2K9PA

Structure of tm1_tm2 in lppg micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
b'GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone alpha factor receptor
publication title Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.920 Mainly Alpha Orthogonal Bundle Helix Hairpins Pheromone alpha factor receptor. 2k9pA00
2K9PA
chains in the Genus database with same CATH superfamily
5KA5A 2QWNB 3ZMSA 3CC4V 4DR2B 2E76B 4I4TB 2CTWA 4X1IA 4GUNA 5B66Z 1FFTB 2ZE7A 4YJ3A 2UUAO 3FB5C 3ICXA 2IU0A 3AG1B 1VQMV 1IURA 3CCSV 2ZDIC 4DXWA 4CBCA 1Y74B 1KUQA 2VWKA 1BCCH 1M9NA 4QJFB 2ZNJA 2DYRB 5IYCO 1NVPB 1HNWB 2LW7A 1PD3A 2XAGA 1WP8A 2CUGA 1XBLA 4B3TO 3ABKC 4YY3O 3TXSA 1H2LA 3TXQA 3K0GA 1P49A 5BY1A 1AI4A 1VF5B 3K5LA 5KHGA 4JI4O 1EBOA 4P2ZA 1KECA 2GTSA 4JI5B 3E8BA 4OPAA 2VQFB 2GHYA 4JYYA 4P9PA 3JD3A 1AJQA 3U11A 2JGDA 2LFRA 4WFFA 5DECA 1PL4A 4DV0O 3OM3B 5IJ0B 4WFGA 2CH7B 1K92A 5B1AB 1B04A 5KHIA 2E5LB 4QNHB 3SJQC 3THOA 4JI7B 5KUKA 4O4IB 1TUBA 3AG3B 2PYJA 2OT5A 3M7MX 4CS4A 4FZ1A 3RBZA 4WFEA 4TUYA 4EB6A 2GBOA 4L8JA 3CXCU 4B08A 1JPXA 5LMNO 2Y0IA 3ZN0A 4I50B 1XUQA 4DR6B 5CBFA 2OTLV 2XHBA 1ZTEA 3C3SA 3N2GA 1XL6A 3G71V 2NN4A 4KHPB 4LFBO 2CK3G 1KC8W 3CPWU 1H8EG 3FD9A 4X65B 1HR0B 4XDKA 5KX5A 2P90A 1AROP 4K0KB 5FPRA 5F2VO 5FPOA 1ZL8A 1QR8A 1XHXA 2QJ1A 1HNZB 4W4KA 3X2QB 3IAYA 5CBHA 4CC5A 5GW7A 5K1PA 2N04A 3CS5A 4X1KB 2F4VO 3ZHSA 2QKSA 3LNNA 3HKDB 2GDSA 3G80A 1I7FA 4O2BB 2WLIA 3OUFA 1YI2V 2ETNA 1OCZB 5A9GA 2ITDC 5L3CA 1FJGO 1SA0A 2DMXA 2N05A 1ZWIC 4X66O 1JJOA 1N33O 4YHHB 4NKGB 1GM8A 1SF9A 3ZIAG 2QWQB 3SYOA 3F5TA 2L35A 2FB5A 3ABTA 5L3BA 3EXAA 4FMTA 2F23A 3CHXA 1W0JG 1V54B 1N32O 1IZ3A 3E22A 4J7JA 4AQYO 1M57C 1M90W 2OIGA 4CS3A 2ZIMA 2B5UA 1PP9H 1AILA 2B9ZA 4L87A 1W0KG 3ABLC 5FNVA 4JI6B 5LXTA 2OCHA 4X62O 1YIJV 4EFBA 3ML0A 5JH7A 3AEIA 1O9HA 2ZKOA 4WCEV 4DV6O 1KP2A 2QE7G 1MMMA 2LO1A 1NU1H 3T4DA 3BAAA 1K34A 3ZRWB 4JI2O 4DV1B 2IBZH 1Q3EA 5CB4B 4O4HB 1TAEA 5LMUB 4ZHQB 1BMFG 3QO5A 2YSUB 5KHJA 1W2BU 2F1MA 1YSCA 2RCVA 4I0XA 2E3CA 2A9HA 1R3LC 2M6YA 2FL4A 3RVZA 2DYSC 5B3SB 2DE0X 2ZDIA 3BPZA 1H2MA 1NVPD 3L9DA 3CCJV 1ZUQA 4AI8A 4IIJB 1RM1B 2YUAA 1EZVH 2R9AA 4DR4B 3ZCCA 3LDDA 2N74A 3FFQA 2QR4A 2R70A 2UXXA 1NI8A 5H9CA 1HWYA 3CCUV 3RYCB 1PNKA 4LF9O 4DRXA 4QGPA 5LOVA 4X8AA 4PDRA 1OCCC 2QKCA 3W7WA 2NNUA 3OR6C 5IJ9B 2IH3C 4CH4A 2M7WA 3CD6V 1AR4A 3ABMC 3SJAC 3OTOO 1NH2D 3ZJZA 3CRCA 2P67A 2Q7GA 3D3IA 5JWPA 1HDJA 1XMOB 5IY5C 4IL6Z 2UXDB 3ASNB 3APOA 1H38A 2KSDA 2JEUA 3BABA 5EC1C 2PF4E 1TUEB 5HFLA 5EZYB 2YEVB 3T1HO 4RQFA 1GRJA 1KQSU 2EX3A 1IBKO 3GWKC 4PD4F 5LGTA 1NT2B 2BOCC 1WB8A 3ZHRA 2NR5A 2Y69B 3WG7B 1KD1W 5BMVA 3STZC 4UCVA 4FLYA 4TSFG 4UCOA 3FAVB 2IJJA 1Q82W 2IU3A 5C8YB 4K8ZA 2LP7A 2QM8A 2KG7A 1BZKA 4BR6A 4FM1A 1G8MA 3D36C 1V55C 1QLNA 5IE9A 4MW8A 4IHJA 2YXHA 3A8TA 2BSKA 5B1BC 3N2KA 1GN3A 1B06A 4QPKA 2C2AA 4ZI7B 2UXCO 4GYCB 4DV7O 2AZ0A 3VBBA 4G28B 2UXNA 4MVRA 2F95B 1F7YA 1JVMA 5EIBD 3OEHG 4J10A 1VQ7V 1XHZA 2YIBA 2LGWA 4G2KA 1BQZA 3W7UA 2Q73A 4H44B 4FIPC 1MZEA 1S5HC 1MSWD 2E74B 5IYBO 4JZGA 1TA8A 4TV9B 4O4JB 4QE7A 1K4DC 3JARB 2RN9A 3I5DA 5KUMA 2JK5C 1P7GA 4B3SB 5C93A 3K03A 4JZ2A 1S72V 4DR5B 4DR7O 4X1IB 3OAAG 1ZSPA 4JI8O 2V7QG 4R50A 4LFAO 4OX9O 3VQVA 2YDEA 2PYLA 3CRQA 1K5SA 3ABUA 4DO2A 5B1NA 3CXHF 3MAQA 5K1XA 1QU7A 1XMQB 4JI1B 3CCEV 4BAYA 4X20A 1DK1A 4HAMA 1FXKB 3W7XA 4MW3A 2XT9A 3SYAA 4MVZA 3G6BA 1L0LH 3RFRA 3CCQV 5EK0A 2ZQMA 3QVNA 2GV9A 3ETGA 5CMUA 3E8FA 3A0HZ 2WLMA 1AI7A 3ASOB 1NTKH 4FLTA 4NXMO 1UJWB 2DJVA 5E79Z 2KKWA 5BR8O 2F4VB 1Q81W 1Q6HA 1AB3A 1JFFB 1OCOC 2EINB 1N34B 1J5EB 3WU2Z 4U7OA 2JGDB 4UXNA 4BW5A 1EFRG 5AG2A 4TOIA 2ZE8A 2HEPA 3O65A 3OMNB 4GKKO 4K3AA 1JX9A 4RO2A 2RMKB 2XAFA 3ETDA 1IVSA 1GO3F 1VQ9V 