3CYOA

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d and complementary mutation e137k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEKSQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 33
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cyoA00
2OT5A 4G2KA 1QR8A 4FK5C 5H9CA 5HFMA 4JGSA 5HFLA 5CN0A 4N21A 1DF4A 1JQ0A 5KA6A 1ENVA 1I5XA 1QBZA 1QR9A 1SZTA 2EBOA 1MG1A 2EZPA 1Y66A 1K33A 3B8NA 4E2LA 4JF3A 2X7RB 2M7WA 2MK3A 1F23A 1MOFA 3B8MA 5CMUA 4JPRA 3CYOA 1JPXA 1EBOA 3WFVA 3H01A 1QCEA 2P6JA 3GWOA 4FJCC 1I5YA 1DF5A 3K9AA 3CP1A 3MHSC 4FIPC 2LP7A 3MHHC 3M99B 1DLBA 1Y4MA 2EZOA 3P30A 4N23A 5KA5A 1K34A 3B77A
chains in the Genus database with same CATH superfamily
1IX9A 5IYCO 1BL8A 2VQEB 4GKKO 4UV9A 3K59A 3VQXA 1QR9A 2JJ1G 5B1NA 1SERA 2P7TC 1D5NA 2IJKA 1M4UA 4H0LB 1FKAO 1NQTA 4DR4B 2DOSA 1QCEA 1NTKH 4G27B 1PNMA 4X1KB 2XHBA 1RM1C 3BRCA 1PL4A 4JYCA 2ZINA 2XTAA 3OT7A 2YS8A 4PDVA 3N2KB 2KB1A 3A8TA 3K9SA 3BA8A 2EJ7A 2D3OW 1N34B 3FKSG 4HAMA 2XAQA 3ICXA 3AG3B 3M7MX 1G8MA 3CC7V 4H37A 2FMLA 3O9OA 3X2QB 3ZJZA 4JI5O 1M93A 1QR8A 3IFXA 5LP6C 5EK0A 3ABKC 1QHTA 4BWAA 3W7WA 3A2FA 3H1IH 4MT8A 1YTFD 4O4IB 4LFBB 1F23A 1ZTEA 4UVCA 4PA4A 1V55C 4WFFA 1S0VA 3KZIZ 3K5MA 4UB6Z 3E8GA 1HNWO 2JJ2G 4PA6A 2BTQB 3M8AA 2DQ3A 1L0LH 5ITZB 3NR7A 1R3IC 5JH7B 3IC7A 3ABLB 3FYIB 1R6TA 4JYBA 1ORQC 4BIUA 4FLVA 1ZL8B 5LYJA 2CTPA 2EIKC 2LW1A 2WLNA 3CP1A 1OV9A 1FFXB 4JZ2A 1SQXH 2ARHA 3ZN1A 3B77A 2OTLV 4F4LA 1JMKC 3TJTA 3FB8C 4R6ZA 1S77D 4G28B 2EIJB 4ZBMA 3ZMTA 1B04A 2HLDG 1KQSU 4I0XA 3CMAV 3L73H 4X62O 2E76B 2K1EA 3RVYA 5LA6A 4DRXA 4EFEA 4H44B 4JI4O 1GRJA 4B3SB 3E8FA 1KMIZ 3CC2V 2PUSA 1BZKA 2CTQA 1PV0A 4G2KA 2KG7A 1XNRO 3SJBC 2BTOA 3CCEV 1AJNA 4HYOA 4B3RO 4XDJA 1FD9A 1PKXA 3TETA 4X1IB 4LNUB 2R70A 1ZWIC 3AG4B 3JAWA 4NR1A 4DV4B 5C8YB 3BAAA 5IE9A 2V1DA 5FLXN 1OJHA 5CB4A 1JJ2U 4YY3B 2PTMA 2UU9B 1COWG 3HKCB 1SKVA 1WA8A 4DO2A 1W0KG 3OGCC 3DSQA 2ZR3A 3ZHSA 4KL1A 5KHKA 1WPXA 3FB6C 2CTWA 2UXBO 2QE7G 4UCSA 1GM8A 2OT5A 4JTCB 4JI7B 4DV5O 1DK1A 1LUWA 1KKDA 3UO3A 3B2EE 4CC5A 1O9HA 1K3EA 2UUBO 1EM1A 2IH3C 2X6AA 4H33A 5GW7A 2Y0PA 3RW0A 4X65B 3AK3A 3SJQC 1J5EO 3ZX6A 3FAVB 5IT9N 5GONB 5H6QA 4HNAB 4GKJB 3P3NA 3CC4V 2QM7A 4IL6Z 5L3EA 3RBZA 1NT2B 1NTMH 5LMNO 3MDSA 2WLLA 2HFEC 1K5QA 1IXMA 4JYYA 1AJPA 3EHBB 3T1HB 1QNMA 1IXBA 4NYKA 4UCTA 4LF7O 1R73A 4J7ZA 2EIMB 1Q6HA 2ZIMA 4I50B 4NTYA 2RNBA 4LF4B 3WB2A 1QLEC 4MS2A 1Q81W 4FLWA 4X20B 2X0LA 3JATA 3CXCU 4U3JA 3BCCH 3HPLC 2Z5UA 4DUYO 3HKBA 3CE2A 1Y6XA 4YJ3B 3AK2A 2JRIA 1HNXO 4FPPA 3LUTB 1VQ5V 1ZAUA 2Q7HA 3K5LA 3U10A 2ZKOA 3L71H 2JEUA 5CA0B 4YJ2B 5IYZB 5B3SB 4LFAB 1P84F 4MVUA 2ZM6B 3OM3B 3SR2C 1KYOF 2QEXV 4O2AA 4GYCB 2BSKB 3CJHB 4DR3O 1F4MA 3OTFA 5KMGB 4EKWA 4DV6O 1JVMA 4EFBA 4GCZA 5BZBA 2F4VB 5IJ9B 5KHIA 3RN4A 2WWWA 4WCEV 2XAFA 4FZ0A 1OZ0A 4FM2A 1VQMV 5JJJB 3ZRXA 2X6BA 2N05A 1YCIA 4B3MO 2RCVA 2XAHA 1FXKC 2DYRB 3U0ZA 2XNDG 4FVMA 4BW5A 3WFVA 4JI6O 1KU9A 4ZHQA 4D7TA 5J2TB 3RYHB 2EINB 4KHPO 2UXXA 1H8HG 3J81N 4N21A 4LBEC 1B6QA 2YC0A 4K3AA 1IURA 3CXHF 4IIJB 3KKYA 2RN9A 3CHXA 5JWPA 5KHJA 1YZBA 1KB9F 2ZQMA 3IJ4A 4WBNB 2ZDIA 3NXSA 4D7SA 3M99B 4B08A 4JV5O 3DC6A 3RVZA 4X89A 5B3SC 4ZI7A 4X64O 1K8AW 2HHHB 1YJNV 2LJ2A 4FM1A 3WG7B 2EBOA 1ROPA 1VQOV 1NVPD 2RDCA 2ZIOA 3K03A 1N32O 1PNKA 1P7GA 3BHPA 2B1IA 4UCOA 2WLKA 3F5TA 1WJZA 3MHHC 3HKEA 1MSWD 3JCUZ 1BMFG 4O2BA 1HR0O 3ZRWA 3T4ZA 2FL4A 3OAAG 5EZYB 5LGNA 2EULA 3TXSA 4WFAV 4AQYB 2VWKA 4J11A 1SA0A 3JARA 4GX2A 1GN2A 3LSUA 3JAKA 4DV0O 1GM7A 1XHZA 5F2VO 1XBLA 1XUQA 3ABUA 1OCCB 3T2MA 3TCUA 4IYIA 1HNZB 3JASA 5JCOA 3E89A 4BIZA 4J42A 3OR6C 2GDSA 3JALA 2XAJA 5LBQA 1PNLA 3B4SA 4PV1B 3P3PA 3H1LH 2A7WA 3SPJA 2V7QG 5BY1A 4PA7A 2N74A 1V54B 4DW0A 1HW7A 4IGGA 1QVFU 1H2SB 3QTCA 1W0JG 2IW5A 2DYSB 1PL0A 2HKOA 3OGIB 1BT8A 4DV1O 4DK1A 4LFCO 3JD3A 4DR7O 2OIEA 4FFBB 4ZIBA 4JF3A 1YJWV 4DR6B 1S5LZ 1GKFA 4I0XB 2LGWA 3W7SA 1N33O 5L3FA 5LA6B 5LHGA 1H2MA 1VF5B 3MAQA 1Z5VA 2RMKB 1P4RA 1SZXA 3BPZA 2A0LA 2KG7B 4I4TA 3D36A 3E86A 3HB3B 1Q43A 3CPWU 4CS4A 2A79B 2NLJC 2P4KA 1Y74A 2ZXWC 1THZA 2M6YA 2WLMA 2ZD9A 1Q90D 2L35A 1AI7A 2DW4A 2QWQB 1T5EA 2GBOA 3JAMN 3JD0A 3CCLV 2F93B 4GKKB 2QTOA 3OR7C 4PI2A 1BHBA 4YXWG 4X1YA 3SDLA 5KHHA 3EFFK 3CD6V 3GWKC 4NB5A 1JA8A 1NR7A 4JTAB 1DF4A 4I55A 3BEHA 3I56V 2WA4A 1DTOA 1R6NA 1TVKB 4DR5O 3OMAB 3ASNB 4Z1MG 5KX5A 3LDDA 3OD4A 2LP7A 5KAIZ 1VF7A 5LHIA 4MVQA 1JJOA 1Y4MA 4QNHB 5C93A 1GN4A 1VF6C 2XOKG 1M57C 4FFKA 3WB0A 1AROP 5D5PA 2HR3A 4C7UA 1YXBA 4JI5B 5LMUO 4UCUA 2WLLB 4TV9A 1MZEA 3CCUV 4WF9V 2A3QA 2P90A 2YEVA 2NNUA 4R7CA 4O4LA 4LWSA 1TUBA 3RYCA 4TOIA 3JSNA 2Q9LA 5BR8O 1OHHG 4FLXA 5DM6V 1VQ8V 3GB7C 1XMOO 2Y69C 2E5LO 4LH6A 2QWNB 2R9RB 2VQFO 4U3JB 1HNWB 4O4JA 4MTFA 5IJ0A 3LNMB 2QDOA 2UUCO 3CYOA 1R6KA 3R66A 2GSMB 4TQFA 3S3XA 2QSAA 3TK1A 1HP8A 3K79A 1I0HA 4N23A 4YIOA 1GMGA 2ZE7A 3E83A 5H2FZ 4DW1A 3SJAC 4FLYA 4GX5A 4PHZA 3OMIB 4DV2O 4JI0O 1SS3A 4O2AB 4GX0A 2LQTA 4P30A 4HBNA 2Z0AA 3OEHG 2BE3A 2ZR2A 4I7ZB 5EIBD 3TXQA 4X62B 2AXTZ 4J9YB 1Q6IA 3ETGA 1GTOA 2P22C 2JGDA 3VOUA 4JI4B 3K06A 1BQZA 3VQVA 1VARA 4LF8O 2B9ZA 1XNRB 3LNNA 3RWRD 4GLXA 2H8PC 1FJGO 1U96A 2W6JG 4MSWC 1NZ6A 2CH7A 3K9AA 4K0KO 4ZHQB 1JOYA 3LSQA 2Q4PA 4QPJA 3UT5A 1F7YA 3O65A 4XDKA 1NJIW 4B3RB 4DR2O 1L0NH 1HWYA 4JZGA 4PELA 2W0XA 3C90A 2JDIG 4B7KA 1VQ4V 2YIBD 