3CYOA

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d and complementary mutation e137k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEKSQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Transmembrane protein
total genus 33
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cyoA00
3B77A 4FK5C 4N21A 2OT5A 3K9AA 5H9CA 1ENVA 1QBZA 3GWOA 1Y66A 3CP1A 1Y4MA 4N23A 2MK3A 3H01A 5CN0A 2EBOA 2P6JA 4JGSA 3MHHC 1EBOA 3P30A 1QCEA 5CMUA 5HFMA 1SZTA 3B8MA 3M99B 1JPXA 1K34A 2EZPA 1DLBA 1MOFA 4G2KA 2X7RB 1JQ0A 1F23A 2EZOA 4E2LA 4FIPC 1QR8A 5KA5A 1I5YA 2LP7A 5KA6A 2M7WA 3B8NA 3CYOA 1QR9A 1MG1A 4JPRA 5HFLA 3WFVA 4FJCC 1DF4A 4JF3A 3MHSC 1K33A 1I5XA 1DF5A
chains in the Genus database with same CATH superfamily
2OIEA 1NT2B 1VARA 3HPLC 4FM2A 3JD1A 3H9VA 2MK3A 4CC6A 2EJ7A 3C3TA 1EZVH 5LYJA 3RT3C 2DW4A 4YXWG 3CMEV 2AZ0A 3OMNB 4QJFB 1JJOA 2CTRA 1IXBA 2ITCC 3S3WA 1GK9A 1P49A 1KUQA 4DR2B 2OTJV 1LUWA 2IJJA 1NJIW 4JAVA 4FLZA 2Q0AA 5A2QN 1XMOB 3TXSA 3ZHSA 4DR7O 2A79B 4OXSA 4LF9O 4B3RB 3HKEB 4X66O 1XMOO 3N2GB 3IC7A 3ICXA 2CUGA 5JWPA 5KHKA 1XILA 3ZBHA 4JI2O 4LF5B 1AI6A 2KG7A 2F4VB 1VQ9V 1R3LC 4XDJA 1KB9F 2ADPA 4O4HA 2WLKA 1KYOF 2GDSA 4IL6Z 1VQ7V 1VIBA 2EBOA 1AJPA 3P30A 2EIKC 1MABG 4XDLA 3CCMV 4F6EA 1JQ0A 3U11A 4E4EA 3WB2A 1ZX3A 1SQBH 4DV4O 2A3QA 1KKCA 2JRIA 2JS3A 5EBLC 3UM7A 4DV3O 2P90A 2VWKA 4DV7O 2JK5C 1PV0A 1XL6A 2R70A 2QWPB 1WB8A 5IYCO 1VQOV 1H38A 4GKKO 2R9RB 1D2DA 1Q6IA 1V55B 4TUYA 2QM8A 2XNDG 3ABLB 3ZCCA 1I94O 5H9CA 3ZS8C 1IBMO 4Z1MG 1W2BU 2BSKB 1KD1W 4I5SA 4JYAB 5IWAO 3BA9A 2P06A 2YC0A 1VQKV 2ADQB 1MOFA 5IDJA 4MVSA 4O4LA 2UXDO 4DV1O 1IZ3A 2DYRC 4U3JB 4ZOLA 1D5AA 1YDXA 1I5XA 4UVCA 2WA3A 1YEWA 3CJHA 1VMGA 3OGIB 2WLIA 4I4TA 1FD9A 3ZMZA 4DV2B 4RQFA 2UUBB 3SGIA 4LF4O 1NVPB 5B3SC 1EN6A 3L72H 4TSFG 4TT3G 5LHGA 1VQNV 4F6RB 2EIJB 4YHHO 4DK1A 1M93A 2QWQB 1S0VA 1K33A 1MZEA 4UB8Z 5KLVH 1ZL8B 2ZR3A 1ZSPA 2Q73A 3L71H 1Z5VA 2IU0A 5FNVB 1VF7A 5L3GA 1BZKA 2CH7A 1SQPH 3ZHTA 1YCIA 2DMXA 1K7DA 4Z1VA 3CE2A 1DF5A 3CD6V 4Q6GA 3AK3A 2CK3G 4DR6B 3IJ4A 3BVOA 1JFFA 1SA0B 1J5EB 3M99B 1BQZA 1XMQO 2PYJA 1F4NA 1RM1C 3HKBB 1VP7A 4WFGA 1XEQA 1F4MA 3WFVA 2DJVA 5B1AB 1B3QA 2BCCH 4YIPA 1FXKB 2OTLV 1JA8A 3VQXA 4GZRB 2RMKB 1US6A 1PD3A 4MSWC 1HNWB 1GN6A 2X7RB 3CCQV 1V9PA 4ZI7B 2A9HA 4FJCC 4PA3A 1XUQA 1FFXB 2EIKB 2ZNJA 1H8HG 1I08A 1P7GA 1VF6A 1GO3F 1CXZB 1TVKB 5LP6C 1SESA 3O65A 5J9PC 5B66Z 3C3SA 4UCUA 4NR1A 4DK0A 1KP3A 2HJDA 1U96A 3ZMSA 5CA1B 2N05A 3AEIA 1JVMA 4JV5B 5GTIZ 1Q3EA 4KFMA 3GB7C 3ETEA 2XAJA 3JALB 5AG2A 1PNMA 2G38A 2YSUB 2Q7EA 5IYDO 1AR1B 3OD4A 2BTQB 5JVDA 4UCRA 2Q7HA 4WFEA 5LMNB 4EEQA 3K03A 2KG7B 3E8FA 1K97A 4UFZA 4RUFA 2CDYA 4NXNO 3AG1C 1UJWB 1NH2D 3JSLA 3ZN0A 1JMKC 1WAZA 4H44B 2YIBD 2YXLA 3HKBA 2LQTA 4KL1A 5JJJB 4QGPA 3TXQA 4JI0B 3JD2A 2BOBC 3W7UA 4QPKA 2UU9O 3CMAV 1KKDA 2JEXA 3RYHB 3STLC 1DF4A 4K0KO 2P67A 4D7TA 4DV6O 2IU3A 2ILMA 1Q6HA 1D5NA 4LWSB 2ZXWC 3FYEB 1GM8A 5EIBC 4BWAA 1NU1H 3ZMUA 5DEDA 3T4ZA 1BS3A 3TK1A 1FPOA 5DN6G 3FB6C 4QIWF 1H2GA 4P9PA 1HNXB 1GH6A 3JAMN 1K9MW 2OWOA 3FD9A 2WLMA 2EILC 3T1YO 4JV5O 1LNQA 2YUAA 2UXNA 2YS8A 4W4LA 4LFCB 4JYCA 3ETDA 2H8PC 2W0FC 3SPCA 3ZRSA 4DV5B 2DYRB 3LUTB 1FYJA 1EBOA 1SERA 1QCEA 3WU2Z 3CS5A 1LUVA 3OMIB 1IBKB 1H2LA 2R9AA 3ZX6A 2DWDC 5KMGA 3RYFB 3OR6C 3LDCA 5EBMC 2FTKA 3QTCA 5IYZA 4BW9A 1EN5A 1WLEA 1HDJA 1VQMV 2E5LB 4IYIA 4TWKA 3CRQA 4WBNB 1WPXA 5L3DA 5BZBA 3CP1A 4UV8A 2P6JA 3SJQC 2K1EA 3FB8C 3G71V 3ABTA 4K3AA 2Q6AA 3P3NA 3DSQA 5B1OA 3U10A 2LGWA 2AXTZ 1XBLA 1NR1A 2JJ2G 4DUYB 5B1AC 2FKXA 3E35A 1FXKC 2GBOA 1VF5B 1UFIA 1NR7A 3CCJV 4OPHA 2YDEA 2RQ6A 1VQLV 4MW3A 1YHQV 3HR0A 3OMAB 1N32B 5C8YB 4MVOA 2HKOA 1SS3A 2ZQMA 1AP5A 4JI3O 5JVDB 4QNHB 4O2BA 3K0GA 4YJ2B 3ZHVA 5TISZ 3OTOB 3ZRVA 4LNUB 2BE3A 3OEHG 2AZ2A 4LFBO 4B7KA 5J2TB 3GWOA 2RN9A 1MMMA 4DV7B 4YHHB 2ZDIA 1LR1A 1SZTA 2D2CB 3JAWB 4DR1O 4TV9B 4X20A 1NQTA 3L9DA 1TUBB 3D3QA 4JI4B 3DC5A 4X1IA 5EC1C 1WPBA 1AI7A 1R6NA 1Y74B 1VEWA 3W7TA 4PV1B 4TOIA 5B5EZ 4DR7B 3CCSV 5FLXN 5FPOA 5C8YA 3B4SA 2CH7B 3D3IA 2Q9LA 5LOVB 1RPRA 3GVMA 1HW7A 4JYAO 3U0ZA 5DM6V 1ZLZA 2ATKC 2MW2B 1TUBA 2EINC 3JATA 4IIJA 4LP8A 4O4JA 4B7EA 1JOYA 1SQVH 4B3TB 1XHXA 3WB1A 3L70H 4UCSA 2LJ2A 1K4DC 2FB5A 4IYHA 4O4IA 2EX3A 3RWRD 4GKKB 1AJQA 2WLLA 4TV8A 1PP9H 2B9ZA 1IBLB 3G80A 4X88A 2R72A 1SC5B 2VRZA 5IY5C 1F7YA 3JD3A 4KUMA 3DTUB 2E5LO 4Z2WA 1FXKA 2Y4TA 3X2QC 1PNKA 1JR9A 2E76B 3CCRV 2LFSA 2HVJC 4IGGA 4I7ZB 2ZIOA 4DR5B 1MG1A 4JTCB 4TQFA 2BTOA 3IFXA 3N27A 1AR4A 2CAZC 4N23A 4FLTA 3J7AU 3CXCU 3STZC 4PI0A 5FL7G 3E86A 5E79Z 4GKJB 3F7VC 4DUZO 5LXTA 4MVUA 4X64O 1KMIZ 4NXMB 1G4YB 4MVQA 5H6RA 5KX5A 1SQXH 2FMLA 4FZ1A 2F95B 4AQYO 1HR0B 4H37A 3ZEDA 1AVMA 3BPZA 4CS4A 5J2UA 4LFBB 4U3JA 2H94A 1N36B 2VQEO 1FFTB 2Y48A 2ETNA 3ZHRA 5KHHA 4BIOA 3IAYA 1SF9A 3AG4C 1I5YA 2FYUH 3SJBC 5EC2C 2C2AA 1GTOA 3ABMB 5HFLA 3E83A 3A0HZ 1Q90D 3BHPA 3H1LH 4ZHQB 2RNBA 2XASA 2UUAB 3THOA 3TETA 1BGYH 3SYAA 2N04A 5CA1A 3K0DA 3B2EE 2ITDC 4J80A 1O9GA 2KQXA 3CHXA 2GHYA 4DR4O 3VQVA 2B1IA 2Q5ZA 4J7ZA 1GMGA 3W7WA 3CCEV 1M1KW 3F5TA 2Q4PA 4EB6A 3B77A 4DR3B 4DR4B 1IX9A 1SKVA 3LNNA 4UUJC 1IDSA 2ZM6B 4LF7B 4GUNA 2QJ1A 3E8HA 2X6AA 2CGNA 4BIUA 1XHZA 3W7XA 2P7TC 1I0HA 2UUAO 5IT9N 1XL4A 1DLBA 4LH7A 2ZCEA 4DUZB 4PA7A 1YTFD 2HR3A 3SYPA 2CE4A 2EILB 3LDEA 4UB6Z 3ETQA 2KB1A 2HJFC 3CC7V 2X6BA 