5LA6A 4ABMA 4ZBMA 3P3PA 1TUBB 2AXTZ 2EILC 4TUYB 1N32B 3MHHC 5D5PA 4UCUA 4F6RA 1K9MW 4TQFA 1VQ8V 3BA8A 5FL7G 2HHHB 2Q68A 3LDCA 1JMKC 4JAAA 4X62B 4EEQA 4WBNA 5KX5B 1ZAUA 2Y0PA 4WFBV 3ZEDA 4JYCA 2LW1A 4FLXA 3IGAC 1VQNV 1F23A 3RYIA 4FFBB 3K9SA 3SPCA 3H1KH 1MZFA 4CZZA 2Y4UA 1JA8A 3J81N 4DUZB 1QVFU 4MVMA 5H5NA 1QQCA 4K35A 4JV5O 3L74H 1YHQV 3LSUA 2WLIB 4DR3O 1K4CC 2ZNIA 2MW2B 1K5QA 4BIUA 1VF7A 1NKDA 4B3RB 2AGAA 1PL0A 3T1YB 2YI9A 4O2AB 5IWAO 5LP6B 4X64O 2B1IA 1S5JA 4UB6Z 2EIJC 1VQKV 5J2UA 3CJHB 4WFHA 2HLDG 1K7DA 5GTIZ 1VQPV 3K79A 3F7YC 2CGOA 1HNXB 3ETQA 2PI5A 4LF4O 4LF8B 4DV2B 4HNAA 1L8DA 2W6JG 4WF9V 3ZMVA 4LF6O 1Q6IA 2KB1A 4PV1B 3ZX6A 3WB0A 5IYZB 1G6UA 4LNUB 1I08A 1Y66A 1N8RW 4GX2A 5EBWC 1HW7A 1U96A 3ZRSA 1PKXA 2QTSA 5JQGB 3OTOB 2ZD9A 1IBMB 4I9WA 4TV8A 5EBLC 3FYEB 3T1CA 2EIMC 3M8AA 1DF5A 4I55A 4NVPA 5CA1A 5DN6G 1NR1A 3AG2B 1S3JA 1XNRB 4I0XB 1Q6UA 3SDLA 1KBHA 4GLXA 5JVDA 5IDJA 3CCMV 2JRIA 1WN7A 1OCRB 4FLVA 2FYUH 2DQ3A 1JOYA 4XBFA 2WLNA 4JASA 2E75B 2Q5ZA 4N23A 3AG1C 3JATA 4N21A 2Q4PA 3ABKB 1Y76A 4DRXB 2AW9A 3QNEA 2WLLA 3AG7A 4DV3B 4YIOA 3AK3A 3JAWA 5L3FA 3J7AU 4LBEC 4ASUG 3CB2A 3HKEA 1UFIA 3SJCC 4NTXA 2PGGA 5HFMA 1KP3A 1WB7A 1NH2B 4LC1A 4JYAO 2F43G 1FD9A 1Q43A 5CA0B 2K1EA 4LWSA 4JI3O 3RVYA 4RQEA 5H6RA 1VQLV 5LL6Y 3B8NA 5ITZA 3AG3C 2JDIG 3E89A 1VIBA 2BTQA 3UM7A 1SC5B 3CCVV 4Q20A 1GN2A 1F4NA 2GUZA 5IYDO 3ZHTA 3VQYA 5BMVB 2WA3A 1SS3A 4FLUA 2QDOA 2QKAA 2ZM6O 2OTJV 3JYCA 1PM9A 1TVKA 2KG7B 3TGUH 4LF5O 3JD4A 3KZIZ 3O9OA 3OR7C 2UU9B 1WA8A 1ZLZA 1AI5A 2BSKB 3A0BZ 4MT8A 4DUYO 3CX5F 3N2KB 1OZ0A 4NXNB 5IT9N 3CWBH 4UVCA 4O4LA 5KAFZ 1AP6A 3JSLA 2P06A 3CSXA 1I94O 2DOSA 2XAQA 1GH6A 1IBLO 2WSSG 1WNSA 4JGSA 4B3MO 3BCCH 3CE2A 2CTQA 3H1IH 4DYLA 3JAKA 2JS5A 1X4TA 1OCZC 4P30A 1MSDA 3STLC 3CP1A 3HPLC 3KG2A 4FZ0A 4I9QA 1VARA 2JJ1G 3B2EE 3JALB 3JCZA 3TETA 2EULA 3MD0A 1I0HA 3BHPA 3BEHA 4PJ0Z 4ZKIA 5KLVH 1V54C 3W7SA 3JASB 2FTKA 1RSOA 4GKKB 2A0LA 3L72H 4UFZA 5GTHZ 5EIBC 3M99B 4QE9A 4BIOA 2RJZA 2QM7A 3E8HA 3EFFK 2VWJA 4DK0A 3VQWA 2HFEC 1H8HG 1QLEB 3L71H 3LSSA 2QA4V 2YS8A 1M56C 1AR1B 1P4RA 3RYHB 1G4YB 1Z2GA 3N27A 1YJNV 4RUFA 4EKWA 2EZOA 4TWKA 3W7TA 4UUJC 1H2NA 3TJTA 1D5NA 2YC0A 4Q6GA 1IDSA 2Q67A 1R3KC 5KA6A 5EBMC 3LDEA 1SZXA 1W59A 3K06A 2WAMA 3UT5A 4UCRA 2Z0AA 1VF6C 1YZBA 3RYFA 5CBGA 5B3SC 1SZTA 2UXBO 4OGQB 4YXWG 4I7ZB 1YJWV 4EFEA 4MTOA 2Q0OC 3G4SV 4UVAA 2MK3A 1WJZA 3F7VC 1RM1C 1FKAO 3ZHVA 1OCCB 1N0JA 1YTFB 3QO8A 4JV5B 2UUBO 4PA9A 3K5OA 3C90A 4NYKA 2D3OW 3E2EA 2P5OA 2ZR2A 2OWOA 4QIWF 2P7TC 4LF7B 2BOBC 3PJSK 5LA6B 4DR1B 2H8PC 3AG4B 3UKMA 4ZOLB 3Q4HA 3LNMB 5H6QA 4JI0O 4RAIA 1BE3H 2Q69A 4MVUA 1H2SB 1K73W 3P32A 4MTGA 2OCCB 3SYQA 5KMGA 1FPOA 2WPDG 5IJ0A 4MVQA 2CH7A 4PDLA 5DEDA 4WBNB 2ATKC 1Y4MA 1RP3B 4H37A 3RYIB 1KMIZ 2A79B 2JEXA 2F66C 4FLWA 1R6NA 2FKXA 2F93B 2P6JA 1E1RG 2JS3A 1T5EA 1D2DA 1NTMH 4NR1A 2UUAB 3IFXA 2PUSA 2Q8VA 1HNWO 2YIAA 3WG7C 2RQ6A 1E79G 3SPIA 4G27B 3RGBA 4JTDB 2YIBD 2H3OA 1SQQH 3PN1A 2DWDC 2ZT9B 4MS2A 5J2UB 4X1KA 4GX0A 2V4DA 2Q7HA 4MTXA 4JI5O 1VMGA 2IJIA 4OXSA 4QPJA 2VQFO 1SQPH 5L3GA 4B3TB 2LFSA 4YY3B 3CMAV 4HNAB 3A2FA 5KHHA 1N36O 4C7UA 2E5LO 4JI7O 3E83A 2Q6AA 1EZJA 1A32A 4JI4B 3UQ8A 2ZXWB 2HJDA 2BCCH 2FMLA 2P4VA 1GKFA 4MSWC 4LH7A 5BZBA 3CMEV 3WB1A 4DV0B 4W4LA 4TV8B 4PA7A 2QM4A 4DR6O 1IXBA 2R9RB 5CA1B 1Q90D 2XUMA 4A5UB 2YIDA 4KHPO 4Z2WA 1BQ0A 3U0ZA 3ZMTA 2JVDA 4YJ3B 4PELA 1AR5A 4GT1A 4X65O 1HR0O 2VQEO 5LMNB 1SQBH 3MDSA 3B40A 4J7ZA 5JVDB 3K04A 4K0KO 2KQXA 1HNZO 4F4LA 4LFBB 3CCLV 3NXSA 1RFYA 1JCHA 3ZMUA 1URFA 2K9PA 1BHAA 2P4KA 2G38A 4PA4A 1B6QA 1Y76B 4R6ZA 1VF6A 3JD2A 1YTFD 2D2CB 1SKVA 2ADQB 3G6EV 5JJEB 2IM9A 2ZM6B 2WLLB 1FXKC 3H01A 4IIJA 1YJ9V 2CGNA 4H0LB 4IYIA 4CH6A 2Y4TA 2WLKA 3AK1A 1FJGB 2Q7EA 