2K9PA

Structure of tm1_tm2 in lppg micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Pheromone alpha factor receptor
publication title Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.920 Mainly Alpha Orthogonal Bundle Helix Hairpins Pheromone alpha factor receptor. 2k9pA00
2K9PA
chains in the Genus database with same CATH superfamily
4X62O 1I94O 2CUGA 2PGGA 1K73W 3KKYA 4FLWA 2UXBB 5IYZB 2PY5A 5JQGA 2AZ2A 5H5NA 1VEWA 1JPXA 2QKCA 4LF4O 1GTOA 3CRMA 2GDSA 1HDJA 1WPBA 2FKXA 1BS3A 5LGTA 4MVSA 4KUMA 1ZAUA 4L87A 1QLNA 4X62B 2QEXV 3IJ4A 1AR1B 4GKKO 2VWKA 3O9OA 5D5PA 3OD4A 3T1HO 5C93A 4LH7A 5B66Z 1BQ0A 3BA9A 5JJNB 4DV4O 2YXLA 4EKWA 1NU1H 3FB7C 4LFCO 1MMMA 3FAVB 1N0JA 1ZWIC 1WJZA 3CC4V 4L8JA 4DR1O 4LF4B 1H2LA 3OGIB 1V54B 5H2FZ 4LBEC 4DV5O 2WSSG 1OCOB 3D36A 2E3CA 3OT7A 3ZRVA 2QWQB 4O4IA 4LNUA 5CMUA 2A3QA 5CBGA 4GX1A 4B7EA 3D8CA 1TUEB 4JTCB 3T4DA 2EIJB 1MNGA 5IY5B 3W7SA 2F4VB 3DGEA 3ZRWB 4GKKB 4FFBB 4AHCA 4G28B 2L35A 2ZD9A 3WB2A 3SYPA 4GYCB 5CB4A 4J9YB 4FLUA 3ASOC 3GB7C 3CCVV 2WPDG 4B3TO 4FLTA 2UUAO 1BSMA 3CRQA 2LW1A 2E74B 5FPRA 3LNMB 4DR1B 5JCOA 4DXWA 1M9NA 1WP8A 3OTFA 1XQ8A 2RNBA 1GK9A 2A79B 1V55B 1FFXB 4GUNA 4JF3A 1YJ9V 1XILA 1L0LH 2L6LA 2RDCA 2M6YA 4GX5A 4UFZA 4UCSA 3CXHF 5IJ0A 2JGDA 3LSSA 3JARA 4MVRA 1M57B 2AHZA 5LP6A 2Y69C 2OT5A 2ZR3A 5LXTA 1N34O 3KZIZ 4JI4O 2ADPA 3IGAC 1Q8IA 3W7WA 3SYAA 1MG1A 4FM2A 4QPJA 5LA6B 1AVMA 2EJRA 2ZCEA 2LO1A 2X0LA 4P9PA 2IBZH 1SQXH 5CN0A 5CA0A 1NR1A 4LF9O 2GTAA 4NTYA 1GM8A 2B9ZA 4WFAV 3AK3A 1J5EO 3F5TA 1G1XB 1YVWA 4J10A 1GRJA 4OX9B 1FXKC 5K1XA 4RUEA 1YI2V 1Z5WA 2OYQA 3CCSV 4CH6A 1IVSA 1J95A 2JJ1G 4OXSA 1R6TA 3GVMA 3VQXA 5LBQA 1K92A 3A8TA 3WB0A 1XMQO 4XDJA 1F51A 5L3DA 3SJBC 1N34B 3SPCA 3CCUV 3M99B 2Q7GA 4JI4B 3DXRA 1K34A 5LOVA 2X7RB 5J2TA 1YF2A 1VQOV 1AP6A 1D2DA 1OHHG 5C8YB 3L71H 4DR6B 1Y76B 3JAWA 1H2SB 3STLC 2EJ7A 4QIWF 4PI0A 2HHHO 4I0XA 1Q3EA 2YI8A 1Y74B 3K9AA 1NJIW 1VQ5V 2E76B 4X64B 3JCUZ 3ZHUA 3S3XA 2F1MA 4JI7O 1NBMG 3CSXA 2YICA 2ZIMA 1VARA 3HKBB 1HNZO 1R1BA 1AR4A 3OEEG 2KB1A 2GV9A 1XI1A 2CH7A 2W0FC 5FPOA 1WB7A 4LFAB 3HKCA 3OUFA 4J80A 1SQGA 3CCMV 2DQ3A 4JI0O 4X65O 2HHHB 2ZXWC 3QO5A 4Z1MG 2Z0AA 4X20A 1FJGO 2Q68A 3UT5A 4ZHQB 1NQTA 2AHYA 4EFEA 3TETA 1SQPH 5EZYA 1NVPB 4FM1A 1H8EG 4JI7B 4CS4A 1UJWB 3SPJA 4DUYB 3E2EA 1ZLZA 4PJ0Z 1WPXA 1THZA 4MVMA 5BR8O 4FLXA 3VQWA 1HNZB 4K35A 4I7ZB 3ZHTA 2ZR2A 3ABKB 1EZJA 1AJPA 3JSLA 1R3LC 5IYZA 5B3SC 2CGNA 1M4UA 2HR3A 3E22B 1XL4A 4JI0B 3S3WA 1MABG 3H01A 3KG2A 3LDCA 4EEQA 2ZDIC 2QDOA 2FB5A 1F23A 2R9AA 3L75H 4I50B 2DW4A 4BR6A 5IYDO 3B77A 1VMGA 2HJFC 1QLEB 1XDCA 3H1JH 3SDLA 3DTUB 2KG7B 4JI5O 3K04A 3OMIB 3ZN1A 4MVUA 5BR8B 1KD1W 4IGGA 1SS3A 2PUSA 1KUQA 4CH5A 1LUWA 3SYCA 1I5YA 5B5EZ 4DV1O 1KBHA 1JMKC 5DN6G 2PYLA 1NTKH 4YXWG 3EVKA 5LMNO 4FIPC 4GT1A 5CBHA 2Y69B 5KA6A 5IJ9B 3ABLB 4ZI7B 4G27B 4RQEA 4YJ2B 3CP1A 3D3QA 3JATB 1S72V 1R3KC 5FLXN 1QNMA 1F7YA 4KL1A 4LWSA 1LNQA 4NR1A 3ZRWA 4UUJC 4FFBA 4ZIBA 3I5DA 2C2AA 4MSWC 1W2BU 1PNKA 4R6ZA 4GCZA 1UPGA 3TCUA 4QNHB 3CCLV 2BOCC 2A06H 5A2QN 2YXYA 2QM8A 3G6EV 1TUBB 5EIBC 2YIBD 3ETQA 4DV7O 2DYRB 1N4CA 2AXTZ 2YDEA 2P4VA 4FLYA 5IE9A 1NH2B 4N23A 4X1KB 1R6NA 3LUTB 4H44B 4WBNB 3H1IH 5BMVB 1FFXA 4I9QA 4UXNA 5BY1A 3OUSA 5A9GA 1XMOO 2O57A 3R65A 5LL6Y 1BMFG 1HR0O 4XBFA 1MOFA 1QBZA 3U0ZA 2K9PA 3RYHB 2QSAA 1SZTA 1YXBA 4XDLA 3ML0A 3G80A 4LF6O 1PPJH 3K3WA 5LA6A 1NKDA 3GWOA 5KUMA 1FFTB 4DV7B 5DEDA 3L9DA 2UU9O 4NKGB 3J81N 2P7TC 4K0KO 4TT3G 5J2UB 3C3SA 4TV8B 4RQFA 1XMOB 4JV5O 1M56B 2Q4PA 2LGQA 1XHZA 5LGUA 2DYSC 1IURA 3CB2A 5LGNA 2E5LB 1O9HA 4RUFA 2CDYA 1S77D 1FAFA 3H1HH 1GN4A 1GN6A 3UO2A 4O2AB 5C8YA 4X89A 4YY3O 3CC2V 1HNWB 2VQEO 4TSFG 4IIJA 1Y74A 2IM9A 4MT8A 1K9MW 1YSCA 3ASNB 1BQZA 2EX3A 