2K9PA

Structure of tm1_tm2 in lppg micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Pheromone alpha factor receptor
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.920 Mainly Alpha Orthogonal Bundle Helix Hairpins Pheromone alpha factor receptor. 2k9pA00
2K9PA
chains in the Genus database with same CATH superfamily
5CBFA 4RAIA 1RFYA 1SF9A 1OCOB 1OCOC 5FL7G 5IJ9A 4U3JA 1H2LA 3ZEDA 2KG7A 4LH6A 4P30A 4EB6B 3E86A 2QA4V 5KAFZ 4LF4O 3CS5A 4YY3B 1HWYA 5JQGB 2HVKC 3O9OA 1SQVH 3K5LA 1WJZA 3HR0A 5D5PA 3JAKB 2NN4A 1FS0G 4NXMO 4KHPB 5LXTB 5B1BC 2DQ3A 5JCOA 4YIPA 5CN0A 4AHCA 4KP4A 3CX5F 2ILMA 3K08A 1Z2GA 3K03A 2IJJA 3HKDA 3LUTB 4N23A 2GHYA 2HR3A 2VQFB 3RN4A 5LXTA 2LJ2A 3CRMA 5EYPA 5LP6B 4FFBA 3CP1A 1DLBA 2EINB 4B3MB 2A0LA 4J80A 4YHHB 3ZIAG 1PD3A 4CS2A 3LSSA 2QWOB 4O4JA 1KKCA 4RWUA 3W7XA 4DV0B 4BR6A 2W6IG 2XNDG 3OEHG 4NYKA 2DOSA 4DRXA 1US6A 2N74A 1EN4A 3F7VC 3S3WA 1R6NA 3L9DA 3AG2B 4O4JB 5CBHA 4OPAA 1XMOB 2V4DA 5EZYA 5KHJA 4DV6B 4K8XA 3N2GA 3R66A 1GAXA 1DF5A 4DR1O 4DK0A 1V55C 4XDLA 1J95A 3E22B 1S0VA 1JPXA 1IVSA 2Q6AA 2KG7B 4RO2A 2EIJC 3CE2A 4F6RB 2Y0PA 1GKFA 2DW4A 3ETEA 3BA8A 3ZMVA 2QEXV 1R1BA 5CBGA 4GYCB 2Y4TA 1Q7YW 2WLMA 4H37A 5IWAO 5LYJB 5KMGA 1BQZA 5KUMA 1JVMA 5B1AC 1P7BA 4HYOA 4QNHB 1I0HA 5BMVA 4CS3A 2AHZA 3M7MX 1I94O 1NR1A 4ZHQB 3TXSA 4DXWA 4DV4B 3UT5B 4DR4O 2YIBD 3L75H 1QCEA 2FTKA 1WLEA 5KMGB 1IBLB 3X2QC 2LW1A 1DTOA 4TOIA 5DM6V 1GO3F 3KKYA 4UCTA 4U7OA 1Y67A 4OPHA 2JJ1G 4BIZA 1M93A 3JCUZ 1NQTA 4NXNO 5AG2A 2QWPB 4JI1O 1K34A 3HB3B 2JGUA 2Q0OC 4YJ2B 1DF4A 1MNGA 4J9YB 1HDJA 3OM3B 4ZBMA 1T5EA 5GTHZ 4LFBB 4IHJB 4GT1A 2Z0AA 2OT5A 2DWDC 4PDMA 2PUSA 5BY1A 4B3SO 4LWSB 2UXBB 3JD3A 1K9MW 2QJ1A 1QVGU 1RP3B 2V1DA 5KHHA 3SJBC 2Z5UA 4O2BA 1KP2A 2EJ7A 3ABUA 3F7YC 3B09A 2RQ6A 1IX9A 2JS3A 4X1IB 2GTAA 2G38A 4PI0A 3RYFA 4CH4A 4J7JA 2HVJC 3TK1A 4D7TA 2Y4UA 4O2BB 4LF6O 4GKKB 4JZGA 2ZR3A 2ZXWB 1AJPA 4JI0B 2LGWA 3ABKC 1H2NA 3JAKA 4NB5A 1BHBA 5L3EA 3E2EA 1JA8A 3JASA 2ARHA 4LH7A 3LNNA 4GUNA 3AG1C 5EC1C 4MVOA 3RVZA 2IH1C 1ZL8B 5LGNA 5IYCO 3FB5C 2DYRB 3HKDB 4YY3O 4CH6A 1X59A 4MVSA 5FLXN 2CE4A 4I7ZB 5B3SC 4X62O 4JI3B 4DV2O 2E76B 5LMNO 3J81N 3FB8C 5IJ0B 1MABG 3SYCA 4YHHO 1K33A 5B1OA 4FM2A 4PDVA 4B3TB 3F5WC 4DR3O 5KHGA 5IYDO 1AR5A 2Q9LA 1FJGB 5BXZA 1VEWA 4I55A 1S76D 1Y66A 4P2ZA 1SETA 2O57A 3J80N 4DRXB 1NJIW 5A9GA 1XL4A 5LMUB 3STLC 3CCJV 1VQMV 3NXSA 4X89A 3ZN1A 1OZ0A 2EINC 2XUMA 4LC1A 2H8PC 3T4ZA 3CHXA 5B1BB 3N2KB 2YI9A 1VIBA 3J7AU 4LFBO 4MS2A 2E3CA 3DC5A 3B8NA 1W0JG 3KCXA 2Q8VA 2X6BA 3RBZA 3CJHA 2QKAA 5KHKA 3BY6A 3CCUV 4IIJA 1AI4A 4ZOLA 1M90W 4JI4B 1XHZA 3ABTA 3JSLA 3KZIZ 4FMTA 4EKWA 1IXMA 1G1XB 5KHIA 2AZ2A 2ADPA 4D6TH 4ZOLB 5HFLA 4ZHQA 4HNAB 3CC7V 5J2UA 4X66B 3T1YO 1G4YB 2EIJB 2ZINA 1IBMB 1RSOB 2JGDB 3ZCCA 1ROPA 5JH7A 4X64O 1YJWV 3SJCC 3G80A 2GTSA 3BAAA 4I50A 1QLNA 4PA3A 2UUBB 3CCEV 3QTCA 3H1IH 4FM0A 3HKBA 3N27A 5L3DA 4AQYO 5C8YA 3ZRVA 3U0ZA 1K7DA 2JEXA 1PL0A 1S3JA 2XAHA 3ABLC 2YEVB 2RCVA 4P9OA 1F23A 4Z1VA 2H94A 5K1XA 5LHIA 1YCIA 3CB2A 3BCCH 4NTYA 3CCRV 2NNUA 1N0NA 3WB2A 1H8EG 1O9GA 4B3RO 2HG5C 1VQ9V 1B06A 4Q6GA 2F95B 2GUZB 1XEQA 1JR9A 2A9HA 1HR0O 2WLHA 5E79Z 1L0NH 1Z5VA 3VQVA 2DN9A 1PM9A 2KKWA 1K92A 2UXCO 1NTMH 1IBMO 3G71V 2YXYA 3A2FA 4OGQB 1R6KA 3I55V 2W0XA 2ZE5A 4X65B 3I56V 2XAFA 4JI0O 3ABMB 4PV1B 3OAAG 3G4SV 3W7UA 2PF4E 5CMUA 3CCLV 2PZSA 2IBZH 5LOVA 1NH2D 2YXLA 2BTOA 1SS3A 4IYIA 1VP7A 3UKMA 4UB8Z 2YC0A 1XMQO 2IJHA 2GV9A 4I5SA 5JVDB 4X62B 1EBOA 2A3QA 3P30A 4LFCB 3AG2C 3UO2A 1GTOA 2EULA 2Q5ZA 2VWJA 3SPHA 4X66O 3T1YB 4JI4O 1Q6IA 3D36C 1NBMG 4IL6Z 1FFXB 3E89A 2ZM6B 4WFGA 4BIOA 2PYLA 1K5QA 4X9QA 5LA6A 4UCSA 2UXXA 1NZ6A 3RYCB 1PNKA 1Y74B 1H38A 3TJTA 4X88A 1MSWD 1Y6XA 3BA9A 3APOA 1H2GA 