2K9PA

Structure of tm1_tm2 in lppg micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Pheromone alpha factor receptor
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.920 Mainly Alpha Orthogonal Bundle Helix Hairpins Pheromone alpha factor receptor. 2k9pA00
2K9PA
chains in the Genus database with same CATH superfamily
2LQTA 2CAZC 3BA9A 2BSKA 3E35A 4DV0B 4YY3O 2V1DA 1QU7A 5L3GA 2LP7A 4LWSA 1FPOA 1THZA 5LOVB 2O57A 3N27A 5BMVA 2WLLA 4MW3A 1N36B 1O9GA 3ETDA 1E1QG 2JS5A 2FYUH 2VQEB 1BE3H 1PNKA 1XOUA 1GKFA 2DQ0A 4B3SO 3JD4A 4ZHQB 3W7SA 2HHHB 4BIUA 4JI0O 3ASOB 3CB2A 3K9AA 5IJ9B 3JAWB 3CXCU 3SYQA 3LNNA 4ZOLB 1EN5A 3ZBHA 4F6RA 1BQZA 3UO2A 4O4HB 4WBNB 1QVFU 3TK1A 2Y69C 2EIKC 2EILB 1Z5VA 3L74H 4I9QA 1SA0B 1M4UA 1BZKA 2V4DA 5CA0B 4GKJB 2VQEO 1YJWV 4JZGA 1Y6XA 1JVMA 5L3EA 1W0JG 1VQ7V 2GV9A 2OCCB 3W7TA 2YICA 3OR7C 1Y66A 2ZIMA 3SGIA 1FFXB 2QWPB 4IT5A 2CTRA 1WJZA 4UVAA 2DJVA 4LF6B 3RYFA 1MZFA 3P30A 4ASUG 2UXBB 2CH7A 1QQCA 5L3FA 1Y67A 3ABKC 4Q6GA 1XDCA 4X64B 2Q8VA 3AG1C 2XASA 2VWJA 3VOUA 1H8HG 2NNUA 3CP1A 4I4TA 4F6EA 2D3OW 1K34A 4LP8A 1SS3A 4JI6O 4DR3O 2XHBA 4TUYA 2XAQA 3ABLB 4HYOA 3CCEV 1VQOV 4IL6Z 4O2BA 2A3QA 2ZT9B 1KP2A 4R6ZA 4I5SA 1LNQA 2ITCC 1NT2B 1AI7A 2EILC 5IYZA 1AP5A 3JCUZ 1LR1A 1W2BU 2ARHA 2E76B 3OAAG 4LF5O 3OMAB 4TV8B 5JQGB 3U10A 2IU3A 3CCMV 3ZIAG 4PA3A 2RQ6A 1GN3A 1SQBH 4BW5A 4AHCA 1M90W 5LGNA 1I94O 4QPJA 4QGPA 3SJQC 1XMQO 2P22C 4PI0A 1ROPA 1Q5OA 4NTYA 3FB8C 2PUSA 3CD6V 1VQ5V 3JD2A 4H37A 4MVMA 3ZHRA 3HKBA 3VQXA 2ZDIC 3ABKB 2YSUB 4I4TB 4PDVA 1YITV 1NTMH 1VARA 2DWDC 2ZNIA 1BGYH 3ZMUA 4JYAB 4PELA 3R65A 1X4TA 3JASA 3G67A 3K58A 2P4VA 3CC7V 1VQ6V 2OYQA 1VF6C 5J9PC 2CH7B 4I55B 4RQFA 5L3DA 3FAVA 2GUZA 1NU1H 1IBLO 4IGGA 3GVMA 1N33O 4B7EA 1J5EB 1L0NH 1RSOA 3X2QC 1PNLA 2ZE5A 2VQFO 1M1KW 2Q4PA 1N32B 4O4JA 4DR5B 3H01A 1R6NA 4ZKIA 2RCVA 4DV6O 2GTAA 5KA5A 2VQFB 3UT5A 3EVKA 5EC1C 1IXMA 2WA4A 2LO1A 5H2FZ 3K03A 5JJJB 1F4MA 4ZI7B 1CEZA 3CCLV 3GWOA 1XI1A 2V7QG 3B2EE 3WB2A 2RNBA 4O4IB 2DYRB 1MNGA 1TUBB 1TVKA 1K33A 1XILA 5IYCO 4CS2A 1SQFA 1O9HA 3E22A 3SJAC 4E4EA 1Q43A 4A5UB 4RQEA 1R73A 5LHIA 2B1GA 3ABLC 5CN0A 2YDEA 1JPXA 3RYHA 1YEWA 1XBLA 2Q7GA 3H1JH 4X62B 1NI8A 3M99B 4MVZA 4DV5B 4AILC 3CRRA 2PZSA 2UXBO 4J41A 2BTQA 3ZJZA 1Q90D 3ZRSA 3QVNA 4LCUC 4MW8A 2F1MA 1N33B 1XMOO 3U11A 4DV4O 1XEQA 4LFBB 5FPOA 4CZZA 2HLDG 4FM1A 4DV6B 4EFEA 3FB7C 2A06H 4HBNA 4KHPB 3AG1B 2BSKB 3IC9A 2Q0AA 4JI1O 2R72A 3N2KB 1AJNA 1D5NA 1IBKO 4JI5B 1M56B 4JYCA 3K9SA 4FLZA 4UCSA 4K35A 1SQVH 4MS2A 1GH6A 4KFMA 5E79Z 3N2GA 1J95A 1WB7A 1WP8A 2D2CB 4WFBV 3EFFK 4MT8A 2PI5A 1EFRG 2YS8A 5B1AC 1OCCB 2Y4TA 3UCSC 3AG7A 2YI9A 1COWG 3VQYA 5CBFA 1PP9H 2UXXA 3SPCA 4LF8B 4PI2A 4FZ0A 1FJGO 4DR4O 1IDSA 4J42A 4J7KA 4WFGA 2QKSA 1G1XB 4BW9A 5EBMC 1ZL8A 4TV9B 3T1YO 3AK3A 2FB5A 1K73W 4XDJA 1HR0B 3B8MA 1H2KA 5HFLA 1R3JC 1TVKB 4TOIA 5BR8B 4DYLA 1YJNV 1GAXA 1VF7A 5JWPA 2BTQB 1H38A 4HNAA 4I0XA 4LH6A 3CCSV 1DGSA 3Q4HB 4JF3A 2IH1C 2Y0IA 1L0LH 2YUAA 2HHHO 3BVOA 1DF5A 1ORQC 4FFKA 2KKWA 3T1HB 2Z5UA 3CCVV 3ZMVA 3RBZA 2K1EA 1VQNV 2Y0PA 4O4JB 1OCCC 4AQYO 4TSFG 3RYCB 2ITDC 4MVOA 2RJZA 1TUBA 4JPRA 4JTDB 1PKXA 4MVSA 4LF4B 3DC6A 3LUTB 3CSXA 4FMTA 3E8FA 5EIBD 1XQ8A 3O65A 2JJ1G 1H2LA 1PL4A 3LSUA 1TGOA 4LF4O 4DV1O 1AJQA 4R50A 2P90A 4IIJA 3WB1A 4UCOA 2P6JA 3JYCA 1SKVA 2YIBA 3NR7A 2YIDA 3CJHB 1V9PA 2JS3A 4TWKA 5K1PA 2HJFC 3OW2U 3CRAA 4OPHA 4R8CA 3CE2A 4DR2B 1HNWB 4CH5A 3HKCA 1F7YA 4I55A 3ABUA 1N34B 1L8DA 2WLLB 3M8AA 5B1BC 1K9MW 4YHHO 1QHTA 4QIWF 1KD1W 3L9DA 2QJ1A 5JJNB 4LF9O 2QWQB 4I50A 1PM9A 5GONA 4MVQA 2EX3A 3T1YB 4ZIBA 4P2ZA 2PI4A 1KU9A 1ZWIC 4J9YB 1AI5A 3KCXA 4EB6A 4OX9B 1Y74A 2M7WA 2WLMA 2UUAO 4TV9A 3ZHTA 3CRMA 1GM9A 2EINC 2BCCH 5GONB 4FIPC 2NN4A 