1FFXA 1WLEA 4X66B 3ASOC 2QGNA 3BA9A 1N33B 3UO3A 1OHHG 1ORQC 1PNMA 4D7TA 2X0LA 4JI6O 2EINC 4DW0A 4D7SA 4EB6B 1QCEA 4AQYB 2ITCC 3OMIB 4XDLA 2O57A 1AP5A 3N2GB 1WP7A 3BY6A 3K9AA 4Z1MG 4LWSB 3K08A 4DV1O 2WA4A 3OD4A 5J9PC 1VP7A 1UPGA 3CRMA 1AI6A 2BTQB 1R6TA 3SGIA 1JJ2U 3AK2A 4DV6B 2YI8A 3D3QA 1GM7A 1ZL8B 2OYQA 1U97A 4K8XA 4JI2B 2ZINA 4HZ3A 2YEVA 1WPBA 5J2TA 1ROPA 3HKBA 1TVKB 3HR0A 4CH5A 3K58A 4DR4O 1NTZH 2EZPA 2IJHA 4H13B 4BWAA 1Q7YW 1SA0B 4LH6A 3D36A 3QTCA 4O4LB 3P3NA 4PI2A 5LBQA 1S76D 1TGOA 1X59A 5LGUA 4LFCO 1K97A 2XTAA 4NB5A 2XOKG 3CEIA 4UCSA 4GZRB 3DSQA 4FM2A 3FAVA 2EIJB 4BW9A 5C8YA 1LUVA 1R3JC 5BXZA 3TK1A 3E22B 2PZSA 1IX9A 1XNQO 5LYJA 4AHCA 2EJ7A 4LF9B 2A06H 1R6KA 3JAMN 5LP6C 3UCSC 5KHKA 5FNVB 5LXTB 4KP4A 1I5XA 5JH7B 1NS1A 1VQOV 2ZCEA 4WFAV 1XMOO 1F51A 2R72A 3APQA 2EIKC 2UXDO 2CAZC 2X6CA 5L3DA 1KU9A 1RSOB 3JSNA 2HVKC 2CTPA 3J80N 2EIMB 2LJ2A 3JCUZ 2HKOA 3SPHA 1YITV 3LUTB 4CC6A 1FXVA 3CCRV 1XI1A 4RUEA 3OMAB 4MVOA 1YEWA 5CN0A 2Z3YA 3OGIB 3FB8C 1V9PA 1Z5WA 5LHIA 1CPYA 2JJ2G 3CC7V 4KUMA 1ENVA 3T1HB 4J42A 4GKJO 3OUSA 3E8GA 3AG2C 1IBKB 2QEXV 3SR2C 3UT5B 2PTMA 1XREA 3BFRA 3RYFB 1O9GA 1DGSA 4I5SA 5EYPA 2OIEA 3T2MA 3RN4A 2WLHA 3GWOA 3OT7A 1OCRC 4X1YA 1EN6A 5GONA 5LOVB 2QSAA 4ZIBA 1S5LZ 3R66A 1M1KW 1XL4A 3WB2A 1F4MA 2DYRC 1FXKA 5JCOC 2QTOA 2AHZA 1N4CA 4DV5O 2ADPA 1AJPA 1SQVH 2EJRA 3H1HH 3UO2A 4DW1A 3B09A 3ZN1A 5LHGA 5JJJB 3GB7C 2A3QA 1KYOF 1S77D 2UXCB 2WWWA 4DV7B 1GK9A 3KCYA 3Q4HB 1OJHA 4PA6A 1JFFA 4B7KA 5LGNA 1VQ6V 5H2FZ 1MNGA 5KMGB 4B3SO 2BTOA 1K3EA 1N36B 5B1AC 1BL8A 3OEEG 4DR5O 3E35A 3VOUA 2LGQA 4U3JA 1MA1A 1NR7A 4J7KA 4FFKA 3ZBHA 3ZRXA 4HYOA 4BIZA 1R3IC 1FYJA 4JYBA 4X9QA 1EN4A 3P30A 2ODMA 4DR7B 1XMQO 4JI1O 1YCIA 4E4EA 3T4ZA 1B3QA 4JI8B 2L6LA 4LFAB 4OX9B 4F6EA 2VQEB 2CTRA 4IGGA 4IHJB 2ZR3A 2UUCO 4FFBA 3EVKA 3X2QC 1CEZA 4DV4O 1VEWA 2CE4A 1PNLA 2ZE6A 5B5EZ 1S0VA 3DGEA 4GX1A 2Z5UA 4E2LA 1N34O 1J5EO 3GVMA 1M57B 2IJKA 4NXMB 5E1AC 2YXYA 4H33A 3DXRA 4O2AA 5BR8B 5DM6V 1YVWA 4YJ2A 5LP6A 3ABLB 1CXZB 3H1JH 1LR1A 1LUWA 3CJHA 1R1BA 3HKCA 2VS0A 2ZIOA 3FX7A 5B1OA 2HHHO 4UCTA 4X89A 1GN4A 3G67A 3ZMZA 5FLXN 5IYZA 4LNUA 4X88A 1M56B 2DQ0A 5TISZ 5JQGA 1MABG 2DYSB 4CS2A 3R65A 4X20B 4UB8Z 4I4TA 2GTAA 1VQ5V 4DUZO 3KCXA 4TQDA 1QLEC 1SQFA 2V1DA 2LQTA 3WFVA 4PA3A 1GMGA 2QWPB 4B3RO 2HP8A 3T1YO 1Y74A 3ZRVA 1H2GA 1KKDA 4KXRA 4MTFA 3QG5A 1GN6A 4DR3B 5JCOA 4U7NA 2VRZA 3OGCC 1Q8IA 2RDCA 3ABMB 5KAIZ 3DC6A 1FFXB 3S3XA 1US6A 3OE7G 1HNXO 1GAXA 4NTWA 1JQ0A 4LFCB 2DWEC 4LF8O 4ICGA 1I5YA 5IWAB 1K33A 4DV2O 4X64B 4PDVA 3E86A 4XDJA 2XAHA 2QWOB 1MOFA 1XEQA 5IY5B 2XASA 1G1XB 1H2KA 1N0NA 3NR7A 3K5MA 4UVBA 4JAUA 3H1LH 4F6RB 1XILA 4LF4B 4KFMA 1XNQB 1IBMO 1M93A 3K59A 1J95A 1GTOA 3VQXA 4DR2O 4LF6B 4UV9A 3QO7A 3AG4C 2ARHA 4O4IA 1XNRO 2X6BA 2HVJC 2GSMB 3ASNC 2HJFC 3OTFA 2DN9A 1WAZA 4I50A 2OCCC 2AHYA 4D6TH 4LR3A 1LNQA 1QHTA 5J2TB 5CA0A 3HKBB 4U3FH 1COWG 4AILC 2BE3A 1IXMA 1EM1A 2HG5C 1RPRA 3B4SA 1NZ6A 3DC5A 5D5QA 4HBNA 3B77A 1Z5VA 1V55B 2YXLA 2Y69C 4J11A 4GKJB 1FS0G 4FPPA 4J9YB 1RPOA 5B1BB 3ZS8C 1Y67A 1BSMA 1GM9A 4JTCB 4DV3O 4PHZA 1QNMA 3HKDA 4O2BA 4JAVA 5LYJB 3SPJA 3FB7C 3H9VA 5JJNB 3TCUA 4IYHA 1YDXA 3RT3C 4P9OA 3JD1A 4DV5B 4LP8A 4FM0A 3HB3B 4PDMA 3IC7A 3SYPA 2HR3A 2Q0AA 1PPJH 3SJBC 3MHSC 4FVMA 4FJCC 3KKYA 3LSQA 4I55B 1L1FA 1HP8A 3JALA 3K5NA 4TT3G 3L73H 3FB6C 3ETEA 4JYAB 1VQ4V 2ZXWC 4MVSA 4FLZA 4GX5A 4Z1VA 3IJ4A 3SPGA 3JASA 1WPXA 3CRRA 1QVGU 5CA3A 4PI0A 4JI3B 2Y48A 3C3TA 3CYOA 3ZRWA 4GCZA 1SERA 1Q5OA 1Q86W 3OFNG 5CB4A 4R7CA 4O4HA 3ZHQA 1DF4A 5EC2C 4ZHQA 3JATB 2UU9O 5EYPB 3RYHA 4X1YB 4J9ZB 5GONB 4NXNO 2X6AA 1CP9A 2JGUA 3RWRD 4YHHO 1SQGA 1M5IA 1SESA 3DTUB 1FXHA 4LF5B 2W6IG 5LHHA 1BT8A 3JAWB 1OCOB 4LCUC 3HKEB 4DUYB 1KKCA 3U10A 