2EINB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2einB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2einB02
1AAJA 3V9EA 2W88A 4FAAB 3ZDWA 1GS8A 1ILUA 3FU7A 3SBRA 3NJHA 4E9VA 3PXLA 4N4YB 5A7EA 2ZONA 1ADWA 1SHXA 2N0MA 3EH3B 1KCWA 1NWOA 2TSAA 1OOWA 2IDUA 3OMNB 2QPEB 4DP0X 5AZUA 3D12B 1GS7A 1WAEA 1NZRA 2H47C 3IBOA 3NJFA 3NP3A 4G72B 4HIPA 1L9QA 1N70A 2DV6A 3ASOB 1BXVA 1CC3A 3X1FA 4KNUA 4YVUA 1J9SA 3V9CA 2YARA 1JZJA 1RCYA 4X4KA 1X9RA 2J5WA 3QJUB 1WA1X 5I5MA 3NSFA 2IWEA 3N2JA 4P5RA 5I5IA 4A66A 4BXVA 2EIKB 3GDCA 5I28A 2LLNA 2QDVA 5ANHA 4DPBX 2FT6A 3UACA 4BK5C 3AZUA 4GY4A 3OMIB 1XMEB 3H56A 1AG6A 4AI7A 1WA2X 1BEXA 2JXMA 3AG1B 2YEVB 4L0PB 2MRYA 4F2FA 1KGYE 4G7QB 2GIMA 2UXTA 3S3DB 2YAPA 3WNJA 1XB6A 3RYMA 2PPFA 1A65A 1SDDB 5I5JA 2FT7A 4ZK8A 1NIDA 5EHFA 4PAZA 2YAFA 2EILB 2J56A 1JZFA 2DWSA 2P80D 1QNIA 1JERA 1ZIBA 3FPXA 1OV8A 3T6ZA 4DP1X 2XV2A 3NSCA 1MG2C 2XV0A 4KO7A 4HCFA 1PMYA 1CURA 2QDWA 2FT8A 1JVOA 1RZQA 3AG4B 2DYSB 1IKOP 5PAZA 2XV3A 1OCCB 4E9TA 4A2GA 2XX0A 4KOBA 5FC9A 9PCYA 3PPSA 2IDSA 4QLWA 1W8EA 2YAMA 2CUAA 2YAEA 3EH5B 3TBCA 2H3XC 5B7MA 2HX8A 1PZBA 6PAZA 5B3SB 1GS6X 3QJVB 3PAVA 1AZUA 2PP9A 1HAUA 4HHWA 2BP0A 3ZX1A 5B1JA 1E30A 6PCYA 1W6WA 3NJGA 4A68A 4KO6A 3CZUB 3NJKA 4A2EA 2FQGA 3JT2A 2VSKB 4UF7C 3CVCA 3H4FA 2PPDA 2EINB 2FJSA 2GB2A 3ERXA 2UX7A 4TXVB 2PPAA 5I6KA 1N68A 4G70B 4YSSA 3WKQA 3FYEB 1AR1B 3X1NA 3MBWB 5TK4A 3TU6A 4NB7A 2W8CA 4YSPA 4A2FA 3KW7A 1M56B 1X9UA 1BQ5A 1JZHA 2JKWA 1M9WA 1XB3A 3UGEA 4E9WA 2XUWA 5E9NA 2XXFA 1ZDSA 1ASQA 1AIZA 2VW6A 1QLEB 1I53A 4YSRA 1HAWA 2JFCA 1ETJA 4EF3A 2HXAA 2FQFA 3ABGA 4WTQA 4AX3A 1GW0A 5B1JC 4AZUA 2QT6A 4KO9A 2OJ1A 1ID2A 4GP5B 3IN2A 3AG3B 1RKRA 3ABLB 1V54B 4E9QA 2YXWA 1AQ8A 3EH4B 1E5ZA 2YAHA 1TEFA 1IUZA 1AS8A 3FSAA 3FT0A 3KW8A 1PNCA 3FU9A 2IH8A 3NT0A 4YSDA 2BW4A 4GP4B 4K9JA 4KOCA 1AZNA 5B1BB 2BZ7A 4WKXA 5B7FA 4RH4A 1NPNA 2NRDA 4DP4X 5I6LA 4Q89A 5AKRA 4JHUA 3NJLA 3CG8A 3G5WA 1KYAA 3X1BA 4MFHA 4JHVA 1ASPA 4A2DA 2WO3B 4ENZA 1J9QA 1PZAA 3CVDA 2PLTA 2HX9A 2B08A 3PAZA 2PPEA 4BWTA 1TKWA 3ZIYA 1PLAA 3AG2B 3NYKA 5I6OA 1T5KA 2FQEA 2GC4C 2X87A 3NSYA 4DPCX 1NIEA 1PAZA 4CSZA 1AS7A 1J9TA 2IDTA 1EHKB 3QJQB 3TBBA 5I6NA 4E9SA 1IBZA 1M57B 1WS7A 3FQ2A 3BVDB 1NWPA 2XX1A 2RACA 2E86A 3X2QB 1GSKA 2ZOOA 1A4CA 3UADA 3JTBA 3FS9A 1A3ZA 2VN3A 2DY2A 2HLEB 4YVNA 3EHBB 3ZBMA 1ZPUA 1IBYA 1SF3A 1CUOA 3QJTB 3OM3B 2P80A 3FQYA 1AZBA 3WI9A 1GR7A 3ASNB 4AKPA 4F7KA 1URIA 1AZCA 3AW5A 1IC0A 1E5YA 2BWIA 3FSVA 4GYBA 4QKTA 4W1TA 2VMJA 1NPJA 4YSQA 2EIJB 2BP0B 4DP8X 1V10A 5B1AB 1JOIA 4UANA 1OE1A 2Q5BA 3TASA 4YSUA 2EIMB 3TA4D 2AFNA 4A2HA 4A67A 4G7RB 1KBVA 2A3TA 1E65A 3NJJA 2HRHA 2VSMB 3DTUB 1FWXA 3X1GA 2IAAC 2TSBA 1TEGA 1UATA 3QJRB 5D4IA 4DP6X 2J57A 3FU8A 2GI0A 1MZYA 1SFHA 3OD3A 2I7SA 3OMAB 3GYRA 4HHGA 4NERA 3NP4A 5B1KA 2ZXWB 1MZZA 4BXSV 1NIAA 1OE3A 1BQRA 1ASOA 2DWTA 2IDQA 1A8ZA 2J55A 3CVBA 3S3CB 4BDVB 2QPDB 1BYOA 2CJ3A 3SBPA 2GSMB 3X1EA 4F2EA 3S8GB 5IY5B 1SJMA 3HB3B 3PLYA 4BDVA 1AANA 3DIVA 4BWWA 3N55A 1AG0A 