3TETA 4B3RB 3VBBA 5JQGA 1VQ4V 3I5DA 3LDDA 5CA3A 1D2DA 4PA7A 3SYCA 3BPZA 2HR3A 1Q7YW 1H2GA 2HP8A 1BT8A 4Z1VA 2XOKG 4QNHB 4O2BB 1SZXA 3JAMN 1S76D 5EIBC 4WCEV 3JD0A 1YIJV 2F95B 4O2AA 1EBOA 4DR5O 2WPDG 1G6UA 1ZTEA 3UM7A 1GM8A 1B3QA 3B8NA 3CCUV 1AROP 4J7JA 4JV5O 2CTQA 4H13B 1IBLB 2H3OA 1VMGA 3E22B 4RUFA 4GKJO 1BS3A 4O4HA 2AHZA 2QE7G 4JI4B 3JD3A 1AI4A 2QGNA 4FVMA 3CHXA 4U3JA 4O4IA 3RVYA 4DR2O 3ETGA 2PY5A 3E8BA 1SQPH 2WA3A 5LP6C 2KQXA 3CYOA 1JFFA 1NVPD 3SPHA 1AI6A 2BTOA 1M93A 3SDLA 3UQ8A 1WPBA 2Q0OC 4U3JB 4EEQA 5EC2C 2YIBD 1HNXO 4E2LA 5B3SB 5CA1A 2DWEC 1N8RW 1Q6IA 5LOVA 4K8XA 4FLXA 1TUEB 4LWSB 1YSCA 1IZ3A 4HNAB 1VIBA 2PF4E 2ZNJA 3G71V 4LF6O 1HNZO 2UXCO 1NJIW 1FFTB 1JJ2U 1QNMA 5IJ9A 4FK5C 1VF6A 5H5NA 4DRXA 1NZ6A 1QLEC 3MDSA 2Q73A 1KQSU 2HVKC 5JJEB 2F23A 3B4SA 1SRYA 1WP7A 4YJ3A 1ZAUA 3OGIB 5DECA 5KX5B 3UT5B 4X88A 4PJ0Z 4DXWA 5CBGA 3HKEB 2YXLA 1AR1B 2F93B 3OFNG 4CH6A 3CMEV 1GN2A 3H1HH 2VS0A 3VQWA 4CC6A 1AR5A 2WLNA 3K06A 1K8AW 2Q7HA 5LA6B 4G27B 4QPKA 2ADPA 1K92A 4TV8A 5LMNO 1XNRO 5GTHZ 4LFAB 2Q5ZA 4JGSA 3CPWU 1OCOB 1XHXA 2P67A 2ILMA 3T1CA 3J7AU 4DV7O 5IJ0B 1FD9A 3SYAA 1FXHA 2KSDA 4PV1B 1SC5B 2ZCEA 3DTUB 1Y74B 3E86A 3CRQA 4YY3B 3ETQA 3UKMA 4JI2B 5FL7G 1WNSA 4B7KA 1EZJA 3JATB 2QDOA 4JV5B 4H0LB 1WA8B 2DYSB 1EZVH 1YF2A 1NH2D 2VWKA 3HKDA 3THOA 2OCHA 3JSLA 1OCZB 4KUMA 4UCRA 3G6BA 4X20A 3AK1A 2IM9A 1MZEA 2R70A 2GDSA 4GLXA 3S3WA 3ABMC 2DQ3A 3J80N 3E8GA 4OXSA 5LYJA 4YIOA 3K0GA 2WLKA 3ZEDA 2ZM6O 4DRXB 3AK2A 3OEEG 1FS0G 4JI7O 1BMFG 3QO7A 5AG2A 2IJKA 1AVMA 3WFVA 2LJ2A 1JMKC 5C93A 4WF9V 4JI4O 3OUFA 4ZI7A 1I0HA 5LL6Y 2CDYA 1G8MA 2UUCO 2UXNA 2CGOA 1K7DA 5KMGA 4EFBA 4WFEA 4X1YB 1EN4A 4QE7A 3IGAC 3ASNC 3GWKC 1K4DC 2RN9A 4OX9O 2YI8A 4NVPA 3IC7A 1QLEB 3F5TA 5LXTB 3QG5A 4NB5A 1WA8A 4DUZO 5KHHA 1SERA 5B1OA 2EINB 1TAEA 4LFCB 4PDLA 3A0HZ 3EXAA 3MHSC 4UUJC 5B1BB 1P7BA 3SJBC 1BHBA 4N23A 1B06A 1WPXA 1M57B 3TXQA 4JI0B 3B40A 4X20B 2X7RB 3H9VA 4DR7O 3TGUH 2B9ZA 3L75H 3FYIB 3HKBB 4K0KB 3A8TA 3JAWA 3K79A 2ETNA 3CMAV 5B3SC 4IHJB 5D5QA 3A0RA 5B1AB 4KL1A 1IBMB 4B3MB 3WU2Z 3LDEA 4OPAA 1FXKB 4DR1O 2AGAA 4K0KO 2EJRA 2LW7A 4DR4B 1GTOA 4DV0O 4BR6A 3OM3B 4L87A 1RPOA 3STLC 4DK0A 1NKDA 3WB0A 5BMVB 2ZDIA 1MOFA 2EIMC 3OGCC 2C2AA 1V55C 1RFYA 2X6BA 1P4RA 1Y76B 2AW9A 1NR7A 3G6EV 1VQMV 5FLXN 4DR6O 2ATKC 2XT9A 3OT7A 1URFA 3JCZA 2OT5A 1YDXA 5LMUB 1AP6A 1IBKB 5KAIZ 3ZHUA 1DF4A 4IHJA 2WLHA 2ZXWB 4ZBMA 3TCUA 2JGDA 2CTPA 1H8EG 1QR8A 1N0JA 1RM1B 2DN9A 1MSWD 2ZR2A 3K3WA 5KHKA 5CB4B 1TA8A 2E3CA 2UUAB 5C8YA 5BR8O 5J2TB 2QKAA 2ZR3A 2OTJV 4X62O 3D8CA 2QWNB 3RYIB 3C3SA 4QE9A 1FFXA 4FLTA 4JASA 4NXMB 1VQLV 1ENVA 2Q68A 3APOA 2XTAA 2YC0A 1JCHA 3EHBB 3FB5C 2FKXA 4WFHA 2E5LO 2FTKA 1KECA 1P7GA 3ZHVA 2OTLV 1VQ9V 1YCIA 3T4DA 4IIJB 4GZRB 4X1YA 3NXSA 3W7XA 4FFBB 1BHAA 4WBNA 2GHYA 2Y48A 2JRIA 2QWRB 3OTOO 1OJHA 2Z3YA 4UXNA 1VQ8V 2ZE7A 3ICXA 4NTWA 1XUQA 2IU0A 2R9AA 3CRCA 2JVDA 4U7OA 1S0VA 4MTXA 1QBZA 1QLNA 1S5HC 3A2FA 4RAIA 3I56V 2YXYA 4JI1B 2PYLA 4CH3A 1US6A 1G4YB 4P30A 1OHHG 2A0LA 3DC5A 1WLEA 2F4VO 2WAMA 4DV2B 4MSWC 2ZINA 5A2QN 2GBOA 2P5OA 4O4LB 4FM2A 1U97A 1VF5B 2Y4UA 4B3MO 4JAAA 4G28B 4LC1A 5KHJA 3OTOB 1V55B 2KB1A 3SPGA 4RUEA 4W4LA 5H6RA 3QNEA 4CBCA 1GK9A 4O2AB 1GMGA 4X1IA 5L3BA 2EJ7A 5EYPA 3GB7C 2RDCA 3G4SV 4UVCA 1GN6A 1V54B 3BFRA 1F4NA 2QM8A 2XUMA 3FD9A 1JX9A 4X1KA 1IURA 2G38A 1BQ0A 1T5EA 3ZRVA 4X65O 4JI3O 3HKDB 1F23A 1QR9A 4JI2O 3OMIB 1I5XA 1A32A 1E1RG 4GX0A 1CXZB 2M6YA 1I5YA 5FNVB 3JATA 3ABTA 2OIEA 3CCRV 4I7ZB 3FKSG 1ZSPA 4DV7B 4LF5B 1FXKA 5J2UB 5FNVA 3CXHF 3K59A 4U3FH 5KUKA 3LSSA 4BWAA 2X0LA 1RP3B 3H1LH 4UB6Z 1PL0A 3WG7C 1RPRA 4DK1A 1YTFD 2PGGA 4NR1A 1UJWB 3L70H 2Q9LA 4FM0A 4B3SB 4X1KB 1RM1C 2ZM6B 3K57A 2BOBC 5DEDA 2WLJA 4BIZA 2MK3A 