3X2QB 3JD0A 1N0JA 1IXBA 3DGEA 1GN3A 5EC2C 1KD1W 1BE3H 1Q43A 3E8FA 2B1IA 4A5UB 1K3EA 3ETGA 3CXCU 2QE7G 2ZDIA 2ETNA 3JD1A 4WBNB 4CBCA 3SYPA 5IT9N 3ZRSA 3QF7A 5D5QA 5J2TB 4TUYB 3OTFA 3OR6C 4E4EA 1Q8IA 4PDLA 2JEUA 3CRQA 5CA3A 1EM1A 4XBFA 3ASNC 3K79A 1VQOV 1H2KA 4QPJA 4TV9A 4JAAA 4F4LA 1TA8A 1FYJA 4NTXA 3DXRB 1G8MA 1BMFG 2LFRA 4Q20A 1OJHA 2VQFO 1WA8A 1TUEB 4X1KB 3RGBA 3L72H 4LFAO 4LBEC 4R8CA 4ABMA 1QNMA 5LHGA 1PV0A 4K0KB 1Q5OA 2WA3A 1L1FA 4LNUA 3SPJA 2UU9O 4F6RA 1ENVA 5CA1A 4GKJB 4LF7O 4NR1A 5IY5B 4DUZB 1YJNV 3WG7B 4I9QA 1XL6A 3RW0A 3ZX6A 4TQDA 4W4KA 2P67A 1VF6A 3ZHUA 2UUBO 2FYUH 2ZT9B 4DV1O 1W2BU 3OMAB 4MW3A 1S72V 4OXSA 3D3IA 2P06A 2ZDIC 3FAVB 2QM7A 3AG7A 4B3RB 2V7QG 2NLJC 1NR7A 4WFBV 1ZWIC 4W4LA 3CCQV 5CA0A 2R9AA 2XAQA 4YJ3B 3OTOO 3WU2Z 3UM7A 1K5SA 4UCUA 3ETDA 3HKEB 4LP8A 1M1KW 4AILC 2F23A 2KSDA 4DR2B 1KKDA 3EVKA 4KXRA 1OCRC 1JOYA 2JIZG 4UFZA 4G28B 4DV3B 2CTQA 2BE3A 3AEIA 4WCEV 5HFMA 4B3TO 4P9PA 4ZI7A 2DWEC 2YS8A 1NT2B 2HP8A 4HZ3A 1AI5A 1N33B 4GX2A 2D3OW 2L6LA 3MD0A 2UUCO 3K9SA 4GCZA 5JJNB 3ETQA 1OCZB 3VQWA 1GN6A 1VQ8V 3HKCA 2WLKA 1JFFA 1Y4MA 3ZMUA 3DSQA 1J5EB 2ZKOA 1YJ9V 2QGNA 1AROP 4X1YA 4DR2O 4H33A 2M7WA 4DV6O 2CTRA 2ZIOA 1VF5B 1Q6UA 5EBMC 5E1AC 2P7TC 5B5EZ 2A7WA 3P3NA 1SA0B 5LMUO 4DR1B 1N33O 2A06H 2F43G 3RVYA 3SJAC 4LF8O 4I55B 2UXBO 2YI8A 1NS1A 3OMIB 2LP7A 1SERA 2YICA 2FL4A 4TV8B 4JTAB 1VQNV 3RYFB 4L87A 3ZHTA 2IJIA 2ITCC 4O2AA 1RM1C 2QDOA 4O4HB 1V54C 4PDRA 1N34B 3JARB 4LF8B 1ZAUA 3JASB 5CA1B 4HBNA 3SPGA 1UPGA 1FFTB 4IIJB 3B4SA 4O2AB 3JAMN 3ASOC 3DXRA 2BCCH 1I5XA 3UT5A 4DK1A 4DR5O 1TGOA 2YDEA 5JJJB 1D5AA 3SDLA 3ZMZA 3K5OA 3AG3B 1WPBA 3CXHF 4JYBA 4X64B 1M9NA 1BS3A 4G27B 4N21A 4PA7A 2QR4A 1XHXA 2QWQB 2RMKB 2P4VA 1IBKB 4D7SA 2F93B 4I9WA 4JPRA 5CB4A 4JTDB 3CCSV 5J2TA 5JH7B 1TAEA 1YF2A 2Q7HA 3ASNB 2H3OA 1FAFA 1WPXA 4KUMA 3THOA 3IAYA 4MW8A 5BMVB 2UU9B 2ITDC 3AG4B 2EIMB 3IC9A 1E79G 1E1RG 1NTZH 4LR3A 2XAJA 1OCZC 3ZHVA 1PP9H 4KHPO 4DUZO 2Q69A 2QM4A 1I94B 2AW9A 1XI1A 3L73H 1KUQA 1MA1A 4MSWC 2Q4PA 3N2KA 1SZXA 4JASA 5IWAB 3SGIA 3LNMB 5IYBO 1SESA 3RFRA 4DW1A 4FJCC 2GSMB 3RT3C 1OCRB 3JSNA 1EN6A 2EBOA 5DEDA 2PY5A 3A8TA 1PNMA 5LBQA 1MZFA 2P22C 2ZQMA 3HKBB 3U11A 2OWOA 3CCVV 2XT9A 5GTIZ 1SQFA 4UCOA 3T1CA 1XDCA 1N32B 2UXDB 4RQFA 3VBBA 1QR9A 2WLIB 1Q3EA 1ZLZA 4UV8A 4WF9V 2YXHA 1VQ7V 1JQ0A 1XMQB 3OE7G 4UVBA 5KA5A 2DYSC 4UXNA 3TCUA 2XAGA 5EBLC 3NR7A 2IU0A 3ICXA 3K59A 1AJQA 1VQ5V 4FFBB 1Q81W 4DV7O 3SPIA 2DYRC 4JI6O 1KU9A 2FKXA 3L71H 4B08A 1WP7A 4X8AA 1SA0A 3AG1B 2OCCC 4EFEA 3PJSK 1THZA 4GX1A 3K5MA 2WLNA 5JCOC 4FLWA 2OCHA 1UJWB 3CWBH 1YXBA 1YDXA 1FD9A 4OX9B 2DE0X 1MOFA 2IU3A 3TETA 1YVWA 2ZNIA 3VQXA 3JAWB 3W7WA 3OGIB 4NVPA 3RYCA 4J7KA 5KA6A 5IYZA 4DV1B 3SYQA 1IBKO 4FLXA 4DR3B 1M57C 4FLUA 3MHHC 1FXKB 3JALB 1ZUQA 1BL8A 1Q6HA 4LF9O 2D2CB 3ZN0A 2ZE8A 2JVDA 4MVMA 5JJEB 4PI2A 2A79B 1I7FA 1QVFU 1U97A 2X6AA 4TWKA 1R3KC 4WBNA 3P3PA 5EZYB 3E8GA 4H44B 1HNXB 1P4RA 2JGDA 4FLTA 3F5TA 2LFSA 2X7RB 1O9HA 1FPOA 3CEIA 4FLVA 1VQKV 2F4VB 1X4TA 4CS4A 1NVPB 5B3SB 3OR7C 3E83A 3K0GA 5CB4B 3CC4V 1VQLV 2XASA 4LF9B 1U96A 2QTOA 3SR2C 2ZIMA 3UCSC 3UQ8A 3JATB 3SJQC 5TISZ 2YEVA 3IFXA 4GX0A 1SQGA 2HHHO 3ML0A 1HW7A 3SYOA 1IDSA 4J7ZA 3ZBHA 2Y48A 1XREA 5EK0A 4HAMA 3JATA 2K1EA 5C93A 4B3SB 2N04A 5L3FA 4PELA 3ABKB 3AK2A 3BHPA 5B1NA 1YTFD 1YHQV 2PI4A 1PPJH 4JF3A 1P84F 1XUQA 1QBZA 1E1QG 3TGUH 1HNZO 1Y76B 2F1MA 2Q7GA 3H1JH 5H2FZ 4K3AA 1NKDA 1FXKA 4PD4F 2JK5C 1XNQO 1F4MA 4OX9O 4FLYA 4MVQA 3OW2U 4DW0A 4CH5A 1RPOA 2N05A 1AVMA 4TQFA 3C3TA 2WLIA 5IDJA 3FD9A 2ZE7A 4CZZA 2Q7EA 2XHBA 3TXQA 5L3GA 3ABLB 4K0KO 2Q67A 1AR1B 2CTWA 2UUAO 1CPYA 1V9PA 4JV5B 2MW2B 3ZJZA 2X6CA 2WSSG 1VF6C 2EZOA 3FAVA 1HNWO 2UXCB 1P49A 3OUSA 1H8HG 1UFIA 2WAMA 