3CYOA

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d and complementary mutation e137k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEKSQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Transmembrane protein
total genus 33
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cyoA00
2MK3A 3CP1A 5KA6A 1JQ0A 2M7WA 2P6JA 2X7RB 2LP7A 3P30A 4N21A 5HFLA 3H01A 4FIPC 1QCEA 2EZOA 1DF4A 3GWOA 4JPRA 1DF5A 1MOFA 4JF3A 3CYOA 5HFMA 1I5YA 1I5XA 1JPXA 1K33A 3MHHC 1F23A 1K34A 5KA5A 1QR8A 1MG1A 1DLBA 5H9CA 4FJCC 4JGSA 1ENVA 1QR9A 1Y66A 3WFVA 5CMUA 3K9AA 2EZPA 3M99B 4FK5C 3MHSC 4N23A 4G2KA 1Y4MA 1EBOA 5CN0A 4E2LA 3B77A 2OT5A 3B8MA 3B8NA 1SZTA 2EBOA 1QBZA
chains in the Genus database with same CATH superfamily
3OGIB 2V4DA 3UT5B 1EZVH 2EJ7A 4JI3O 2Q0AA 3JD3A 4XBFA 1BS3A 3K04A 3T4ZA 2IM9A 5JCOA 4PI0A 3AEIA 3CB2A 1HNWO 3QO7A 3B8MA 1BQZA 3L73H 3F7YC 1H8EG 3FB8C 2XOKG 1SESA 4O4HB 4X89A 1EN6A 4X1KB 4LC1A 1R3JC 1I08A 1OCRC 4AILC 3WFVA 3OTFA 2GUZA 4K8ZA 4JAUA 3CC4V 2EILC 4YJ3A 4MVQA 5IJ9A 4UVBA 1GO3F 2ZD9A 4DW1A 3CEIA 1L0NH 1G4YB 5L3GA 1K5SA 2Q5ZA 3JASB 4FPPA 5DEDA 2O57A 3DXRA 2WLKA 3A8TA 2FMLA 3JSLA 3ZHQA 5KX5A 2IU0A 1M5IA 3QO8A 3ZRSA 1KB9F 1COWG 2L35A 5A9GA 3BVOA 2EINB 5C8YA 3K0DA 4PJ0Z 1URFA 3OMIB 2VWJA 5CA1B 4CZZA 2YXYA 1QCEA 3WG7B 2QM7A 3RBZA 2GUZB 3EHBB 4LF6O 3H1KH 4HAMA 4EFEA 3GVMA 4DV0O 4MSWC 1HNZB 4KHPO 2BTOA 3R66A 4AQYB 1QHTA 2JVDA 2Y4UA 5TISZ 1X59A 2E5LO 3CC2V 4JTCB 3FAVA 3DGEA 1TGOA 3JSNA 2QR4A 3BHPA 5H6RA 4NTXA 1H2LA 3MHSC 5CA1A 1QLEB 4NXMO 3CCEV 5LA6B 3U0ZA 5H6QA 2CH7A 2IU3A 1N4CA 1BMFG 3UCSC 1VF6C 4ZIBA 5LMUO 2B1IA 2E75B 3N27A 5IYCO 1K73W 1OCCB 4OX9B 3ZN1A 1M57B 1YTFB 3QNEA 1THZA 3B40A 4LF4B 1K4DC 1MZEA 2WSSG 4DYLA 4JV5B 4DUYO 3RYHB 3HR0A 1BHBA 1S5LZ 1KD1W 1NH2D 1KECA 5J2TA 4IT5A 2Q67A 4MVZA 4TSFG 4LFBB 3ZJZA 4DV7O 3KCXA 1AI7A 3NR7A 1BE3H 3LSSA 1SRYA 2PZSA 1FFXA 2CTPA 4WFAV 1M93A 1EFRG 3P32A 3OEHG 2QKSA 4FLZA 2FYUH 4X64O 1K9MW 2CDYA 2VQFO 4FFBB 2LGWA 3ZS8C 1XQ8A 4NTYA 4CH6A 4YJ3B 4MS2A 3H9VA 4RUFA 3JCZA 4UCVA 3I56V 2ARHA 4IYIA 4LNUA 4FFKA 1K7DA 4HNAA 2QA4V 2WLIA 2VRZA 2R70A 4JI7O 1IBMB 3SJCC 1FJGO 2P6JA 4JI8B 3SYAA 2YUAA 4DV1O 1PNKA 2Q0OC 4X62B 3IAYA 2QWPB 3LSQA 3JARA 1US6A 4GYCB 1GTOA 1NR7A 3K5OA 1ENVA 3VQWA 2DMXA 2UXDO 1MZFA 4PHZA 5LMNO 4I50B 1WP7A 4N23A 4DV1B 1P7BA 5BR8B 5IT9N 1VF5B 4LR3A 3W7SA 5EBLC 4I50A 1DF4A 4X20B 2L6LA 1EM1A 3K0GA 1O9GA 4HBNA 4TV9A 1R3LC 1JOYA 4X66O 2EULA 4JYAO 1AR5A 2P22C 5BMVA 3CRCA 4UV8A 4UCUA 5L3BA 4FLUA 1Q86W 2F93B 1W2BU 3OMNB 4QE7A 4GX1A 3ZMZA 4JASA 1YXBA 2G38A 5CA0A 2LP7A 3ZHRA 1RPOA 1DK1A 4F6RA 2AHYA 3UT5A 4DV4B 3CCRV 1VQPV 3QTCA 3N2KA 1NVPD 4GKJO 1AJNA 5EYPB 4JI5B 1KMIZ 3ZBHA 1IZ3A 4NYKA 5LGUA 1WB8A 3ZX6A 5B1NA 3JYCA 3ZMUA 4DV6B 2DWDC 1XBLA 1AJPA 2YIBA 3D36A 3PJSK 2EINC 5EIBC 4FM1A 4WFBV 4O4HA 5EZYA 1NBMG 4K8XA 5L3CA 4P9PA 1JJOA 4H33A 4DR6B 2Q68A 1RP3B 1NTMH 1L8DA 1GN4A 1VQ5V 4F6RB 1WP8A 5C93A 4ZOLA 3FB7C 2WLIB 5IY5C 1YTFD 1ZSPA 1KC8W 3RYFA 1HNZO 1RSOA 4AHCA 3ASNC 4B3SO 5EC1C 3JATA 1Q82W 1GMGA 4JI0B 3AG1C 1D5AA 4O4JB 2QWNB 2ZXWB 4X66B 1WJZA 3UQ8A 5JH7B 5BXZA 2BSKA 4MT8A 1MOFA 1I7FA 1YF2A 3MHHC 4UXNA 5DECA 5EBWC 2YXHA 4NB5A 4U3JA 5LMUB 4X88A 2LO1A 3ZIAG 1AROP 3LDCA 2YDEA 1EN5A 2UXXA 3RYHA 2BTQA 4J41A 1JA8A 4LBEC 2XT9A 1KP2A 3CCJV 3RYIA 2B1GA 1GM9A 2C2AA 4E4EA 4FM0A 2UXBO 4I0XB 5EBMC 3ETEA 1GN6A 4Q6GA 2QEXV 2UU9B 3JAWA 5JJJB 4J7KA 5GTHZ 4AQYO 3P3NA 4KL1A 4MVMA 1QNMA 1AJQA 5J9PC 2WLHA 1SQGA 4C7UA 1CP9A 1FFTB 5LA6A 4JZ2A 4LH6A 3OW2U 2JGDB 1BHAA 4L8JA 5KHGA 2ADQB 2X6BA 5JJNB 2F43G 3SPIA 4GUNA 1F23A 3E8GA 4CH5A 5H9CA 4PA7A 2V1DA 4O4IA 1F51A 5B1BC 2ZIOA 5IE9A 4FK5C 1JFFA 4G2KA 2AXTZ 1YJ9V 1BQ0A 1KU9A 1LNQA 4DRXA 1SQQH 4FLVA 2RQ6A 1Q3EA 2KG7B 2K1EA 3ML0A 1K8AW 3A0BZ 4DUZB 3CYOA 3HKBB 5BZBA 4B3TO 1TUBA 4JV5O 4BW5A 3TJTA 2X6AA 1PV0A 4B7KA 4EB6B 1VMGA 1FD9A 4FM2A 1FFXB 3JALA 4OGQB 3S3WA 4TV9B 4FIPC 4FVMA 1AVMA 1RPRA 1WPXA 4JPRA 5BMVB 1NZ6A 4X1IB 4D7SA 4IHJB 1ZUQA 3JAKA 4LCUC 4PDRA 4PA4A 4JI1B 4CC5A 4DV3B 1ZX3A 5KAFZ 4BAYA 2ZM6B 3ZMVA 1J5EO 3AK3A 3OMAB 4KP4A 4UV9A 1HNWB 2P06A 1WNSA 2WLMA 2RN9A 1TUBB 3GWOA 4QNHB 5EC2C 3SYQA 1YCIA 1I94B 2CK3G 3RYCA 1F4MA 3E22A 1Y76A 3E8FA 2QWOB 2PUSA 1I94O 2D2CB 3B77A 2BCCH 5B3SB 4LF6B 4DW0A 3G71V 1HW7A 3UO3A 2JGUA 5EZYB 2BTQB 1FXHA 1YHQV 3ABMC 2JJ2G 4DR1O 1XL6A 5GONB 3RWRD 3SDLA 5KUMA 3W7WA 4DR5O 1P7GA 2HHHB 1QLNA 2OT5A 1UJWB 4JI4O 1PL0A 1N34B 2UU9O 4H0LB 4ZBMA 2RDCA 5B1OA 1XNRB 3E22B 2XAFA 4PDVA 1IDSA 5KHKA 4NXNO 3M7MX 2Q7EA 3WU2Z 2ZE5A 1OCOC 2EIJB 4CC6A 2ZR2A 1OJHA 2Q4PA 2ATKC 3Q4HB 4Z1VA 2EBOA 4MVOA 5KA6A 4DK0A 4IIJB 3H01A 2P7TC 1RM1C 3K58A 5IDJA 1OCZC 5FLXN 3J81N 2AGAA 3J7AU 3K9SA 4J11A 4IIJA 4KFMA 1N32O 3C3TA 4DV5O 1YI2V 5IYZB 3IC7A 2UXBB 1GK9A 2HEPA 1SZTA 3FD9A 3QO5A 1Q43A 3E2EA 2ZE6A 5IJ0B 4YXWG 3CJHB 1DLBA 1FS0G 1Q8IA 1AR4A 5KHHA 1S72V 1WA8A 1VQ8V 3K5NA 1XREA 3ZHTA 4LF9O 2EIMB 1U97A 3E8BA 4Q20A 1IBLB 4JI0O 2XUMA 4LFCO 3D3IA 1D2DA 2N05A 2PYJA 3OTOB 4B3RB 1NT2B 2DN9A 4JYBA 3RYFB 2KQXA 2IH3C 1FKAO 3A0RA 3WG7C 4ABMA 4UCSA 2Y69B 3FB5C 3OD4A 1T5EA 3LDEA 1CEZA 3L71H 3SYOA 3FYEB 1DF5A 1YIJV 4DV7B 4GCZA 1Q90D 2IBZH 3OUFA 1XDCA 1KKDA 4DR2O 2Q6AA 3ABMB 3HKDB 2QM8A 1V9PA 4DUYB 1VQ4V 4A5UB 1AI5A 4LF4O 4MW8A 5CBFA 1IURA 3OUSA 3X2QC 2AHZA 3N2GB 5GW7A 2LFSA 3ZMTA 1OHHG 4OX9O 1YZBA 