4MTFA 4LFCO 4X64O 2B5UA 4TQFA 3HKCB 1SQXH 5LA6A 3OR6C 3F5WC 3X2QB 1Q82W 4FLVA 5E1AC 2IJHA 3ZRWB 1U96A 3OTFA 4X9QA 3CJHA 5LHHA 4NXNB 4HZ3A 4YXWG 4GKKB 1LUVA 3DXRB 2IBZH 4DO2A 3ML0A 4X66B 4B3TO 1NTZH 3OUSA 2JK5C 3CS5A 4XDKA 2HEPA 2XNDG 1KBHA 5EK0A 4J11A 1FXKC 5CA0A 4CC5A 1SA0A 4I0XB 4LNUB 1GO3F 2DOSA 3PJSK 1HNXB 2UXDB 1OCRC 1D5AA 3H1IH 4IYIA 3K5OA 5JCOA 3ZS8C 1NR1A 2L6LA 3B77A 1S77D 4FFBA 2UXDO 1Q3EA 3AEIA 4DUZB 1ZX3A 5JH7A 1NTKH 1DLBA 1K97A 4YIPA 3APQA 2AZ2A 5IWAO 2X6CA 5J2TA 4GX1A 5KLVH 1F51A 2E74B 1N36O 3Q4HA 1MG1A 2PTMA 1SF9A 2AHYA 4H44B 3P3NA 1I94B 4LFAO 1Q81W 1K5QA 4I9WA 1JA8A 3G80A 4DR7B 5IE9A 4LF9B 1Q6HA 1VEWA 3OE7G 3QO8A 5EBWC 1N4CA 1M5IA 5LP6B 5DN6G 1SQQH 3D36C 5CB4A 1GRJA 4MVRA 1VP7A 4JI6B 1M9NA 1YVWA 3RN4A 3S3XA 4GKKO 1K5SA 1BCCH 2EIMB 2UU9O 1Q8IA 2XAJA 3K08A 3E83A 3RT3C 2N04A 1H2SB 4Z1MG 1FKAO 2H8PC 4ABMA 3E8HA 1R3IC 1KYOF 4K8ZA 4WFFA 3C90A 4X66O 4B3TB 3J81N 1X59A 3VQVA 2QM7A 3QO5A 5L3CA 3H1KH 2JGUA 1HWYA 2CGNA 3AG4B 1L1FA 2JDIG 1IBMO 4GUNA 2F43G 1NQTA 2N05A 1MA1A 2QWOB 4JAVA 5JVDA 4FJCC 2YXHA 1XNQO 1BSMA 3E2EA 4MVUA 2CK3G 2HVJC 1PPJH 4P9OA 4XDLA 1MMMA 4G2KA 3ZN0A 2DYRC 5H9CA 2UXCB 1JR9A 3JSNA 5LP6A 4TUYB 4HAMA 3SR2C 5B66Z 2CE4A 3WG7B 1AR4A 4PD4F 2BOCC 3D36A 3CCJV 2NR5A 1P49A 3KCYA 4B08A 4GX5A 4NYKA 3DSQA 1Y4MA 5D5PA 1KB9F 2JEUA 3AG2C 3MAQA 1W59A 3IAYA 4X65B 4DUYO 2B1IA 2L35A 4U7NA 3D3IA 1YJ9V 3U0ZA 5DM6V 3RYFB 2UU9B 3RFRA 1KP3A 1OCOC 1DTOA 3CCQV 3CX5F 5KUMA 2QM4A 3AG4C 3L73H 2YIAA 3CEIA 1OZ0A 3FYEB 5KHIA 5BY1A 3CWBH 2NLJC 3ZMZA 3QTCA 2HKOA 3IFXA 2W6JG 2ZXWC 4J9ZB 3ZRWA 4KHPO 3OD4A 2H94A 4QJFB 3KG2A 4LFBO 4PDRA 2XAFA 3JAKA 4DV4B 4LNUA 3HR0A 4NXNO 4F4LA 2QTOA 5IY5C 3B09A 4FLWA 3D3QA 3JASB 1NS1A 4F6RB 1YI2V 3STZC 3I55V 3JAKB 4OGQB 4W4KA 2P7TC 1XREA 3MHHC 5LYJB 2HJDA 3SYOA 1B6QA 2EZPA 4GX2A 3OEHG 1WAZA 4D7SA 1LUWA 1ZL8B 4N21A 2F66C 1EN6A 3K5NA 2WSSG 1YTFB 1IX9A 2Y69B 5JVDB 1BL8A 2E75B 5IYDO 1Z5WA 3BA8A 3QF7A 5BZBA 3A0BZ 1HW7A 4B3RO 1KKDA 5C8YB 1KKCA 2WLIA 2Z0AA 4D7TA 5EBLC 2FL4A 1QVGU 2VRZA 4JYYA 4NTXA 5IJ0A 2EZOA 2EIKB 2WWWA 1R1BA 2DYSC 2FMLA 4IYHA 4TT3G 1S72V 1NH2B 1R3LC 3HPLC 3M7MX 1MSDA 1SESA 3F7VC 3TXSA 1OCRB 3K5MA 5J2UA 4X1IB 4LF8O 1DK1A 4H33A 4LBEC 5LMUO 3K5LA 4I50B 1KUQA 3T4ZA 3BRCA 5LMNB 4JAUA 3ASNB 4PA9A 1QCEA 2IJJA 3LDCA 4KP4A 4AQYB 1OV9A 2QA4V 5LGTA 3SPIA 1I7FA 1P84F 3KZIZ 4D6TH 2IJIA 2W0FC 3FB6C 4GYCB 4JYAO 3ZX6A 1NVPB 2R9RB 1FAFA 4DV2O 2Q7EA 3HKEA 4DR1B 2UUCB 3CC4V 2KG7A 1ZUQA 3N2KA 2P4KA 4JI8O 2JEXA 5KX5A 5GTIZ 4MTOA 4DV3B 1XMQB 4X8AA 5CMUA 2MW2B 2LFSA 2K9PA 4CS4A 1HP8A 4J10A 1S5JA 4O4LA 1J5EO 5ITZA 4DV5O 3ASOC 1HNZB 2XAHA 4J7ZA 4BAYA 3P3PA 2EIJB 1MABG 2YEVA 4EKWA 3KKYA 1UFIA 1XHZA 3T2MA 2RMKB 5GW7A 2GTSA 4JZ2A 1XNRB 2GSMB 1Z2GA 4ZHQA 3F7YC 3E89A 3RWRD 3BY6A 1XL6A 3RYHB 5B5EZ 2YEVB 4AI8A 1YZBA 5JH7B 2E5LB 1JJOA 3W7WA 3RVZA 1FYJA 1WN7A 4JTCB 4RWUA 2Q67A 4L8JA 5IT9N 3L72H 2QTSA 1R6KA 3ETEA 5KHGA 1JFFB 3ZHSA 1JQ0A 3SYPA 1KC8W 1XL4A 4UVBA 2KG7B 1W0KG 4JI3B 2BE3A 4UB8Z 3DGEA 2LGQA 4JI8B 1CPYA 2Q69A 1FJGB 1IVSA 5IY5B 2QEXV 3DXRA 4JI5O 2LFRA 5FPRA 5CBHA 1FXVA 2R9IA 1IXBA 2LGWA 3LSQA 2XAGA 2PYJA 2QKCA 3UO3A 4WFAV 5A9GA 2OCCC 4XBFA 1R6TA 4LR3A 2ZE6A 2CUGA 3TJTA 5HFMA 3FAVB 4Q20A 2W0XA 1K4CC 4UCVA 3W7UA 3JARB 2EULA 4DUYB 5LHGA 5EZYA 4CH4A 1JOYA 2ZKOA 4NXMO 2EBOA 5JCOC 2ZE8A 2DW4A 1XMOB 4C7UA 3P32A 1EM1A 1Y76A 1Q86W 3L71H 3FFQA 1WB8A 1OCZC 4UV8A 4EB6B 2CTWA 3IJ4A 3RW0A 1R3KC 1NBMG 1VQKV 2A7WA 3R66A 3AG2B 1PD3A 1PV0A 2LW1A 1XNQB 2UUBB 5LBQA 3BEHA 5LXTA 2WLIB 2EIJC 1GN4A 2OWOA 2P06A 5F2VO 4PHZA 3ZCCA 2JJ2G 5B1NA 3ZMTA 2ODMA 2JIZG 1K3EA 4DR6B 4YJ3B 2Q6AA 4UCUA 4YJ2A 5BXZA 4KXRA 4CS3A 2ZIOA 5EYPB 4LF7B 1SQGA 2HG5C 1H2NA 3ABMB 3RGBA 4JYBA 4DV1B 1S3JA 