1VQ6V 2QDOA 4MVZA 3JALA 3JAWA 4JZGA 2KKWA 4WFHA 3ML0A 3T4DA 4DO2A 1F51A 1Y67A 2NNUA 2YEVB 3M7MX 4CH5A 2LO1A 2Q69A 4OX9O 5IJ0A 2PZSA 1TVKA 3PJSK 5KHIA 2V4DA 5GONB 1KC8W 2HHHO 3JARB 1S3JA 5FPRA 3EVKA 3RYFA 3BCCH 4J9ZB 3I55V 4OPAA 1CEZA 3ABKC 4RQEA 5IYBO 2PI5A 3FAVB 3QF7A 3EFFK 4B3SO 1OV9A 1M57C 2XTAA 1PL0A 3HKCB 2XAFA 1PPJH 4PHZA 2OCCB 2PI4A 2ZINA 5LXTB 3H1KH 5HFMA 2CTWA 4LCUC 4U7OA 4CZZA 1K5SA 2XAQA 1H2MA 1GM7A 5D5PA 1E1QG 4RUEA 4O2BB 3R65A 2V7QG 2WLIB 5H5NA 3E2EA 2GTAA 5KAFZ 4OX9B 2HP8A 2RCVA 4FK5C 2DWEC 1DGSA 5CB4B 3T1HO 1VQ5V 4U3FH 3ABUA 4UCVA 2UXBB 3EHBB 2W0XA 4XBFA 2ZKOA 3ASOC 4KHPO 2KSDA 1YZBA 1FJGB 3SPHA 4UV9A 1XNRO 2UXXA 3OW2U 2P22C 5IY5B 2ZM6O 1R6KA 5IJ9A 4IHJB 1BCCH 3N2KA 4J7JA 2OIGA 4J9YB 2F43G 1QVFU 2HVKC 2JIZG 1FXVA 2QA4V 3JAKA 3OTFA 1AROP 2LW1A 3H1IH 4CH6A 5FNVA 3UT5A 1PNLA 2IJKA 3AK2A 2VWJA 1ZUQA 4YIOA 2Y0PA 4J10A 4DR1B 1EM1A 2F23A 3UCSC 1JPXA 5EYPB 4R50A 1VQ4V 1WA8B 3ZHUA 3OTOO 4U7NA 5EK0A 3QO7A 1EFRG 4R8CA 3RYCB 4LFAB 4LBEC 3KCXA 1N36O 1K34A 4UVBA 4KXRA 1L1FA 1J5EO 4AQYB 3VOUA 1NS1A 2LFRA 4X64B 1BHBA 3Q4HA 3AG4B 3A0RA 3JATB 4IIJB 3ZRWB 5LL6Y 5JJEB 3KZIZ 4DV4B 1QVGU 3JARA 4JAUA 1M56B 5KUMA 4BAYA 1BSMA 1W0KG 1Z5WA 4J11A 3K79A 2EULA 1V55C 4K35A 4NTWA 4DV1B 4TV9A 4X20B 3E89A 3DXRA 5LP6B 3N2GA 2GSMB 3JSNA 4JI1O 2XT9A 1HNXO 1SQGA 5J2TA 3X2QB 3CRAA 3A2FA 3AG3B 2QWOB 2IM9A 1URFA 2EJRA 2Z3YA 1SZXA 4MVMA 5CA0B 2YXHA 2W6IG 1N32O 5CA3A 1RSOB 2X0LA 4I9WA 1QNMA 5BXZA 3CWBH 5LOVA 1RPOA 3HB3B 5EZYB 4I9QA 2QSAA 3E8GA 4DV0O 1WA8A 1Y4MA 2GUZA 1MNGA 1WNSA 3AG7A 2DQ0A 3J80N 1R3JC 3T1YB 3B8MA 4P2ZA 1Y74A 1N8RW 1MZFA 2UUCO 4JI0O 3QO8A 2EIMC 2ZD9A 1M57B 4P9OA 4MW8A 3HKEA 1BT8A 3RN4A 5B1NA 3CPWU 5CMUA 5KUKA 1G1XB 3QNEA 4LNUA 1XNRB 1JFFB 1FKAO 2ZE8A 4I0XA 1R3KC 4D7SA 2JDIG 4QE7A 5JH7A 3K04A 4I50A 5EYPA 3M8AA 4DYLA 2NN4A 3OR7C 1R3IC 1NH2B 3ZRWA 4X66B 2JS5A 1PM9A 3ZMTA 1ZL8A 1WJZA 2EZPA 4FFKA 1FAFA 4G28B 4A5UB 1UPGA 4D6TH 2BSKA 3RYIA 5LGNA 4MTXA 3CB2A 3JAKB 4JI3B 3FKSG 3K5MA 2Q0OC 2UXCB 4F4LA 3K9AA 5BMVB 1XNQO 3T2MA 1M90W 4NVPA 1AILA 1BQ0A 1YJWV 1OCOC 1V54B 1MA1A 1NBMG 1NTKH 5B1BB 3HKDA 1E1RG 4I4TB 3SDLA 1EZJA 5BY1A 4X1YB 1HNZO 1SRYA 5H2FZ 4B3SB 3ABKB 2IJHA 3BA8A 2OT5A 2VS0A 2ODMA 3ZJZA 3G4SV 4DR3O 1H8EG 4K8ZA 4JI6O 3MHHC 5J2UB 5K1XA 2WLJA 3JD0A 4YY3B 2Y69C 1S76D 4H0LB 1B06A 1Q7YW 1QLEB 3FFQA 3CSXA 3RVZA 4QPJA 2GUZB 4GX5A 3SPJA 1VQPV 3HKDB 2PYLA 2DN9A 3E22B 1R73A 4FLVA 1DTOA 3LDDA 1NKDA 2NLJC 4BW5A 4KP4A 4B3MB 2JJ1G 1NZ6A 4PDRA 4FPPA 5L3CA 4X65B 4MT8A 1OCRB 4G2KA 4O4JB 2WWWA 4DXWA 3K57A 2YI9A 5KA6A 1R6TA 4O4LB 4JI5O 3FAVA 5E1AC 5LBQA 2PY5A 3OUFA 5LP6A 4MVRA 2B1GA 1FXHA 2W6JG 1SETA 3R66A 2VQEB 3AG3C 1B04A 5GW7A 2Q67A 3W7SA 2QE7G 2DOSA 1B6QA 2OCCC 3MDSA 4HZ3A 1KP2A 3BAAA 3CX5F 2QTSA 3CXHF 2UXBO 1OCOB 4YJ3B 1ZWIC 2HFEC 3WB0A 2IW5A 4NXMO 3RGBA 3RBZA 3IC9A 2F66C 1TA8A 5IJ0B 2BTQA 1TGOA 2IH1C 2P4KA 2A06H 2WLLB 4TV8B 4JTAB 2CTQA 4EKWA 1AI4A 1QQCA 5JQGA 2NR5A 3VQYA 3VQWA 3ASNB 1NTZH 5LMUO 4GT1A 1G8MA 2Y69B 4FLWA 2CGOA 1K3EA 2AW9A 1YTFB 4I55B 4YJ2A 1S5HC 3MD0A 4PDMA 2B5UA 4ZHQA 1CP9A 2Z0AA 1K4CC 1XDCA 4JI8B 1RP3B 2YIAA 2JGDA 3SJAC 5LHIA 3ZRXA 1MSDA 1QBZA 1U97A 2EIJC 4UCTA 5L3FA 2YI8A 1TAEA 4EB6B 2WA4A 1IVSA 2QM4A 5GONA 5LYJB 4GX2A 2EINB 2QWRB 5JJNB 3K9SA 1Y76B 2L35A 1N34O 1H2KA 2JEUA 3NR7A 4CC5A 4PDLA 2QM7A 4C7UA 5LMNO 2GTSA 5IWAB 1DK1A 3ABMC 4X9QA 5LMUB 3OM3B 4IHJA 2Z5UA 1THZA 1YXBA 3SPGA 3OUSA 2EZOA 1AP6A 1NVPD 4MTFA 5B3SB 2E3CA 3E22A 5EBWC 1XREA 5IYZB 2GV9A 1HR0O 3RYIB 2Q7GA 1YITV 2AGAA 4BR6A 3C90A 4QE9A 4WCEV 1YJ9V 2OYQA 4HNAB 3B09A 1F23A 4X1YA 1PL4A 4HBNA 1G6UA 1ZAUA 1YIJV 1S5JA 4JF3A 4JI5B 4JAAA 2QGNA 3OE7G 4LF9B 1ORQC 1HNWO 1Y66A 4JYYA 3D36C 1TUEB 4JYBA 3A8TA 4ZKIA 4DR2O 1COWG 5LGUA 1M4UA 3QG5A 4ASUG 1I7FA 1XQ8A 4B3TO 5BMVA 2F4VO 4Q20A 3WG7C 4GYCB 1S72V 4LF8O 4UCOA 1I94B 3RVYA 3UT5B 2AHZA 3K08A 1K73W 3BFRA 4PD4F 2ARHA 1P4RA 5L3EA 3CCUV 1IXMA 4FIPC 4PJ0Z 4B08A 5JH7B 4UVAA 1V54C 1NI8A 2N74A 5CBHA 4AI8A 2IH3C 3AG2C 5K1PA 4OGQB 3LSUA 4LF6B 1X4TA 4DV3B 4X1IB 2P5OA 4PA4A 4J42A 1Q86W 3I56V 3ETGA 4ZBMA 5F2VO 2D3OW 3CJHB 4PELA 4H13B 4JI1B 3G67A 2PUSA 4DW0A 4FFBA 1J95A 3CEIA 2ZE6A 4X8AA 5CBFA 3QO5A 4RAIA 5IE9A 3CCVV 4DR5O 1RFYA 2EIMB 1H2NA 1Y76A 3D36A 3RFRA 4HYOA 4LWSA 4RWUA 1QLNA 3JD4A 2ZR2A 3K5OA 1KBHA 2JGDB 1JJ2U 1KU9A 4R6ZA 1OCCC 3OT7A 1YI2V 4BIZA 2YXYA 4DUYO 2Q68A 1NTMH 4O4HB 2ZXWB 3K5LA 3CC4V 5A9GA 4NYKA 4JI6B 1S77D 3ABLC 2PTMA 1K92A 4N21A 4JI7B 1WP7A 3ASNC 3OFNG 4X62O 4GLXA 3ASOB 4W4KA 3OAAG 3AK1A 4X1KA 5ITZB 1HP8A 4X1KB 5ITZA 1SA0A 3BY6A 4EFEA 3DC6A 5BR8B 2BOCC 5LHHA 1QR8A 5KA5A 2M7WA 4WBNA 4JTDB 5JQGB 2UUCB 1GRJA 2XUMA 3ZN1A 1FFXA 1R1BA 1XNQB 1QHTA 4YJ3A 4FM0A 2E75B 1ENVA 5LA6A 4ZI7A 1OJHA 4WFBV 1XOUA 4JGSA 3Q4HB 5GTHZ 3K59A 2V1DA 3OEEG 3FYIB 1YJNV 4EFBA 1N33O 3K3WA 4JI4O 4O2AA 3ZMVA 4LFCO 1IURA 5JCOA 3JASB 3SJCC 1PKXA 4TQDA 1XI1A 3APQA 2F93B 2Q8VA 5EIBD 1IBKO 4G27B 4JI2B 1AI5A 4LF5O 3JYCA 3K58A 2ZNIA 3MHSC 4PI2A 2IBZH 3VBBA 3QVNA 3SYCA 3T1CA 4DV5O 1Y6XA 3F5WC 4UXNA 3UO2A 4B3RO 1L8DA 1ROPA 4CS3A 4FLUA 4DV6B 1OCZB 2QWNB 4FVMA 4K0KB 3O9OA 4DV0B 2AHYA 2DE0X 2WAMA 3RYHA 4LF8B 1L0LH 3B40A 3N2KB 3DGEA 1BE3H 2L6LA 1K8AW 3JCUZ 5H6QA 5CBGA 4WFFA 2X6CA 3CYOA 4RO2A 5KMGB 1QU7A 4X62B 4J41A 2RJZA 1WP8A 4O2AB 1N4CA 3RW0A 4PA9A 3WG7B 3LSQA 5C93A 2VQFB 4PA6A 