3CYOA

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d and complementary mutation e137k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEKSQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Transmembrane protein
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 33
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cyoA00
4N21A 1F23A 4JPRA 2EBOA 1SZTA 2X7RB 3CYOA 4FIPC 3B8MA 2P6JA 1EBOA 2LP7A 3CP1A 3GWOA 4G2KA 1JPXA 2EZOA 5CN0A 4N23A 5HFLA 1Y66A 1I5XA 5KA5A 1JQ0A 3B8NA 1MG1A 1QR8A 4FJCC 5H9CA 4JGSA 1I5YA 3WFVA 3K9AA 2EZPA 1K33A 5CMUA 1K34A 1QBZA 2M7WA 3MHSC 4JF3A 3M99B 2OT5A 3B77A 1DLBA 1Y4MA 3P30A 4E2LA 1ENVA 3H01A 1QCEA 1DF4A 1DF5A 5KA6A 5HFMA 4FK5C 2MK3A 1MOFA 1QR9A 3MHHC
chains in the Genus database with same CATH superfamily
1GK9A 1FJGB 1WP7A 4DK1A 3CRQA 3N2KB 5J9PC 1B6QA 1KKCA 1G4YB 4KP4A 4LFAO 3UT5A 4CS4A 4QGPA 1W2BU 4I0XA 3CC4V 1EFRG 2YXHA 3JD1A 1VQLV 4NXNO 5LP6C 3AEIA 2PI4A 4K8ZA 3B40A 2WLMA 1Z5WA 1D2DA 4RWUA 3AG2B 4B3RB 1N0NA 2KKWA 4FIPC 2UXBO 5CBFA 5KHGA 4JYYA 3IFXA 5LXTA 2RMKB 1VQKV 2PUSA 2CH7B 4B08A 4FLXA 3RT3C 3RVYA 4YHHO 1U96A 1VQ9V 4C7UA 4KL1A 4W4KA 1VQ5V 2EIJB 3CCMV 2AZ0A 3I55V 5CB4A 3E89A 3GWOA 1GH6A 2WLLA 1YIJV 3ZHQA 3HPLC 1BS3A 2F93B 2UUBB 4B3SB 3QNEA 3K5LA 4FK5C 1P7BA 1JFFA 1EN6A 3ZMVA 1B04A 3S3WA 3FKSG 4JV5B 1YZBA 2B1IA 4JGSA 4UV8A 2IH1C 3A0BZ 2GBOA 4JYBA 3ABTA 2OCHA 1ENVA 5EBLC 5LA6B 2MK3A 3QTCA 3JD0A 1H8EG 4HNAB 2Y4UA 3STZC 1NH2D 4LF4B 1CPYA 2LO1A 3KZIZ 2X6BA 1CP9A 3O65A 1Y76B 5CN0A 1GAXA 3K9SA 5L3CA 2P4KA 2GDSA 3VQVA 4X64O 2VQFB 3G67A 2ZE8A 1NVPD 4X66B 2ZNIA 2RNBA 1V9PA 1QQCA 1Q3EA 4X65B 2LFRA 2AGAA 4KFMA 1SETA 1ZSPA 1LR1A 1BGYH 2KQXA 4PDRA 1N32O 2BOCC 4JI3B 2WAMA 1L0NH 3AK1A 2LGWA 3G6EV 1TGOA 1M93A 5B1BB 1WB7A 4J42A 5L3EA 1N4CA 4DR3O 4IL6Z 1Q81W 5EYPA 2HJDA 5B1AC 4DV0B 1YITV 1RSOB 4ZHQB 1EM1A 4WFGA 2BSKB 3GWKC 3HKEB 4F6RB 2N04A 2HJFC 1HNXB 1JQ0A 2KG7A 5IDJA 1YSCA 4DV6B 1QBZA 1N8RW 3F5TA 1OCCC 2K9PA 2EINC 1M57B 1U97A 2Q4PA 2FL4A 2DYRC 3AG3B 1K5QA 3ZN0A 4LF8O 3G4SV 2WA4A 2JIZG 1SQFA 4IT5A 2VRZA 4QPJA 3OGCC 1Y74A 5D5QA 3ZMSA 1Y74B 4LFBO 4JZGA 4DUYO 1QHTA 4LC1A 1FKAO 1PV0A 2ZINA 3B8MA 2JEXA 1DK1A 4O4JB 2JDIG 2A79B 3N27A 3ZEDA 4GX5A 1KB9F 2CGOA 1PNMA 4OX9O 2EULA 5JQGA 4JI7B 2EZPA 2NN4A 5BZBA 3K5OA 1F7YA 2ZDIA 2QE7G 1O9GA 2QM8A 1DGSA 1VQ4V 2EX3A 3WU2Z 1G1XB 4I4TA 3H1IH 2LQTA 1MSDA 2DOSA 4FLYA 3X2QC 3T1YO 1IBKO 1ZX3A 2Y48A 5BMVA 2QR4A 3SJQC 2CTPA 3BABA 4UB8Z 3GVMA 3QO8A 4JI6B 3APOA 3E8BA 5KHKA 3P30A 3BFRA 1Q43A 5KAFZ 3LDDA 2GTAA 4PA3A 4MTGA 5KAIZ 1VQPV 3OGIB 1PL4A 1WP8A 3DC5A 1P49A 1Z2GA 3QG5A 1EZVH 1R73A 3FAVB 5JCOA 5JWPA 3OTOO 1N32B 2IJHA 5FNVA 3JASA 1I94O 4JAUA 3RVZA 1ORQC 1S76D 3IAYA 1G6UA 4AILC 1IBMO 1YVWA 2N05A 5JH7A 5IWAO 5IJ9B 3FX7A 2YXLA 3ABKC 1XNRB 1KUQA 5TISZ 2OWOA 1N36O 3JALA 3SYAA 2EBOA 2CE4A 2FTKA 3J80N 3U10A 5J2UA 4MVMA 2NNUA 1GN2A 1SQVH 4GKKB 1IBLB 1JMKC 2E5LO 3BCCH 4LCUC 3U11A 2W0XA 4FZ0A 5GTIZ 5B1NA 2AW9A 2QDOA 1XNQO 4HZ3A 1OCRC 2NR5A 2QWPB 3K04A 1IX9A 4B7KA 3WG7C 4LF7B 4BW9A 4QPKA 1ZUQA 5KMGA 4LWSB 4JF3A 3H1JH 1B06A 4U3JB 3RYFA 2HVKC 3F7YC 1DF4A 1TUBA 2P7TC 4LF9O 3ZRSA 2WLIB 1JCHA 3A0RA 1SF9A 3BPZA 1X4TA 1FS0G 2UXCB 2ZE7A 1TUBB 5CA3A 2Y0PA 4X1IB 1GKFA 4PA4A 4W4LA 3TK1A 5EZYA 3CMAV 3CCRV 3JAWA 2PYLA 5IJ0A 1V55C 2DWEC 2IM9A 3LSQA 1DF5A 4PJ0Z 1WAZA 3JAWB 1US6A 3SR2C 1EN5A 3RYHA 1GN3A 1FFXA 5C93A 3CRAA 4MSWC 3H9VA 4MW8A 1THZA 4JYAB 2ITCC 5B1BC 1XREA 4DYLA 4DV7O 2WLJA 3CCEV 1YHQV 3ASOC 2CTWA 3E22A 2Q6AA 3OTFA 4DR2B 2R9AA 5BR8O 4LNUA 1T5EA 3VQYA 5H2FZ 4X1KA 3PN1A 4TV9B 3C3SA 2WSSG 3E22B 5B66Z 4LNUB 4ZOLA 1M57C 5EIBC 1M90W 2LW7A 4LF6O 3AG3C 1FXKA 3H1KH 4KXRA 4JI4B 4I55A 4GX0A 4B3TB 3CRCA 2JRIA 3CX5F 3H01A 1URFA 4RQFA 5FL7G 3T1CA 1R6NA 4DV4B 3D3QA 3BY6A 2P06A 2XAQA 1IVSA 4DR4B 1KYOF 4J7KA 1YJNV 3IGAC 4GCZA 5KA5A 2CAZC 1QR8A 3E2EA 5CBHA 4J9ZB 5JJJB 3CE2A 1VQNV 1PKXA 3QO7A 3D3IA 3PJSK 1RPOA 4YY3B 3B2EE 2F23A 3BA8A 2QTSA 4GUNA 5E1AC 2V1DA 1TA8A 4ZIBA 4JAAA 1S3JA 1BZKA 3EHBB 4OXSA 3ZN1A 3CCQV 2D3OW 2P22C 1XHZA 1NZ6A 3FB5C 2JGDA 4O2AB 3CCLV 3CCSV 3KCYA 2ZDIC 2ZE6A 5EC2C 4YJ2B 5B1OA 2X6CA 2RN9A 5EBWC 1XBLA 2DYSB 2ZM6O 1GM9A 1NQTA 1S5JA 2A9HA 1SQPH 4DUZB 2XHBA 2YS8A 1NJIW 5IYDO 1N33B 1I5YA 4NTWA 2BTQA 2ZR2A 3SPJA 1HNWO 4LR3A 2QJ1A 4UCSA 3ZS8C 2JGUA 2OT5A 3W7TA 2HLDG 4RQEA 2PYJA 4YXWG 3ABLB 1XL6A 4WCEV 1ROPA 2X7RB 4AHCA 4ABMA 2ZNJA 1SKVA 3LSUA 3JD2A 2P90A 3M8AA 3UCSC 5DECA 4LFCO 1KP2A 3ZRXA 1F51A 2R70A 4X88A 1Q6UA 3W7WA 5JCOC 2Y4TA 3N2KA 1AB3A 4BIUA 1QR9A 1V54C 4JASA 4PDVA 1FPOA 3SJBC 4CS2A 2CTRA 5CBGA 1H2LA 2XAFA 3IJ4A 4NR1A 5BR8B 3SYOA 2E74B 3WFVA 4FM1A 3BVOA 1ZWIC 2UU9O 2VQEO 1P7GA 2DN9A 1NH2B 4CH5A 4JI8B 4UCRA 4N21A 4CS3A 2YI8A 2CH7A 2LGQA 4B3MO 1SA0A 2Q9LA 2B1GA 1HR0O 2QKCA 3HKBB 5IYBO 1OCOB 3THOA 4JI5O 4MT8A 1M56B 1PD3A 2D2CB 1NVPB 1ZTEA 3ZJZA 1SA0B 4KHPO 2JEUA 2BE3A 1MSWD 2H3OA 4DV5B 1Q6IA 1H2MA 2YUAA 3K57A 2HHHO 1MZEA 5LYJB 1QLEB 4JI1B 3ETEA 5H5NA 4WF9V 3AK2A 1Q90D 3KCXA 4BIZA 3ICXA 4NB5A 4MVZA 1Q8IA 1FXVA 2L35A 3JSNA 1XMQO 2G38A 1AR4A 4LF5B 4I5SA 2XAHA 3LSSA 2ZQMA 3T1HB 1YEWA 4DV1O 2A3QA 1MABG 1ZL8B 5L3FA 3M7MX 4X1YB 4UCVA 2RCVA 2F4VO 1M9NA 2RJZA 4MVUA 5LA6A 2UUAB 1K33A 3K5MA 2IJIA 4HNAA 4GX1A 2ZM6B 1BT8A 1WNSA 5KUKA 4X62B 4ZBMA 3LUTB 3Q4HB 4IYHA 2QKSA 5ITZA 1Y76A 3G80A 1K97A 4JZ2A 