2F4VB 4P9PA 4K3AA 4NKGB 5CA1B 1AJPA 3AG3C 3SJCC 1N32O 2QR4A 2HFEC 1VQPV 2IW5A 3K04A 5KMGB 5TISZ 3K0DA 1M56C 3RYCA 2A9HA 3SPJA 1RSOB 2DE0X 4FLUA 4DW1A 4DW0A 3T1HO 3O9OA 4UFZA 1N34O 1S5LZ 2GUZB 2N74A 3JD1A 4JTAB 3FX7A 5IYBO 2X6AA 1HNWO 4UCTA 2UUBO 4TQDA 1AB3A 4PA4A 2QSAA 2W6IG 1GM7A 5ITZB 4LH7A 4YJ2B 4J80A 1UPGA 4ZOLA 2OIGA 1M57C 2JGDB 3PN1A 1YXBA 1ZLZA 5KA6A 2ADQB 3HB3B 4R7CA 1H2MA 1HR0O 5LGUA 3CC2V 5IWAB 5EZYB 2ZD9A 1B04A 1N0NA 3JARA 5H6QA 1KMIZ 2DMXA 3BAAA 3OMNB 5IDJA 4GT1A 1V54C 1SZTA 4X89A 4ICGA 4YHHB 3ZMSA 4DV3O 3RYIA 4FZ1A 4JI7B 4DR3B 3ZN1A 3JALA 1E79G 1CP9A 5KAFZ 4MTGA 3BCCH 4GCZA 1HDJA 1PNMA 3ZHQA 3ZRXA 1AILA 2AXTZ 3C3TA 3AG3B 3BABA 4LF7O 3JALB 2A79B 3LNMB 5IYZB 3MD0A 4Z2WA 2ZQMA 4RO2A 2AZ0A 4FPPA 1YHQV 3N2GB 4UV9A 4PA6A 4BIOA 2IH3C 3BHPA 1SETA 4PDMA 1Q6UA 5K1XA 1I08A 4FLYA
chains in the Genus database with same CATH topology
2K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9P A; 
#chains in the Genus database with same CATH topology
 2LQT A;  2CAZ C;  3BA9 A;  2BSK A;  3E35 A;  4DV0 B;  4YY3 O;  2V1D A;  1QU7 A;  5L3G A;  2LP7 A;  4LWS A;  1FPO A;  1THZ A;  5LOV B;  2O57 A;  3N27 A;  5BMV A;  2WLL A;  4MW3 A;  1N36 B;  1O9G A;  3ETD A;  1E1Q G;  2JS5 A;  2FYU H;  2VQE B;  1BE3 H;  1PNK A;  1XOU A;  1GKF A;  2DQ0 A;  4B3S O;  3JD4 A;  4ZHQ B;  3W7S A;  2HHH B;  4BIU A;  4JI0 O;  3ASO B;  3CB2 A;  3K9A A;  5IJ9 B;  3JAW B;  3CXC U;  3SYQ A;  3LNN A;  4ZOL B;  1EN5 A;  3ZBH A;  4F6R A;  1BQZ A;  3UO2 A;  4O4H B;  4WBN B;  1QVF U;  3TK1 A;  2Y69 C;  2EIK C;  2EIL B;  1Z5V A;  3L74 H;  4I9Q A;  1SA0 B;  1M4U A;  1BZK A;  2V4D A;  5CA0 B;  4GKJ B;  2VQE O;  1YJW V;  4JZG A;  1Y6X A;  1JVM A;  5L3E A;  1W0J G;  1VQ7 V;  2GV9 A;  2OCC B;  3W7T A;  2YIC A;  3OR7 C;  1Y66 A;  2ZIM A;  3SGI A;  1FFX B;  2QWP B;  4IT5 A;  2CTR A;  1WJZ A;  4UVA A;  2DJV A;  4LF6 B;  3RYF A;  1MZF A;  3P30 A;  4ASU G;  2UXB B;  2CH7 A;  1QQC A;  5L3F A;  1Y67 A;  3ABK C;  4Q6G A;  1XDC A;  4X64 B;  2Q8V A;  3AG1 C;  2XAS A;  2VWJ A;  3VOU A;  1H8H G;  2NNU A;  3CP1 A;  4I4T A;  4F6E A;  2D3O W;  1K34 A;  4LP8 A;  1SS3 A;  4JI6 O;  4DR3 O;  2XHB A;  4TUY A;  2XAQ A;  3ABL B;  4HYO A;  3CCE V;  1VQO V;  4IL6 Z;  4O2B A;  2A3Q A;  2ZT9 B;  1KP2 A;  4R6Z A;  4I5S A;  1LNQ A;  2ITC C;  1NT2 B;  1AI7 A;  2EIL C;  5IYZ A;  1AP5 A;  3JCU Z;  1LR1 A;  1W2B U;  2ARH A;  2E76 B;  3OAA G;  4LF5 O;  3OMA B;  4TV8 B;  5JQG B;  3U10 A;  2IU3 A;  3CCM V;  3ZIA G;  4PA3 A;  2RQ6 A;  1GN3 A;  1SQB H;  4BW5 A;  4AHC A;  1M90 W;  5LGN A;  1I94 O;  4QPJ A;  4QGP A;  3SJQ C;  1XMQ O;  2P22 C;  4PI0 A;  1ROP A;  1Q5O A;  4NTY A;  3FB8 C;  2PUS A;  3CD6 V;  1VQ5 V;  3JD2 A;  4H37 A;  4MVM A;  3ZHR A;  3HKB A;  3VQX A;  2ZDI C;  3ABK B;  2YSU B;  4I4T B;  4PDV A;  1YIT V;  1NTM H;  1VAR A;  2DWD C;  2ZNI A;  1BGY H;  3ZMU A;  4JYA B;  4PEL A;  3R65 A;  1X4T A;  3JAS A;  3G67 A;  3K58 A;  2P4V A;  3CC7 V;  1VQ6 V;  2OYQ A;  1VF6 C;  5J9P C;  2CH7 B;  4I55 B;  4RQF A;  5L3D A;  3FAV A;  2GUZ A;  1NU1 H;  1IBL O;  4IGG A;  3GVM A;  1N33 O;  4B7E A;  1J5E B;  1L0N H;  1RSO A;  3X2Q C;  1PNL A;  2ZE5 A;  2VQF O;  1M1K W;  2Q4P A;  1N32 B;  4O4J A;  4DR5 B;  3H01 A;  1R6N A;  4ZKI A;  2RCV A;  4DV6 O;  2GTA A;  5KA5 A;  2VQF B;  3UT5 A;  3EVK A;  5EC1 C;  1IXM A;  2WA4 A;  2LO1 A;  5H2F Z;  3K03 A;  5JJJ B;  1F4M A;  4ZI7 B;  1CEZ A;  3CCL V;  3GWO A;  1XI1 A;  2V7Q G;  3B2E E;  3WB2 A;  2RNB A;  4O4I B;  2DYR B;  1MNG A;  1TUB B;  1TVK A;  1K33 A;  1XIL A;  5IYC O;  4CS2 A;  1SQF A;  1O9H A;  3E22 A;  3SJA C;  4E4E A;  1Q43 A;  4A5U B;  4RQE A;  1R73 A;  5LHI A;  2B1G A;  3ABL C;  5CN0 A;  2YDE A;  1JPX