2K9PA

Structure of tm1_tm2 in lppg micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone alpha factor receptor
publication title Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.920 Mainly Alpha Orthogonal Bundle Helix Hairpins Pheromone alpha factor receptor. 2k9pA00
2K9PA
chains in the Genus database with same CATH superfamily
4DV2O 1GN3A 5KA6A 2ZR3A 1Y66A 2Q8VA 4UCUA 2JEXA 5EZYA 1XREA 5TISZ 5C93A 1YHQV 1R3JC 3STZC 2A06H 3HB3B 2OIGA 1WAZA 1ZAUA 2P06A 4X88A 1Y76B 4B08A 1ZL8A 2IM9A 4EFBA 4Q20A 2W6IG 1WPXA 1K3EA 3B40A 1FXKA 3LDCA 1JMKC 4Q6GA 2Y48A 5KHJA 1N4CA 4QPKA 4H44B 3SYQA 1MSWD 2ZXWC 3CC4V 3QO8A 3ZN1A 4DR4B 3APOA 3ASOC 3UO2A 3VQYA 3CYOA 3LSQA 3ASNC 3BY6A 4TUYB 4FM2A 1NJIW 3O9OA 1SA0B 4J9YB 5CBFA 2A9HA 4IHJB 2EZOA 1R6KA 3IC9A 3W7XA 1YCIA 1MZFA 5JJJB 3MD0A 1NH2B 1PPJH 2PUSA 2JJ2G 4DXWA 2XASA 3NXSA 3F5WC 4GZRB 4DRXB 3S3WA 4Z1VA 4UCTA 3BPZA 4PA4A 3FX7A 5LYJA 2FTKA 4JI7B 1RPRA 2A0LA 4DV4O 2F23A 2ZDIA 5KUMA 1Y67A 1Q6HA 5B1AB 4GKJO 4X66O 2QGNA 3BAAA 5EBLC 3K57A 1A32A 1XDCA 3JD2A 4LNUA 2F95B 3SYCA 1LUWA 5A9GA 2F4VO 1IXMA 5JQGA 3OE7G 2Q67A 2N74A 3KCYA 1OCOB 2Q0OC 5EIBC 3OAAG 3CX5F 3CP1A 2VQFB 2PI5A 1S5LZ 1HNWB 2UXDB 4PA6A 2HHHB 3JD1A 4GCZA 1LR1A 3QG5A 4YIPA 1VF6A 1WA8B 2ZT9B 4JZ2A 4OX9O 3K5MA 3CWBH 3ETGA 4NXMB 1SRYA 3G71V 3FKSG 4KFMA 2WLIB 1PL4A 4CZZA 1OJHA 3ML0A 2ZIMA 2QE7G 2EULA 4O4HA 1MA1A 3OTOO 2R72A 3ETQA 3JATA 3K04A 1Y76A 4DV5O 3CEIA 4O2BB 3OT7A 5KA5A 2GUZB 2ZE6A 3B4SA 1AI7A 2QKAA 5FPOA 3BFRA 4I4TB 4IIJB 1U97A 3SJQC 1SKVA 2WLJA 4PI2A 2BE3A 4LF5O 2IH3C 5LL6Y 4JGSA 1DF4A 1OCCB 2E5LO 5D5PA 5B1BC 1DTOA 3H1JH 4TUYA 2A79B 5CA1B 4JASA 3OMNB 3ZCCA 1K97A 2Z3YA 1AI6A 1NR7A 3TXQA 1SA0A 1R3LC 3ABMB 4X1IA 5GONB 2BOBC 2L6LA 4U3JB 4MW8A 4UFZA 1XMQO 5JVDB 3HKCB 3STLC 2IJKA 3CPWU 1EN4A 1UJWB 3AG3B 4XDJA 2GDSA 3ZHTA 2AHYA 3RYIA 3C3SA 4JI6O 1AI4A 1R6NA 3K79A 1M9NA 2E3CA 1OHHG 1M57C 1K8AW 4EB6A 3EVKA 3JCUZ 1H2NA 1VQ5V 1GN6A 1J95A 1M56C 4NTXA 2HP8A 4LH7A 2OYQA 5KX5B 4NKGB 4DV4B 4DV7B 4RQEA 4UVCA 5GTIZ 4X62O 5CA0A 2BCCH 2ZQMA 1N8RW 3A2FA 4XBFA 4LFAO 1AB3A 2YIBD 2JGUA 3AG1C 2YIAA 1R6TA 1BHBA 4PELA 4X1YB 1KECA 2EZPA 5J2TA 2VRZA 1OV9A 3JALA 1M5IA 5CB4A 1B04A 4DK0A 2GSMB 4WFAV 3ZMTA 1THZA 1S72V 4JI8B 4OX9B 2MK3A 3APQA 3K5OA 1ZUQA 3K58A 3QTCA 4MVZA 5EIBD 2QWPB 1N36O 4LF9O 5IJ9B 1ZSPA 2GUZA 1BT8A 3T4ZA 4P30A 3M7MX 3OTOB 3QO5A 3G6BA 4LF7B 4IIJA 4DV5B 1PKXA 3K03A 4J80A 4DYLA 3N2KA 4ZI7A 2UU9B 2QM7A 4FJCC 2ZE5A 4IYHA 1GN4A 2BSKB 2FMLA 3JASB 2ZXWB 1IBKO 3M99B 3H1LH 3ASOB 2CAZC 1Y74A 4BR6A 4LF8O 3G67A 4LF5B 2ODMA 5LGNA 3C3TA 3CMEV 2CUGA 2E5LB 4UXNA 1OCZC 2ZIOA 4U3JA 4A5UB 3K9AA 4L8JA 4I50A 2ETNA 3JAMN 3TXSA 2EILC 1SQFA 2BOCC 1XMQB 4BW9A 1V55C 5L3DA 4MVRA 2GTSA 1SQXH 3CRRA 1DF5A 1AI5A 2CTWA 2Q73A 4YHHO 2QDOA 3UM7A 4IT5A 4JI6B 4ASUG 1GMGA 2HVJC 4DV3O 2DWDC 1TA8A 2WWWA 2P7TC 2VQEO 4JI2O 5KAIZ 1TUEB 3JARB 1I0HA 3IC7A 1KKDA 5IDJA 5LOVB 2P22C 1K5QA 5BMVB 2DW4A 4YIOA 4TV9A 1CPYA 4J7KA 1F51A 3OTFA 5A2QN 4LH6A 1Q5OA 4H37A 4I7ZB 5L3EA 2WLLB 5LGUA 2ZE7A 5GW7A 4X62B 3SYPA 1VARA 3ZRWB 3WU2Z 3ABKC 4X1YA 4PHZA 1MABG 4LFAB 3RN4A 3J7AU 3D36C 4GUNA 1GKFA 4B3MO 3I55V 1VF5B 4PDMA 2ZR2A 3CRAA 4DUYO 1JVMA 4MTFA 1H2MA 4DR5B 4U7NA 4MT8A 5BR8O 2X6AA 2UUAO 1ZL8B 4O2AB 3L9DA 3QNEA 4JYYA 4DR4O 2DYRC 4LBEC 2QJ1A 5C8YA 4D7SA 2EX3A 1N36B 4LF9B 5LHHA 5CBHA 1QVFU 1FFTB 1Q82W 3F7YC 4PA3A 1B6QA 4G27B 1NR1A 3AG7A 1T5EA 1G6UA 4LFBO 1X4TA 3OGCC 4LF4O 2Z5UA 4O4JB 4DV0O 4MVQA 5DECA 4JI0O 2QEXV 4HBNA 5B1BB 3HKBA 1IBKB 1I5XA 2XNDG 4MTGA 4NR1A 4TQFA 5H6RA 1SZTA 2RCVA 1FXHA 4FM1A 3QVNA 1AR4A 4FLTA 5BY1A 3KZIZ 4MTXA 2OIEA 4CS2A 4U7OA 4FLUA 1P7GA 1R3IC 1TGOA 2Q9LA 2GV9A 5LHGA 1KQSU 1D2DA 4R7CA 3BVOA 3WG7C 2LGQA 3K3WA 4X65O 