5AG2A 3ASNB 3WB1A 4MTXA 4GLXA 2Q5ZA 2EIMC 3FYEB 3ML0A 3LNNA 5ITZB 3H1HH 1HNWB 2YIBD 4UVCA 4HYOA 4FJCC 1VARA 1AR5A 4J41A 4TUYB 1NTZH 3JD4A 3VQXA 4D7SA 4DV3B 2YI9A 4J11A 4K0KB 2FKXA 4FMTA 1L1FA 1QVFU 4OGQB 2WLKA 4ICGA 4PDMA 1N0JA 4GKJB 3JAMN 4NTYA 2UXXA 1RFYA 3KG2A 3HKDB 3B8NA 2X6AA 1GN4A 2EJRA 2OCCB 2UUCB 1VP7A 1FXKC 1YXBA 1WA8B 1RSOA 4ZHQA 1YF2A 1Y6XA 1R6TA 2BSKA 4TT3G 3HKEA 4XBFA 4F6RA 5KLVH 4UV9A 3G6BA 4CBCA 4ZKIA 4G28B 3FFQA 1H2NA 4LFAB 2Q7HA 5IT9N 1F4NA 1YTFD 1VF5B 2FMLA 2QKAA 3TXSA 1VQ7V 5KUMA 2E76B 4J7JA 4NXNB 5L3BA 4FLUA 1UFIA 1NBMG 1TAEA 2XAJA 1QCEA 2UXBB 4QNHB 1HNZO 1KC8W 2UXDO 4JI5B 1COWG 1AR1B 4YHHB 2QSAA 4G2KA 2F66C 2B9ZA 2DYSC 3OE7G 3SYQA 1P4RA 5BXZA 2EIKC 4O4JA 1RM1C 2XNDG 4O4IB 1H8HG 1FAFA 3AK3A 1R3KC 5LMUO 4FZ1A 3SDLA 4QJFB 1OV9A 4J10A 1IXMA 4D7TA 3RW0A 2C2AA 5H9CA 5A9GA 3CD6V 1QNMA 1SQXH 2ZXWC 1YJWV 5LL6Y 3RGBA 2DQ3A 4MVQA 3E8GA 2QA4V 2VWJA 3OFNG 3A8TA 1H38A 3E83A 3EVKA 1QVGU 4GZRB 3CP1A 4DR5O 4QE7A 3STLC 1GO3F 1SQQH 3VBBA 3APQA 4DR6O 4JTCB 3CCVV 3ZHUA 3CRMA 1N34O 1D5AA 3C90A 4AQYO 2ETNA 3OEEG 3ZHRA 1H2GA 4R8CA 4O4HB 4X64B 3FAVA 2FB5A 5CA0B 1OCZB 2HKOA 1B3QA 5EBMC 4NXMO 3IC9A 4IIJB 1L0LH 1KECA 4R7CA 3B77A 3AG2C 2QWOB 1OHHG 4MVOA 4J80A 3JCZA 1XQ8A 1M56C 1M4UA 3DXRB 4KUMA 5IJ9A 1VQMV 4PV1B 4MVSA 1AILA 2EIJC 5KX5B 4DR3B 3FB6C 4JI0O 3OAAG 3L72H 4I9WA 2PTMA 5LHHA 1QLEC 1J5EO 2OIGA 3ZRWB 3RFRA 2DWDC 3ZBHA 4JYCA 1YDXA 1VIBA 2WLHA 2JS5A 3JD3A 4PA6A 1JJOA 4UVAA 3RYIB 3ABUA 3R65A 5JVDB 1AROP 2Y69B 1XMOO 1E1RG 5J2TB 3CMEV 1MNGA 2IH3C 1NS1A 4O2BB 2P4VA 4LF8B 3TGUH 1W0KG 4XDLA 1H2KA 4YIPA 3L70H 1HW7A 1IURA 1JJ2U 4MS2A 1W59A 3L75H 1IXBA 4LWSA 3BRCA 5LP6B 1JX9A 2F43G 4U3JA 4ASUG 4LFBB 3T4ZA 2WLIA 1OZ0A 3FYIB 5K1XA 2QEXV 4DUYB 1AI7A 1SC5B 1I08A 4TQFA 1D5NA 4DR1O 2R9IA 4X1IA 1XDCA 2F95B 1XI1A 2M6YA 3JCUZ 3LNMB 4OX9B 2W6IG 2CTQA 1WPXA 2Q73A 2Q69A 1DTOA 2V4DA 3FB8C 4WFEA 3N2GA 2GTSA 3W7SA 4YJ3B 4H44B 2QTOA 3E35A 4WFBV 4JAVA 1JA8A 4DV2O 2HVJC 3N2GB 2CDYA 3L9DA 3T4DA 2DW4A 4HAMA 3T1YB 3GB7C 1IBKB 2BTOA 3ZCCA 1WPBA 3HKCB 4P9OA 3VOUA 5GONB 5LMNO 2MW2B 2GUZB 5B3SB 1PM9A 3JARB 5FPRA 1NI8A 4TV9A 4WFFA 2YEVA 3MAQA 4DR7O 5KA6A 1VQ8V 3OEHG 2KSDA 1TVKB 2A0LA 3B4SA 2ZKOA 4IYIA 1SZTA 3MDSA 1AI6A 3RN4A 2YEVB 1LUVA 4CC5A 3P3NA 2W0FC 5LHGA 5LOVB 3K5NA 1SS3A 2ZIMA 3OTOB 1FJGO 1KBHA 1I94B 1QU7A 3OMAB 4U3FH 1AJQA 1K8AW 1AJNA 1Y4MA 1J95A 3SJAC 3OM3B 1IBMB 1MOFA 2W6JG 2UXNA 4EB6B 3OT7A 5IWAB 4B3RO 1SQGA 5GW7A 3P3PA 1XUQA 1PNLA 3K0DA 1AP5A 1KP3A 4QIWF 4U7OA 1N36B 3IC7A 3KKYA 4OPHA 4AI8A 1XMOB 3CJHB 1FD9A 3FD9A 1WB8A 2Q8VA 3TJTA 3SPGA 1VF6A 1E79G 3BHPA 2HR3A 3BAAA 2E5LB 2PGGA 3F5WC 4TSFG 4O2AA 4B7EA 2GHYA 4R6ZA 4LP8A 5B1AB 1VEWA 4YJ2A 1PL0A 2HG5C 4FFKA 3UM7A 1XNQB 2Q7EA 1S0VA 2E75B 3L73H 3OUSA 5IY5B 4FM0A 1GM7A 3DSQA 1OCCB 1IZ3A 2AXTZ 4ZI7B 2UUBO 1MMMA 4B3SO 1I7FA 1HWYA 2IJKA 5C8YB 1KQSU 4IGGA 2WPDG 4NYKA 2FYUH 5E79Z 5BY1A 3W7UA 4EFBA 4LF9B 2H94A 4JV5O 1S77D 3ZMTA 1BSMA 4PA9A 5HFMA 1OCZC 2DQ0A 4Z1VA 3A2FA 4I50B 3OD4A 3WB2A 4BIOA 3D36A 3EXAA 1QLNA 3JATB 4LF4O 4H33A 2A7WA 2WA3A 1RP3B 2DMXA 4K3AA 3VQWA 3FB7C 3P32A 4L87A 4BAYA 3AG1B 1ZLZA 1M5IA 2VQFO 2GV9A 3DGEA 1KMIZ 5LMNB 4DV7B 2XUMA 1Q5OA 2YDEA 4X65O 3RYCA 4CZZA 3CCJV 4PA7A 2EJ7A 1H2SB 3CB2A 4O4LB 4MW3A 4WFAV 2R9RB 3X2QB 2OIEA 1PPJH 3RYCB 1K92A 2Q0OC 2NLJC 2ZIOA 2VS0A 3E8FA 2QWQB 3HKBA 4CH4A 1ZAUA 4WBNB 2IU3A 4LF6B 5KHHA 3LDEA 1SQBH 4DV0O 3L74H 4PD4F 2AHYA 4X89A 5LYJA 4UCTA 1MA1A 5LGTA 1HNXO 1DLBA 1UJWB 4DV6O 4JI2O 5JJEB 3AG4B 2JJ2G 3UT5B 4TWKA 3K0GA 2ATKC 4JPRA 4I0XB 5D5PA 1EBOA 2WLNA 3NR7A 4Q20A 1MZFA 3RBZA 3ZRVA 1ZL8A 4X1YA 5LXTB 2A06H 4DO2A 3I56V 5EK0A 5HFLA 3AG7A 2OTLV 2XT9A 1Q86W 1WLEA 3JSLA 1OJHA 2YIDA 2ZT9B 2CK3G 2WWWA 3ABKB 1YTFB 1AI4A 3Q4HA 1BL8A 5CB4B 1SERA 4JTAB 1EN4A 1L8DA 4TV8A 1KKDA 2WLLB 1A32A 4JI7O 1CEZA 2XASA 1YJ9V 3ETQA 2QWRB 2RQ6A 4TV8B 4TUYA 1F4MA 2P6JA 5B3SC 1NT2B 5GTHZ 1VF7A 4PELA 1OCRB 3K03A 2N74A 2Z5UA 3WB0A 3WG7B 4LBEC 2HFEC 1JFFB 3W7XA 1K73W 3CC7V 3M99B 3UQ8A 4U7NA 4UB6Z 2YICA 2YXYA 3HKDA 4JI6O 3A0HZ 1RPRA 1WA8A 2QGNA 1P84F 4LFCB 3U0ZA 4YIOA 1KD1W 3SPHA 4PHZA 2OYQA 3J81N 5EC1C 4BW5A 4TQDA 2ILMA 3MHHC 1V55B 4WFHA 4PI0A 3RWRD 2PI5A 4F4LA 3H1LH 2HP8A 1JPXA 1FFTB 5DN6G 2UU9B 4RO2A 1XILA 2VQEB 1IDSA 3ZHTA 3K06A 1Q7YW 1GRJA 4DK0A 2ZE5A 4B3MB 4UCUA 5H6RA 2JK5C 3ASOB 1HR0B 2XTAA 2X0LA 2IBZH 1XNRO 1VF6C 4PDLA 1NR1A 2YIAA 3E86A 2JS3A 4KHPB 2O57A 3K08A 2ODMA 1WJZA 3HR0A 5EYPB 3UO3A 5IY5C 4JI2B 5JJNB 2V7QG 4LH6A 2OTJV 4O4IA 3OMIB 3K3WA 1BQZA 2HHHB 4GKKO 3ZHVA 1IBLO 2KG7B 1BHBA 4GX2A 3ABMB 4MTOA 5KHJA 4I9QA 4QE9A 4UVBA 1XMQB 4EEQA 1Y67A 2EILB 4XDJA 4LF7O 1EZJA 5H6QA 3O9OA 3CS5A 3ABLC 4DV1B 4Z2WA 3SGIA 1O9HA 2H8PC 5L3GA 2F4VB 4GYCB 1CXZB 3UO2A 3R66A 1K9MW 2ZR3A 5K1PA 2PZSA 2ADPA 4X9QA 5IYZA 1Y66A 4R50A 3D36C 3TXQA 1JVMA 2ZD9A 2Q0AA 1MG1A 3AG1C 2LW1A 3CXCU 3CHXA 2UXCO 3BEHA 1YI2V 5IYZB 4O4HA 5CA0A 3CC2V 4P2ZA 2IU0A 5JQGB 1M1KW 4RUFA 1R3LC 1XEQA 1NTMH 3L71H 4IIJA 2LP7A 2GSMB 1R3IC 3LDCA 5F2VO 3QVNA 4I4TB 4D6TH 5DEDA 3QF7A 1NTKH 2XAGA 4JYAO 1AVMA 2LJ2A 5KHIA 3DXRA 5BMVB 5EIBD 1HDJA 2IJJA 4DR2O 1OCOC 2AZ2A 2DE0X 2BCCH 3ETGA 3CYOA 5KX5A 4UCOA 4CH6A 3C3TA 1XOUA 1I5XA 3ZRWA 5FLXN 2IW5A 2XOKG 3AG4C 4FPPA 2ARHA 3OMNB 3JAKA 3RYIA 5JVDA 2PY5A 4BWAA 4MTFA 1NU1H 1BQ0A 5LGNA 4JI4O 4B3TO 5J2TA 1E1QG 4O2BA 3JAKB 