3DC5A 1VQOV 3SR2C 2IJHA 3CMAV 4UB6Z 2ZNJA 3WB1A 1AB3A 1LR1A 2M6YA 2OIGA 3LSUA 5KLVH 2HJDA 4Z1MG 2IW5A 1NR1A 4LFCB 2UUAO 1S0VA 3JD0A 3VBBA 5LMNB 3AG4B 3STLC 5AG2A 4GKKB 4YHHO 4UVCA 4QIWF 4EFBA 5LL6Y 2KG7A 3ZRVA 4CH3A 2PI4A 4FJCC 1VQLV 4XDKA 1JJ2U 4I9WA 2JGDA 4KHPB 1HP8A 3T1YO 4MW3A 3JD1A 2PI5A 3EFFK 4TWKA 2OCHA 1V55B 1PM9A 2RCVA 2KB1A 2WWWA 3IC9A 3IGAC 1IXBA 1N8RW 1AI4A 4F6EA 1IBLO 1Q6IA 4TV8A 5B1AC 3WB2A 5IY5B 2WLJA 2XAHA 1Y74B 1K5QA 4E2LA 3L70H 4U3FH 4MTFA 2N04A 1WAZA 5F2VO 3ABUA 3CJHA 2CTWA 2M7WA 2N74A 1N34O 3FX7A 3U11A 1IBMO 2ODMA 1HNXB 3VOUA 2HHHO 3ABLB 4RQFA 3BAAA 3L9DA 1VQKV 4UVAA 1R6NA 4I7ZB 5K1PA 3H1HH 1HR0O 1Y66A 2QDOA 3CPWU 4UUJC 3HKDA 4QPJA 4OPHA 4RQEA 2JK5C 3ETGA 3GWKC 2B9ZA 5JQGA 4LFAO 2UUCO 2Q7GA 2P5OA 1JQ0A 1VP7A 2VQFB 1DGSA 4LF8B 4I9QA 1XOUA 2GSMB 2JS5A 1S5HC 3SJAC 2GBOA 4PD4F 4J7JA 3QF7A 4JAVA 3HKCA 4CH4A 5E1AC 2MK3A 4WBNA 3U10A 2UXNA 2NLJC 3P30A 1VQMV 1QLEC 1MABG 2F66C 3CXHF 3HKCB 1EN4A 4NXNB 3ZHSA 2UUBB 4EEQA 3OE7G 2HG5C 1NVPB 1P84F 3JD2A 2DYRC 4TT3G 3AG7A 3T1HB 2A9HA 2IH1C 2PYLA 3K59A 4DV0B 4QGPA 4MVUA 1ZLZA 2LGQA 4ZI7A 1HDJA 4X1YB 3OEEG 5D5PA 2Q8VA 2QTOA 1A32A 1VIBA 1QU7A 4PA6A 1YVWA 4ZI7B 1R6TA 1XL4A 4FLYA 4JI1O 2YXLA 5CB4A 5LHHA 3QVNA 4LF7O 3MD0A 4B3TB 2HJFC 5H5NA 2QWQB 4IHJA 4DUZO 1K97A 3TXQA 2DYSC 3F5TA 1V55C 3E8HA 3FKSG 2EZOA 2R9IA 2YEVB 5JWPA 4NXMB 3Q4HA 4H44B 3BEHA 2ZXWC 3BFRA 2F23A 3ZHUA 5CA3A 1Q7YW 3OFNG 2EIKB 1H38A 1QQCA 4L87A 3J80N 4DV5B 3RYCB 3BABA 1W0KG 3ZEDA 4UFZA 3RT3C 2QJ1A 1X4TA 1W0JG 4FZ0A 1GN2A 3L72H 5C8YB 1JFFB 3SGIA 1Y74A 4NR1A 3APQA 5FPOA 2HVKC 1FXKA 4GX0A 5LHIA 2NR5A 2UXCB 4ZKIA 3AK2A 5LP6B 2CGNA 4BW9A 4TUYA 2WA3A 3M99B 1MMMA 3ETQA 4PI2A 3A0HZ 2VS0A 2QE7G 4KUMA 3B8NA 3UM7A 1DTOA 1XMOB 1M56B 5GTIZ 3MDSA 1AILA 1TVKA 1F4NA 3K79A 4WBNB 1UPGA 2PY5A 1XNRO 1G6UA 3PN1A 3ABKB 2H94A 3K08A 3M8AA 3FAVB 5BY1A 2HKOA 1F7YA 1JVMA 2WAMA 1Z5VA 3D36C 4FFBA 1M4UA 2YC0A 4I0XA 4JZGA 2LJ2A 3JARB 2E3CA 3FFQA 2YIAA 2GV9A 3CP1A 4MVSA 1YJNV 3SYCA 4LWSB 2R72A 2YIBD 1J95A 3K3WA 2CH7B 1GAXA 2V7QG 3N2GA 3R65A 4TUYB 1Z2GA 5KA5A 3EXAA 1KUQA 3C90A 3CMEV 5EIBD 1WPBA 3THOA 5E79Z 3DXRB 1YITV 4GLXA 2DOSA 3B2EE 2GDSA 5B1BB 3I5DA 2Q9LA 4F4LA 3VQXA 3KKYA 3ZRWB 1XUQA 5J2TB 3CE2A 3IJ4A 3QG5A 3CD6V 2XHBA 2P90A 2JEXA 1OCRB 2F4VO 3BY6A 3BA8A 1RM1B 4WF9V 2QTSA 4MVRA 2AW9A 2FTKA 2XAQA 5L3EA 5ITZB 2GHYA 4JI2B 3AG2C 2ZCEA 1VQ7V 3OR7C 4DR6O 5IYDO 2ZIMA 3AG1B 3RW0A 1AP5A 2EIKC 5L3FA 1FXKB 2EIMC 1ROPA 4LFAB 2ZE8A 4JI6B 4AI8A 2QKAA 4J42A 5FL7G 3HPLC 3ASOB 4X9QA 1ZL8A 3ETDA 2QM4A 4HNAB 4DO2A 1S3JA 5HFLA 1JX9A 5LP6C 2WLLA 1K33A 4BR6A 1XNQO 1AI6A 4JI5O 2Y69C 2VQEO 1IX9A 1ZAUA 2WLLB 2NNUA 2RNBA 4DV2O 3S3XA 4LP8A 4JYYA 3JAWB 3E89A 3VQVA 2JJ1G 4YY3B 3B4SA 2FB5A 4LF8O 1NI8A 2QSAA 3DTUB 3UKMA 1GRJA 5K1XA 1VQ6V 1K92A 1YEWA 2JRIA 1PD3A 1R1BA 3VQYA 1L1FA 4DV6O 3TXSA 4GX5A 4WCEV 3OM3B 1Y6XA 1Q6UA 1HNXO 3FYIB 4N21A 5DN6G 1SETA 2ITCC 3DSQA 1QVFU 4GKJB 2UUCB 4O2AB 1PPJH 2YIDA 3F5WC 2CE4A 4JYCA 2ADPA 1MG1A 2NN4A 2LW1A 5IWAO 3OAAG 3EVKA 1XI1A 2IJKA 4TQFA 3N2KB 3AG3C 3OR6C 2ZDIA 3TCUA 1N36B 1D5NA 4X1KA 1H8HG 1SQVH 1FYJA 1AR1B 1NJIW 2QWRB 1FXVA 1OCOB 5KHIA 1P4RA 1N36O 2JEUA 4BWAA 3W7XA 3CRRA 3RFRA 4O2AA 4LFBO 3CCSV 2WA4A 5CBGA 3ZRWA 3E35A 4B3SB 2Q73A 5IWAB 5EK0A 4O2BA 2DQ3A 1IBKB 4O4LA 3T1YB 1ZL8B 3OGCC 1PKXA 2XAGA 1QR8A 4JI6O 4RUEA 4JGSA 1OZ0A 4JI8O 1XNQB 4JI4B 3CHXA 2GTAA 3W7UA 1BCCH 4B3RO 1S77D 3DC6A 4EB6A 1E1QG 4UCRA 4U7OA 3HB3B 1BL8A 3ZRXA 2A3QA 2HFEC 4OPAA 1IVSA 3NXSA 2DYRB 1FPOA 3ABKC 1MSDA 2YI9A 4B3MO 4LNUB 4K35A 1G1XB 2KSDA 2OCCB 3TGUH 1V54B 4ASUG 3CCVV 3G4SV 3RGBA 4IYHA 1JPXA 1XILA 2AZ0A 1Q6HA 1SERA 1IBKO 4GZRB 1M57C 1AP6A 1RFYA 2ZDIC 1O9HA 5A2QN 4MTGA 1MA1A 5JH7A 4Z2WA 1WB7A 3JALB 1B3QA 1J5EB 1RSOB 2E5LB 3E83A 5D5QA 3ZHVA 1N0JA 2FL4A 4DV3O 3P3PA 2VWKA 2BE3A 3FB6C 2PGGA 4LF9B 4UCOA 2IJJA 2Y48A 3TK1A 2A79B 1V54C 3JD4A 2Q69A 2LQTA 2E74B 4JAAA 4RAIA 3JASA 4BIUA 1PNLA 5BR8O 2ZKOA 4W4KA 4ZOLB 4DR3O 1XHXA 3CSXA 5B66Z 5KUKA 2Z3YA 1R6KA 3STZC 1I0HA 4R50A 4J80A 5KHJA 2BOCC 4DRXB 1XHZA 1NKDA 4CS3A 5LHGA 5CA0B 5LYJB 4P2ZA 5B1AB 1M90W 3AG2B 4GT1A 4PA9A 5IJ0A 1FAFA 2EILB 4JI7B 1JMKC 4O4JA 1H2SB 5LYJA 2D3OW 1LUWA 4K3AA 2HP8A 3BRCA 3CCUV 2HLDG 5LXTA 1NTZH 5FNVB 4DK1A 4B08A 4D7TA 4XDLA 3SPHA 3ASOC 4RWUA 5JCOC 1PP9H 2YSUB 3G67A 2PF4E 3LUTB 1SS3A 5LOVB 1TUEB 1VARA 2VQEB 4QE9A 3MAQA 1BSMA 4IGGA 2RMKB 5DM6V 3H1LH 1TVKB 4PELA 4PDLA 4QJFB 1MNGA 1SA0B 1E79G 2BOBC 2ZQMA 1Y76B 4JI3B 1B06A 5JVDA 4UCTA 1MSWD 2DJVA 4QPKA 4ICGA 3T1CA 4TQDA 1XMQO 1I5YA 1IXMA 1VQ9V 2ZR3A 5JQGB 1HWYA 1Z5WA 4I55B 4P30A 4GX2A 1PNMA 3T1HO 4WFEA 2EIJC 3T4DA 2DE0X 1BGYH 1R3KC 2P4VA 2UUBO 2A7WA 4G27B 3E86A 4I4TA 4LF5O 4FLWA 1BT8A 1Q5OA 3TETA 1GN3A 2Q7HA 3X2QB 3UO2A 1OCZB 2F95B 2WPDG 4I4TB 2ZM6O 2CUGA 2XASA 2K9PA 2EZPA 2B5UA 2E76B 1KYOF 3JCUZ 5LGNA 1Q81W 5J2UA 3O65A 2CTQA 4LF7B 1SKVA 1R73A 3AK1A 3CCLV 2XTAA 3CX5F 2R9RB 4R8CA 5IJ9B 5JJEB 1GKFA 3ZCCA 2ZINA 3HKEA 5FNVA 3K5MA 1L0LH 3K9AA 2W0XA 4FLTA 3JAMN 4G28B 2YICA 4O4IB 3I55V 3CXCU 1K3EA 3GB7C 2Y0PA 5B5EZ 4UB8Z 2JDIG 1ZTEA 1SQXH 4H37A 4J10A 4WFHA 4DXWA 1KKCA 2IJIA 1NTKH 3BA9A 4DV4O 2R9AA 1M9NA 4O2BB 4K0KB 1SZXA 2MW2B 4O4LB 4WFGA 3HKBA 1XMOO 2YEVA 1NH2B 4YIPA 3K06A 1LUVA 1OV9A 1GM7A 1KBHA 2UXCO 5KMGB 4YJ2A 4JYAB 1EZJA 1M56C 5LBQA 3D8CA 2Z5UA 1H2KA 1VF6A 