3IC9A 4CS2A 3EXAA 4P9PA 3GWOA 1U97A 4JI3O 4X88A 2ZT9B 2WA3A 1CPYA 1QVGU 5BMVA 3ZHTA 2IJHA 1NS1A 3J80N 3L9DA 2YXHA 3LDCA 4DR4O 4RUEA 4ZI7B 5FNVA 1EN5A 1QBZA 2C2AA 5B1BB 2UXBB 4NVPA 4FLTA 1YI2V 3UQ8A 3SPGA 2ADQB 4DV5B 2AZ0A 4J80A 3CCMV 1D2DA 4JAUA 2VS0A 1XREA 2YIDA 4DUZB 3AG3C 1RPOA 4QIWF 2R9IA 3CEIA 2UUBB 3HKEB 3X2QC 2LGQA 4JYAB 3ZIAG 4CS3A 5KA6A 4AILC 3ZRWB 1J5EB 1MG1A 5CBHA 5LGUA 1YIJV 2ETNA 3JSLA 4J7JA 4UB8Z 1N36B 2JS5A 3JARB 3SYQA 2IU3A 3S3WA 1RSOA 3THOA 1BGYH 1I08A 1LR1A 2YI8A 3JAKB 1KC8W 5LMNB 3UKMA 1VP7A 2OCHA 2Y48A 3ZRVA 3SPHA 2F95B 3DTUB 4BIOA 4LF7B 1SZTA 3RFRA 3SYAA 3ABLC 1AR1B 1EZJA 3HKDB 3H01A 1GK9A 1AILA 4FJCC 4OPAA 4NXNB 3OTOO 1AB3A 2H94A 4F6EA 2QR4A 1RPRA 2UXDO 1HNXB 2EIJC 1P49A 4DV3O 1W2BU 3CCJV 2WLIA 5L3DA 1YJ9V 5J2UA 5CMUA 3KCXA 1XHXA 4F6RA 3ZHUA 5K1XA 5BXZA 1S5JA 2FYUH 4YHHB 5KUKA 3ML0A 4R8CA 3ASOB 4DR3B 4CH5A 4DV6B 3R65A 5H5NA 1SC5B 1PPJH 4I4TB 2IBZH 4PDLA 1YITV 3B8NA 4GT1A 4GZRB 1XNQO 4TT3G 2KSDA 5LOVA 1QQCA 1AI6A 4B3TO 2Q6AA 4B3MB 4TWKA 1Y74B 3AG4C 4GUNA 1GN3A 5LP6A 3H9VA 1SQVH 3SPCA 4FK5C 4OX9B 1IBLO 1NH2D 4JI6B 1AI4A 5KHGA 1ZLZA 3BABA 1MNGA 4MVOA 1IBKO 4RQFA 1E79G 2NN4A 2E75B 2WSSG 2VWJA 4UVBA 2CE4A 1Q5OA 2UXCO 4X1YB 4X9QA 3D8CA 1JFFA 3MHSC 3AG7A 1E1RG 5HFLA 1YHQV 3T1CA 2R72A 1I5XA 4GX1A 4I55B 3AG2B 2Q68A 1KP2A 1K9MW 1K7DA 4X64B 1Q8IA 1YEWA 1VQLV 3KCYA 1XI1A 1R3KC 1LNQA 3APOA 2XT9A 2HVKC 3C3TA 3ZCCA 3I55V 4Q6GA 2QWOB 1JCHA 3ZRSA 3N2GB 1N32B 5HFMA 4EB6A 5KUMA 2QKSA 4ABMA 4X65O 2QM4A 1JR9A 2Y4UA 4PDMA 3ZS8C 1K33A 3K3WA 4DV7B 1G6UA 1SQQH 1HR0B 3CRRA 2BOBC 2YEVB 4GKJO 4O4LB 4FIPC 3FX7A 3CRAA 4LWSB 3ZMSA 1TUBB 3RYCB 3TGUH 3WB1A 2EIMC 2ZNJA 3KG2A 4DYLA 2A9HA 4XBFA 1H2LA 1YF2A 4CH6A 1UFIA 2GTSA 4E2LA 4NTXA 4FM0A 4ZOLA 4O4JB 3QO7A 2AGAA 4LF4O 5KAFZ 4RAIA 2OWOA 5IWAO 2ODMA 1F51A 5CA3A 1DLBA 3L70H 2Q69A 4DR1O 1ZSPA 4KXRA 3MD0A 2EILB 5CA1A 4CC6A 2F43G 3A0HZ 5K1PA 2PYLA 3G71V 1Q7YW 1URFA 4LFAO 4DV1B 4LFCB 2ZM6O 4RUFA 4DR7B 1S5HC 3QO8A 3AEIA 3FD9A 1DGSA 1N33B 2OTJV 4LF5O 2P4VA 1H2KA 2JGDB 3G6BA 4I9WA 2CGOA 1XQ8A 3E22A 1M56B 2JEXA 1YTFB 3ZHVA 1IDSA 3BY6A 2CAZC 3B40A 2DYRC 3K08A 2W0FC 5LXTA 1NBMG 2Q7GA 2EINC 4PA3A 1AR4A 3UT5B 2ITDC 2ZCEA 1FFTB 4MVSA 2JK5C 1WB7A 3P32A 2XASA 3A0RA 1XL6A 4YIPA 1Q6UA 2BCCH 5LYJB 4MVRA 1DF5A 1OCOB 2A06H 2OCCB 2W6IG 3T1YO 5B1AB 4TUYA 4QGPA 5FNVB 3WG7C 2XUMA 5CBFA 3B09A 4DRXB 1AR5A 1GH6A 4QJFB 2QTSA 5JJNB 4DR5B 2DMXA 1CP9A 5H9CA 1R1BA 3L74H 2PZSA 3JD1A 2AW9A 1TA8A 4NXMO 1M56C 4CZZA 3CB2A 1B06A 1BCCH 2GUZA 1GAXA 3RYIA 4J9ZB 1RSOB 3OUFA 4JI1O 1IVSA 5LMUB 3FAVA 5GONA 4AI8A 1VQNV 4CBCA 1OCCC 2Q8VA 3JAWB 2H3OA 4J10A 5L3CA 5CB4B 3CCRV 2PY5A 3QG5A 1FXKA 2ATKC 3ETDA 2F66C 1XMQO 5BR8B 1K4CC 1G4YB 1HNZO 4QE7A 1EBOA 3OEEG 4CH3A 1XMOB 1WA8B 2E5LB 5JVDA 2VQFB 2ITCC 3Q4HA 1V54C 3QVNA 2UUCB 4IT5A 4JGSA 1WB8A 3W7TA 4X20A 3CSXA 1IBMO 3E2EA 1I94O 2DYSC 3K0GA 4DXWA 2AZ2A 3JD2A 2Q73A 3E35A 2WLIB 3LSSA 2IJIA 2FB5A 4JI2O 4DK0A 3JD4A 4L8JA 5J2UB 3F5WC 1OCRB 1SQFA 3ABTA 4DV2B 3HR0A 3QO5A 4FLZA 4JI0B 3L72H 5GTHZ 1RM1B 2YI9A 3P30A 2JVDA 4DR6O 5CA0A 2GHYA 2WPDG 4YJ2A 1KECA 1H2NA 5LL6Y 5IDJA 4JI8O 4PD4F 4WFHA 4X66O 4LF9O 3CJHA 2M7WA 4O4HA 1G1XB 5LOVB 4LF8B 2PI4A 4FZ1A 4JASA 5H6RA 2LFSA 5LGTA 5LP6B 1FJGB 5E79Z 3ABKB 5AG2A 3ZN0A 4K0KB 3AK1A 1NR1A 1O9GA 5J9PC 2ZE8A 3JATB 1H38A 1Y76A 1YVWA 2QA4V 5A9GA 5FL7G 3LDEA 1V55B 4E4EA 3HKBB 5J2TA 1I5YA 3RYHA 1CEZA 3IGAC 2DWEC 2YIAA 2G38A 1JFFB 4UCVA 2BOCC 3RYFA 1XILA 3G4SV 2UXNA 4IIJA 4JI3B 4RQEA 2IU0A 1R3JC 4WBNA 3H1KH 2EIKB 3ASNC 1OCRC 2Y4TA 4NTWA 2YDEA 1ZUQA 4RWUA 1VQ7V 1M5IA 1PP9H 3SPIA 1JX9A 1SQPH 1KD1W 2YUAA 2GV9A 2VRZA 4IHJA 1GN6A 3DXRA 5IY5B 4EB6B 4Z2WA 1VQPV 2HVJC 3SGIA 4LF6O 4IYHA 3FB5C 3D3IA 3ZMUA 3E8BA 1VQ6V 2WLJA 1D5AA 3ABMB 3L75H 3ZMZA 1N4CA 2B1GA 5EC2C 1S3JA 4TV8A 3G67A 5EYPA 1TAEA 1MMMA 5EZYA 4PI0A 2UUAO 1SETA 1US6A 2EX3A 4MVMA 4EEQA 4LP8A 4ZOLB 1F4NA 2YIBA 5EC1C 1X59A 2VQEO 2AHYA 5EBMC 4P2ZA 3CX5F 2QWRB 2QGNA 2NR5A 1L8DA 3DC5A 3AG1B 3OTOB 3SJCC 3CRCA 4WFBV 2KQXA 3RT3C 5CA1B 2WAMA 2UXDB 1FXHA 2DWDC 2E3CA 4U7OA 4DV3B 1NVPB 1AVMA 5JQGA 1QU7A 2F23A 5IY5C 4O2BB 3UM7A 5KLVH 3GVMA 1N34O 4FFBA 3W7XA 4UUJC 1FPOA 2ILMA 4HZ3A 3QNEA 1EZVH 5FPOA 2X6CA 3BFRA 2ZE6A 3E22B 2CDYA 2WLHA 1SA0B 3ABMC 2HP8A 2HJFC 5LXTB 3VBBA 4JAVA 1XNQB 1VF6A 4LFBO 4L87A 4LR3A 1Z2GA 2Q5ZA 2PI5A 3JASB 4B3TB 1XEQA 2CUGA 2V4DA 3K04A 3UCSC 4MW8A 1MOFA 3JALB 5A2QN 1IBLB 1L1FA 2ZE5A 1VMGA 2ZDIC 2YSUB 1IBKB 1WN7A 1M9NA 1W59A 4WFEA 4DUYB 1SRYA 1QLEB 3AG1C 3CRQA 1RP3B 2XAGA 4Q20A 2UXCB 3FB7C 4TUYB 1Y66A 5B1BC 1KKCA 1MA1A 1ZX3A 4A5UB 3J7AU 2DN9A 1KP3A 4FMTA 3OW2U 1OCZB 3FFQA 4UXNA 3ETEA 5DN6G 2JS3A 4DUZO 1MZFA 1TVKA 1B3QA 4B3SO 4Z1VA 1AP5A 3D3QA 3ZHQA 2HG5C 4KUMA 1IZ3A 4KFMA 1NTZH 4JYAO 2GUZB 3RYIB 1EN6A 4TSFG 1M90W 2K9PA 1K5SA 1FAFA 4TQDA 1K34A 1N36O 4MTXA 3WU2Z 5JCOC 1X4TA 1WAZA 1GO3F 4U7NA 4KHPB 2RQ6A 1V9PA 2HJDA 2Y0IA 1H8EG 1FXKB 2LFRA 4DV4O 3G6EV 3N27A 3VQWA 5JVDB 2L6LA 3K57A 2O57A 4YY3O 3Q4HB 3K58A 2P5OA 1J95A 2UU9O 1VEWA 3SYOA 4NXNO 5IWAB 4JV5B 2YICA 1A32A 1S72V 4DR1B 2P67A 4JI7O 4K8ZA 3CRMA 3VQYA 4X1KA 3W7UA 3UO2A 1N8RW 5KX5B 1OCZC 3H1JH 3ASOC 1TUEB 1R3LC 1XL4A 4BAYA 2QKAA 3D36C 3N2KA 5B5EZ 4YHHO 1XOUA 2EZPA 4RO2A 2MK3A 4LF5B 4JTDB 1NI8A 1SESA 3A0BZ 4BW9A 1K73W 1BSMA 4QE9A 4TV9B 4O4HB 2Q67A 5JJEB 1UJWB 4KP4A 