3JSNA 3E83A 4B3RO 4W4LA 5BZBA 3AG7A 4X8AA 3DC6A 3HKBA 3K5LA 1Q81W 2Q6AA 2R70A 4TQFA 3ZHQA 3CJHB 4I55B 4PDRA 1DF4A 4IYIA 5B1BC 2EINC 2QR4A 2FL4A 1KMIZ 4IT5A 1VQKV 2R9RB 2KSDA 3CMEV 4JTAB 1JR9A 4Q20A 2UUCB 3JD4A 3OMNB 4ZHQA 4DR3O 4JTDB 3ZMSA 1CXZB 4GX0A 3ZHVA 1P84F 1PNMA 4NVPA 4B7KA 2NNUA 2UXDB 1I0HA 2BTQB 5L3FA 3IC7A 4X1IB 1SQBH 3CRRA 1LR1A 2V7QG 1JOYA 1L1FA 2AZ0A 4DW1A 2DWEC 5FL7G 4LFBO 5KMGB 3J80N 2XAGA 2OWOA 2GBOA 4HAMA 3ZS8C 1IBLO 4PA9A 3Q4HB 1CP9A 1COWG 1IBMO 5EK0A 3G6BA 4PA6A 3E22A 4DW0A 5IT9N 4GX2A 2PTMA 4I50A 1N32O 3K03A 2PZSA 2B1IA 3RGBA 2IJKA 4MVZA 3ZMUA 1QU7A 1YCIA 2UXXA 2BTOA 2LFRA 2OTJV 3OE7G 4JI6O 2KG7A 2QKAA 5KHIA 2Q0AA 3BEHA 3ZRXA 1I94B 4KP4A 3B2EE 1OCRB 3I55V 1IBLB 1OCZB 4O4LB 2GTSA 5GONB 2IJIA 1KECA 1FS0G 2QGNA 3OW2U 2CGOA 2YEVB 5KUKA 1IBMB 4CH3A 3OR7C 4O4JB 1EN5A 3ZMVA 2BOBC 1XBLA 1OCCC 2DQ0A 1VQ7V 3SJQC 3DSQA 5IJ9A 4ZI7A 4YJ2A 1S76D 2XHBA 3JATA 2IH1C 2YC0A 4K8ZA 2GHYA 2RQ6A 2HLDG 5H9CA 4I9WA 3QF7A 5JH7B 3HPLC 1WB8A 2P90A 3CS5A 4PHZA 2IJHA 3T1HB 3JD2A 1US6A 5E79Z 2PYJA 4JYAO 3ETGA 4DV4B 3H1LH 4HYOA 1YJWV 3QO7A 4QJFB 4LFCB 1JX9A 1QR8A 1EZVH 4MTOA 4BAYA 2OCHA 2EULA 1TUBA 1M5IA 4E2LA 5CA1B 4DV5B 4X1KA 3C90A 3PN1A 4HBNA 2ZM6O 1Q6IA 1P49A 2DYSB 4WBNA 1AROP 5BMVA 1JJOA 1S5HC 2B5UA 1UFIA 1GKFA 2FMLA 2P4KA 5EBLC 4E4EA 4PA3A 4GLXA 1T5EA 4UCOA 3AG4C 1VF6A 4JYAB 3RYHA 5KHGA 1IZ3A 4X1YB 3HKDB 1NT2B 3PJSK 2UUAB 4PA7A 4B3TB 5B1NA 2UUBO 2F43G 3P32A 5KHHA 4DYLA 4DRXB 3BA8A 3K0GA 3OMAB 1XNRO 3D36C 2ZM6B 3MAQA 4FFKA 5J2UA 3E89A 3U11A 4TV8A 4UV9A 4O4HB 1K97A 2W6JG 4WFHA 3JAKB 3QVNA 5EYPB 2EIKB 4Q6GA 1IBKO 4K3AA 2EIMC 5IYCO 1VQ4V 2UUBB 4JYYA 2KQXA 5D5QA 2GUZB 2OIGA 4O2AA 2M7WA 5JCOC 3K57A 4JZGA 2ZQMA 3A0RA 4H33A 3K0DA 1XNRB 2AGAA 1JCHA 2F23A 5L3CA 2Q5ZA 4AI8A 4LF9B 2PI4A 2QTOA 2ZNJA 2VWJA 3SPIA 1N8RW 1J5EB 1BHAA 4MS2A 3K5OA 1MZEA 4UB8Z 2LJ2A 3LSQA 1Y66A 1H8HG 1FKAO 1ZSPA 3AG3C 1R73A 5LP6C 1F4MA 1XMQB 1M90W 1OJHA 1VQ8V 4ASUG 3FB5C 4IL6Z 1K5QA 3WG7C 3ZRSA 3CJHA 4I55A 3JASB 1VQ6V 1YDXA 1WAZA 1PM9A 1RSOB 2Z5UA 2JEXA 1WLEA 3LSUA 4J7JA 5B1AC 2XNDG 2QKSA 1QCEA 2VRZA 1SA0B 1IXBA 2WLKA 1KQSU 1B04A 1I5XA 4UVCA 2QM4A 3BHPA 2W0XA 3CXCU 1PV0A 3FB8C 4WCEV 4K8XA 1XL6A 4AQYO 2BTQA 3FFQA 1E79G 4X1IA 2DOSA 1DGSA 4LCUC 3JALB 1NH2D 3ABMC 1RPOA 5KMGA 1DLBA 2EILC 3A2FA 4JAUA 3UO3A 4BIUA 4EFBA 1TA8A 2Y4UA 1DF5A 2RMKB 3Q4HA 3M8AA 1KYOF 2LFSA 4F4LA 3E8GA 2ODMA 2HFEC 4X65B 4UVBA 4NXNO 1AILA 4DUZO 1FJGB 4GZRB 3ASOB 2RJZA 2IU0A 5HFMA 1NZ6A 1GO3F 2F66C 1BZKA 1IX9A 3JCZA 4DV3O 3BABA 1TAEA 5KHKA 4TWKA 3OR6C 3T1CA 5BXZA 2Q69A 2WLNA 4LF8O 4RAIA 1XHXA 3RWRD 1BL8A 1Y67A 2ZNIA 4PD4F 5IWAO 3F7YC 4DR4O 5GONA 2NR5A 2JGUA 2HP8A 2YEVA 1AI6A 3FAVA 5ITZB 1QR9A 3C3TA 4MVOA 3E35A 3IFXA 4O4JA 4NXNB 2N05A 3AG4B 2QTSA 2F95B 2JS5A 4PDMA 4YIOA 1P4RA 3NR7A 4JI5B 2DE0X 3SYQA 4FLVA 2PF4E 1RM1C 2UXCO 4QPKA 3BVOA 3EXAA 4LF8B 5JH7A 4JI1O 2XTAA 4LF5O 2H3OA 4DV1B 5IWAB 1BGYH 3SJCC 3ZCCA 1XOUA 5KX5B 4J7ZA 1S0VA 1FXKB 1GM7A 3QG5A 1NTMH 1VP7A 1YTFD 2V4DA 5LMNB 2R9IA 2YSUB 4OPHA 1GN3A 4U7NA 3IAYA 2Q0OC 4WFFA 1WA8B 3RYFB 4R7CA 5CA1A 2Q8VA 5LHGA 4C7UA 2ITCC 2HG5C 4O2BB 2EIMB 3ZJZA 3TK1A 2YI9A 3F5WC 3FD9A 2B1GA 1GMGA 5EC1C 4X66O 3FX7A 3UQ8A 3CCEV 4ABMA 2LP7A 2YS8A 4UVAA 1VQLV 4LC1A 1QVFU 2BE3A 2A0LA 4JI1B 4LF5B 4LP8A 4UCUA 4JZ2A 1WP7A 1SF9A 4X1YA 3HKDA 4RWUA 3IC9A 3W7XA 3ZEDA 3OEHG 4DV6O 5LMUO 3AK1A 3BY6A 4DRXA 1PD3A 1M93A 3ABUA 1JFFB 1OCOC 3L73H 5JJEB 3CMAV 1MSDA 1S5JA 1HNXO 3T2MA 3EFFK 4DV2O 3G4SV 1SQQH 2XASA 4P9OA 4DR7O 1HWYA 1NS1A 3JAKA 1H2GA 1NTZH 2EIJC 5IY5C 5EYPA 4A5UB 1HR0B 2JVDA 2ZXWB 1KKDA 3E86A 3RT3C 2DJVA 5KLVH 5B1AB 3OTOO 4FZ1A 2ZINA 1AJNA 2WA3A 1L0NH 3SJAC 4LF6B 1SZXA 3JD3A 2GSMB 1G8MA 5LMUB 3RFRA 5FNVB 2UU9B 