3ZIAG 3JASB 5FNVB 1V54B 2ITDC 4DV4O 2R72A 4UUJC 2QWNB 1VQ6V 4DR4O 2K1EA 1HNZB 3K59A 4CC6A 4BR6A 3F7VC 3MHSC 2UXDB 3EFFK 5LP6A 1KU9A 5JH7B 1UPGA 4H0LB 4DW0A 4YY3O 2Z0AA 4RAIA 2QM7A 3E8HA 3JALB 4NTXA 2Z3YA 2KB1A 5LBQA 4NKGB 3SJCC 1K34A 1AJPA 1W0JG 3OR7C 5J2UB 4UXNA 3ASNC 1WN7A 3K79A 4K8XA 1SRYA 4E4EA 2Q67A 5LMUB 1PNKA 4JTDB 2Q68A 2AHZA 4HBNA 3TCUA 1R1BA 3D8CA 4YJ3A 1NKDA 4N23A 4MVRA 3S3XA 4IHJA 1K5SA 2P5OA 4EKWA 4DUZO 2JJ1G 3HKCA 1N33O 3TETA 4FLTA 5GONA 4IHJB 5KMGB 4DR5B 1FYJA 3CPWU 4J9YB 4FVMA 1XHXA 2GUZA 4DR6B 2OCCC 3CRRA 3RYFB 4FLVA 2YC0A 3JARA 1VQOV 3UKMA 5A2QN 1N34B 3SPCA 5IYCO 2CUGA 5B5EZ 1BE3H 3CSXA 4AQYB 4DRXA 1TVKA 2M7WA 2YSUB 2PF4E 4FFBA 2LFSA 4NVPA 3CWBH 4X8AA 1LUWA 5EZYB 1GM8A 5IJ0B 4XDKA 5LOVA 4DRXB 1XL4A 4FFBB 4NXMB 1VMGA 3DTUB 1GMGA 1AP6A 4FLZA 1BHAA 4G27B 5LHIA 1GN6A 2EIMB 4EFEA 4P9PA 3RYHB 2QM4A 1FFXB 4RUEA 2Y0IA 4EB6A 4A5UB 4J7ZA 1HP8A 1K7DA 1YCIA 3OUFA 4GT1A 5DM6V 2ZCEA 1F23A 1R6KA 3B09A 5L3DA 3NXSA 5CA1A 2DJVA 4FLWA 4JI8O 1JR9A 4JI0B 1G8MA 1K4CC 3G71V 4X1KB 3SYPA 1BCCH 1J5EB 3CJHA 3SYCA 3K9AA 1NR7A 1K4DC 2Q7GA 3ABMC 1AI5A 4ZOLB 1BMFG 5CA1B 3K58A 1FXHA 4PI2A 1FXKB 1SZXA 5LGUA 1I0HA 4I55B 4DV5O 2EILC 1Q82W 2B5UA 4LH7A 3DC6A 3ZMZA 4Z1MG 2P67A 4JI1O 4ZI7A 2JVDA 3I5DA 3QO5A 3J7AU 5C8YA 1K3EA 5FPOA 5IE9A 4OPAA 1SESA 3ZHSA 3MD0A 2EINB 4F6EA 4LF5O 1Z5VA 2E3CA 3HB3B 1S72V 4K35A 3T1HO 2DYRB 1S5LZ 1S5HC 1LNQA 1TUEB 4DR1B 2VWKA 2F1MA 2RDCA 2BOBC 4I50A 4CH3A 3CCUV 2UUAO 3OW2U 3JATA 3BA9A 3ZX6A 4X62O 2ADQB 1Q6HA 4DW1A 2JGDB 3CXHF 2EIKB 4I7ZB 1RM1B 1JOYA 4P30A 1PP9H 2L6LA 4L8JA 2CGNA 2HEPA 4DV2B 4E2LA 1X59A 2BTQB 4TOIA 4X20A 4H37A 2ZXWB 4Q6GA 3ETDA 4UFZA 4X66O 4O4LA 4DV3O 4FM2A 1GTOA 4K0KO 2EZOA 4H13B 4X20B 3OR6C 3T2MA 4DR7B 4GKJO 1R3JC 3JYCA 5CMUA 4JI3O 4DXWA 4WBNA 2YIBA 3SPIA 2UUCO 2Y69C 3ZMUA 3CEIA
chains in the Genus database with same CATH topology
3JCZA 1V55B 4WFHA 1GK9A 1M56C 2PI5A 4F4LA 2WSSG 1JPXA 4KUMA 5J9PC 1FFTB 5DN6G 1B6QA 1M57C 1M90W 1VQMV 4MVSA 4RO2A 1G4YB 2EIJC 4KP4A 3AG3C 1FXKA 3FB6C 1Q7YW 3K06A 4GX0A 3OAAG 4I9WA 5LHHA 1W2BU 1QLEC 3CC4V 1EFRG 3H01A 3ZRWB 3JD1A 4RQFA 2DWDC 5FL7G 5H6RA 4JYCA 3T1CA 1VQLV 2PI4A 3AEIA 2JK5C 3ASOB 1R6NA 2WLHA 2WLMA 3BY6A 3JD3A 3AG2B 4PA6A 4UVAA 2XAQA 2X0LA 3ABUA 3R65A 4FIPC 1AROP 2Y69B 1E1RG 4PDLA 5CBFA 1YJNV 1NR1A 3E86A 3IGAC 4GCZA 3IFXA 3K08A 1VQKV 5KA5A 3CMEV 1QR8A 3E2EA 2IH3C 5IY5C 3RVYA 5CBHA 4J9ZB 2V7QG 2OTJV 1VQNV 3OMIB 1VQ9V 3K3WA 1PKXA 3QO7A 1VQ5V 1W0KG 2EIJB 3D3IA 4XDLA 1BHBA 3PJSK 1RPOA 3CCMV 4GX2A 3I55V 3ABMB 4MS2A 4MTOA 1JJ2U 5E1AC 2V1DA 4QE9A 3E89A 3GWOA 1S3JA 4UVBA 1JX9A 2F43G 2WLLA 3EHBB 1YIJV 4OXSA 4ASUG 2EILB 4XDJA 3T4ZA 3ZN1A 3CCQV 2WLIA 1EZJA 1OZ0A 3FYIB 5H6QA 2QEXV 2D3OW 1AI7A 3HPLC 3ABLC 3FB5C 3CCLV 3CCSV 2ZDIC 2R9IA 3QNEA 5EC2C 2H8PC 5L3GA 5B1OA 4FK5C 1P7BA 2X6CA 1K9MW 5EBWC 2ZR3A 2DYSB 3LNMB 1GM9A 1NQTA 2W6IG 1WPXA 2A9HA 3ZMVA 2Q69A 1Y66A 3FKSG 4R50A 1JVMA 2ZD9A 1MG1A 1DTOA 2B1IA 5IYDO 1NJIW 4JGSA 4UV8A 2IH1C 3AG1C 1I5YA 3FB8C 4WFEA 3CXCU 2ZR2A 4JYBA 3SPJA 3W7SA 3BEHA 3ABTA 2OT5A 1YI2V 2QTOA 3E35A 3W7TA 4WFBV 2HLDG 1ENVA 4JAVA 5EBLC 4RQEA 3CC2V 4P2ZA 2MK3A 4YXWG 2IU0A 2HVJC 1M1KW 3ABLB 3JD0A 1H8EG 4RUFA 2DW4A 4HAMA 1XL6A 3GB7C 1R3LC 3STZC 3T4DA 1NH2D 1CPYA 3ZCCA 4WCEV 2X6BA 1ROPA 2X7RB 1CP9A 2LP7A 4P9OA 3VOUA 2GSMB 5CN0A 1R3IC 3LDCA 3JD2A 5L3CA 2P90A 5B3SB 2XAGA 1KP2A 3ZRXA 1F51A 1NVPD 4WFFA 2YEVA 4X88A 3W7WA 5KA6A 1VQ8V 3OEHG 4BIUA 2LFRA 1QR9A 1V54C 2IJJA 4JASA 2A0LA 4PDVA 4KFMA 1OCOC 1SETA 1SZTA 3ETGA 1AI6A 3CYOA 5CBGA 2YEVB 4PDRA 2BOCC 2WAMA 2W0FC 2XAFA 1I5XA 5LHGA 3ZRWA 3SYOA 2IW5A 2XOKG 3WFVA 3AG4C 3G6EV 4FPPA 1ZWIC 3OMAB 3OMNB 1AJQA 5B1BB 1K8AW 1AJNA 1Y4MA 5L3EA 4MTFA 1J95A 1NH2B 5LGNA 3OM3B 1MOFA 1Q81W 4N21A 2W6JG 1E1QG 2UXNA 5B1AC 1YITV 2B1GA 4WFGA 3ZIAG 1V54B 2HJFC 2ITDC 4UUJC 5IYBO 1JQ0A 1OCOB 5GW7A 4MT8A 1M56B 1VQ6V 1PD3A 1NVPB 5IDJA 1YSCA 1PNLA 3K0DA 2K1EA 3ZJZA 1QBZA 1N8RW 1KP3A 1OCCC 2JEUA 3F7VC 3MHSC 4QIWF 4U7OA 1MSWD 2EINC 3IC7A 1M57B 3EFFK 2DYRC 3AG3B 1K5QA 3ZN0A 3G4SV 3SPGA 2JIZG 1E79G 1QLEB 3ETEA 2HR3A 3F5WC 4QPJA 3OGCC 4TSFG 4RAIA 4WF9V 2QM7A 2GHYA 3E8HA 4R6ZA 4LP8A 4BIZA 5B1AB 4MVZA 1FXVA 2Z3YA 1PL0A 2KB1A 2HG5C 3UM7A 5LBQA 3ZMSA 1K34A 1AJPA 1W0JG 3OR7C 4UXNA 3ASNC 3K79A 1S0VA 1SRYA 4I5SA 2XAHA 3OUSA 3LSSA 2Q67A 5IY5B 1PNKA 2ZQMA 1GM7A 4JTDB 1OCCB 2Q68A 2AHZA 1MABG 5L3FA 3TCUA 4LC1A 3B8MA 1HWYA 2JEXA 2IJKA 1NKDA 1M9NA 1KQSU 4N23A 2JDIG 2A79B 2WPDG 4MVRA 4GX5A 1PNMA 1K5SA 4MVUA 3W7UA 4EKWA 2EZPA 1K33A 5BZBA 2H94A 2IJIA 2JJ1G 4GX1A 2ZDIA 5KUKA 1S77D 2QE7G 2QM8A 4ZBMA 3LUTB 2QKSA 3ZMTA 3TETA 1VQ4V 1K97A 4PA9A 5HFMA 1OCZC 3CPWU 4J9YB 3ASNB 4MTXA 2DQ0A 2EIMC 3FYEB 3ML0A 2OCCC 1VQOV 3UKMA 3SPCA 3X2QC 3D36A 4UVCA 5IYCO 1QLNA 4HYOA 4FJCC 2Y48A 4H33A 3SJQC 2M7WA 2YSUB 3QO8A 2LFSA 3E8BA 3JD4A 3FB7C 3P30A 3P32A 4L87A 4BAYA 3AG1B 4X8AA 3LDDA 1GM8A 4PA3A 3DGEA 4FMTA 4MTGA 4XDKA 1L1FA 1QVFU 1XL4A 1VQPV 2WLKA 4PDMA 3DTUB 1GMGA 2UXXA 3KG2A 1BHAA 4G27B 4CZZA 5LHIA 3CCJV 2EIMB 3B8NA 2X6AA 4PA7A 2EJRA 2OCCB 4P9PA 1R73A 4RUEA 4MW3A 4WFAV 2R9RB 1FXKC 3X2QB 1K92A 2NLJC 4TT3G 2IJHA 4XBFA 1K7DA 3E8FA 3OUFA 4GT1A 4UV9A 5DM6V 4JAUA 3RVZA 1ORQC 1F23A 1S76D 1R6KA 4CBCA 4ZKIA 2IU3A 4G28B 5L3DA 3NXSA 3LDEA 1G8MA 1F4NA 1K4CC 3G71V 1YTFD 3SYPA 1VQ7V 5KUMA 3SYCA 2AHYA 3K9AA 1NR7A 