A;  3RYH A;  1YEW A;  1XBL A;  2Q7G A;  3H1J H;  4X62 B;  1NI8 A;  3M99 B;  4MVZ A;  4DV5 B;  4AIL C;  3CRR A;  2PZS A;  2UXB O;  4J41 A;  2BTQ A;  3ZJZ A;  1Q90 D;  3ZRS A;  3QVN A;  4LCU C;  4MW8 A;  2F1M A;  1N33 B;  1XMO O;  3U11 A;  4DV4 O;  1XEQ A;  4LFB B;  5FPO A;  4CZZ A;  2HLD G;  4FM1 A;  4DV6 B;  4EFE A;  3FB7 C;  2A06 H;  4HBN A;  4KHP B;  3AG1 B;  2BSK B;  3IC9 A;  2Q0A A;  4JI1 O;  2R72 A;  3N2K B;  1AJN A;  1D5N A;  1IBK O;  4JI5 B;  1M56 B;  4JYC A;  3K9S A;  4FLZ A;  4UCS A;  4K35 A;  1SQV H;  4MS2 A;  1GH6 A;  4KFM A;  5E79 Z;  3N2G A;  1J95 A;  1WB7 A;  1WP8 A;  2D2C B;  4WFB V;  3EFF K;  4MT8 A;  2PI5 A;  1EFR G;  2YS8 A;  5B1A C;  1OCC B;  2Y4T A;  3UCS C;  3AG7 A;  2YI9 A;  1COW G;  3VQY A;  5CBF A;  1PP9 H;  2UXX A;  3SPC A;  4LF8 B;  4PI2 A;  4FZ0 A;  1FJG O;  4DR4 O;  1IDS A;  4J42 A;  4J7K A;  4WFG A;  2QKS A;  1G1X B;  4BW9 A;  5EBM C;  1ZL8 A;  4TV9 B;  3T1Y O;  3AK3 A;  2FB5 A;  1K73 W;  4XDJ A;  1HR0 B;  3B8M A;  1H2K A;  5HFL A;  1R3J C;  1TVK B;  4TOI A;  5BR8 B;  4DYL A;  1YJN V;  1GAX A;  1VF7 A;  5JWP A;  2BTQ B;  1H38 A;  4HNA A;  4I0X A;  4LH6 A;  3CCS V;  1DGS A;  3Q4H B;  4JF3 A;  2IH1 C;  2Y0I A;  1L0L H;  2YUA A;  2HHH O;  3BVO A;  1DF5 A;  1ORQ C;  4FFK A;  2KKW A;  3T1H B;  2Z5U A;  3CCV V;  3ZMV A;  3RBZ A;  2K1E A;  1VQN V;  2Y0P A;  4O4J B;  1OCC C;  4AQY O;  4TSF G;  3RYC B;  2ITD C;  4MVO A;  2RJZ A;  1TUB A;  4JPR A;  4JTD B;  1PKX A;  4MVS A;  4LF4 B;  3DC6 A;  3LUT B;  3CSX A;  4FMT A;  3E8F A;  5EIB D;  1XQ8 A;  3O65 A;  2JJ1 G;  1H2L A;  1PL4 A;  3LSU A;  1TGO A;  4LF4 O;  4DV1 O;  1AJQ A;  4R50 A;  2P90 A;  4IIJ A;  3WB1 A;  4UCO A;  2P6J A;  3JYC A;  1SKV A;  2YIB A;  3NR7 A;  2YID A;  3CJH B;  1V9P A;  2JS3 A;  4TWK A;  5K1P A;  2HJF C;  3OW2 U;  3CRA A;  4OPH A;  4R8C A;  3CE2 A;  4DR2 B;  1HNW B;  4CH5 A;  3HKC A;  1F7Y A;  4I55 A;  3ABU A;  1N34 B;  1L8D A;  2WLL B;  3M8A A;  5B1B C;  1K9M W;  4YHH O;  1QHT A;  4QIW F;  1KD1 W;  3L9D A;  2QJ1 A;  5JJN B;  4LF9 O;  2QWQ B;  4I50 A;  1PM9 A;  5GON A;  4MVQ A;  2EX3 A;  3T1Y B;  4ZIB A;  4P2Z A;  2PI4 A;  1KU9 A;  1ZWI C;  4J9Y B;  1AI5 A;  3KCX A;  4EB6 A;  4OX9 B;  1Y74 A;  2M7W A;  2WLM A;  2UUA O;  4TV9 A;  3ZHT A;  3CRM A;  1GM9 A;  2EIN C;  2BCC H;  5GON B;  4FIP C;  2NN4 A;  3TET A;  4B3R B;  3VBB A;  5JQG A;  1VQ4 V;  3I5D A;  3LDD A;  5CA3 A;  1D2D A;  4PA7 A;  3SYC A;  3BPZ A;  2HR3 A;  1Q7Y W;  1H2G A;  2HP8 A;  1BT8 A;  4Z1V A;  2XOK G;  4QNH B;  4O2B B;  1SZX A;  3JAM N;  1S76 D;  5EIB C;  4WCE V;  3JD0 A;  1YIJ V;  2F95 B;  4O2A A;  1EBO A;  4DR5 O;  2WPD G;  1G6U A;  1ZTE A;  3UM7 A;  1GM8 A;  1B3Q A;  3B8N A;  3CCU V;  1ARO P;  4J7J A;  4JV5 O;  2CTQ A;  4H13 B;  1IBL B;  2H3O A;  1VMG A;  3E22 B;  4RUF A;  4GKJ O;  1BS3 A;  4O4H A;  2AHZ A;  2QE7 G;  4JI4 B;  3JD3 A;  1AI4 A;  2QGN A;  4FVM A;  3CHX A;  4U3J A;  4O4I A;  3RVY A;  4DR2 O;  3ETG A;  2PY5 A;  3E8B A;  1SQP H;  2WA3 A;  5LP6 C;  2KQX A;  3CYO A;  1JFF A;  1NVP D;  3SPH A;  1AI6 A;  2BTO A;  1M93 A;  3SDL A;  3UQ8 A;  1WPB A;  2Q0O C;  4U3J B;  4EEQ A;  5EC2 C;  2YIB D;  1HNX O;  4E2L A;  5B3S B;  5CA1 A;  2DWE C;  1N8R W;  1Q6I A;  5LOV A;  4K8X A;  4FLX A;  1TUE B;  4LWS B;  1YSC A;  1IZ3 A;  4HNA B;  1VIB A;  2PF4 E;  2ZNJ A;  3G71 V;  4LF6 O;  1HNZ O;  2UXC O;  1NJI W;  1FFT B;  1JJ2 U;  1QNM A;  5IJ9 A;  4FK5 C;  1VF6 A;  5H5N A;  4DRX A;  1NZ6 A;  1QLE C;  3MDS A;  2Q73 A;  1KQS U;  2HVK C;  5JJE B;  2F23 A;  3B4S A;  1SRY A;  1WP7 A;  4YJ3 A;  1ZAU A;  3OGI B;  5DEC A;  5KX5 B;  3UT5 B;  4X88 A;  4PJ0 Z;  4DXW A;  5CBG A;  3HKE B;  2YXL A;  1AR1 B;  2F93 B;  3OFN G;  