1Y76A 3BAAA 4OGQB 4MW8A 3SYOA 2WLJA 1Y4MA 4K0KB 4PDLA 3TXQA 2EZOA 3H9VA 4GKJO 4PELA 3WB1A 1Q6UA 2HEPA 4JI3O 1D5AA 5J2TB 5B3SB 4DR7B 1ROPA 4JV5B 1AI7A 3KCXA 2ADQB 2P5OA 1NR7A 4J7KA 5JWPA 3JAWB 4MTXA 3K08A 1WN7A 3CRCA 3FKSG 3GWKC 3QNEA 1VQMV 3EHBB 3APQA 2XAFA 2F93B 1AI4A 3K5NA 1FXHA 3OTOB 4NB5A 5CBFA 2NN4A 4TQDA 4I4TB 4QE7A 1P7GA 3K06A 5IYBO 4DK1A 2VQFO 4YIPA 3JASA 3AEIA 4ZBMA 2IW5A 2YXHA 3B4SA 4YY3B 3VOUA 2VQEB 1RSOA 4GKJB 1EN6A 2LQTA 4JI3B 1SA0A 1H2NA 1BE3H 3CE2A 1KP3A 2QM7A 4B3RB 2IU3A 3UM7A 1AR5A 3K59A 2Q7HA 3CCJV 4WF9V 1SERA 3VQYA 3THOA 3K79A 3OM3B 4TV9B 1A32A 2D2CB 4UCTA 3JALA 4Z1VA 3UKMA 5DM6V 4J9ZB 1SETA 2XAHA 2XAJA 1AI5A 3E8FA 2ZIOA 4BW9A 2VQFB 4JAVA 1MSWD 4TUYB 4R8CA 3UCSC 1NI8A 2QA4V 2JIZG 3R66A 1Z2GA 2HVKC 1VQPV 1YIJV 2ZE8A 4BW5A 4H37A 1G6UA 3SGIA 4DR3B 2WLMA 4EB6B 2Y4TA 2HVJC 3BCCH 3H1KH 2Y48A 2JDIG 4CS3A 2WLHA 3HB3B 4TOIA 2PI5A 1GH6A 5CA3A 1QQCA 4FZ0A 4LFBB 1OZ0A 2XOKG 1L8DA 4B08A 2Z3YA 3ZBHA 1I08A 1PP9H 3B09A 2X6CA 4WFEA 1JVMA 2RN9A 4CC6A 2X6AA 3OGCC 5ITZA 2F4VO 1ZL8B 2HKOA 3BFRA 1XEQA 1N32B 3LDEA 3P3NA 4NXMO 4JASA 4JI6B 3RYIB 2Q9LA 1B6QA 1RFYA 2CTPA 1QVGU 1VIBA 2QE7G 2WLLB 3ZX6A 3CHXA 3ABKC 2N74A 3CPWU 1W0KG 1Q82W 3CYOA 1ENVA 1SC5B 4P2ZA 3ZN0A 4UV8A 1VF5B 5KX5A 1EBOA 4FJCC 1KP2A 4LWSB 1FD9A 3L74H 1FXKA 1YITV 3AK2A 3AG2C 4JI8O 4R50A 1KU9A 3VBBA 2X6BA 4FMTA 4PI2A 1PKXA 3W7TA 1TVKB 3MHSC 1WA8A 3RYFA 3F7VC 4JGSA 1YZBA 2YUAA 3U10A 1O9GA 1QLEC 4O2BA 4NXMB 1SQVH 1KKCA 1S5LZ 1AB3A 5E1AC 1GN2A 3CRAA 2CTQA 4W4KA 4CBCA 1CPYA 5KAIZ 1B3QA 2KKWA 3QO8A 3SPGA 4JAAA 1DK1A 2IH3C 3MDSA 3VQVA 4DV0O 4JYCA 3D3IA 4X88A 1NVPD 3SR2C 4OX9O 5F2VO 1VQ9V 5JVDB 4JI8B 3K9SA 2JJ2G 3RYCB 3X2QC 1H38A 4H13B 5L3GA 1LUVA 5KHJA 5KA5A 1JFFA 3ABLC 4J42A 4Z2WA 4CS2A 4ICGA 2HJDA 2OCCC 4FVMA 1EN4A 4F6RB 3ZHRA 4IHJB 2QWOB 5B1BB 3LDDA 2EINB 4DR5O 4MTGA 4DR6O 2XUMA 3G67A 1Z5VA 2Y0PA 3NXSA 1PNLA 3P3PA 3CD6V 2H8PC 2WAMA 4QGPA 4DV0B 2CAZC 1M1KW 5LHIA 3K58A 4X64O 1JQ0A 2MW2B 1U96A 3CEIA 3O65A 4NYKA 2DYRC 3ETDA 5FNVA 1E1RG 1ZTEA 3CCRV 3E8BA 5EBWC 1R3IC 5LYJB 2ETNA 4RO2A 2CE4A 3JD0A 2G38A 2ZT9B 4ZOLB 4XDKA 4DR5B 2OIEA 4LFAO 2UXNA 1N0NA 2BSKB 4LH6A 4U3JB 1IBKB 3ZIAG 3TJTA 4H0LB 4IIJB 1R6KA 2ZDIA 1WNSA 3L72H 1VF6C 3MD0A 4HNAB 4JI2O 5K1PA 3JYCA 4AILC 4I4TA 1V9PA 4DUYO 3N2GB 3RVYA 4B3SO 1VF7A 4J41A 2DWDC 1URFA 2YIBA 4CC5A 4YJ3B 3ZMZA 3WFVA 4BIZA 1R3JC 3ICXA 3HKEB 2Q67A 4D7TA 2DN9A 3CCQV 1DTOA 2XT9A 3ZHSA 1M56C 5H6RA 4MVQA 4HZ3A 4PDVA 2ZE6A 1Q5OA 3J7AU 3P30A 2YIDA 3HR0A 2P06A 3N2KB 2QWPB 3CX5F 4TV9A 1N36O 1OCCB 4JI2B 2WLIB 1Y6XA 5JJJB 2CTWA 4QE9A 4IYHA 2QWNB 4G2KA 2FTKA 4CH4A 4B3SB 3BPZA 2LW7A 4TUYA 3ABTA 2E75B 2D3OW 4UCVA 1IXMA 3JD1A 4WFBV 1IDSA 1YJNV 3OAAG 3N27A 4U7OA 3AG1C 5KAFZ 5TISZ 2ZKOA 3ASNC 2JK5C 5JQGB 4EB6A 3STZC 5AG2A 1H2KA 4AQYB 4WFGA 3AG2B 3A0HZ 1YEWA 3K5MA 2P22C 1N36B 3G71V 1G4YB 4N21A 4O4LA 3B40A 3BRCA 3ETEA 4LF7O 3OFNG 1OV9A 1SQFA 3TXSA 4FLZA 1U97A 2A9HA 1ZL8A 3RBZA 4DUZB 1ZX3A 3DC5A 3I56V 3B8NA 1X59A 4ZKIA 4CZZA 4DV3B 1EFRG 1PL4A 2P67A 1N33O 2K1EA 3RYIA 3CWBH 5H6QA 2DMXA 3X2QB 2AW9A 1MA1A 2WLLA 4NTWA 1JA8A 5L3EA 2N04A 2OCCB 3WU2Z 4O4IB 3SPHA 2R72A 4LNUB 2WA4A 4DR4B 4DR2O 5DECA 4LF7B 3E8HA 1P7BA 2P6JA 1TGOA 3RW0A 1K3EA 5B1OA 2EZPA 1XNQO 3FB6C 2WWWA 1TVKA 2QWRB 5CB4B 1YHQV 2H94A 5HFLA 5EBMC 2YIAA 1PL0A 1ZUQA 1W59A 1ORQC 1N33B 4KFMA 1Q6HA 2UXCB 2W6IG 1FXVA 4BWAA 3CC7V 1MZFA 1X4TA 1W0JG 4X9QA 4UCRA 5GTIZ 1OCRC 4BIOA 1GAXA 3L70H 1OCZC 4PA4A 2EBOA 4FK5C 2CTRA 4DR2B 4MW3A 5IJ0B 4OPAA 4DK0A 2JGDB 1D5NA 3JARB 5JVDA 3AG3B 1EM1A 5LP6B 4NTXA 1V54C 1XNQB 3RYCA 3APOA 1K7DA 5GW7A 5LXTB 3ZMTA 1KC8W 3T1YO 2XAQA 2E5LO 4B3MO 5IDJA 1XREA 3WG7B 4I5SA 3LNNA 4X66B 4O4HA 1E1QG 4F6RA 3JAMN 4IHJA 5GTHZ 2ATKC 2MK3A 