2GHZA 1BQKA 2FWLB 1RZPA 2UXFA 4DP5X 2UXGA 1F56A 2VM3A 4KNSA 1R1CA 2CCWA 4AKOA 3FSWA 1W6LA 2H5UA 4M3HA 3QQXA 3FSZA 2X88A 2Y69B 3T6XA 1VLXA 1ZV2A 1V55B 5I6PA 2GC7C 4DP9X 1CYWA 5TK2A 4HALA 5D4HA 2WSDA 2DYRB 4G7SB 1ET8A 1PY0A 2PCFA 1ZIAA 4DPAX 2BWDA 3S3BB 2Y1AA 1SF5A 3U25A 3T6WA 1PCSA 2I7OA 3CDZB 4CSPA 1AOZA 1NIBA 1YLBB 2R7EB 3QJSB 2FQDA 1FA4A 3WIAA 3S8FB 3T6VA 1NICA 1XB8A 1KDJA 3CDZA 1BXAA 2R7EA 2Q9OA 3SBQA 3PCYA 2YAOA 2I85A 4DP2X 2GBAA 1KDIA 7PAZA 3H4HA 1DZ0A 3IN0A 7PCYA 2YXVA 1DYZA 2UXVA 4YL4A 3WKPA 1JXFA 1PLCA 4PCYA 4DP7X 2BO0A 4E9YA 1JZGA 4E9RA 1OCOB 2FNWA 2XVBA 2CBPA 3NSDA 4HCIA 3UAEA 4YSCA 1PF3A 3C75A 1SFDA 4KO5A 2AZUA 2PP8A 2OV0A 3WNIA 1BYPA 3T9WA 2MTAA 5I6MA 1OF0A 1E67A 1MDAA 2BZCA 4GXFA 2ZWNA 1J5DA 2AVFA 1EZLA 1GY1A 3AY2A 1JZIA 2XU9A 1L9TA 2VW4A 5B7EA 3QPKA 1JXDA 1A4BA 2HZHA 2XYBA 1HFUA 4YSEA 1AZRA 1GYCA 3HEIB 1ET7A 1KBWA 3NJMA 2AANA 2BHFA 1JXGA 2XWZA 1AS6A 2XLLA 1SDDA 3UAAA 1CYXA 4P5SA 1L9PA 4YSOA 1JZEA 4FA7B 5F7BA 1PNDA 3UABA 2PP7A 5F7AA 2BP8B 1OCZB 1TU2A 4UAHA 2IDFA 2FTAA 1KCBA 2YQBA 2HX7A 1PZCA 1SHWA 2BP8A 2AZAA 1L9OA 1OCRB 1B3IA 5PCYA 1ET5A 3OQRA 3GXUB 2CALA 1KV7A 4HZ1A 4HAKA 2VM4A 1NIFA 2YAQA 3DKHA 3PAUA 3L45A 3FYIB 2PPCA 4Q8BA 4E9XA 1NTDA 2IH9A 2UX6A 2WO2B 2CAKA 3NJIA 5I26A 1J9RA 3IEAA 4NAJA 3WG7B 5D4JA 3FPYA 4GP8B 4M4RB 2VW7A 1BXUA 4G71B 1PLBA 3MX0B 2XXGA 1NINA 4YSAA 2IWKA 1BAWA 3T71A 1OE2A 1SNRA 1A4AA 1JVLA 2BW5A 1ZDQA 4AKQA 1J5CA 2OCCB 2HRGA 1WA0X 4HCGA 4YSTA 1L9RA 1WS8A 1AACA 1QHQA 3BQVA 4N8UA 1MG3C 3IE9A 3NJNA 5AFAA 1FFTB 2PCYA 3ABMB 3SQRA 4W9ZA 1GY2A 1NDTA 3EF4A 8PAZA 1ILSA 5LDUA 4JKNA 2B3IA 3FU7B 3ABKB 2IWFA 1L9SA 4BWUA 4KNTA 3FQ1A
chains in the Genus database with same CATH superfamily
4M8VA 3CUPA 3PGFH 1AAJA 4DUWA 1GYUA 4FAAB 1JGLH 4K35A 5D7KD 4NFBA 2YPKB 2WPGA 3CHRA 3GUTB 3Q8CA 5E5MA 4AIXA 2BNUB 1KCWA 5E70A 2TSAA 3DTXA 2ADIB 2VABA 4C55A 5ICYA 2C9QA 4BUQA 1R5VA 3OL2A 2NXYC 4MJID 1T3FA 4GKOA 2LGWA 1UA3A 1IU1A 2IDCA 3HS0C 1QOKA 2VDKL 2VN5A 3QDAA 4KNUA 4PLKD 5M7QA 4JDTL 5CD3B 1KUQA 3BH8B 4AZ8B 4Y2OA 1NLBL 2X6UA 5FWQA 3NSFA 1S7XB 4TM9A 3WUWA 3UO3A 1JF1B 3KJ4B 4R7DB 5BRZA 3GKZA 2VCOA 2CA3A 5IW3A 4LAQH 2EIKB 1A4KA 5DEFA 3PABA 2VLRA 2OLDA 5ID1B 2FJUB 4I5BB 4FA6A 1T6WA 3LZPA 3K0WA 43CAA 4QGPA 1SN2A 4JDVB 1VGKB 4RGOL 3V10A 4FTVA 1UM4L 2L7QA 1X5AA 4IGBD 4AYEC 1MQKL 2EDWA 4J6RH 1DUZB 1BEXA 3G3LA 3RUGA 1Q72L 5A2FA 3JV0A 4IJTA 3LMJH 2DOCA 4JHWL 1MVFA 3OB0H 1DQDH 5LMNO 1JHKH 1WC7B 4K0OA 5T1KD 1ZLWK 5DLML 5BV7C 4FXKA 4X89A 2FT7A 5CJQH 1EEZB 2YQ2A 3D06A 4UQBA 4HS8H 3FMGH 4K23H 3N2KB 4HPYH 5EHFA 3BUPA 5F3HA 4G82A 1U6AL 2Y06H 1LP9E 3FUIA 3V4VA 3A22A 5IFHL 1Y66A 1ZGLP 2P80D 3MPCA 5IBTH 3TS8A 3AK1A 3AY4A 4IEFB 1UC6A 4L48A 4PY8J 3LSSA 1QFWL 3NXSA 1P6FA 4RETB 5DD6B 3FL7A 4G6KL 3NSCA 4WU5A 3RBSA 5GXBB 4N3UA 3MLPA 1HEJC 3AS1A 1OB0A 1ECZA 4Y2NA 1KN4H 2HAZA 4NBXB 2AMGA 4P5KB 1RIVH 4KUZL 5E4EC 1JMZA 2NY1D 3E2HC 3NOIA 1RZQA 4H33A 4PJFA 3THMH 4MAYC 4OSUH 1O0VA 1H8EG 4HH9B 5AAWA 2UY6B 3CQFA 5I1HH 4YWGL 2AV7A 1R3LC 