1FJGO 4FLXA 4LC1A 1VF6C 1A32A 3UKMA 1T5EA 3TCUA 2IJIA 2XAHA 3FX7A 1K5QA 2QR4A 3CRCA 4LF6O 2UU9B 4IT5A 2LGQA 1Q5OA 1WB7A 2FL4A 2HLDG 3AG2B 2QEXV 4NTXA 3H1JH 4ZIBA 3BABA 3PN1A 1VQ8V 3T1HB 1W59A 2WPDG 3FB7C 3L74H 2ZT9B 5L3BA 4AHCA 3SYQA 1SQFA 3G6EV 3APOA 3ZIAG 3IGAC 4NKGB 1OZ0A 4L87A 3AG1B 2ZIMA 1Q6UA 3HKCA 4LFAO 2CTPA 2XAGA 2VQFO 2YIBA 4P30A 4LR3A 3H01A 3SR2C 3A0BZ 2K9PA 3MAQA 5EZYA 1GN3A 4K8XA 4NTYA 2LP7A 5LA6B 4FLYA 1BMFG 1N0JA 2DQ3A 4MTGA 1YVWA 4DV2O 2UUBO 4LF4B 4CS2A 4CBCA 2YICA 3P3PA 3JCZA 1EN4A 2HHHB 1O9HA 3E8BA 2YEVA 2F1MA 5CA0A 1Q43A 1BHAA 4DR6O 1JX9A 4GCZA 3H1HH 2WLHA 1BL8A 3TJTA 1QR9A 2R9IA 4WF9V 2H3OA 4NXNB 3KG2A 3DXRB 1HNZB 5KHJA 2QKSA 5KHGA 1OCCB 2WLNA 1IBMB 3UO3A 3CRMA 3KCYA 5CN0A 4KHPB 3S3XA 1GAXA 1GN4A 2PGGA 1P7BA 2ZE5A 4R7CA 4PDVA 1RSOA 1YF2A 1XMQB 2YIDA 2E74B 1WN7A 4ICGA 1N34B 1GN2A 2UXCO 1KECA 4AILC 1S5LZ 4ABMA 1M5IA 1GM9A 4DRXB 2O57A 2JGUA 2Y0IA 3BRCA 2LW7A 2QKAA 5DECA 2DYSC 4F6RA 2ZE7A 3CRRA 1GKFA 4DW1A 2JVDA 3L73H 3KKYA 2OCHA 1M56C 4MS2A 1YSCA 1M9NA 3OGCC 1HWYA 3NXSA 1RM1B 4MTOA 1AB3A 1JCHA 1N0NA 3I5DA 1Q8IA 4LF7O 3L75H 4J7KA 3UQ8A 4GX0A 1CPYA 2Y4UA 5KX5B 3K5NA 5BR8O 3CC2V 1OCZC 4FFBB 5CB4A 3LNMB 1FS0G 5IJ9B 2QKCA 4TUYB 4I50B 4FZ0A 2PF4E 4JI8O 1OHHG 3RYCA 1AR5A 4HAMA 1L0NH 2P4VA 1Q82W 3EXAA 2UXDB 4O4IB 4L8JA 4GKJO 4X89A 3JASA 4WFAV 3B8NA 1MSWD 4XDKA 4JPRA 4NB5A 2HG5C 4HNAA 5JCOC 5KAIZ 1AJNA 3ZHQA 1E79G 3F7YC 1OCRC 3GWKC 3D8CA 3LSSA 1Z2GA 1P84F 2A7WA 3FB5C 4B3MO 4FM1A 2XOKG 1ZTEA 1QLEC 3BEHA 2ZDIC 3SPIA 4CH4A 4E2LA 1H2SB 3J81N 2HEPA 4JI7O 4JZ2A 4FMTA 3K06A 4I0XB 3G6BA 3P32A 4CH3A 2XHBA 1W0JG 2M6YA 5B1BC 3SYOA 4YY3O 4JASA 1N33B 4I55A 1KQSU 2QTOA 5LGTA 1IBLO 4DRXA 2RDCA 3CCLV 4ZOLB 1SQQH 4X65O 2DYSB 1Q81W 3TGUH 4LH6A 5D5QA 4H33A 2A0LA 1X59A 2WSSG 4GX1A
chains in the Genus database with same CATH topology
5B1AC 3AG4B 3E35A 1FXKC 3A0RA 3D36A 4HYOA 3ZRWB 3HPLC 1QLNA 1NR7A 3CCJV 3JD4A 3JD1A 2MK3A 1VQLV 2ZR2A 4MW3A 2DW4A 4YXWG 1QVGU 1YHQV 4JAUA 3OMAB 3CMEV 1M56B 3OMNB 5KUMA 4BAYA 4QJFB 1JJ2U 2ITCC 4MVOA 2HKOA 1W0KG 1GK9A 4R6ZA 1OCCC 2ZQMA 1YI2V 3K79A 4BIZA 2OTJV 4QNHB 2Q68A 2IJJA 1NJIW 4JAVA 3K0GA 2ZXWB 1BHBA 3CC4V 1V55C 1S77D 3ZRVA 3E89A 3OEHG 3ABLC 1K92A 4N21A 2GSMB 2A79B 4OXSA 3ASNC 3GWOA 3OFNG 3ASOB 3OAAG 3X2QB 3IC7A 2ZDIA 3AG3B 1SZTA 2EJRA 2Z3YA 3BY6A 1NQTA 4MVMA 2BOCC 5LHHA 1QR8A 5KA5A 2W6IG 2M7WA 5CA3A 4JTDB 2X0LA 5EC1C 1AI6A 4I9WA 3ZN1A 1AI7A 1R6NA 3W7TA 1RPOA 3HB3B 1VQ9V 1R3LC 4XDJA 3E8GA 2WLKA 1ENVA 3CCSV 1VQ7V 1Y4MA 4WFBV 2EBOA 4JGSA 2DQ0A 1AJPA 3P30A 1R3JC 3D3IA 2EIKC 3B8MA 4P2ZA 1MABG 1RPRA 4XDLA 3CCMV 2V1DA 1N8RW 1JQ0A 3OEEG 3FYIB 5DM6V 1YJNV 2ATKC 2EINC 4LP8A 1JOYA 3QO8A 3K3WA 2EIMC 2ZD9A 3ZMVA 1M57B 5EBLC 3UM7A 4P9OA 4MW8A 1K4DC 2P90A 5B1NA 3CPWU 1PKXA 2JK5C 5CMUA 5KUKA 1XL6A 3QNEA 1AJQA 2WLLA 5IYCO 1VQOV 1H38A 1R3KC 2JDIG 2R9RB 4QE7A 4G27B 3K04A 1AI5A 1V55B 3JYCA 4X88A 3MHSC 2QM8A 3ABLB 2XNDG 3VBBA 3ZCCA 5IY5C 3JD3A 4KUMA 5H9CA 3SYCA 3DTUB 3T1CA 3OR7C 1R3IC 3F5WC 4Z1MG 1W2BU 1FXKA 1KD1W 1NH2B 3ZRWA 3X2QC 1PNKA 4UXNA 3ZMTA 1ROPA 4I5SA 1VQKV 3CCRV 2EZPA 1MOFA 2LFSA 5IDJA 2HVJC 4G28B 4MVSA 1OCZB 5LGNA 2DYRC 1MG1A 4MTXA 4JTCB 3FKSG 1I5XA 4UVCA 2AHYA 4F4LA 2WAMA 3K9AA 3IFXA 3T2MA 2WLIA 1M90W 4N23A 3ZMZA 1YJWV 3CXCU 3DGEA 4RQFA 3STZC 1OCOC 1V54B 1NVPB 5B3SC 5FL7G 1K8AW 3E86A 5H6QA 4TSFG 4TT3G 1NBMG 3F7VC 5B1BB 5CBGA 5LHGA 1E1RG 4MVUA 4WFFA 1EZJA 2X6CA 1VQNV 2EIJB 3CYOA 4RO2A 1G4YB 4MVQA 5H6RA 1S0VA 1SRYA 1K33A 3ABKB 2IJHA 2ZR3A 4PA9A 4H37A 3LSQA 2OT5A 3RW0A 3WG7B 5C93A 4PA6A 3ZJZA 3G4SV 2H94A 1H8EG 2IU0A 4LC1A 3MHHC 3UKMA 1FFTB 2WLJA 3JD0A 3TCUA 2IJIA 2XAHA 2Y69C 5L3GA 2Y48A 1K5QA 1S76D 1Q7YW 1QLEB 3AG4C 3RVZA 4QPJA 1I5YA 4GX5A 1K7DA 2HLDG 5EC2C 3SPJA 1VQPV 3AG2B 2C2AA 1GTOA 3ABMB 5HFLA 2QEXV 1DF5A 3E83A 1VQ8V 1R73A 3CD6V 1DTOA 3LDDA 2CK3G 1NKDA 2NLJC 2WPDG 4KP4A 4BW5A 3FB7C 2XASA 2JJ1G 3TETA 5L3BA 3SYAA 4PDRA 3K0DA 4FPPA 5L3CA 3M99B 4MT8A 3SYQA 1OCRB 1F4NA 2ITDC 4G2KA 3G6EV 3ZIAG 3IGAC 2GHYA 2WWWA 4DXWA 1RM1C 5KA6A 2B1IA 1OZ0A 4L87A 5E1AC 3OUFA 5LBQA 4WFGA 1F4MA 1GMGA 3AG1B 4MVRA 3WFVA 2B1GA 3W7WA 3CCEV 5B1AB 1FXHA 2W6JG 1SETA 1M1KW 3B77A 3AG3C 5GW7A 2Q67A 3W7SA 2XAGA 4UUJC 2QE7G 4P30A 1B6QA 1FXKB 2OTLV 2OCCC 3H01A 1KP2A 4HZ3A 3E8HA 2X6AA 4BIUA 1PD3A 1OCOB 4MSWC 1ZWIC 3W7XA 2HFEC 2P7TC 2IW5A 1XL4A 1DLBA 2X7RB 4PA7A 1YTFD 3RBZA 3CCQV 2LP7A 2HR3A 3SYPA 2A9HA 2IH1C 1BMFG 2DQ3A 2EILB 3LDEA 4MTGA 4FJCC 2KB1A 2HJFC 4PA3A 2X6BA 3CC7V 1VQ6V 2WLLB 4MVZA 4CBCA 4JTAB 2EIKB 1H8HG 1AI4A 3JCZA 4EKWA 1GO3F 1SESA 3E8BA 3ASNB 5J9PC 4WFHA 2YEVA 3ML0A 4GT1A 3T4DA 1G8MA 2Y69B 4DO2A 1F51A 1KP3A 1BHAA 1K3EA 2NNUA 3ZMSA 1JX9A 4GCZA 1YTFB 3AEIA 1JVMA 2YEVB 1S5HC 2Q69A 2WLHA 3MD0A 4PDMA 1BL8A 2B5UA 3PJSK 4KFMA 1QR9A 1CP9A 2R9IA 3GB7C 4WF9V 3ETEA 3KG2A 1KC8W 1K4CC 2QKSA 2XAJA 1OCCB 2WLNA 1PNMA 5LHIA 2YSUB 5IYDO 1S3JA 3ZRXA 1AR1B 1QBZA 2EIJC 5L3FA 5CN0A 4J9ZB 4WFEA 3I55V 1P7BA 3K03A 1CEZA 3ABKC 4RQEA 5IYBO 4R7CA 3E8FA 4GX2A 1K97A 4PDVA 4RUFA 2EINB 2PI5A 3EFFK 1KECA 3AG1C 1UJWB 1NH2D 1M57C 3ZN0A 1GM9A 1PL0A 2JEUA 2XAFA 4PDLA 2QM7A 2OCCB 2PI4A 2DYSC 3ABMC 3OM3B 5HFMA 4LCUC 4U7OA 4CZZA 1K5SA 1GKFA 2Z5UA 2XAQA 1THZA 1GM7A 3JD2A 2BOBC 3W7UA 4QPKA 3SPGA 3OUSA 2EZOA 3CMAV 1KKDA 1E1QG 2JEXA 4RUEA 3R65A 2V7QG 2WLIB 3E2EA 3STLC 1DF4A 2P67A 