4JI7O 4BIUA 2XOKG 1EN5A 1HNXO 1CP9A 1YITV 2HKOA 3WB0A 1GN4A 4FIPC 1KP3A 4FFKA 1FJGO 4B3MO 4JI3O 2HJFC 2IW5A 3WFVA 3RYIA 4TV9B 1XOUA 4QGPA 3M99B 2MK3A 4JV5O 2HHHB 3A0RA 4X1KA 3JAWA 1K73W 5GONB 4JI6B 3C90A 3W7SA 1RSOA 4JI8O 1JMKC 5CA0B 1QR8A 2W6JG 4UB6Z 3JALA 5IJ9B 2Q73A 2RN9A 3FX7A 3I5DA 3QNEA 4ZKIA 2CGOA 3LDCA 2UXDO 2CTPA 5H5NA 1BHAA 5H9CA 2OTJV 3GWOA 2X0LA 1IURA 2CH7A 1H2SB 3B8MA 2EILB 1GH6A 2ATKC 3CC2V 1JJ2U 1COWG 1AB3A 3FB6C 3GVMA 1BT8A 2P90A 2Y69C 2ZR2A 3FFQA 4UUJC 5ITZA 3OMNB 4JYAO 2HLDG 5J2UB 4DV7B 2CUGA 2GUZA 1KYOF 3Q4HA 1VQ4V 4H13B 2IH3C 5KAIZ 4DR7O 3CD6V 3JD4A 3H01A 4DR6B 3LDDA 2ADQB 1S5HC 2BOCC 4JTCB 4O4IA 4I4TB 2JS5A 2CK3G 3JCZA 2HFEC 2Y69B 2OIGA 3QVNA 1HNWB 1EZVH 4FPPA 3ZS8C 3FYEB 1GM9A 4JYYA 4NTWA 2YIBA 1KQSU 4QE7A 1SKVA 4ZI7B 4EFBA 3CMAV 4I4TA 2XTAA 2QKCA 3CRAA 1YZBA 4HNAA 4LF5B 1Z5WA 4JYAB 1YEWA 4O4LB 3ZRWA 4BW9A 1N36B 2WLJA 2IJKA 1MMMA 3LSQA 3H9VA 5KX5B 1BSMA 4QJFB 1D2DA 1AI7A 1QU7A 4I50B 3ZMTA 1GM8A 1HNZB 3L74H 2YIAA 1OV9A 5F2VO 4K8ZA 1N32O 4DO2A 3ZHSA 4FM1A 1NVPD 2KQXA 4DR4B 3DC6A 2FB5A 2LQTA 4JYCA 4AI8A 2WA4A 2VS0A 2OTLV 1HP8A 1XNRB 1LUWA 1QQCA 2EZPA 4QPKA 4JAVA 2WPDG 4DR5B 4GLXA 4XDJA 5ITZB 2GBOA 1LUVA 4IT5A 1Y76A 2RJZA 2YSUB 2QWRB 2VRZA 3VOUA 3MAQA 4E2LA 1NI8A 1R3IC 2W0FC 4DV5B 1VQPV 5EIBD 3JARA 1SQXH 4UVAA 5JVDA 5IE9A 4LCUC 3KCYA 4B7KA 4DV2B 3OGCC 3E8BA 1M57B 1XMOO 1R6TA 3CRCA 2WLLB 3BRCA 2RDCA 1L0LH 5K1PA 4YJ2A 1VQ6V 1SQQH 2K9PA 5LYJA 4PJ0Z 2E75B 2FMLA 1F4NA 1SQPH 3UO3A 1ORQC 1YSCA 1JX9A 4QE9A 3RWRD 4BAYA 2LO1A 4RUFA 2B5UA 4H0LB 5FNVA 3ZRWB 5FPRA 4AQYB 4MTXA 1GRJA 4GZRB 4JZ2A 1S5JA 4DV0O 4O4HA 2Z3YA 2BTQB 2AGAA 1Q90D 1LR1A 3BABA 1AI6A 3D3QA 2Q68A 3K3WA 3DTUB 1SQBH 1K97A 4WFFA 3STZC 4DV5O 1MZEA 4CC6A 3B40A 4JAUA 1I08A 2ZE6A 2IM9A 2KB1A 4MVRA 4GX5A 1J5EO 2EIKC 1AP5A 4J42A 1YI2V 2E5LB 1SC5B 4DV4O 1N8RW 4LWSA 1V55B 1NTKH 5EYPB 1Y74A 5LP6A 4JI8B 4G2KA 3H1HH 3T2MA 4ASUG 1Q82W 3ZHQA 1V54B 2DYSB 5LMNB 4X1IA 4F6EA 2PI5A 4UCVA 3B77A 4Z2WA 1WAZA 1N34O 2Y0IA 4J41A 4UVCA 4PA4A 1R73A 2PTMA 3SPCA 1B3QA 4IHJA 3IC7A 1M4UA 5DN6G 1R3JC 3U10A 4NXMB 1GM7A 3O65A 2WLLA 1EFRG 3H1LH 5BR8B 5IY5C 1N4CA 1XILA 4IYHA 3CMEV 2EIKB 4CH3A 1ZL8A 4C7UA 1NH2B 4B7EA 4O4LA 4DYLA 2CGNA 4WFEA 5FPOA 2EILC 1FXHA 5KX5A 3G6BA 1N36O 2ZCEA 2UUCB 3CRRA 5FNVB 2LW7A 2OYQA 1OHHG 1I5YA 3IGAC 3PN1A 1OCCB 5KLVH 1B04A 2L35A 4FLZA 1K4DC 3K9AA 3SYAA 1K8AW 2VQEB 2F66C 4LNUB 3OTOB 3AK1A 2EIMC 1GMGA 5L3BA 2R72A 3FKSG 1PKXA 4LF5O 1KMIZ 5H6QA 4X20A 2QWNB 4Z1MG 5LHHA 2ZXWC 4NXNB 1FXVA 4LF4B 3OD4A 3T4DA 3ASOB 2UXNA 5L3CA 2YIDA 1F7YA 4FZ0A 4TSFG 4DR6O 1SZTA 4LF6B 1D5NA 1KB9F 2DQ0A 3P32A 4KFMA 4TUYA 5IJ0A 3HPLC 3K58A 1BCCH 1KECA 4MTOA 3OFNG 1W0KG 3K04A 3RYHA 2AZ0A 3M8AA 1QHTA 1WP8A 4CC5A 5BZBA 3OUFA 5B66Z 4DR7B 2Q0AA 4RQEA 1G6UA 3E8HA 4KL1A 5A2QN 1ZX3A 1WB7A 3EFFK 3D8CA 1R3LC 4JI2O 5J9PC 3VQYA 3T1HB 3C3SA 4L8JA 4DUYB 1PL4A 1L8DA 3ZMSA 4BW5A 2AXTZ 3QG5A 5IYZB 3CYOA 2HEPA 1AP6A 2CDYA 3CCMV 1AILA 3CJHB 3MDSA 1JFFB 3H1KH 4EB6A 1YTFB 2NR5A 3G6EV 4I0XB 3QO5A 3OT7A 1PNLA 2P6JA 3OEEG 1M5IA 5JQGA 3WB1A 4JI1B 2R70A 4MVZA 4YIOA 3LSUA 1TVKA 4J9ZB 1K4CC 1AR4A 4J10A 4J11A 3ABMC 1WA8B 4FZ1A 1WN7A 4LFCO 3AG3C 2B9ZA 3A0BZ 4PA6A 2E5LO 1XBLA 4ICGA 2ODMA 4UV9A 2LGQA 2GDSA 3FYIB 1FKAO 1DGSA 4JI2B 2CAZC 1OCCC 4U3JB 1KC8W 2BTQA 1CEZA 3QO7A 1P7GA 5LL6Y 4X1YB 2M6YA 1S77D 2QKSA 1TUBB 1NU1H 4GKJO 4WFAV 3BPZA 2R9RB 4EEQA 1VMGA 4MT8A 2P4KA 3BFRA 2CH7B 4LFAB 1XNQB 2BSKA 5LP6C 3JYCA 4PHZA 4R50A 2ZM6O 4JI5O 1HR0B 5JWPA 2WWWA 4QIWF 3GB7C 1M56B 4FK5C 1JCHA 3D36A 5KUKA 1M56C 1RM1B 3HKCB 1FXKC 4MVUA 5GONA 3EHBB 3R65A 1BQ0A 1MG1A 4ZIBA 3HKEA 3WG7C 2ZD9A 4R7CA 1XNRO 1GN2A 1VF7A 5LGUA 4DUYO 4JI7B 2OIEA 2F4VO 1Q86W 1H2MA 2VQEO 4U7NA 4JI5B 