2H0JA 3TBCA 2X4QB 5TGBB 3AREC 5B7MA 4ISVB 1R0AH 5B3SB 3UBXB 5JDJA 5IWAB 5FPRA 4NLHA 3B5GA 4D6TH 5GZOC 4C8XA 4R4FH 4U1GB 3TIDA 4G80B 4HHWA 5KSAA 4OF5A 3UAJA 7FABL 3CJJA 2P5WA 2P06A 4J28A 4A68A 4A5UB 1FDLL 1HDMA 1MVUA 4LLYB 4JTAB 2CO7B 4R5TA 4CC4A 4E41E 2XRAL 4DGVH 4K3GA 2QTSA 3KLAB 1IX2A 4HKXA 1T1ZA 3LRLA 1A6TA 1YY9C 4JY5L 4K4KA 3FB8A 1R47A 4YDLC 1RD6A 3CPLB 5SX5K 1CGYA 1JTTA 4NNYA 4M9PA 3ECVA 4GLRH 1QNMA 3NPSB 4JI1B 4OFYA 4B3EA 4LF5O 2NQCA 4JPVH 3IFOB 1O7DE 3RN4A 3Q2WA 4F8NA 1G9HA 4GBXB 1N59B 4PRBB 1AIZA 4K3DL 2D03H 2Q8VA 3ZRFC 3JWNG 4PJ8D 3FOMB 5DMGD 1N6QL 2OTLV 3LTVA 4X4MA 4J4PD 5J13B 1QD0A 4XBMA 4NAQA 4NT6A 5KSBF 2ITDA 3HCVB 4TSBL 4NI6A 3CLFH 2A0LD 3P30A 2ODHA 2YICA 3V5DA 1AXIB 1VB9A 2XN2A 1E2VA 4N6RA 1CIDA 3TBWA 4HQQH 5C1MB 4FJYA 1Q81W 5HJBA 3SKMB 4XCYB 5HJ3A 1XF1A 3AQDA 3UG3A 3U0TA 3FQXB 2JGDB 5EN2B 3KW8A 1KCSH 2J43A 1YEEL 3OVUB 3M17A 3WL9B 4ODSL 1CD9B 3BSGA 2NQDA 2NNXA 3N42F 1NMAH 5ESAA 3WLWC 5FB8B 5LDSA 1AROP 2YWZA 1HESA 3GMPB 1UG9A 2BK8A 4XBGA 4X6BB 5DJ2A 1WRFA 2SODB 2FEEI 5I1KL 4FQHB 1THZA 5ISZB 3QA3B 2MCG1 4LHUG 4X6FB 4Y9FA 2OIEA 1UASA 2X70B 3EADA 3GXPA 5A7BA 4PWEA 1E5UI 5IMOA 4MTGA 2HX9A 2NY5L 1H3WM 3PAZA 4PJBF 3GMRA 4J27A 3BPCA 2K9FB 1A6UL 4JRYD 3OZLA 3HS9A 2P8LA 4HLZH 2PXYC 2ZPKL 4AVIA 3QFJA 1IGIH 1INEL 2GITB 4GAGL 1S9WB 3HG1D 2EYRA 3QDMD 3GM8A 3WNLA 1WS7A 3P4LA 2B0SH 2D4FA 2JF1A 2UYLA 3DGGB 1BVZA 3BMWA 3NFPB 2BY2A 4P05A 1VACB 1LEGB 4YE4L 2E86A 1BVNT 1A4CA 3UADA 3QWNA 2CKNA 2VN3A 2DY2A 2N59A 2L04A 1KTJA 1FFOA 1M1SA 1MRFH 5AW3B 4HULB 4X5RA 4RMBA 4QRFA 1FFNB 1DDTA 2ZAIA 4AQ1C 4KUCF 2WTRB 4OCSH 4EN3C 4S11A 4O51A 3DX8B 4ANWA 2ZOUA 4X5XB 4LOFA 1G7HB 5F1SA 4J10A 3FCGA 4GT0A 3CE1A 4A7VA 1IC0A 1YCIA 4PJ5A 1WWBX 4WV1C 3WY1A 1XH3B 3K79A 2B1AL 4IBSA 1HX0A 4DZ8A 1NPJA 4YSQA 2YS4A 2EZ0D 5HVHB 4ELMB 4ANXA 3ZHRA 4U6XB 4WFHE 1NCTA 5FYKL 3CC4V 3NGBC 4K15A 4Y5XB 4YDJA 3H0TB 4R96A 5BZDA 1XF2B 2EIMB 2IGFH 1B0GB 4S1QL 4F33A 2BHUA 1A7NL 5BR8O 1JG9A 3NTCH 3DJZA 3S3SA 1ZT1B 3G5VA 4LFBO 3G67A 3P77A 5KLVH 3QZBA 5KX5B 2DWDB 4KKZA 2IQAB 3II2A 1FHGA 1B2WL 4W9IC 3SYOA 1Y6KR 2Q6WB 3ZZSA 5EBLA 2ESVE 3HBPA 3B7RL 1HE7A 3Q8FA 2NXYD 5FUZH 1ZL8B 2V7NB 2ZCLH 4RX4A 2VXTH 4LHUA 1Y6XA 2Z31A 4XHJC 4O4JA 5AG8A 4OIAA 1BQHB 1CLZL 1FNGB 1S7TB 5FDYA 2LTQC 5GS0C 2XZQL 2BFGA 2WO4A 1JYXA 4NXNO 5F1IA 2QPDB 2W9EL 5C07B 5CEZE 4FQLL 3SGKC 4J39A 4JB9L 2AITA 4YC2B 2ZICA 1A3RH 2V9QA 4OF0A 4QAMB 3U2JA 2OSLB 1L3WA 3VM7A 5ADOL 4LL4A 1AANA 3KPQB 1Q86W 3M99B 5FO9A 1M6UA 2OXGA 1H5BC 1NCCL 2ZWSA 4R50A 2VZSA 5J9PB 1XGQA 3LDBC 1NAMA 4HNAA 3EJSA 4LVOC 2WJ7A 3DTDA 5DZOA 4KJPC 5TE6H 4JZNA 4UILH 4I18C 3FH7A 1HZKA 1R1CA 5CZXC 4QEGA 4TUJB 3TYFA 4GKKO 1EJ8A 1ACYH 3FSZA 2Q7YA 1MSWD 1UM5L 2QVKA 1VLXA 3HIZA 2OPCA 3INUH 4KU1A 1V7NL 1UJ3A 2UWEA 1DVFB 2N7BA 3FTVA 1AILA 2F2HA 3CQPA 3EYUH 1G87A 5I8KH 1ZVNA 5GTHZ 5JO5A 1B0WA 3QUML 4AE1A 2EDBA 1OF2B 5L3BA 2QGCA 3ZHLA 3OHMB 4MCZB 4FM0A 4EBQL 5HYJB 1L0LH 3WN5A 4LF8B 1SF5A 1NSNH 1G84A 3MLWL 4C4KO 3MXWL 2XAGA 3ZYZA 4JI8B 2Y07L 