1K4DC 5L3BA 4X89A 3ABMC 1AI5A 5LGTA 1BMFG 1DLBA 1NBMG 2XAJA 1QCEA 1FXHA 1UJWB 3ABKC 4QNHB 3AG4B 1FXKB 2JJ2G 1KC8W 5LGUA 4TWKA 3K0GA 2ATKC 4JPRA 3SYAA 2EBOA 2EILC 2FTKA 1Q82W 2B5UA 1COWG 1EBOA 2WLNA 4MVMA 3ZMZA 1AR1B 4G2KA 2NNUA 4Z1MG 4Q20A 2P67A 3RBZA 4LCUC 3ZRVA 2DYSC 3OE7G 3SYQA 3QO5A 1P4RA 1K3EA 2EIKC 5B1NA 1RM1C 1SESA 2XNDG 4DO2A 3I56V 5EK0A 4HZ3A 5HFLA 3MD0A 2OTLV 1Q86W 1H8HG 1OCRC 1WLEA 2EINB 3K04A 3HB3B 3WG7C 1S72V 1R3KC 3ABKB 2CK3G 2WWWA 1YTFB 2DYRB 4QJFB 1AI4A 1S5HC 1IXMA 1BL8A 1LNQA 1TUEB 4QPKA 3RW0A 2C2AA 4JTAB 5H9CA 1SERA 3CD6V 4JF3A 1KKDA 2WLLB 2ZXWC 2BOBC 1YJWV 2DQ3A 3CCUV 2HVKC 3F7YC 1DF4A 4MVQA 3E8GA 2QA4V 1CEZA 2XASA 2P7TC 3OFNG 3OW2U 3ZRSA 1YJ9V 2WLIB 1H38A 3E83A 1JCHA 1QVGU 3A0RA 2EIKB 1F4MA 2P6JA 3CP1A 5B3SC 1FS0G 1RM1B 1JOYA 4P30A 4QE7A 1GO3F 3STLC 4PELA 5CA3A 1OCRB 3VBBA 3K03A 1GKFA 4PA4A 2Z5UA 3TK1A 3WG7B 4JTCB 3CCRV 3CMAV 3CCVV 4LBEC 2HFEC 3W7XA 1K73W 3CC7V 3M99B 1V55C 2DWEC 4E2LA 3LSQA 1DF5A 4U7NA 3OEEG 4H37A 2ZXWB 3ETDA 1H2GA 1RPRA 5C93A 4R8CA 1GTOA 4MSWC 4MW8A 2EZOA 1THZA 2ITCC 1OCZB 5B1BC 1KD1W 2HKOA 3SPHA 5EBMC 3OR6C 3T2MA 2WLJA 3CCEV 1YHQV 1R3JC 3JYCA 5CMUA 3ASOC 1KECA 4R7CA 3B77A 4DXWA 3AG2C 2Q6AA 3SPIA 1OHHG 5EC1C 4BW5A 4MVOA 2Y69C 3ZMUA 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N21 A;  1F23 A;  4JPR A;  2EBO A;  1SZT A;  2X7R B;  3CYO A;  4FIP C;  3B8M A;  2P6J A;  1EBO A;  2LP7 A;  3CP1 A;  3GWO A;  4G2K A;  1JPX A;  2EZO A;  5CN0 A;  4N23 A;  5HFL A;  1Y66 A;  1I5X A;  5KA5 A;  1JQ0 A;  3B8N A;  1MG1 A;  1QR8 A;  4FJC C;  5H9C A;  4JGS A;  1I5Y A;  3WFV A;  3K9A A;  2EZP A;  1K33 A;  5CMU A;  1K34 A;  1QBZ A;  2M7W A;  3MHS C;  4JF3 A;  3M99 B;  2OT5 A;  3B77 A;  1DLB A;  1Y4M A;  3P30 A;  4E2L A;  1ENV A;  3H01 A;  1QCE A;  1DF4 A;  1DF5 A;  5KA6 A;  5HFM A;  4FK5 C;  2MK3 A;  1MOF A;  1QR9 A;  3MHH C; 
#chains in the Genus database with same CATH topology
 1GK9 A;  1FJG B;  1WP7 A;  4DK1 A;  3CRQ A;  3N2K B;  5J9P C;  1B6Q A;  1KKC A;  1G4Y B;  4KP4 A;  4LFA O;  3UT5 A;  4CS4 A;  4QGP A;  1W2B U;  4I0X A;  3CC4 V;  1EFR G;  2YXH A;  3JD1 A;  1VQL V;  4NXN O;  5LP6 C;  3AEI A;  2PI4 A;  4K8Z A;  3B40 A;  2WLM A;  1Z5W A;  1D2D A;  4RWU A;  3AG2 B;  4B3R B;  1N0N A;  2KKW A;  4FIP C;  2UXB O;  5CBF A;  5KHG A;  4JYY A;  3IFX A;  5LXT A;  2RMK B;  1VQK V;  2PUS A;  2CH7 B;  4B08 A;  4FLX A;  3RT3 C;  3RVY A;  4YHH O;  1U96 A;  1VQ9 V;  4C7U A;  4KL1 A;  4W4K A;  1VQ5 V;  2EIJ B;  3CCM V;  2AZ0 A;  3I55 V;  5CB4 A;  3E89 A;  3GWO A;  1GH6 A;  2WLL A;  1YIJ V;  3ZHQ A;  3HPL C;  1BS3 A;  2F93 B;  2UUB B;  4B3S B;  3QNE A;  3K5L A;  4FK5 C;  1P7B A;  1JFF A;  1EN6 A;  3ZMV A;  1B04 A;  3S3W A;  3FKS G;  4JV5 B;  1YZB A;  2B1I A;  4JGS A;  4UV8 A;  2IH1 C;  3A0B Z;  2GBO A;  4JYB A;  3ABT A;  2OCH A;  1ENV A;  5EBL C;  5LA6 B;  2MK3 A;  3QTC A;  3JD0 A;  1H8E G;  4HNA B;  2Y4U A;  3STZ C;  1NH2 D;  4LF4 B;  1CPY A;  2LO1 A;  3KZI Z;  2X6B A;  1CP9 A;  3O65 A;  1Y76 B;  5CN0 A;  1GAX A;  3K9S A;  5L3C A;  2P4K A;  2GDS A;  3VQV A;  4X64 O;  2VQF B;  3G67 A;  2ZE8 A;  1NVP D;  4X66 B;  2ZNI A;  2RNB A;  1V9P A;  1QQC A;  1Q3E A;  4X65 B;  2LFR A;  2AGA A;  4KFM A;  1SET A;  1ZSP A;  1LR1 A;  1BGY H;  2KQX A;  4PDR A;  1N32 O;  2BOC C;  4JI3 B;  2WAM A;  1L0N H;  3AK1 A;  2LGW A;  3G6E V;  1TGO A;  1M93 A;  5B1B B;  1WB7 A;  4J42 A;  5L3E A;  1N4C A;  4DR3 O;  4IL6 Z;  1Q81 W;  5EYP A;  2HJD A;  5B1A C;  4DV0 B;  1YIT V;  1RSO B;  4ZHQ B;  1EM1 A;  4WFG A;  2BSK B;  3GWK C;  3HKE B;  4F6R B;  2N04 A;  2HJF C;  1HNX B;  1JQ0 A;  2KG7 A;  5IDJ A;  1YSC A;  4DV6 B;  1QBZ A;  1N8R W;  3F5T A;  1OCC C;  2K9P A;  2EIN C;  1M57 B;  1U97 A;  2Q4P A;  2FL4 A;  2DYR C;  3AG3 B;  1K5Q A;  3ZN0 A;  4LF8 O;  3G4S V;  2WA4 A;  2JIZ G;  1SQF A;  4IT5 A;  2VRZ A;  4QPJ A;  3OGC C;  1Y74 A;  5D5Q A;  3ZMS A;  1Y74 B;  4LFB O;  4JZG A;  4DUY O;  1QHT A;  4LC1 A;  1FKA O;  1PV0 A;  2ZIN A;  3B8M A;  2JEX A;  1DK1 A;  4O4J B;  2JDI G;  2A79 B;  3N27 A;  3ZED A;  4GX5 A;  1KB9 F;  2CGO A;  1PNM A;  4OX9 O;  2EUL A;  5JQG A;  4JI7 B;  2EZP A;  2NN4 A;  5BZB A;  3K5O A;  1F7Y A;  2ZDI A;  2QE7 G;  1O9G A;  2QM8 A;  1DGS A;  1VQ4 V;  2EX3 A;  3WU2 Z;  1G1X B;  4I4T A;  3H1I H;  2LQT A;  1MSD A;  2DOS A;  4FLY A;  3X2Q C;  3T1Y O;  1IBK O;  1ZX3 A;  2Y48 A;  5BMV A;  2QR4 A;  3SJQ C;  2CTP A;  3BAB A;  4UB8 Z;  3GVM A;  3QO8 A;  4JI6 B;  3APO A;  3E8B A;  5KHK A;  3P30 A;  3BFR A;  1Q43 A;  5KAF Z;  3LDD A;  2GTA A;  4PA3 A;  4MTG A;  5KAI Z;  1VQP V;  3OGI B;  1PL4 A;  1WP8 A;  3DC5 A;  1P49 A;  1Z2G A;  3QG5 A;  1EZV H;  1R73 A;  3FAV B;  5JCO A;  5JWP A;  3OTO O;  1N32 B;  2IJH A;  5FNV A;  3JAS A;  1I94 O;  4JAU A;  3RVZ A;  1ORQ C;  1S76 D;  3IAY A;  1G6U A;  4AIL C;  1IBM O;  1YVW A;  2N05 A;  5JH7 A;  5IWA O;  5IJ9 B;  3FX7 A;  2YXL A;  3ABK C;  1XNR B;  1KUQ A;  5TIS Z;  2OWO A;  1N36 O;  3JAL A;  3SYA A;  2EBO A;  2CE4 A;  2FTK A;  3J80 N;  3U10 A;  5J2U A;  4MVM A;  2NNU A;  1GN2 A;  1SQV H;  4GKK B;  1IBL B;  1JMK C;  2E5L O;  3BCC H;  4LCU C;  3U11 A;  2W0X A;  4FZ0 A;  5GTI Z;  5B1N A;  2AW9 A;  2QDO A;  1XNQ O;  4HZ3 A;  1OCR C;  2NR5 A;  2QWP B;  3K04 A;  1IX9 A;  4B7K A;  3WG7 C;  4LF7 B;  4BW9 A;  4QPK