  4DV0 O;  4DV3 O;  4B3R O;  4JI6 O;  1YZB A;  1HNZ O;  4LF6 O;  4YHH O;  4LF4 O;  2UUC O;  4DR7 O;  1D2D A;  1N34 O;  5IWA O;  5IT9 N;  1FYJ A;  2UU9 O;  1XNR O;  1A32 A;  4OPH A;  5H5N A;  4DV1 O;  3OTO O;  4LF9 O;  4B3M O;  4GKJ O;  4YY3 O;  3SDL A;  1DK1 A;  3JAM N;  2UXD O;  4X62 O;  4LFA O;  5LL6 Y;  5LMU O;  1X59 A;  4LF5 O;  5BXZ A;  5BR8 O;  4DUZ O;  2LW7 A;  1HR0 O;  3J81 N;  4DR6 O;  1HNW O;  1AIL A;  4JI2 O;  1N36 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...