3L74H 1K34A 2OCCC 5L3DA 1GM8A 1SF9A 5LOVA 2A0LA 1QR9A 4U7NA 1Y4MA 1EBOA 1GH6A 2QKCA 1YJWV 4J7ZA 3SPGA 5H2FZ 5IYZA 4JF3A 4PV1B 3L75H 2WLNA 5JVDB 1SC5B 1VF7A 1WN7A 2RJZA 4DR4B 4YJ2B 5KMGA 2X0LA 2HVJC 2W6IG 3RVYA 5LGTA 3H1JH 1OCCC 1WLEA 2Y0IA 3SPJA 1R3IC 2YS8A 4TV8B 4X1YA 4DR3B 1SQFA 2OIEA 2UUAB 4HZ3A 1CPYA 3SYPA 2YI8A 4BIZA 2GTSA 2X6CA 2Y4TA 4CS4A 4CBCA 2ZT9B 4U3JB 3HKEB 4DV2B 2OTJV 3LNMB 4EKWA 2KKWA 4OXSA 5KAIZ 5KX5B 4DR7O 2EJRA 4B3MB 3RYIB 3C3SA 3K03A 3LDDA 1G8MA 4NVPA 4X65B 1QVGU 4HYOA 4X65O 4BIOA 5CN0A 4DR7B 4X8AA 4R7CA 2P4KA 3CRMA 1B6QA 4X1IA 2ILMA 1SQPH 4P9OA 1H2GA 5EYPA 3BPZA 2CTRA 4I55A 3SJQC 2W0FC 4WFFA 3D3QA 5ITZA 2OYQA 3OT7A 3KG2A 4XDJA 2F1MA 3W7TA 2UXDB 3RVZA 1HR0B 5CBHA 1BZKA 2X7RB 3KCYA 4CS2A 1N33B 4DR2B 4X62O 1FXKC 2JIZG 1I5XA 2OTLV 1SQBH 4LH7A 2H3OA 2QGNA 4FLXA 1FJGB 1XEQA 2H8PC 1K4CC 3IFXA 4NTWA 5IYBO 1ZWIC 4FMTA 4JTDB 1S76D 1WA8B 1YSCA 3BCCH 2LW7A 3CC7V 2DWEC 3WB0A 4MTOA 5FPRA 3SJBC 1ORQC 4R6ZA 1TAEA 4NKGB 3ZMSA 1VEWA 2ZNIA 1NS1A 2LFRA 4X64B 1PL4A 3B09A 1Y67A 2JS3A 2ETNA 3AG3B 1NQTA 4RO2A 2PTMA 3RN4A 2EX3A 3APOA 4YIOA 1SA0A 1U96A 4TOIA 5HFMA 4J9ZB 2XAJA 3SPCA 1N33O 1P49A 4YHHB 4GKKO 2DW4A 1KP3A 2Z0AA 3G80A 3O9OA 4J9YB 3A2FA 4MTXA 3JAKB 1QBZA 1N32B 3G6BA 2A06H 2P67A 3F7VC 2FKXA 1CXZB 4W4LA 3AG4C 3KZIZ 3LNNA 5LP6A 1KQSU 3CS5A 4JTAB 4DR1B 1B04A 5LXTB 4X20A 3CRAA 2OWOA 4IL6Z 3ABLC 1VQNV 4PDMA 2CGOA 4B7EA 2AZ2A 1UFIA 3JATB 2ZE7A 4LF5B 1W59A 4YY3O 4K0KO 1JR9A 5J2UB 2XNDG 1NU1H 2DYSB 3G6EV 1N0NA 4ZHQB 3ZN0A 1E1RG 3ABTA 1H2MA 2BSKB 3CRQA 4LWSA 4FZ1A 4DR5B 2ITDC 2HR3A 2W6JG 3T2MA 1TA8A 4I5SA 4ZHQA 1YDXA 3OTOO 3ICXA 5GONA 3CWBH 3CCQV 3K57A 5CB4B 2DQ0A 3H1IH 3K5LA 1S5JA 4H13B 1JCHA 1H2NA 3ASNB 2F4VB 4KXRA 5B3SC 5CMUA 4PA3A 3CCMV 1M1KW 1XMQB 2CAZC 4DR4O 4D6TH 4JI2O
chains in the Genus database with same CATH topology
1LNQA 2DYSC 1TUEB 4QE9A 1V55C 2K1EA 3E8HA 3FKSG 3ML0A 2EZOA 1K8AW 2R9IA 2YEVB 3JD3A 3CYOA 4XBFA 3K04A 3T4ZA 5BZBA 3BEHA 2ZXWC 5DM6V 3AEIA 4BW5A 4PELA 2X6AA 4PDLA 5CA3A 1Q7YW 3OFNG 4QJFB 2EIKB 1H38A 1E79G 2BOBC 4L87A 3QO7A 2ZQMA 3B8MA 1W0KG 1MSWD 4QPKA 3F7YC 1W0JG 4FIPC 1H8EG 3FB8C 3T1CA 2XOKG 1RPRA 1WPXA 4JPRA 1SESA 5LHIA 2HVKC 1FXKA 1I5YA 1IXMA 4GX0A 1VQ9V 4X89A 2ZR3A 4LCUC 1HWYA 4PDRA 4PA4A 4LC1A 1R3JC 4ZKIA 4P30A 1OCRC 3WFVA 4GX2A 1PNMA 3M99B 4BAYA 4WFEA 2EIJC 3T4DA 3ZMVA 1R3KC 4JAUA 2EILC 3CC4V 3OMAB 2QE7G 4KP4A 4G27B 4KUMA 4MVQA 4UV9A 3E86A 1GO3F 3B8NA 4UVBA 1DTOA 3UM7A 2ZD9A 1M56B 1G4YB 5L3GA 1K5SA 4FPPA 2WLMA 1F4NA 3TETA 3K79A 3GWOA 3X2QB 4QNHB 5EC2C 3SYQA 2WLKA 1OCZB 2WPDG 2CK3G 3ABKB 2H94A 3K08A 1F4MA 2IU0A 2HKOA 2XASA 2EZPA 1JVMA 3E8FA 2WAMA 3QO8A 3ZRSA 1COWG 2B5UA 3B77A 5LGNA 1Q81W 2EINB 5B3SB 3K0DA 3OMIB 3CP1A 4MVSA 4CZZA 1YJNV 3SYCA 1R73A 3G71V 3CCLV 1QCEA 3WG7B 1J95A 3K3WA 2V7QG 2QM7A 3R65A 2R9RB 5KA5A 4R8CA 1FXHA 3RBZA 1GKFA 1YHQV 3ZCCA 3ABMC 3CMEV 2JJ2G 3EHBB 1XL6A 3K9AA 4HAMA 5KUMA 4G28B 4MSWC 3W7WA 3I55V 3CXCU 1K3EA 1QLNA 2OT5A 3GB7C 1UJWB 1PL0A 1YITV 4H37A 2JDIG 4ZBMA 4WFHA 4DXWA 5B1OA 2IJIA 3CC2V 4JTCB 5B1BB 2XAFA 4PDVA 3DGEA 4F4LA 1M9NA 3ZRWB 5H6RA 1OCOC 2EIJB 3CD6V 4WFGA 2P90A 2JEXA 2ZR2A 1OCRB 2YEVA 3MHSC 1QLEB 1NH2B 3CCEV 3BY6A 3K06A 1RM1B 2ATKC 4WF9V 4MVRA 2EBOA 5H6QA 4MVOA 5KA6A 2FTKA 2XAQA 1GM7A 2IU3A 1BMFG 5L3EA 3H01A 1EZJA 1M56C 2B1IA 2GHYA 2P7TC 5LBQA 3AG2C 2Z5UA 1VQ7V 3OR7C 5IYCO 1RM1C 5IDJA 1K34A 1OCZC 2OCCC 1K73W 5IYDO 5L3DA 1GM8A 3AG1B 1OCCB 3RW0A 2EIKC 2A0LA 1QR9A 1FXKB 2EIMC 5L3FA 1ROPA 4KFMA 4U7NA 1YI2V 3ZN1A 1Y4MA 1EBOA 1M57B 3IC7A 5FL7G 1YTFB 1GK9A 3HPLC 1YJWV 3QNEA 1SZTA 1THZA 3ASOB 1K4DC 3QO5A 2WSSG 3ETDA 3E2EA 4DO2A 1S3JA 5HFLA 1JX9A 1BHBA 3SPGA 1KD1W 1NH2D 2WLLA 1KECA 4JF3A 4TSFG 2Q67A 4MVZA 3ZJZA 1K33A 4YXWG 2WLNA 1AI6A 2Y69C 1DLBA 1FS0G 1AI7A 2WLLB 2NNUA 1SRYA 3LSSA 4LP8A 4WFAV 1S72V 3E89A 1VQ8V 1EFRG 2JJ1G 2X0LA 3P32A 2HVJC 3OEHG 2QKSA 2W6IG 1K9MW 3RVYA 2EIMB 5LGTA 1OCCC 1WLEA 3E8BA 3SPJA 4Q20A 1R3IC 3DTUB 3UKMA 1VQ6V 1K92A 4HZ3A 3D3IA 1CPYA 4MS2A 4RUFA 3SYPA 3JCZA 1PD3A 3I56V 4BIZA 2X6CA 1L1FA 1K7DA 4JYBA 4GX5A 4WCEV 3OM3B 4CBCA 2QA4V 2WLIA 2IH3C 3A0RA 3WG7C 3FYIB 4N21A 5DN6G 2OTJV 2Y69B 3FB5C 1SETA 2ITCC 3LNMB 4EKWA 1QVFU 2P6JA 4OXSA 3LDEA 1CEZA 3SYOA 3SYAA 3FYEB 3F5WC 1DF5A 1YIJV 2EJRA 4JYCA 4GCZA 1PNKA 3OUFA 1KKDA 3LSQA 2Q6AA 3ABMB 1MG1A 3K03A 3LDDA 1G8MA 1GTOA 1QVGU 2QM8A 1NR7A 4HYOA 1ENVA 1VQ4V 3OAAG 1AI5A 4MW8A 2IJKA 4N23A 5CN0A 5CBFA 1P7BA 4X8AA 3AG3C 3OUSA 4R7CA 3X2QC 3OR6C 2AHZA 1B6QA 5GW7A 2ZDIA 2LFSA 3TCUA 3ZMTA 1OHHG 3W7SA 1H8HG 1H2GA 4P9OA 5EBLC 1DF4A 3SJQC 1VQOV 3K0GA 2IJHA 3CMAV 2W0FC 4WFFA 1AR1B 1NJIW 1R3LC 1JOYA 1FXVA 1OCOB 1P4RA 2JEUA 4Z1MG 2IW5A 1NR1A 4UV8A 5L3BA 3W7XA 1Q86W 1W2BU 3KG2A 4XDJA 3OMNB 3CCSV 1S0VA 3JD0A 4QE7A 4GX1A 3VBBA 3ZRWA 5CBGA 3E35A 3W7TA 3AG4B 4JASA 3STLC 3ZMZA 5EK0A 3RVZA 5CBHA 2X7RB 2LP7A 4UVCA 1RPOA 2DQ3A 4QIWF 1FXKC 2JIZG 1I5XA 2AHYA 3OGCC 2OTLV 1PKXA 2XAGA 1QR8A 3ZRVA 3CCRV 1VQPV 2PI4A 4FJCC 4RUEA 4JGSA 4XDKA 1OZ0A 1VQLV 1NVPD 1JJ2U 1AJNA 4I9WA 5LGUA 2H8PC 1K4CC 3IFXA 3W7UA 4MW3A 1ZWIC 3JD1A 5B1NA 3EFFK 4FMTA 3JYCA 4JTDB 4TWKA 5IYBO 1V55B 3ZMUA 1S76D 2DWDC 2KB1A 1YSCA 1S77D 1E1QG 2WWWA 3CC7V 1AJPA 2DWEC 3D36A 4MTOA 3IGAC 4U7OA 3PJSK 2EINC 1ORQC 1N8RW 1AI4A 4R6ZA 3ZMSA 3HB3B 1BL8A 4WFBV 3ZRXA 2HFEC 5B1AC 3NXSA 1NBMG 2DYRB 5IY5B 