3K06A 3CJHA 2EJRA 1LUVA 5LYJB 4JYBA 1NKDA 3ZHQA 2ITDC 1M57B 5IY5C 2PI4A 3T1YB 2YIBA 1SERA 1KUQA 4I9WA 3E22A 4YHHB 3JAKB 5IWAO 1S77D 1BQ0A 4PV1B 1L0NH 1M90W 3JD0A 2UUBO 3L72H 3SPCA 1D5NA 4LNUB 4JI2B 4RWUA 4MS2A 1QCEA 5BMVA 1DGSA 4PA7A 1TAEA 5JQGB 2WLMA 4DO2A 2HHHO 4K3AA 4QGPA 4I0XA 2R9IA 4BIUA 4EKWA 5FL7G 2WA3A 1VEWA 2KB1A 2EIJC 2GHYA 2IJHA 4GT1A 5IYDO 3JD3A 2FYUH 3A0BZ 1K5SA 2YEVB 4DR1O 4KL1A 2PY5A 1CXZB 4TT3G 1Q6IA 2XUMA 2DJVA 3W7TA 3CE2A 2RN9A 2EINB 4O4HB 3OR6C 4B3MB 1HWYA 2IH1C 2XT9A 3JATB 3FB7C 3AG4C 2QM8A 1NI8A 2D2CB 4B3SB 4DUYB 1UPGA 4R6ZA 2IJIA 4PJ0Z 4O2AA 2ADQB 4N23A 3D8CA 2DMXA 2AZ0A 1N32O 1VQOV 1IZ3A 5BR8B 2UUAB 2JGDA 4KHPO 3ABTA 3BRCA 3WB1A 3RYCA 3OUSA 1WLEA 4NTWA 3A0RA 1EZJA 2WAMA 5B1OA 2JS5A 3ICXA 1NTZH 2K1EA 2WLHA 2WA4A 3H1IH 3ZIAG 1NT2B 2PTMA 3L74H 2E74B 4O4JA 4NTYA 1N33O 2XAJA 1PL0A 1EFRG 5LA6B 1FD9A 2F1MA 3U0ZA 5B3SB 2KSDA 1L0LH 1VQ9V 4LFBB 3DGEA 1G8MA 4X1IB 4LF4B 3L73H 4DV0B 5F2VO 2HKOA 3DXRB 4JI0B 1P4RA 1OCZB 1IXBA 3CRQA 4J11A 2C2AA 4AHCA 3RYIB 1H2LA 4TWKA 3FB8C 4CS3A 1XQ8A 3FAVB 3HKDA 2EILB 2CTPA 4EB6B 3GWKC 2OWOA 1VQ8V 1Z5VA 4FVMA 1QBZA 2ZM6B 4DV7O 1Y6XA 3C90A 3RYHA 3ABUA 4X65B 1XHZA 4JTAB 4NYKA 3JAKA 5K1XA 1VMGA 2CH7B 5JCOC 4UCRA 5H5NA 4Z1MG 3CCUV 5CA0B 1XNQO 5IWAB 4UCOA 3U10A 3B09A 1RP3B 1FFXB 3R65A 2UUBB 1YDXA 2P90A 3CXHF 4CS4A 2JJ1G 1IDSA 2W0FC 4JI8O 2JK5C 2P5OA 1IURA 3QO7A 5J2TB 1F23A 3JALB 5EBWC 2PF4E 2YEVA 5CB4B 4B7KA 3OFNG 1TUBA 3SYOA 5E1AC 4OGQB 2QWQB 1IBLO 3ZRXA 4DR1B 3OW2U 4LF7O 3CD6V 3K5NA 1JFFB 3F5TA 1JOYA 3UCSC 4DUZB 2UU9O 4YY3O 2CGNA 5B1NA 4O4IA 4LCUC 4X64O 4WFHA 3N2KB 3T1HO 1Q7YW 4ZI7B 4JI5O 2DYRB 3CC7V 3RYFB 5JH7B 1JPXA 1N32B 2HJDA 1MNGA 3PJSK 4I9QA 3X2QC 4KHPB 2X0LA 4JYCA 2XHBA 4LWSA 3CS5A 4L87A 1VQMV 4J10A 1IBMO 1RSOB 2IBZH 2H8PC 5KUKA 4N21A 3DC5A 1Y74B 1VP7A 4UCSA 5LA6A 3S3XA 4BAYA 2XAFA 1K7DA 1I94B 1XL6A 4IGGA 4PD4F 1HDJA 1N33B 3DXRA 1V54C 2N04A 4I50B 3IGAC 1E1RG 1PNMA 4F6RA 1HR0O 4RQFA 1ZTEA 4HNAB 1NS1A 3ETEA 3ETDA 2K9PA 2DQ0A 3BABA 2AGAA 3FAVA 4QE9A 2CDYA 4GX0A 3AK1A 1J5EO 2CTQA 1VQ4V 1FYJA 1QQCA 1H2SB 3ZHSA 4K0KO 5LP6A 3ZEDA 1N0NA 4G2KA 2CH7A 3Q4HA 1BQZA 1SS3A 4C7UA 2NN4A 3VQWA 2X6CA 2LP7A 2DN9A 1GO3F 4TV9B 2Q5ZA 5EBMC 4JV5O 1SC5B 1SQVH 3TK1A 5KMGA 3HKEA 3CC2V 4D6TH 3IFXA 1FFXA 3K0DA 1TVKA 1WP7A 2D3OW 1PNLA 1W59A 3OD4A 4HZ3A 1AJQA 3VOUA 1XNQB 4NB5A 1YZBA 3LSSA 3RVYA 2LW7A 4P9OA 2Y69B 2UUCO 4DR5O 2P67A 4QPJA 1QNMA 4RAIA 2XAGA 3LNMB 3LDDA 3D36A 1B06A 1GM9A 3E35A 1NVPD 2DWEC 3F7VC 1JFFA 1IBLB 3AG4B 3RGBA 3E2EA 1Q43A 1Q3EA 1WPBA 5C8YB 2VS0A 4JTCB 4WFFA 3EHBB 5IJ0B 4DW1A 5FNVB 3SR2C 2RDCA 3AEIA 3RYFA 5JH7A 4LF6O 1DLBA 4JZGA 5LMUB 2BTOA 4YY3B 1QR8A 3L70H 4EEQA 3MDSA 4UVAA 4X8AA 4X64B 1L1FA 5B5EZ 1GAXA 4TV8A 3T1HB 1E79G 4JI5B 2PZSA 2O57A 1RSOA 1VQPV 1XNRO 1XMOB 1MOFA 3JAWA 5IT9N 4YJ2A 3HKBB 1FKAO 2A7WA 3ASNB 4ABMA 1IBMB 1QU7A 1HNZB 3I56V 2PYLA 1NBMG 2Q0AA 1PD3A 3N2GA 4JI3O 2NR5A 1S76D 1ZX3A 4TQDA 1OZ0A 4BWAA 1HNXB 3QF7A 2LJ2A 4MVOA 3R66A 1G1XB 4HNAA 3LSUA 3T1YO 1S5JA 4GX5A 1HR0B 1URFA 5LP6C 3CJHB 3FYEB 1COWG 5KHIA 4B3RO 1XEQA 1JR9A 3JD4A 3MAQA 2X6BA 5CA3A 4X89A 1GH6A 4FZ0A 2ZKOA 1Q86W 1S3JA 3E22B 4CH4A 3ZMUA 1MZEA 1AJNA 1GM7A 4MW3A 1N0JA 4UB6Z 1J5EB 4DR7O 1QLEC 1OCRC 3THOA 1US6A 4K0KB 3U11A 4MSWC 1VQNV 3ZBHA 3CCEV 5B1AC 1ZLZA 2H94A 1YF2A 4I0XB 2FL4A 2CK3G 2QWNB 3D3IA 4DR6O 4JV5B 1LNQA 2ITCC 2DYSC 2KG7A 4FLYA 3J81N 3P30A 1F4MA 2UXBO 1ORQC 4KP4A 2ZINA 2YSUB 3W7UA 4B3SO 1WNSA 1K33A 1WB7A 3E8FA 1H8HG 1Q6UA 2UUCB 1BE3H 4FLVA 1AVMA 1BZKA 4H0LB 1VIBA 1ZWIC 5GTHZ 2Q7HA 2PYJA 3ZHRA 4WFEA 1R3KC 2M6YA 3KG2A 3OGIB 4JAAA 2EIKC 2V7QG 4U3FH 3D3QA 1DK1A 2JGDB 1AJPA 2YDEA 3RYCB 3OMIB 5IJ0A 5FNVA 4FLWA 3AG2C 1Q90D 4PDVA 4KXRA 1GTOA 4FFBA 3SPGA 