2C2AA 3AK3A 1MSDA 2UUAB 4TV8A 3IJ4A 1TVKB 2PGGA 3MHSC 2BOBC 4NKGB 3GWKC 3T1HO 2DJVA 2AHYA 3N2GB 4IGGA 3A0HZ 5LA6B 1BZKA 3AG4C 2EJRA 3BEHA 1QLEC 4PA9A 3S3XA 1QLEB 1F51A 4MTGA 2QM8A 1W59A 2OCCB 1LNQA 1EZJA 4LF7B 4R6ZA 4FVMA 1URFA 3EXAA 5C8YB 3ZHRA 1RPRA 2HJDA 1ZTEA 1A32A 3CPWU 1WNSA 1ZSPA 3G67A 3RYHB 4O4IB 3K0DA 1TUBA 4X20B 3K5NA 1FFXA 1DK1A 1IZ3A 5BR8O 4JGSA 1BGYH 4BWAA 3B2EE 3RYIB 1KBHA 1S5LZ 2YUAA 2JDIG 2R9IA 2E74B 1CXZB 2BSKB 2B1GA 2ZNJA 5LOVB 2QSAA 4X65O 2DMXA 1YIJV 3FB7C 2JRIA 3BVOA 3K57A 4UCRA 1VARA 2RNBA 3E22A 1GK9A 1IBLO 5DECA 3KG2A 3APQA 1XQ8A 1B6QA 3QO8A 5H6RA 3JD2A 4K35A 3Q4HB 2VWKA 2PYJA 4DV3O 5EIBC 3ZRXA 4I0XA 2QTSA 3LDEA 1WB8A 3CSXA 5B1AB 3K06A 4XDKA 1JJOA 2JJ2G 5EBWC 4YJ3A 5LGTA 3W7TA 4WFHA 1AJNA 3L70H 5GW7A 2EX3A 4GKKO 3E35A 4TT3G 4YXWG 2P5OA 4MTFA 4RUEA 1SRYA 4U3FH
chains in the Genus database with same CATH topology
2K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9P A; 
#chains in the Genus database with same CATH topology
 5CBF A;  4RAI A;  1RFY A;  1SF9 A;  1OCO B;  1OCO C;  5FL7 G;  5IJ9 A;  4U3J A;  1H2L A;  3ZED A;  2KG7 A;  4LH6 A;  4P30 A;  4EB6 B;  3E86 A;  2QA4 V;  5KAF Z;  4LF4 O;  3CS5 A;  4YY3 B;  1HWY A;  5JQG B;  2HVK C;  3O9O A;  1SQV H;  3K5L A;  1WJZ A;  3HR0 A;  5D5P A;  3JAK B;  2NN4 A;  1FS0 G;  4NXM O;  4KHP B;  5LXT B;  5B1B C;  2DQ3 A;  5JCO A;  4YIP A;  5CN0 A;  4AHC A;  4KP4 A;  3CX5 F;  2ILM A;  3K08 A;  1Z2G A;  3K03 A;  2IJJ A;  3HKD A;  3LUT B;  4N23 A;  2GHY A;  2HR3 A;  2VQF B;  3RN4 A;  5LXT A;  2LJ2 A;  3CRM A;  5EYP A;  5LP6 B;  4FFB A;  3CP1 A;  1DLB A;  2EIN B;  4B3M B;  2A0L A;  4J80 A;  4YHH B;  3ZIA G;  1PD3 A;  4CS2 A;  3LSS A;  2QWO B;  4O4J A;  1KKC A;  4RWU A;  3W7X A;  4DV0 B;  4BR6 A;  2W6I G;  2XND G;  3OEH G;  4NYK A;  2DOS A;  4DRX A;  1US6 A;  2N74 A;  1EN4 A;  3F7V C;  3S3W A;  1R6N A;  3L9D A;  3AG2 B;  4O4J B;  5CBH A;  4OPA A;  1XMO B;  2V4D A;  5EZY A;  5KHJ A;  4DV6 B;  4K8X A;  3N2G A;  3R66 A;  1GAX A;  1DF5 A;  4DR1 O;  4DK0 A;  1V55 C;  4XDL A;  1J95 A;  3E22 B;  1S0V A;  1JPX A;  1IVS A;  2Q6A A;  2KG7 B;  4RO2 A;  2EIJ C;  3CE2 A;  4F6R B;  2Y0P A;  1GKF A;  2DW4 A;  3ETE A;  3BA8 A;  3ZMV A;  2QEX V;  1R1B A;  5CBG A;  4GYC B;  2Y4T A;  1Q7Y W;  2WLM A;  4H37 A;  5IWA O;  5LYJ B;  5KMG A;  1BQZ A;  5KUM A;  1JVM A;  5B1A C;  1P7B A;  4HYO A;  4QNH B;  1I0H A;  5BMV A;  4CS3 A;  2AHZ A;  3M7M X;  1I94 O;  1NR1 A;  4ZHQ B;  3TXS A;  4DXW A;  4DV4 B;  3UT5 B;  4DR4 O;  2YIB D;  3L75 H;  1QCE A;  2FTK A;  1WLE A;  5KMG B;  1IBL B;  3X2Q C;  2LW1 A;  1DTO A;  4TOI A;  5DM6 V;  1GO3 F;  3KKY A;  4UCT A;  4U7O A;  1Y67 A;  4OPH A;  2JJ1 G;  4BIZ A;  1M93 A;  3JCU Z;  1NQT A;  4NXN O;  5AG2 A;  2QWP B;  4JI1 O;  1K34 A;  3HB3 B;  2JGU A;  2Q0O C;  4YJ2 B;  1DF4 A;  1MNG A;  4J9Y B;  1HDJ A;  3OM3 B;  4ZBM A;  1T5E A;  5GTH Z;  4LFB B;  4IHJ B;  4GT1 A;  2Z0A A;  2OT5 A;  2DWD C;  4PDM A;  2PUS A;  5BY1 A;  4B3S O;  4LWS B;  2UXB B;  3JD3 A;  1K9M W;  2QJ1 A;  1QVG U;  1RP3 B;  2V1D A;  5KHH A;  3SJB C;  2Z5U A;  4O2B A;  1KP2 A;  2EJ7 A;  3ABU A;  3F7Y C;  3B09 A;  2RQ6 A;  1IX9 A;  2JS3 A;  4X1I B;  2GTA A;  2G38 A;  4PI0 A;  3RYF A;  4CH4 A;  4J7J A;  2HVJ C;  3TK1 A;  4D7T A;  2Y4U A;  4O2B B;  4LF6 O;  4GKK B;  4JZG A;  2ZR3 A;  2ZXW B;  1AJP A;  4JI0 B;  2LGW A;  3ABK C;  1H2N A;  3JAK A;  4NB5 A;  1BHB A;  5L3E A;  3E2E A;  1JA8 A;  3JAS A;  2ARH A;  4LH7 A;  3LNN A;  4GUN A;  3AG1 C;  5EC1 C;  4MVO A;  3RVZ A;  2IH1 C;  1ZL8 B;  5LGN A;  5IYC O;  3FB5 C;  2DYR B;  3HKD B;  4YY3 O;  4CH6 A;  1X59 A;  4MVS A;  5FLX N;  2CE4 A;  4I7Z B;  5B3S C;  4X62 O;  4JI3 B;  4DV2 O;  2E76 