5B66Z 3CWBH 4I9QA 1UPGA 4DV0B 4B7EA 1NKDA 1SQBH 4O4IA 3T1HO 3SYCA 4UV8A 4D6TH 5IJ0B 1Y76B 4XDLA 4OX9O 2JGUA 2DQ0A 3STLC 1Q82W 1M1KW 3ETQA 2BTQA 1AI5A 2YXLA 1VIBA 2QKCA 5ITZA 1JQ0A 3RYFB 5B1OA 4I5SA 5CBGA 5JH7A 2Z3YA 1TGOA 3APQA 2PGGA 2R9AA 1YDXA 4OGQB 2YXYA 3RGBA 1BE3H 2N04A 4J7KA 4K35A 1ZL8A 1VQKV 3AG2C 1BHAA 3T1YB 3T4DA 1E1QG 1VQ9V 1H2GA 1Y67A 1FFXA 1BS3A 2EZOA 3QF7A 2B5UA 4IHJB 4CH4A 3DXRB 3BA9A 2ZNIA 1K92A 1WP8A 2QM8A 4H13B 4PA9A 2F4VO 4QPKA 2Q0OC 2X7RB 2FTKA 1RFYA 4JPRA 3IAYA 5EBLC 3F7VC 1XDCA 4NXMB 4ASUG 4ICGA 2CH7B 1WLEA 4DV7O 4TV8B 2IH1C 5IYDO 2PF4E 1FXVA 5EYPB 4ZKIA 1CXZB 4JI1B 4OXSA 3ZMVA 1WNSA 1QLNA 5L3GA 1PM9A 4X1IA 4LNUA 3F7YC 4MVZA 4MTGA 2ZXWB 3ZEDA 2QWPB 1XMQB 3PN1A 5C8YA 3SYPA 5GTIZ 2F1MA 3EVKA 3K0DA 5BMVB 1S76D 5E1AC 1WPBA 2Q0AA 2HEPA 3JYCA 2EILC 3BVOA 3HKCA 3HKDA 3I5DA 2EJRA 5LHHA 3PJSK 1IBMB 1I94B 3FYEB 1Z5WA 1MSDA 2HHHO 2JIZG 2KKWA 4MW3A 3K5NA 5TISZ 2QJ1A 5JQGB 1LUVA 4JI2B 1Q86W 4R50A 4BR6A 3JCZA 5L3BA 5EIBC 3CMEV 2FKXA 3C3SA 1NU1H 2RJZA 3B8MA 2P6JA 4W4KA 5DEDA 2LW7A 3CCQV 4JI8B 4UFZA 4K8XA 4LF9B 4X66B 2DE0X 2IM9A 5EBWC 4LCUC 4AQYO 4HNAA 1M57B 3G80A 5FPRA 2GTAA 2CTRA 2PYJA 1N0NA 1FYJA 1WP7A 5IYBO 3OUSA 3H1HH 1OCOC 1K97A 4I50A 2AHZA 2CK3G 2OCCC 4MTOA 1KBHA 5CN0A 3OE7G 2Y69B 1K4DC 1I7FA 2P06A 5B1AC 1MABG 1EFRG 4AHCA 3DGEA 1HDJA 1PD3A 2D2CB 2E74B 3ZBHA 1P7BA 4YJ3A 1JPXA 4NKGB 1AJQA 3CCVV 4PDRA 4F6RB 2ADPA 3ZHRA 4U3FH 4PJ0Z 1Q3EA 4JAAA 1GM9A 1AP6A 5IYZA 1KUQA 1SF9A 5D5QA 4LC1A 3U11A 2OYQA 2BSKA 4P9OA 5KMGA 4W4LA 4LF6B 3K5OA 5IJ9A 2IJJA 1EN4A 3OMNB 3N2GA 1YSCA 5DECA 4FLUA 4X8AA 4UCRA 3E8HA 1ENVA 1BQ0A 3CCSV 2LO1A 2MW2B 1N0JA 1NH2B 1SQGA 4WFGA 3OFNG 4J41A 4DR2B 2OIGA 2UUAB 2DJVA 3CS5A 4UVAA 3STZC 1FS0G 2CGNA 4LH7A 4OPHA 5KA5A 2Q7EA
chains in the Genus database with same CATH topology
5IYCO 1BL8A 4L87A 5HFMA 1W0JG 2IW5A 4UV9A 2PI5A 5KUMA 2DYSB 1PL0A 2HKOA 2QKSA 1QR9A 2JJ1G 5B1NA 3JD3A 4PDMA 1QVFU 3K04A 1SERA 1K33A 2P7TC 3K3WA 4JF3A 1YJWV 2IJKA 4MW8A 1MOFA 1GKFA 3W7SA 1NQTA 1L1FA 1QCEA 5L3FA 2BOBC 2ZDIC 2YEVB 2YSUB 5LHGA 4FIPC 4G27B 1M9NA 1PNMA 3ZMSA 1RM1C 2EIMC 1P4RA 4WFEA 1SRYA 1QLEB 3AG1C 3KG2A 2A0LA 2A9HA 2XAGA 4JYCA 3D36A 4Q20A 4XBFA 3FB7C 4PDVA 3E86A 3HB3B 1Y66A 4E2LA 5B1BC 2KB1A 3QO7A 3CPWU 4RAIA 2D3OW 2A79B 2NLJC 3FKSG 4HAMA 2XAQA 1KP3A 3AG3B 2ZXWC 1G8MA 3CC7V 4FMTA 1THZA 4H37A 3OW2U 1F51A 5CA3A 1DLBA 2WLMA 1OCZB 2ZD9A 2Q69A 3X2QB 3ZJZA 1QR8A 3IFXA 4UXNA 5EK0A 1AI7A 2DW4A 3ABKC 3ETEA 5DN6G 3MD0A 3W7WA 1YTFD 4MT8A 2EILB 3JD0A 3CCLV 2F43G 1F23A 2QTOA 2HG5C 3OR7C 4KUMA 4UVCA 3G71V 4KFMA 1Q7YW 4PA4A 1V55C 4TSFG 1M90W 1BHBA 4YXWG 4RUFA 1S5HC 1K5SA 3QO8A 3AEIA 4WFFA 1S0VA 3EFFK 3CD6V 3E8GA 1K34A 1NR7A 2JJ2G 4PA6A 4MTXA 2OTJV 2DQ3A 4JTAB 1DF4A 1R3IC 3IC7A 3BEHA 3ABLB 3I56V 1GO3F 4U7NA 4I9WA 3FYIB 1DTOA 1H8EG 1FXKB 1ORQC 1R6NA 1M56B 4JYBA 2JEXA 4BIUA 2LFRA 1YTFB 3G6EV 3OMAB 3ASNB 3BY6A 2EIKC 4Z1MG 2DYRC 3K08A 2WLNA 2W0FC 3LDDA 3CP1A 1NBMG 2LP7A 5LHIA 4MVQA 2EINC 1Y4MA 4PA3A 2ITDC 3ZN1A 3B77A 1J95A 4QNHB 5C93A 1FFTB 4MVSA 2JK5C 4F4LA 2OTLV 3FB8C 4R6ZA 2XOKG 1S77D 4G28B 1M57C 3SYOA 2EIJB 4ZBMA 3P32A 1AROP 3ZMTA 2HR3A 2HLDG 1KQSU 2XASA 3A0RA 1XL6A 3CMAV 2WLLB 1S72V 2K1EA 3CCUV 4WF9V 3RVYA 2P90A 2P67A 2YEVA 2NNUA 4R7CA 4MVRA 1DF5A 1OCOB 3W7UA 3E8FA 1N8RW 3CC2V 1OCZC 3ASOC 2OCCB 2W6IG 1TUEB 1R3LC 1XL4A 4G2KA 4BAYA 1OHHG 5DM6V 1VQ8V 3GB7C 2Y69C 5B1AB 2R9RB 2EZPA 3WG7C 4MTFA 3CCEV 1AJNA 3LNMB 2MK3A 4RO2A 4HYOA 4JTDB 1SESA 3CYOA 5CBFA 1K73W 1R6KA 4QE9A 1PKXA 4XDJA 3TETA 2Q67A 2GSMB 1UJWB 4KP4A 1ZWIC 3TK1A 3AG4B 4QJFB 3K79A 4N23A 1GMGA 3E83A 1CP9A 5H9CA 2V1DA 3JD1A 4GX5A 1JJ2U 1NKDA 3OMIB 3SYCA 1COWG 4GX0A 1M56C 4UV8A 4CZZA 4XDLA 4DO2A 1W0KG 3OGCC 4P30A 4J9ZB 2ZR3A 1WPXA 3OUFA 3OEHG 2DQ0A 3STLC 1Q82W 2ZR2A 3FB6C 1M1KW 1VQNV 4CBCA 4J9YB 1AI5A 1OCCC 2QE7G 1GM8A 1GTOA 2OT5A 3ETGA 4JTCB 1JQ0A 3VOUA 5B1OA 3K06A 1KKDA 4I5SA 5CBGA 2Z3YA 5L3CA 3CCRV 1FXKA 1K3EA 2ATKC 3ETDA 1VQKV 3AG2C 1K4CC 1BHAA 3T4DA 1E1QG 1VQ9V 1G4YB 2IH3C 2X6AA 4H33A 5GW7A 4QE7A 1EBOA 3OEEG 3RW0A 2H8PC 1H2GA 2W6JG 4MSWC 3K9AA 3SJQC 2ITCC 1JOYA 3LSQA 1V54C 4QPJA 2EZOA 4JGSA 4XDKA 2B5UA 1NJIW 3W7TA 1HWYA 5H6QA 3E2EA 1K92A 4PELA 2DYSC 2QM8A 3CC4V 2JDIG 2QM7A 3K0GA 4PA9A 3RBZA 5L3EA 1VQ4V 4DXWA 4QPKA 2WLLA 3JD2A 2HFEC 2X7RB 2FTKA 3E35A 2WLIB 3LSSA 2IJIA 4JPRA 1K5QA 3JD4A 1IXMA 4P9PA 3F5WC 3GWOA 5EBLC 3F7VC 1OCRB 3ABTA 1AJPA 4X88A 4ASUG 3EHBB 3QO5A 1R73A 1RM1B 2EIMB 3P30A 1CPYA 1WLEA 1QVGU 2IJHA 2GHYA 2IH1C 2WPDG 5IYDO 1KECA 1FXVA 3LDCA 1QLEC 4MS2A 4RUEA 4ZKIA 1Q81W 4OXSA 2X0LA 5IDJA 1QBZA 3CXCU 2C2AA 5B1BB 4WFHA 2M7WA 3ZMVA 1YI2V 1QLNA 3HPLC 2Z5UA 3SPGA 5L3GA 3CCMV 3F7YC 4MVZA 4JAUA 4MTGA 2ZXWB 3AG3C 1RPOA 4FPPA 3LUTB 4QIWF 1VQ5V 2PI4A 2R9IA 4JASA 5H6RA 2LFSA 3SYPA 5LGTA 3X2QC 3K0DA 2JEUA 3ZIAG 5B3SB 3ABKB 5KA6A 1S76D 4MVUA 5E1AC 3ZRWB 3ZN0A 3OM3B 1MG1A 3JYCA 2EILC 1NR1A 5CBHA 5J9PC 5LGUA 1YIJV 1H38A 2QEXV 2EJRA 5LHHA 3PJSK 2QA4V 3SYQA 2IU3A 1F4MA 5FL7G 3LDEA 4EKWA 1V55B 3FYEB 1JVMA 1I5YA 4GCZA 1CEZA 5BZBA 3IGAC 1KC8W 2DWEC 2JIZG 2WWWA 4MW3A 3UKMA 4WCEV 1Q86W 4R50A 2XAFA 1OZ0A 3JCZA 2BOCC 5L3BA 2Y48A 3ZRVA 3G4SV 2UXNA 3ZRXA 3CMEV 2X6BA 3SPHA 4RQEA 3DTUB 2IU0A 1SZTA 3SYAA 3ABLC 1AR1B 2XAHA 1R3JC 1EZJA 3B8MA 1FXKC 2EIKB 2DYRB 2XNDG 3ASNC 4BW5A 3WFVA 3H01A 2P6JA 