4CMMB 1T5XA 4WO0A 1R3HB 5ESVB 1D6VH 5FK9A 4UB8Z 3GIZH 1CFBA 4FG0A 5DUPH 5IM7B 2DIEA 3F3HA 3P3UA 1VKXA 2HKHL 3BKYH 2V5SA 3LQAL 4QTHB 5AVZB 1U8HB 3ZYOA 5I19H 5AZEL 1BXAA 4PB0H 2GAZA 3V0WH 1IC5H 1ETB1 1VZHA 3GPSA 4A7GA 3T6QC 3PCYA 3AACA 4Y1AA 3W39A 3BVXA 1P4BH 1TA8A 2F93B 2HLAB 3M1BA 1RJYA 2OIGA 1NVPD 2ZYIA 5C0EA 4MAYD 2PTMA 1QQCA 3OHXB 3DO4A 5AAMC 1IGTA 1U8CA 2XBDA 3WFCL 1FUNA 4F2MA 1CFVH 1KJVA 5L6YL 2XKSA 4B3RB 1YUKB 5L2JB 2C5DC 6FABL 1LMKA 4M8QB 4AUYA 4GUQA 3KCPA 5IK3A 1F13A 1R3JA 2HWZL 2VISB 3ARED 4HX1B 3W57A 5T3ZD 3OE7G 4PD4F 2XVBA 2XG5A 3H6JA 4ZTPH 2HN7A 3CN0A 4HCIA 1K4DB 3PHQB 3VFVA 5EEXA 3RWHA 5LGKA 4ZUUB 2VR5A 1E5CA 4NRZA 2CDEA 3I6KB 4DO5A 1XXFC 5EN3A 4FQQA 2XPGB 3DLQR 5FFGA 4HOXA 5J0BA 3WTVA 4QXGL 2BZCA 4JNXA 2AVFA 4FKKA 1Q90A 2DMBA 4HHAB 1A6AB 3OKKB 1J5IA 2GABA 3K57A 2ITCC 4FLVA 1BD2B 3BEWA 5JHBA 2YXYA 4M7LL 2Z0AA 3MROB 2FNBA 5DEZA 3TZVA 1QR8A 1HFUA 2PWFA 5B1BC 3EG9B 4XMPL 5HHOA 1ORQA 1AKJB 1OAYH 2E0PA 4P4KA 5J6SA 3F05A 2WK2A 1QFHA 2FGZA 5JVDB 1IC4H 3TYGH 5DEJA 1R3IC 1KCUL 1SDDA 3GTTA 4JFEB 4NC0B 2A6KA 1KYFA 2HKAA 2PTVA 4NP9A 3IGAC 3LNFA 2VN7A 3H6AA 3LCYA 2BP8B 2F5BH 1D9KA 3B8SA 3EYVB 1XL4A 1ETZA 1PIFA 1TU2A 4FFZH 4UTBA 5JLZA 3UMNA 2Q7AA 1F8TL 5IMKA 2AZAA 4KTEH 4F37F 3VB8A 2OM5A 4P49A 3QHZL 4C56A 1FBIL 4QOKB 4NIKB 3WN6A 1OGAA 5I6XB 2V4LA 3JT0A 2MK3A 2XT1B 3LQMA 1JP5A 4HZ1A 4WFAV 3L08A 4NUJB 3VFOB 3IDIA 1P5UC 4R26L 4G3YH 3STZB 3UTTB 3RKDD 3F7KA 3NPZB 4ABWA 1WUZA 1RIUL 4PA3A 1S7VB 1K85A 1FJGB 4YBLB 2DQDH 4WEUD 2WUCL 1NUFA 3MUY1 2QM4A 4WI4A 5LBSA 2BS9A 4FQCH 2VW7A 3ZRVA 3B3IB 3F5WC 2AI0H 4G71B 4PM1A 5A9GA 4Q6KA 3WLWD 3MX0B 2EEXA 4GQRA 4M5SA 3KDMA 4ESKA 3NACH 2OXHB 1Q1JH 2EDRA 5CGBA 1FJ1A 5KYXB 2XN9D 1SNRA 3CX2A 2ENSA 4MKMA 1U3YA 3JVGA 1J5EO 4XNZC 3QS2A 1ED3B 4DR5O 1XF3B 2WXRA 3U1PA 1SVCP 4ZAKC 3UTPE 4Z7WE 1QFWH 4FXGA 3V8OA 2APXA 5AFAA 2VDRH 5LBQA 4JREC 2OP4L 1FFTB 1GRJA 2PXYD 5F0LB 3WOVA 4UVCA 5K9KB 1GY2A 2PW1A 2XQ0A 2GPZA 4TOYL 4YEFA 2B3IA 3FB5A 4Z0XA 4LE8A 3ULUF 4JYYA 5I73B 4WFFD 1I9EA 1RL1A 4P2CG 5FF6A 2EH7L 1N7ML 1AGEA 4UDUB 1FH2A 2W88A 3MRKB 4NWUL 1P7GA 4FNRA 1DTOA 3FU7A 4O2FB 3NJHA 2ZSVA 1WWCA 3BGFB 4PJ9B 1E4KC 2EDYA 5IFJA 3IAPA 1K3ZA 5EEYA 1ZT4B 2QKAA 2R70A 3APQA 3JCUZ 1AO7E 1IAIH 1WFTA 3DHMA 5AZUA 2H3NA 2DMCA 3GJFH 1QBLL 3CFCL 4PJHA 1RVFL 3ZHTA 4EN3D 1VHPA 2H0EA 5HP5A 2DQCL 4MNGE 4ZOEA 5IY5C 1Z0MA 4GOSA 1OTTD 2YARA 4BQCA 3S37H 5D7JA 3O6KH 4KTGA 4EI5A 2W81C 1H9VA 1WWWX 4XCCH 2VE6B 3I3BA 4Y4KC 4PSPA 4JM4H 1JGDA 1EZJA 2ZP8A 3TO4B 1NGPL 3OJDB 3V4PH 1YYLL 5K1JA 2XQBH 4P3CL 1GCFA 1YMMD 4DVBB 4XTRC 4WFED 3TVMB 2E7BA 1FXKA 2JKNA 1TVDA 1RUPH 2P5ED 2GTQA 4DV1O 4AEIL 4YUEH 4ZNEE 3OMIB 2IU3A 2Y5TB 2F53A 5DC0A 1ZV5A 4CZZA 1JA8A 4FEIA 1DN2A 1EUTA 1NPUA 2FO4B 2K4WA 2WP3O 3IF1B 5I15L 3F7VA 1ZLSL 1HIMH 1YN7B 4F7CA 5F71A 5K9OB 2MHAA 1CDJA 1T80A 2ZKWA 2X4NA 4PJ7A 2FYYA 4JCWA 2A2QT 3K2UL 4U1HB 3TEUA 3BYTA 4I0XA 4K71B 4XHJD 5GGVH 3BP7B 2OMZB 4TWKA 2H26B 2J2ZB 3APNA 3D3VA 1CDIA 4Z2WA 2R29H 5GGSB 5GS0D 4XPTH 2H0PA 1F6LL 