4FK5C 3K9SA 2IU0A 5EYPB 4LF6B 4WF9V 3X2QB 3ABLC 5L3BA 2B5UA 2G38A 4LP8A 1JJ2U 2ATKC 3E86A 4QE7A 3RW0A 1XNRB 3RT3C 3CRCA 4K8XA 3E8GA 5J9PC 4WFBV 3ABMC 1PV0A 2Z0AA 3B8NA 3IAYA 4NXNO 1V54B 4CC5A 4BIOA 5ITZB 4JI3B 2EJ7A 3K5LA 2F93B 4ZIBA 2ZM6O 2JRIA 3HKDB 3AG3C 4X1KA 4DV6O 1WN7A 2Y0PA 2EIMC 4G28B 1X59A 3EFFK 2AW9A 4EFEA 3DTUB 3P3PA 3SGIA 3TJTA 3RYHB 1M4UA 3CHXA 2QWOB 2HG5C 4OPAA 3E83A 4B3RB 1M93A 3J80N 1M56B 1PM9A 1EN5A 4GKKO 2Y0IA 1P7BA 5LGTA 3N27A 3OEHG 3L75H 5JCOA 4DR7B 2JDIG 4B3TO 1O9HA 1KC8W 3GVMA 1BMFG 4B7EA 3NR7A 4BIZA 2JVDA 3RBZA 1RFYA 2GBOA 1CEZA 1SZXA 5IYZA 5K1PA 3AG1B 4DV1O 4QIWF 4FIPC 4GLXA 1HP8A 4DR6B 4WBNA 1TUBB 1KKCA 2YXLA 2YIDA 1SQQH 3H1HH 3ZX6A 2VWKA 2ZNIA 4DUZO 4OPHA 2UXBB 3CCQV 2PGGA 1VQLV 3W7SA 2MW2B 1QHTA 2LO1A 3LUTB 1YEWA 2ADPA 3OEEG 5D5QA 3O65A 1KB9F 4O4IB 2JEUA 1Q81W 3H9VA 1KU9A 4F4LA 5H9CA 2B1GA 2QWRB 3RVZA 2AHZA 3PN1A 4LWSB 2Q68A 4K8ZA 2XTAA 4QJFB 4F6EA 1I94O 5J2UB 1H8EG 5EYPA 1EBOA 3AK2A 4ZBMA 3GWOA 3LDEA 1VQ7V 1L8DA 4ZHQB 1AR5A 2X7RB 4LC1A 3SPIA 2HR3A 1BGYH 1MMMA 3UT5B 2WSSG 1BS3A 5L3CA 4J41A 4ZOLA 4F6RB 1MSDA 2R70A 1JQ0A 2UXCB 2NLJC 1YSCA 4RUFA 2QM4A 2P4KA 1AP5A 5ITZA 1K4CC 3FFQA 4AQYO 5DM6V 1BCCH 4X20A 4NXNB 1V55B 5L3FA 4QNHB 1VQKV 4MVSA 1QLNA 1K34A 1CP9A 2ZD9A 3OM3B 1YJNV 3CMAV 1SQGA 3MHHC 3OUFA 4DR2O 1XHXA 5LP6B 4GX2A 4DV6B 3AK3A 4IL6Z 4P2ZA 3Q4HB 1D5AA 3TCUA 4W4KA 1N34O 1KBHA 5JJEB 4FFKA 1PP9H 1QLEB 3ZN0A 1OCRB 5KMGB 3HKEB 2Q7GA 1TVKB 4D7TA 2UXNA 4GKKB 1W0KG 4MTOA 1K9MW 3W7WA 2R9RB 4B3TB 1FS0G 2W0XA 2ILMA 5CBGA 3BCCH 3CRMA 5HFMA 1WJZA 2B1IA 4TSFG 3ABKB 1I08A 1IX9A 4JPRA 4AI8A 2DYSB 3KCXA 3L71H 1YVWA 5HFLA 3ZMSA 4DV1B 2QA4V 1JX9A 5BXZA 4FLXA 1XI1A 4H33A 4WCEV 4MVUA 2DE0X 1QVGU 2H3OA 2HVKC 2RMKB 4UV9A 5LXTB 5LMUO 4DV2B 2JIZG 2YS8A 2OCCC 1YIJV 5H2FZ 2EIKB 1FXKC 1YTFD 4PI0A 1SQPH 4DK1A 1XMOO 4X9QA 5AG2A 5KHKA 2KKWA 4TV8B 2OT5A 3K08A 3AG2B 1HNZO 3P3NA 3T1CA 5J2UA 2P4VA 3JAWB 3OMAB 3SPJA 1JJOA 1ENVA 4YJ2B 1XILA 1FXVA 1JA8A 4I55B 1AROP 4CC6A 4ZHQA 3G6EV 5KHHA 2AXTZ 1V9PA 3ABLB 3JCZA 3WB2A 1HNXO 4UVBA 3UT5A 3N2GB 4CH5A 3VBBA 3G80A 2RQ6A 1B3QA 2YI9A 1NZ6A 1BL8A 2IJJA 2QSAA 3TGUH 3UKMA 4IHJA 3T2MA 1YXBA 4CH6A 5LMNO 2XAHA 4LFCO 1RM1C 2HFEC 4P9PA 3B8MA 1EZVH 3VQXA 2Y4UA 4FZ1A 3M8AA 1YJ9V 4PDRA 3WG7B 4AQYB 2W6JG 2WPDG 1F7YA 2EIMB 4DRXA 3KKYA 5IY5B 4JI4O 2E76B 2YICA 3SPHA 3WFVA 4DR2B 2ZDIC 2DQ3A 3ZJZA 3K0GA 3WB0A 1GM8A 4MVMA 4JYAO 1K4DC 2FKXA 5BZBA 2FB5A 1EM1A 3CSXA 1N34B 1H2KA 4WFGA 2E75B 5IE9A 2AZ2A 2Q6AA 4JAVA 4ICGA 2QKSA 2CTRA 2KG7B 4OXSA 2LGWA 4PDLA 4GKJB 2EIJB 3SJAC 3DSQA 4X66B 4UUJC 2YXHA 3E8HA 4BW5A 2VWJA 4FM0A 3I5DA 2ZCEA 1VF6C 5KAFZ 1SQBH 2F4VB 1YTFB 2YI8A 2V4DA 4W4LA 2QKCA 3E8BA 1WA8A 4JF3A 2V1DA 2HLDG 2QTSA 4YJ3B 2XAQA 4R50A 1IVSA 2EINC 2ZNJA 1FJGO 5LXTA 2HEPA 2EBOA 2WLIA 1M1KW 1E1QG 4J7JA 2WLNA 1K73W 1RPOA 4R8CA 1SESA 2QR4A 4XDKA 2OTLV 4O2BA 4FFBB 3ZS8C 3JSLA 1GK9A 4KUMA 3DC6A 1NTKH 2DOSA 1I7FA 4I4TA 3CCLV 5EC2C 4HYOA 4I55A 5KLVH 1AR1B 1BSMA 1FAFA 1XBLA 1KP2A 2OTJV 1S5HC 5B3SC 2R9AA 5CA1A 3CCVV 2N05A 3FYIB 1AILA 3K59A 4DR3O 4E2LA 3IJ4A 5GONA 1YI2V 2IU3A 5JJNB 3RFRA 1H2GA 4X1KB 1QR9A 1Z2GA 3H01A 5JVDA 3G4SV 3HKCA 1KMIZ 5FPRA 2UXXA 5LMNB 2LFRA 2ZE8A 4JTDB 1ROPA 2LFSA 4LFCB 4JI1O 3FD9A 4J7ZA 2XOKG 1SETA 4UV8A 3ZRVA 3B77A 2BTQB 3ZHUA 2F66C 4E4EA 1H38A 4UCVA 1FPOA 1Q8IA 1YJWV 4O4LB 2LQTA 3EXAA 3FB6C 2YC0A 3VQVA 4JI4B 1MG1A 2GTAA 1S0VA 3CCJV 3OR7C 4GX1A 4JYAB 5KX5A 3MHSC 5DN6G 5IYZB 1WB8A 3JSNA 1NVPB 1O9GA 1OCOC 3HR0A 5CN0A 5E79Z 4UB8Z 3ZMZA 4WBNB 4CBCA 2F43G 3ZHVA 3SYAA 5KHGA 4GYCB 2JS3A 5LHIA 2RNBA 2QTOA 2CE4A 5LBQA 5EC1C 2YXYA 5B66Z 1W0JG 5IYBO 4JAUA 5EZYB 1K92A 1GRJA 4YJ3A 1BHAA 3T4DA 3BEHA 3CXCU 4PA9A 3B2EE 1GN2A 3E89A 2B9ZA 5DEDA 