4YHHO 4MTFA 1CEZA 1HNWO 2Y0IA 2FYUH 3FYEB 5CA0B 4FM0A 2VS0A 1SRYA 2A7WA 1K4DC 1Q86W 1FPOA 2OTLV 2V1DA 4D7SA 3W7UA 1Q7YW 5J9PC 4DV6B 1H2MA 1KB9F 1Q43A 2JRIA 2Q73A 2GUZA 1VQNV 2LGWA 1F4NA 5EIBD 2JS3A 3B8MA 1S3JA 3RN4A 1V55C 5LYJA 3T1YB 3ABMB 5EC2C 1RP3B 1K8AW 1RPRA 2RCVA 1HNXB 4B3MB 3DXRB 4DV2B 5LOVB 2EILB 2ARHA 4ZOLA 2ZE5A 2IJJA 5LHHA 1GM9A 4U3FH 1BHBA 3FYIB 4LR3A 1AP5A 1BCCH 2BSKA 4YHHB 1JJ2U 1M57C 4I0XB 4U3JA 4KHPO 4PV1B 4DO2A 1XUQA 3AG1B 1Q90D 3TGUH 2UUCO 4HNAA 2Q7EA 3QTCA 1K33A 2BCCH 1SESA 1YTFB 1I7FA 3N2GA 2CK3G 2UXDO 1QHTA 4JPRA 4YJ3A 3M7MX 5L3BA 3MHHC 3A0BZ 4J11A 4KXRA 2CH7B 2UXBO 3HKEA 4P30A 1FYJA 1HP8A 2ITDC 1K4CC 3HKCB 2EIKC 2JEUA 1SKVA 2ZE7A 2ILMA 1B06A 2NLJC 4X20B 4KHPB 3T4ZA 3N2KA 1HW7A 3UT5B 4UB6Z 1K5SA 2WLIA 5EZYB 3KCYA 3RVZA 4FPPA 1BT8A 4JYBA 4F6EA 1RM1B 4D6TH 1AJQA 2QJ1A
chains in the Genus database with same CATH topology
2K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9P A; 
#chains in the Genus database with same CATH topology
 4X62 O;  1I94 O;  2CUG A;  2PGG A;  1K73 W;  3KKY A;  4FLW A;  2UXB B;  5IYZ B;  2PY5 A;  5JQG A;  2AZ2 A;  5H5N A;  1VEW A;  1JPX A;  2QKC A;  4LF4 O;  1GTO A;  3CRM A;  2GDS A;  1HDJ A;  1WPB A;  2FKX A;  1BS3 A;  5LGT A;  4MVS A;  4KUM A;  1ZAU A;  4L87 A;  1QLN A;  4X62 B;  2QEX V;  3IJ4 A;  1AR1 B;  4GKK O;  2VWK A;  3O9O A;  5D5P A;  3OD4 A;  3T1H O;  5C93 A;  4LH7 A;  5B66 Z;  1BQ0 A;  3BA9 A;  5JJN B;  4DV4 O;  2YXL A;  4EKW A;  1NU1 H;  3FB7 C;  4LFC O;  1MMM A;  3FAV B;  1N0J A;  1ZWI C;  1WJZ A;  3CC4 V;  4L8J A;  4DR1 O;  4LF4 B;  1H2L A;  3OGI B;  1V54 B;  5H2F Z;  4LBE C;  4DV5 O;  2WSS G;  1OCO B;  3D36 A;  2E3C A;  3OT7 A;  3ZRV A;  2QWQ B;  4O4I A;  4LNU A;  5CMU A;  2A3Q A;  5CBG A;  4GX1 A;  4B7E A;  3D8C A;  1TUE B;  4JTC B;  3T4D A;  2EIJ B;  1MNG A;  5IY5 B;  3W7S A;  2F4V B;  3DGE A;  3ZRW B;  4GKK B;  4FFB B;  4AHC A;  4G28 B;  2L35 A;  2ZD9 A;  3WB2 A;  3SYP A;  4GYC B;  5CB4 A;  4J9Y B;  4FLU A;  3ASO C;  3GB7 C;  3CCV V;  2WPD G;  4B3T O;  4FLT A;  2UUA O;  1BSM A;  3CRQ A;  2LW1 A;  2E74 B;  5FPR A;  3LNM B;  4DR1 B;  5JCO A;  4DXW A;  1M9N A;  1WP8 A;  3OTF A;  1XQ8 A;  2RNB A;  1GK9 A;  2A79 B;  1V55 B;  1FFX B;  4GUN A;  4JF3 A;  1YJ9 V;  1XIL A;  1L0L H;  2L6L A;  2RDC A;  2M6Y A;  4GX5 A;  4UFZ A;  4UCS A;  3CXH F;  5IJ0 A;  2JGD A;  3LSS A;  3JAR A;  4MVR A;  1M57 B;  2AHZ A;  5LP6 A;  2Y69 C;  2OT5 A;  2ZR3 A;  5LXT A;  1N34 O;  3KZI Z;  4JI4 O;  2ADP A;  3IGA C;  1Q8I A;  3W7W A;  3SYA A;  1MG1 A;  4FM2 A;  4QPJ A;  5LA6 B;  1AVM A;  2EJR A;  2ZCE A;  2LO1 A;  2X0L A;  4P9P A;  2IBZ H;  1SQX H;  5CN0 A;  5CA0 A;  1NR1 A;  4LF9 O;  2GTA A;  4NTY A;  1GM8 A;  2B9Z A;  4WFA V;  3AK3 A;  1J5E O;  3F5T A;  1G1X B;  1YVW A;  4J10 A;  1GRJ A;  4OX9 B;  1FXK C;  5K1X A;  4RUE A;  1YI2 V;  1Z5W A;  2OYQ A;  3CCS V;  4CH6 A;  1IVS A;  1J95 A;  2JJ1 G;  4OXS A;  1R6T A;  3GVM A;  3VQX A;  5LBQ A;  1K92 A;  3A8T A;  3WB0 A;  1XMQ O;  4XDJ A;  1F51 A;  5L3D A;  3SJB C;  1N34 B;  3SPC A;  3CCU V;  3M99 B;  2Q7G A;  4JI4 B;  3DXR A;  1K34 A;  5LOV A;  2X7R B;  5J2T A;  1YF2 A;  1VQO V;  1AP6 A;  1D2D A;  1OHH G;  5C8Y B;  3L71 H;  4DR6 B;  1Y76 B;  3JAW A;  1H2S B;  3STL C;  2EJ7 A;  4QIW F;  4PI0 A;  2HHH O;  4I0X A;  1Q3E A;  2YI8 A;  1Y74 B;  3K9A A;  1NJI W;  1VQ5 V;  2E76 B;  4X64 B;  3JCU Z;  3ZHU A;  3S3X A;  2F1M A;  4JI7 O;  1NBM G;  3CSX A;  2YIC A;  2ZIM A;  1VAR A;  3HKB B;  1HNZ O;  1R1B A;  1AR4 A;  3OEE G;  2KB1 A;  2GV9 A;  1XI1 A;  2CH7 A;  2W0F C;  5FPO A;  1WB7 A;  4LFA B;  3HKC A;  3OUF A;  4J80 A;  1SQG A;  3CCM V;  2DQ3 A;  4JI0 O;  4X65 O;  2HHH B;  2ZXW C;  3QO5 A;  