B;  5LMN O;  3J81 N;  3FB8 C;  5IJ0 B;  1MAB G;  3SYC A;  4YHH O;  1K33 A;  5B1O A;  4FM2 A;  4PDV A;  4B3T B;  3F5W C;  4DR3 O;  5KHG A;  5IYD O;  1AR5 A;  2Q9L A;  1FJG B;  5BXZ A;  1VEW A;  4I55 A;  1S76 D;  1Y66 A;  4P2Z A;  1SET A;  2O57 A;  3J80 N;  4DRX B;  1NJI W;  5A9G A;  1XL4 A;  5LMU B;  3STL C;  3CCJ V;  1VQM V;  3NXS A;  4X89 A;  3ZN1 A;  1OZ0 A;  2EIN C;  2XUM A;  4LC1 A;  2H8P C;  3T4Z A;  3CHX A;  5B1B B;  3N2K B;  2YI9 A;  1VIB A;  3J7A U;  4LFB O;  4MS2 A;  2E3C A;  3DC5 A;  3B8N A;  1W0J G;  3KCX A;  2Q8V A;  2X6B A;  3RBZ A;  3CJH A;  2QKA A;  5KHK A;  3BY6 A;  3CCU V;  4IIJ A;  1AI4 A;  4ZOL A;  1M90 W;  4JI4 B;  1XHZ A;  3ABT A;  3JSL A;  3KZI Z;  4FMT A;  4EKW A;  1IXM A;  1G1X B;  5KHI A;  2AZ2 A;  2ADP A;  4D6T H;  4ZOL B;  5HFL A;  4ZHQ A;  4HNA B;  3CC7 V;  5J2U A;  4X66 B;  3T1Y O;  1G4Y B;  2EIJ B;  2ZIN A;  1IBM B;  1RSO B;  2JGD B;  3ZCC A;  1ROP A;  5JH7 A;  4X64 O;  1YJW V;  3SJC C;  3G80 A;  2GTS A;  3BAA A;  4I50 A;  1QLN A;  4PA3 A;  2UUB B;  3CCE V;  3QTC A;  3H1I H;  4FM0 A;  3HKB A;  3N27 A;  5L3D A;  4AQY O;  5C8Y A;  3ZRV A;  3U0Z A;  1K7D A;  2JEX A;  1PL0 A;  1S3J A;  2XAH A;  3ABL C;  2YEV B;  2RCV A;  4P9O A;  1F23 A;  4Z1V A;  2H94 A;  5K1X A;  5LHI A;  1YCI A;  3CB2 A;  3BCC H;  4NTY A;  3CCR V;  2NNU A;  1N0N A;  3WB2 A;  1H8E G;  1O9G A;  4B3R O;  2HG5 C;  1VQ9 V;  1B06 A;  4Q6G A;  2F95 B;  2GUZ B;  1XEQ A;  1JR9 A;  2A9H A;  1HR0 O;  2WLH A;  5E79 Z;  1L0N H;  1Z5V A;  3VQV A;  2DN9 A;  1PM9 A;  2KKW A;  1K92 A;  2UXC O;  1NTM H;  1IBM O;  3G71 V;  2YXY A;  3A2F A;  4OGQ B;  1R6K A;  3I55 V;  2W0X A;  2ZE5 A;  4X65 B;  3I56 V;  2XAF A;  4JI0 O;  3ABM B;  4PV1 B;  3OAA G;  3G4S V;  3W7U A;  2PF4 E;  5CMU A;  3CCL V;  2PZS A;  2IBZ H;  5LOV A;  1NH2 D;  2YXL A;  2BTO A;  1SS3 A;  4IYI A;  1VP7 A;  3UKM A;  4UB8 Z;  2YC0 A;  1XMQ O;  2IJH A;  2GV9 A;  4I5S A;  5JVD B;  4X62 B;  1EBO A;  2A3Q A;  3P30 A;  4LFC B;  3AG2 C;  3UO2 A;  1GTO A;  2EUL A;  2Q5Z A;  2VWJ A;  3SPH A;  4X66 O;  3T1Y B;  4JI4 O;  1Q6I A;  3D36 C;  1NBM G;  4IL6 Z;  1FFX B;  3E89 A;  2ZM6 B;  4WFG A;  4BIO A;  2PYL A;  1K5Q A;  4X9Q A;  5LA6 A;  4UCS A;  2UXX A;  1NZ6 A;  3RYC B;  1PNK A;  1Y74 B;  1H38 A;  3TJT A;  4X88 A;  1MSW D;  1Y6X A;  3BA9 A;  3APO A;  1H2G A;  3X2Q B;  3JD0 A;  1N0J A;  1IXB A;  3DGE A;  1GN3 A;  5EC2 C;  1KD1 W;  1BE3 H;  1Q43 A;  3E8F A;  2B1I A;  4A5U B;  1K3E A;  3ETG A;  3CXC U;  2QE7 G;  2ZDI A;  2ETN A;  3JD1 A;  4WBN B;  4CBC A;  3SYP A;  5IT9 N;  3ZRS A;  3QF7 A;  5D5Q A;  5J2T B;  4TUY B;  3OTF A;  3OR6 C;  4E4E A;  1Q8I A;  4PDL A;  2JEU A;  3CRQ A;  5CA3 A;  1EM1 A;  4XBF A;  3ASN C;  3K79 A;  1VQO V;  1H2K A;  4QPJ A;  4TV9 A;  4JAA A;  4F4L A;  1TA8 A;  1FYJ A;  4NTX A;  3DXR B;  1G8M A;  1BMF G;  2LFR A;  4Q20 A;  1OJH A;  2VQF O;  1WA8 A;  1TUE B;  4X1K B;  3RGB A;  3L72 H;  4LFA O;  4LBE C;  4R8C A;  4ABM A;  1QNM A;  5LHG A;  1PV0 A;  4K0K B;  1Q5O A;  2WA3 A;  1L1F A;  4LNU A;  3SPJ A;  2UU9 O;  4F6R A;  1ENV A;  5CA1 A;  4GKJ B;  4LF7 O;  4NR1 A;  5IY5 B;  4DUZ B;  1YJN V;  3WG7 B;  4I9Q A;  1XL6 A;  3RW0 A;  3ZX6 A;  4TQD A;  4W4K A;  2P67 A;  1VF6 A;  3ZHU A;  2UUB O;  2FYU H;  2ZT9 B;  4DV1 O;  1W2B U;  3OMA B;  4MW3 A;  1S72 V;  4OXS A;  3D3I A;  2P06 A;  2ZDI C;  3FAV B;  2QM7 A;  3AG7 A;  4B3R B;  2V7Q G;  2NLJ C;  1NR7 A;  4WFB V;  1ZWI C;  4W4L A;  3CCQ V;  5CA0 A;  2R9A A;  2XAQ A;  4YJ3 B;  3OTO O;  3WU2 Z;  3UM7 A;  1K5S A;  4UCU A;  3ETD A;  3HKE B;  4LP8 A;  1M1K W;  4AIL C;  2F23 A;  2KSD A;  4DR2 B;  1KKD A;  3EVK A;  4KXR A;  1OCR C;  1JOY A;  2JIZ G;  4UFZ A;  4G28 B;  4DV3 B;  