2UUCB 3CC2V 2WLJA 1P84F 3A0RA 4DV4B 1FAFA 2XNDG 4YIPA 3BVOA 4R8CA 3RYCA 3FYIB 1I94B 2PY5A 1IBLB 1OV9A 3K0DA 4B3MB 2DW4A 2EILB 2ZE5A 3K3WA 1MG1A 4JPRA 5IJ9A 3JD0A 4FK5C 1NJIW 3S3WA 3BRCA 3I55V 1DLBA 2XAJA 1Y6XA 2PI4A 1P7BA 4NTYA 2CDYA 4DK1A 2AZ2A 1K8AW 4RWUA 1AVMA 4OPHA 4U3JB 1PV0A 5ITZB 5LMUO 4B7EA 2H94A 4ZOLA 4J41A 2GUZB 3F5WC 3B8MA 1DTOA 1XOUA 3IC9A 1NQTA 4J80A 3QF7A 1SQXH 2RNBA 2NLJC 2A7WA 5EZYA 1YF2A 4JF3A 1JR9A 2QWRB 2IH1C 3D8CA 1KB9F 1M4UA 2ILMA 2JIZG 1WA8B 2W0FC 2YICA 1AJNA 4KL1A 2R9IA 1XQ8A 4IT5A 1D5AA 3L70H 3I56V 2Q9LA 1BGYH 4CH3A 3JAKB 2B1GA 1EN5A 3FKSG 2UXBB 1L0NH 3DXRB 3CRAA 4LF7O 1ZX3A 4YJ2B 4DR1O 3SYCA 3ZHUA 4ZI7A 2UUBB 2X7RB 1BS3A 5L3EA 2P22C 4UV8A 1BHBA 2EIKB 1THZA 4JTAB 3HKCB 5A2QN 1SETA 3RW0A 1QBZA 1E1QG 2EBOA 2IW5A 3L75H 3EHBB 1QR9A 1R73A 2W0XA 3K57A 3OW2U 4TV9A 4O4JA 4JI0B 1XDCA 1SRYA 1NBMG 3JARA 1YXBA
chains in the Genus database with same CATH topology
2K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9P A; 
#chains in the Genus database with same CATH topology
 5KA5 A;  2QWN B;  3ZMS A;  3CC4 V;  4DR2 B;  2E76 B;  4I4T B;  2CTW A;  4X1I A;  4GUN A;  5B66 Z;  1FFT B;  2ZE7 A;  4YJ3 A;  2UUA O;  3FB5 C;  3ICX A;  2IU0 A;  3AG1 B;  1VQM V;  1IUR A;  3CCS V;  2ZDI C;  4DXW A;  4CBC A;  1Y74 B;  1KUQ A;  2VWK A;  1BCC H;  1M9N A;  4QJF B;  2ZNJ A;  2DYR B;  5IYC O;  1NVP B;  1HNW B;  2LW7 A;  1PD3 A;  2XAG A;  1WP8 A;  2CUG A;  1XBL A;  4B3T O;  3ABK C;  4YY3 O;  3TXS A;  1H2L A;  3TXQ A;  3K0G A;  1P49 A;  5BY1 A;  1AI4 A;  1VF5 B;  3K5L A;  5KHG A;  4JI4 O;  1EBO A;  4P2Z A;  1KEC A;  2GTS A;  4JI5 B;  3E8B A;  4OPA A;  2VQF B;  2GHY A;  4JYY A;  4P9P A;  3JD3 A;  1AJQ A;  3U11 A;  2JGD A;  2LFR A;  4WFF A;  5DEC A;  1PL4 A;  4DV0 O;  3OM3 B;  5IJ0 B;  4WFG A;  2CH7 B;  1K92 A;  5B1A B;  1B04 A;  5KHI A;  2E5L B;  4QNH B;  3SJQ C;  3THO A;  4JI7 B;  5KUK A;  4O4I B;  1TUB A;  3AG3 B;  2PYJ A;  2OT5 A;  3M7M X;  4CS4 A;  4FZ1 A;  3RBZ A;  4WFE A;  4TUY A;  4EB6 A;  2GBO A;  4L8J A;  3CXC U;  4B08 A;  1JPX A;  5LMN O;  2Y0I A;  3ZN0 A;  4I50 B;  1XUQ A;  4DR6 B;  5CBF A;  2OTL V;  2XHB A;  1ZTE A;  3C3S A;  3N2G A;  1XL6 A;  3G71 V;  2NN4 A;  4KHP B;  4LFB O;  2CK3 G;  1KC8 W;  3CPW U;  1H8E G;  3FD9 A;  4X65 B;  1HR0 B;  4XDK A;  5KX5 A;  2P90 A;  1ARO P;  4K0K B;  5FPR A;  5F2V O;  5FPO A;  1ZL8 A;  1QR8 A;  1XHX A;  2QJ1 A;  1HNZ B;  4W4K A;  3X2Q B;  3IAY A;  5CBH A;  4CC5 A;  5GW7 A;  5K1P A;  2N04 A;  3CS5 A;  4X1K B;  2F4V O;  3ZHS A;  2QKS A;  3LNN A;  3HKD B;  2GDS A;  3G80 A;  1I7F A;  4O2B B;  2WLI A;  3OUF A;  1YI2 V;  2ETN A;  1OCZ B;  5A9G A;  2ITD C;  5L3C A;  1FJG O;  1SA0 A;  2DMX A;  2N05 A;  1ZWI C;  4X66 O;  1JJO A;  1N33 O;  4YHH B;  4NKG B;  1GM8 A;  1SF9 A;  3ZIA G;  2QWQ B;  3SYO A;  3F5T A;  2L35 A;  2FB5 A;  3ABT A;  5L3B A;  3EXA A;  4FMT A;  2F23 A;  3CHX A;  1W0J G;  1V54 B;  1N32 O;  1IZ3 A;  3E22 A;  4J7J A;  4AQY O;  1M57 C;  1M90 W;  2OIG A;  4CS3 A;  2ZIM A;  2B5U A;  1PP9 H;  1AIL A;  2B9Z A;  4L87 A;  1W0K G;  3ABL C;  5FNV A;  4JI6 B;  5LXT A;  2OCH A;  4X62 O;  1YIJ V;  4EFB A;  3ML0 A;  5JH7 A;  3AEI A;  1O9H A;  2ZKO A;  4WCE V;  4DV6 O;  1KP2 A;  2QE7 G;  1MMM A;  2LO1 A;  1NU1 H;  3T4D A;  3BAA A;  1K34 A;  3ZRW B;  4JI2 O;  4DV1 B;  2IBZ H;  1Q3E A;  5CB4 B;  4O4H B;  1TAE A;  5LMU B;  4ZHQ B;  1BMF G;  3QO5 A;  2YSU B;  5KHJ A;  1W2B U;  2F1M A;  1YSC A;  2RCV A;  4I0X A;  2E3C A;  2A9H A;  1R3L C;  2M6Y A;  2FL4 A;  3RVZ A;  2DYS C;  5B3S B;  2DE0 X;  2ZDI A;  3BPZ A;  1H2M A;  1NVP D;  3L9D A;  3CCJ V;  1ZUQ A;  4AI8 A;  4IIJ B;  1RM1 B;  2YUA A;  1EZV H;  2R9A A;  4DR4 B;  3ZCC A;  3LDD A;  2N74 A;  