4Z1M G;  2Z0A A;  4X20 A;  1FJG O;  2Q68 A;  3UT5 A;  4ZHQ B;  1NQT A;  2AHY A;  4EFE A;  3TET A;  1SQP H;  5EZY A;  1NVP B;  4FM1 A;  1H8E G;  4JI7 B;  4CS4 A;  1UJW B;  3SPJ A;  4DUY B;  3E2E A;  1ZLZ A;  4PJ0 Z;  1WPX A;  1THZ A;  4MVM A;  5BR8 O;  4FLX A;  3VQW A;  1HNZ B;  4K35 A;  4I7Z B;  3ZHT A;  2ZR2 A;  3ABK B;  1EZJ A;  1AJP A;  3JSL A;  1R3L C;  5IYZ A;  5B3S C;  2CGN A;  1M4U A;  2HR3 A;  3E22 B;  1XL4 A;  4JI0 B;  3S3W A;  1MAB G;  3H01 A;  3KG2 A;  3LDC A;  4EEQ A;  2ZDI C;  2QDO A;  2FB5 A;  1F23 A;  2R9A A;  3L75 H;  4I50 B;  2DW4 A;  4BR6 A;  5IYD O;  3B77 A;  1VMG A;  2HJF C;  1QLE B;  1XDC A;  3H1J H;  3SDL A;  3DTU B;  2KG7 B;  4JI5 O;  3K04 A;  3OMI B;  3ZN1 A;  4MVU A;  5BR8 B;  1KD1 W;  4IGG A;  1SS3 A;  2PUS A;  1KUQ A;  4CH5 A;  1LUW A;  3SYC A;  1I5Y A;  5B5E Z;  4DV1 O;  1KBH A;  1JMK C;  5DN6 G;  2PYL A;  1NTK H;  4YXW G;  3EVK A;  5LMN O;  4FIP C;  4GT1 A;  5CBH A;  2Y69 B;  5KA6 A;  5IJ9 B;  3ABL B;  4ZI7 B;  4G27 B;  4RQE A;  4YJ2 B;  3CP1 A;  3D3Q A;  3JAT B;  1S72 V;  1R3K C;  5FLX N;  1QNM A;  1F7Y A;  4KL1 A;  4LWS A;  1LNQ A;  4NR1 A;  3ZRW A;  4UUJ C;  4FFB A;  4ZIB A;  3I5D A;  2C2A A;  4MSW C;  1W2B U;  1PNK A;  4R6Z A;  4GCZ A;  1UPG A;  3TCU A;  4QNH B;  3CCL V;  2BOC C;  2A06 H;  5A2Q N;  2YXY A;  2QM8 A;  3G6E V;  1TUB B;  5EIB C;  2YIB D;  3ETQ A;  4DV7 O;  2DYR B;  1N4C A;  2AXT Z;  2YDE A;  2P4V A;  4FLY A;  5IE9 A;  1NH2 B;  4N23 A;  4X1K B;  1R6N A;  3LUT B;  4H44 B;  4WBN B;  3H1I H;  5BMV B;  1FFX A;  4I9Q A;  4UXN A;  5BY1 A;  3OUS A;  5A9G A;  1XMO O;  2O57 A;  3R65 A;  5LL6 Y;  1BMF G;  1HR0 O;  4XBF A;  1MOF A;  1QBZ A;  3U0Z A;  2K9P A;  3RYH B;  2QSA A;  1SZT A;  1YXB A;  4XDL A;  3ML0 A;  3G80 A;  4LF6 O;  1PPJ H;  3K3W A;  5LA6 A;  1NKD A;  3GWO A;  5KUM A;  1FFT B;  4DV7 B;  5DED A;  3L9D A;  2UU9 O;  4NKG B;  3J81 N;  2P7T C;  4K0K O;  4TT3 G;  5J2U B;  3C3S A;  4TV8 B;  4RQF A;  1XMO B;  4JV5 O;  1M56 B;  2Q4P A;  2LGQ A;  1XHZ A;  5LGU A;  2DYS C;  1IUR A;  3CB2 A;  5LGN A;  2E5L B;  1O9H A;  4RUF A;  2CDY A;  1S77 D;  1FAF A;  3H1H H;  1GN4 A;  1GN6 A;  3UO2 A;  4O2A B;  5C8Y A;  4X89 A;  4YY3 O;  3CC2 V;  1HNW B;  2VQE O;  4TSF G;  4IIJ A;  1Y74 A;  2IM9 A;  4MT8 A;  1K9M W;  1YSC A;  3ASN B;  1BQZ A;  2EX3 A;  3JSN A;  3E83 A;  4B3R O;  4W4L A;  5BZB A;  3AG7 A;  4X8A A;  3DC6 A;  3HKB A;  3K5L A;  1Q81 W;  2Q6A A;  2R70 A;  4TQF A;  3ZHQ A;  3CJH B;  4I55 B;  4PDR A;  1DF4 A;  4IYI A;  5B1B C;  2EIN C;  2QR4 A;  2FL4 A;  1KMI Z;  4IT5 A;  1VQK V;  2R9R B;  2KSD A;  3CME V;  4JTA B;  1JR9 A;  4Q20 A;  2UUC B;  3JD4 A;  3OMN B;  4ZHQ A;  4DR3 O;  4JTD B;  3ZMS A;  1CXZ B;  4GX0 A;  3ZHV A;  1P84 F;  1PNM A;  4NVP A;  4B7K A;  2NNU A;  2UXD B;  1I0H A;  2BTQ B;  5L3F A;  3IC7 A;  4X1I B;  1SQB H;  3CRR A;  1LR1 A;  2V7Q G;  1JOY A;  1L1F A;  2AZ0 A;  4DW1 A;  2DWE C;  5FL7 G;  4LFB O;  5KMG B;  3J80 N;  2XAG A;  2OWO A;  2GBO A;  4HAM A;  3ZS8 C;  1IBL O;  4PA9 A;  3Q4H B;  1CP9 A;  1COW G;  1IBM O;  5EK0 A;  3G6B A;  4PA6 A;  3E22 A;  4DW0 A;  5IT9 N;  4GX2 A;  2PTM A;  4I50 A;  1N32 O;  3K03 A;  2PZS A;  2B1I A;  3RGB A;  2IJK A;  4MVZ A;  3ZMU A;  1QU7 A;  1YCI A;  2UXX A;  2BTO A;  2LFR A;  2OTJ V;  3OE7 G;  4JI6 O;  2KG7 A;  2QKA A;  5KHI A;  2Q0A A;  3BEH A;  3ZRX A;  1I94 B;  4KP4 A;  3B2E E;  1OCR B;  3I55 V;  1IBL B;  1OCZ B;  4O4L B;  2GTS A;  5GON B;  2IJI A;  1KEC A;  1FS0 G;  2QGN A;  3OW2 U;  2CGO A;  2YEV B;  5KUK A;  1IBM B;  4CH3 A;  3OR7 C;  4O4J B;  1EN5 A;  3ZMV A;  2BOB C;  1XBL A;  1OCC C;  2DQ0 A;  1VQ7 V;  3SJQ C;  3DSQ A;  5IJ9 A;  4ZI7 A;  4YJ2 A;  1S76 D;  2XHB A;  3JAT