4CH6 A;  3CME V;  1GN2 A;  3H1H H;  2VS0 A;  3VQW A;  4CC6 A;  1AR5 A;  2WLN A;  3K06 A;  1K8A W;  2Q7H A;  5LA6 B;  4G27 B;  4QPK A;  2ADP A;  1K92 A;  4TV8 A;  5LMN O;  1XNR O;  5GTH Z;  4LFA B;  2Q5Z A;  4JGS A;  3CPW U;  1OCO B;  1XHX A;  2P67 A;  2ILM A;  3T1C A;  3J7A U;  4DV7 O;  5IJ0 B;  1FD9 A;  3SYA A;  1FXH A;  2KSD A;  4PV1 B;  1SC5 B;  2ZCE A;  3DTU B;  1Y74 B;  3E86 A;  3CRQ A;  4YY3 B;  3ETQ A;  3UKM A;  4JI2 B;  5FL7 G;  1WNS A;  4B7K A;  1EZJ A;  3JAT B;  2QDO A;  4JV5 B;  4H0L B;  1WA8 B;  2DYS B;  1EZV H;  1YF2 A;  1NH2 D;  2VWK A;  3HKD A;  3THO A;  2OCH A;  3JSL A;  1OCZ B;  4KUM A;  4UCR A;  3G6B A;  4X20 A;  3AK1 A;  2IM9 A;  1MZE A;  2R70 A;  2GDS A;  4GLX A;  3S3W A;  3ABM C;  2DQ3 A;  3J80 N;  3E8G A;  4OXS A;  5LYJ A;  4YIO A;  3K0G A;  2WLK A;  3ZED A;  2ZM6 O;  4DRX B;  3AK2 A;  3OEE G;  1FS0 G;  4JI7 O;  1BMF G;  3QO7 A;  5AG2 A;  2IJK A;  1AVM A;  3WFV A;  2LJ2 A;  1JMK C;  5C93 A;  4WF9 V;  4JI4 O;  3OUF A;  4ZI7 A;  1I0H A;  5LL6 Y;  2CDY A;  1G8M A;  2UUC O;  2UXN A;  2CGO A;  1K7D A;  5KMG A;  4EFB A;  4WFE A;  4X1Y B;  1EN4 A;  4QE7 A;  3IGA C;  3ASN C;  3GWK C;  1K4D C;  2RN9 A;  4OX9 O;  2YI8 A;  4NVP A;  3IC7 A;  1QLE B;  3F5T A;  5LXT B;  3QG5 A;  4NB5 A;  1WA8 A;  4DUZ O;  5KHH A;  1SER A;  5B1O A;  2EIN B;  1TAE A;  4LFC B;  4PDL A;  3A0H Z;  3EXA A;  3MHS C;  4UUJ C;  5B1B B;  1P7B A;  3SJB C;  1BHB A;  4N23 A;  1B06 A;  1WPX A;  1M57 B;  3TXQ A;  4JI0 B;  3B40 A;  4X20 B;  2X7R B;  3H9V A;  4DR7 O;  3TGU H;  2B9Z A;  3L75 H;  3FYI B;  3HKB B;  4K0K B;  3A8T A;  3JAW A;  3K79 A;  2ETN A;  3CMA V;  5B3S C;  4IHJ B;  5D5Q A;  3A0R A;  5B1A B;  4KL1 A;  1IBM B;  4B3M B;  3WU2 Z;  3LDE A;  4OPA A;  1FXK B;  4DR1 O;  2AGA A;  4K0K O;  2EJR A;  2LW7 A;  4DR4 B;  1GTO A;  4DV0 O;  4BR6 A;  3OM3 B;  4L87 A;  1RPO A;  3STL C;  4DK0 A;  1NKD A;  3WB0 A;  5BMV B;  2ZDI A;  1MOF A;  2EIM C;  3OGC C;  2C2A A;  1V55 C;  1RFY A;  2X6B A;  1P4R A;  1Y76 B;  2AW9 A;  1NR7 A;  3G6E V;  1VQM V;  5FLX N;  4DR6 O;  2ATK C;  2XT9 A;  3OT7 A;  1URF A;  3JCZ A;  2OT5 A;  1YDX A;  5LMU B;  1AP6 A;  1IBK B;  5KAI Z;  3ZHU A;  1DF4 A;  4IHJ A;  2WLH A;  2ZXW B;  4ZBM A;  3TCU A;  2JGD A;  2CTP A;  1H8E G;  1QR8 A;  1N0J A;  1RM1 B;  2DN9 A;  1MSW D;  2ZR2 A;  3K3W A;  5KHK A;  5CB4 B;  1TA8 A;  2E3C A;  2UUA B;  5C8Y A;  5BR8 O;  5J2T B;  2QKA A;  2ZR3 A;  2OTJ V;  4X62 O;  3D8C A;  2QWN B;  3RYI B;  3C3S A;  4QE9 A;  1FFX A;  4FLT A;  4JAS A;  4NXM B;  1VQL V;  1ENV A;  2Q68 A;  3APO A;  2XTA A;  2YC0 A;  1JCH A;  3EHB B;  3FB5 C;  2FKX A;  4WFH A;  2E5L O;  2FTK A;  1KEC A;  1P7G A;  3ZHV A;  2OTL V;  1VQ9 V;  1YCI A;  3T4D A;  4IIJ B;  4GZR B;  4X1Y A;  3NXS A;  3W7X A;  4FFB B;  1BHA A;  4WBN A;  2GHY A;  2Y48 A;  2JRI A;  2QWR B;  3OTO O;  1OJH A;  2Z3Y A;  4UXN A;  1VQ8 V;  2ZE7 A;  3ICX A;  4NTW A;  1XUQ A;  2IU0 A;  2R9A A;  3CRC A;  2JVD A;  4U7O A;  1S0V A;  4MTX A;  1QBZ A;  1QLN A;  1S5H C;  3A2F A;  4RAI A;  3I56 V;  2YXY A;  4JI1 B;  2PYL A;  4CH3 A;  1US6 A;  1G4Y B;  4P30 A;  1OHH G;  2A0L A;  3DC5 A;  1WLE A;  2F4V O;  2WAM A;  4DV2 B;  4MSW C;  2ZIN A;  5A2Q N;  2GBO A;  2P5O A;  4O4L B;  4FM2 A;  1U97 A;  1VF5 B;  2Y4U A;  4B3M O;  4JAA A;  4G28 B;  4LC1 A;  5KHJ A;  3OTO B;  1V55 B;  2KB1 A;  3SPG A;  4RUE A;  4W4L A;  5H6R A;  3QNE A;  4CBC A;  1GK9 A;  4O2A B;  1GMG A;  4X1I A;  5L3B A;  2EJ7 A;  5EYP A;  3GB7 C;  2RDC A;  3G4S V;  4UVC A;  1GN6 A;  1V54 B;  3BFR A;  1F4N A;  2QM8 A;  2XUM A;  3FD9 A;  1JX9 A;  4X1K A;  1IUR A;  2G38 A;  1BQ0 A;  1T5E A;  3ZRV A;  4X65 O;  4JI3 O;  3HKD B;  1F23 A;  1QR9 A;  4JI2 O;  3OMI