A;  1ZUQ A;  5KMG A;  4LWS B;  4JF3 A;  3H1J H;  1B06 A;  4U3J B;  3RYF A;  2HVK C;  3F7Y C;  1DF4 A;  1TUB A;  2P7T C;  4LF9 O;  3ZRS A;  2WLI B;  1JCH A;  3A0R A;  1SF9 A;  3BPZ A;  1X4T A;  1FS0 G;  2UXC B;  2ZE7 A;  1TUB B;  5CA3 A;  2Y0P A;  4X1I B;  1GKF A;  4PA4 A;  4W4L A;  3TK1 A;  5EZY A;  3CMA V;  3CCR V;  3JAW A;  2PYL A;  5IJ0 A;  1V55 C;  2DWE C;  2IM9 A;  3LSQ A;  1DF5 A;  4PJ0 Z;  1WAZ A;  3JAW B;  1US6 A;  3SR2 C;  1EN5 A;  3RYH A;  1GN3 A;  1FFX A;  5C93 A;  3CRA A;  4MSW C;  3H9V A;  4MW8 A;  1THZ A;  4JYA B;  2ITC C;  5B1B C;  1XRE A;  4DYL A;  4DV7 O;  2WLJ A;  3CCE V;  1YHQ V;  3ASO C;  2CTW A;  3E22 A;  2Q6A A;  3OTF A;  4DR2 B;  2R9A A;  5BR8 O;  4LNU A;  1T5E A;  3VQY A;  5H2F Z;  4X1K A;  3PN1 A;  4TV9 B;  3C3S A;  2WSS G;  3E22 B;  5B66 Z;  4LNU B;  4ZOL A;  1M57 C;  5EIB C;  1M90 W;  2LW7 A;  4LF6 O;  3AG3 C;  1FXK A;  3H1K H;  4KXR A;  4JI4 B;  4I55 A;  4GX0 A;  4B3T B;  3CRC A;  2JRI A;  3CX5 F;  3H01 A;  1URF A;  4RQF A;  5FL7 G;  3T1C A;  1R6N A;  4DV4 B;  3D3Q A;  3BY6 A;  2P06 A;  2XAQ A;  1IVS A;  4DR4 B;  1KYO F;  4J7K A;  1YJN V;  3IGA C;  4GCZ A;  5KA5 A;  2CAZ C;  1QR8 A;  3E2E A;  5CBH A;  4J9Z B;  5JJJ B;  3CE2 A;  1VQN V;  1PKX A;  3QO7 A;  3D3I A;  3PJS K;  1RPO A;  4YY3 B;  3B2E E;  2F23 A;  3BA8 A;  2QTS A;  4GUN A;  5E1A C;  2V1D A;  1TA8 A;  4ZIB A;  4JAA A;  1S3J A;  1BZK A;  3EHB B;  4OXS A;  3ZN1 A;  3CCQ V;  2D3O W;  2P22 C;  1XHZ A;  1NZ6 A;  3FB5 C;  2JGD A;  4O2A B;  3CCL V;  3CCS V;  3KCY A;  2ZDI C;  2ZE6 A;  5EC2 C;  4YJ2 B;  5B1O A;  2X6C A;  2RN9 A;  5EBW C;  1XBL A;  2DYS B;  2ZM6 O;  1GM9 A;  1NQT A;  1S5J A;  2A9H A;  1SQP H;  4DUZ B;  2XHB A;  2YS8 A;  1NJI W;  5IYD O;  1N33 B;  1I5Y A;  4NTW A;  2BTQ A;  2ZR2 A;  3SPJ A;  1HNW O;  4LR3 A;  2QJ1 A;  4UCS A;  3ZS8 C;  2JGU A;  2OT5 A;  3W7T A;  2HLD G;  4RQE A;  2PYJ A;  4YXW G;  3ABL B;  1XL6 A;  4WCE V;  1ROP A;  2X7R B;  4AHC A;  4ABM A;  2ZNJ A;  1SKV A;  3LSU A;  3JD2 A;  2P90 A;  3M8A A;  3UCS C;  5DEC A;  4LFC O;  1KP2 A;  3ZRX A;  1F51 A;  2R70 A;  4X88 A;  1Q6U A;  3W7W A;  5JCO C;  2Y4T A;  3N2K A;  1AB3 A;  4BIU A;  1QR9 A;  1V54 C;  4JAS A;  4PDV A;  1FPO A;  3SJB C;  4CS2 A;  2CTR A;  5CBG A;  1H2L A;  2XAF A;  3IJ4 A;  4NR1 A;  5BR8 B;  3SYO A;  2E74 B;  3WFV A;  4FM1 A;  3BVO A;  1ZWI C;  2UU9 O;  2VQE O;  1P7G A;  2DN9 A;  1NH2 B;  4CH5 A;  4JI8 B;  4UCR A;  4N21 A;  4CS3 A;  2YI8 A;  2CH7 A;  2LGQ A;  4B3M O;  1SA0 A;  2Q9L A;  2B1G A;  1HR0 O;  2QKC A;  3HKB B;  5IYB O;  1OCO B;  3THO A;  4JI5 O;  4MT8 A;  1M56 B;  1PD3 A;  2D2C B;  1NVP B;  1ZTE A;  3ZJZ A;  1SA0 B;  4KHP O;  2JEU A;  2BE3 A;  1MSW D;  2H3O A;  4DV5 B;  1Q6I A;  1H2M A;  2YUA A;  3K57 A;  2HHH O;  1MZE A;  5LYJ B;  1QLE B;  4JI1 B;  3ETE A;  5H5N A;  4WF9 V;  3AK2 A;  1Q90 D;  3KCX A;  4BIZ A;  3ICX A;  4NB5 A;  4MVZ A;  1Q8I A;  1FXV A;  2L35 A;  3JSN A;  1XMQ O;  2G38 A;  1AR4 A;  4LF5 B;  4I5S A;  2XAH A;  3LSS A;  2ZQM A;  3T1H B;  1YEW A;  4DV1 O;  2A3Q A;  1MAB G;  1ZL8 B;  5L3F A;  3M7M X;  4X1Y B;  4UCV A;  2RCV A;  2F4V O;  1M9N A;  2RJZ A;  4MVU A;  5LA6 A;  2UUA B;  1K33 A;  3K5M A;  2IJI A;  4HNA A;  4GX1 A;  2ZM6 B;  1BT8 A;  1WNS A;  5KUK A;  4X62 B;  4ZBM A;  3LUT B;  3Q4H B;  4IYH A;  2QKS A;  5ITZ A;  1Y76 A;  3G80 A;  1K97 A;  4JZ2 A;  5AG2 A;  3ASN B;  3WB1 A;  4MTX A;  4GLX A;  2Q5Z A;  2EIM C;  3FYE B;  3ML0 A;  3LNN A;  5ITZ B;  3H1H H;  1HNW B;  2YIB D;  4UVC A;  4HYO A;  4FJC C;  1VAR A;  1AR5 A;  4J41 A;  4TUY B;  1NTZ H;  3JD4 A;  3VQX A;  4D7S A;  4DV3 B;  2YI9 A;  4J11 A;  4K0K B;  2FKX A;  4FMT A;  1L1F A;  1QVF U;  4OGQ B;  2WLK A;  4ICG A;  4PDM A;  1N0J A;  4GKJ B;  3JAM N;  4NTY A;  2UXX A;  1RFY A;  3KG2 A;  3HKD B;  3B8N A;  2X6A A;  1GN4 A;  2EJR A;  2OCC B;  2UUC B;  1VP7 A;  1FXK C;  1YXB A;  1WA8 B;  1RSO A;  4ZHQ A;  1YF2 A;  1Y6X A;  1R6T A;  2BSK A;  4TT3 G;  3HKE A;  4XBF A;  4F6R A;  5KLV H;  4UV9 A;  3G6B A;  4CBC A;  4ZKI A;  4G28 B;  3FFQ A;  1H2N A;  4LFA B;  2Q7H A;  5IT9 N;  1F4N A;  1YTF D;  1VF5 B;  2FML A;  2QKA A;  3TXS A;  1VQ7 V;  5KUM A;  2E76 B;  4J7J A;  4NXN B;  5L3B A;  4FLU A;  1UFI A;  1NBM G;  1TAE A;  2XAJ A;  1QCE A;  2UXB B;  4QNH B;  1HNZ O;  1KC8 W;  2UXD O;  4JI5 B;  1COW G;  1AR1 B;  4YHH B;  2QSA A;  4G2K A;  2F66 C;  2B9Z A;  2DYS C;  3OE7 G;  3SYQ A;  1P4R A;  5BXZ A;  2EIK C;  4O4J A;  1RM1 C;  2XND G;  4O4I B;  1H8H G;  1FAF A;  3AK3 A;  1R3K C;  5LMU O;  4FZ1 A;  3SDL A;  4QJF B;  1OV9 A;  4J10 A;  1IXM A;  4D7T A;  3RW0 A;  2C2A A;  5H9C A;  5A9G A;  3CD6 V;  1QNM A;  1SQX H;  2ZXW C;  1YJW V;  5LL6 Y;  3RGB A;  2DQ3 A;  4MVQ A;  3E8G A;  2QA4 V;  2VWJ A;  3OFN G;  3A8T A;  1H38 A;  3E83 A;  3EVK A;  1QVG U;  4GZR B;  3CP1 A;  4DR5 O;  4QE7 A;  3STL C;  1GO3 F;  1SQQ H;  3VBB A;  3APQ A;  4DR6 O;  4JTC B;  3CCV V;  3ZHU A;  3CRM A;  1N34 O;  1D5A A;  3C90 A;  4AQY O;  2ETN A;  3OEE G;  3ZHR A;  1H2G A;  4R8C A;  4O4H B;  4X64 B;  3FAV A;  2FB5 A;  5CA0 B;  1OCZ B;  2HKO A;  1B3Q A;  5EBM C;  4NXM O;  3IC9 A;  4IIJ B;  1L0L H;  1KEC A;  4R7C A;  3B77 A;  3AG2 C;  2QWO B;  1OHH G;  4MVO A;  4J80 A;  3JCZ A;  1XQ8 A;  1M56 C;  1M4U A;  3DXR B;  4KUM A;  5IJ9 A;  