A;  2IH1 C;  2YC0 A;  4K8Z A;  2GHY A;  2RQ6 A;  2HLD G;  5H9C A;  4I9W A;  3QF7 A;  5JH7 B;  3HPL C;  1WB8 A;  2P90 A;  3CS5 A;  4PHZ A;  2IJH A;  3T1H B;  3JD2 A;  1US6 A;  5E79 Z;  2PYJ A;  4JYA O;  3ETG A;  4DV4 B;  3H1L H;  4HYO A;  1YJW V;  3QO7 A;  4QJF B;  4LFC B;  1JX9 A;  1QR8 A;  1EZV H;  4MTO A;  4BAY A;  2OCH A;  2EUL A;  1TUB A;  1M5I A;  4E2L A;  5CA1 B;  4DV5 B;  4X1K A;  3C90 A;  3PN1 A;  4HBN A;  2ZM6 O;  1Q6I A;  1P49 A;  2DYS B;  4WBN A;  1ARO P;  5BMV A;  1JJO A;  1S5H C;  2B5U A;  1UFI A;  1GKF A;  2FML A;  2P4K A;  5EBL C;  4E4E A;  4PA3 A;  4GLX A;  1T5E A;  4UCO A;  3AG4 C;  1VF6 A;  4JYA B;  3RYH A;  5KHG A;  1IZ3 A;  4X1Y B;  3HKD B;  1NT2 B;  3PJS K;  2UUA B;  4PA7 A;  4B3T B;  5B1N A;  2UUB O;  2F43 G;  3P32 A;  5KHH A;  4DYL A;  4DRX B;  3BA8 A;  3K0G A;  3OMA B;  1XNR O;  3D36 C;  2ZM6 B;  3MAQ A;  4FFK A;  5J2U A;  3E89 A;  3U11 A;  4TV8 A;  4UV9 A;  4O4H B;  1K97 A;  2W6J G;  4WFH A;  3JAK B;  3QVN A;  5EYP B;  2EIK B;  4Q6G A;  1IBK O;  4K3A A;  2EIM C;  5IYC O;  1VQ4 V;  2UUB B;  4JYY A;  2KQX A;  5D5Q A;  2GUZ B;  2OIG A;  4O2A A;  2M7W A;  5JCO C;  3K57 A;  4JZG A;  2ZQM A;  3A0R A;  4H33 A;  3K0D A;  1XNR B;  2AGA A;  1JCH A;  2F23 A;  5L3C A;  2Q5Z A;  4AI8 A;  4LF9 B;  2PI4 A;  2QTO A;  2ZNJ A;  2VWJ A;  3SPI A;  1N8R W;  1J5E B;  1BHA A;  4MS2 A;  3K5O A;  1MZE A;  4UB8 Z;  2LJ2 A;  3LSQ A;  1Y66 A;  1H8H G;  1FKA O;  1ZSP A;  3AG3 C;  1R73 A;  5LP6 C;  1F4M A;  1XMQ B;  1M90 W;  1OJH A;  1VQ8 V;  4ASU G;  3FB5 C;  4IL6 Z;  1K5Q A;  3WG7 C;  3ZRS A;  3CJH A;  4I55 A;  3JAS B;  1VQ6 V;  1YDX A;  1WAZ A;  1PM9 A;  1RSO B;  2Z5U A;  2JEX A;  1WLE A;  3LSU A;  4J7J A;  5B1A C;  2XND G;  2QKS A;  1QCE A;  2VRZ A;  1SA0 B;  1IXB A;  2WLK A;  1KQS U;  1B04 A;  1I5X A;  4UVC A;  2QM4 A;  3BHP A;  2W0X A;  3CXC U;  1PV0 A;  3FB8 C;  4WCE V;  4K8X A;  1XL6 A;  4AQY O;  2BTQ A;  3FFQ A;  1E79 G;  4X1I A;  2DOS A;  1DGS A;  4LCU C;  3JAL B;  1NH2 D;  3ABM C;  1RPO A;  5KMG A;  1DLB A;  2EIL C;  3A2F A;  4JAU A;  3UO3 A;  4BIU A;  4EFB A;  1TA8 A;  2Y4U A;  1DF5 A;  2RMK B;  3Q4H A;  3M8A A;  1KYO F;  2LFS A;  4F4L A;  3E8G A;  2ODM A;  2HFE C;  4X65 B;  4UVB A;  4NXN O;  1AIL A;  4DUZ O;  1FJG B;  4GZR B;  3ASO B;  2RJZ A;  2IU0 A;  5HFM A;  1NZ6 A;  1GO3 F;  2F66 C;  1BZK A;  1IX9 A;  3JCZ A;  4DV3 O;  3BAB A;  1TAE A;  5KHK A;  4TWK A;  3OR6 C;  3T1C A;  5BXZ A;  2Q69 A;  2WLN A;  4LF8 O;  4RAI A;  1XHX A;  3RWR D;  1BL8 A;  1Y67 A;  2ZNI A;  4PD4 F;  5IWA O;  3F7Y C;  4DR4 O;  5GON A;  2NR5 A;  2JGU A;  2HP8 A;  2YEV A;  1AI6 A;  3FAV A;  5ITZ B;  1QR9 A;  3C3T A;  4MVO A;  3E35 A;  3IFX A;  4O4J A;  4NXN B;  2N05 A;  3AG4 B;  2QTS A;  2F95 B;  2JS5 A;  4PDM A;  4YIO A;  1P4R A;  3NR7 A;  4JI5 B;  2DE0 X;  3SYQ A;  4FLV A;  2PF4 E;  1RM1 C;  2UXC O;  4QPK A;  3BVO A;  3EXA A;  4LF8 B;  5JH7 A;  4JI1 O;  2XTA A;  4LF5 O;  2H3O A;  4DV1 B;  5IWA B;  1BGY H;  3SJC C;  3ZCC A;  1XOU A;  5KX5 B;  4J7Z A;  1S0V A;  1FXK B;  1GM7 A;  3QG5 A;  1NTM H;  1VP7 A;  1YTF D;  2V4D A;  5LMN B;  2R9I A;  2YSU B;  4OPH A;  1GN3 A;  4U7N A;  3IAY A;  2Q0O C;  4WFF A;  1WA8 B;  3RYF B;  4R7C A;  5CA1 A;  2Q8V A;  5LHG A;  4C7U A;  2ITC C;  2HG5 C;  4O2B B;  2EIM B;  3ZJZ A;  3TK1 A;  2YI9 A;  3F5W C;  3FD9 A;  2B1G A;  1GMG A;  5EC1 C;  4X66 O;  3FX7 A;  3UQ8 A;  3CCE V;  4ABM A;  2LP7 A;  2YS8 A;  4UVA A;  1VQL V;  4LC1 A;  1QVF U;  2BE3 A;  2A0L A;  4JI1 B;  4LF5 B;  4LP8 A;  4UCU A;  4JZ2 A;  1WP7 A;  1SF9 A;  4X1Y A;  3HKD A;  4RWU A;  3IC9 A;  3W7X A;  3ZED A;  3OEH G;  4DV6 O;  5LMU O;  3AK1 A;  3BY6 A;  4DRX A;  1PD3 A;  1M93 A;  3ABU A;  