2CTQ A;  2BE3 A;  3AEI A;  4WCE V;  5HFM A;  4B3T O;  4P9P A;  4ZI7 A;  2DWE C;  2YS8 A;  1NT2 B;  2HP8 A;  4HZ3 A;  1AI5 A;  1N33 B;  4GX2 A;  2D3O W;  2L6L A;  3MD0 A;  2UUC O;  3K9S A;  4GCZ A;  5JJN B;  3ETQ A;  1OCZ B;  3VQW A;  1GN6 A;  1VQ8 V;  3HKC A;  2WLK A;  1JFF A;  1Y4M A;  3ZMU A;  3DSQ A;  1J5E B;  2ZKO A;  1YJ9 V;  2QGN A;  1ARO P;  4X1Y A;  4DR2 O;  4H33 A;  2M7W A;  4DV6 O;  2CTR A;  2ZIO A;  1VF5 B;  1Q6U A;  5EBM C;  5E1A C;  2P7T C;  5B5E Z;  2A7W A;  3P3N A;  1SA0 B;  5LMU O;  4DR1 B;  1N33 O;  2A06 H;  2F43 G;  3RVY A;  3SJA C;  4LF8 O;  4I55 B;  2UXB O;  2YI8 A;  1NS1 A;  3OMI B;  2LP7 A;  1SER A;  2YIC A;  2FL4 A;  4TV8 B;  4JTA B;  1VQN V;  3RYF B;  4L87 A;  3ZHT A;  2IJI A;  2ITC C;  4O2A A;  1RM1 C;  2QDO A;  4O4H B;  1V54 C;  4PDR A;  1N34 B;  3JAR B;  4LF8 B;  1ZAU A;  3JAS B;  5CA1 B;  4HBN A;  3SPG A;  1UPG A;  1FFT B;  4IIJ B;  3B4S A;  4O2A B;  3JAM N;  3ASO C;  3DXR A;  2BCC H;  1I5X A;  3UT5 A;  4DK1 A;  4DR5 O;  1TGO A;  2YDE A;  5JJJ B;  1D5A A;  3SDL A;  3ZMZ A;  3K5O A;  3AG3 B;  1WPB A;  3CXH F;  4JYB A;  4X64 B;  1M9N A;  1BS3 A;  4G27 B;  4N21 A;  4PA7 A;  2QR4 A;  1XHX A;  2QWQ B;  2RMK B;  2P4V A;  1IBK B;  4D7S A;  2F93 B;  4I9W A;  4JPR A;  5CB4 A;  4JTD B;  3CCS V;  5J2T A;  5JH7 B;  1TAE A;  1YF2 A;  2Q7H A;  3ASN B;  2H3O A;  1FAF A;  1WPX A;  4KUM A;  3THO A;  3IAY A;  4MW8 A;  5BMV B;  2UU9 B;  2ITD C;  3AG4 B;  2EIM B;  3IC9 A;  1E79 G;  1E1R G;  1NTZ H;  4LR3 A;  2XAJ A;  1OCZ C;  3ZHV A;  1PP9 H;  4KHP O;  4DUZ O;  2Q69 A;  2QM4 A;  1I94 B;  2AW9 A;  1XI1 A;  3L73 H;  1KUQ A;  1MA1 A;  4MSW C;  2Q4P A;  3N2K A;  1SZX A;  4JAS A;  5IWA B;  3SGI A;  3LNM B;  5IYB O;  1SES A;  3RFR A;  4DW1 A;  4FJC C;  2GSM B;  3RT3 C;  1OCR B;  3JSN A;  1EN6 A;  2EBO A;  5DED A;  2PY5 A;  3A8T A;  1PNM A;  5LBQ A;  1MZF A;  2P22 C;  2ZQM A;  3HKB B;  3U11 A;  2OWO A;  3CCV V;  2XT9 A;  5GTI Z;  1SQF A;  4UCO A;  3T1C A;  1XDC A;  1N32 B;  2UXD B;  4RQF A;  3VBB A;  1QR9 A;  2WLI B;  1Q3E A;  1ZLZ A;  4UV8 A;  4WF9 V;  2YXH A;  1VQ7 V;  1JQ0 A;  1XMQ B;  3OE7 G;  4UVB A;  5KA5 A;  2DYS C;  4UXN A;  3TCU A;  2XAG A;  5EBL C;  3NR7 A;  2IU0 A;  3ICX A;  3K59 A;  1AJQ A;  1VQ5 V;  4FFB B;  1Q81 W;  4DV7 O;  3SPI A;  2DYR C;  4JI6 O;  1KU9 A;  2FKX A;  3L71 H;  4B08 A;  1WP7 A;  4X8A A;  1SA0 A;  3AG1 B;  2OCC C;  4EFE A;  3PJS K;  1THZ A;  4GX1 A;  3K5M A;  2WLN A;  5JCO C;  4FLW A;  2OCH A;  1UJW B;  3CWB H;  1YXB A;  1YDX A;  1FD9 A;  4OX9 B;  2DE0 X;  1MOF A;  2IU3 A;  3TET A;  1YVW A;  2ZNI A;  3VQX A;  3JAW B;  3W7W A;  3OGI B;  4NVP A;  3RYC A;  4J7K A;  5KA6 A;  5IYZ A;  4DV1 B;  3SYQ A;  1IBK O;  4FLX A;  4DR3 B;  1M57 C;  4FLU A;  3MHH C;  1FXK B;  3JAL B;  1ZUQ A;  1BL8 A;  1Q6H A;  4LF9 O;  2D2C B;  3ZN0 A;  2ZE8 A;  2JVD A;  4MVM A;  5JJE B;  4PI2 A;  2A79 B;  1I7F A;  1QVF U;  1U97 A;  2X6A A;  4TWK A;  1R3K C;  4WBN A;  3P3P A;  5EZY B;  3E8G A;  4H44 B;  1HNX B;  1P4R A;  2JGD A;  4FLT A;  3F5T A;  2LFS A;  2X7R B;  1O9H A;  1FPO A;  3CEI A;  4FLV A;  1VQK V;  2F4V B;  1X4T A;  4CS4 A;  1NVP B;  5B3S B;  3OR7 C;  3E83 A;  3K0G A;  5CB4 B;  3CC4 V;  1VQL V;  2XAS A;  4LF9 B;  1U96 A;  2QTO A;  3SR2 C;  2ZIM A;  3UCS C;  3UQ8 A;  3JAT B;  3SJQ C;  5TIS Z;  2YEV A;  3IFX A;  4GX0 A;  1SQG A;  2HHH O;  3ML0 A;  1HW7 A;  3SYO A;  1IDS A;  4J7Z A;  3ZBH A;  2Y48 A;  1XRE A;  5EK0 A;  4HAM A;  3JAT A;  2K1E A;  5C93 A;  4B3S B;  2N04 A;  5L3F A;  4PEL A;  3ABK B;  3AK2 A;  3BHP A;  5B1N A;  1YTF D;  1YHQ V;  2PI4 A;  1PPJ H;  4JF3 A;  1P84 F;  1XUQ A;  1QBZ A;  1E1Q G;  3TGU H;  1HNZ O;  1Y76 B;  2F1M A;  2Q7G A;  3H1J