1NVPD 1M56C 4MS2A 4MTFA 5B3SB 4FK5C 2DWEC 5EBWC 1YSCA 2IU3A 1M9NA 3OGCC 1HWYA 3NXSA 1RM1B 1VQ5V 4MTOA 1JCHA 1YITV 2ZXWC 3ABUA 4QE9A 4WCEV 1YJ9V 3FYEB 1GM8A 3EHBB 3ZMUA 4GX0A 1CPYA 4XBFA 3T4ZA 1F23A 3CC2V 1OCZC 3ASOC 1YIJV 3TK1A 3LNMB 4JF3A 5DN6G 3FB6C 1FS0G 4QIWF 1H2GA 4P9PA 3OE7G 3SPHA 4UV9A 1ORQC 1K9MW 1Y66A 1OHHG 2UXXA 2WLMA 4HAMA 2EILC 3OW2U 5IY5B 1TUEB 1R6KA 4JYBA 1Q82W 1LNQA 4ZKIA 1COWG 5LGUA 2UXNA 4X89A 4ASUG 3B8NA 4WFAV 4JYCA 1MSWD 4J9YB 3ETDA 2H8PC 4JPRA 4XDKA 2F43G 1QVFU 2HVKC 2JIZG 2W0FC 2HG5C 4Q20A 3WG7C 1FXVA 3SPCA 1S72V 2QA4V 3ZRSA 1AJNA 1AROP 1E79G 3F7YC 1OCRC 1PNLA 2DYRB 3LUTB 2IJKA 3LSSA 3RVYA 1EBOA 3FB5C 2AHZA 1QCEA 1SERA 3K08A 1K73W 2XOKG 1JPXA 1QLEC 3OMIB 1P4RA 5L3EA 3CCUV 3BEHA 2ZDIC 3SPIA 1IXMA 2DWDC 4E2LA 3OR6C 4FIPC 4R50A 1VQ4V 3LDCA 4UVAA 4FMTA 5EBMC 1V54C 2FTKA 3K06A 5CBHA 3P32A 2IH3C 3AG2C 1W0JG 1WLEA 4U7NA 1VQMV 5EK0A 3QO7A 5B1BC 3SYOA 4TWKA 1EFRG 1WPXA 4R8CA 4PA4A 5L3DA 5BZBA 3CP1A 4JASA 2P6JA 4UV8A 3SJQC 1Q86W 4LBEC 3ETGA 4ZBMA 3I56V 2D3OW 4PELA 2QTOA 2K1EA 3FB8C 5LGTA 1KQSU 3G71V 1K34A 3ABTA 3CCLV 2Q6AA 4UVBA 1L1FA 5B1OA 2DYSB 1Q81W 1J95A 3VOUA 4X8AA 5CBFA 3QO5A 4H33A 2A0LA 2LFRA 4RAIA 1NR1A 3CCVV 2WSSG 2JJ2G 4GX1A 2EIMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  4FK5 C;  4N21 A;  2OT5 A;  3K9A A;  5H9C A;  1ENV A;  1QBZ A;  3GWO A;  1Y66 A;  3CP1 A;  1Y4M A;  4N23 A;  2MK3 A;  3H01 A;  5CN0 A;  2EBO A;  2P6J A;  4JGS A;  3MHH C;  1EBO A;  3P30 A;  1QCE A;  5CMU A;  5HFM A;  1SZT A;  3B8M A;  3M99 B;  1JPX A;  1K34 A;  2EZP A;  1DLB A;  1MOF A;  4G2K A;  2X7R B;  1JQ0 A;  1F23 A;  2EZO A;  4E2L A;  4FIP C;  1QR8 A;  5KA5 A;  1I5Y A;  2LP7 A;  5KA6 A;  2M7W A;  3B8N A;  3CYO A;  1QR9 A;  1MG1 A;  4JPR A;  5HFL A;  3WFV A;  4FJC C;  1DF4 A;  4JF3 A;  3MHS C;  1K33 A;  1I5X A;  1DF5 A; 
#chains in the Genus database with same CATH topology
 2OIE A;  1NT2 B;  1VAR A;  3HPL C;  4FM2 A;  3JD1 A;  3H9V A;  2MK3 A;  4CC6 A;  2EJ7 A;  3C3T A;  1EZV H;  5LYJ A;  3RT3 C;  2DW4 A;  4YXW G;  3CME V;  2AZ0 A;  3OMN B;  4QJF B;  1JJO A;  2CTR A;  1IXB A;  2ITC C;  3S3W A;  1GK9 A;  1P49 A;  1KUQ A;  4DR2 B;  2OTJ V;  1LUW A;  2IJJ A;  1NJI W;  4JAV A;  4FLZ A;  2Q0A A;  5A2Q N;  1XMO B;  3TXS A;  3ZHS A;  4DR7 O;  2A79 B;  4OXS A;  4LF9 O;  4B3R B;  3HKE B;  4X66 O;  1XMO O;  3N2G B;  3IC7 A;  3ICX A;  2CUG A;  5JWP A;  5KHK A;  1XIL A;  3ZBH A;  4JI2 O;  4LF5 B;  1AI6 A;  2KG7 A;  2F4V B;  1VQ9 V;  1R3L C;  4XDJ A;  1KB9 F;  2ADP A;  4O4H A;  2WLK A;  1KYO F;  2GDS A;  4IL6 Z;  1VQ7 V;  1VIB A;  2EBO A;  1AJP A;  3P30 A;  2EIK C;  1MAB G;  4XDL A;  3CCM V;  4F6E A;  1JQ0 A;  3U11 A;  4E4E A;  3WB2 A;  1ZX3 A;  1SQB H;  4DV4 O;  2A3Q A;  1KKC A;  2JRI A;  2JS3 A;  5EBL C;  3UM7 A;  4DV3 O;  2P90 A;  2VWK A;  4DV7 O;  2JK5 C;  1PV0 A;  1XL6 A;  2R70 A;  2QWP B;  1WB8 A;  5IYC O;  1VQO V;  1H38 A;  4GKK O;  2R9R B;  1D2D A;  1Q6I A;  1V55 B;  4TUY A;  2QM8 A;  2XND G;  3ABL B;  3ZCC A;  1I94 O;  5H9C A;  3ZS8 C;  1IBM O;  4Z1M G;  1W2B U;  2BSK B;  1KD1 W;  4I5S A;  4JYA B;  5IWA O;  3BA9 A;  2P06 A;  2YC0 A;  1VQK V;  2ADQ B;  1MOF A;  5IDJ A;  4MVS A;  4O4L A;  2UXD O;  4DV1 O;  1IZ3 A;  2DYR C;  4U3J B;  4ZOL A;  1D5A A;  1YDX A;  1I5X A;  4UVC A;  2WA3 A;  1YEW A;  3CJH A;  1VMG A;  3OGI B;  2WLI A;  4I4T A;  1FD9 A;  3ZMZ A;  4DV2 B;  4RQF A;  2UUB B;  3SGI A;  4LF4 O;  1NVP B;  5B3S C;  1EN6 A;  3L72 H;  4TSF G;  4TT3 G;  5LHG A;  1VQN V;  4F6R B;  2EIJ B;  4YHH O;  4DK1 A;  1M93 A;  2QWQ B;  1S0V A;  1K33 A;  1MZE A;  4UB8 Z;  5KLV H;  1ZL8 B;  2ZR3 A;  1ZSP A;  2Q73 A;  3L71 H;  1Z5V A;  2IU0 A;  5FNV B;  1VF7 A;  5L3G A;  1BZK A;  2CH7 A;  1SQP H;  3ZHT A;  1YCI A;  2DMX A;  1K7D A;  4Z1V A;  3CE2 A;  1DF5 A;  3CD6 V;  4Q6G A;  3AK3 A;  2CK3 G;  4DR6 B;  3IJ4 A;  3BVO A;  1JFF A;  1SA0 B;  1J5E B;  3M99 B;  1BQZ A;  1XMQ O;  2PYJ A;  1F4N A;  1RM1 C;  3HKB B;  1VP7 A;  4WFG A;  1XEQ A;  1F4M A;  3WFV A;  2DJV A;  5B1A B;  1B3Q A;  2BCC H;  4YIP A;  1FXK B;  2OTL V;  1JA8 A;  3VQX A;  4GZR B;  2RMK B;  1US6 A;  1PD3 A;  4MSW C;  1HNW B;  1GN6 A;  2X7R B;  3CCQ V;  1V9P A;  4ZI7 B;  2A9H A;  4FJC C;  4PA3 A;  1XUQ A;  1FFX B;  2EIK B;  2ZNJ A;  1H8H G;  1I08 A;  1P7G A;  1VF6 A;  1GO3 F;  1CXZ B;  1TVK B;  5LP6 C;  1SES A;  3O65 A;  5J9P C;  5B66 Z;  3C3S A;  4UCU A;  4NR1 A;  4DK0 A;  1KP3 A;  2HJD A;  1U96 A;  3ZMS A;  5CA1 B;  2N05 A;  3AEI A;  1JVM A;  4JV5 B;  5GTI Z;  1Q3E A;  4KFM A;  3GB7 C;  3ETE A;  2XAJ A;  3JAL B;  5AG2 A;  1PNM A;  2G38 A;  2YSU B;  2Q7E A;  5IYD O;  1AR1 B;  3OD4 A;  2BTQ B;  5JVD A;  4UCR A;  2Q7H A;  4WFE A;  5LMN B;  4EEQ A;  3K03 A;  2KG7 B;  3E8F A;  1K97 A;  4UFZ A;  4RUF A;  2CDY A;  4NXN O;  3AG1 C;  1UJW B;  1NH2 D;  3JSL A;  3ZN0 A;  1JMK C;  1WAZ A;  4H44 B;  2YIB D;  2YXL A;  3HKB A;  2LQT A;  4KL1 A;  5JJJ B;  4QGP A;  3TXQ A;  4JI0 B;  3JD2 A;  2BOB C;  3W7U A;  4QPK A;  2UU9 O;  3CMA V;  1KKD A;  2JEX A;  3RYH B;  3STL C;  1DF4 A;  4K0K O;  2P67 A;  4D7T A;  4DV6 O;  2IU3 A;  2ILM A;  1Q6H A;  1D5N A;  4LWS B;  2ZXW C;  3FYE B;  1GM8 A;  5EIB C;  4BWA A;  1NU1 H;  3ZMU A;  5DED A;  3T4Z A;  1BS3 A;  3TK1 A;  1FPO A;  5DN6 G;  3FB6 C;  4QIW F;  1H2G A;  