4YXWG 3TETA 1FJGB 1HW7A 4HAMA 1XOUA 2OCCB 1Z5WA 1F4NA 1XL4A 3BA9A 1NU1H 5IJ9A 3HPLC 1FXKB 3ZMVA 3CCMV 1PNKA 1WP8A 2Q69A 1KD1W 1I5YA 2Y4TA 1OCCC 3LNNA 1Y4MA 5L3GA 2BSKA 2UXCO 1U96A 3JASA 3FB5C 3UQ8A 3GB7C 3CB2A 4RO2A 1YITV 5H6QA 4AILC 2KQXA 4ZOLB 2WLKA 1R73A 2IW5A 1VF7A 1NTMH 3UO3A 1SF9A 2RJZA 1JCHA 1KP3A 2OCHA 4J42A 3SJCC 4LF8B 4X20B 3JYCA 1G4YB 1XUQA 2Q4PA 1NQTA 2HJFC 3SDLA 1RM1B 4DR3B 3BA8A 1UFIA 2NNUA 3CCSV 3SJBC 2ARHA 3CCRV 1EN6A 2A3QA 1KYOF 4I5SA 4JI7O 4K35A 1AP6A 2BTQA 4DW0A 2L35A 4JI1B 5JWPA 5FLXN 4XDLA 2Q7EA 1R1BA 3ZRSA 4FMTA 4O4LA 5CMUA 1NH2D 4IYIA 4J9ZB 2P6JA 2LW1A 1P84F 2CGOA 5EK0A 4CH3A 2YUAA 3A8TA 3JARA 3A0HZ 4Z2WA 3BHPA 4DV3B 2M7WA 5LOVA 2VQEB 4FPPA 3H1KH 1P49A 3RWRD 4H13B 4ZKIA 4RUEA 2VQFO 4NVPA 1HNWO 2UXDO 1VQ6V 1W2BU 4TOIA 2WLLA 4LR3A 5IYCO 2Y69C 4NXMO 3ZRWA 4FLZA 3P32A
chains in the Genus database with same CATH topology
2K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9P A; 
#chains in the Genus database with same CATH topology
 4DV2 O;  1GN3 A;  5KA6 A;  2ZR3 A;  1Y66 A;  2Q8V A;  4UCU A;  2JEX A;  5EZY A;  1XRE A;  5TIS Z;  5C93 A;  1YHQ V;  1R3J C;  3STZ C;  2A06 H;  3HB3 B;  2OIG A;  1WAZ A;  1ZAU A;  2P06 A;  4X88 A;  1Y76 B;  4B08 A;  1ZL8 A;  2IM9 A;  4EFB A;  4Q20 A;  2W6I G;  1WPX A;  1K3E A;  3B40 A;  1FXK A;  3LDC A;  1JMK C;  4Q6G A;  2Y48 A;  5KHJ A;  1N4C A;  4QPK A;  4H44 B;  3SYQ A;  1MSW D;  2ZXW C;  3CC4 V;  3QO8 A;  3ZN1 A;  4DR4 B;  3APO A;  3ASO C;  3UO2 A;  3VQY A;  3CYO A;  3LSQ A;  3ASN C;  3BY6 A;  4TUY B;  4FM2 A;  1NJI W;  3O9O A;  1SA0 B;  4J9Y B;  5CBF A;  2A9H A;  4IHJ B;  2EZO A;  1R6K A;  3IC9 A;  3W7X A;  1YCI A;  1MZF A;  5JJJ B;  3MD0 A;  1NH2 B;  1PPJ H;  2PUS A;  2JJ2 G;  4DXW A;  2XAS A;  3NXS A;  3F5W C;  4GZR B;  4DRX B;  3S3W A;  4Z1V A;  4UCT A;  3BPZ A;  4PA4 A;  3FX7 A;  5LYJ A;  2FTK A;  4JI7 B;  1RPR A;  2A0L A;  4DV4 O;  2F23 A;  2ZDI A;  5KUM A;  1Y67 A;  1Q6H A;  5B1A B;  4GKJ O;  4X66 O;  2QGN A;  3BAA A;  5EBL C;  3K57 A;  1A32 A;  1XDC A;  3JD2 A;  4LNU A;  2F95 B;  3SYC A;  1LUW A;  5A9G A;  2F4V O;  1IXM A;  5JQG A;  3OE7 G;  2Q67 A;  2N74 A;  3KCY A;  1OCO B;  2Q0O C;  5EIB C;  3OAA G;  3CX5 F;  3CP1 A;  2VQF B;  2PI5 A;  1S5L Z;  1HNW B;  2UXD B;  4PA6 A;  2HHH B;  3JD1 A;  4GCZ A;  1LR1 A;  3QG5 A;  4YIP A;  1VF6 A;  1WA8 B;  2ZT9 B;  4JZ2 A;  4OX9 O;  3K5M A;  3CWB H;  3ETG A;  4NXM B;  1SRY A;  3G71 V;  3FKS G;  4KFM A;  2WLI B;  1PL4 A;  4CZZ A;  1OJH A;  3ML0 A;  2ZIM A;  2QE7 G;  2EUL A;  4O4H A;  1MA1 A;  3OTO O;  2R72 A;  3ETQ A;  3JAT A;  3K04 A;  1Y76 A;  4DV5 O;  3CEI A;  4O2B B;  3OT7 A;  5KA5 A;  2GUZ B;  2ZE6 A;  3B4S A;  1AI7 A;  2QKA A;  5FPO A;  3BFR A;  4I4T B;  4IIJ B;  1U97 A;  3SJQ C;  1SKV A;  2WLJ A;  4PI2 A;  2BE3 A;  4LF5 O;  2IH3 C;  5LL6 Y;  4JGS A;  1DF4 A;  1OCC B;  2E5L O;  5D5P A;  5B1B C;  1DTO A;  3H1J H;  4TUY A;  2A79 B;  5CA1 B;  4JAS A;  3OMN B;  3ZCC A;  1K97 A;  2Z3Y A;  1AI6 A;  1NR7 A;  3TXQ A;  1SA0 A;  1R3L C;  3ABM B;  4X1I A;  5GON B;  2BOB C;  2L6L A;  4U3J B;  4MW8 A;  4UFZ A;  1XMQ O;  5JVD B;  3HKC B;  3STL C;  2IJK A;  3CPW U;  1EN4 A;  1UJW B;  3AG3 B;  4XDJ A;  2GDS A;  3ZHT A;  2AHY A;  3RYI A;  3C3S A;  4JI6 O;  1AI4 A;  1R6N A;  3K79 A;  1M9N A;  2E3C A;  1OHH G;  1M57 C;  1K8A W;  4EB6 A;  3EVK A;  3JCU Z;  1H2N A;  1VQ5 V;  1GN6 A;  1J95 A;  1M56 C;  4NTX A;  2HP8 A;  4LH7 A;  2OYQ A;  5KX5 B;  4NKG B;  4DV4 B;  4DV7 B;  4RQE A;  4UVC A;  5GTI Z;  4X62 O;  5CA0 A;  2BCC H;  2ZQM A;  1N8R W;  3A2F A;  4XBF A;  4LFA O;  1AB3 A;  2YIB D;  2JGU A;  3AG1 C;  2YIA A;  1R6T A;  1BHB A;  4PEL A;  4X1Y B;  1KEC A;  2EZP A;  5J2T A;  