1GK9A 1OCRC 4FJCC 3CCQV 1VQMV 1VQ7V 2H94A 3SPIA 1JX9A 2EINB 1KD1W 2UXXA 1RPRA 5EBWC 1H8HG 4LCUC 4N21A 4LBEC 1M57B 5IY5B 1B6QA 1VQPV 2HVJC 2EIJC 1W2BU 3CCJV 3FB5C 2WLIA 5L3DA 3D3IA 1YJ9V 3ZMUA 2ZQMA 5CMUA 3E8BA 1VQ6V 2ZDIA 2WLJA 3NXSA 3ABMB 5IYBO 3ZMZA 2B1GA 3OUSA 1OCOC 5EC2C 1K97A 3M99B 1S3JA 5KUKA 3ML0A 4R8CA 3ASOB 2AHZA 2CK3G 2OCCC 4MTOA 3RVZA 5CN0A 3OE7G 4X89A 3R65A 5B3SC 2Y69B 1K8AW 1K4DC 5B1AC 1MABG 1EFRG 1YJNV 4PDLA 1YITV 3DGEA 1SETA 3WG7B 2EBOA 1ROPA 3B8NA 1VQOV 4MVMA 1NVPD 4GT1A 1PD3A 4LP8A 1F4NA 1P7BA 3K03A 5EC1C 1JPXA 1AJQA 4TT3G 3CCVV 1PNKA 4PDRA 2B1IA 2WLKA 2AHYA 1AI6A 5EBMC 2Q6AA 4P2ZA 4TWKA 3MHHC 3AG4C 1MSWD 1BMFG 3SPCA 1GM9A 4FK5C 3AG1B 3ZRWA 3T4ZA 1NH2D 1AI4A 3OAAG 5LGNA 4WFBV 4LC1A 4MVOA 4WFAV 4RQFA 1E79G 2WAMA 4GX2A 4P9OA 1FXHA 2DWDC 4U7OA 2WSSG 1NVPB 4UVBA 1GM7A 2IJJA 3ZRSA 3OMNB 1YSCA 3ABUA 1OCCB 3MHSC 3T2MA 3TCUA 4X8AA 1E1RG 5HFLA 3E8HA 1YHQV 3T1CA 5IY5C 1ENVA 3CCSV 1I5XA 3UM7A 3E89A 3W7XA 4GX1A 4UUJC 4BIZA 4HZ3A 3OR6C 3QNEA 1NH2B 4WFGA 3AG2B 2XAJA 2X6CA 3OFNG 2Q68A 5LBQA 1KP2A 1PNLA 1K9MW 1K7DA 2WLHA 1VQLV 3SPJA 2V7QG 3ABMC 4PA7A 4UVAA 1R3KC 3STZC 1LNQA 1FS0G 2HVKC 2HJFC 1V54B 3ZCCA 3VBBA 3I55V 1JCHA 5KA5A 4JAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT5 A;  4G2K A;  1QR8 A;  4FK5 C;  5H9C A;  5HFM A;  4JGS A;  5HFL A;  5CN0 A;  4N21 A;  1DF4 A;  1JQ0 A;  5KA6 A;  1ENV A;  1I5X A;  1QBZ A;  1QR9 A;  1SZT A;  2EBO A;  1MG1 A;  2EZP A;  1Y66 A;  1K33 A;  3B8N A;  4E2L A;  4JF3 A;  2X7R B;  2M7W A;  2MK3 A;  1F23 A;  1MOF A;  3B8M A;  5CMU A;  4JPR A;  3CYO A;  1JPX A;  1EBO A;  3WFV A;  3H01 A;  1QCE A;  2P6J A;  3GWO A;  4FJC C;  1I5Y A;  1DF5 A;  3K9A A;  3CP1 A;  3MHS C;  4FIP C;  2LP7 A;  3MHH C;  3M99 B;  1DLB A;  1Y4M A;  2EZO A;  3P30 A;  4N23 A;  5KA5 A;  1K34 A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1IX9 A;  5IYC O;  1BL8 A;  2VQE B;  4GKK O;  4UV9 A;  3K59 A;  3VQX A;  1QR9 A;  2JJ1 G;  5B1N A;  1SER A;  2P7T C;  1D5N A;  2IJK A;  1M4U A;  4H0L B;  1FKA O;  1NQT A;  4DR4 B;  2DOS A;  1QCE A;  1NTK H;  4G27 B;  1PNM A;  4X1K B;  2XHB A;  1RM1 C;  3BRC A;  1PL4 A;  4JYC A;  2ZIN A;  2XTA A;  3OT7 A;  2YS8 A;  4PDV A;  3N2K B;  2KB1 A;  3A8T A;  3K9S A;  3BA8 A;  2EJ7 A;  2D3O W;  1N34 B;  3FKS G;  4HAM A;  2XAQ A;  3ICX A;  3AG3 B;  3M7M X;  1G8M A;  3CC7 V;  4H37 A;  2FML A;  3O9O A;  3X2Q B;  3ZJZ A;  4JI5 O;  1M93 A;  1QR8 A;  3IFX A;  5LP6 C;  5EK0 A;  3ABK C;  1QHT A;  4BWA A;  3W7W A;  3A2F A;  3H1I H;  4MT8 A;  1YTF D;  4O4I B;  4LFB B;  1F23 A;  1ZTE A;  4UVC A;  4PA4 A;  1V55 C;  4WFF A;  1S0V A;  3KZI Z;  3K5M A;  4UB6 Z;  3E8G A;  1HNW O;  2JJ2 G;  4PA6 A;  2BTQ B;  3M8A A;  2DQ3 A;  1L0L H;  5ITZ B;  3NR7 A;  1R3I C;  5JH7 B;  3IC7 A;  3ABL B;  3FYI B;  1R6T A;  4JYB A;  1ORQ C;  4BIU A;  4FLV A;  1ZL8 B;  5LYJ A;  2CTP A;  2EIK C;  2LW1 A;  2WLN A;  3CP1 A;  1OV9 A;  1FFX B;  4JZ2 A;  1SQX H;  2ARH A;  3ZN1 A;  3B77 A;  2OTL V;  4F4L A;  1JMK C;  3TJT A;  3FB8 C;  4R6Z A;  1S77 D;  4G28 B;  2EIJ B;  4ZBM A;  3ZMT A;  1B04 A;  2HLD G;  1KQS U;  4I0X A;  3CMA V;  3L73 H;  4X62 O;  2E76 B;  2K1E A;  3RVY A;  5LA6 A;  4DRX A;  4EFE A;  4H44 B;  4JI4 O;  1GRJ A;  4B3S B;  3E8F A;  1KMI Z;  3CC2 V;  2PUS A;  1BZK A;  2CTQ A;  1PV0 A;  4G2K A;  2KG7 A;  1XNR O;  3SJB C;  2BTO A;  3CCE V;  1AJN A;  4HYO A;  4B3R O;  4XDJ A;  1FD9 A;  1PKX A;  3TET A;  4X1I B;  4LNU B;  2R70 A;  1ZWI C;  3AG4 B;  3JAW A;  4NR1 A;  4DV4 B;  5C8Y B;  3BAA A;  5IE9 A;  2V1D A;  5FLX N;  1OJH A;  5CB4 A;  1JJ2 U;  4YY3 B;  2PTM A;  2UU9 B;  1COW G;  3HKC B;  1SKV A;  1WA8 A;  4DO2 A;  1W0K G;  3OGC C;  3DSQ A;  2ZR3 A;  3ZHS A;  4KL1 A;  5KHK A;  1WPX A;  3FB6 C;  2CTW A;  2UXB O;  2QE7 G;  4UCS A;  1GM8 A;  2OT5 A;  4JTC B;  4JI7 B;  4DV5 O;  1DK1 A;  1LUW A;  1KKD A;  3UO3 A;  3B2E E;  4CC5 A;  1O9H A;  1K3E A;  2UUB O;  1EM1 A;  2IH3 C;  2X6A A;  4H33 A;  5GW7 A;  2Y0P A;  3RW0 A;  4X65 B;  3AK3 A;  3SJQ C;  1J5E O;  3ZX6 A;  3FAV B;  5IT9 N;  5GON B;  5H6Q A;  4HNA B;  4GKJ B;  3P3N A;  3CC4 V;  2QM7 A;  4IL6 Z;  5L3E A;  3RBZ A;  1NT2 B;  1NTM H;  5LMN O;  3MDS A;  2WLL A;  2HFE C;  1K5Q A;  1IXM A;  4JYY A;  1AJP A;  3EHB B;  3T1H B;  1QNM A;  1IXB A;  4NYK A;  4UCT A;  4LF7 O;  1R73 A;  4J7Z A;  2EIM B;  1Q6H A;  2ZIM A;  4I50 B;  4NTY A;  2RNB A;  4LF4 B;  3WB2 A;  1QLE C;  4MS2 A;  1Q81 W;  4FLW A;  4X20 B;  2X0L A;  3JAT A;  3CXC U;  4U3J A;  3BCC H;  3HPL C;  2Z5U A;  4DUY O;  3HKB A;  3CE2 A;  1Y6X A;  4YJ3 B;  3AK2 A;  2JRI A;  1HNX O;  4FPP A;  3LUT B;  1VQ5 V;  1ZAU A;  2Q7H A;  3K5L A;  3U10 A;  2ZKO A;  3L71 H;  2JEU A;  5CA0 B;  4YJ2 B;  5IYZ B;  5B3S B;  4LFA B;  1P84 F;  4MVU A;  2ZM6 B;  3OM3 B;  3SR2 C;  1KYO F;  2QEX V;  4O2A A;  4GYC B;  2BSK B;  3CJH B;  4DR3 O;  1F4M A;  3OTF A;  5KMG B;  4EKW A;  4DV6 O;  1JVM A;  4EFB A;  4GCZ A;  5BZB A;  2F4V B;  5IJ9 B;  5KHI A;  3RN4 A;  2WWW A;  4WCE V;  2XAF A;  4FZ0 A;  1OZ0 A;  4FM2 A;  1VQM V;  5JJJ B;  3ZRX A;  2X6B A;  2N05 A;  1YCI A;  4B3M O;  2RCV A;  2XAH A;  1FXK C;  2DYR B;  3U0Z A;  2XND G;  4FVM A;  4BW5 A;  3WFV A;  4JI6 O;  1KU9 A;  4ZHQ A;  4D7T A;  5J2T B;  3RYH B;  2EIN B;  4KHP O;  2UXX A;  1H8H G;  3J81 