2LFRA 2WLJA 2XAHA 5L3CA 4P9PA 4H33A 1K5QA 3ABKC 4E2LA 2Q68A 4MTFA 3AG3B 1NQTA 4RO2A 1VQ5V 3ABUA 2OCCB 5C93A 2M7WA 1V54B 2WLIB 3FB7C 5IY5C 1YTFD 4ASUG 3CCVV 1KC8W 5HFMA 3VOUA 4J9ZB 3G4SV 3ABLB 1JPXA 4RQFA 1VQKV 2XAJA 1SERA 4UVAA 3SPCA 1R6NA 1M57C 2ZDIC 3ASNC 1Y66A 2DW4A 1KP3A 5EC1C 3CPWU 4MTGA 1Q82W 4UUJC 4QPJA 4J9YB 4RQEA 1GMGA 2JK5C 3ETGA 4MTXA 3E83A 1QBZA 3AG1C 1JQ0A 2ZXWB 2P67A 3F7VC 3AG4C 3FB6C 4MT8A 2GSMB 1MOFA 2IJJA 2Y48A 1S5HC 3TK1A 1KQSU 3MHHC 4UXNA 2A79B 1V54C 3JD4A 2Q69A 5EBWC 4JTAB 4X88A 3ZIAG 4JAVA 4RAIA 1AROP 3LDCA 4BIUA 1PNLA 2UXXA 1VQNV 3ABLC 4LBEC 5E1AC 4PDMA 2MK3A 1KP2A 5KUKA 2Z3YA 2UXNA 2NLJC 3P30A 1R6KA 1QLEC 1MABG 3STZC 3CCJV 1VQMV 2B1GA 1GM9A 2C2AA 4R50A 2BOCC 1NKDA 5LHGA 3OE7G 2HG5C 1NVPB 2XNDG 5EBMC 3ETEA 3JD2A 2QEXV 2DYSB 2DYRC 4TT3G 3G6EV 4P2ZA 5B1AB 1M90W 3AG2B 3ZN0A 1E1RG 4GT1A 4PA9A 2A9HA 4MVMA 2EILB 3ABTA 2IH1C 4MVUA 2ITDC 1AJQA 2D3OW 2HR3A 2W6JG 2WLHA 3T2MA 5J9PC 4I5SA 1CP9A 1FFTB 3OEEG 3CCUV 3OW2U 2HLDG 2QTOA 3CCQV 1BHAA 2DQ0A 2X6BA 2F43G 3SPIA 1JCHA 4PA6A 1F23A 3E8GA 3ASNB 4XDLA 2PI5A 3SPHA 3ASOC 5H9CA 4PA7A 1XL4A 2YSUB 2V1DA 5B3SC 1F51A 5B1BC 5CMUA 4FK5C 5LHHA 4PA3A 3MD0A 3CCMV 4G2KA 1M1KW 2HJFC 1YJ9V 1K97A 3LUTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK3 A;  3CP1 A;  5KA6 A;  1JQ0 A;  2M7W A;  2P6J A;  2X7R B;  2LP7 A;  3P30 A;  4N21 A;  5HFL A;  3H01 A;  4FIP C;  1QCE A;  2EZO A;  1DF4 A;  3GWO A;  4JPR A;  1DF5 A;  1MOF A;  4JF3 A;  3CYO A;  5HFM A;  1I5Y A;  1I5X A;  1JPX A;  1K33 A;  3MHH C;  1F23 A;  1K34 A;  5KA5 A;  1QR8 A;  1MG1 A;  1DLB A;  5H9C A;  4FJC C;  4JGS A;  1ENV A;  1QR9 A;  1Y66 A;  3WFV A;  5CMU A;  3K9A A;  2EZP A;  3M99 B;  4FK5 C;  3MHS C;  4N23 A;  4G2K A;  1Y4M A;  1EBO A;  5CN0 A;  4E2L A;  3B77 A;  2OT5 A;  3B8M A;  3B8N A;  1SZT A;  2EBO A;  1QBZ A; 
#chains in the Genus database with same CATH topology
 3OGI B;  2V4D A;  3UT5 B;  1EZV H;  2EJ7 A;  4JI3 O;  2Q0A A;  3JD3 A;  4XBF A;  1BS3 A;  3K04 A;  3T4Z A;  2IM9 A;  5JCO A;  4PI0 A;  3AEI A;  3CB2 A;  1HNW O;  3QO7 A;  3B8M A;  1BQZ A;  3L73 H;  3F7Y C;  1H8E G;  3FB8 C;  2XOK G;  1SES A;  4O4H B;  4X89 A;  1EN6 A;  4X1K B;  4LC1 A;  1R3J C;  1I08 A;  1OCR C;  4AIL C;  3WFV A;  3OTF A;  2GUZ A;  4K8Z A;  4JAU A;  3CC4 V;  2EIL C;  4YJ3 A;  4MVQ A;  5IJ9 A;  4UVB A;  1GO3 F;  2ZD9 A;  4DW1 A;  3CEI A;  1L0N H;  1G4Y B;  5L3G A;  1K5S A;  2Q5Z A;  3JAS B;  4FPP A;  5DED A;  2O57 A;  3DXR A;  2WLK A;  3A8T A;  2FML A;  3JSL A;  3ZHQ A;  5KX5 A;  2IU0 A;  1M5I A;  3QO8 A;  3ZRS A;  1KB9 F;  1COW G;  2L35 A;  5A9G A;  3BVO A;  2EIN B;  5C8Y A;  3K0D A;  4PJ0 Z;  1URF A;  3OMI B;  2VWJ A;  5CA1 B;  4CZZ A;  2YXY A;  1QCE A;  3WG7 B;  2QM7 A;  3RBZ A;  2GUZ B;  3EHB B;  4LF6 O;  3H1K H;  4HAM A;  4EFE A;  3GVM A;  4DV0 O;  4MSW C;  1HNZ B;  4KHP O;  2BTO A;  3R66 A;  4AQY B;  1QHT A;  2JVD A;  2Y4U A;  5TIS Z;  1X59 A;  2E5L O;  3CC2 V;  4JTC B;  3FAV A;  3DGE A;  1TGO A;  3JSN A;  2QR4 A;  3BHP A;  5H6R A;  4NTX A;  1H2L A;  3MHS C;  5CA1 A;  1QLE B;  4NXM O;  3CCE V;  5LA6 B;  3U0Z A;  5H6Q A;  2CH7 A;  2IU3 A;  1N4C A;  1BMF G;  3UCS C;  1VF6 C;  4ZIB A;  5LMU O;  2B1I A;  2E75 B;  3N27 A;  5IYC O;  1K73 W;  1OCC B;  4OX9 B;  3ZN1 A;  1M57 B;  1YTF B;  3QNE A;  1THZ A;  3B40 A;  4LF4 B;  1K4D C;  1MZE A;  2WSS G;  4DYL A;  4JV5 B;  4DUY O;  3RYH B;  3HR0 A;  1BHB A;  1S5L Z;  1KD1 W;  1NH2 D;  1KEC A;  5J2T A;  4IT5 A;  2Q67 A;  4MVZ A;  4TSF G;  4LFB B;  3ZJZ A;  4DV7 O;  3KCX A;  1AI7 A;  3NR7 A;  1BE3 H;  3LSS A;  1SRY A;  2PZS A;  1FFX A;  2CTP A;  4WFA V;  1M93 A;  1EFR G;  3P32 A;  3OEH G;  2QKS A;  4FLZ A;  2FYU H;  4X64 O;  1K9M W;  2CDY A;  2VQF O;  4FFB B;  2LGW A;  3ZS8 C;  1XQ8 A;  4NTY A;  4CH6 A;  4YJ3 B;  4MS2 A;  3H9V A;  4RUF A;  3JCZ A;  4UCV A;  3I56 V;  2ARH A;  4IYI A;  4LNU A;  4FFK A;  1K7D A;  4HNA A;  2QA4 V;  2WLI A;  2VRZ A;  2R70 A;  4JI7 O;  1IBM B;  3SJC C;  1FJG O;  2P6J A;  4JI8 B;  3SYA A;  2YUA A;  4DV1 O;  1PNK A;  2Q0O C;  4X62 B;  3IAY A;  2QWP B;  3LSQ A;  3JAR A;  1US6 A;  4GYC B;  1GTO A;  1NR7 A;  3K5O A;  1ENV A;  3VQW A;  2DMX A;  2UXD O;  1MZF A;  4PHZ A;  5LMN O;  4I50 B;  1WP7 A;  4N23 A;  4DV1 B;  1P7B A;  5BR8 B;  5IT9 N;  1VF5 B;  4LR3 A;  3W7S A;  5EBL C;  4I50 A;  1DF4 A;  4X20 B;  2L6L A;  1EM1 A;  3K0G A;  1O9G A;  4HBN A;  4TV9 A;  1R3L C;  1JOY A;  4X66 O;  2EUL A;  4JYA O;  1AR5 A;  2P22 C;  5BMV A;  3CRC A;  4UV8 A;  4UCU A;  5L3B A;  4FLU A;  1Q86 W;  2F93 B;  1W2B U;  3OMN B;  4QE7 A;  4GX1 A;  3ZMZ A;  4JAS A;  1YXB A;  2G38 A;  5CA0 A;  2LP7 A;  3ZHR A;  1RPO A;  1DK1 A;  4F6R A;  2AHY A;  3UT5 A;  4DV4 B;  3CCR V;  1VQP V;  3QTC A;  3N2K A;  1NVP D;  4GKJ O;  1AJN A;  5EYP B;  4JI5 B;  1KMI Z;  3ZBH A;  1IZ3 A;  4NYK A;  5LGU A;  1WB8 A;  3ZX6 A;  5B1N A;  3JYC A;  3ZMU A;  4DV6 B;  2DWD C;  1XBL A;  1AJP A;  2YIB A;  3D36 A;  3PJS K;  2EIN C;  5EIB C;  4FM1 A;  4WFB V;  4O4H A;  5EZY A;  1NBM G;  4K8X A;  5L3C A;  4P9P A;  1JJO A;  4H33 A;  4DR6 B;  2Q68 A;  1RP3 B;  1NTM H;  1L8D A;  1GN4 A;  1VQ5 V;  4F6R B;  1WP8 A;  5C93 A;  4ZOL A;  3FB7 C;  2WLI B;  5IY5 C;  1YTF D;  1ZSP A;  1KC8 W;  3RYF A;  1HNZ O;  1RSO A;  4AHC A;  3ASN C;  4B3S O;  