2VRZ A;  1OV9 A;  3JAL A;  1M5I A;  5CB4 A;  1B04 A;  4DK0 A;  2GSM B;  4WFA V;  3ZMT A;  1THZ A;  1S72 V;  4JI8 B;  4OX9 B;  2MK3 A;  3APQ A;  3K5O A;  1ZUQ A;  3K58 A;  3QTC A;  4MVZ A;  5EIB D;  2QWP B;  1N36 O;  4LF9 O;  5IJ9 B;  1ZSP A;  2GUZ A;  1BT8 A;  3T4Z A;  4P30 A;  3M7M X;  3OTO B;  3QO5 A;  3G6B A;  4LF7 B;  4IIJ A;  4DV5 B;  1PKX A;  3K03 A;  4J80 A;  4DYL A;  3N2K A;  4ZI7 A;  2UU9 B;  2QM7 A;  4FJC C;  2ZE5 A;  4IYH A;  1GN4 A;  2BSK B;  2FML A;  3JAS B;  2ZXW B;  1IBK O;  3M99 B;  3H1L H;  3ASO B;  2CAZ C;  1Y74 A;  4BR6 A;  4LF8 O;  3G67 A;  4LF5 B;  2ODM A;  5LGN A;  3C3T A;  3CME V;  2CUG A;  2E5L B;  4UXN A;  1OCZ C;  2ZIO A;  4U3J A;  4A5U B;  3K9A A;  4L8J A;  4I50 A;  2ETN A;  3JAM N;  3TXS A;  2EIL C;  1SQF A;  2BOC C;  1XMQ B;  4BW9 A;  1V55 C;  5L3D A;  4MVR A;  2GTS A;  1SQX H;  3CRR A;  1DF5 A;  1AI5 A;  2CTW A;  2Q73 A;  4YHH O;  2QDO A;  3UM7 A;  4IT5 A;  4JI6 B;  4ASU G;  1GMG A;  2HVJ C;  4DV3 O;  2DWD C;  1TA8 A;  2WWW A;  2P7T C;  2VQE O;  4JI2 O;  5KAI Z;  1TUE B;  3JAR B;  1I0H A;  3IC7 A;  1KKD A;  5IDJ A;  5LOV B;  2P22 C;  1K5Q A;  5BMV B;  2DW4 A;  4YIO A;  4TV9 A;  1CPY A;  4J7K A;  1F51 A;  3OTF A;  5A2Q N;  4LH6 A;  1Q5O A;  4H37 A;  4I7Z B;  5L3E A;  2WLL B;  5LGU A;  2ZE7 A;  5GW7 A;  4X62 B;  3SYP A;  1VAR A;  3ZRW B;  3WU2 Z;  3ABK C;  4X1Y A;  4PHZ A;  1MAB G;  4LFA B;  3RN4 A;  3J7A U;  3D36 C;  4GUN A;  1GKF A;  4B3M O;  3I55 V;  1VF5 B;  4PDM A;  2ZR2 A;  3CRA A;  4DUY O;  1JVM A;  4MTF A;  1H2M A;  4DR5 B;  4U7N A;  4MT8 A;  5BR8 O;  2X6A A;  2UUA O;  1ZL8 B;  4O2A B;  3L9D A;  3QNE A;  4JYY A;  4DR4 O;  2DYR C;  4LBE C;  2QJ1 A;  5C8Y A;  4D7S A;  2EX3 A;  1N36 B;  4LF9 B;  5LHH A;  5CBH A;  1QVF U;  1FFT B;  1Q82 W;  3F7Y C;  4PA3 A;  1B6Q A;  4G27 B;  1NR1 A;  3AG7 A;  1T5E A;  1G6U A;  4LFB O;  1X4T A;  3OGC C;  4LF4 O;  2Z5U A;  4O4J B;  4DV0 O;  4MVQ A;  5DEC A;  4JI0 O;  2QEX V;  4HBN A;  5B1B B;  3HKB A;  1IBK B;  1I5X A;  2XND G;  4MTG A;  4NR1 A;  4TQF A;  5H6R A;  1SZT A;  2RCV A;  1FXH A;  4FM1 A;  3QVN A;  1AR4 A;  4FLT A;  5BY1 A;  3KZI Z;  4MTX A;  2OIE A;  4CS2 A;  4U7O A;  4FLU A;  1P7G A;  1R3I C;  1TGO A;  2Q9L A;  2GV9 A;  5LHG A;  1KQS U;  1D2D A;  4R7C A;  3BVO A;  3WG7 C;  2LGQ A;  3K3W A;  4X65 O;  3K06 A;  3CJH A;  2EJR A;  1LUV A;  5LYJ B;  4JYB A;  1NKD A;  3ZHQ A;  2ITD C;  1M57 B;  5IY5 C;  2PI4 A;  3T1Y B;  2YIB A;  1SER A;  1KUQ A;  4I9W A;  3E22 A;  4YHH B;  3JAK B;  5IWA O;  1S77 D;  1BQ0 A;  4PV1 B;  1L0N H;  1M90 W;  3JD0 A;  2UUB O;  3L72 H;  3SPC A;  1D5N A;  4LNU B;  4JI2 B;  4RWU A;  4MS2 A;  1QCE A;  5BMV A;  1DGS A;  4PA7 A;  1TAE A;  5JQG B;  2WLM A;  4DO2 A;  2HHH O;  4K3A A;  4QGP A;  4I0X A;  2R9I A;  4BIU A;  4EKW A;  5FL7 G;  2WA3 A;  1VEW A;  2KB1 A;  2EIJ C;  2GHY A;  2IJH A;  4GT1 A;  5IYD O;  3JD3 A;  2FYU H;  3A0B Z;  1K5S A;  2YEV B;  4DR1 O;  4KL1 A;  2PY5 A;  1CXZ B;  4TT3 G;  1Q6I A;  2XUM A;  2DJV A;  3W7T A;  3CE2 A;  2RN9 A;  2EIN B;  4O4H B;  3OR6 C;  4B3M B;  1HWY A;  2IH1 C;  2XT9 A;  3JAT B;  3FB7 C;  3AG4 C;  2QM8 A;  1NI8 A;  2D2C B;  4B3S B;  4DUY B;  1UPG A;  4R6Z A;  2IJI A;  4PJ0 Z;  4O2A A;  2ADQ B;  4N23 A;  3D8C A;  2DMX A;  2AZ0 A;  1N32 O;  1VQO V;  1IZ3 A;  5BR8 B;  2UUA B;  2JGD A;  4KHP O;  3ABT A;  3BRC A;  3WB1 A;  3RYC A;  3OUS A;  1WLE A;  4NTW A;  3A0R A;  1EZJ A;  2WAM A;  5B1O A;  2JS5 A;  3ICX A;  1NTZ H;  2K1E A;  2WLH A;  2WA4 A;  3H1I H;  3ZIA G;  1NT2 B;  2PTM A;  3L74 H;  2E74 B;  4O4J A;  4NTY A;  1N33 O;  2XAJ A;  1PL0 A;  1EFR G;  5LA6 B;  1FD9 A;  2F1M A;  3U0Z A;  5B3S B;  2KSD A;  1L0L H;  1VQ9 V;  4LFB B;  3DGE