B;  1I5X A;  1A32 A;  1E1R G;  4GX0 A;  1CXZ B;  2M6Y A;  1I5Y A;  5FNV B;  3JAT A;  3ABT A;  2OIE A;  3CCR V;  4I7Z B;  3FKS G;  1ZSP A;  4DV7 B;  4LF5 B;  1FXK A;  5J2U B;  5FNV A;  3CXH F;  3K59 A;  4U3F H;  5KUK A;  3LSS A;  4BWA A;  2X0L A;  1RP3 B;  3H1L H;  4UB6 Z;  1PL0 A;  3WG7 C;  1RPR A;  4DK1 A;  1YTF D;  2PGG A;  4NR1 A;  1UJW B;  3L70 H;  2Q9L A;  4FM0 A;  4B3S B;  4X1K B;  1RM1 C;  2ZM6 B;  3K57 A;  2BOB C;  5DED A;  2WLJ A;  4BIZ A;  2MK3 A;  4MTF A;  4LFC O;  4X64 O;  2B5U A;  4TQF A;  3HKC B;  1SQX H;  5LA6 A;  3OR6 C;  3F5W C;  3X2Q B;  1Q82 W;  4FLV A;  5E1A C;  2IJH A;  3ZRW B;  1U96 A;  3OTF A;  4X9Q A;  3CJH A;  5LHH A;  4NXN B;  4HZ3 A;  4YXW G;  4GKK B;  1LUV A;  3DXR B;  2IBZ H;  4DO2 A;  3ML0 A;  4X66 B;  4B3T O;  1NTZ H;  3OUS A;  2JK5 C;  3CS5 A;  4XDK A;  2HEP A;  2XND G;  1KBH A;  5EK0 A;  4J11 A;  1FXK C;  5CA0 A;  4CC5 A;  1SA0 A;  4I0X B;  4LNU B;  1GO3 F;  2DOS A;  3PJS K;  1HNX B;  2UXD B;  1OCR C;  1D5A A;  3H1I H;  4IYI A;  3K5O A;  5JCO A;  3ZS8 C;  1NR1 A;  2L6L A;  3B77 A;  1S77 D;  4FFB A;  2UXD O;  1Q3E A;  3AEI A;  4DUZ B;  1ZX3 A;  5JH7 A;  1NTK H;  1DLB A;  1K97 A;  4YIP A;  3APQ A;  2AZ2 A;  5IWA O;  2X6C A;  5J2T A;  4GX1 A;  5KLV H;  1F51 A;  2E74 B;  1N36 O;  3Q4H A;  1MG1 A;  2PTM A;  1SF9 A;  2AHY A;  4H44 B;  3P3N A;  1I94 B;  4LFA O;  1Q81 W;  1K5Q A;  4I9W A;  1JA8 A;  3G80 A;  4DR7 B;  5IE9 A;  4LF9 B;  1Q6H A;  1VEW A;  3OE7 G;  3QO8 A;  5EBW C;  1N4C A;  1M5I A;  5LP6 B;  5DN6 G;  1SQQ H;  3D36 C;  5CB4 A;  1GRJ A;  4MVR A;  1VP7 A;  4JI6 B;  1M9N A;  1YVW A;  3RN4 A;  3S3X A;  4GKK O;  1K5S A;  1BCC H;  2EIM B;  2UU9 O;  1Q8I A;  2XAJ A;  3K08 A;  3E83 A;  3RT3 C;  2N04 A;  1H2S B;  4Z1M G;  1FKA O;  2H8P C;  4ABM A;  3E8H A;  1R3I C;  1KYO F;  4K8Z A;  4WFF A;  3C90 A;  4X66 O;  4B3T B;  3J81 N;  1X59 A;  3VQV A;  2QM7 A;  3QO5 A;  5L3C A;  3H1K H;  2JGU A;  1HWY A;  2CGN A;  3AG4 B;  1L1F A;  2JDI G;  1IBM O;  4GUN A;  2F43 G;  1NQT A;  2N05 A;  1MA1 A;  2QWO B;  4JAV A;  5JVD A;  4FJC C;  2YXH A;  1XNQ O;  1BSM A;  3E2E A;  4MVU A;  2CK3 G;  2HVJ C;  1PPJ H;  4P9O A;  4XDL A;  1MMM A;  4G2K A;  3ZN0 A;  2DYR C;  5H9C A;  2UXC B;  1JR9 A;  3JSN A;  5LP6 A;  4TUY B;  4HAM A;  3SR2 C;  5B66 Z;  2CE4 A;  3WG7 B;  1AR4 A;  4PD4 F;  2BOC C;  3D36 A;  3CCJ V;  2NR5 A;  1P49 A;  3KCY A;  4B08 A;  4GX5 A;  4NYK A;  3DSQ A;  1Y4M A;  5D5P A;  1KB9 F;  2JEU A;  3AG2 C;  3MAQ A;  1W59 A;  3IAY A;  4X65 B;  4DUY O;  2B1I A;  2L35 A;  4U7N A;  3D3I A;  1YJ9 V;  3U0Z A;  5DM6 V;  3RYF B;  2UU9 B;  3RFR A;  1KP3 A;  1OCO C;  1DTO A;  3CCQ V;  3CX5 F;  5KUM A;  2QM4 A;  3AG4 C;  3L73 H;  2YIA A;  3CEI A;  1OZ0 A;  3FYE B;  5KHI A;  5BY1 A;  3CWB H;  2NLJ C;  3ZMZ A;  3QTC A;  2HKO A;  3IFX A;  2W6J G;  2ZXW C;  4J9Z B;  3ZRW A;  4KHP O;  3OD4 A;  2H94 A;  4QJF B;  3KG2 A;  4LFB O;  4PDR A;  2XAF A;  3JAK A;  4DV4 B;  4LNU A;  3HR0 A;  4NXN O;  4F4L A;  2QTO A;  5IY5 C;  3B09 A;  4FLW A;  3D3Q A;  3JAS B;  1NS1 A;  4F6R B;  1YI2 V;  3STZ C;  3I55 V;  3JAK B;  4OGQ B;  4W4K A;  2P7T C;  1XRE A;  3MHH C;  5LYJ B;  2HJD A;  3SYO A;  1B6Q A;  2EZP A;  4GX2 A;  3OEH G;  1WAZ A;  4D7S A;  1LUW A;  1ZL8 B;  4N21 A;  2F66 C;  1EN6 A;  3K5N A;  2WSS G;  1YTF B;  1IX9 A;  2Y69 B;  5JVD B;  1BL8 A;  2E75 B;  5IYD O;  1Z5W A;  3BA8 A;  3QF7 A;  5BZB A;  3A0B Z;  1HW7 A;  4B3R O;  1KKD A;  5C8Y B;  1KKC A;  2WLI A;  2Z0A A;  4D7T A;  5EBL C;  2FL4 A;  1QVG U;  2VRZ A;  4JYY A;  4NTX A;  5IJ0 A;  2EZO A;  2EIK B;  2WWW A;  1R1B A;  2DYS C;  2FML A;  4IYH A;  4TT3 G;  1S72 V;  1NH2 B;  1R3L C;  3HPL C;  3M7M X;  1MSD A;  1SES A;  