1JFF B;  1OCO C;  3L73 H;  5JJE B;  3CMA V;  1MSD A;  1S5J A;  1HNX O;  3T2M A;  3EFF K;  4DV2 O;  3G4S V;  1SQQ H;  2XAS A;  4P9O A;  4DR7 O;  1HWY A;  1NS1 A;  3JAK A;  1H2G A;  1NTZ H;  2EIJ C;  5IY5 C;  5EYP A;  4A5U B;  1HR0 B;  2JVD A;  2ZXW B;  1KKD A;  3E86 A;  3RT3 C;  2DJV A;  5KLV H;  5B1A B;  3OTO O;  4FZ1 A;  2ZIN A;  1AJN A;  2WA3 A;  1L0N H;  3SJA C;  4LF6 B;  1SZX A;  3JD3 A;  2GSM B;  1G8M A;  5LMU B;  3RFR A;  5FNV B;  2UU9 B;  1Y76 A;  3BAA A;  4OGQ B;  4MW8 A;  3SYO A;  2WLJ A;  1Y4M A;  4K0K B;  4PDL A;  3TXQ A;  2EZO A;  3H9V A;  4GKJ O;  4PEL A;  3WB1 A;  1Q6U A;  2HEP A;  4JI3 O;  1D5A A;  5J2T B;  5B3S B;  4DR7 B;  1ROP A;  4JV5 B;  1AI7 A;  3KCX A;  2ADQ B;  2P5O A;  1NR7 A;  4J7K A;  5JWP A;  3JAW B;  4MTX A;  3K08 A;  1WN7 A;  3CRC A;  3FKS G;  3GWK C;  3QNE A;  1VQM V;  3EHB B;  3APQ A;  2XAF A;  2F93 B;  1AI4 A;  3K5N A;  1FXH A;  3OTO B;  4NB5 A;  5CBF A;  2NN4 A;  4TQD A;  4I4T B;  4QE7 A;  1P7G A;  3K06 A;  5IYB O;  4DK1 A;  2VQF O;  4YIP A;  3JAS A;  3AEI A;  4ZBM A;  2IW5 A;  2YXH A;  3B4S A;  4YY3 B;  3VOU A;  2VQE B;  1RSO A;  4GKJ B;  1EN6 A;  2LQT A;  4JI3 B;  1SA0 A;  1H2N A;  1BE3 H;  3CE2 A;  1KP3 A;  2QM7 A;  4B3R B;  2IU3 A;  3UM7 A;  1AR5 A;  3K59 A;  2Q7H A;  3CCJ V;  4WF9 V;  1SER A;  3VQY A;  3THO A;  3K79 A;  3OM3 B;  4TV9 B;  1A32 A;  2D2C B;  4UCT A;  3JAL A;  4Z1V A;  3UKM A;  5DM6 V;  4J9Z B;  1SET A;  2XAH A;  2XAJ A;  1AI5 A;  3E8F A;  2ZIO A;  4BW9 A;  2VQF B;  4JAV A;  1MSW D;  4TUY B;  4R8C A;  3UCS C;  1NI8 A;  2QA4 V;  2JIZ G;  3R66 A;  1Z2G A;  2HVK C;  1VQP V;  1YIJ V;  2ZE8 A;  4BW5 A;  4H37 A;  1G6U A;  3SGI A;  4DR3 B;  2WLM A;  4EB6 B;  2Y4T A;  2HVJ C;  3BCC H;  3H1K H;  2Y48 A;  2JDI G;  4CS3 A;  2WLH A;  3HB3 B;  4TOI A;  2PI5 A;  1GH6 A;  5CA3 A;  1QQC A;  4FZ0 A;  4LFB B;  1OZ0 A;  2XOK G;  1L8D A;  4B08 A;  2Z3Y A;  3ZBH A;  1I08 A;  1PP9 H;  3B09 A;  2X6C A;  4WFE A;  1JVM A;  2RN9 A;  4CC6 A;  2X6A A;  3OGC C;  5ITZ A;  2F4V O;  1ZL8 B;  2HKO A;  3BFR A;  1XEQ A;  1N32 B;  3LDE A;  3P3N A;  4NXM O;  4JAS A;  4JI6 B;  3RYI B;  2Q9L A;  1B6Q A;  1RFY A;  2CTP A;  1QVG U;  1VIB A;  2QE7 G;  2WLL B;  3ZX6 A;  3CHX A;  3ABK C;  2N74 A;  3CPW U;  1W0K G;  1Q82 W;  3CYO A;  1ENV A;  1SC5 B;  4P2Z A;  3ZN0 A;  4UV8 A;  1VF5 B;  5KX5 A;  1EBO A;  4FJC C;  1KP2 A;  4LWS B;  1FD9 A;  3L74 H;  1FXK A;  1YIT V;  3AK2 A;  3AG2 C;  4JI8 O;  4R50 A;  1KU9 A;  3VBB A;  2X6B A;  4FMT A;  4PI2 A;  1PKX A;  3W7T A;  1TVK B;  3MHS C;  1WA8 A;  3RYF A;  3F7V C;  4JGS A;  1YZB A;  2YUA A;  3U10 A;  1O9G A;  1QLE C;  4O2B A;  4NXM B;  1SQV H;  1KKC A;  1S5L Z;  1AB3 A;  5E1A C;  1GN2 A;  3CRA A;  2CTQ A;  4W4K A;  4CBC A;  1CPY A;  5KAI Z;  1B3Q A;  2KKW A;  3QO8 A;  3SPG A;  4JAA A;  1DK1 A;  2IH3 C;  3MDS A;  3VQV A;  4DV0 O;  4JYC A;  3D3I A;  4X88 A;  1NVP D;  3SR2 C;  4OX9 O;  5F2V O;  1VQ9 V;  5JVD B;  4JI8 B;  3K9S A;  2JJ2 G;  3RYC B;  3X2Q C;  1H38 A;  4H13 B;  5L3G A;  1LUV A;  5KHJ A;  5KA5 A;  1JFF A;  3ABL C;  4J42 A;  4Z2W A;  4CS2 A;  4ICG A;  2HJD A;  2OCC C;  4FVM A;  1EN4 A;  4F6R B;  3ZHR A;  4IHJ B;  2QWO B;  5B1B B;  3LDD A;  2EIN B;  4DR5 O;  4MTG A;  4DR6 O;  2XUM A;  3G67 A;  1Z5V A;  2Y0P A;  3NXS A;  1PNL A;  3P3P A;  3CD6 V;  2H8P C;  2WAM A;  4QGP A;  4DV0 B;  2CAZ C;  1M1K W;  5LHI A;  3K58 A;  4X64 O;  1JQ0 A;  2MW2 B;  1U96 A;  3CEI A;  3O65 A;  4NYK A;  2DYR C;  3ETD A;  5FNV A;  1E1R G;  1ZTE A;  3CCR V;  3E8B A;  5EBW C;  1R3I C;  5LYJ B;  2ETN A;  4RO2 A;  2CE4 A;  3JD0 A;  2G38 A;  2ZT9 B;  4ZOL B;  4XDK A;  4DR5 B;  2OIE A;  4LFA O;  2UXN A;  1N0N A;  2BSK B;  4LH6 A;  4U3J B;  