A;  1G8M A;  4X1I B;  4LF4 B;  3L73 H;  4DV0 B;  5F2V O;  2HKO A;  3DXR B;  4JI0 B;  1P4R A;  1OCZ B;  1IXB A;  3CRQ A;  4J11 A;  2C2A A;  4AHC A;  3RYI B;  1H2L A;  4TWK A;  3FB8 C;  4CS3 A;  1XQ8 A;  3FAV B;  3HKD A;  2EIL B;  2CTP A;  4EB6 B;  3GWK C;  2OWO A;  1VQ8 V;  1Z5V A;  4FVM A;  1QBZ A;  2ZM6 B;  4DV7 O;  1Y6X A;  3C90 A;  3RYH A;  3ABU A;  4X65 B;  1XHZ A;  4JTA B;  4NYK A;  3JAK A;  5K1X A;  1VMG A;  2CH7 B;  5JCO C;  4UCR A;  5H5N A;  4Z1M G;  3CCU V;  5CA0 B;  1XNQ O;  5IWA B;  4UCO A;  3U10 A;  3B09 A;  1RP3 B;  1FFX B;  3R65 A;  2UUB B;  1YDX A;  2P90 A;  3CXH F;  4CS4 A;  2JJ1 G;  1IDS A;  2W0F C;  4JI8 O;  2JK5 C;  2P5O A;  1IUR A;  3QO7 A;  5J2T B;  1F23 A;  3JAL B;  5EBW C;  2PF4 E;  2YEV A;  5CB4 B;  4B7K A;  3OFN G;  1TUB A;  3SYO A;  5E1A C;  4OGQ B;  2QWQ B;  1IBL O;  3ZRX A;  4DR1 B;  3OW2 U;  4LF7 O;  3CD6 V;  3K5N A;  1JFF B;  3F5T A;  1JOY A;  3UCS C;  4DUZ B;  2UU9 O;  4YY3 O;  2CGN A;  5B1N A;  4O4I A;  4LCU C;  4X64 O;  4WFH A;  3N2K B;  3T1H O;  1Q7Y W;  4ZI7 B;  4JI5 O;  2DYR B;  3CC7 V;  3RYF B;  5JH7 B;  1JPX A;  1N32 B;  2HJD A;  1MNG A;  3PJS K;  4I9Q A;  3X2Q C;  4KHP B;  2X0L A;  4JYC A;  2XHB A;  4LWS A;  3CS5 A;  4L87 A;  1VQM V;  4J10 A;  1IBM O;  1RSO B;  2IBZ H;  2H8P C;  5KUK A;  4N21 A;  3DC5 A;  1Y74 B;  1VP7 A;  4UCS A;  5LA6 A;  3S3X A;  4BAY A;  2XAF A;  1K7D A;  1I94 B;  1XL6 A;  4IGG A;  4PD4 F;  1HDJ A;  1N33 B;  3DXR A;  1V54 C;  2N04 A;  4I50 B;  3IGA C;  1E1R G;  1PNM A;  4F6R A;  1HR0 O;  4RQF A;  1ZTE A;  4HNA B;  1NS1 A;  3ETE A;  3ETD A;  2K9P A;  2DQ0 A;  3BAB A;  2AGA A;  3FAV A;  4QE9 A;  2CDY A;  4GX0 A;  3AK1 A;  1J5E O;  2CTQ A;  1VQ4 V;  1FYJ A;  1QQC A;  1H2S B;  3ZHS A;  4K0K O;  5LP6 A;  3ZED A;  1N0N A;  4G2K A;  2CH7 A;  3Q4H A;  1BQZ A;  1SS3 A;  4C7U A;  2NN4 A;  3VQW A;  2X6C A;  2LP7 A;  2DN9 A;  1GO3 F;  4TV9 B;  2Q5Z A;  5EBM C;  4JV5 O;  1SC5 B;  1SQV H;  3TK1 A;  5KMG A;  3HKE A;  3CC2 V;  4D6T H;  3IFX A;  1FFX A;  3K0D A;  1TVK A;  1WP7 A;  2D3O W;  1PNL A;  1W59 A;  3OD4 A;  4HZ3 A;  1AJQ A;  3VOU A;  1XNQ B;  4NB5 A;  1YZB A;  3LSS A;  3RVY A;  2LW7 A;  4P9O A;  2Y69 B;  2UUC O;  4DR5 O;  2P67 A;  4QPJ A;  1QNM A;  4RAI A;  2XAG A;  3LNM B;  3LDD A;  3D36 A;  1B06 A;  1GM9 A;  3E35 A;  1NVP D;  2DWE C;  3F7V C;  1JFF A;  1IBL B;  3AG4 B;  3RGB A;  3E2E A;  1Q43 A;  1Q3E A;  1WPB A;  5C8Y B;  2VS0 A;  4JTC B;  4WFF A;  3EHB B;  5IJ0 B;  4DW1 A;  5FNV B;  3SR2 C;  2RDC A;  3AEI A;  3RYF A;  5JH7 A;  4LF6 O;  1DLB A;  4JZG A;  5LMU B;  2BTO A;  4YY3 B;  1QR8 A;  3L70 H;  4EEQ A;  3MDS A;  4UVA A;  4X8A A;  4X64 B;  1L1F A;  5B5E Z;  1GAX A;  4TV8 A;  3T1H B;  1E79 G;  4JI5 B;  2PZS A;  2O57 A;  1RSO A;  1VQP V;  1XNR O;  1XMO B;  1MOF A;  3JAW A;  5IT9 N;  4YJ2 A;  3HKB B;  1FKA O;  2A7W A;  3ASN B;  4ABM A;  1IBM B;  1QU7 A;  1HNZ B;  3I56 V;  2PYL A;  1NBM G;  2Q0A A;  1PD3 A;  3N2G A;  4JI3 O;  2NR5 A;  1S76 D;  1ZX3 A;  4TQD A;  1OZ0 A;  4BWA A;  1HNX B;  3QF7 A;  2LJ2 A;  4MVO A;  3R66 A;  1G1X B;  4HNA A;  3LSU A;  3T1Y O;  1S5J A;  4GX5 A;  1HR0 B;  1URF A;  5LP6 C;  3CJH B;  3FYE B;  1COW G;  5KHI A;  4B3R O;  1XEQ A;  1JR9 A;  3JD4 A;  3MAQ A;  2X6B A;  5CA3 A;  4X89 A;  1GH6 A;  4FZ0 A;  2ZKO A;  1Q86 W;  1S3J A;  3E22 B;  4CH4 A;  3ZMU A;  1MZE A;  1AJN A;  1GM7 A;  4MW3 A;  1N0J A;  4UB6 Z;  1J5E B;  4DR7 O;  1QLE C;  1OCR C;  3THO A;  1US6 A;  4K0K B;  3U11 A;  4MSW C;  1VQN V;  3ZBH A;  3CCE V;  5B1A C;  1ZLZ A;  2H94 A;  1YF2 A;  4I0X B;  2FL4 A;  2CK3 G;  2QWN B;  3D3I A;  4DR6 O;  4JV5 B;  1LNQ A;  2ITC C;  2DYS C;  2KG7 A;  4FLY A;  3J81 N;  3P30 A;  1F4M A;  2UXB