N;  4N21 A;  4LBE C;  1B6Q A;  2YC0 A;  4K3A A;  1IUR A;  3CXH F;  4IIJ B;  3KKY A;  2RN9 A;  3CHX A;  5JWP A;  5KHJ A;  1YZB A;  1KB9 F;  2ZQM A;  3IJ4 A;  4WBN B;  2ZDI A;  3NXS A;  4D7S A;  3M99 B;  4B08 A;  4JV5 O;  3DC6 A;  3RVZ A;  4X89 A;  5B3S C;  4ZI7 A;  4X64 O;  1K8A W;  2HHH B;  1YJN V;  2LJ2 A;  4FM1 A;  3WG7 B;  2EBO A;  1ROP A;  1VQO V;  1NVP D;  2RDC A;  2ZIO A;  3K03 A;  1N32 O;  1PNK A;  1P7G A;  3BHP A;  2B1I A;  4UCO A;  2WLK A;  3F5T A;  1WJZ A;  3MHH C;  3HKE A;  1MSW D;  3JCU Z;  1BMF G;  4O2B A;  1HR0 O;  3ZRW A;  3T4Z A;  2FL4 A;  3OAA G;  5EZY B;  5LGN A;  2EUL A;  3TXS A;  4WFA V;  4AQY B;  2VWK A;  4J11 A;  1SA0 A;  3JAR A;  4GX2 A;  1GN2 A;  3LSU A;  3JAK A;  4DV0 O;  1GM7 A;  1XHZ A;  5F2V O;  1XBL A;  1XUQ A;  3ABU A;  1OCC B;  3T2M A;  3TCU A;  4IYI A;  1HNZ B;  3JAS A;  5JCO A;  3E89 A;  4BIZ A;  4J42 A;  3OR6 C;  2GDS A;  3JAL A;  2XAJ A;  5LBQ A;  1PNL A;  3B4S A;  4PV1 B;  3P3P A;  3H1L H;  2A7W A;  3SPJ A;  2V7Q G;  5BY1 A;  4PA7 A;  2N74 A;  1V54 B;  4DW0 A;  1HW7 A;  4IGG A;  1QVF U;  1H2S B;  3QTC A;  1W0J G;  2IW5 A;  2DYS B;  1PL0 A;  2HKO A;  3OGI B;  1BT8 A;  4DV1 O;  4DK1 A;  4LFC O;  3JD3 A;  4DR7 O;  2OIE A;  4FFB B;  4ZIB A;  4JF3 A;  1YJW V;  4DR6 B;  1S5L Z;  1GKF A;  4I0X B;  2LGW A;  3W7S A;  1N33 O;  5L3F A;  5LA6 B;  5LHG A;  1H2M A;  1VF5 B;  3MAQ A;  1Z5V A;  2RMK B;  1P4R A;  1SZX A;  3BPZ A;  2A0L A;  2KG7 B;  4I4T A;  3D36 A;  3E86 A;  3HB3 B;  1Q43 A;  3CPW U;  4CS4 A;  2A79 B;  2NLJ C;  2P4K A;  1Y74 A;  2ZXW C;  1THZ A;  2M6Y A;  2WLM A;  2ZD9 A;  1Q90 D;  2L35 A;  1AI7 A;  2DW4 A;  2QWQ B;  1T5E A;  2GBO A;  3JAM N;  3JD0 A;  3CCL V;  2F93 B;  4GKK B;  2QTO A;  3OR7 C;  4PI2 A;  1BHB A;  4YXW G;  4X1Y A;  3SDL A;  5KHH A;  3EFF K;  3CD6 V;  3GWK C;  4NB5 A;  1JA8 A;  1NR7 A;  4JTA B;  1DF4 A;  4I55 A;  3BEH A;  3I56 V;  2WA4 A;  1DTO A;  1R6N A;  1TVK B;  4DR5 O;  3OMA B;  3ASN B;  4Z1M G;  5KX5 A;  3LDD A;  3OD4 A;  2LP7 A;  5KAI Z;  1VF7 A;  5LHI A;  4MVQ A;  1JJO A;  1Y4M A;  4QNH B;  5C93 A;  1GN4 A;  1VF6 C;  2XOK G;  1M57 C;  4FFK A;  3WB0 A;  1ARO P;  5D5P A;  2HR3 A;  4C7U A;  1YXB A;  4JI5 B;  5LMU O;  4UCU A;  2WLL B;  4TV9 A;  1MZE A;  3CCU V;  4WF9 V;  2A3Q A;  2P90 A;  2YEV A;  2NNU A;  4R7C A;  4O4L A;  4LWS A;  1TUB A;  3RYC A;  4TOI A;  3JSN A;  2Q9L A;  5BR8 O;  1OHH G;  4FLX A;  5DM6 V;  1VQ8 V;  3GB7 C;  1XMO O;  2Y69 C;  2E5L O;  4LH6 A;  2QWN B;  2R9R B;  2VQF O;  4U3J B;  1HNW B;  4O4J A;  4MTF A;  5IJ0 A;  3LNM B;  2QDO A;  2UUC O;  3CYO A;  1R6K A;  3R66 A;  2GSM B;  4TQF A;  3S3X A;  2QSA A;  3TK1 A;  1HP8 A;  3K79 A;  1I0H A;  4N23 A;  4YIO A;  1GMG A;  2ZE7 A;  3E83 A;  5H2F Z;  4DW1 A;  3SJA C;  4FLY A;  4GX5 A;  4PHZ A;  3OMI B;  4DV2 O;  4JI0 O;  1SS3 A;  4O2A B;  4GX0 A;  2LQT A;  4P30 A;  4HBN A;  2Z0A A;  3OEH G;  2BE3 A;  2ZR2 A;  4I7Z B;  5EIB D;  3TXQ A;  4X62 B;  2AXT Z;  4J9Y B;  1Q6I A;  3ETG A;  1GTO A;  2P22 C;  2JGD A;  3VOU A;  4JI4 B;  3K06 A;  1BQZ A;  3VQV A;  1VAR A;  4LF8 O;  2B9Z A;  1XNR B;  3LNN A;  3RWR D;  4GLX A;  2H8P C;  1FJG O;  1U96 A;  2W6J G;  4MSW C;  1NZ6 A;  2CH7 A;  3K9A A;  4K0K O;  4ZHQ B;  1JOY A;  3LSQ A;  2Q4P A;  4QPJ A;  3UT5 A;  1F7Y A;  3O65 A;  4XDK A;  1NJI W;  4B3R B;  4DR2 O;  1L0N H;  1HWY A;  4JZG A;  4PEL A;  2W0X A;  3C90 A;  2JDI G;  4B7K A;  1VQ4 V;  2YIB D;  3IC9 A;  4CS2 A;  3EXA A;  4P9P A;  3GWO A;  1U97 A;  4JI3 O;  4X88 A;  2ZT9 B;  2WA3 A;  1CPY A;  1QVG U;  5BMV A;  3ZHT A;  2IJH A;  1NS1 A;  3J80 N;  3L9D A;  2YXH A;  3LDC A;  4DR4 O;  4RUE A;  4ZI7 B;  5FNV A;  1EN5 A;  1QBZ A;  2C2A A;  5B1B B;  2UXB B;  4NVP A;  4FLT A;  1YI2 V;  3UQ8 A;  3SPG A;  2ADQ B;  4DV5 B;  2AZ0 A;  4J80 A;  3CCM V;  1D2D A;  4JAU A;  2VS0 A;  1XRE A;  2YID A;  4DUZ B;  3AG3 C;  1RPO A;  4QIW F;  2R9I A;  3CEI A;  2UUB B;  3HKE B;  3X2Q C;  2LGQ A;  4JYA B;  3ZIA G;  4CS3 A;  5KA6 A;  4AIL C;  3ZRW B;  1J5E B;  1MG1 A;  5CBH A;  5LGU A;  1YIJ V;  2ETN A;  3JSL A;  4J7J A;  4UB8 Z;  1N36 B;  2JS5 A;  3JAR B;  3SYQ A;  2IU3 A;  3S3W A;  1RSO A;  3THO A;  1BGY H;  1I08 A;  1LR1 A;  2YI8 A;  3JAK B;  1KC8 W;  5LMN B;  3UKM A;  1VP7 A;  2OCH A;  2Y48 A;  3ZRV A;  3SPH A;  2F95 B;  3DTU B;  4BIO A;  4LF7 B;  1SZT A;  3RFR A;  3SYA A;  3ABL C;  1AR1 B;  1EZJ A;  3HKD B;  3H01 A;  1GK9 A;  1AIL A;  4FJC C;  4OPA A;  4NXN B;  3OTO O;  1AB3 A;  2H94 A;  4F6E A;  2QR4 A;  1RPR A;  2UXD O;  1HNX B;  2EIJ C;  1P49 A;  4DV3 O;  1W2B U;  3CCJ V;  2WLI A;  5L3D A;  1YJ9 V;  5J2U A;  5CMU A;  3KCX A;  1XHX A;  4F6R A;  3ZHU A;  5K1X A;  5BXZ A;  1S5J A;  2FYU H;  4YHH B;  5KUK A;  3ML0 A;  4R8C A;  3ASO B;  4DR3 B;  4CH5 A;  4DV6 B;  3R65 A;  5H5N A;  1SC5 B;  1PPJ H;  4I4T B;  2IBZ H;  4PDL A;  1YIT V;  3B8N A;  4GT1 A;  4GZR B;  1XNQ O;  4TT3 G;  2KSD A;  5LOV A;  1QQC A;  1AI6 A;  4B3T O;  2Q6A A;  4B3M B;  4TWK A;  1Y74 B;  3AG4 C;  4GUN A;  1GN3 A;  5LP6 A;  3H9V A;  1SQV H;  3SPC A;  4FK5 C;  4OX9 B;  1IBL O;  1NH2 D;  4JI6 B;  1AI4 A;  5KHG A;  1ZLZ A;  3BAB A;  1MNG A;  4MVO A;  1IBK O;  4RQF A;  1E79 G;  2NN4 A;  2E75 B;  2WSS G;  2VWJ A;  4UVB A;  2CE4 A;  1Q5O A;  2UXC O;  4X1Y B;  4X9Q A;  3D8C A;  