3GIVB 2XI9A 1MW3A 3V4UH 2YPVA 3EYFA 3L5XL 3G80A 1KV3A 4ODUB 5CIPB 4U1SA 2GJ6A 1AGCB 3MBEC 5EIIB 3FQ4A 5A2IH 2R0LH 2CDFA 5LNEA 5BW7C 3WGUB 4OAWB 4E0RB 4Z7NB 2C9XA 1NOFA 3QIUC 4W6YB 1Q9KA 2FX9L 1BZ9A 3ATEA 4HT1H 4TQPA 5ICXB 1RSYA 2P52A 4B3MB 3ILDA 5EULV 4E41B 4K7PH 4K9EL 1TZ8A 1DJYA 2HFGH 5CZXD 4YHZH 1Q1PA 1R3KA 4KOBA 1N8ZA 4M61A 2RQ8A 3IDMB 4ZXBA 2MTPA 5CP7A 4C47A 1T22A 4NZTL 1A6WH 2I26N 3VWKA 1ZAUA 2XOTA 1M90W 4HCRH 1A6VH 1OPGH 2KKWA 3BWSA 4Y19D 3TWCH 3SJVE 2WOBA 1MW2A 3N2GB 3TNMB 3W9EB 4NNXA 3Q2CA 3O45B 2VZOA 4N2FA 3CCJV 2KQXA 4PRNB 4PWHA 2JCCF 1W6WA 5FYLD 1XGTB 4XP6H 2WM0A 5CP3A 3VFPB 3FK3A 3S9DB 4RQQB 1QZ1A 4A2LA 3N5AA 2Z3YA 2FJSA 4XP1L 2EDNA 2ZWZA 1J0JA 3DBSA 4NN6C 4Q2ZA 5L3DA 1JDAA 3AWEA 5BMVB 1KCRL 5BOJA 4ZI8A 4GMSL 2OWOA 2UUDK 2VDLL 1CICA 4YSPA 1VQ8V 1S78C 1TPXC 4LWSA 5I23A 5FLVA 1N8RW 1AC6A 1NKOA 5CGYC 1NFIB 2EIZB 3L71H 3F58L 4TLKA 4ZQTA 2YGOA 3GMQB 5AKTA 4CU8A 4Q52A 4WK0B 4NWTL 3ZTCC 2AZ2A 5E9NA 2ZP0T 1GGUA 3WE1A 3U6RB 3AG4C 1ZA6B 3D1MC 2NY2D 3VH8G 5JPNA 3NCEB 3JWDC 4ZMXA 4KHTH 1J0KA 3O3AB 3T4YA 2VDOH 3UTZA 1MFBL 4HUVB 4L4JA 5LOVA 1SS3A 4KTDL 4MMZC 5LQBL 2DQEL 2Q8BH 5B3JF 1ZCRA 3B83A 5FCUH 1FD9A 2V5TA 4DR6O 1INDL 1QVFU 3ZPDA 2Z3FA 3OD4A 3MNWB 4H0LB 2DLHA 3R06B 4XDLA 1JNLL 5IOKA 2FECL 3HKEA 1RKRA 3BMVA 3US1A 2HVKC 3P73B 1FIEA 5FYJD 3T0XA 1N5AA 1F3JB 4XI5C 2IH1C 4KQ4L 4FLUA 5J8OA 4L0YA 4UM9D 4QLRA 5H4YA 2P43B 1ID5I 1B2WH 1L0PA 4O2BA 1AZNA 3VU2A 5DD1L 1D3CA 4DO4A 3M8AA 1TG8A 5B7FA 2P42B 3ZSTA 3QDJA 3H2QA 1AR1C 4O4LB 5AKRA 2MPAL 1HSBA 2R69H 2XWRA 1RZJL 4YFLF 2NXZB 1S5LZ 3H1KH 4RUEA 3KLDA 3MGTA 4JHVA 4UB0H 2JTYA 2O57A 4POZC 3RWEB 3ZSSA 1QLEH 1RM1B 5EZYB 4L4TA 1U58A 1QCEA 2IJKA 3MNZA 4GUPA 5EU4B 3J27A 1F2XK 2YI8A 5F7YC 4WFGD 3DSFH 1A5FH 4JN1L 3V52H 3IFLL 4CDGC 4P3DB 1BFOA 4MQ7A 3QR1A 5I1AB 4ZDHA 4WENB 2QQKL 3QG6A 1DVTA 5CMUA 3NDZE 3A67H 4V1DA 4UV4L 4N0YL 1AJ7L 1W2BU 4POUB 3NCMA 3OBAA 5EOCJ 4JUTA 3KH4A 1UD4A 4JVWA 2DTSA 5IWLA 3A23A 3UH8A 1SJEB 3UZVA 2FZ3B 5DR5L 1S8DA 3FKSG 2G5RA 2VJXA 3QUMH 3ULSB 2Q0ZX 3VH8A 2FB5A 5BO1H 2BFVH 3QZWB 5LN4A 1S3JA 1FZKB 1DJZA 2OTWB 4B60A 4Z0BH 1CDYA 2GCYA 3H9SD 4IBTA 4ONHA 3OKOA 3U0PB 4HUWB 1HHGB 3PP4L 4HAFA 2Y07H 3RNKB 5E4OA 1AZBA 3P3TA 4HUXA 3FO1B 2ATKC 1GR7A 1HOCB 2R2BA 4LRNL 1GTNA 4QT5B 1RERA 2ESVB 4CADB 3K1DA 4E4EA 3GSWA 4F27A 5DC4B 3TH3T 5A2KH 3W3BA 1NBYB 1XR9B 4EE2A 1MCDA 4KX8A 3GF8A 3IPFA 4DR3O 3ETDA 1BP3B 4MZIA 2HFFB 3UP1A 2EH8L 3HPJB 4GNKB 1X5JA 3GXFA 1XIWD 1Z32X 2QBWA 2QQLH 5E95B 3MLZH 4MBOA 3T1FA 3MQIA 3QORC 4DQOH 4M48L 5ICUA 5C08B 2ZYRA 4AQZA 1D5IH 1I7ZB 1KBVA 4HGMA 3L9RA 3FN9A 1XSKA 3QAZB 1E65A 4GSDH 3RVUC 2EP6A 3VGAC 5JIPA 1G7IB 3SDDA 2HYMA 1UA6L 3ILPA 4IK6A 1OEZW 2M83A 4H8WH 2D73A 4GRWH 5CBAA 4LCYA 4UT6L 1NH2B 3Q8EA 1N36B 3CX5J 3QJHB 1U3HC 3D4YA 4Y8DC 2WCSA 1J5OH 2X3BA 4DVRL 3A3YB 4OQTH 3EXJA 1XBDA 2G0KA 4AC4A 4D94A 1YTFD 4BKTC 4Y4KD 3EHBC 2E4FA 3CXCU 4M6OL 1SKVA 1A3LH 4EB6B 2WCPA 4UDTB 3X13A 5FHAH 5KVDE 4MXVE 3F83A 1MAJA 4XTRD 2QSTA 1AG0A 2Z92B 4S1RL 5GRJH 