3FFQ A;  2QR4 A;  2R70 A;  2UXX A;  1NI8 A;  5H9C A;  1HWY A;  3CCU V;  3RYC B;  1PNK A;  4LF9 O;  4DRX A;  4QGP A;  5LOV A;  4X8A A;  4PDR A;  1OCC C;  2QKC A;  3W7W A;  2NNU A;  3OR6 C;  5IJ9 B;  2IH3 C;  4CH4 A;  2M7W A;  3CD6 V;  1AR4 A;  3ABM C;  3SJA C;  3OTO O;  1NH2 D;  3ZJZ A;  3CRC A;  2P67 A;  2Q7G A;  3D3I A;  5JWP A;  1HDJ A;  1XMO B;  5IY5 C;  4IL6 Z;  2UXD B;  3ASN B;  3APO A;  1H38 A;  2KSD A;  2JEU A;  3BAB A;  5EC1 C;  2PF4 E;  1TUE B;  5HFL A;  5EZY B;  2YEV B;  3T1H O;  4RQF A;  1GRJ A;  1KQS U;  2EX3 A;  1IBK O;  3GWK C;  4PD4 F;  5LGT A;  1NT2 B;  2BOC C;  1WB8 A;  3ZHR A;  2NR5 A;  2Y69 B;  3WG7 B;  1KD1 W;  5BMV A;  3STZ C;  4UCV A;  4FLY A;  4TSF G;  4UCO A;  3FAV B;  2IJJ A;  1Q82 W;  2IU3 A;  5C8Y B;  4K8Z A;  2LP7 A;  2QM8 A;  2KG7 A;  1BZK A;  4BR6 A;  4FM1 A;  1G8M A;  3D36 C;  1V55 C;  1QLN A;  5IE9 A;  4MW8 A;  4IHJ A;  2YXH A;  3A8T A;  2BSK A;  5B1B C;  3N2K A;  1GN3 A;  1B06 A;  4QPK A;  2C2A A;  4ZI7 B;  2UXC O;  4GYC B;  4DV7 O;  2AZ0 A;  3VBB A;  4G28 B;  2UXN A;  4MVR A;  2F95 B;  1F7Y A;  1JVM A;  5EIB D;  3OEH G;  4J10 A;  1VQ7 V;  1XHZ A;  2YIB A;  2LGW A;  4G2K A;  1BQZ A;  3W7U A;  2Q73 A;  4H44 B;  4FIP C;  1MZE A;  1S5H C;  1MSW D;  2E74 B;  5IYB O;  4JZG A;  1TA8 A;  4TV9 B;  4O4J B;  4QE7 A;  1K4D C;  3JAR B;  2RN9 A;  3I5D A;  5KUM A;  2JK5 C;  1P7G A;  4B3S B;  5C93 A;  3K03 A;  4JZ2 A;  1S72 V;  4DR5 B;  4DR7 O;  4X1I B;  3OAA G;  1ZSP A;  4JI8 O;  2V7Q G;  4R50 A;  4LFA O;  4OX9 O;  3VQV A;  2YDE A;  2PYL A;  3CRQ A;  1K5S A;  3ABU A;  4DO2 A;  5B1N A;  3CXH F;  3MAQ A;  5K1X A;  1QU7 A;  1XMQ B;  4JI1 B;  3CCE V;  4BAY A;  4X20 A;  1DK1 A;  4HAM A;  1FXK B;  3W7X A;  4MW3 A;  2XT9 A;  3SYA A;  4MVZ A;  3G6B A;  1L0L H;  3RFR A;  3CCQ V;  5EK0 A;  2ZQM A;  3QVN A;  2GV9 A;  3ETG A;  5CMU A;  3E8F A;  3A0H Z;  2WLM A;  1AI7 A;  3ASO B;  1NTK H;  4FLT A;  4NXM O;  1UJW B;  2DJV A;  5E79 Z;  2KKW A;  5BR8 O;  2F4V B;  1Q81 W;  1Q6H A;  1AB3 A;  1JFF B;  1OCO C;  2EIN B;  1N34 B;  1J5E B;  3WU2 Z;  4U7O A;  2JGD B;  4UXN A;  4BW5 A;  1EFR G;  5AG2 A;  4TOI A;  2ZE8 A;  2HEP A;  3O65 A;  3OMN B;  4GKK O;  4K3A A;  1JX9 A;  4RO2 A;  2RMK B;  2XAF A;  3ETD A;  1IVS A;  1GO3 F;  1VQ9 V;  5LA6 A;  4ABM A;  4ZBM A;  3P3P A;  1TUB B;  2AXT Z;  2EIL C;  4TUY B;  1N32 B;  3MHH C;  5D5P A;  4UCU A;  4F6R A;  1K9M W;  4TQF A;  1VQ8 V;  3BA8 A;  5FL7 G;  2HHH B;  2Q68 A;  3LDC A;  1JMK C;  4JAA A;  4X62 B;  4EEQ A;  4WBN A;  5KX5 B;  1ZAU A;  2Y0P A;  4WFB V;  3ZED A;  4JYC A;  2LW1 A;  4FLX A;  3IGA C;  1VQN V;  1F23 A;  3RYI A;  4FFB B;  3K9S A;  3SPC A;  3H1K H;  1MZF A;  4CZZ A;  2Y4U A;  1JA8 A;  3J81 N;  4DUZ B;  1QVF U;  4MVM A;  5H5N A;  1QQC A;  4K35 A;  4JV5 O;  3L74 H;  1YHQ V;  3LSU A;  2WLI B;  4DR3 O;  1K4C C;  2ZNI A;  2MW2 B;  1K5Q A;  4BIU A;  1VF7 A;  1NKD A;  4B3R B;  2AGA A;  1PL0 A;  3T1Y B;  2YI9 A;  4O2A B;  5IWA O;  5LP6 B;  4X64 O;  2B1I A;  1S5J A;  4UB6 Z;  2EIJ C;  1VQK V;  5J2U A;  3CJH B;  4WFH A;  2HLD G;  1K7D A;  5GTI Z;  1VQP V;  3K79 A;  3F7Y C;  2CGO A;  1HNX B;  3ETQ A;  2PI5 A;  4LF4 O;  4LF8 B;  4DV2 B;  4HNA A;  1L8D A;  2W6J G;  4WF9 V;  3ZMV A;  4LF6 O;  1Q6I A;  2KB1 A;  4PV1 B;  3ZX6 A;  3WB0 A;  5IYZ B;  1G6U A;  4LNU B;  1I08 A;  1Y66 A;  1N8R W;  4GX2 A;  5EBW C;  1HW7 A;  1U96 A;  3ZRS A;  1PKX A;  2QTS A;  5JQG B;  3OTO B;  2ZD9 A;  1IBM B;  4I9W A;  4TV8 A;  5EBL C;  3FYE B;  3T1C A;  2EIM C;  3M8A A;  1DF5 A;  4I55 A;  4NVP A;  5CA1 A;  5DN6 G;  1NR1 A;  3AG2 B;  1S3J A;  1XNR B;  4I0X B;  1Q6U A;  3SDL A;  1KBH A;  4GLX A;  5JVD A;  5IDJ A;  3CCM V;  2JRI A;  1WN7 A;  1OCR B;  4FLV