1IBK B;  3ZIA G;  3TJT A;  4H0L B;  4IIJ B;  1R6K A;  2ZDI A;  1WNS A;  3L72 H;  1VF6 C;  3MD0 A;  4HNA B;  4JI2 O;  5K1P A;  3JYC A;  4AIL C;  4I4T A;  1V9P A;  4DUY O;  3N2G B;  3RVY A;  4B3S O;  1VF7 A;  4J41 A;  2DWD C;  1URF A;  2YIB A;  4CC5 A;  4YJ3 B;  3ZMZ A;  3WFV A;  4BIZ A;  1R3J C;  3ICX A;  3HKE B;  2Q67 A;  4D7T A;  2DN9 A;  3CCQ V;  1DTO A;  2XT9 A;  3ZHS A;  1M56 C;  5H6R A;  4MVQ A;  4HZ3 A;  4PDV A;  2ZE6 A;  1Q5O A;  3J7A U;  3P30 A;  2YID A;  3HR0 A;  2P06 A;  3N2K B;  2QWP B;  3CX5 F;  4TV9 A;  1N36 O;  1OCC B;  4JI2 B;  2WLI B;  1Y6X A;  5JJJ B;  2CTW A;  4QE9 A;  4IYH A;  2QWN B;  4G2K A;  2FTK A;  4CH4 A;  4B3S B;  3BPZ A;  2LW7 A;  4TUY A;  3ABT A;  2E75 B;  2D3O W;  4UCV A;  1IXM A;  3JD1 A;  4WFB V;  1IDS A;  1YJN V;  3OAA G;  3N27 A;  4U7O A;  3AG1 C;  5KAF Z;  5TIS Z;  2ZKO A;  3ASN C;  2JK5 C;  5JQG B;  4EB6 A;  3STZ C;  5AG2 A;  1H2K A;  4AQY B;  4WFG A;  3AG2 B;  3A0H Z;  1YEW A;  3K5M A;  2P22 C;  1N36 B;  3G71 V;  1G4Y B;  4N21 A;  4O4L A;  3B40 A;  3BRC A;  3ETE A;  4LF7 O;  3OFN G;  1OV9 A;  1SQF A;  3TXS A;  4FLZ A;  1U97 A;  2A9H A;  1ZL8 A;  3RBZ A;  4DUZ B;  1ZX3 A;  3DC5 A;  3I56 V;  3B8N A;  1X59 A;  4ZKI A;  4CZZ A;  4DV3 B;  1EFR G;  1PL4 A;  2P67 A;  1N33 O;  2K1E A;  3RYI A;  3CWB H;  5H6Q A;  2DMX A;  3X2Q B;  2AW9 A;  1MA1 A;  2WLL A;  4NTW A;  1JA8 A;  5L3E A;  2N04 A;  2OCC B;  3WU2 Z;  4O4I B;  3SPH A;  2R72 A;  4LNU B;  2WA4 A;  4DR4 B;  4DR2 O;  5DEC A;  4LF7 B;  3E8H A;  1P7B A;  2P6J A;  1TGO A;  3RW0 A;  1K3E A;  5B1O A;  2EZP A;  1XNQ O;  3FB6 C;  2WWW A;  1TVK A;  2QWR B;  5CB4 B;  1YHQ V;  2H94 A;  5HFL A;  5EBM C;  2YIA A;  1PL0 A;  1ZUQ A;  1W59 A;  1ORQ C;  1N33 B;  4KFM A;  1Q6H A;  2UXC B;  2W6I G;  1FXV A;  4BWA A;  3CC7 V;  1MZF A;  1X4T A;  1W0J G;  4X9Q A;  4UCR A;  5GTI Z;  1OCR C;  4BIO A;  1GAX A;  3L70 H;  1OCZ C;  4PA4 A;  2EBO A;  4FK5 C;  2CTR A;  4DR2 B;  4MW3 A;  5IJ0 B;  4OPA A;  4DK0 A;  2JGD B;  1D5N A;  3JAR B;  5JVD A;  3AG3 B;  1EM1 A;  5LP6 B;  4NTX A;  1V54 C;  1XNQ B;  3RYC A;  3APO A;  1K7D A;  5GW7 A;  5LXT B;  3ZMT A;  1KC8 W;  3T1Y O;  2XAQ A;  2E5L O;  4B3M O;  5IDJ A;  1XRE A;  3WG7 B;  4I5S A;  3LNN A;  4X66 B;  4O4H A;  1E1Q G;  4F6R A;  3JAM N;  4IHJ A;  5GTH Z;  2ATK C;  2MK3 A;  4YHH O;  4MTF A;  1CEZ A;  1HNW O;  2Y0I A;  2FYU H;  3FYE B;  5CA0 B;  4FM0 A;  2VS0 A;  1SRY A;  2A7W A;  1K4D C;  1Q86 W;  1FPO A;  2OTL V;  2V1D A;  4D7S A;  3W7U A;  1Q7Y W;  5J9P C;  4DV6 B;  1H2M A;  1KB9 F;  1Q43 A;  2JRI A;  2Q73 A;  2GUZ A;  1VQN V;  2LGW A;  1F4N A;  5EIB D;  2JS3 A;  3B8M A;  1S3J A;  3RN4 A;  1V55 C;  5LYJ A;  3T1Y B;  3ABM B;  5EC2 C;  1RP3 B;  1K8A W;  1RPR A;  2RCV A;  1HNX B;  4B3M B;  3DXR B;  4DV2 B;  5LOV B;  2EIL B;  2ARH A;  4ZOL A;  2ZE5 A;  2IJJ A;  5LHH A;  1GM9 A;  4U3F H;  1BHB A;  3FYI B;  4LR3 A;  1AP5 A;  1BCC H;  2BSK A;  4YHH B;  1JJ2 U;  1M57 C;  4I0X B;  4U3J A;  4KHP O;  4PV1 B;  4DO2 A;  1XUQ A;  3AG1 B;  1Q90 D;  3TGU H;  2UUC O;  4HNA A;  2Q7E A;  3QTC A;  1K33 A;  2BCC H;  1SES A;  1YTF B;  1I7F A;  3N2G A;  2CK3 G;  2UXD O;  1QHT A;  4JPR A;  4YJ3 A;  3M7M X;  5L3B A;  3MHH C;  3A0B Z;  4J11 A;  4KXR A;  2CH7 B;  2UXB O;  3HKE A;  4P30 A;  1FYJ A;  1HP8 A;  2ITD C;  1K4C C;  3HKC B;  2EIK C;  2JEU A;  1SKV A;  2ZE7 A;  2ILM A;  1B06 A;  2NLJ C;  4X20 B;  4KHP B;  3T4Z A;  3N2K A;  1HW7 A;  3UT5 B;  4UB6 Z;  1K5S A;  2WLI A;  5EZY B;  3KCY A;  3RVZ A;  4FPP A;  1BT8 A;  4JYB A;  4F6E A;  1RM1 B;  4D6T H;  1AJQ A;  2QJ1 A; 
#chains in the Genus database with same CATH homology
 2K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...