5EC1 C;  3JAT A;  1Q82 W;  1GMG A;  4JI0 B;  3AG1 C;  1D5A A;  4O4J B;  2QWN B;  2ZXW B;  4X66 B;  1WJZ A;  3UQ8 A;  5JH7 B;  5BXZ A;  2BSK A;  4MT8 A;  1MOF A;  1I7F A;  1YF2 A;  3MHH C;  4UXN A;  5DEC A;  5EBW C;  2YXH A;  4NB5 A;  4U3J A;  5LMU B;  4X88 A;  2LO1 A;  3ZIA G;  1ARO P;  3LDC A;  2YDE A;  1EN5 A;  2UXX A;  3RYH A;  2BTQ A;  4J41 A;  1JA8 A;  4LBE C;  2XT9 A;  1KP2 A;  3CCJ V;  3RYI A;  2B1G A;  1GM9 A;  2C2A A;  4E4E A;  4FM0 A;  2UXB O;  4I0X B;  5EBM C;  3ETE A;  1GN6 A;  4Q6G A;  2QEX V;  2UU9 B;  3JAW A;  5JJJ B;  4J7K A;  5GTH Z;  4AQY O;  3P3N A;  4KL1 A;  4MVM A;  1QNM A;  1AJQ A;  5J9P C;  2WLH A;  1SQG A;  4C7U A;  1CP9 A;  1FFT B;  5LA6 A;  4JZ2 A;  4LH6 A;  3OW2 U;  2JGD B;  1BHA A;  4L8J A;  5KHG A;  2ADQ B;  2X6B A;  5JJN B;  2F43 G;  3SPI A;  4GUN A;  1F23 A;  3E8G A;  4CH5 A;  5H9C A;  4PA7 A;  2V1D A;  4O4I A;  1F51 A;  5B1B C;  2ZIO A;  5IE9 A;  4FK5 C;  1JFF A;  4G2K A;  2AXT Z;  1YJ9 V;  1BQ0 A;  1KU9 A;  1LNQ A;  4DRX A;  1SQQ H;  4FLV A;  2RQ6 A;  1Q3E A;  2KG7 B;  2K1E A;  3ML0 A;  1K8A W;  3A0B Z;  4DUZ B;  3CYO A;  3HKB B;  5BZB A;  4B3T O;  1TUB A;  4JV5 O;  4BW5 A;  3TJT A;  2X6A A;  1PV0 A;  4B7K A;  4EB6 B;  1VMG A;  1FD9 A;  4FM2 A;  1FFX B;  3JAL A;  4OGQ B;  3S3W A;  4TV9 B;  4FIP C;  4FVM A;  1AVM A;  1RPR A;  1WPX A;  4JPR A;  5BMV B;  1NZ6 A;  4X1I B;  4D7S A;  4IHJ B;  1ZUQ A;  3JAK A;  4LCU C;  4PDR A;  4PA4 A;  4JI1 B;  4CC5 A;  4DV3 B;  1ZX3 A;  5KAF Z;  4BAY A;  2ZM6 B;  3ZMV A;  1J5E O;  3AK3 A;  3OMA B;  4KP4 A;  4UV9 A;  1HNW B;  2P06 A;  1WNS A;  2WLM A;  2RN9 A;  1TUB B;  3GWO A;  4QNH B;  5EC2 C;  3SYQ A;  1YCI A;  1I94 B;  2CK3 G;  3RYC A;  1F4M A;  3E22 A;  1Y76 A;  3E8F A;  2QWO B;  2PUS A;  1I94 O;  2D2C B;  3B77 A;  2BCC H;  5B3S B;  4LF6 B;  4DW0 A;  3G71 V;  1HW7 A;  3UO3 A;  2JGU A;  5EZY B;  2BTQ B;  1FXH A;  1YHQ V;  3ABM C;  2JJ2 G;  4DR1 O;  1XL6 A;  5GON B;  3RWR D;  3SDL A;  5KUM A;  3W7W A;  4DR5 O;  1P7G A;  2HHH B;  1QLN A;  2OT5 A;  1UJW B;  4JI4 O;  1PL0 A;  1N34 B;  2UU9 O;  4H0L B;  4ZBM A;  2RDC A;  5B1O A;  1XNR B;  3E22 B;  2XAF A;  4PDV A;  1IDS A;  5KHK A;  4NXN O;  3M7M X;  2Q7E A;  3WU2 Z;  2ZE5 A;  1OCO C;  2EIJ B;  4CC6 A;  2ZR2 A;  1OJH A;  2Q4P A;  2ATK C;  3Q4H B;  4Z1V A;  2EBO A;  4MVO A;  5KA6 A;  4DK0 A;  4IIJ B;  3H01 A;  2P7T C;  1RM1 C;  3K58 A;  5IDJ A;  1OCZ C;  5FLX N;  3J81 N;  2AGA A;  3J7A U;  3K9S A;  4J11 A;  4IIJ A;  4KFM A;  1N32 O;  3C3T A;  4DV5 O;  1YI2 V;  5IYZ B;  3IC7 A;  2UXB B;  1GK9 A;  2HEP A;  1SZT A;  3FD9 A;  3QO5 A;  1Q43 A;  3E2E A;  2ZE6 A;  5IJ0 B;  4YXW G;  3CJH B;  1DLB A;  1FS0 G;  1Q8I A;  1AR4 A;  5KHH A;  1S72 V;  1WA8 A;  1VQ8 V;  3K5N A;  1XRE A;  3ZHT A;  4LF9 O;  2EIM B;  1U97 A;  3E8B A;  4Q20 A;  1IBL B;  4JI0 O;  2XUM A;  4LFC O;  3D3I A;  1D2D A;  2N05 A;  2PYJ A;  3OTO B;  4B3R B;  1NT2 B;  2DN9 A;  4JYB A;  3RYF B;  2KQX A;  2IH3 C;  1FKA O;  3A0R A;  3WG7 C;  4ABM A;  4UCS A;  2Y69 B;  3FB5 C;  3OD4 A;  1T5E A;  3LDE A;  1CEZ A;  3L71 H;  3SYO A;  3FYE B;  1DF5 A;  1YIJ V;  4DV7 B;  4GCZ A;  1Q90 D;  2IBZ H;  3OUF A;  1XDC A;  1KKD A;  4DR2 O;  2Q6A A;  3ABM B;  3HKD B;  2QM8 A;  1V9P A;  4DUY B;  1VQ4 V;  4A5U B;  1AI5 A;  4LF4 O;  4MW8 A;  5CBF A;  1IUR A;  3OUS A;  3X2Q C;  2AHZ A;  3N2G B;  5GW7 A;  2LFS A;  3ZMT A;  1OHH G;  4OX9 O;  1YZB A;  3DC5 A;  1VQO V;  3SR2 C;  2IJH A;  3CMA V;  4UB6 Z;  2ZNJ A;  3WB1 A;  1AB3 A;  1LR1 A;  2M6Y A;  2OIG A;  3LSU A;  5KLV H;  2HJD A;  4Z1M G;  2IW5 A;  1NR1 A;  4LFC B;  2UUA O;  1S0V A;  3JD0 A;  3VBB A;  5LMN B;  3AG4 B;  3STL C;  5AG2 A;  4GKK B;  4YHH O;  4UVC A;  4QIW F;  4EFB A;  5LL6 Y;  2KG7 A;  3ZRV A;  4CH3 A;  2PI4 A;  4FJC C;  1VQL V;  4XDK A;  1JJ2 U;  4I9W A;  2JGD A;  4KHP B;  1HP8 A;  3T1Y O;  4MW3 A;  3JD1 A;  2PI5 A;  3EFF K;  4TWK A;  2OCH A;  1V55 B;  1PM9 A;  2RCV A;  2KB1 A;  2WWW A;  3IC9 A;  3IGA C;  1IXB A;  1N8R W;  1AI4 A;  4F6E A;  1IBL O;  1Q6I A;  4TV8 A;  5B1A C;  3WB2 A;  5IY5 B;  2WLJ A;  2XAH A;  1Y74 B;  1K5Q A;  4E2L A;  3L70 H;  4U3F H;  4MTF A;  2N04 A;  1WAZ A;  5F2V O;  3ABU A;  3CJH A;  2CTW A;  2M7W A;  2N74 A;  1N34 O;  3FX7 A;  3U11 A;  1IBM O;  2ODM A;  1HNX B;  3VOU A;  2HHH O;  3ABL B;  4RQF A;  3BAA A;  3L9D A;  1VQK V;  4UVA A;  1R6N A;  4I7Z B;  5K1P A;  3H1H H;  1HR0 O;  1Y66 A;  2QDO A;  3CPW U;  4UUJ C;  3HKD A;  4QPJ A;  4OPH A;  4RQE A;  2JK5 C;  3ETG A;  3GWK C;  2B9Z A;  5JQG A;  4LFA O;  2UUC O;  2Q7G A;  2P5O A;  1JQ0 A;  1VP7 A;  2VQF B;  1DGS A;  4LF8 B;  4I9Q A;  1XOU A;  2GSM B;  2JS5 A;  1S5H C;  3SJA C;  2GBO A;  4PD4 F;  4J7J A;  3QF7 A;  4JAV A;  3HKC A;  4CH4 A;  5E1A C;  2MK3 A;  4WBN A;  3U10 A;  2UXN A;  2NLJ C;  3P30 A;  1VQM V;  1QLE C;  1MAB G;  2F66 C;  3CXH F;  3HKC B;  1EN4 A;  4NXN B;  3ZHS A;  2UUB B;  4EEQ A;  3OE7 G;  2HG5 C;  1NVP B;  1P84 F;  3JD2 A;  2DYR C;  4TT3 G;  3AG7 A;  3T1H B;  2A9H A;  2IH1 C;  2PYL A;  3K59 A;  4DV0 B;  4QGP A;  4MVU A;  1ZLZ A;  2LGQ A;  4ZI7 A;  1HDJ A;  4X1Y B;  3OEE G;  5D5P A;  2Q8V A;  2QTO A;  1A32 A;  1VIB A;  1QU7 A;  4PA6 A;  1YVW A;  4ZI7 B;  1R6T A;  1XL4 A;  4FLY A;  4JI1 O;  2YXL A;  5CB4 A;  5LHH A;  3QVN A;  4LF7 O;  