O;  1ORQ C;  4KP4 A;  2ZIN A;  2YSU B;  3W7U A;  4B3S O;  1WNS A;  1K33 A;  1WB7 A;  3E8F A;  1H8H G;  1Q6U A;  2UUC B;  1BE3 H;  4FLV A;  1AVM A;  1BZK A;  4H0L B;  1VIB A;  1ZWI C;  5GTH Z;  2Q7H A;  2PYJ A;  3ZHR A;  4WFE A;  1R3K C;  2M6Y A;  3KG2 A;  3OGI B;  4JAA A;  2EIK C;  2V7Q G;  4U3F H;  3D3Q A;  1DK1 A;  2JGD B;  1AJP A;  2YDE A;  3RYC B;  3OMI B;  5IJ0 A;  5FNV A;  4FLW A;  3AG2 C;  1Q90 D;  4PDV A;  4KXR A;  1GTO A;  4FFB A;  3SPG A;  4FK5 C;  3K9S A;  2IU0 A;  5EYP B;  4LF6 B;  4WF9 V;  3X2Q B;  3ABL C;  5L3B A;  2B5U A;  2G38 A;  4LP8 A;  1JJ2 U;  2ATK C;  3E86 A;  4QE7 A;  3RW0 A;  1XNR B;  3RT3 C;  3CRC A;  4K8X A;  3E8G A;  5J9P C;  4WFB V;  3ABM C;  1PV0 A;  2Z0A A;  3B8N A;  3IAY A;  4NXN O;  1V54 B;  4CC5 A;  4BIO A;  5ITZ B;  4JI3 B;  2EJ7 A;  3K5L A;  2F93 B;  4ZIB A;  2ZM6 O;  2JRI A;  3HKD B;  3AG3 C;  4X1K A;  4DV6 O;  1WN7 A;  2Y0P A;  2EIM C;  4G28 B;  1X59 A;  3EFF K;  2AW9 A;  4EFE A;  3DTU B;  3P3P A;  3SGI A;  3TJT A;  3RYH B;  1M4U A;  3CHX A;  2QWO B;  2HG5 C;  4OPA A;  3E83 A;  4B3R B;  1M93 A;  3J80 N;  1M56 B;  1PM9 A;  1EN5 A;  4GKK O;  2Y0I A;  1P7B A;  5LGT A;  3N27 A;  3OEH G;  3L75 H;  5JCO A;  4DR7 B;  2JDI G;  4B3T O;  1O9H A;  1KC8 W;  3GVM A;  1BMF G;  4B7E A;  3NR7 A;  4BIZ A;  2JVD A;  3RBZ A;  1RFY A;  2GBO A;  1CEZ A;  1SZX A;  5IYZ A;  5K1P A;  3AG1 B;  4DV1 O;  4QIW F;  4FIP C;  4GLX A;  1HP8 A;  4DR6 B;  4WBN A;  1TUB B;  1KKC A;  2YXL A;  2YID A;  1SQQ H;  3H1H H;  3ZX6 A;  2VWK A;  2ZNI A;  4DUZ O;  4OPH A;  2UXB B;  3CCQ V;  2PGG A;  1VQL V;  3W7S A;  2MW2 B;  1QHT A;  2LO1 A;  3LUT B;  1YEW A;  2ADP A;  3OEE G;  5D5Q A;  3O65 A;  1KB9 F;  4O4I B;  2JEU A;  1Q81 W;  3H9V A;  1KU9 A;  4F4L A;  5H9C A;  2B1G A;  2QWR B;  3RVZ A;  2AHZ A;  3PN1 A;  4LWS B;  2Q68 A;  4K8Z A;  2XTA A;  4QJF B;  4F6E A;  1I94 O;  5J2U B;  1H8E G;  5EYP A;  1EBO A;  3AK2 A;  4ZBM A;  3GWO A;  3LDE A;  1VQ7 V;  1L8D A;  4ZHQ B;  1AR5 A;  2X7R B;  4LC1 A;  3SPI A;  2HR3 A;  1BGY H;  1MMM A;  3UT5 B;  2WSS G;  1BS3 A;  5L3C A;  4J41 A;  4ZOL A;  4F6R B;  1MSD A;  2R70 A;  1JQ0 A;  2UXC B;  2NLJ C;  1YSC A;  4RUF A;  2QM4 A;  2P4K A;  1AP5 A;  5ITZ A;  1K4C C;  3FFQ A;  4AQY O;  5DM6 V;  1BCC H;  4X20 A;  4NXN B;  1V55 B;  5L3F A;  4QNH B;  1VQK V;  4MVS A;  1QLN A;  1K34 A;  1CP9 A;  2ZD9 A;  3OM3 B;  1YJN V;  3CMA V;  1SQG A;  3MHH C;  3OUF A;  4DR2 O;  1XHX A;  5LP6 B;  4GX2 A;  4DV6 B;  3AK3 A;  4IL6 Z;  4P2Z A;  3Q4H B;  1D5A A;  3TCU A;  4W4K A;  1N34 O;  1KBH A;  5JJE B;  4FFK A;  1PP9 H;  1QLE B;  3ZN0 A;  1OCR B;  5KMG B;  3HKE B;  2Q7G A;  1TVK B;  4D7T A;  2UXN A;  4GKK B;  1W0K G;  4MTO A;  1K9M W;  3W7W A;  2R9R B;  4B3T B;  1FS0 G;  2W0X A;  2ILM A;  5CBG A;  3BCC H;  3CRM A;  5HFM A;  1WJZ A;  2B1I A;  4TSF G;  3ABK B;  1I08 A;  1IX9 A;  4JPR A;  4AI8 A;  2DYS B;  3KCX A;  3L71 H;  1YVW A;  5HFL A;  3ZMS A;  4DV1 B;  2QA4 V;  1JX9 A;  5BXZ A;  4FLX A;  1XI1 A;  4H33 A;  4WCE V;  4MVU A;  2DE0 X;  1QVG U;  2H3O A;  2HVK C;  2RMK B;  4UV9 A;  5LXT B;  5LMU O;  4DV2 B;  2JIZ G;  2YS8 A;  2OCC C;  1YIJ V;  5H2F Z;  2EIK B;  1FXK C;  1YTF D;  4PI0 A;  1SQP H;  4DK1 A;  1XMO O;  4X9Q A;  5AG2 A;  5KHK A;  2KKW A;  4TV8 B;  2OT5 A;  3K08 A;  3AG2 B;  1HNZ O;  3P3N A;  3T1C A;  5J2U A;  2P4V A;  3JAW B;  3OMA B;  3SPJ A;  1JJO A;  1ENV A;  4YJ2 B;  1XIL A;  1FXV A;  1JA8 A;  4I55 B;  1ARO P;  4CC6 A;  4ZHQ A;  3G6E V;  5KHH A;  2AXT Z;  1V9P A;  3ABL B;  3JCZ A;  3WB2 A;  1HNX O;  4UVB A;  3UT5 A;  3N2G B;  4CH5 A;  3VBB A;  3G80 A;  2RQ6 A;  1B3Q A;  2YI9 A;  1NZ6 A;  1BL8 A;  2IJJ A;  2QSA A;  3TGU H;  3UKM A;  4IHJ A;  