3F7V C;  3TXS A;  1OCR B;  3K5M A;  5J2U A;  4X1I B;  4LF8 O;  1DK1 A;  4H33 A;  4LBE C;  5LMU O;  3K5L A;  4I50 B;  1KUQ A;  3T4Z A;  3BRC A;  5LMN B;  4JAU A;  3ASN B;  4PA9 A;  1QCE A;  2IJJ A;  3LDC A;  4KP4 A;  4AQY B;  1OV9 A;  2QA4 V;  5LGT A;  3SPI A;  1I7F A;  1P84 F;  3KZI Z;  4D6T H;  2IJI A;  2W0F C;  3FB6 C;  4GYC B;  4JYA O;  3ZX6 A;  1NVP B;  2R9R B;  1FAF A;  4DV2 O;  2Q7E A;  3HKE A;  4DR1 B;  2UUC B;  3CC4 V;  2KG7 A;  1ZUQ A;  3N2K A;  2P4K A;  4JI8 O;  2JEX A;  5KX5 A;  5GTI Z;  4MTO A;  4DV3 B;  1XMQ B;  4X8A A;  5CMU A;  2MW2 B;  2LFS A;  2K9P A;  4CS4 A;  1HP8 A;  4J10 A;  1S5J A;  4O4L A;  1J5E O;  5ITZ A;  4DV5 O;  3ASO C;  1HNZ B;  2XAH A;  4J7Z A;  4BAY A;  3P3P A;  2EIJ B;  1MAB G;  2YEV A;  4EKW A;  3KKY A;  1UFI A;  1XHZ A;  3T2M A;  2RMK B;  5GW7 A;  2GTS A;  4JZ2 A;  1XNR B;  2GSM B;  1Z2G A;  4ZHQ A;  3F7Y C;  3E89 A;  3RWR D;  3BY6 A;  1XL6 A;  3RYH B;  5B5E Z;  2YEV B;  4AI8 A;  1YZB A;  5JH7 B;  2E5L B;  1JJO A;  3W7W A;  3RVZ A;  1FYJ A;  1WN7 A;  4JTC B;  4RWU A;  2Q67 A;  4L8J A;  5IT9 N;  3L72 H;  2QTS A;  1R6K A;  3ETE A;  5KHG A;  1JFF B;  3ZHS A;  1JQ0 A;  3SYP A;  1KC8 W;  1XL4 A;  4UVB A;  2KG7 B;  1W0K G;  4JI3 B;  2BE3 A;  4UB8 Z;  3DGE A;  2LGQ A;  4JI8 B;  1CPY A;  2Q69 A;  1FJG B;  1IVS A;  5IY5 B;  2QEX V;  3DXR A;  4JI5 O;  2LFR A;  5FPR A;  5CBH A;  1FXV A;  2R9I A;  1IXB A;  2LGW A;  3LSQ A;  2XAG A;  2PYJ A;  2QKC A;  3UO3 A;  4WFA V;  5A9G A;  2OCC C;  4XBF A;  1R6T A;  4LR3 A;  2ZE6 A;  2CUG A;  3TJT A;  5HFM A;  3FAV B;  4Q20 A;  2W0X A;  1K4C C;  4UCV A;  3W7U A;  3JAR B;  2EUL A;  4DUY B;  5LHG A;  5EZY A;  4CH4 A;  1JOY A;  2ZKO A;  4NXM O;  2EBO A;  5JCO C;  2ZE8 A;  2DW4 A;  1XMO B;  4C7U A;  3P32 A;  1EM1 A;  1Y76 A;  1Q86 W;  3L71 H;  3FFQ A;  1WB8 A;  1OCZ C;  4UV8 A;  4EB6 B;  2CTW A;  3IJ4 A;  3RW0 A;  1R3K C;  1NBM G;  1VQK V;  2A7W A;  3R66 A;  3AG2 B;  1PD3 A;  1PV0 A;  2LW1 A;  1XNQ B;  2UUB B;  5LBQ A;  3BEH A;  5LXT A;  2WLI B;  2EIJ C;  1GN4 A;  2OWO A;  2P06 A;  5F2V O;  4PHZ A;  3ZCC A;  2JJ2 G;  5B1N A;  3ZMT A;  2ODM A;  2JIZ G;  1K3E A;  4DR6 B;  4YJ3 B;  2Q6A A;  4UCU A;  4YJ2 A;  5BXZ A;  4KXR A;  4CS3 A;  2ZIO A;  5EYP B;  4LF7 B;  1SQG A;  2HG5 C;  1H2N A;  3ABM B;  3RGB A;  4JYB A;  4DV1 B;  1S3J A;  2F4V B;  4P9P A;  4K3A A;  4NKG B;  5CA1 B;  1AJP A;  3AG3 C;  3SJC C;  1N32 O;  2QR4 A;  2HFE C;  1VQP V;  2IW5 A;  3K04 A;  5KMG B;  5TIS Z;  3K0D A;  1M56 C;  3RYC A;  2A9H A;  3SPJ A;  1RSO B;  2DE0 X;  4FLU A;  4DW1 A;  4DW0 A;  3T1H O;  3O9O A;  4UFZ A;  1N34 O;  1S5L Z;  2GUZ B;  2N74 A;  3JD1 A;  4JTA B;  3FX7 A;  5IYB O;  2X6A A;  1HNW O;  4UCT A;  2UUB O;  4TQD A;  1AB3 A;  4PA4 A;  2QSA A;  2W6I G;  1GM7 A;  5ITZ B;  4LH7 A;  4YJ2 B;  4J80 A;  1UPG A;  4ZOL A;  2OIG A;  1M57 C;  2JGD B;  3PN1 A;  1YXB A;  1ZLZ A;  5KA6 A;  2ADQ B;  3HB3 B;  4R7C A;  1H2M A;  1HR0 O;  5LGU A;  3CC2 V;  5IWA B;  5EZY B;  2ZD9 A;  1B04 A;  1N0N A;  3JAR A;  5H6Q A;  1KMI Z;  2DMX A;  3BAA A;  3OMN B;  5IDJ A;  4GT1 A;  1V54 C;  1SZT A;  4X89 A;  4ICG A;  4YHH B;  3ZMS A;  4DV3 O;  3RYI A;  4FZ1 A;  4JI7 B;  4DR3 B;  3ZN1 A;  3JAL A;  1E79 G;  1CP9 A;  5KAF Z;  4MTG A;  3BCC H;  4GCZ A;  1HDJ A;  1PNM A;  3ZHQ A;  3ZRX A;  1AIL A;  2AXT Z;  3C3T A;  3AG3 B;  3BAB A;  4LF7 O;  3JAL B;  2A79 B;  3LNM B;  5IYZ B;  3MD0 A;  4Z2W A;  2ZQM A;  4RO2 A;  2AZ0 A;  4FPP A;  1YHQ V;  3N2G B;  4UV9 A;  4PA6 A;  4BIO A;  2IH3 C;  3BHP A;  1SET A;  4PDM A;  1Q6U A;  5K1X A;  1I08 A;  4FLY A; 
#chains in the Genus database with same CATH homology
 2K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...