A;  2FYU H;  2DQ3 A;  1JOY A;  4XBF A;  2WLN A;  4JAS A;  2E75 B;  2Q5Z A;  4N23 A;  3AG1 C;  3JAT A;  4N21 A;  2Q4P A;  3ABK B;  1Y76 A;  4DRX B;  2AW9 A;  3QNE A;  2WLL A;  3AG7 A;  4DV3 B;  4YIO A;  3AK3 A;  3JAW A;  5L3F A;  3J7A U;  4LBE C;  4ASU G;  3CB2 A;  3HKE A;  1UFI A;  3SJC C;  4NTX A;  2PGG A;  5HFM A;  1KP3 A;  1WB7 A;  1NH2 B;  4LC1 A;  4JYA O;  2F43 G;  1FD9 A;  1Q43 A;  5CA0 B;  2K1E A;  4LWS A;  4JI3 O;  3RVY A;  4RQE A;  5H6R A;  1VQL V;  5LL6 Y;  3B8N A;  5ITZ A;  3AG3 C;  2JDI G;  3E89 A;  1VIB A;  2BTQ A;  3UM7 A;  1SC5 B;  3CCV V;  4Q20 A;  1GN2 A;  1F4N A;  2GUZ A;  5IYD O;  3ZHT A;  3VQY A;  5BMV B;  2WA3 A;  1SS3 A;  4FLU A;  2QDO A;  2QKA A;  2ZM6 O;  2OTJ V;  3JYC A;  1PM9 A;  1TVK A;  2KG7 B;  3TGU H;  4LF5 O;  3JD4 A;  3KZI Z;  3O9O A;  3OR7 C;  2UU9 B;  1WA8 A;  1ZLZ A;  1AI5 A;  2BSK B;  3A0B Z;  4MT8 A;  4DUY O;  3CX5 F;  3N2K B;  1OZ0 A;  4NXN B;  5IT9 N;  3CWB H;  4UVC A;  4O4L A;  5KAF Z;  1AP6 A;  3JSL A;  2P06 A;  3CSX A;  1I94 O;  2DOS A;  2XAQ A;  1GH6 A;  1IBL O;  2WSS G;  1WNS A;  4JGS A;  4B3M O;  3BCC H;  3CE2 A;  2CTQ A;  3H1I H;  4DYL A;  3JAK A;  2JS5 A;  1X4T A;  1OCZ C;  4P30 A;  1MSD A;  3STL C;  3CP1 A;  3HPL C;  3KG2 A;  4FZ0 A;  4I9Q A;  1VAR A;  2JJ1 G;  3B2E E;  3JAL B;  3JCZ A;  3TET A;  2EUL A;  3MD0 A;  1I0H A;  3BHP A;  3BEH A;  4PJ0 Z;  4ZKI A;  5KLV H;  1V54 C;  3W7S A;  3JAS B;  2FTK A;  1RSO A;  4GKK B;  2A0L A;  3L72 H;  4UFZ A;  5GTH Z;  5EIB C;  3M99 B;  4QE9 A;  4BIO A;  2RJZ A;  2QM7 A;  3E8H A;  3EFF K;  2VWJ A;  4DK0 A;  3VQW A;  2HFE C;  1H8H G;  1QLE B;  3L71 H;  3LSS A;  2QA4 V;  2YS8 A;  1M56 C;  1AR1 B;  1P4R A;  3RYH B;  1G4Y B;  1Z2G A;  3N27 A;  1YJN V;  4RUF A;  4EKW A;  2EZO A;  4TWK A;  3W7T A;  4UUJ C;  1H2N A;  3TJT A;  1D5N A;  2YC0 A;  4Q6G A;  1IDS A;  2Q67 A;  1R3K C;  5KA6 A;  5EBM C;  3LDE A;  1SZX A;  1W59 A;  3K06 A;  2WAM A;  3UT5 A;  4UCR A;  2Z0A A;  1VF6 C;  1YZB A;  3RYF A;  5CBG A;  5B3S C;  1SZT A;  2UXB O;  4OGQ B;  4YXW G;  4I7Z B;  1YJW V;  4EFE A;  4MTO A;  2Q0O C;  3G4S V;  4UVA A;  2MK3 A;  1WJZ A;  3F7V C;  1RM1 C;  1FKA O;  3ZHV A;  1OCC B;  1N0J A;  1YTF B;  3QO8 A;  4JV5 B;  2UUB O;  4PA9 A;  3K5O A;  3C90 A;  4NYK A;  2D3O W;  3E2E A;  2P5O A;  2ZR2 A;  2OWO A;  4QIW F;  2P7T C;  4LF7 B;  2BOB C;  3PJS K;  5LA6 B;  4DR1 B;  2H8P C;  3AG4 B;  3UKM A;  4ZOL B;  3Q4H A;  3LNM B;  5H6Q A;  4JI0 O;  4RAI A;  1BE3 H;  2Q69 A;  4MVU A;  1H2S B;  1K73 W;  3P32 A;  4MTG A;  2OCC B;  3SYQ A;  5KMG A;  1FPO A;  2WPD G;  5IJ0 A;  4MVQ A;  2CH7 A;  4PDL A;  5DED A;  4WBN B;  2ATK C;  1Y4M A;  1RP3 B;  4H37 A;  3RYI B;  1KMI Z;  2A79 B;  2JEX A;  2F66 C;  4FLW A;  1R6N A;  2FKX A;  2F93 B;  2P6J A;  1E1R G;  2JS3 A;  1T5E A;  1D2D A;  1NTM H;  4NR1 A;  2UUA B;  3IFX A;  2PUS A;  2Q8V A;  1HNW O;  2YIA A;  3WG7 C;  2RQ6 A;  1E79 G;  3SPI A;  4G27 B;  3RGB A;  4JTD B;  2YIB D;  2H3O A;  1SQQ H;  3PN1 A;  2DWD C;  2ZT9 B;  4MS2 A;  5J2U B;  4X1K A;  4GX0 A;  2V4D A;  2Q7H A;  4MTX A;  4JI5 O;  1VMG A;  2IJI A;  4OXS A;  4QPJ A;  2VQF O;  1SQP H;  5L3G A;  4B3T B;  2LFS A;  4YY3 B;  3CMA V;  4HNA B;  3A2F A;  5KHH A;  1N36 O;  4C7U A;  2E5L O;  4JI7 O;  3E83 A;  2Q6A A;  1EZJ A;  1A32 A;  4JI4 B;  3UQ8 A;  2ZXW B;  2HJD A;  2BCC H;  2FML A;  2P4V A;  1GKF A;  4MSW C;  4LH7 A;  5BZB A;  3CME V;  3WB1 A;  4DV0 B;  4W4L A;  4TV8 B;  4PA7 A;  2QM4 A;  4DR6 O;  1IXB A;  2R9R B;  5CA1 B;  1Q90 D;  2XUM A;  4A5U B;  2YID A;  4KHP O;  4Z2W A;  1BQ0 A;  3U0Z A;  3ZMT A;  2JVD A;  4YJ3 B;  4PEL A;  1AR5 A;  4GT1 A;  4X65 O;  1HR0 O;  2VQE O;  5LMN B;  1SQB H;  3MDS A;  3B40 A;  4J7Z