H;  5H2F Z;  4K3A A;  1NKD A;  1FXK A;  4PD4 F;  2JK5 C;  1XNQ O;  1F4M A;  4OX9 O;  4FLY A;  4MVQ A;  3OW2 U;  4DW0 A;  4CH5 A;  1RPO A;  2N05 A;  1AVM A;  4TQF A;  3C3T A;  2WLI A;  5IDJ A;  3FD9 A;  2ZE7 A;  4CZZ A;  2Q7E A;  2XHB A;  3TXQ A;  5L3G A;  3ABL B;  4K0K O;  2Q67 A;  1AR1 B;  2CTW A;  2UUA O;  1CPY A;  1V9P A;  4JV5 B;  2MW2 B;  3ZJZ A;  2X6C A;  2WSS G;  1VF6 C;  2EZO A;  3FAV A;  1HNW O;  2UXC B;  1P49 A;  3OUS A;  1H8H G;  1UFI A;  2WAM A;  4JI7 O;  4BIU A;  2XOK G;  1EN5 A;  1HNX O;  1CP9 A;  1YIT V;  2HKO A;  3WB0 A;  1GN4 A;  4FIP C;  1KP3 A;  4FFK A;  1FJG O;  4B3M O;  4JI3 O;  2HJF C;  2IW5 A;  3WFV A;  3RYI A;  4TV9 B;  1XOU A;  4QGP A;  3M99 B;  2MK3 A;  4JV5 O;  2HHH B;  3A0R A;  4X1K A;  3JAW A;  1K73 W;  5GON B;  4JI6 B;  3C90 A;  3W7S A;  1RSO A;  4JI8 O;  1JMK C;  5CA0 B;  1QR8 A;  2W6J G;  4UB6 Z;  3JAL A;  5IJ9 B;  2Q73 A;  2RN9 A;  3FX7 A;  3I5D A;  3QNE A;  4ZKI A;  2CGO A;  3LDC A;  2UXD O;  2CTP A;  5H5N A;  1BHA A;  5H9C A;  2OTJ V;  3GWO A;  2X0L A;  1IUR A;  2CH7 A;  1H2S B;  3B8M A;  2EIL B;  1GH6 A;  2ATK C;  3CC2 V;  1JJ2 U;  1COW G;  1AB3 A;  3FB6 C;  3GVM A;  1BT8 A;  2P90 A;  2Y69 C;  2ZR2 A;  3FFQ A;  4UUJ C;  5ITZ A;  3OMN B;  4JYA O;  2HLD G;  5J2U B;  4DV7 B;  2CUG A;  2GUZ A;  1KYO F;  3Q4H A;  1VQ4 V;  4H13 B;  2IH3 C;  5KAI Z;  4DR7 O;  3CD6 V;  3JD4 A;  3H01 A;  4DR6 B;  3LDD A;  2ADQ B;  1S5H C;  2BOC C;  4JTC B;  4O4I A;  4I4T B;  2JS5 A;  2CK3 G;  3JCZ A;  2HFE C;  2Y69 B;  2OIG A;  3QVN A;  1HNW B;  1EZV H;  4FPP A;  3ZS8 C;  3FYE B;  1GM9 A;  4JYY A;  4NTW A;  2YIB A;  1KQS U;  4QE7 A;  1SKV A;  4ZI7 B;  4EFB A;  3CMA V;  4I4T A;  2XTA A;  2QKC A;  3CRA A;  1YZB A;  4HNA A;  4LF5 B;  1Z5W A;  4JYA B;  1YEW A;  4O4L B;  3ZRW A;  4BW9 A;  1N36 B;  2WLJ A;  2IJK A;  1MMM A;  3LSQ A;  3H9V A;  5KX5 B;  1BSM A;  4QJF B;  1D2D A;  1AI7 A;  1QU7 A;  4I50 B;  3ZMT A;  1GM8 A;  1HNZ B;  3L74 H;  2YIA A;  1OV9 A;  5F2V O;  4K8Z A;  1N32 O;  4DO2 A;  3ZHS A;  4FM1 A;  1NVP D;  2KQX A;  4DR4 B;  3DC6 A;  2FB5 A;  2LQT A;  4JYC A;  4AI8 A;  2WA4 A;  2VS0 A;  2OTL V;  1HP8 A;  1XNR B;  1LUW A;  1QQC A;  2EZP A;  4QPK A;  4JAV A;  2WPD G;  4DR5 B;  4GLX A;  4XDJ A;  5ITZ B;  2GBO A;  1LUV A;  4IT5 A;  1Y76 A;  2RJZ A;  2YSU B;  2QWR B;  2VRZ A;  3VOU A;  3MAQ A;  4E2L A;  1NI8 A;  1R3I C;  2W0F C;  4DV5 B;  1VQP V;  5EIB D;  3JAR A;  1SQX H;  4UVA A;  5JVD A;  5IE9 A;  4LCU C;  3KCY A;  4B7K A;  4DV2 B;  3OGC C;  3E8B A;  1M57 B;  1XMO O;  1R6T A;  3CRC A;  2WLL B;  3BRC A;  2RDC A;  1L0L H;  5K1P A;  4YJ2 A;  1VQ6 V;  1SQQ H;  2K9P A;  5LYJ A;  4PJ0 Z;  2E75 B;  2FML A;  1F4N A;  1SQP H;  3UO3 A;  1ORQ C;  1YSC A;  1JX9 A;  4QE9 A;  3RWR D;  4BAY A;  2LO1 A;  4RUF A;  2B5U A;  4H0L B;  5FNV A;  3ZRW B;  5FPR A;  4AQY B;  4MTX A;  1GRJ A;  4GZR B;  4JZ2 A;  1S5J A;  4DV0 O;  4O4H A;  2Z3Y A;  2BTQ B;  2AGA A;  1Q90 D;  1LR1 A;  3BAB A;  1AI6 A;  3D3Q A;  2Q68 A;  3K3W A;  3DTU B;  1SQB H;  1K97 A;  4WFF A;  3STZ C;  4DV5 O;  1MZE A;  4CC6 A;  3B40 A;  4JAU A;  1I08 A;  2ZE6 A;  2IM9 A;  2KB1 A;  4MVR A;  4GX5 A;  1J5E O;  2EIK C;  1AP5 A;  4J42 A;  1YI2 V;  2E5L B;  1SC5 B;  4DV4 O;  1N8R W;  4LWS A;  1V55 B;  1NTK H;  5EYP B;  1Y74 A;  5LP6 A;  4JI8 B;  4G2K A;  3H1H H;  3T2M A;  4ASU G;  1Q82 W;  3ZHQ A;  1V54 B;  2DYS B;  5LMN B;  4X1I A;  4F6E A;  2PI5 A;  4UCV A;  3B77 A;  4Z2W A;  1WAZ A;  1N34 O;  2Y0I A;  4J41 A;  4UVC A;  4PA4 A;  1R73 A;  2PTM A;  3SPC A;  1B3Q A;  4IHJ A;  3IC7 A;  1M4U A;  5DN6 G;  1R3J C;  3U10 A;  4NXM B;  1GM7 A;  3O65 A;  2WLL A;  1EFR G;  3H1L H;  5BR8 B;  5IY5 C;  1N4C A;  1XIL A;  