3T2M A;  1YXB A;  4CH6 A;  5LMN O;  2XAH A;  4LFC O;  1RM1 C;  2HFE C;  4P9P A;  3B8M A;  1EZV H;  3VQX A;  2Y4U A;  4FZ1 A;  3M8A A;  1YJ9 V;  4PDR A;  3WG7 B;  4AQY B;  2W6J G;  2WPD G;  1F7Y A;  2EIM B;  4DRX A;  3KKY A;  5IY5 B;  4JI4 O;  2E76 B;  2YIC A;  3SPH A;  3WFV A;  4DR2 B;  2ZDI C;  2DQ3 A;  3ZJZ A;  3K0G A;  3WB0 A;  1GM8 A;  4MVM A;  4JYA O;  1K4D C;  2FKX A;  5BZB A;  2FB5 A;  1EM1 A;  3CSX A;  1N34 B;  1H2K A;  4WFG A;  2E75 B;  5IE9 A;  2AZ2 A;  2Q6A A;  4JAV A;  4ICG A;  2QKS A;  2CTR A;  2KG7 B;  4OXS A;  2LGW A;  4PDL A;  4GKJ B;  2EIJ B;  3SJA C;  3DSQ A;  4X66 B;  4UUJ C;  2YXH A;  3E8H A;  4BW5 A;  2VWJ A;  4FM0 A;  3I5D A;  2ZCE A;  1VF6 C;  5KAF Z;  1SQB H;  2F4V B;  1YTF B;  2YI8 A;  2V4D A;  4W4L A;  2QKC A;  3E8B A;  1WA8 A;  4JF3 A;  2V1D A;  2HLD G;  2QTS A;  4YJ3 B;  2XAQ A;  4R50 A;  1IVS A;  2EIN C;  2ZNJ A;  1FJG O;  5LXT A;  2HEP A;  2EBO A;  2WLI A;  1M1K W;  1E1Q G;  4J7J A;  2WLN A;  1K73 W;  1RPO A;  4R8C A;  1SES A;  2QR4 A;  4XDK A;  2OTL V;  4O2B A;  4FFB B;  3ZS8 C;  3JSL A;  1GK9 A;  4KUM A;  3DC6 A;  1NTK H;  2DOS A;  1I7F A;  4I4T A;  3CCL V;  5EC2 C;  4HYO A;  4I55 A;  5KLV H;  1AR1 B;  1BSM A;  1FAF A;  1XBL A;  1KP2 A;  2OTJ V;  1S5H C;  5B3S C;  2R9A A;  5CA1 A;  3CCV V;  2N05 A;  3FYI B;  1AIL A;  3K59 A;  4DR3 O;  4E2L A;  3IJ4 A;  5GON A;  1YI2 V;  2IU3 A;  5JJN B;  3RFR A;  1H2G A;  4X1K B;  1QR9 A;  1Z2G A;  3H01 A;  5JVD A;  3G4S V;  3HKC A;  1KMI Z;  5FPR A;  2UXX A;  5LMN B;  2LFR A;  2ZE8 A;  4JTD B;  1ROP A;  2LFS A;  4LFC B;  4JI1 O;  3FD9 A;  4J7Z A;  2XOK G;  1SET A;  4UV8 A;  3ZRV A;  3B77 A;  2BTQ B;  3ZHU A;  2F66 C;  4E4E A;  1H38 A;  4UCV A;  1FPO A;  1Q8I A;  1YJW V;  4O4L B;  2LQT A;  3EXA A;  3FB6 C;  2YC0 A;  3VQV A;  4JI4 B;  1MG1 A;  2GTA A;  1S0V A;  3CCJ V;  3OR7 C;  4GX1 A;  4JYA B;  5KX5 A;  3MHS C;  5DN6 G;  5IYZ B;  1WB8 A;  3JSN A;  1NVP B;  1O9G A;  1OCO C;  3HR0 A;  5CN0 A;  5E79 Z;  4UB8 Z;  3ZMZ A;  4WBN B;  4CBC A;  2F43 G;  3ZHV A;  3SYA A;  5KHG A;  4GYC B;  2JS3 A;  5LHI A;  2RNB A;  2QTO A;  2CE4 A;  5LBQ A;  5EC1 C;  2YXY A;  5B66 Z;  1W0J G;  5IYB O;  4JAU A;  5EZY B;  1K92 A;  1GRJ A;  4YJ3 A;  1BHA A;  3T4D A;  3BEH A;  3CXC U;  4PA9 A;  3B2E E;  1GN2 A;  3E89 A;  2B9Z A;  5DED A;  4YXW G;  3TET A;  1FJG B;  1HW7 A;  4HAM A;  1XOU A;  2OCC B;  1Z5W A;  1F4N A;  1XL4 A;  3BA9 A;  1NU1 H;  5IJ9 A;  3HPL C;  1FXK B;  3ZMV A;  3CCM V;  1PNK A;  1WP8 A;  2Q69 A;  1KD1 W;  1I5Y A;  2Y4T A;  1OCC C;  3LNN A;  1Y4M A;  5L3G A;  2BSK A;  2UXC O;  1U96 A;  3JAS A;  3FB5 C;  3UQ8 A;  3GB7 C;  3CB2 A;  4RO2 A;  1YIT V;  5H6Q A;  4AIL C;  2KQX A;  4ZOL B;  2WLK A;  1R73 A;  2IW5 A;  1VF7 A;  1NTM H;  3UO3 A;  1SF9 A;  2RJZ A;  1JCH A;  1KP3 A;  2OCH A;  4J42 A;  3SJC C;  4LF8 B;  4X20 B;  3JYC A;  1G4Y B;  1XUQ A;  2Q4P A;  1NQT A;  2HJF C;  3SDL A;  1RM1 B;  4DR3 B;  3BA8 A;  1UFI A;  2NNU A;  3CCS V;  3SJB C;  2ARH A;  3CCR V;  1EN6 A;  2A3Q A;  1KYO F;  4I5S A;  4JI7 O;  4K35 A;  1AP6 A;  2BTQ A;  4DW0 A;  2L35 A;  4JI1 B;  5JWP A;  5FLX N;  4XDL A;  2Q7E A;  1R1B A;  3ZRS A;  4FMT A;  4O4L A;  5CMU A;  1NH2 D;  4IYI A;  4J9Z B;  2P6J A;  2LW1 A;  1P84 F;  2CGO A;  5EK0 A;  4CH3 A;  2YUA A;  3A8T A;  3JAR A;  3A0H Z;  4Z2W A;  3BHP A;  4DV3 B;  2M7W A;  5LOV A;  2VQE B;  4FPP A;  3H1K H;  1P49 A;  3RWR D;  4H13 B;  4ZKI A;  4RUE A;  2VQF O;  4NVP A;  1HNW O;  2UXD O;  1VQ6 V;  1W2B U;  4TOI A;  2WLL A;  4LR3 A;  5IYC O;  2Y69 C;  4NXM O;  3ZRW A;  4FLZ A;  3P32 A; 
#chains in the Genus database with same CATH homology
 2K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...