1JFF A;  3MHS C;  3AG7 A;  1E1R G;  5HFL A;  1YHQ V;  3T1C A;  2R72 A;  1I5X A;  4GX1 A;  4I55 B;  3AG2 B;  2Q68 A;  1KP2 A;  1K9M W;  1K7D A;  4X64 B;  1Q8I A;  1YEW A;  1VQL V;  3KCY A;  1XI1 A;  1R3K C;  1LNQ A;  3APO A;  2XT9 A;  2HVK C;  3C3T A;  3ZCC A;  3I55 V;  4Q6G A;  2QWO B;  1JCH A;  3ZRS A;  3N2G B;  1N32 B;  5HFM A;  4EB6 A;  5KUM A;  2QKS A;  4ABM A;  4X65 O;  2QM4 A;  1JR9 A;  2Y4U A;  4PDM A;  3ZS8 C;  1K33 A;  3K3W A;  4DV7 B;  1G6U A;  1SQQ H;  1HR0 B;  3CRR A;  2BOB C;  2YEV B;  4GKJ O;  4O4L B;  4FIP C;  3FX7 A;  3CRA A;  4LWS B;  3ZMS A;  1TUB B;  3RYC B;  3TGU H;  3WB1 A;  2EIM C;  2ZNJ A;  3KG2 A;  4DYL A;  2A9H A;  4XBF A;  1H2L A;  1YF2 A;  4CH6 A;  1UFI A;  2GTS A;  4E2L A;  4NTX A;  4FM0 A;  4ZOL A;  4O4J B;  3QO7 A;  2AGA A;  4LF4 O;  5KAF Z;  4RAI A;  2OWO A;  5IWA O;  2ODM A;  1F51 A;  5CA3 A;  1DLB A;  3L70 H;  2Q69 A;  4DR1 O;  1ZSP A;  4KXR A;  3MD0 A;  2EIL B;  5CA1 A;  4CC6 A;  2F43 G;  3A0H Z;  5K1P A;  2PYL A;  3G71 V;  1Q7Y W;  1URF A;  4LFA O;  4DV1 B;  4LFC B;  2ZM6 O;  4RUF A;  4DR7 B;  1S5H C;  3QO8 A;  3AEI A;  3FD9 A;  1DGS A;  1N33 B;  2OTJ V;  4LF5 O;  2P4V A;  1H2K A;  2JGD B;  3G6B A;  4I9W A;  2CGO A;  1XQ8 A;  3E22 A;  1M56 B;  2JEX A;  1YTF B;  3ZHV A;  1IDS A;  3BY6 A;  2CAZ C;  3B40 A;  2DYR C;  3K08 A;  2W0F C;  5LXT A;  1NBM G;  2Q7G A;  2EIN C;  4PA3 A;  1AR4 A;  3UT5 B;  2ITD C;  2ZCE A;  1FFT B;  4MVS A;  2JK5 C;  1WB7 A;  3P32 A;  2XAS A;  3A0R A;  1XL6 A;  4YIP A;  1Q6U A;  2BCC H;  5LYJ B;  4MVR A;  1DF5 A;  1OCO B;  2A06 H;  2OCC B;  2W6I G;  3T1Y O;  5B1A B;  4TUY A;  4QGP A;  5FNV B;  3WG7 C;  2XUM A;  5CBF A;  3B09 A;  4DRX B;  1AR5 A;  1GH6 A;  4QJF B;  2QTS A;  5JJN B;  4DR5 B;  2DMX A;  1CP9 A;  5H9C A;  1R1B A;  3L74 H;  2PZS A;  3JD1 A;  2AW9 A;  1TA8 A;  4NXM O;  1M56 C;  4CZZ A;  3CB2 A;  1B06 A;  1BCC H;  2GUZ A;  1GAX A;  3RYI A;  4J9Z B;  1RSO B;  3OUF A;  4JI1 O;  1IVS A;  5LMU B;  3FAV A;  5GON A;  4AI8 A;  1VQN V;  4CBC A;  1OCC C;  2Q8V A;  3JAW B;  2H3O A;  4J10 A;  5L3C A;  5CB4 B;  3CCR V;  2PY5 A;  3QG5 A;  1FXK A;  2ATK C;  3ETD A;  2F66 C;  1XMQ O;  5BR8 B;  1K4C C;  1G4Y B;  1HNZ O;  4QE7 A;  1EBO A;  3OEE G;  4CH3 A;  1XMO B;  1WA8 B;  2E5L B;  5JVD A;  2VQF B;  2ITC C;  3Q4H A;  1V54 C;  3QVN A;  2UUC B;  4IT5 A;  4JGS A;  1WB8 A;  3W7T A;  4X20 A;  3CSX A;  1IBM O;  3E2E A;  1I94 O;  2DYS C;  3K0G A;  4DXW A;  2AZ2 A;  3JD2 A;  2Q73 A;  3E35 A;  2WLI B;  3LSS A;  2IJI A;  2FB5 A;  4JI2 O;  4DK0 A;  3JD4 A;  4L8J A;  5J2U B;  3F5W C;  1OCR B;  1SQF A;  3ABT A;  4DV2 B;  3HR0 A;  3QO5 A;  4FLZ A;  4JI0 B;  3L72 H;  5GTH Z;  1RM1 B;  2YI9 A;  3P30 A;  2JVD A;  4DR6 O;  5CA0 A;  2GHY A;  2WPD G;  4YJ2 A;  1KEC A;  1H2N A;  5LL6 Y;  5IDJ A;  4JI8 O;  4PD4 F;  4WFH A;  4X66 O;  4LF9 O;  3CJH A;  2M7W A;  4O4H A;  1G1X B;  5LOV B;  4LF8 B;  2PI4 A;  4FZ1 A;  4JAS A;  5H6R A;  2LFS A;  5LGT A;  5LP6 B;  1FJG B;  5E79 Z;  3ABK B;  5AG2 A;  3ZN0 A;  4K0K B;  3AK1 A;  1NR1 A;  1O9G A;  5J9P C;  2ZE8 A;  3JAT B;  1H38 A;  1Y76 A;  1YVW A;  2QA4 V;  5A9G A;  5FL7 G;  3LDE A;  1V55 B;  4E4E A;  3HKB B;  5J2T A;  1I5Y A;  3RYH A;  1CEZ A;  3IGA C;  2DWE C;  2YIA A;  2G38 A;  1JFF B;  4UCV A;  2BOC C;  3RYF A;  1XIL A;  3G4S V;  2UXN A;  4IIJ A;  4JI3 B;  4RQE A;  2IU0 A;  1R3J C;  4WBN A;  3H1K H;  2EIK B;  3ASN C;  1OCR C;  2Y4T A;  4NTW A;  2YDE A;  1ZUQ A;  4RWU A;  1VQ7 V;  1M5I A;  1PP9 H;  3SPI A;  1JX9 A;  1SQP H;  1KD1 W;  2YUA A;  2GV9 A;  2VRZ A;  4IHJ A;  1GN6 A;  3DXR A;  5IY5 B;  4EB6 B;  4Z2W A;  1VQP V;  2HVJ C;  3SGI A;  4LF6 O;  4IYH A;  3FB5 C;  3D3I A;  3ZMU A;  3E8B A;  1VQ6 V;  2WLJ A;  1D5A A;  3ABM B;  3L75 H;  3ZMZ A;  1N4C A;  2B1G A;  5EC2 C;  1S3J A;  4TV8 A;  3G67 A;  5EYP A;  1TAE A;  1MMM A;  5EZY A;  4PI0 A;  2UUA O;  1SET A;  1US6 A;  2EX3 A;  4MVM A;  4EEQ A;  4LP8 A;  4ZOL B;  1F4N A;  2YIB A;  5EC1 C;  1X59 A;  2VQE O;  2AHY A;  5EBM C;  4P2Z A;  3CX5 F;  2QWR B;  2QGN A;  2NR5 A;  1L8D A;  3DC5 A;  3AG1 B;  3OTO B;  3SJC C;  3CRC A;  4WFB V;  2KQX A;  3RT3 C;  5CA1 B;  2WAM A;  2UXD B;  1FXH A;  2DWD C;  2E3C A;  4U7O A;  4DV3 B;  1NVP B;  1AVM A;  5JQG A;  1QU7 A;  2F23 A;  5IY5 C;  4O2B B;  3UM7 A;  5KLV H;  3GVM A;  1N34 O;  4FFB A;  3W7X A;  4UUJ C;  1FPO A;  2ILM A;  4HZ3 A;  3QNE A;  1EZV H;  5FPO A;  2X6C A;  3BFR A;  2ZE6 A;  3E22 B;  2CDY A;  2WLH A;  1SA0 B;  3ABM C;  2HP8 A;  2HJF C;  5LXT B;  3VBB A;  4JAV A;  1XNQ B;  1VF6 A;  4LFB O;  4L87 A;  4LR3 A;  1Z2G A;  2Q5Z A;  2PI5 A;  3JAS B;  4B3T B;  1XEQ A;  2CUG A;  2V4D A;  3K04 A;  3UCS C;  4MW8 A;  1MOF A;  3JAL B;  5A2Q N;  1IBL B;  1L1F A;  2ZE5 A;  1VMG A;  2ZDI C;  2YSU B;  1IBK B;  1WN7 A;  1M9N A;  1W59 A;  4WFE A;  4DUY B;  1SRY A;  1QLE B;  3AG1 C;  3CRQ A;  1RP3 B;  2XAG A;  4Q20 A;  2UXC B;  3FB7 C;  4TUY B;  1Y66 A;  5B1B C;  1KKC A;  1MA1 A;  1ZX3 A;  4A5U B;  3J7A U;  2DN9 A;  1KP3 A;  4FMT A;  3OW2 U;  1OCZ B;  3FFQ A;  4UXN A;  3ETE A;  5DN6 G;  2JS3 A;  4DUZ O;  1MZF A;  1TVK A;  1B3Q A;  4B3S O;  4Z1V A;  1AP5 A;  3D3Q A;  3ZHQ A;  2HG5 C;  4KUM A;  1IZ3 A;  4KFM A;  1NTZ H;  4JYA O;  2GUZ B;  3RYI B;  1EN6 A;  4TSF G;  1M90 W;  2K9P