4P9P A;  1HNX B;  1GH6 A;  3JAM N;  1K9M W;  2OWO A;  3FD9 A;  2WLM A;  2EIL C;  3T1Y O;  4JV5 O;  1LNQ A;  2YUA A;  2UXN A;  2YS8 A;  4W4L A;  4LFC B;  4JYC A;  3ETD A;  2H8P C;  2W0F C;  3SPC A;  3ZRS A;  4DV5 B;  2DYR B;  3LUT B;  1FYJ A;  1EBO A;  1SER A;  1QCE A;  3WU2 Z;  3CS5 A;  1LUV A;  3OMI B;  1IBK B;  1H2L A;  2R9A A;  3ZX6 A;  2DWD C;  5KMG A;  3RYF B;  3OR6 C;  3LDC A;  5EBM C;  2FTK A;  3QTC A;  5IYZ A;  4BW9 A;  1EN5 A;  1WLE A;  1HDJ A;  1VQM V;  2E5L B;  4IYI A;  4TWK A;  3CRQ A;  4WBN B;  1WPX A;  5L3D A;  5BZB A;  3CP1 A;  4UV8 A;  2P6J A;  3SJQ C;  2K1E A;  3FB8 C;  3G71 V;  3ABT A;  4K3A A;  2Q6A A;  3P3N A;  3DSQ A;  5B1O A;  3U10 A;  2LGW A;  2AXT Z;  1XBL A;  1NR1 A;  2JJ2 G;  4DUY B;  5B1A C;  2FKX A;  3E35 A;  1FXK C;  2GBO A;  1VF5 B;  1UFI A;  1NR7 A;  3CCJ V;  4OPH A;  2YDE A;  2RQ6 A;  1VQL V;  4MW3 A;  1YHQ V;  3HR0 A;  3OMA B;  1N32 B;  5C8Y B;  4MVO A;  2HKO A;  1SS3 A;  2ZQM A;  1AP5 A;  4JI3 O;  5JVD B;  4QNH B;  4O2B A;  3K0G A;  4YJ2 B;  3ZHV A;  5TIS Z;  3OTO B;  3ZRV A;  4LNU B;  2BE3 A;  3OEH G;  2AZ2 A;  4LFB O;  4B7K A;  5J2T B;  3GWO A;  2RN9 A;  1MMM A;  4DV7 B;  4YHH B;  2ZDI A;  1LR1 A;  1SZT A;  2D2C B;  3JAW B;  4DR1 O;  4TV9 B;  4X20 A;  1NQT A;  3L9D A;  1TUB B;  3D3Q A;  4JI4 B;  3DC5 A;  4X1I A;  5EC1 C;  1WPB A;  1AI7 A;  1R6N A;  1Y74 B;  1VEW A;  3W7T A;  4PV1 B;  4TOI A;  5B5E Z;  4DR7 B;  3CCS V;  5FLX N;  5FPO A;  5C8Y A;  3B4S A;  2CH7 B;  3D3I A;  2Q9L A;  5LOV B;  1RPR A;  3GVM A;  1HW7 A;  4JYA O;  3U0Z A;  5DM6 V;  1ZLZ A;  2ATK C;  2MW2 B;  1TUB A;  2EIN C;  3JAT A;  4IIJ A;  4LP8 A;  4O4J A;  4B7E A;  1JOY A;  1SQV H;  4B3T B;  1XHX A;  3WB1 A;  3L70 H;  4UCS A;  2LJ2 A;  1K4D C;  2FB5 A;  4IYH A;  4O4I A;  2EX3 A;  3RWR D;  4GKK B;  1AJQ A;  2WLL A;  4TV8 A;  1PP9 H;  2B9Z A;  1IBL B;  3G80 A;  4X88 A;  2R72 A;  1SC5 B;  2VRZ A;  5IY5 C;  1F7Y A;  3JD3 A;  4KUM A;  3DTU B;  2E5L O;  4Z2W A;  1FXK A;  2Y4T A;  3X2Q C;  1PNK A;  1JR9 A;  2E76 B;  3CCR V;  2LFS A;  2HVJ C;  4IGG A;  4I7Z B;  2ZIO A;  4DR5 B;  1MG1 A;  4JTC B;  4TQF A;  2BTO A;  3IFX A;  3N27 A;  1AR4 A;  2CAZ C;  4N23 A;  4FLT A;  3J7A U;  3CXC U;  3STZ C;  4PI0 A;  5FL7 G;  3E86 A;  5E79 Z;  4GKJ B;  3F7V C;  4DUZ O;  5LXT A;  4MVU A;  4X64 O;  1KMI Z;  4NXM B;  1G4Y B;  4MVQ A;  5H6R A;  5KX5 A;  1SQX H;  2FML A;  4FZ1 A;  2F95 B;  4AQY O;  1HR0 B;  4H37 A;  3ZED A;  1AVM A;  3BPZ A;  4CS4 A;  5J2U A;  4LFB B;  4U3J A;  2H94 A;  1N36 B;  2VQE O;  1FFT B;  2Y48 A;  2ETN A;  3ZHR A;  5KHH A;  4BIO A;  3IAY A;  1SF9 A;  3AG4 C;  1I5Y A;  2FYU H;  3SJB C;  5EC2 C;  2C2A A;  1GTO A;  3ABM B;  5HFL A;  3E83 A;  3A0H Z;  1Q90 D;  3BHP A;  3H1L H;  4ZHQ B;  2RNB A;  2XAS A;  2UUA B;  3THO A;  3TET A;  1BGY H;  3SYA A;  2N04 A;  5CA1 A;  3K0D A;  3B2E E;  2ITD C;  4J80 A;  1O9G A;  2KQX A;  3CHX A;  2GHY A;  4DR4 O;  3VQV A;  2B1I A;  2Q5Z A;  4J7Z A;  1GMG A;  3W7W A;  3CCE V;  1M1K W;  3F5T A;  2Q4P A;  4EB6 A;  3B77 A;  4DR3 B;  4DR4 B;  1IX9 A;  1SKV A;  3LNN A;  4UUJ C;  1IDS A;  2ZM6 B;  4LF7 B;  4GUN A;  2QJ1 A;  3E8H A;  2X6A A;  2CGN A;  4BIU A;  1XHZ A;  3W7X A;  2P7T C;  1I0H A;  2UUA O;  5IT9 N;  1XL4 A;  1DLB A;  4LH7 A;  2ZCE A;  4DUZ B;  4PA7 A;  1YTF D;  2HR3 A;  3SYP A;  2CE4 A;  2EIL B;  3LDE A;  4UB6 Z;  3ETQ A;  2KB1 A;  2HJF C;  3CC7 V;  2X6B A;  1VQ6 V;  2QDO A;  4MVZ A;  3JAL A;  3JAW A;  4JZG A;  2KKW A;  4WFH A;  3ML0 A;  3T4D A;  4DO2 A;  1F51 A;  1Y67 A;  2NNU A;  2YEV B;  3M7M X;  4CH5 A;  2LO1 A;  2Q69 A;  4OX9 O;  5IJ0 A;  2PZS A;  1TVK A;  3PJS K;  5KHI A;  2V4D A;  5GON B;  1KC8 W;  2HHH O;  3JAR B;  1S3J A;  5FPR A;  3EVK A;  3RYF A;  3BCC H;  4J9Z B;  3I55 V;  4OPA A;  1CEZ A;  3ABK C;  4RQE A;  5IYB O;  2PI5 A;  3FAV B;  3QF7 A;  3EFF K;  4B3S O;  1OV9 A;  1M57 C;  2XTA A;  1PL0 A;  3HKC B;  2XAF A;  1PPJ H;  4PHZ A;  2OCC B;  2PI4 A;  2ZIN A;  5LXT B;  3H1K H;  5HFM A;  2CTW A;  4LCU C;  4U7O A;  4CZZ A;  1K5S A;  2XAQ A;  1H2M A;  1GM7 A;  5D5P A;  1E1Q G;  4RUE A;  4O2B B;  3R65 A;  2V7Q G;  2WLI B;  5H5N A;  3E2E A;  2GTA A;  5KAF Z;  4OX9 B;  2HP8 A;  2RCV A;  4FK5 C;  2DWE C;  1DGS A;  5CB4 B;  3T1H O;  1VQ5 V;  4U3F H;  3ABU A;  4UCV A;  2UXB B;  3EHB B;  2W0X A;  4XBF A;  2ZKO A;  3ASO C;  4KHP O;  2KSD A;  1YZB A;  1FJG B;  3SPH A;  4UV9 A;  1XNR O;  2UXX A;  3OW2 U;  2P22 C;  5IY5 B;  2ZM6 O;  1R6K A;  5IJ9 A;  4IHJ B;  1BCC H;  3N2K A;  4J7J A;  2OIG A;  4J9Y B;  2F43 G;  1QVF U;  2HVK C;  2JIZ G;  1FXV A;  2QA4 V;  3JAK A;  3OTF A;  1ARO P;  2LW1 A;  3H1I H;  4CH6 A;  5FNV A;  3UT5 A;  1PNL A;  2IJK A;  3AK2 A;  2VWJ A;  1ZUQ A;  4YIO A;  2Y0P A;  4J10 A;  4DR1 B;  1EM1 A;  2F23 A;  3UCS C;  1JPX A;  5EYP B;  4R50 A;  1VQ4 V;  1WA8 B;  3ZHU A;  3OTO O;  4U7N A;  5EK0 A;  3QO7 A;  1EFR G;  4R8C A;  3RYC B;  4LFA B;  4LBE C;  3KCX A;  1N36 O;  1K34 A;  4UVB A;  4KXR A;  1L1F A;  1J5E O;  4AQY B;  3VOU A;  1NS1 A;  2LFR A;  4X64 B;  1BHB A;  3Q4H A;  3AG4 B;  3A0R A;  3JAT B;  4IIJ B;  3ZRW B;  5LL6 Y;  5JJE B;  3KZI Z;  4DV4 B;  1QVG U;  3JAR A;  4JAU A;  1M56 B;  5KUM A;  4BAY A;  1BSM A;  1W0K G;  1Z5W A;  4J11 A;  3K79 A;  2EUL A;  1V55 C;  4K35 A;  4NTW A;  4DV1 