4IYH A;  3CME V;  2EIK B;  4CH3 A;  1ZL8 A;  4C7U A;  1NH2 B;  4B7E A;  4O4L A;  4DYL A;  2CGN A;  4WFE A;  5FPO A;  2EIL C;  1FXH A;  5KX5 A;  3G6B A;  1N36 O;  2ZCE A;  2UUC B;  3CRR A;  5FNV B;  2LW7 A;  2OYQ A;  1OHH G;  1I5Y A;  3IGA C;  3PN1 A;  1OCC B;  5KLV H;  1B04 A;  2L35 A;  4FLZ A;  1K4D C;  3K9A A;  3SYA A;  1K8A W;  2VQE B;  2F66 C;  4LNU B;  3OTO B;  3AK1 A;  2EIM C;  1GMG A;  5L3B A;  2R72 A;  3FKS G;  1PKX A;  4LF5 O;  1KMI Z;  5H6Q A;  4X20 A;  2QWN B;  4Z1M G;  5LHH A;  2ZXW C;  4NXN B;  1FXV A;  4LF4 B;  3OD4 A;  3T4D A;  3ASO B;  2UXN A;  5L3C A;  2YID A;  1F7Y A;  4FZ0 A;  4TSF G;  4DR6 O;  1SZT A;  4LF6 B;  1D5N A;  1KB9 F;  2DQ0 A;  3P32 A;  4KFM A;  4TUY A;  5IJ0 A;  3HPL C;  3K58 A;  1BCC H;  1KEC A;  4MTO A;  3OFN G;  1W0K G;  3K04 A;  3RYH A;  2AZ0 A;  3M8A A;  1QHT A;  1WP8 A;  4CC5 A;  5BZB A;  3OUF A;  5B66 Z;  4DR7 B;  2Q0A A;  4RQE A;  1G6U A;  3E8H A;  4KL1 A;  5A2Q N;  1ZX3 A;  1WB7 A;  3EFF K;  3D8C A;  1R3L C;  4JI2 O;  5J9P C;  3VQY A;  3T1H B;  3C3S A;  4L8J A;  4DUY B;  1PL4 A;  1L8D A;  3ZMS A;  4BW5 A;  2AXT Z;  3QG5 A;  5IYZ B;  3CYO A;  2HEP A;  1AP6 A;  2CDY A;  3CCM V;  1AIL A;  3CJH B;  3MDS A;  1JFF B;  3H1K H;  4EB6 A;  1YTF B;  2NR5 A;  3G6E V;  4I0X B;  3QO5 A;  3OT7 A;  1PNL A;  2P6J A;  3OEE G;  1M5I A;  5JQG A;  3WB1 A;  4JI1 B;  2R70 A;  4MVZ A;  4YIO A;  3LSU A;  1TVK A;  4J9Z B;  1K4C C;  1AR4 A;  4J10 A;  4J11 A;  3ABM C;  1WA8 B;  4FZ1 A;  1WN7 A;  4LFC O;  3AG3 C;  2B9Z A;  3A0B Z;  4PA6 A;  2E5L O;  1XBL A;  4ICG A;  2ODM A;  4UV9 A;  2LGQ A;  2GDS A;  3FYI B;  1FKA O;  1DGS A;  4JI2 B;  2CAZ C;  1OCC C;  4U3J B;  1KC8 W;  2BTQ A;  1CEZ A;  3QO7 A;  1P7G A;  5LL6 Y;  4X1Y B;  2M6Y A;  1S77 D;  2QKS A;  1TUB B;  1NU1 H;  4GKJ O;  4WFA V;  3BPZ A;  2R9R B;  4EEQ A;  1VMG A;  4MT8 A;  2P4K A;  3BFR A;  2CH7 B;  4LFA B;  1XNQ B;  2BSK A;  5LP6 C;  3JYC A;  4PHZ A;  4R50 A;  2ZM6 O;  4JI5 O;  1HR0 B;  5JWP A;  2WWW A;  4QIW F;  3GB7 C;  1M56 B;  4FK5 C;  1JCH A;  3D36 A;  5KUK A;  1M56 C;  1RM1 B;  3HKC B;  1FXK C;  4MVU A;  5GON A;  3EHB B;  3R65 A;  1BQ0 A;  1MG1 A;  4ZIB A;  3HKE A;  3WG7 C;  2ZD9 A;  4R7C A;  1XNR O;  1GN2 A;  1VF7 A;  5LGU A;  4DUY O;  4JI7 B;  2OIE A;  2F4V O;  1Q86 W;  1H2M A;  2VQE O;  4U7N A;  4JI5 B;  2C2A A;  3AK3 A;  1MSD A;  2UUA B;  4TV8 A;  3IJ4 A;  1TVK B;  2PGG A;  3MHS C;  2BOB C;  4NKG B;  3GWK C;  3T1H O;  2DJV A;  2AHY A;  3N2G B;  4IGG A;  3A0H Z;  5LA6 B;  1BZK A;  3AG4 C;  2EJR A;  3BEH A;  1QLE C;  4PA9 A;  3S3X A;  1QLE B;  1F51 A;  4MTG A;  2QM8 A;  1W59 A;  2OCC B;  1LNQ A;  1EZJ A;  4LF7 B;  4R6Z A;  4FVM A;  1URF A;  3EXA A;  5C8Y B;  3ZHR A;  1RPR A;  2HJD A;  1ZTE A;  1A32 A;  3CPW U;  1WNS A;  1ZSP A;  3G67 A;  3RYH B;  4O4I B;  3K0D A;  1TUB A;  4X20 B;  3K5N A;  1FFX A;  1DK1 A;  1IZ3 A;  5BR8 O;  4JGS A;  1BGY H;  4BWA A;  3B2E E;  3RYI B;  1KBH A;  1S5L Z;  2YUA A;  2JDI G;  2R9I A;  2E74 B;  1CXZ B;  2BSK B;  2B1G A;  2ZNJ A;  5LOV B;  2QSA A;  4X65 O;  2DMX A;  1YIJ V;  3FB7 C;  2JRI A;  3BVO A;  3K57 A;  4UCR A;  1VAR A;  2RNB A;  3E22 A;  1GK9 A;  1IBL O;  5DEC A;  3KG2 A;  3APQ A;  1XQ8 A;  1B6Q A;  3QO8 A;  5H6R A;  3JD2 A;  4K35 A;  3Q4H B;  2VWK A;  2PYJ A;  4DV3 O;  5EIB C;  3ZRX A;  4I0X A;  2QTS A;  3LDE A;  1WB8 A;  3CSX A;  5B1A B;  3K06 A;  4XDK A;  1JJO A;  2JJ2 G;  5EBW C;  4YJ3 A;  5LGT A;  3W7T A;  4WFH A;  1AJN A;  3L70 H;  5GW7 A;  2EX3 A;  4GKK O;  3E35 A;  4TT3 G;  4YXW G;  2P5O A;  4MTF A;  4RUE A;  1SRY A;  4U3F H; 
#chains in the Genus database with same CATH homology
 2K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...