A;  1K5S A;  1FAF A;  4TQD A;  1K34 A;  1N36 O;  4MTX A;  3WU2 Z;  5JCO C;  1X4T A;  1WAZ A;  1GO3 F;  4U7N A;  4KHP B;  2RQ6 A;  1V9P A;  2HJD A;  2Y0I A;  1H8E G;  1FXK B;  2LFR A;  4DV4 O;  3G6E V;  3N27 A;  3VQW A;  5JVD B;  2L6L A;  3K57 A;  2O57 A;  4YY3 O;  3Q4H B;  3K58 A;  2P5O A;  1J95 A;  2UU9 O;  1VEW A;  3SYO A;  4NXN O;  5IWA B;  4JV5 B;  2YIC A;  1A32 A;  1S72 V;  4DR1 B;  2P67 A;  4JI7 O;  4K8Z A;  3CRM A;  3VQY A;  4X1K A;  3W7U A;  3UO2 A;  1N8R W;  5KX5 B;  1OCZ C;  3H1J H;  3ASO C;  1TUE B;  1R3L C;  1XL4 A;  4BAY A;  2QKA A;  3D36 C;  3N2K A;  5B5E Z;  4YHH O;  1XOU A;  2EZP A;  4RO2 A;  2MK3 A;  4LF5 B;  4JTD B;  1NI8 A;  1SES A;  3A0B Z;  4BW9 A;  1K73 W;  1BSM A;  4QE9 A;  4TV9 B;  4O4H B;  2Q67 A;  5JJE B;  1UJW B;  4KP4 A;  5B66 Z;  3CWB H;  4I9Q A;  1UPG A;  4DV0 B;  4B7E A;  1NKD A;  1SQB H;  4O4I A;  3T1H O;  3SYC A;  4UV8 A;  4D6T H;  5IJ0 B;  1Y76 B;  4XDL A;  4OX9 O;  2JGU A;  2DQ0 A;  3STL C;  1Q82 W;  1M1K W;  3ETQ A;  2BTQ A;  1AI5 A;  2YXL A;  1VIB A;  2QKC A;  5ITZ A;  1JQ0 A;  3RYF B;  5B1O A;  4I5S A;  5CBG A;  5JH7 A;  2Z3Y A;  1TGO A;  3APQ A;  2PGG A;  2R9A A;  1YDX A;  4OGQ B;  2YXY A;  3RGB A;  1BE3 H;  2N04 A;  4J7K A;  4K35 A;  1ZL8 A;  1VQK V;  3AG2 C;  1BHA A;  3T1Y B;  3T4D A;  1E1Q G;  1VQ9 V;  1H2G A;  1Y67 A;  1FFX A;  1BS3 A;  2EZO A;  3QF7 A;  2B5U A;  4IHJ B;  4CH4 A;  3DXR B;  3BA9 A;  2ZNI A;  1K92 A;  1WP8 A;  2QM8 A;  4H13 B;  4PA9 A;  2F4V O;  4QPK A;  2Q0O C;  2X7R B;  2FTK A;  1RFY A;  4JPR A;  3IAY A;  5EBL C;  3F7V C;  1XDC A;  4NXM B;  4ASU G;  4ICG A;  2CH7 B;  1WLE A;  4DV7 O;  4TV8 B;  2IH1 C;  5IYD O;  2PF4 E;  1FXV A;  5EYP B;  4ZKI A;  1CXZ B;  4JI1 B;  4OXS A;  3ZMV A;  1WNS A;  1QLN A;  5L3G A;  1PM9 A;  4X1I A;  4LNU A;  3F7Y C;  4MVZ A;  4MTG A;  2ZXW B;  3ZED A;  2QWP B;  1XMQ B;  3PN1 A;  5C8Y A;  3SYP A;  5GTI Z;  2F1M A;  3EVK A;  3K0D A;  5BMV B;  1S76 D;  5E1A C;  1WPB A;  2Q0A A;  2HEP A;  3JYC A;  2EIL C;  3BVO A;  3HKC A;  3HKD A;  3I5D A;  2EJR A;  5LHH A;  3PJS K;  1IBM B;  1I94 B;  3FYE B;  1Z5W A;  1MSD A;  2HHH O;  2JIZ G;  2KKW A;  4MW3 A;  3K5N A;  5TIS Z;  2QJ1 A;  5JQG B;  1LUV A;  4JI2 B;  1Q86 W;  4R50 A;  4BR6 A;  3JCZ A;  5L3B A;  5EIB C;  3CME V;  2FKX A;  3C3S A;  1NU1 H;  2RJZ A;  3B8M A;  2P6J A;  4W4K A;  5DED A;  2LW7 A;  3CCQ V;  4JI8 B;  4UFZ A;  4K8X A;  4LF9 B;  4X66 B;  2DE0 X;  2IM9 A;  5EBW C;  4LCU C;  4AQY O;  4HNA A;  1M57 B;  3G80 A;  5FPR A;  2GTA A;  2CTR A;  2PYJ A;  1N0N A;  1FYJ A;  1WP7 A;  5IYB O;  3OUS A;  3H1H H;  1OCO C;  1K97 A;  4I50 A;  2AHZ A;  2CK3 G;  2OCC C;  4MTO A;  1KBH A;  5CN0 A;  3OE7 G;  2Y69 B;  1K4D C;  1I7F A;  2P06 A;  5B1A C;  1MAB G;  1EFR G;  4AHC A;  3DGE A;  1HDJ A;  1PD3 A;  2D2C B;  2E74 B;  3ZBH A;  1P7B A;  4YJ3 A;  1JPX A;  4NKG B;  1AJQ A;  3CCV V;  4PDR A;  4F6R B;  2ADP A;  3ZHR A;  4U3F H;  4PJ0 Z;  1Q3E A;  4JAA A;  1GM9 A;  1AP6 A;  5IYZ A;  1KUQ A;  1SF9 A;  5D5Q A;  4LC1 A;  3U11 A;  2OYQ A;  2BSK A;  4P9O A;  5KMG A;  4W4L A;  4LF6 B;  3K5O A;  5IJ9 A;  2IJJ A;  1EN4 A;  3OMN B;  3N2G A;  1YSC A;  5DEC A;  4FLU A;  4X8A A;  4UCR A;  3E8H A;  1ENV A;  1BQ0 A;  3CCS V;  2LO1 A;  2MW2 B;  1N0J A;  1NH2 B;  1SQG A;  4WFG A;  3OFN G;  4J41 A;  4DR2 B;  2OIG A;  2UUA B;  2DJV A;  3CS5 A;  4UVA A;  3STZ C;  1FS0 G;  2CGN A;  4LH7 A;  4OPH A;  5KA5 A;  2Q7E A; 
#chains in the Genus database with same CATH homology
 5IYC O;  1BL8 A;  4L87 A;  5HFM A;  1W0J G;  2IW5 A;  4UV9 A;  2PI5 A;  5KUM A;  2DYS B;  1PL0 A;  2HKO A;  2QKS A;  1QR9 A;  2JJ1 G;  5B1N A;  3JD3 A;  4PDM A;  1QVF U;  3K04 A;  1SER A;  1K33 A;  2P7T C;  3K3W A;  4JF3 A;  1YJW V;  2IJK A;  4MW8 A;  1MOF A;  1GKF A;  3W7S A;  1NQT A;  1L1F A;  1QCE A;  5L3F A;  2BOB C;  2ZDI C;  2YEV B;  2YSU B;  5LHG A;  4FIP C;  4G27 B;  1M9N A;  1PNM A;  3ZMS A;  1RM1 C;  2EIM C;  1P4R A;  4WFE A;  1SRY A;  1QLE B;  3AG1 C;  3KG2 A;  2A0L A;  2A9H A;  2XAG A;  4JYC A;  3D36 A;  4Q20 A;  4XBF A;  3FB7 C;  4PDV A;  3E86 A;  3HB3 B;  1Y66 A;  4E2L A;  5B1B C;  2KB1 A;  3QO7 A;  3CPW U;  4RAI A;  2D3O W;  2A79 B;  2NLJ C;  3FKS G;  4HAM A;  2XAQ A;  1KP3 A;  3AG3 B;  2ZXW C;  1G8M A;  3CC7 V;  4FMT A;  1THZ A;  4H37 A;  3OW2 U;  1F51 A;  5CA3 A;  1DLB A;  2WLM A;  1OCZ B;  2ZD9 A;  2Q69 A;  3X2Q B;  3ZJZ A;  1QR8 A;  3IFX A;  4UXN A;  5EK0 A;  1AI7 A;  2DW4 A;  3ABK C;  3ETE A;  5DN6 G;  3MD0 A;  3W7W A;  1YTF D;  4MT8 A;  2EIL B;  3JD0 A;  3CCL V;  2F43 G;  1F23 A;  2QTO A;  2HG5 C;  3OR7 C;  4KUM A;  4UVC A;  3G71 V;  4KFM A;  1Q7Y W;  4PA4 A;  1V55 C;  4TSF G;  1M90 W;  1BHB A;  4YXW G;  4RUF A;  1S5H C;  1K5S A;  3QO8 A;  3AEI A;  4WFF A;  1S0V A;  3EFF K;  3CD6 V;  3E8G A;  1K34 A;  1NR7 A;  2JJ2 G;  4PA6 A;  4MTX A;  2OTJ V;  2DQ3 A;  4JTA B;  1DF4 A;  1R3I C;  3IC7 A;  3BEH A;  3ABL B;  3I56 V;  1GO3 F;  4U7N A;  4I9W A;  3FYI B;  1DTO A;  1H8E G;  1FXK B;  1ORQ C;  1R6N A;  1M56 B;  4JYB A;  2JEX A;  4BIU A;  2LFR A;  1YTF B;  3G6E V;  3OMA B;  3ASN B;  3BY6 A;  2EIK C;  4Z1M G;  2DYR C;  3K08 A;  2WLN A;  2W0F C;  3LDD A;  3CP1 A;  1NBM G;  2LP7 A;  5LHI A;  4MVQ A;  2EIN C;  1Y4M A;  4PA3 A;  2ITD C;  3ZN1 A;  3B77 A;  