A;  5JVD B;  3K04 A;  4K0K O;  2KQX A;  1HNZ O;  4F4L A;  4LFB B;  3CCL V;  3NXS A;  1RFY A;  1JCH A;  3ZMU A;  1URF A;  2K9P A;  1BHA A;  2P4K A;  2G38 A;  4PA4 A;  1B6Q A;  1Y76 B;  4R6Z A;  1VF6 A;  3JD2 A;  1YTF D;  2D2C B;  1SKV A;  2ADQ B;  3G6E V;  5JJE B;  2IM9 A;  2ZM6 B;  2WLL B;  1FXK C;  3H01 A;  4IIJ A;  1YJ9 V;  2CGN A;  4H0L B;  4IYI A;  4CH6 A;  2Y4T A;  2WLK A;  3AK1 A;  1FJG B;  2Q7E A;  1FFX A;  1WLE A;  4X66 B;  3ASO C;  2QGN A;  3BA9 A;  1N33 B;  3UO3 A;  1OHH G;  1ORQ C;  1PNM A;  4D7T A;  2X0L A;  4JI6 O;  2EIN C;  4DW0 A;  4D7S A;  4EB6 B;  1QCE A;  4AQY B;  2ITC C;  3OMI B;  4XDL A;  2O57 A;  1AP5 A;  3N2G B;  1WP7 A;  3BY6 A;  3K9A A;  4Z1M G;  4LWS B;  3K08 A;  4DV1 O;  2WA4 A;  3OD4 A;  5J9P C;  1VP7 A;  1UPG A;  3CRM A;  1AI6 A;  2BTQ B;  1R6T A;  3SGI A;  1JJ2 U;  3AK2 A;  4DV6 B;  2YI8 A;  3D3Q A;  1GM7 A;  1ZL8 B;  2OYQ A;  1U97 A;  4K8X A;  4JI2 B;  2ZIN A;  4HZ3 A;  2YEV A;  1WPB A;  5J2T A;  1ROP A;  3HKB A;  1TVK B;  3HR0 A;  4CH5 A;  3K58 A;  4DR4 O;  1NTZ H;  2EZP A;  2IJH A;  4H13 B;  4BWA A;  1Q7Y W;  1SA0 B;  4LH6 A;  3D36 A;  3QTC A;  4O4L B;  3P3N A;  4PI2 A;  5LBQ A;  1S76 D;  1TGO A;  1X59 A;  5LGU A;  4LFC O;  1K97 A;  2XTA A;  4NB5 A;  2XOK G;  3CEI A;  4UCS A;  4GZR B;  3DSQ A;  4FM2 A;  3FAV A;  2EIJ B;  4BW9 A;  5C8Y A;  1LUV A;  1R3J C;  5BXZ A;  3TK1 A;  3E22 B;  2PZS A;  1IX9 A;  1XNQ O;  5LYJ A;  4AHC A;  2EJ7 A;  4LF9 B;  2A06 H;  1R6K A;  3JAM N;  5LP6 C;  3UCS C;  5KHK A;  5FNV B;  5LXT B;  4KP4 A;  1I5X A;  5JH7 B;  1NS1 A;  1VQO V;  2ZCE A;  4WFA V;  1XMO O;  1F51 A;  2R72 A;  3APQ A;  2EIK C;  2UXD O;  2CAZ C;  2X6C A;  5L3D A;  1KU9 A;  1RSO B;  3JSN A;  2HVK C;  2CTP A;  3J80 N;  2EIM B;  2LJ2 A;  3JCU Z;  2HKO A;  3SPH A;  1YIT V;  3LUT B;  4CC6 A;  1FXV A;  3CCR V;  1XI1 A;  4RUE A;  3OMA B;  4MVO A;  1YEW A;  5CN0 A;  2Z3Y A;  3OGI B;  3FB8 C;  1V9P A;  1Z5W A;  5LHI A;  1CPY A;  2JJ2 G;  3CC7 V;  4KUM A;  1ENV A;  3T1H B;  4J42 A;  4GKJ O;  3OUS A;  3E8G A;  3AG2 C;  1IBK B;  2QEX V;  3SR2 C;  3UT5 B;  2PTM A;  1XRE A;  3BFR A;  3RYF B;  1O9G A;  1DGS A;  4I5S A;  5EYP A;  2OIE A;  3T2M A;  3RN4 A;  2WLH A;  3GWO A;  3OT7 A;  1OCR C;  4X1Y A;  1EN6 A;  5GON A;  5LOV B;  2QSA A;  4ZIB A;  1S5L Z;  3R66 A;  1M1K W;  1XL4 A;  3WB2 A;  1F4M A;  2DYR C;  1FXK A;  5JCO C;  2QTO A;  2AHZ A;  1N4C A;  4DV5 O;  2ADP A;  1AJP A;  1SQV H;  2EJR A;  3H1H H;  3UO2 A;  4DW1 A;  3B09 A;  3ZN1 A;  5LHG A;  5JJJ B;  3GB7 C;  2A3Q A;  1KYO F;  1S77 D;  2UXC B;  2WWW A;  4DV7 B;  1GK9 A;  3KCY A;  3Q4H B;  1OJH A;  4PA6 A;  1JFF A;  4B7K A;  5LGN A;  1VQ6 V;  5H2F Z;  1MNG A;  5KMG B;  4B3S O;  2BTO A;  1K3E A;  1N36 B;  5B1A C;  1BL8 A;  3OEE G;  4DR5 O;  3E35 A;  3VOU A;  2LGQ A;  4U3J A;  1MA1 A;  1NR7 A;  4J7K A;  4FFK A;  3ZBH A;  3ZRX A;  4HYO A;  4BIZ A;  1R3I C;  1FYJ A;  4JYB A;  4X9Q A;  1EN4 A;  3P30 A;  2ODM A;  4DR7 B;  1XMQ O;  4JI1 O;  1YCI A;  4E4E A;  3T4Z A;  1B3Q A;  4JI8 B;  2L6L A;  4LFA B;  4OX9 B;  4F6E A;  2VQE B;  2CTR A;  4IGG A;  4IHJ B;  2ZR3 A;  2UUC O;  4FFB A;  3EVK A;  3X2Q C;  1CEZ A;  4DV4 O;  1VEW A;  2CE4 A;  1PNL A;  2ZE6 A;  5B5E Z;  1S0V A;  3DGE A;  4GX1 A;  2Z5U A;  4E2L A;  1N34 O;  1J5E O;  3GVM A;  1M57 B;  2IJK A;  4NXM B;  5E1A C;  2YXY A;  4H33 A;  3DXR A;  4O2A A;  5BR8 B;  5DM6 V;  1YVW A;  4YJ2 A;  5LP6 A;  3ABL B;  1CXZ B;  3H1J H;  1LR1 A;  1LUW A;  3CJH A;  1R1B A;  3HKC A;  2VS0 A;  2ZIO A;  3FX7 A;  5B1O A;  2HHH O;  4UCT A;  4X89 A;  1GN4 A;  3G67 A;  3ZMZ A;  5FLX N;  5IYZ A;  4LNU A;  4X88 A;  1M56 B;  2DQ0 A;  5TIS Z;  5JQG A;  1MAB G;  2DYS B;  4CS2 A;  3R65 A;  