B;  4TV9 A;  4X20 B;  3E89 A;  3DXR A;  5LP6 B;  3N2G A;  2GSM B;  3JSN A;  4JI1 O;  2XT9 A;  1HNX O;  1SQG A;  5J2T A;  3X2Q B;  3CRA A;  3A2F A;  3AG3 B;  2QWO B;  2IM9 A;  1URF A;  2EJR A;  2Z3Y A;  1SZX A;  4MVM A;  5CA0 B;  2YXH A;  2W6I G;  1N32 O;  5CA3 A;  1RSO B;  2X0L A;  4I9W A;  1QNM A;  5BXZ A;  3CWB H;  5LOV A;  1RPO A;  3HB3 B;  5EZY B;  4I9Q A;  2QSA A;  3E8G A;  4DV0 O;  1WA8 A;  1Y4M A;  2GUZ A;  1MNG A;  1WNS A;  3AG7 A;  2DQ0 A;  3J80 N;  1R3J C;  3T1Y B;  3B8M A;  4P2Z A;  1Y74 A;  1N8R W;  1MZF A;  2UUC O;  4JI0 O;  3QO8 A;  2EIM C;  2ZD9 A;  1M57 B;  4P9O A;  4MW8 A;  3HKE A;  1BT8 A;  3RN4 A;  5B1N A;  3CPW U;  5CMU A;  5KUK A;  1G1X B;  3QNE A;  4LNU A;  1XNR B;  1JFF B;  1FKA O;  2ZE8 A;  4I0X A;  1R3K C;  4D7S A;  2JDI G;  4QE7 A;  5JH7 A;  3K04 A;  4I50 A;  5EYP A;  3M8A A;  4DYL A;  2NN4 A;  3OR7 C;  1R3I C;  1NH2 B;  3ZRW A;  4X66 B;  2JS5 A;  1PM9 A;  3ZMT A;  1ZL8 A;  1WJZ A;  2EZP A;  4FFK A;  1FAF A;  4G28 B;  4A5U B;  1UPG A;  4D6T H;  2BSK A;  3RYI A;  5LGN A;  4MTX A;  3CB2 A;  3JAK B;  4JI3 B;  3FKS G;  3K5M A;  2Q0O C;  2UXC B;  4F4L A;  3K9A A;  5BMV B;  1XNQ O;  3T2M A;  1M90 W;  4NVP A;  1AIL A;  1BQ0 A;  1YJW V;  1OCO C;  1V54 B;  1MA1 A;  1NBM G;  1NTK H;  5B1B B;  3HKD A;  1E1R G;  4I4T B;  3SDL A;  1EZJ A;  5BY1 A;  4X1Y B;  1HNZ O;  1SRY A;  5H2F Z;  4B3S B;  3ABK B;  2IJH A;  3BA8 A;  2OT5 A;  2VS0 A;  2ODM A;  3ZJZ A;  3G4S V;  4DR3 O;  1H8E G;  4K8Z A;  4JI6 O;  3MHH C;  5J2U B;  5K1X A;  2WLJ A;  3JD0 A;  4YY3 B;  2Y69 C;  1S76 D;  4H0L B;  1B06 A;  1Q7Y W;  1QLE B;  3FFQ A;  3CSX A;  3RVZ A;  4QPJ A;  2GUZ B;  4GX5 A;  3SPJ A;  1VQP V;  3HKD B;  2PYL A;  2DN9 A;  3E22 B;  1R73 A;  4FLV A;  1DTO A;  3LDD A;  1NKD A;  2NLJ C;  4BW5 A;  4KP4 A;  4B3M B;  2JJ1 G;  1NZ6 A;  4PDR A;  4FPP A;  5L3C A;  4X65 B;  4MT8 A;  1OCR B;  4G2K A;  4O4J B;  2WWW A;  4DXW A;  3K57 A;  2YI9 A;  5KA6 A;  1R6T A;  4O4L B;  4JI5 O;  3FAV A;  5E1A C;  5LBQ A;  2PY5 A;  3OUF A;  5LP6 A;  4MVR A;  2B1G A;  1FXH A;  2W6J G;  1SET A;  3R66 A;  2VQE B;  3AG3 C;  1B04 A;  5GW7 A;  2Q67 A;  3W7S A;  2QE7 G;  2DOS A;  1B6Q A;  2OCC C;  3MDS A;  4HZ3 A;  1KP2 A;  3BAA A;  3CX5 F;  2QTS A;  3CXH F;  2UXB O;  1OCO B;  4YJ3 B;  1ZWI C;  2HFE C;  3WB0 A;  2IW5 A;  4NXM O;  3RGB A;  3RBZ A;  3IC9 A;  2F66 C;  1TA8 A;  5IJ0 B;  2BTQ A;  1TGO A;  2IH1 C;  2P4K A;  2A06 H;  2WLL B;  4TV8 B;  4JTA B;  2CTQ A;  4EKW A;  1AI4 A;  1QQC A;  5JQG A;  2NR5 A;  3VQY A;  3VQW A;  3ASN B;  1NTZ H;  5LMU O;  4GT1 A;  1G8M A;  2Y69 B;  4FLW A;  2CGO A;  1K3E A;  2AW9 A;  1YTF B;  4I55 B;  4YJ2 A;  1S5H C;  3MD0 A;  4PDM A;  2B5U A;  4ZHQ A;  1CP9 A;  2Z0A A;  1K4C C;  1XDC A;  4JI8 B;  1RP3 B;  2YIA A;  2JGD A;  3SJA C;  5LHI A;  3ZRX A;  1MSD A;  1QBZ A;  1U97 A;  2EIJ C;  4UCT A;  5L3F A;  2YI8 A;  1TAE A;  4EB6 B;  2WA4 A;  1IVS A;  2QM4 A;  5GON A;  5LYJ B;  4GX2 A;  2EIN B;  2QWR B;  5JJN B;  3K9S A;  1Y76 B;  2L35 A;  1N34 O;  1H2K A;  2JEU A;  3NR7 A;  4CC5 A;  4PDL A;  2QM7 A;  4C7U A;  5LMN O;  2GTS A;  5IWA B;  1DK1 A;  3ABM C;  4X9Q A;  5LMU B;  3OM3 B;  4IHJ A;  2Z5U A;  1THZ A;  1YXB A;  3SPG A;  3OUS A;  2EZO A;  1AP6 A;  1NVP D;  4MTF A;  5B3S B;  2E3C A;  3E22 A;  5EBW C;  1XRE A;  5IYZ B;  2GV9 A;  1HR0 O;  3RYI B;  2Q7G A;  1YIT V;  2AGA A;  4BR6 A;  3C90 A;  4QE9 A;  4WCE V;  1YJ9 V;  2OYQ A;  4HNA B;  3B09 A;  1F23 A;  4X1Y A;  1PL4 A;  4HBN A;  1G6U A;  1ZAU A;  1YIJ V;  1S5J A;  4JF3 A;  4JI5 B;  4JAA A;  2QGN A;  3OE7 G;  4LF9 B;  1ORQ C;  1HNW O;  1Y66 A;  4JYY A;  3D36 C;  1TUE B;  4JYB A;  3A8T A;  4ZKI A;  4DR2 O;  1COW G;  5LGU A;  1M4U A;  3QG5 A;  4ASU G;  1I7F A;  1XQ8 A;  4B3T O;  5BMV A;  2F4V O;  4Q20 A;  3WG7 C;  4GYC B;  1S72 V;  4LF8 O;  4UCO A;  1I94 B;  3RVY A;  3UT5 B;  2AHZ A;  3K08 A;  1K73 W;  3BFR A;  4PD4 F;  2ARH A;  1P4R A;  5L3E A;  3CCU V;  1IXM A;  4FIP C;  4PJ0 Z;  4B08 A;  5JH7 B;  4UVA A;  1V54 C;  1NI8 A;  2N74 A;  5CBH A;  4AI8 A;  2IH3 C;  3AG2 C;  5K1P A;  4OGQ B;  3LSU A;  4LF6 B;  1X4T A;  4DV3 B;  4X1I B;  2P5O A;  4PA4 A;  4J42 A;  1Q86 W;  3I56 V;  3ETG A;  4ZBM A;  5F2V O;  2D3O W;  3CJH B;  4PEL A;  4H13 B;  4JI1 B;  3G67 A;  2PUS A;  4DW0 A;  4FFB A;  1J95 A;  3CEI A;  2ZE6 A;  4X8A A;  5CBF A;  3QO5 A;  4RAI A;  5IE9 A;  3CCV V;  4DR5 O;  1RFY A;  2EIM B;  1H2N A;  1Y76 A;  3D36 A;  3RFR A;  4HYO A;  4LWS A;  4RWU A;  1QLN A;  3JD4 A;  2ZR2 A;  3K5O A;  1KBH A;  2JGD B;  1JJ2 U;  1KU9 A;  4R6Z A;  1OCC C;  3OT7 A;  1YI2 V;  4BIZ A;  2YXY A;  4DUY O;  2Q68 A;  1NTM H;  4O4H B;  2ZXW B;  3K5L A;  3CC4 V;  5A9G A;  4NYK A;  4JI6 B;  1S77 D;  3ABL C;  2PTM A;  1K92 A;  4N21 A;  4JI7 B;  1WP7 A;  3ASN C;  3OFN G;  4X62 O;  4GLX A;  3ASO B;  4W4K A;  3OAA G;  3AK1 A;  4X1K A;  5ITZ B;  1HP8 A;  4X1K B;  5ITZ A;  1SA0 A;  3BY6 A;  4EFE A;  3DC6 A;  5BR8 B;  2BOC C;  5LHH A;  1QR8 A;  5KA5 A;  2M7W A;  4WBN A;  4JTD B;  5JQG B;  2UUC B;  1GRJ A;  2XUM A;  3ZN1 A;  1FFX A;  1R1B A;  1XNQ B;  1QHT A;  4YJ3 A;  4FM0 A;  2E75 B;  1ENV A;  5LA6 A;  4ZI7 A;  1OJH A;  4WFB V;  1XOU A;  4JGS A;  3Q4H B;  5GTH Z;  3K59 A;  2V1D A;  3OEE G;  3FYI B;  1YJN V;  4EFB A;  1N33 O;  3K3W