5I0ZA 3VJ6A 1L0QA 1E6JL 1MXGA 2JEUA 4FFYH 3MNVB 5I76B 4AEFA 1UEMA 5ITBH 3OAUH 3U0WL 2BVPA 3S34L 5B66Z 2VM3A 1X5LA 1IQDB 3MUGA 3QUXB 1OW0C 1JHLL 4M3HA 5GSVA 5A2AA 2G9HB 5IV2B 3GB7B 2K6YA 3E8VA 2YRLA 5FECA 3C09C 4M1DH 2P44B 1KIPA 3MR9A 1CG9B 1SEQL 4BK5A 1IGCH 2AJYH 5CCHE 3L1EA 4WEBL 1ACZA 4CDHA 2P7TB 4Q56A 1H3UA 4O02L 1NMBH 2P47B 5KYYA 3BEVB 4JYBA 1EH9A 2NW3B 2GTZA 1ZS8A 4OCRH 1YLBB 3D52A 2GSIA 3ARRA 3MBED 1BLNB 3RWFB 4QJ4B 4OF3A 4J7JA 2NY3B 4HZAA 1LE5B 3ZL2A 1QX1A 1I3UA 3LN4B 5MEND 4IU3B 3IB4A 1YEHL 2R7EA 3QIUD 3OKLB 5IJVA 3IDNA 2XDHA 1E4XI 4BFIA 5KZCB 1F58H 1KQSU 3MNMA 3OZKA 5BS0A 2NYKA 3WJMA 3NRPA 3QHFL 5DFVC 1JOYA 4I9WD 4YK4C 4CC1A 1PIGA 1JN6A 4MRCA 3GO1L 4F3FB 4U1JB 4AIZB 3FO2A 4NP4H 5FW8A 1DQMH 1E9PA 1PLCA 4UTAL 5KSVA 1RK0B 4AYFA 1TDQA 4JFPA 2BO0A 4DK1A 4NCC2 3VXSA 3HKBA 15C8H 4H26B 4KL1A 2HFEC 3GKWL 2NNUA 4KH2A 2BDNL 4ZFOA 3RYFB 4MVQA 3UYRL 1S7UB 3KS0J 1FG9C 5D7SL 2BSRA 2APWA 4AQOA 5IW6A 4TQDA 1JWUA 3Q05A 4CMHB 4NYLB 4KHPB 5LHHA 4IHBA 3N1QC 4L4VA 2OKMA 2VJ0A 3N40F 1CFMA 4JPWL 1EUUA 1KB5A 1J5DA 3BPOB 4HH8A 1B6QA 2FTKA 3QO8A 3GINA 3PWVA 4PRDB 4TVPE 1W80A 1N0JA 2LW3A 1O9WA 4Y5VA 1N7MH 5CN1A 3RAJH 1JXDA 5DEGA 3RUGF 4LKXB 1TUEB 1SF9A 4NWUH 4QXVA 1QHPA 4YHNA 5IJ0B 4RNRB 3RFZA 4QCIA 3L7EA 1S78D 1FYTD 4GI9A 1AIFA 2N1TE 4XX1E 4AV0A 4RWUA 4FA8A 2IBZH 2OTPA 4HOMA 2JK5B 1I1FA 2GBVA 2NY7H 3L2MA 5F7LB 1J5HA 5C0BE 3A6CL 3WXVH 2J1KA 1IBMO 3L9DA 3HPLA 2KB1A 2VC2H 1V7ML 4GKNA 5K5YA 4ZOAA 3S35H 2R8SL 1ROCA 5AL8A 4KMQA 1M6OA 2OK0L 3CCHB 3SQOL 3QUKA 2BS8A 1PZ5A 3PQYD 4N21A 1GGIL 3CSBA 1L9OA 1OAJA 4MAUH 4UQAA 1DL7H 3NN8A 3T4AC 1TITA 4PJFF 1M1XA 4K3EH 4Q6IB 2IOOA 4L8SB 3B9DA 3GK8H 3PHOB 5I1JL 5DMIH 3RVTC 1GH6A 4J9ZB 3GUFA 5KW9L 4Z7WB 3SDXA 1DBJL 3GSXA 3RWJB 2IH9A 5JWPA 4WTXA 5C0CD 1ZTXL 3WIHH 2FAUA 2O5XL 1AGBB 1FSKB 2A9CA 2IAMC 5HVGB 2ADYA 5L4IA 4UIMB 1TVHB 3GRGA 1PLBA 4HWZA 4XCNA 3D36A 3SDAA 4ZW3A 2UXNA 1BAFH 2PW2A 3FN0H 3WCYA 1EFXB 1AR1D 1QO3B 4UCOA 2XWJA 4IRSA 4GT7A 3T71A 2H6PA 4IRJC 1ZDQA 2I9TB 4AK2A 4GIOA 3GRWH 4HCGA 4DV3O 4G42A 4POZD 2BOCC 1OM3L 2I5YH 4OB5L 1A7QH 1KIQB 1PJ9A 2PR4L 4NKDA 3HS8A 4KXDA 1KXQA 5B21A 4QNPE 1AO7B 2AV1B 5DSCB 1RURH 1I1RA 3OEHG 2HJFA 2BOBC 1UCBL 1W2KT 4CS2A 2AEWA 2WQSA 4KI1A 2FUQA 4HF5L 2ODMA 2BNRD 4A6YL 4MNGB 4LQ1A 2Y24A 1KGCE 1G7QB 3ARDC 2XTLA 4WWPA 4CVZA 4IBZA 2JLPA 2Y2WA 4XWOC 1ZLWH 1EHXA 5DA4A 3V79C 5IE9A 3D51A 2E3CA 2DZEA 3BUIA 1J1XL 2FD6L 2VDQB 5EBWA 5CO1A 1F4AA 3SBRA 5I2IB 4ORGA 2D31A 2VH5L 4E9VA 2ZDIA 3B6SA 5JHLL 3HNVH 3KHOA 4Q14A 1G9ML 3IAQA 1XSJA 1E43A 3LHPL 4IMKA 3NCJH 3ZE0F 2ICCA 3VWJC 1A47A 4MMXB 3JVFC 1D6EA 4HSCX 2Q87A 2ZJSL 3IJ9A 4GKZA 4FNSA 4LASL 5T5FH 3OJVC 3S5LB 3MYJA 4MVRA 3DX3A 4X4KA 4KQ3L 2X9WA 3VO0A 4Z7QF 3QRGH 4AGQA 1NL0L 4KX9A 2HEPA 1CZ8L 1DP0A 2VS0A 1U33A 4P5RA 4XVOA 3CHSA 1D5NA 1BZQK 4HIIA 2CK2A 5DEDA 4O4YL 2CLVA 1LUWA 35C8H 3TH2T 4A7TA 1GHFL 1KN2L 4KGJA 5GW7A 5EO1B 3VXUA 1JZDC 4N5UA 3QORD 1H3GA 5DVLA 4TUOA 2XIIA 5JPMB 1NDGB 3GWJA 3KBHE 1NGWB 1DBMH 4GQ9L 2O6FA 2APSA 