3MD0 A;  4B3T B;  2HJF C;  5H5N A;  2QWQ B;  4IHJ A;  4DUZ O;  1K97 A;  3TXQ A;  2DYS C;  3F5T A;  1V55 C;  3E8H A;  3FKS G;  2EZO A;  2R9I A;  2YEV B;  5JWP A;  4NXM B;  3Q4H A;  4H44 B;  3BEH A;  2ZXW C;  3BFR A;  2F23 A;  3ZHU A;  5CA3 A;  1Q7Y W;  3OFN G;  2EIK B;  1H38 A;  1QQC A;  4L87 A;  3J80 N;  4DV5 B;  3RYC B;  3BAB A;  1W0K G;  3ZED A;  4UFZ A;  3RT3 C;  2QJ1 A;  1X4T A;  1W0J G;  4FZ0 A;  1GN2 A;  3L72 H;  5C8Y B;  1JFF B;  3SGI A;  1Y74 A;  4NR1 A;  3APQ A;  5FPO A;  2HVK C;  1FXK A;  4GX0 A;  5LHI A;  2NR5 A;  2UXC B;  4ZKI A;  3AK2 A;  5LP6 B;  2CGN A;  4BW9 A;  4TUY A;  2WA3 A;  3M99 B;  1MMM A;  3ETQ A;  4PI2 A;  3A0H Z;  2VS0 A;  2QE7 G;  4KUM A;  3B8N A;  3UM7 A;  1DTO A;  1XMO B;  1M56 B;  5GTI Z;  3MDS A;  1AIL A;  1TVK A;  1F4N A;  3K79 A;  4WBN B;  1UPG A;  2PY5 A;  1XNR O;  1G6U A;  3PN1 A;  3ABK B;  2H94 A;  3K08 A;  3M8A A;  3FAV B;  5BY1 A;  2HKO A;  1F7Y A;  1JVM A;  2WAM A;  1Z5V A;  3D36 C;  4FFB A;  1M4U A;  2YC0 A;  4I0X A;  4JZG A;  2LJ2 A;  3JAR B;  2E3C A;  3FFQ A;  2YIA A;  2GV9 A;  3CP1 A;  4MVS A;  1YJN V;  3SYC A;  4LWS B;  2R72 A;  2YIB D;  1J95 A;  3K3W A;  2CH7 B;  1GAX A;  2V7Q G;  3N2G A;  3R65 A;  4TUY B;  1Z2G A;  5KA5 A;  3EXA A;  1KUQ A;  3C90 A;  3CME V;  5EIB D;  1WPB A;  3THO A;  5E79 Z;  3DXR B;  1YIT V;  4GLX A;  2DOS A;  3B2E E;  2GDS A;  5B1B B;  3I5D A;  2Q9L A;  4F4L A;  3VQX A;  3KKY A;  3ZRW B;  1XUQ A;  5J2T B;  3CE2 A;  3IJ4 A;  3QG5 A;  3CD6 V;  2XHB A;  2P90 A;  2JEX A;  1OCR B;  2F4V O;  3BY6 A;  3BA8 A;  1RM1 B;  4WF9 V;  2QTS A;  4MVR A;  2AW9 A;  2FTK A;  2XAQ A;  5L3E A;  5ITZ B;  2GHY A;  4JI2 B;  3AG2 C;  2ZCE A;  1VQ7 V;  3OR7 C;  4DR6 O;  5IYD O;  2ZIM A;  3AG1 B;  3RW0 A;  1AP5 A;  2EIK C;  5L3F A;  1FXK B;  2EIM C;  1ROP A;  4LFA B;  2ZE8 A;  4JI6 B;  4AI8 A;  2QKA A;  4J42 A;  5FL7 G;  3HPL C;  3ASO B;  4X9Q A;  1ZL8 A;  3ETD A;  2QM4 A;  4HNA B;  4DO2 A;  1S3J A;  5HFL A;  1JX9 A;  5LP6 C;  2WLL A;  1K33 A;  4BR6 A;  1XNQ O;  1AI6 A;  4JI5 O;  2Y69 C;  2VQE O;  1IX9 A;  1ZAU A;  2WLL B;  2NNU A;  2RNB A;  4DV2 O;  3S3X A;  4LP8 A;  4JYY A;  3JAW B;  3E89 A;  3VQV A;  2JJ1 G;  4YY3 B;  3B4S A;  2FB5 A;  4LF8 O;  1NI8 A;  2QSA A;  3DTU B;  3UKM A;  1GRJ A;  5K1X A;  1VQ6 V;  1K92 A;  1YEW A;  2JRI A;  1PD3 A;  1R1B A;  3VQY A;  1L1F A;  4DV6 O;  3TXS A;  4GX5 A;  4WCE V;  3OM3 B;  1Y6X A;  1Q6U A;  1HNX O;  3FYI B;  4N21 A;  5DN6 G;  1SET A;  2ITC C;  3DSQ A;  1QVF U;  4GKJ B;  2UUC B;  4O2A B;  1PPJ H;  2YID A;  3F5W C;  2CE4 A;  4JYC A;  2ADP A;  1MG1 A;  2NN4 A;  2LW1 A;  5IWA O;  3OAA G;  3EVK A;  1XI1 A;  2IJK A;  4TQF A;  3N2K B;  3AG3 C;  3OR6 C;  2ZDI A;  3TCU A;  1N36 B;  1D5N A;  4X1K A;  1H8H G;  1SQV H;  1FYJ A;  1AR1 B;  1NJI W;  2QWR B;  1FXV A;  1OCO B;  5KHI A;  1P4R A;  1N36 O;  2JEU A;  4BWA A;  3W7X A;  3CRR A;  3RFR A;  4O2A A;  4LFB O;  3CCS V;  2WA4 A;  5CBG A;  3ZRW A;  3E35 A;  4B3S B;  2Q73 A;  5IWA B;  5EK0 A;  4O2B A;  2DQ3 A;  1IBK B;  4O4L A;  3T1Y B;  1ZL8 B;  3OGC C;  1PKX A;  2XAG A;  1QR8 A;  4JI6 O;  4RUE A;  4JGS A;  1OZ0 A;  4JI8 O;  1XNQ B;  4JI4 B;  3CHX A;  2GTA A;  3W7U A;  1BCC H;  4B3R O;  1S77 D;  3DC6 A;  4EB6 A;  1E1Q G;  4UCR A;  4U7O A;  3HB3 B;  1BL8 A;  3ZRX A;  2A3Q A;  2HFE C;  4OPA A;  1IVS A;  3NXS A;  2DYR B;  1FPO A;  3ABK C;  1MSD A;  2YI9 A;  4B3M O;  4LNU B;  4K35 A;  1G1X B;  2KSD A;  2OCC B;  3TGU H;  1V54 B;  4ASU G;  3CCV V;  3G4S V;  3RGB A;  4IYH A;  1JPX A;  1XIL A;  2AZ0 A;  1Q6H A;  1SER A;  1IBK O;  4GZR B;  1M57 C;  1AP6 A;  1RFY A;  2ZDI C;  1O9H A;  5A2Q N;  4MTG A;  1MA1 A;  5JH7 A;  4Z2W A;  1WB7 A;  3JAL B;  1B3Q A;  1J5E B;  1RSO B;  2E5L B;  3E83 A;  5D5Q A;  3ZHV A;  1N0J A;  2FL4 A;  4DV3 O;  3P3P A;  2VWK A;  2BE3 A;  3FB6 C;  2PGG A;  4LF9 B;  4UCO A;  2IJJ A;  2Y48 A;  3TK1 A;  2A79 B;  1V54 C;  3JD4 A;  2Q69 A;  2LQT A;  2E74 B;  4JAA A;  4RAI A;  3JAS A;  4BIU A;  1PNL A;  5BR8 O;  2ZKO A;  4W4K A;  4ZOL B;  4DR3 O;  1XHX A;  3CSX A;  5B66 Z;  5KUK A;  2Z3Y A;  1R6K A;  3STZ C;  1I0H A;  4R50 A;  4J80 A;  5KHJ A;  2BOC C;  4DRX B;  1XHZ A;  1NKD A;  4CS3 A;  5LHG A;  5CA0 B;  5LYJ B;  4P2Z A;  5B1A B;  1M90 W;  3AG2 B;  4GT1 A;  4PA9 A;  5IJ0 A;  1FAF A;  2EIL B;  4JI7 B;  1JMK C;  4O4J A;  1H2S B;  5LYJ A;  2D3O W;  1LUW A;  4K3A A;  2HP8 A;  3BRC A;  3CCU V;  2HLD G;  5LXT A;  1NTZ H;  5FNV B;  4DK1 A;  4B08 A;  4D7T A;  4XDL A;  3SPH A;  3ASO C;  4RWU A;  5JCO C;  1PP9 H;  2YSU B;  3G67 A;  2PF4 E;  3LUT B;  1SS3 A;  5LOV B;  1TUE B;  1VAR A;  2VQE B;  4QE9 A;  3MAQ A;  1BSM A;  4IGG A;  2RMK B;  5DM6 V;  3H1L H;  1TVK B;  4PEL A;  4PDL A;  4QJF B;  1MNG A;  1SA0 B;  1E79 G;  2BOB C;  2ZQM A;  1Y76 B;  4JI3 B;  1B06 A;  5JVD A;  4UCT A;  1MSW D;  2DJV A;  4QPK A;  4ICG A;  3T1C A;  4TQD A;  1XMQ O;  1I5Y A;  1IXM A;  1VQ9 V;  2ZR3 A;  5JQG B;  1HWY A;  1Z5W A;  4I55 B;  4P30 A;  4GX2 A;  1PNM A;  3T1H O;  4WFE A;  2EIJ C;  3T4D A;  2DE0 X;  1BGY H;  1R3K C;  2P4V A;  2UUB O;  2A7W A;  4G27 B;  3E86 A;  4I4T A;  4LF5 O;  4FLW A;  1BT8 A;  1Q5O A;  3TET A;  1GN3 A;  2Q7H A;  3X2Q B;  3UO2 A;  1OCZ B;  2F95 B;  2WPD G;  4I4T B;  2ZM6 O;  2CUG A;  2XAS A;  2K9P A;  2EZP A;  2B5U