1VQM V;  4PV1 B;  4MVS A;  1AIL A;  2EIJ C;  5KX5 B;  4DR3 B;  3FB6 C;  4JI0 O;  3OAA G;  3L72 H;  4I9W A;  2PTM A;  5LHH A;  1QLE C;  1J5E O;  2OIG A;  3ZRW B;  3RFR A;  2DWD C;  3ZBH A;  4JYC A;  1YDX A;  1VIB A;  2WLH A;  2JS5 A;  3JD3 A;  4PA6 A;  1JJO A;  4UVA A;  3RYI B;  3ABU A;  3R65 A;  5JVD B;  1ARO P;  2Y69 B;  1XMO O;  1E1R G;  5J2T B;  3CME V;  1MNG A;  2IH3 C;  1NS1 A;  4O2B B;  2P4V A;  4LF8 B;  3TGU H;  1W0K G;  4XDL A;  1H2K A;  4YIP A;  3L70 H;  1HW7 A;  1IUR A;  1JJ2 U;  4MS2 A;  1W59 A;  3L75 H;  1IXB A;  4LWS A;  3BRC A;  5LP6 B;  1JX9 A;  2F43 G;  4U3J A;  4ASU G;  4LFB B;  3T4Z A;  2WLI A;  1OZ0 A;  3FYI B;  5K1X A;  2QEX V;  4DUY B;  1AI7 A;  1SC5 B;  1I08 A;  4TQF A;  1D5N A;  4DR1 O;  2R9I A;  4X1I A;  1XDC A;  2F95 B;  1XI1 A;  2M6Y A;  3JCU Z;  3LNM B;  4OX9 B;  2W6I G;  2CTQ A;  1WPX A;  2Q73 A;  2Q69 A;  1DTO A;  2V4D A;  3FB8 C;  4WFE A;  3N2G A;  2GTS A;  3W7S A;  4YJ3 B;  4H44 B;  2QTO A;  3E35 A;  4WFB V;  4JAV A;  1JA8 A;  4DV2 O;  2HVJ C;  3N2G B;  2CDY A;  3L9D A;  3T4D A;  2DW4 A;  4HAM A;  3T1Y B;  3GB7 C;  1IBK B;  2BTO A;  3ZCC A;  1WPB A;  3HKC B;  4P9O A;  3VOU A;  5GON B;  5LMN O;  2MW2 B;  2GUZ B;  5B3S B;  1PM9 A;  3JAR B;  5FPR A;  1NI8 A;  4TV9 A;  4WFF A;  2YEV A;  3MAQ A;  4DR7 O;  5KA6 A;  1VQ8 V;  3OEH G;  2KSD A;  1TVK B;  2A0L A;  3B4S A;  2ZKO A;  4IYI A;  1SZT A;  3MDS A;  1AI6 A;  3RN4 A;  2YEV B;  1LUV A;  4CC5 A;  3P3N A;  2W0F C;  5LHG A;  5LOV B;  3K5N A;  1SS3 A;  2ZIM A;  3OTO B;  1FJG O;  1KBH A;  1I94 B;  1QU7 A;  3OMA B;  4U3F H;  1AJQ A;  1K8A W;  1AJN A;  1Y4M A;  1J95 A;  3SJA C;  3OM3 B;  1IBM B;  1MOF A;  2W6J G;  2UXN A;  4EB6 B;  3OT7 A;  5IWA B;  4B3R O;  1SQG A;  5GW7 A;  3P3P A;  1XUQ A;  1PNL A;  3K0D A;  1AP5 A;  1KP3 A;  4QIW F;  4U7O A;  1N36 B;  3IC7 A;  3KKY A;  4OPH A;  4AI8 A;  1XMO B;  3CJH B;  1FD9 A;  3FD9 A;  1WB8 A;  2Q8V A;  3TJT A;  3SPG A;  1VF6 A;  1E79 G;  3BHP A;  2HR3 A;  3BAA A;  2E5L B;  2PGG A;  3F5W C;  4TSF G;  4O2A A;  4B7E A;  2GHY A;  4R6Z A;  4LP8 A;  5B1A B;  1VEW A;  4YJ2 A;  1PL0 A;  2HG5 C;  4FFK A;  3UM7 A;  1XNQ B;  2Q7E A;  1S0V A;  2E75 B;  3L73 H;  3OUS A;  5IY5 B;  4FM0 A;  1GM7 A;  3DSQ A;  1OCC B;  1IZ3 A;  2AXT Z;  4ZI7 B;  2UUB O;  1MMM A;  4B3S O;  1I7F A;  1HWY A;  2IJK A;  5C8Y B;  1KQS U;  4IGG A;  2WPD G;  4NYK A;  2FYU H;  5E79 Z;  5BY1 A;  3W7U A;  4EFB A;  4LF9 B;  2H94 A;  4JV5 O;  1S77 D;  3ZMT A;  1BSM A;  4PA9 A;  5HFM A;  1OCZ C;  2DQ0 A;  4Z1V A;  3A2F A;  4I50 B;  3OD4 A;  3WB2 A;  4BIO A;  3D36 A;  3EXA A;  1QLN A;  3JAT B;  4LF4 O;  4H33 A;  2A7W A;  2WA3 A;  1RP3 B;  2DMX A;  4K3A A;  3VQW A;  3FB7 C;  3P32 A;  4L87 A;  4BAY A;  3AG1 B;  1ZLZ A;  1M5I A;  2VQF O;  2GV9 A;  3DGE A;  1KMI Z;  5LMN B;  4DV7 B;  2XUM A;  1Q5O A;  2YDE A;  4X65 O;  3RYC A;  4CZZ A;  3CCJ V;  4PA7 A;  2EJ7 A;  1H2S B;  3CB2 A;  4O4L B;  4MW3 A;  4WFA V;  2R9R B;  3X2Q B;  2OIE A;  1PPJ H;  3RYC B;  1K92 A;  2Q0O C;  2NLJ C;  2ZIO A;  2VS0 A;  3E8F A;  2QWQ B;  3HKB A;  4CH4 A;  1ZAU A;  4WBN B;  2IU3 A;  4LF6 B;  5KHH A;  3LDE A;  1SQB H;  4DV0 O;  3L74 H;  4PD4 F;  2AHY A;  4X89 A;  5LYJ A;  4UCT A;  1MA1 A;  5LGT A;  1HNX O;  1DLB A;  1UJW B;  4DV6 O;  4JI2 O;  5JJE B;  3AG4 B;  2JJ2 G;  3UT5 B;  4TWK A;  3K0G A;  2ATK C;  4JPR A;  4I0X B;  5D5P A;  1EBO A;  2WLN A;  3NR7 A;  4Q20 A;  1MZF A;  3RBZ A;  3ZRV A;  1ZL8 A;  4X1Y A;  5LXT B;  2A06 H;  4DO2 A;  3I56 V;  5EK0 A;  5HFL A;  3AG7 A;  2OTL V;  2XT9 A;  1Q86 W;  1WLE A;  3JSL A;  1OJH A;  2YID A;  2ZT9 B;  2CK3 G;  2WWW A;  3ABK B;  1YTF B;  1AI4 A;  3Q4H A;  1BL8 A;  5CB4 B;  1SER A;  4JTA B;  1EN4 A;  1L8D A;  4TV8 A;  1KKD A;  2WLL B;  1A32 A;  4JI7 O;  1CEZ A;  2XAS A;  1YJ9 V;  3ETQ A;  2QWR B;  2RQ6 A;  4TV8 B;  4TUY A;  1F4M A;  2P6J A;  5B3S C;  1NT2 B;  5GTH Z;  1VF7 A;  4PEL A;  1OCR B;  3K03 A;  2N74 A;  2Z5U A;  3WB0 A;  3WG7 B;  4LBE C;  2HFE C;  1JFF B;  3W7X A;  1K73 W;  3CC7 V;  3M99 B;  3UQ8 A;  4U7N A;  4UB6 Z;  2YIC A;  2YXY A;  3HKD A;  4JI6 O;  3A0H Z;  1RPR A;  1WA8 A;  2QGN A;  1P84 F;  4LFC B;  3U0Z A;  4YIO A;  1KD1 W;  3SPH A;  4PHZ A;  2OYQ A;  3J81 N;  5EC1 C;  4BW5 A;  4TQD A;  2ILM A;  3MHH C;  1V55 B;  4WFH A;  4PI0 A;  3RWR D;  2PI5 A;  4F4L A;  3H1L H;  2HP8 A;  1JPX A;  1FFT B;  5DN6 G;  2UU9 B;  4RO2 A;  1XIL A;  2VQE B;  1IDS A;  3ZHT A;  3K06 A;  1Q7Y W;  1GRJ A;  4DK0 A;  2ZE5 A;  4B3M B;  4UCU A;  5H6R A;  2JK5 C;  3ASO B;  1HR0 B;  2XTA A;  2X0L A;  2IBZ H;  1XNR O;  1VF6 C;  4PDL A;  1NR1 A;  2YIA A;  3E86 A;  2JS3 A;  4KHP B;  2O57 A;  3K08 A;  2ODM A;  1WJZ A;  3HR0 A;  5EYP B;  3UO3 A;  5IY5 C;  4JI2 B;  5JJN B;  2V7Q G;  4LH6 A;  2OTJ V;  4O4I A;  3OMI B;  3K3W A;  1BQZ A;  2HHH B;  4GKK O;  3ZHV A;  1IBL O;  2KG7 B;  1BHB A;  4GX2 A;  3ABM B;  4MTO A;  5KHJ A;  4I9Q A;  4QE9 A;  4UVB A;  1XMQ B;  4EEQ A;  1Y67 A;  2EIL B;  4XDJ A;  4LF7 O;  1EZJ A;  5H6Q A;  3O9O A;  3CS5 A;  3ABL C;  4DV1 B;  4Z2W A;  3SGI A;  1O9H A;  2H8P C;  5L3G A;  2F4V B;  4GYC B;  1CXZ B;  3UO2 A;  3R66 A;  1K9M W;  2ZR3 A;  5K1P A;  2PZS A;  2ADP A;  4X9Q A;  5IYZ A;  1Y66 A;  4R50 A;  3D36 C;  3TXQ A;  1JVM A;  2ZD9 A;  2Q0A A;  1MG1 A;  3AG1 