1J95 A;  4QNH B;  5C93 A;  1FFT B;  4MVS A;  2JK5 C;  4F4L A;  2OTL V;  3FB8 C;  4R6Z A;  2XOK G;  1S77 D;  4G28 B;  1M57 C;  3SYO A;  2EIJ B;  4ZBM A;  3P32 A;  1ARO P;  3ZMT A;  2HR3 A;  2HLD G;  1KQS U;  2XAS A;  3A0R A;  1XL6 A;  3CMA V;  2WLL B;  1S72 V;  2K1E A;  3CCU V;  4WF9 V;  3RVY A;  2P90 A;  2P67 A;  2YEV A;  2NNU A;  4R7C A;  4MVR A;  1DF5 A;  1OCO B;  3W7U A;  3E8F A;  1N8R W;  3CC2 V;  1OCZ C;  3ASO C;  2OCC B;  2W6I G;  1TUE B;  1R3L C;  1XL4 A;  4G2K A;  4BAY A;  1OHH G;  5DM6 V;  1VQ8 V;  3GB7 C;  2Y69 C;  5B1A B;  2R9R B;  2EZP A;  3WG7 C;  4MTF A;  3CCE V;  1AJN A;  3LNM B;  2MK3 A;  4RO2 A;  4HYO A;  4JTD B;  1SES A;  3CYO A;  5CBF A;  1K73 W;  1R6K A;  4QE9 A;  1PKX A;  4XDJ A;  3TET A;  2Q67 A;  2GSM B;  1UJW B;  4KP4 A;  1ZWI C;  3TK1 A;  3AG4 B;  4QJF B;  3K79 A;  4N23 A;  1GMG A;  3E83 A;  1CP9 A;  5H9C A;  2V1D A;  3JD1 A;  4GX5 A;  1JJ2 U;  1NKD A;  3OMI B;  3SYC A;  1COW G;  4GX0 A;  1M56 C;  4UV8 A;  4CZZ A;  4XDL A;  4DO2 A;  1W0K G;  3OGC C;  4P30 A;  4J9Z B;  2ZR3 A;  1WPX A;  3OUF A;  3OEH G;  2DQ0 A;  3STL C;  1Q82 W;  2ZR2 A;  3FB6 C;  1M1K W;  1VQN V;  4CBC A;  4J9Y B;  1AI5 A;  1OCC C;  2QE7 G;  1GM8 A;  1GTO A;  2OT5 A;  3ETG A;  4JTC B;  1JQ0 A;  3VOU A;  5B1O A;  3K06 A;  1KKD A;  4I5S A;  5CBG A;  2Z3Y A;  5L3C A;  3CCR V;  1FXK A;  1K3E A;  2ATK C;  3ETD A;  1VQK V;  3AG2 C;  1K4C C;  1BHA A;  3T4D A;  1E1Q G;  1VQ9 V;  1G4Y B;  2IH3 C;  2X6A A;  4H33 A;  5GW7 A;  4QE7 A;  1EBO A;  3OEE G;  3RW0 A;  2H8P C;  1H2G A;  2W6J G;  4MSW C;  3K9A A;  3SJQ C;  2ITC C;  1JOY A;  3LSQ A;  1V54 C;  4QPJ A;  2EZO A;  4JGS A;  4XDK A;  2B5U A;  1NJI W;  3W7T A;  1HWY A;  5H6Q A;  3E2E A;  1K92 A;  4PEL A;  2DYS C;  2QM8 A;  3CC4 V;  2JDI G;  2QM7 A;  3K0G A;  4PA9 A;  3RBZ A;  5L3E A;  1VQ4 V;  4DXW A;  4QPK A;  2WLL A;  3JD2 A;  2HFE C;  2X7R B;  2FTK A;  3E35 A;  2WLI B;  3LSS A;  2IJI A;  4JPR A;  1K5Q A;  3JD4 A;  1IXM A;  4P9P A;  3F5W C;  3GWO A;  5EBL C;  3F7V C;  1OCR B;  3ABT A;  1AJP A;  4X88 A;  4ASU G;  3EHB B;  3QO5 A;  1R73 A;  1RM1 B;  2EIM B;  3P30 A;  1CPY A;  1WLE A;  1QVG U;  2IJH A;  2GHY A;  2IH1 C;  2WPD G;  5IYD O;  1KEC A;  1FXV A;  3LDC A;  1QLE C;  4MS2 A;  4RUE A;  4ZKI A;  1Q81 W;  4OXS A;  2X0L A;  5IDJ A;  1QBZ A;  3CXC U;  2C2A A;  5B1B B;  4WFH A;  2M7W A;  3ZMV A;  1YI2 V;  1QLN A;  3HPL C;  2Z5U A;  3SPG A;  5L3G A;  3CCM V;  3F7Y C;  4MVZ A;  4JAU A;  4MTG A;  2ZXW B;  3AG3 C;  1RPO A;  4FPP A;  3LUT B;  4QIW F;  1VQ5 V;  2PI4 A;  2R9I A;  4JAS A;  5H6R A;  2LFS A;  3SYP A;  5LGT A;  3X2Q C;  3K0D A;  2JEU A;  3ZIA G;  5B3S B;  3ABK B;  5KA6 A;  1S76 D;  4MVU A;  5E1A C;  3ZRW B;  3ZN0 A;  3OM3 B;  1MG1 A;  3JYC A;  2EIL C;  1NR1 A;  5CBH A;  5J9P C;  5LGU A;  1YIJ V;  1H38 A;  2QEX V;  2EJR A;  5LHH A;  3PJS K;  2QA4 V;  3SYQ A;  2IU3 A;  1F4M A;  5FL7 G;  3LDE A;  4EKW A;  1V55 B;  3FYE B;  1JVM A;  1I5Y A;  4GCZ A;  1CEZ A;  5BZB A;  3IGA C;  1KC8 W;  2DWE C;  2JIZ G;  2WWW A;  4MW3 A;  3UKM A;  4WCE V;  1Q86 W;  4R50 A;  2XAF A;  1OZ0 A;  3JCZ A;  2BOC C;  5L3B A;  2Y48 A;  3ZRV A;  3G4S V;  2UXN A;  3ZRX A;  3CME V;  2X6B A;  3SPH A;  4RQE A;  3DTU B;  2IU0 A;  1SZT A;  3SYA A;  3ABL C;  1AR1 B;  2XAH A;  1R3J C;  1EZJ A;  3B8M A;  1FXK C;  2EIK B;  2DYR B;  2XND G;  3ASN C;  4BW5 A;  3WFV A;  3H01 A;  2P6J A;  1GK9 A;  1OCR C;  4FJC C;  3CCQ V;  1VQM V;  1VQ7 V;  2H94 A;  3SPI A;  1JX9 A;  2EIN B;  1KD1 W;  2UXX A;  1RPR A;  5EBW C;  1H8H G;  4LCU C;  4N21 A;  4LBE C;  1M57 B;  5IY5 B;  1B6Q A;  1VQP V;  2HVJ C;  2EIJ C;  1W2B U;  3CCJ V;  3FB5 C;  2WLI A;  5L3D A;  3D3I A;  1YJ9 V;  3ZMU A;  2ZQM A;  5CMU A;  3E8B A;  1VQ6 V;  2ZDI A;  2WLJ A;  3NXS A;  3ABM B;  5IYB O;  3ZMZ A;  2B1G A;  3OUS A;  1OCO C;  5EC2 C;  1K97 A;  3M99 B;  1S3J A;  5KUK A;  3ML0 A;  4R8C A;  3ASO B;  2AHZ A;  2CK3 G;  2OCC C;  4MTO A;  3RVZ A;  5CN0 A;  3OE7 G;  4X89 A;  3R65 A;  5B3S C;  2Y69 B;  1K8A W;  1K4D C;  5B1A C;  1MAB G;  1EFR G;  1YJN V;  4PDL A;  1YIT V;  3DGE A;  1SET A;  3WG7 B;  2EBO A;  1ROP A;  3B8N A;  1VQO V;  4MVM A;  1NVP D;  4GT1 A;  1PD3 A;  4LP8 A;  1F4N A;  1P7B A;  3K03 A;  5EC1 C;  1JPX A;  1AJQ A;  4TT3 G;  3CCV V;  1PNK A;  4PDR A;  2B1I A;  2WLK A;  2AHY A;  1AI6 A;  5EBM C;  2Q6A A;  4P2Z A;  4TWK A;  3MHH C;  3AG4 C;  1MSW D;  1BMF G;  3SPC A;  1GM9 A;  4FK5 C;  3AG1 B;  3ZRW A;  3T4Z A;  1NH2 D;  1AI4 A;  3OAA G;  5LGN A;  4WFB V;  4LC1 A;  4MVO A;  4WFA V;  4RQF A;  1E79 G;  2WAM A;  4GX2 A;  4P9O A;  1FXH A;  2DWD C;  4U7O A;  2WSS G;  1NVP B;  4UVB A;  1GM7 A;  2IJJ A;  3ZRS A;  3OMN B;  1YSC A;  3ABU A;  1OCC B;  3MHS C;  3T2M A;  3TCU A;  4X8A A;  1E1R G;  5HFL A;  3E8H A;  1YHQ V;  3T1C A;  5IY5 C;  1ENV A;  3CCS V;  1I5X A;  3UM7 A;  3E89 A;  3W7X A;  4GX1 A;  4UUJ C;  4BIZ A;  4HZ3 A;  3OR6 C;  3QNE A;  1NH2 B;  4WFG A;  3AG2 B;  2XAJ A;  2X6C A;  3OFN G;  2Q68 A;  5LBQ A;  1KP2 A;  1PNL A;  1K9M W;  1K7D A;  2WLH A;  1VQL V;  3SPJ A;  2V7Q G;  3ABM C;  4PA7 A;  4UVA A;  1R3K C;  3STZ C;  1LNQ A;  1FS0 G;  2HVK C;  2HJF C;  1V54 B;  3ZCC A;  3VBB A;  3I55 V;  1JCH A;  5KA5 A;  4JAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...