A;  2E76 B;  1KYO F;  3JCU Z;  5LGN A;  1Q81 W;  5J2U A;  3O65 A;  2CTQ A;  4LF7 B;  1SKV A;  1R73 A;  3AK1 A;  3CCL V;  2XTA A;  3CX5 F;  2R9R B;  4R8C A;  5IJ9 B;  5JJE B;  1GKF A;  3ZCC A;  2ZIN A;  3HKE A;  5FNV A;  3K5M A;  1L0L H;  3K9A A;  2W0X A;  4FLT A;  3JAM N;  4G28 B;  2YIC A;  4O4I B;  3I55 V;  3CXC U;  1K3E A;  3GB7 C;  2Y0P A;  5B5E Z;  4UB8 Z;  2JDI G;  1ZTE A;  1SQX H;  4H37 A;  4J10 A;  4WFH A;  4DXW A;  1KKC A;  2IJI A;  1NTK H;  3BA9 A;  4DV4 O;  2R9A A;  1M9N A;  4O2B B;  4K0K B;  1SZX A;  2MW2 B;  4O4L B;  4WFG A;  3HKB A;  1XMO O;  2YEV A;  1NH2 B;  4YIP A;  3K06 A;  1LUV A;  1OV9 A;  1GM7 A;  1KBH A;  2UXC O;  5KMG B;  4YJ2 A;  4JYA B;  1EZJ A;  1M56 C;  5LBQ A;  3D8C A;  2Z5U A;  1H2K A;  1VF6 A;  3L74 H;  1K34 A;  2OCC C;  5L3D A;  1GM8 A;  1SF9 A;  5LOV A;  2A0L A;  1QR9 A;  4U7N A;  1Y4M A;  1EBO A;  1GH6 A;  2QKC A;  1YJW V;  4J7Z A;  3SPG A;  5H2F Z;  5IYZ A;  4JF3 A;  4PV1 B;  3L75 H;  2WLN A;  5JVD B;  1SC5 B;  1VF7 A;  1WN7 A;  2RJZ A;  4DR4 B;  4YJ2 B;  5KMG A;  2X0L A;  2HVJ C;  2W6I G;  3RVY A;  5LGT A;  3H1J H;  1OCC C;  1WLE A;  2Y0I A;  3SPJ A;  1R3I C;  2YS8 A;  4TV8 B;  4X1Y A;  4DR3 B;  1SQF A;  2OIE A;  2UUA B;  4HZ3 A;  1CPY A;  3SYP A;  2YI8 A;  4BIZ A;  2GTS A;  2X6C A;  2Y4T A;  4CS4 A;  4CBC A;  2ZT9 B;  4U3J B;  3HKE B;  4DV2 B;  2OTJ V;  3LNM B;  4EKW A;  2KKW A;  4OXS A;  5KAI Z;  5KX5 B;  4DR7 O;  2EJR A;  4B3M B;  3RYI B;  3C3S A;  3K03 A;  3LDD A;  1G8M A;  4NVP A;  4X65 B;  1QVG U;  4HYO A;  4X65 O;  4BIO A;  5CN0 A;  4DR7 B;  4X8A A;  4R7C A;  2P4K A;  3CRM A;  1B6Q A;  4X1I A;  2ILM A;  1SQP H;  4P9O A;  1H2G A;  5EYP A;  3BPZ A;  2CTR A;  4I55 A;  3SJQ C;  2W0F C;  4WFF A;  3D3Q A;  5ITZ A;  2OYQ A;  3OT7 A;  3KG2 A;  4XDJ A;  2F1M A;  3W7T A;  2UXD B;  3RVZ A;  1HR0 B;  5CBH A;  1BZK A;  2X7R B;  3KCY A;  4CS2 A;  1N33 B;  4DR2 B;  4X62 O;  1FXK C;  2JIZ G;  1I5X A;  2OTL V;  1SQB H;  4LH7 A;  2H3O A;  2QGN A;  4FLX A;  1FJG B;  1XEQ A;  2H8P C;  1K4C C;  3IFX A;  4NTW A;  5IYB O;  1ZWI C;  4FMT A;  4JTD B;  1S76 D;  1WA8 B;  1YSC A;  3BCC H;  2LW7 A;  3CC7 V;  2DWE C;  3WB0 A;  4MTO A;  5FPR A;  3SJB C;  1ORQ C;  4R6Z A;  1TAE A;  4NKG B;  3ZMS A;  1VEW A;  2ZNI A;  1NS1 A;  2LFR A;  4X64 B;  1PL4 A;  3B09 A;  1Y67 A;  2JS3 A;  2ETN A;  3AG3 B;  1NQT A;  4RO2 A;  2PTM A;  3RN4 A;  2EX3 A;  3APO A;  4YIO A;  1SA0 A;  1U96 A;  4TOI A;  5HFM A;  4J9Z B;  2XAJ A;  3SPC A;  1N33 O;  1P49 A;  4YHH B;  4GKK O;  2DW4 A;  1KP3 A;  2Z0A A;  3G80 A;  3O9O A;  4J9Y B;  3A2F A;  4MTX A;  3JAK B;  1QBZ A;  1N32 B;  3G6B A;  2A06 H;  2P67 A;  3F7V C;  2FKX A;  1CXZ B;  4W4L A;  3AG4 C;  3KZI Z;  3LNN A;  5LP6 A;  1KQS U;  3CS5 A;  4JTA B;  4DR1 B;  1B04 A;  5LXT B;  4X20 A;  3CRA A;  2OWO A;  4IL6 Z;  3ABL C;  1VQN V;  4PDM A;  2CGO A;  4B7E A;  2AZ2 A;  1UFI A;  3JAT B;  2ZE7 A;  4LF5 B;  1W59 A;  4YY3 O;  4K0K O;  1JR9 A;  5J2U B;  2XND G;  1NU1 H;  2DYS B;  3G6E V;  1N0N A;  4ZHQ B;  3ZN0 A;  1E1R G;  3ABT A;  1H2M A;  2BSK B;  3CRQ A;  4LWS A;  4FZ1 A;  4DR5 B;  2ITD C;  2HR3 A;  2W6J G;  3T2M A;  1TA8 A;  4I5S A;  4ZHQ A;  1YDX A;  3OTO O;  3ICX A;  5GON A;  3CWB H;  3CCQ V;  3K57 A;  5CB4 B;  2DQ0 A;  3H1I H;  3K5L A;  1S5J A;  4H13 B;  1JCH A;  1H2N A;  3ASN B;  2F4V B;  4KXR A;  5B3S C;  5CMU A;  4PA3 A;  3CCM V;  1M1K W;  1XMQ B;  2CAZ C;  4DR4 O;  4D6T H;  4JI2 O; 
#chains in the Genus database with same CATH homology
 1LNQ A;  2DYS C;  1TUE B;  4QE9 A;  1V55 C;  2K1E A;  3E8H A;  3FKS G;  3ML0 A;  2EZO A;  1K8A W;  2R9I A;  2YEV B;  3JD3 A;  3CYO A;  4XBF A;  3K04 A;  3T4Z A;  5BZB A;  3BEH A;  2ZXW C;  5DM6 V;  3AEI A;  4BW5 A;  4PEL A;  2X6A A;  4PDL A;  5CA3 A;  1Q7Y W;  3OFN G;  4QJF B;  2EIK B;  1H38 A;  1E79 G;  2BOB C;  4L87 A;  3QO7 A;  2ZQM A;  3B8M A;  1W0K G;  1MSW D;  4QPK A;  3F7Y C;  1W0J G;  4FIP C;  1H8E G;  3FB8 C;  3T1C A;  2XOK G;  1RPR A;  1WPX A;  4JPR A;  1SES A;  5LHI A;  2HVK C;  1FXK A;  1I5Y A;  1IXM A;  4GX0 A;  1VQ9 V;  4X89 A;  2ZR3 A;  4LCU C;  1HWY A;  4PDR A;  4PA4 A;  4LC1 A;  1R3J C;  4ZKI A;  4P30 A;  1OCR C;  3WFV A;  4GX2 A;  1PNM A;  3M99 B;  4BAY A;  4WFE A;  2EIJ C;  3T4D A;  3ZMV A;  1R3K C;  4JAU A;  2EIL C;  3CC4 V;  3OMA B;  2QE7 G;  4KP4 A;  4G27 B;  4KUM A;  4MVQ A;  4UV9 A;  3E86 A;  1GO3 F;  3B8N A;  4UVB A;  1DTO A;  3UM7 A;  2ZD9 A;  1M56 B;  1G4Y B;  5L3G A;  1K5S A;  4FPP A;  2WLM A;  1F4N A;  3TET A;  3K79 A;  3GWO A;  3X2Q B;  4QNH B;  5EC2 C;  3SYQ A;  2WLK A;  1OCZ B;  2WPD G;  2CK3 G;  3ABK B;  2H94 A;  3K08 A;  1F4M A;  2IU0 A;  2HKO A;  2XAS A;  2EZP A;  1JVM A;  3E8F A;  2WAM A;  3QO8 A;  3ZRS A;  1COW G;  2B5U A;  3B77 A;  5LGN A;  1Q81 W;  2EIN B;  5B3S B;  3K0D A;  3OMI B;  3CP1 A;  4MVS A;  4CZZ A;  1YJN V;  3SYC A;  1R73 A;  3G71 V;  3CCL V;  1QCE A;  3WG7 B;  1J95 A;  3K3W A;  2V7Q G;  2QM7 A;  3R65 A;  2R9R B;  5KA5 A;  4R8C A;  1FXH A;  3RBZ A;  1GKF A;  1YHQ V;  3ZCC A;  3ABM C;  3CME V;  2JJ2 G;  3EHB B;  1XL6 A;  3K9A A;  4HAM A;  5KUM A;  4G28 B;  4MSW C;  3W7W A;  3I55 V;  3CXC U;  1K3E A;  1QLN A;  2OT5 A;  3GB7 C;  1UJW B;  1PL0 A;  1YIT V;  4H37 A;  2JDI G;  4ZBM A;  4WFH A;  4DXW A;  5B1O A;  2IJI