C;  2LW1 A;  3CXC U;  3CHX A;  2UXC O;  3BEH A;  1YI2 V;  5IYZ B;  4O4H A;  5CA0 A;  3CC2 V;  4P2Z A;  2IU0 A;  5JQG B;  1M1K W;  4RUF A;  1R3L C;  1XEQ A;  1NTM H;  3L71 H;  4IIJ A;  2LP7 A;  2GSM B;  1R3I C;  3LDC A;  5F2V O;  3QVN A;  4I4T B;  4D6T H;  5DED A;  3QF7 A;  1NTK H;  2XAG A;  4JYA O;  1AVM A;  2LJ2 A;  5KHI A;  3DXR A;  5BMV B;  5EIB D;  1HDJ A;  2IJJ A;  4DR2 O;  1OCO C;  2AZ2 A;  2DE0 X;  2BCC H;  3ETG A;  3CYO A;  5KX5 A;  4UCO A;  4CH6 A;  3C3T A;  1XOU A;  1I5X A;  3ZRW A;  5FLX N;  2IW5 A;  2XOK G;  3AG4 C;  4FPP A;  2ARH A;  3OMN B;  3JAK A;  3RYI A;  5JVD A;  2PY5 A;  4BWA A;  4MTF A;  1NU1 H;  1BQ0 A;  5LGN A;  4JI4 O;  4B3T O;  5J2T A;  1E1Q G;  4O2B A;  3JAK B;  3ZIA G;  3JAS B;  5FNV B;  1V54 B;  2ITD C;  4DV4 O;  2R72 A;  4UUJ C;  2QWN B;  1VQ6 V;  4DR4 O;  2K1E A;  1HNZ B;  3K59 A;  4CC6 A;  4BR6 A;  3F7V C;  3MHS C;  2UXD B;  3EFF K;  5LP6 A;  1KU9 A;  5JH7 B;  1UPG A;  4H0L B;  4DW0 A;  4YY3 O;  2Z0A A;  4RAI A;  2QM7 A;  3E8H A;  3JAL B;  4NTX A;  2Z3Y A;  2KB1 A;  5LBQ A;  4NKG B;  3SJC C;  1K34 A;  1AJP A;  1W0J G;  3OR7 C;  5J2U B;  4UXN A;  3ASN C;  1WN7 A;  3K79 A;  4K8X A;  1SRY A;  4E4E A;  2Q67 A;  5LMU B;  1PNK A;  4JTD B;  2Q68 A;  2AHZ A;  4HBN A;  3TCU A;  1R1B A;  3D8C A;  4YJ3 A;  1NKD A;  4N23 A;  4MVR A;  3S3X A;  4IHJ A;  1K5S A;  2P5O A;  4EKW A;  4DUZ O;  2JJ1 G;  3HKC A;  1N33 O;  3TET A;  4FLT A;  5GON A;  4IHJ B;  5KMG B;  4DR5 B;  1FYJ A;  3CPW U;  4J9Y B;  4FVM A;  1XHX A;  2GUZ A;  4DR6 B;  2OCC C;  3CRR A;  3RYF B;  4FLV A;  2YC0 A;  3JAR A;  1VQO V;  3UKM A;  5A2Q N;  1N34 B;  3SPC A;  5IYC O;  2CUG A;  5B5E Z;  1BE3 H;  3CSX A;  4AQY B;  4DRX A;  1TVK A;  2M7W A;  2YSU B;  2PF4 E;  4FFB A;  2LFS A;  4NVP A;  3CWB H;  4X8A A;  1LUW A;  5EZY B;  1GM8 A;  5IJ0 B;  4XDK A;  5LOV A;  4DRX B;  1XL4 A;  4FFB B;  4NXM B;  1VMG A;  3DTU B;  1GMG A;  1AP6 A;  4FLZ A;  1BHA A;  4G27 B;  5LHI A;  1GN6 A;  2EIM B;  4EFE A;  4P9P A;  3RYH B;  2QM4 A;  1FFX B;  4RUE A;  2Y0I A;  4EB6 A;  4A5U B;  4J7Z A;  1HP8 A;  1K7D A;  1YCI A;  3OUF A;  4GT1 A;  5DM6 V;  2ZCE A;  1F23 A;  1R6K A;  3B09 A;  5L3D A;  3NXS A;  5CA1 A;  2DJV A;  4FLW A;  4JI8 O;  1JR9 A;  4JI0 B;  1G8M A;  1K4C C;  3G71 V;  4X1K B;  3SYP A;  1BCC H;  1J5E B;  3CJH A;  3SYC A;  3K9A A;  1NR7 A;  1K4D C;  2Q7G A;  3ABM C;  1AI5 A;  4ZOL B;  1BMF G;  5CA1 B;  3K58 A;  1FXH A;  4PI2 A;  1FXK B;  1SZX A;  5LGU A;  1I0H A;  4I55 B;  4DV5 O;  2EIL C;  1Q82 W;  2B5U A;  4LH7 A;  3DC6 A;  3ZMZ A;  4Z1M G;  2P67 A;  4JI1 O;  4ZI7 A;  2JVD A;  3I5D A;  3QO5 A;  3J7A U;  5C8Y A;  1K3E A;  5FPO A;  5IE9 A;  4OPA A;  1SES A;  3ZHS A;  3MD0 A;  2EIN B;  4F6E A;  4LF5 O;  1Z5V A;  2E3C A;  3HB3 B;  1S72 V;  4K35 A;  3T1H O;  2DYR B;  1S5L Z;  1S5H C;  1LNQ A;  1TUE B;  4DR1 B;  2VWK A;  2F1M A;  2RDC A;  2BOB C;  4I50 A;  4CH3 A;  3CCU V;  2UUA O;  3OW2 U;  3JAT A;  3BA9 A;  3ZX6 A;  4X62 O;  2ADQ B;  1Q6H A;  4DW1 A;  2JGD B;  3CXH F;  2EIK B;  4I7Z B;  1RM1 B;  1JOY A;  4P30 A;  1PP9 H;  2L6L A;  4L8J A;  2CGN A;  2HEP A;  4DV2 B;  4E2L A;  1X59 A;  2BTQ B;  4TOI A;  4X20 A;  4H37 A;  2ZXW B;  4Q6G A;  3ETD A;  4UFZ A;  4X66 O;  4O4L A;  4DV3 O;  4FM2 A;  1GTO A;  4K0K O;  2EZO A;  4H13 B;  4X20 B;  3OR6 C;  3T2M A;  4DR7 B;  4GKJ O;  1R3J C;  3JYC A;  5CMU A;  4JI3 O;  4DXW A;  4WBN A;  2YIB A;  3SPI A;  2UUC O;  2Y69 C;  3ZMU A;  3CEI A; 
#chains in the Genus database with same CATH homology
 3JCZ A;  1V55 B;  4WFH A;  1GK9 A;  1M56 C;  2PI5 A;  4F4L A;  2WSS G;  1JPX A;  4KUM A;  5J9P C;  1FFT B;  5DN6 G;  1B6Q A;  1M57 C;  1M90 W;  1VQM V;  4MVS A;  4RO2 A;  1G4Y B;  2EIJ C;  4KP4 A;  3AG3 C;  1FXK A;  3FB6 C;  1Q7Y W;  3K06 A;  4GX0 A;  3OAA G;  4I9W A;  5LHH A;  1W2B U;  1QLE C;  3CC4 V;  1EFR G;  3H01 A;  3ZRW B;  3JD1 A;  4RQF A;  2DWD C;  5FL7 G;  5H6R A;  4JYC A;  3T1C A;  1VQL V;  2PI4 A;  3AEI A;  2JK5 C;  3ASO B;  1R6N A;  2WLH A;  2WLM A;  3BY6 A;  3JD3 A;  3AG2 B;  4PA6 A;  4UVA A;  2XAQ A;  2X0L A;  3ABU A;  3R65 A;  4FIP C;  1ARO P;  2Y69 B;  1E1R G;  4PDL A;  5CBF A;  1YJN V;  1NR1 A;  3E86 A;  3IGA C;  4GCZ A;  3IFX A;  3K08 A;  1VQK V;  5KA5 A;  3CME V;  1QR8 A;  3E2E A;  2IH3 C;  5IY5 C;  3RVY A;  5CBH A;  4J9Z B;  2V7Q G;  2OTJ V;  1VQN V;  3OMI B;  1VQ9 V;  3K3W A;  1PKX A;  3QO7 A;  1VQ5 V;  1W0K G;  2EIJ B;  3D3I A;  4XDL A;  1BHB A;  3PJS K;  1RPO A;  3CCM V;  4GX2 A;  3I55 V;  3ABM B;  4MS2 A;  4MTO A;  1JJ2 U;  5E1A C;  2V1D A;  4QE9 A;  3E89 A;  3GWO A;  1S3J A;  4UVB A;  1JX9 A;  2F43 G;  2WLL A;  3EHB B;  1YIJ V;  4OXS A;  4ASU G;  2EIL B;  4XDJ A;  3T4Z A;  3ZN1 A;  3CCQ V;  2WLI A;  1EZJ A;  1OZ0 A;  3FYI B;  5H6Q A;  2QEX V;  2D3O W;  1AI7 A;  3HPL C;  3ABL C;  3FB5 C;  3CCL V;  3CCS V;  2ZDI C;  2R9I A;  3QNE A;  5EC2 C;  2H8P C;  5L3G A;  5B1O A;  4FK5 C;  1P7B A;  2X6C A;  1K9M W;  5EBW C;  2ZR3 A;  2DYS B;  3LNM B;  1GM9 A;  1NQT A;  2W6I G;  1WPX A;  2A9H A;  3ZMV A;  2Q69 A;  1Y66 A;  3FKS G;  4R50 A;  1JVM A;  2ZD9 A;  1MG1 A;  1DTO A;  2B1I A;  5IYD O;  1NJI W;  4JGS A;  4UV8 A;  2IH1 C;  3AG1 C;  1I5Y A;  3FB8 C;  4WFE A;  3CXC U;  2ZR2 A;  4JYB A;  3SPJ A;  3W7S A;  3BEH A;  3ABT A;  2OT5 A;  