5IB5B 3D9AL 3RVUD 2NY0B 3SOBL 4HIXL 4H8UA 1T66D 1OIOA 3AG1B 2DQFA 2WUBL 3GS7A 5TDPB 3B2UC 3S3DB 3EO1B 4LNRA 2FHFA 1NC4D 4MA3A 3R0NA 3HA0A 4AGNA 4JHBA 1GKOA 1AGFB 1T7WA 5SX5H 2DWSA 5G55A 1JWSA 3CFIC 4I3RL 4LF9O 3EHBD 2E7HA 2BXZA 2P24B 2DMXA 1MJ7H 3JWOL 2FO8A 1GOHA 3SJVB 4B9GA 4NM4L 1WA8B 3VX0A 1YAZA 3DRTB 3LQAC 5EC1B 2YUWA 5MP6H 4UNTA 4Z5RB 4Y9BA 1PAMA 3KL5A 4HCFA 1RUAH 1FL5B 3DDGA 2CA4A 4I87A 5AYUL 2DKSA 4HLZG 1U96A 1NBZA 3VFSA 1J1PH 5FFOA 2DYSB 4ZFFB 1ZPLA 3FQNB 1COBA 1OHQA 3KJ4C 3LKOA 1OCCB 5T3ZH 3VI3A 4A2GA 3WTXA 2QV2A 4YHIA 2EIKC 3SYAA 4LH6A 1OCWL 3A21A 2QJ1A 2DWYA 2IGTA 4ZSOE 5EUKA 4FABH 5C0JA 1XD1A 5HDBE 5D2LE 2GT9B 5CCKL 2DQGL 4RIRA 2GTWA 3TFBA 2V2WA 1Y0LB 3VI4A 2ZKMX 3RB5A 1N32B 1Z2KA 4UMGA 3RGVA 2FSEA 5B1JA 2PYEE 5IMMA 3IFLH 3RYIA 5CMAB 4YDNA 4X7SH 1XILA 1KCLA 3NJGA 4FXLA 2VAAB 3ZHUA 2COVD 1MCNA 3P3SA 4I0PA 5E6UB 4HZLB 4F93B 3H4FA 2QR0A 4JG0L 3BJ91 5LMUB 1T04B 1N2RB 2R1YB 3AT8A 4ZPTA 2UX7A 4RZCA 4QHKJ 5IDJA 2IAND 2FIKB 4L23A 1QAWA 5JZ7C 4WHYH 3HZVA 5DFVD 5HHMB 5T1MB 1RPRA 2W8CA 2K3HA 1CB4A 3M86A 1BQUA 3BQUD 3BN3B 1E1RG 4HWBH 1QHOA 1Q9WB 2V8MA 4B9IA 2NNAB 1CVRA 3BH4A 1B4JL 4HZ3A 5LXVA 3SGJC 1NGXB 4LL9A 32C2B 3KWVA 5C0FB 4UV8A 3EZ8A 2GBTA 2B59A 3NUKA 1FC1A 3MRGA 3LIZL 4HIHA 3ULAB 1K5SA 5IESL 1OAQH 4TNGA 1KU9A 5DO8A 4YIQB 5CKGA 4KPHL 3MZGB 4O4IB 3QH3A 4MVSA 2OX5A 4Y7OC 5KJ7E 4KFMA 1PJWA 4WLCA 2WLNA 4JV5B 3AWFA 3CVHH 3HG5A 1E27A 3QCUH 2ALAA 1EBOA 4P46C 1CU4L 2RCVA 1INQB 4RGNC 1UOKA 3DARA 2UWEF 1LD9A 2QWNB 2WKLA 5L2KA 5IBLC 1WPBA 4K9JA 4DT2A 1EEYA 3L9BA 1SJXA 4LT7A 4DKDC 4Y5YB 3U7WH 3DXAA 1JI1A 3SCMA 4GRLC 3G5WA 1YIJV 3FCTA 3WB1A 2DBLL 4WJ5B 3RX7A 1MJUL 3QXDB 3K5LA 3ZE1F 3GSOA 5CD5C 4HUKB 1SEBA 4LVNB 1D5RA 3GZKA 2B08A 4A7GF 5DN6G 5E2JA 4PDMA 3QI9B 5HGDB 2E5LO 4GBXC 1NT2B 1F4XH 1KCVH 2FX7H 1FFRA 3P4NB 3GEFA 1T5KA 3MRLB 3RVTD 3S96B 1Z6JT 3OKYA 3TBSB 2N56A 3BUDA 3EFFB 2DRUA 3GEWB 5J13C 4G5AA 4LBEA 3RNQA 1EHAA 5T5NG 1IT9H 1JNHB 2VITB 1U92B 4KKPA 3JATA 2KHAA 1VARA 2IAMD 2XV6B 2X42A 4Z3IA 3K4ZA 3K8KA 3L3GB 5L3FA 4RGMC 4FIPC 1FL3A 2P46B 4ZW5A 5CLWA 1J95A 4WKZB 2JI2A 2ZOOA 1S9XB 4I88A 4IM8A 4W4KA 1QBBA 4NN7B 2P5PA 4PCSA 1TZAA 4BK8A 1F2QA 1XSOA 5C86A 4J7RA 1JRHI 1KC5L 1WCBA 3ZBMA 4G6FB 4IRJD 4YX2L 2FIRT 5DVMA 1MWAL 2HVBA 4HYOA 1DJWA 1GAXA 2IOIA 2CK3G 1E8YA 4BKLA 3F7RA 1YMHA 1C12B 2EJRA 2B9ZA 2HP8A 3AW5A 4LLMB 4NSKA 3HI6L 3K8LA 3BH9B 4ZMOA 4QKTA 4Z7VA 1KWGA 3E6HB 4EVNA 1MEXL 2BSSA 2A1WL 5JCOC 2VDMH 3P69A 4JFDA 3NIFF 2WXQA 3N1FC 1V10A 1Z9OA 3L1FA 1JOIA 5BZXA 3WLBB 3OX8A 5F7UA 4XWOD 4JKKA 1CS6A 1U8JB 1PL0A 1O6VA 1KBGH 4HFWB 5DQDH 3MV8A 4XOAA 3E38A 3KLLA 4FLHA 1QMUA 3UEQA 2VSMB 1EN4A 5JJEB 2JJSC 2YJQA 3L95A 3B09A 4L3AA 2TSBA 1TEGA 3G4SV 1CF1A 1CF8H 1P1ZB 3G7TA 5GS0H 2E8ZA 4DZBA 5D7SH 1T2QL 4PRHD 2K6WA 2A06H 4XNYH 3LXCA 3ESOA 2DJUA 3MRMA 4N2HA 4U1LA 5HHVH 5I0WA 3CVBA 4BDVB 2AC0A 4LFAO 2YI9A 5EH1A 1O9HA 4HV8B 3DK2A 2VLJE 3D4GA 2NR6C 2QZ5A 3RZCA 1XF5B 5SWZA 1COWG 2BY0A 3HB3B 1U2CA 2EYSB 2RTTA 3CLWA 3PLYA 4E68A 1ND0B 