4X20 B;  4UB8 Z;  4I4T A;  2GTA A;  1VQ5 V;  4DUZ O;  3KCX A;  4TQD A;  1QLE C;  1SQF A;  2V1D A;  2LQT A;  3WFV A;  4PA3 A;  1GMG A;  2QWP B;  4B3R O;  2HP8 A;  3T1Y O;  1Y74 A;  3ZRV A;  1H2G A;  1KKD A;  4KXR A;  4MTF A;  3QG5 A;  1GN6 A;  4DR3 B;  5JCO A;  4U7N A;  2VRZ A;  3OGC C;  1Q8I A;  2RDC A;  3ABM B;  5KAI Z;  3DC6 A;  1FFX B;  3S3X A;  1US6 A;  3OE7 G;  1HNX O;  1GAX A;  4NTW A;  1JQ0 A;  4LFC B;  2DWE C;  4LF8 O;  4ICG A;  1I5Y A;  5IWA B;  1K33 A;  4DV2 O;  4X64 B;  4PDV A;  3E86 A;  4XDJ A;  2XAH A;  2QWO B;  1MOF A;  1XEQ A;  5IY5 B;  2XAS A;  1G1X B;  1H2K A;  1N0N A;  3NR7 A;  3K5M A;  4UVB A;  4JAU A;  3H1L H;  4F6R B;  1XIL A;  4LF4 B;  4KFM A;  1XNQ B;  1IBM O;  1M93 A;  3K59 A;  1J95 A;  1GTO A;  3VQX A;  4DR2 O;  4LF6 B;  4UV9 A;  3QO7 A;  3AG4 C;  2ARH A;  4O4I A;  1XNR O;  2X6B A;  2HVJ C;  2GSM B;  3ASN C;  2HJF C;  3OTF A;  2DN9 A;  1WAZ A;  4I50 A;  2OCC C;  2AHY A;  4D6T H;  4LR3 A;  1LNQ A;  1QHT A;  5J2T B;  5CA0 A;  3HKB B;  4U3F H;  1COW G;  4AIL C;  2BE3 A;  1IXM A;  1EM1 A;  2HG5 C;  1RPR A;  3B4S A;  1NZ6 A;  3DC5 A;  5D5Q A;  4HBN A;  3B77 A;  1Z5V A;  1V55 B;  2YXL A;  2Y69 C;  4J11 A;  4GKJ B;  1FS0 G;  4FPP A;  4J9Y B;  1RPO A;  5B1B B;  3ZS8 C;  1Y67 A;  1BSM A;  1GM9 A;  4JTC B;  4DV3 O;  4PHZ A;  1QNM A;  3HKD A;  4O2B A;  4JAV A;  5LYJ B;  3SPJ A;  3FB7 C;  3H9V A;  5JJN B;  3TCU A;  4IYH A;  1YDX A;  3RT3 C;  4P9O A;  3JD1 A;  4DV5 B;  4LP8 A;  4FM0 A;  3HB3 B;  4PDM A;  3IC7 A;  3SYP A;  2HR3 A;  2Q0A A;  1PPJ H;  3SJB C;  3MHS C;  4FVM A;  4FJC C;  3KKY A;  3LSQ A;  4I55 B;  1L1F A;  1HP8 A;  3JAL A;  3K5N A;  4TT3 G;  3L73 H;  3FB6 C;  3ETE A;  4JYA B;  1VQ4 V;  2ZXW C;  4MVS A;  4FLZ A;  4GX5 A;  4Z1V A;  3IJ4 A;  3SPG A;  3JAS A;  1WPX A;  3CRR A;  1QVG U;  5CA3 A;  4PI0 A;  4JI3 B;  2Y48 A;  3C3T A;  3CYO A;  3ZRW A;  4GCZ A;  1SER A;  1Q5O A;  1Q86 W;  3OFN G;  5CB4 A;  4R7C A;  4O4H A;  3ZHQ A;  1DF4 A;  5EC2 C;  4ZHQ A;  3JAT B;  2UU9 O;  5EYP B;  3RYH A;  4X1Y B;  4J9Z B;  5GON B;  4NXN O;  2X6A A;  1CP9 A;  2JGU A;  3RWR D;  4YHH O;  1SQG A;  1M5I A;  1SES A;  3DTU B;  1FXH A;  4LF5 B;  2W6I G;  5LHH A;  1BT8 A;  3JAW B;  1OCO B;  4LCU C;  3HKE B;  4DUY B;  1KKC A;  3U10 A;  2UUC B;  3CC2 V;  2WLJ A;  1P84 F;  3A0R A;  4DV4 B;  1FAF A;  2XND G;  4YIP A;  3BVO A;  4R8C A;  3RYC A;  3FYI B;  1I94 B;  2PY5 A;  1IBL B;  1OV9 A;  3K0D A;  4B3M B;  2DW4 A;  2EIL B;  2ZE5 A;  3K3W A;  1MG1 A;  4JPR A;  5IJ9 A;  3JD0 A;  4FK5 C;  1NJI W;  3S3W A;  3BRC A;  3I55 V;  1DLB A;  2XAJ A;  1Y6X A;  2PI4 A;  1P7B A;  4NTY A;  2CDY A;  4DK1 A;  2AZ2 A;  1K8A W;  4RWU A;  1AVM A;  4OPH A;  4U3J B;  1PV0 A;  5ITZ B;  5LMU O;  4B7E A;  2H94 A;  4ZOL A;  4J41 A;  2GUZ B;  3F5W C;  3B8M A;  1DTO A;  1XOU A;  3IC9 A;  1NQT A;  4J80 A;  3QF7 A;  1SQX H;  2RNB A;  2NLJ C;  2A7W A;  5EZY A;  1YF2 A;  4JF3 A;  1JR9 A;  2QWR B;  2IH1 C;  3D8C A;  1KB9 F;  1M4U A;  2ILM A;  2JIZ G;  1WA8 B;  2W0F C;  2YIC A;  1AJN A;  4KL1 A;  2R9I A;  1XQ8 A;  4IT5 A;  1D5A A;  3L70 H;  3I56 V;  2Q9L A;  1BGY H;  4CH3 A;  3JAK B;  2B1G A;  1EN5 A;  3FKS G;  2UXB B;  1L0N H;  3DXR B;  3CRA A;  4LF7 O;  1ZX3 A;  4YJ2 B;  4DR1 O;  3SYC A;  3ZHU A;  4ZI7 A;  2UUB B;  2X7R B;  1BS3 A;  5L3E A;  2P22 C;  4UV8 A;  1BHB A;  2EIK B;  1THZ A;  4JTA B;  3HKC B;  5A2Q N;  1SET A;  3RW0 A;  1QBZ A;  1E1Q G;  2EBO A;  2IW5 A;  3L75 H;  3EHB B;  1QR9 A;  1R73 A;  2W0X A;  3K57 A;  3OW2 U;  4TV9 A;  4O4J A;  4JI0 B;  1XDC A;  1SRY A;  1NBM G;  3JAR A;  1YXB A; 
#chains in the Genus database with same CATH homology
 2K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...