1YI2 V;  2QTO A;  3E35 A;  3W7T A;  4WFB V;  2HLD G;  1ENV A;  4JAV A;  5EBL C;  4RQE A;  3CC2 V;  4P2Z A;  2MK3 A;  4YXW G;  2IU0 A;  2HVJ C;  1M1K W;  3ABL B;  3JD0 A;  1H8E G;  4RUF A;  2DW4 A;  4HAM A;  1XL6 A;  3GB7 C;  1R3L C;  3STZ C;  3T4D A;  1NH2 D;  1CPY A;  3ZCC A;  4WCE V;  2X6B A;  1ROP A;  2X7R B;  1CP9 A;  2LP7 A;  4P9O A;  3VOU A;  2GSM B;  5CN0 A;  1R3I C;  3LDC A;  3JD2 A;  5L3C A;  2P90 A;  5B3S B;  2XAG A;  1KP2 A;  3ZRX A;  1F51 A;  1NVP D;  4WFF A;  2YEV A;  4X88 A;  3W7W A;  5KA6 A;  1VQ8 V;  3OEH G;  4BIU A;  2LFR A;  1QR9 A;  1V54 C;  2IJJ A;  4JAS A;  2A0L A;  4PDV A;  4KFM A;  1OCO C;  1SET A;  1SZT A;  3ETG A;  1AI6 A;  3CYO A;  5CBG A;  2YEV B;  4PDR A;  2BOC C;  2WAM A;  2W0F C;  2XAF A;  1I5X A;  5LHG A;  3ZRW A;  3SYO A;  2IW5 A;  2XOK G;  3WFV A;  3AG4 C;  3G6E V;  4FPP A;  1ZWI C;  3OMA B;  3OMN B;  1AJQ A;  5B1B B;  1K8A W;  1AJN A;  1Y4M A;  5L3E A;  4MTF A;  1J95 A;  1NH2 B;  5LGN A;  3OM3 B;  1MOF A;  1Q81 W;  4N21 A;  2W6J G;  1E1Q G;  2UXN A;  5B1A C;  1YIT V;  2B1G A;  4WFG A;  3ZIA G;  1V54 B;  2HJF C;  2ITD C;  4UUJ C;  5IYB O;  1JQ0 A;  1OCO B;  5GW7 A;  4MT8 A;  1M56 B;  1VQ6 V;  1PD3 A;  1NVP B;  5IDJ A;  1YSC A;  1PNL A;  3K0D A;  2K1E A;  3ZJZ A;  1QBZ A;  1N8R W;  1KP3 A;  1OCC C;  2JEU A;  3F7V C;  3MHS C;  4QIW F;  4U7O A;  1MSW D;  2EIN C;  3IC7 A;  1M57 B;  3EFF K;  2DYR C;  3AG3 B;  1K5Q A;  3ZN0 A;  3G4S V;  3SPG A;  2JIZ G;  1E79 G;  1QLE B;  3ETE A;  2HR3 A;  3F5W C;  4QPJ A;  3OGC C;  4TSF G;  4RAI A;  4WF9 V;  2QM7 A;  2GHY A;  3E8H A;  4R6Z A;  4LP8 A;  4BIZ A;  5B1A B;  4MVZ A;  1FXV A;  2Z3Y A;  1PL0 A;  2KB1 A;  2HG5 C;  3UM7 A;  5LBQ A;  3ZMS A;  1K34 A;  1AJP A;  1W0J G;  3OR7 C;  4UXN A;  3ASN C;  3K79 A;  1S0V A;  1SRY A;  4I5S A;  2XAH A;  3OUS A;  3LSS A;  2Q67 A;  5IY5 B;  1PNK A;  2ZQM A;  1GM7 A;  4JTD B;  1OCC B;  2Q68 A;  2AHZ A;  1MAB G;  5L3F A;  3TCU A;  4LC1 A;  3B8M A;  1HWY A;  2JEX A;  2IJK A;  1NKD A;  1M9N A;  1KQS U;  4N23 A;  2JDI G;  2A79 B;  2WPD G;  4MVR A;  4GX5 A;  1PNM A;  1K5S A;  4MVU A;  3W7U A;  4EKW A;  2EZP A;  1K33 A;  5BZB A;  2H94 A;  2IJI A;  2JJ1 G;  4GX1 A;  2ZDI A;  5KUK A;  1S77 D;  2QE7 G;  2QM8 A;  4ZBM A;  3LUT B;  2QKS A;  3ZMT A;  3TET A;  1VQ4 V;  1K97 A;  4PA9 A;  5HFM A;  1OCZ C;  3CPW U;  4J9Y B;  3ASN B;  4MTX A;  2DQ0 A;  2EIM C;  3FYE B;  3ML0 A;  2OCC C;  1VQO V;  3UKM A;  3SPC A;  3X2Q C;  3D36 A;  4UVC A;  5IYC O;  1QLN A;  4HYO A;  4FJC C;  2Y48 A;  4H33 A;  3SJQ C;  2M7W A;  2YSU B;  3QO8 A;  2LFS A;  3E8B A;  3JD4 A;  3FB7 C;  3P30 A;  3P32 A;  4L87 A;  4BAY A;  3AG1 B;  4X8A A;  3LDD A;  1GM8 A;  4PA3 A;  3DGE A;  4FMT A;  4MTG A;  4XDK A;  1L1F A;  1QVF U;  1XL4 A;  1VQP V;  2WLK A;  4PDM A;  3DTU B;  1GMG A;  2UXX A;  3KG2 A;  1BHA A;  4G27 B;  4CZZ A;  5LHI A;  3CCJ V;  2EIM B;  3B8N A;  2X6A A;  4PA7 A;  2EJR A;  2OCC B;  4P9P A;  1R73 A;  4RUE A;  4MW3 A;  4WFA V;  2R9R B;  1FXK C;  3X2Q B;  1K92 A;  2NLJ C;  4TT3 G;  2IJH A;  4XBF A;  1K7D A;  3E8F A;  3OUF A;  4GT1 A;  4UV9 A;  5DM6 V;  4JAU A;  3RVZ A;  1ORQ C;  1F23 A;  1S76 D;  1R6K A;  4CBC A;  4ZKI A;  2IU3 A;  4G28 B;  5L3D A;  3NXS A;  3LDE A;  1G8M A;  1F4N A;  1K4C C;  3G71 V;  1YTF D;  3SYP A;  1VQ7 V;  5KUM A;  3SYC A;  2AHY A;  3K9A A;  1NR7 A;  1K4D C;  5L3B A;  4X89 A;  3ABM C;  1AI5 A;  5LGT A;  1BMF G;  1DLB A;  1NBM G;  2XAJ A;  1QCE A;  1FXH A;  1UJW B;  3ABK C;  4QNH B;  3AG4 B;  1FXK B;  2JJ2 G;  1KC8 W;  5LGU A;  4TWK A;  3K0G A;  2ATK C;  4JPR A;  3SYA A;  2EBO A;  2EIL C;  2FTK A;  1Q82 W;  2B5U A;  1COW G;  1EBO A;  2WLN A;  4MVM A;  3ZMZ A;  1AR1 B;  4G2K A;  2NNU A;  4Z1M G;  4Q20 A;  2P67 A;  3RBZ A;  4LCU C;  3ZRV A;  2DYS C;  3OE7 G;  3SYQ A;  3QO5 A;  1P4R A;  1K3E A;  2EIK C;  5B1N A;  1RM1 C;  1SES A;  2XND G;  4DO2 A;  3I56 V;  5EK0 A;  4HZ3 A;  5HFL A;  3MD0 A;  2OTL V;  1Q86 W;  1H8H G;  1OCR C;  1WLE A;  2EIN B;  3K04 A;  3HB3 B;  3WG7 C;  1S72 V;  1R3K C;  3ABK B;  2CK3 G;  2WWW A;  1YTF B;  2DYR B;  4QJF B;  1AI4 A;  1S5H C;  1IXM A;  1BL8 A;  1LNQ A;  1TUE B;  4QPK A;  3RW0 A;  2C2A A;  4JTA B;  5H9C A;  1SER A;  3CD6 V;  4JF3 A;  1KKD A;  2WLL B;  2ZXW C;  2BOB C;  1YJW V;  2DQ3 A;  3CCU V;  2HVK C;  3F7Y C;  1DF4 A;  4MVQ A;  3E8G A;  2QA4 V;  1CEZ A;  2XAS A;  2P7T C;  3OFN G;  3OW2 U;  3ZRS A;  1YJ9 V;  2WLI B;  1H38 A;  3E83 A;  1JCH A;  1QVG U;  3A0R A;  2EIK B;  1F4M A;  2P6J A;  3CP1 A;  5B3S C;  1FS0 G;  1RM1 B;  1JOY A;  4P30 A;  4QE7 A;  1GO3 F;  3STL C;  4PEL A;  5CA3 A;  1OCR B;  3VBB A;  3K03 A;  1GKF A;  4PA4 A;  2Z5U A;  3TK1 A;  3WG7 B;  4JTC B;  3CCR V;  3CMA V;  3CCV V;  4LBE C;  2HFE C;  3W7X A;  1K73 W;  3CC7 V;  3M99 B;  1V55 C;  2DWE C;  4E2L A;  3LSQ A;  1DF5 A;  4U7N A;  3OEE G;  4H37 A;  2ZXW B;  3ETD A;  1H2G A;  1RPR A;  5C93 A;  4R8C A;  1GTO A;  4MSW C;  4MW8 A;  2EZO A;  1THZ A;  2ITC C;  1OCZ B;  5B1B C;  1KD1 W;  2HKO A;  3SPH A;  5EBM C;  3OR6 C;  3T2M A;  2WLJ A;  3CCE V;  1YHQ V;  1R3J C;  3JYC A;  5CMU A;  3ASO C;  1KEC A;  4R7C A;  3B77 A;  4DXW A;  3AG2 C;  2Q6A A;  3SPI A;  1OHH G;  5EC1 C;  4BW5 A;  4MVO A;  2Y69 C;  3ZMU A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...