A;  4JI4 O;  4O2A A;  3ZMV A;  4LFC O;  1IUR A;  5JCO A;  3JAS B;  3SJC C;  1PKX A;  4TQD A;  1XI1 A;  3APQ A;  2F93 B;  2Q8V A;  5EIB D;  1IBK O;  4G27 B;  4JI2 B;  1AI5 A;  4LF5 O;  3JYC A;  3K58 A;  2ZNI A;  3MHS C;  4PI2 A;  2IBZ H;  3VBB A;  3QVN A;  3SYC A;  3T1C A;  4DV5 O;  1Y6X A;  3F5W C;  4UXN A;  3UO2 A;  4B3R O;  1L8D A;  1ROP A;  4CS3 A;  4FLU A;  4DV6 B;  1OCZ B;  2QWN B;  4FVM A;  4K0K B;  3O9O A;  4DV0 B;  2AHY A;  2DE0 X;  2WAM A;  3RYH A;  4LF8 B;  1L0L H;  3B40 A;  3N2K B;  3DGE A;  1BE3 H;  2L6L A;  1K8A W;  3JCU Z;  5H6Q A;  5CBG A;  4WFF A;  2X6C A;  3CYO A;  4RO2 A;  5KMG B;  1QU7 A;  4X62 B;  4J41 A;  2RJZ A;  1WP8 A;  4O2A B;  1N4C A;  3RW0 A;  4PA9 A;  3WG7 B;  3LSQ A;  5C93 A;  2VQF B;  4PA6 A;  1FJG O;  4FLX A;  4LC1 A;  1VF6 C;  1A32 A;  3UKM A;  1T5E A;  3TCU A;  2IJI A;  2XAH A;  3FX7 A;  1K5Q A;  2QR4 A;  3CRC A;  4LF6 O;  2UU9 B;  4IT5 A;  2LGQ A;  1Q5O A;  1WB7 A;  2FL4 A;  2HLD G;  3AG2 B;  2QEX V;  4NTX A;  3H1J H;  4ZIB A;  3BAB A;  3PN1 A;  1VQ8 V;  3T1H B;  1W59 A;  2WPD G;  3FB7 C;  3L74 H;  2ZT9 B;  5L3B A;  4AHC A;  3SYQ A;  1SQF A;  3G6E V;  3APO A;  3ZIA G;  3IGA C;  4NKG B;  1OZ0 A;  4L87 A;  3AG1 B;  2ZIM A;  1Q6U A;  3HKC A;  4LFA O;  2CTP A;  2XAG A;  2VQF O;  2YIB A;  4P30 A;  4LR3 A;  3H01 A;  3SR2 C;  3A0B Z;  2K9P A;  3MAQ A;  5EZY A;  1GN3 A;  4K8X A;  4NTY A;  2LP7 A;  5LA6 B;  4FLY A;  1BMF G;  1N0J A;  2DQ3 A;  4MTG A;  1YVW A;  4DV2 O;  2UUB O;  4LF4 B;  4CS2 A;  4CBC A;  2YIC A;  3P3P A;  3JCZ A;  1EN4 A;  2HHH B;  1O9H A;  3E8B A;  2YEV A;  2F1M A;  5CA0 A;  1Q43 A;  1BHA A;  4DR6 O;  1JX9 A;  4GCZ A;  3H1H H;  2WLH A;  1BL8 A;  3TJT A;  1QR9 A;  2R9I A;  4WF9 V;  2H3O A;  4NXN B;  3KG2 A;  3DXR B;  1HNZ B;  5KHJ A;  2QKS A;  5KHG A;  1OCC B;  2WLN A;  1IBM B;  3UO3 A;  3CRM A;  3KCY A;  5CN0 A;  4KHP B;  3S3X A;  1GAX A;  1GN4 A;  2PGG A;  1P7B A;  2ZE5 A;  4R7C A;  4PDV A;  1RSO A;  1YF2 A;  1XMQ B;  2YID A;  2E74 B;  1WN7 A;  4ICG A;  1N34 B;  1GN2 A;  2UXC O;  1KEC A;  4AIL C;  1S5L Z;  4ABM A;  1M5I A;  1GM9 A;  4DRX B;  2O57 A;  2JGU A;  2Y0I A;  3BRC A;  2LW7 A;  2QKA A;  5DEC A;  2DYS C;  4F6R A;  2ZE7 A;  3CRR A;  1GKF A;  4DW1 A;  2JVD A;  3L73 H;  3KKY A;  2OCH A;  1M56 C;  4MS2 A;  1YSC A;  1M9N A;  3OGC C;  1HWY A;  3NXS A;  1RM1 B;  4MTO A;  1AB3 A;  1JCH A;  1N0N A;  3I5D A;  1Q8I A;  4LF7 O;  3L75 H;  4J7K A;  3UQ8 A;  4GX0 A;  1CPY A;  2Y4U A;  5KX5 B;  3K5N A;  5BR8 O;  3CC2 V;  1OCZ C;  4FFB B;  5CB4 A;  3LNM B;  1FS0 G;  5IJ9 B;  2QKC A;  4TUY B;  4I50 B;  4FZ0 A;  2PF4 E;  4JI8 O;  1OHH G;  3RYC A;  1AR5 A;  4HAM A;  1L0N H;  2P4V A;  1Q82 W;  3EXA A;  2UXD B;  4O4I B;  4L8J A;  4GKJ O;  4X89 A;  3JAS A;  4WFA V;  3B8N A;  1MSW D;  4XDK A;  4JPR A;  4NB5 A;  2HG5 C;  4HNA A;  5JCO C;  5KAI Z;  1AJN A;  3ZHQ A;  1E79 G;  3F7Y C;  1OCR C;  3GWK C;  3D8C A;  3LSS A;  1Z2G A;  1P84 F;  2A7W A;  3FB5 C;  4B3M O;  4FM1 A;  2XOK G;  1ZTE A;  1QLE C;  3BEH A;  2ZDI C;  3SPI A;  4CH4 A;  4E2L A;  1H2S B;  3J81 N;  2HEP A;  4JI7 O;  4JZ2 A;  4FMT A;  3K06 A;  4I0X B;  3G6B A;  3P32 A;  4CH3 A;  2XHB A;  1W0J G;  2M6Y A;  5B1B C;  3SYO A;  4YY3 O;  4JAS A;  1N33 B;  4I55 A;  1KQS U;  2QTO A;  5LGT A;  1IBL O;  4DRX A;  2RDC A;  3CCL V;  4ZOL B;  1SQQ H;  4X65 O;  2DYS B;  1Q81 W;  3TGU H;  4LH6 A;  5D5Q A;  4H33 A;  2A0L A;  1X59 A;  2WSS G;  4GX1 A; 
#chains in the Genus database with same CATH homology
 5B1A C;  3AG4 B;  3E35 A;  1FXK C;  3A0R A;  3D36 A;  4HYO A;  3ZRW B;  3HPL C;  1QLN A;  1NR7 A;  3CCJ V;  3JD4 A;  3JD1 A;  2MK3 A;  1VQL V;  2ZR2 A;  4MW3 A;  2DW4 A;  4YXW G;  1QVG U;  1YHQ V;  4JAU A;  3OMA B;  3CME V;  1M56 B;  3OMN B;  5KUM A;  4BAY A;  4QJF B;  1JJ2 U;  2ITC C;  4MVO A;  2HKO A;  1W0K G;  1GK9 A;  4R6Z A;  1OCC C;  2ZQM A;  1YI2 V;  3K79 A;  4BIZ A;  2OTJ V;  4QNH B;  2Q68 A;  2IJJ A;  1NJI W;  4JAV A;  3K0G A;  2ZXW B;  1BHB A;  3CC4 V;  1V55 C;  1S77 D;  3ZRV A;  3E89 A;  3OEH G;  3ABL C;  1K92 A;  4N21 A;  2GSM B;  2A79 B;  4OXS A;  3ASN C;  3GWO A;  3OFN G;  3ASO B;  3OAA G;  3X2Q B;  3IC7 A;  2ZDI A;  3AG3 B;  1SZT A;  2EJR A;  2Z3Y A;  3BY6 A;  1NQT A;  4MVM A;  2BOC C;  5LHH A;  1QR8 A;  5KA5 A;  2W6I G;  2M7W A;  5CA3 A;  4JTD B;  2X0L A;  5EC1 C;  1AI6 A;  4I9W A;  3ZN1 A;  1AI7 A;  1R6N A;  3W7T A;  1RPO A;  3HB3 B;  1VQ9 V;  1R3L C;  4XDJ A;  3E8G A;  2WLK A;  1ENV A;  3CCS V;  1VQ7 V;  1Y4M A;  4WFB V;  2EBO A;  4JGS A;  2DQ0 A;  1AJP A;  3P30 A;  1R3J C;  3D3I A;  2EIK C;  3B8M A;  4P2Z A;  1MAB G;  1RPR A;  4XDL A;  3CCM V;  2V1D A;  1N8R W;  1JQ0 A;  3OEE G;  3FYI B;  5DM6 V;  1YJN V;  2ATK C;  2EIN C;  4LP8 A;  1JOY A;  3QO8 A;  3K3W A;  2EIM C;  2ZD9 A;  3ZMV A;  1M57 B;  5EBL C;  3UM7 A;  4P9O A;  4MW8 A;  1K4D C;  2P90 A;  5B1N A;  3CPW U;  1PKX A;  2JK5 C;  5CMU A;  5KUK A;  1XL6 A;  3QNE A;  1AJQ A;  2WLL A;  5IYC O;  1VQO V;  1H38 A;  1R3K C;  2JDI G;  2R9R B;  4QE7 A;  4G27 B;  3K04 A;  1AI5 A;  1V55 B;  3JYC A;  4X88 A;  3MHS C;  2QM8 A;  3ABL B;  2XND G;  3VBB A;  3ZCC A;  5IY5 C;  3JD3 A;  4KUM A;  5H9C A;  3SYC A;  3DTU B;  3T1C A;  3OR7 C;  1R3I C;  3F5W C;  4Z1M G;  1W2B U;  1FXK A;  1KD1 W;  1NH2 B;  3ZRW