A;  3CC2 V;  4JTC B;  5B1B B;  2XAF A;  4PDV A;  3DGE A;  4F4L A;  1M9N A;  3ZRW B;  5H6R A;  1OCO C;  2EIJ B;  3CD6 V;  4WFG A;  2P90 A;  2JEX A;  2ZR2 A;  1OCR B;  2YEV A;  3MHS C;  1QLE B;  1NH2 B;  3CCE V;  3BY6 A;  3K06 A;  1RM1 B;  2ATK C;  4WF9 V;  4MVR A;  2EBO A;  5H6Q A;  4MVO A;  5KA6 A;  2FTK A;  2XAQ A;  1GM7 A;  2IU3 A;  1BMF G;  5L3E A;  3H01 A;  1EZJ A;  1M56 C;  2B1I A;  2GHY A;  2P7T C;  5LBQ A;  3AG2 C;  2Z5U A;  1VQ7 V;  3OR7 C;  5IYC O;  1RM1 C;  5IDJ A;  1K34 A;  1OCZ C;  2OCC C;  1K73 W;  5IYD O;  5L3D A;  1GM8 A;  3AG1 B;  1OCC B;  3RW0 A;  2EIK C;  2A0L A;  1QR9 A;  1FXK B;  2EIM C;  5L3F A;  1ROP A;  4KFM A;  4U7N A;  1YI2 V;  3ZN1 A;  1Y4M A;  1EBO A;  1M57 B;  3IC7 A;  5FL7 G;  1YTF B;  1GK9 A;  3HPL C;  1YJW V;  3QNE A;  1SZT A;  1THZ A;  3ASO B;  1K4D C;  3QO5 A;  2WSS G;  3ETD A;  3E2E A;  4DO2 A;  1S3J A;  5HFL A;  1JX9 A;  1BHB A;  3SPG A;  1KD1 W;  1NH2 D;  2WLL A;  1KEC A;  4JF3 A;  4TSF G;  2Q67 A;  4MVZ A;  3ZJZ A;  1K33 A;  4YXW G;  2WLN A;  1AI6 A;  2Y69 C;  1DLB A;  1FS0 G;  1AI7 A;  2WLL B;  2NNU A;  1SRY A;  3LSS A;  4LP8 A;  4WFA V;  1S72 V;  3E89 A;  1VQ8 V;  1EFR G;  2JJ1 G;  2X0L A;  3P32 A;  2HVJ C;  3OEH G;  2QKS A;  2W6I G;  1K9M W;  3RVY A;  2EIM B;  5LGT A;  1OCC C;  1WLE A;  3E8B A;  3SPJ A;  4Q20 A;  1R3I C;  3DTU B;  3UKM A;  1VQ6 V;  1K92 A;  4HZ3 A;  3D3I A;  1CPY A;  4MS2 A;  4RUF A;  3SYP A;  3JCZ A;  1PD3 A;  3I56 V;  4BIZ A;  2X6C A;  1L1F A;  1K7D A;  4JYB A;  4GX5 A;  4WCE V;  3OM3 B;  4CBC A;  2QA4 V;  2WLI A;  2IH3 C;  3A0R A;  3WG7 C;  3FYI B;  4N21 A;  5DN6 G;  2OTJ V;  2Y69 B;  3FB5 C;  1SET A;  2ITC C;  3LNM B;  4EKW A;  1QVF U;  2P6J A;  4OXS A;  3LDE A;  1CEZ A;  3SYO A;  3SYA A;  3FYE B;  3F5W C;  1DF5 A;  1YIJ V;  2EJR A;  4JYC A;  4GCZ A;  1PNK A;  3OUF A;  1KKD A;  3LSQ A;  2Q6A A;  3ABM B;  1MG1 A;  3K03 A;  3LDD A;  1G8M A;  1GTO A;  1QVG U;  2QM8 A;  1NR7 A;  4HYO A;  1ENV A;  1VQ4 V;  3OAA G;  1AI5 A;  4MW8 A;  2IJK A;  4N23 A;  5CN0 A;  5CBF A;  1P7B A;  4X8A A;  3AG3 C;  3OUS A;  4R7C A;  3X2Q C;  3OR6 C;  2AHZ A;  1B6Q A;  5GW7 A;  2ZDI A;  2LFS A;  3TCU A;  3ZMT A;  1OHH G;  3W7S A;  1H8H G;  1H2G A;  4P9O A;  5EBL C;  1DF4 A;  3SJQ C;  1VQO V;  3K0G A;  2IJH A;  3CMA V;  2W0F C;  4WFF A;  1AR1 B;  1NJI W;  1R3L C;  1JOY A;  1FXV A;  1OCO B;  1P4R A;  2JEU A;  4Z1M G;  2IW5 A;  1NR1 A;  4UV8 A;  5L3B A;  3W7X A;  1Q86 W;  1W2B U;  3KG2 A;  4XDJ A;  3OMN B;  3CCS V;  1S0V A;  3JD0 A;  4QE7 A;  4GX1 A;  3VBB A;  3ZRW A;  5CBG A;  3E35 A;  3W7T A;  3AG4 B;  4JAS A;  3STL C;  3ZMZ A;  5EK0 A;  3RVZ A;  5CBH A;  2X7R B;  2LP7 A;  4UVC A;  1RPO A;  2DQ3 A;  4QIW F;  1FXK C;  2JIZ G;  1I5X A;  2AHY A;  3OGC C;  2OTL V;  1PKX A;  2XAG A;  1QR8 A;  3ZRV A;  3CCR V;  1VQP V;  2PI4 A;  4FJC C;  4RUE A;  4JGS A;  4XDK A;  1OZ0 A;  1VQL V;  1NVP D;  1JJ2 U;  1AJN A;  4I9W A;  5LGU A;  2H8P C;  1K4C C;  3IFX A;  3W7U A;  4MW3 A;  1ZWI C;  3JD1 A;  5B1N A;  3EFF K;  4FMT A;  3JYC A;  4JTD B;  4TWK A;  5IYB O;  1V55 B;  3ZMU A;  1S76 D;  2DWD C;  2KB1 A;  1YSC A;  1S77 D;  1E1Q G;  2WWW A;  3CC7 V;  1AJP A;  2DWE C;  3D36 A;  4MTO A;  3IGA C;  4U7O A;  3PJS K;  2EIN C;  1ORQ C;  1N8R W;  1AI4 A;  4R6Z A;  3ZMS A;  3HB3 B;  1BL8 A;  4WFB V;  3ZRX A;  2HFE C;  5B1A C;  3NXS A;  1NBM G;  2DYR B;  5IY5 B;  2LFR A;  2WLJ A;  2XAH A;  5L3C A;  4P9P A;  4H33 A;  1K5Q A;  3ABK C;  4E2L A;  2Q68 A;  4MTF A;  3AG3 B;  1NQT A;  4RO2 A;  1VQ5 V;  3ABU A;  2OCC B;  5C93 A;  2M7W A;  1V54 B;  2WLI B;  3FB7 C;  5IY5 C;  1YTF D;  4ASU G;  3CCV V;  1KC8 W;  5HFM A;  3VOU A;  4J9Z B;  3G4S V;  3ABL B;  1JPX A;  4RQF A;  1VQK V;  2XAJ A;  1SER A;  4UVA A;  3SPC A;  1R6N A;  1M57 C;  2ZDI C;  3ASN C;  1Y66 A;  2DW4 A;  1KP3 A;  5EC1 C;  3CPW U;  4MTG A;  1Q82 W;  4UUJ C;  4QPJ A;  4J9Y B;  4RQE A;  1GMG A;  2JK5 C;  3ETG A;  4MTX A;  3E83 A;  1QBZ A;  3AG1 C;  1JQ0 A;  2ZXW B;  2P67 A;  3F7V C;  3AG4 C;  3FB6 C;  4MT8 A;  2GSM B;  1MOF A;  2IJJ A;  2Y48 A;  1S5H C;  3TK1 A;  1KQS U;  3MHH C;  4UXN A;  2A79 B;  1V54 C;  3JD4 A;  2Q69 A;  5EBW C;  4JTA B;  4X88 A;  3ZIA G;  4JAV A;  4RAI A;  1ARO P;  3LDC A;  4BIU A;  1PNL A;  2UXX A;  1VQN V;  3ABL C;  4LBE C;  5E1A C;  4PDM A;  2MK3 A;  1KP2 A;  5KUK A;  2Z3Y A;  2UXN A;  2NLJ C;  3P30 A;  1R6K A;  1QLE C;  1MAB G;  3STZ C;  3CCJ V;  1VQM V;  2B1G A;  1GM9 A;  2C2A A;  4R50 A;  2BOC C;  1NKD A;  5LHG A;  3OE7 G;  2HG5 C;  1NVP B;  2XND G;  5EBM C;  3ETE A;  3JD2 A;  2QEX V;  2DYS B;  2DYR C;  4TT3 G;  3G6E V;  4P2Z A;  5B1A B;  1M90 W;  3AG2 B;  3ZN0 A;  1E1R G;  4GT1 A;  4PA9 A;  2A9H A;  4MVM A;  2EIL B;  3ABT A;  2IH1 C;  4MVU A;  2ITD C;  1AJQ A;  2D3O W;  2HR3 A;  2W6J G;  2WLH A;  3T2M A;  5J9P C;  4I5S A;  1CP9 A;  1FFT B;  3OEE G;  3CCU V;  3OW2 U;  2HLD G;  2QTO A;  3CCQ V;  1BHA A;  2DQ0 A;  2X6B A;  2F43 G;  3SPI A;  1JCH A;  4PA6 A;  1F23 A;  3E8G A;  3ASN B;  4XDL A;  2PI5 A;  3SPH A;  3ASO C;  5H9C A;  4PA7 A;  1XL4 A;  2YSU B;  2V1D A;  5B3S C;  1F51 A;  5B1B C;  5CMU A;  4FK5 C;  5LHH A;  4PA3 A;  3MD0 A;  3CCM V;  4G2K A;  1M1K W;  2HJF C;  1YJ9 V;  1K97 A;  3LUT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...