A;  3X2Q C;  1PNK A;  4UXN A;  3ZMT A;  1ROP A;  4I5S A;  1VQK V;  3CCR V;  2EZP A;  1MOF A;  2LFS A;  5IDJ A;  2HVJ C;  4G28 B;  4MVS A;  1OCZ B;  5LGN A;  2DYR C;  1MG1 A;  4MTX A;  4JTC B;  3FKS G;  1I5X A;  4UVC A;  2AHY A;  4F4L A;  2WAM A;  3K9A A;  3IFX A;  3T2M A;  2WLI A;  1M90 W;  4N23 A;  3ZMZ A;  1YJW V;  3CXC U;  3DGE A;  4RQF A;  3STZ C;  1OCO C;  1V54 B;  1NVP B;  5B3S C;  5FL7 G;  1K8A W;  3E86 A;  5H6Q A;  4TSF G;  4TT3 G;  1NBM G;  3F7V C;  5B1B B;  5CBG A;  5LHG A;  1E1R G;  4MVU A;  4WFF A;  1EZJ A;  2X6C A;  1VQN V;  2EIJ B;  3CYO A;  4RO2 A;  1G4Y B;  4MVQ A;  5H6R A;  1S0V A;  1SRY A;  1K33 A;  3ABK B;  2IJH A;  2ZR3 A;  4PA9 A;  4H37 A;  3LSQ A;  2OT5 A;  3RW0 A;  3WG7 B;  5C93 A;  4PA6 A;  3ZJZ A;  3G4S V;  2H94 A;  1H8E G;  2IU0 A;  4LC1 A;  3MHH C;  3UKM A;  1FFT B;  2WLJ A;  3JD0 A;  3TCU A;  2IJI A;  2XAH A;  2Y69 C;  5L3G A;  2Y48 A;  1K5Q A;  1S76 D;  1Q7Y W;  1QLE B;  3AG4 C;  3RVZ A;  4QPJ A;  1I5Y A;  4GX5 A;  1K7D A;  2HLD G;  5EC2 C;  3SPJ A;  1VQP V;  3AG2 B;  2C2A A;  1GTO A;  3ABM B;  5HFL A;  2QEX V;  1DF5 A;  3E83 A;  1VQ8 V;  1R73 A;  3CD6 V;  1DTO A;  3LDD A;  2CK3 G;  1NKD A;  2NLJ C;  2WPD G;  4KP4 A;  4BW5 A;  3FB7 C;  2XAS A;  2JJ1 G;  3TET A;  5L3B A;  3SYA A;  4PDR A;  3K0D A;  4FPP A;  5L3C A;  3M99 B;  4MT8 A;  3SYQ A;  1OCR B;  1F4N A;  2ITD C;  4G2K A;  3G6E V;  3ZIA G;  3IGA C;  2GHY A;  2WWW A;  4DXW A;  1RM1 C;  5KA6 A;  2B1I A;  1OZ0 A;  4L87 A;  5E1A C;  3OUF A;  5LBQ A;  4WFG A;  1F4M A;  1GMG A;  3AG1 B;  4MVR A;  3WFV A;  2B1G A;  3W7W A;  3CCE V;  5B1A B;  1FXH A;  2W6J G;  1SET A;  1M1K W;  3B77 A;  3AG3 C;  5GW7 A;  2Q67 A;  3W7S A;  2XAG A;  4UUJ C;  2QE7 G;  4P30 A;  1B6Q A;  1FXK B;  2OTL V;  2OCC C;  3H01 A;  1KP2 A;  4HZ3 A;  3E8H A;  2X6A A;  4BIU A;  1PD3 A;  1OCO B;  4MSW C;  1ZWI C;  3W7X A;  2HFE C;  2P7T C;  2IW5 A;  1XL4 A;  1DLB A;  2X7R B;  4PA7 A;  1YTF D;  3RBZ A;  3CCQ V;  2LP7 A;  2HR3 A;  3SYP A;  2A9H A;  2IH1 C;  1BMF G;  2DQ3 A;  2EIL B;  3LDE A;  4MTG A;  4FJC C;  2KB1 A;  2HJF C;  4PA3 A;  2X6B A;  3CC7 V;  1VQ6 V;  2WLL B;  4MVZ A;  4CBC A;  4JTA B;  2EIK B;  1H8H G;  1AI4 A;  3JCZ A;  4EKW A;  1GO3 F;  1SES A;  3E8B A;  3ASN B;  5J9P C;  4WFH A;  2YEV A;  3ML0 A;  4GT1 A;  3T4D A;  1G8M A;  2Y69 B;  4DO2 A;  1F51 A;  1KP3 A;  1BHA A;  1K3E A;  2NNU A;  3ZMS A;  1JX9 A;  4GCZ A;  1YTF B;  3AEI A;  1JVM A;  2YEV B;  1S5H C;  2Q69 A;  2WLH A;  3MD0 A;  4PDM A;  1BL8 A;  2B5U A;  3PJS K;  4KFM A;  1QR9 A;  1CP9 A;  2R9I A;  3GB7 C;  4WF9 V;  3ETE A;  3KG2 A;  1KC8 W;  1K4C C;  2QKS A;  2XAJ A;  1OCC B;  2WLN A;  1PNM A;  5LHI A;  2YSU B;  5IYD O;  1S3J A;  3ZRX A;  1AR1 B;  1QBZ A;  2EIJ C;  5L3F A;  5CN0 A;  4J9Z B;  4WFE A;  3I55 V;  1P7B A;  3K03 A;  1CEZ A;  3ABK C;  4RQE A;  5IYB O;  4R7C A;  3E8F A;  4GX2 A;  1K97 A;  4PDV A;  4RUF A;  2EIN B;  2PI5 A;  3EFF K;  1KEC A;  3AG1 C;  1UJW B;  1NH2 D;  1M57 C;  3ZN0 A;  1GM9 A;  1PL0 A;  2JEU A;  2XAF A;  4PDL A;  2QM7 A;  2OCC B;  2PI4 A;  2DYS C;  3ABM C;  3OM3 B;  5HFM A;  4LCU C;  4U7O A;  4CZZ A;  1K5S A;  1GKF A;  2Z5U A;  2XAQ A;  1THZ A;  1GM7 A;  3JD2 A;  2BOB C;  3W7U A;  4QPK A;  3SPG A;  3OUS A;  2EZO A;  3CMA V;  1KKD A;  1E1Q G;  2JEX A;  4RUE A;  3R65 A;  2V7Q G;  2WLI B;  3E2E A;  3STL C;  1DF4 A;  2P67 A;  1NVP D;  1M56 C;  4MS2 A;  4MTF A;  5B3S B;  4FK5 C;  2DWE C;  5EBW C;  1YSC A;  2IU3 A;  1M9N A;  3OGC C;  1HWY A;  3NXS A;  1RM1 B;  1VQ5 V;  4MTO A;  1JCH A;  1YIT V;  2ZXW C;  3ABU A;  4QE9 A;  4WCE V;  1YJ9 V;  3FYE B;  1GM8 A;  3EHB B;  3ZMU A;  4GX0 A;  1CPY A;  4XBF A;  3T4Z A;  1F23 A;  3CC2 V;  1OCZ C;  3ASO C;  1YIJ V;  3TK1 A;  3LNM B;  4JF3 A;  5DN6 G;  3FB6 C;  1FS0 G;  4QIW F;  1H2G A;  4P9P A;  3OE7 G;  3SPH A;  4UV9 A;  1ORQ C;  1K9M W;  1Y66 A;  1OHH G;  2UXX A;  2WLM A;  4HAM A;  2EIL C;  3OW2 U;  5IY5 B;  1TUE B;  1R6K A;  4JYB A;  1Q82 W;  1LNQ A;  4ZKI A;  1COW G;  5LGU A;  2UXN A;  4X89 A;  4ASU G;  3B8N A;  4WFA V;  4JYC A;  1MSW D;  4J9Y B;  3ETD A;  2H8P C;  4JPR A;  4XDK A;  2F43 G;  1QVF U;  2HVK C;  2JIZ G;  2W0F C;  2HG5 C;  4Q20 A;  3WG7 C;  1FXV A;  3SPC A;  1S72 V;  2QA4 V;  3ZRS A;  1AJN A;  1ARO P;  1E79 G;  3F7Y C;  1OCR C;  1PNL A;  2DYR B;  3LUT B;  2IJK A;  3LSS A;  3RVY A;  1EBO A;  3FB5 C;  2AHZ A;  1QCE A;  1SER A;  3K08 A;  1K73 W;  2XOK G;  1JPX A;  1QLE C;  3OMI B;  1P4R A;  5L3E A;  3CCU V;  3BEH A;  2ZDI C;  3SPI A;  1IXM A;  2DWD C;  4E2L A;  3OR6 C;  4FIP C;  4R50 A;  1VQ4 V;  3LDC A;  4UVA A;  4FMT A;  5EBM C;  1V54 C;  2FTK A;  3K06 A;  5CBH A;  3P32 A;  2IH3 C;  3AG2 C;  1W0J G;  1WLE A;  4U7N A;  1VQM V;  5EK0 A;  3QO7 A;  5B1B C;  3SYO A;  4TWK A;  1EFR G;  1WPX A;  4R8C A;  4PA4 A;  5L3D A;  5BZB A;  3CP1 A;  4JAS A;  2P6J A;  4UV8 A;  3SJQ C;  1Q86 W;  4LBE C;  3ETG A;  4ZBM A;  3I56 V;  2D3O W;  4PEL A;  2QTO A;  2K1E A;  3FB8 C;  5LGT A;  1KQS U;  3G71 V;  1K34 A;  3ABT A;  3CCL V;  2Q6A A;  4UVB A;  1L1F A;  5B1O A;  2DYS B;  1Q81 W;  1J95 A;  3VOU A;  4X8A A;  5CBF A;  3QO5 A;  4H33 A;  2A0L A;  2LFR A;  4RAI A;  1NR1 A;  3CCV V;  2WSS G;  2JJ2 G;  4GX1 A;  2EIM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...