4MA8L 4PCTA 3CYOA 4HFUL 4KHXL 2GHZA 4BE6A 1KNOA 2FWLB 4UCFA 1RZPA 1U8MB 4ES9A 1NCDH 1A6ZA 3V8CA 1M2VA 4K9EC 5HVHC 1BZ7B 1D7FA 4JLRA 1D2PA 1U8OA 2OMWB 4NQCD 5E5UB 1SZTA 3EH2A 3CCMV 2EIMC 1ZWIB 3WNMA 5MERB 3B2UD 1T1YA 3BA8A 2R56L 2XY2A 1NEUA 3B7YA 5GJSL 4DO6A 5D8JH 3FO0L 4QO1B 1BOGB 5FYLH 1AHWC 3IKKA 2CSPA 5I8CA 4LSDA 5DCCA 1AH1A 4K3AA 1C7TA 1QFWM 4JYAB 2CDGA 4FQXB 4RA0C 3PF2A 1VIBA 1RU9L 5AVQB 2AKRA 1A2YA 4NJAL 1II4E 3FT2A 4OLXH 2DJVA 2CCVA 2IFFH 3WIAA 2QKIB 2J73A 1MLCB 4R90H 4YOKA 5AW2B 3W39B 5GQBA 2OMNA 3BRGC 1IM9A 5F6IC 1N8OE 2UZYA 2WXIA 4YQXH 4TNVK 4FLZA 3D87B 1F02I 1FKAO 3DHPA 4N26A 3UBXI 5CSBA 4I4TB 5D2NA 1CL7L 1U8KB 2KKQA 4M3JA 1RZKC 1XSIA 1NGQL 2B2XH 4YC2C 3Q9PA 3W2DL 1KPRB 4J41A 4PJHF 5L7XL 2H1XA 2VLKB 2CLZB 2A73B 3ARUA 2ICEA 1HK6A 3KPSA 3W7TA 1GN3A 2MJWA 5GRYA 2MNWA 4FQIL 1YY8B 2BWQA 2BC4B 5DQ9A 3F12B 1RJZB 2FNWA 3WTWA 1DEEA 1W15A 5IF0B 2EJ1A 3I6LD 3RBGA 2CKBB 1S9KC 4Z6AT 1SLWA 2XZAL 2VWKA 4G7VL 1GA2A 3FONA 5JQ6L 1KJ2H 4K3JH 5C0BB 3CFMA 3QRBA 4FFZA 4DK0A 5IHZB 1JZ2A 1GOGA 1DVFC 2Y36L 3BIKB 5FYJH 4EUPH 5B1OA 3EBHA 1ZLVK 3D30A 1FG2B 5A16A 4OLZH 1VESA 2IPUK 4U1IB 1PP9H 5IROC 4LLUB 3DROA 3P0GB 2RJMA 1R3IH 1AQDB 4XBEL 3D0VA 1WK0A 2VKWA 5DYFA 4YJ2A 3MCKA 5JZ7D 4DR7O 3UTSD 1U2YA 3HEIB 3MJ6A 5IZ7A 4OCMC 3JZYA 2BHFA 3VDBA 4PJ7F 1B3QA 5FO8B 2XWZA 3HKCB 2DI9A 1AS6A 1UWGH 3WDJA 4ODVL 2EE6A 1ZVSB 4QRUA 4TRPH 3HG0A 2WBXA 2D2CB 4YSOA 3VFUB 2LQTA 4N8VG 2CUGA 3VD1A 2HJLA 1UFGA 1VQ6V 5HD8C 1OCZB 4CN1A 3UDWA 5GGRY 4JCMA 3WKYA 3DX1A 2VQ4A 3U6XS 2ZUSA 1M3JA 4ODXB 1V8HA 4TL5A 4ZO6A 3DOSA 1OSEA 1MIEH 5D6DA 1CZ8H 5DJCB 4FP8L 2FMLA 4IU2A 2PF4E 4WUKL 3RPIB 3SE9H 1T0NB 4BHUA 5MHSD 3TCLB 1I9RL 2FKXA 1ENVA 4NI3A 1K4DC 4EEQA 4JI7O 4R7VA 4RBPK 3PAUA 4P46D 4BGLA 4UQ2A 1NTDA 2ZOLA 5GGTL 1DHKA 3OT7A 3G04B 4PH8A 4N2BA 2A99A 3WFBL 3NAAH 4MSWA 3MO1B 5IBLD 1KFAL 2QGBA 1WFJA 1EN6A 1CXFA 4N90E 1AP5A 4KRLB 4S1SH 2O6EA 1J8KA 5H2FZ 4PJGA 3LKPB 4JN2B 5HVWA 4LCUA 5K9JH 1I3RB 4GRLD 1KB9F 4KVCH 3M8OL 3MV7A 1YEKH 1QVOA 1WGVA 2HRGA 3C5JB 3NA9H 3GJFA 4G7YH 1HEHC 5L3GA 4R2GB 3SGDI 4OFPA 4LSTH 5ADPL 1CBVL 1WS8A 3AQXA 3VYPA 1QHQA 3MA9L 4GBXD 3LKSA 4FFBB 2HMIC 3EGDA 5FNVB 2V2TA 3DVFA 4WI8A 3ZZQA 4F7PB 2COQA 1N4XL 1I82A 3ABMB 4JO2L 4H40A 1W72H 4PV9B 3FB6C 3QRLA 1NDTA 3P2BA 4AJVA 2IH3A 3HAEB 5D9SB 3V4PA 4AT6B 4PLNC 4WHTB 2AJVH 2V33A 1F1GA 3ARQA 1OAZH 5FO2A 4GW4B 2PYFA 2XN1A 4U7KA 2DQIH 5HJGA 3K03A 4G27B 3B56A 5AW7B 1PPIA 3STZC 4L8BA 4N8VA 5KVEL 5FHBL 1YNTB 2ROYA 3W38A 1TJHL 1WAAA 3GLEA 2ZXWC 4LF6O 4JRWA 5TQ2L 2H47C 1W59A 3CFDA 4FC3E 1LO3H 2XYCA 1DSFH 3ARFA 3SIKA 5G4MA 3RT3C 1EJFA 1YJNV 3RYCB 4N9GA 1JF6A 4MQTB 4O9HH 5SV3A 3TTYA 1XEDA 1HKFA 2I9LA 1VF6C 1EAJA 2R29A 4XAKD 1XCTB 5J2TB 2BCMA 3GBNH 2QKCA 3QC6X 2KBGA 5ISZD 4YGVB 3MUZ1 1TVKB 3PIQA 4RQFA 5TE7H 3MGOA 5ANHA 2JXMB 4KK8C 3KBPA 1GCYA 4OGYH 5D7KE 1TZIA 5JR1L 3ML0A 3KGRA 2PWGA 1TLKA 4AI7A 1PLGH 2ZX7A 3GGWA 4PS7A 43C9B 1RZ7L 4OUOA 2H32B 5C93A 5I73C 2ZKHL 2GIMA 4LLDA 3UO1H 5JA8B 4JL2A 4RLDA 2DB8A 2Z9TA 4Y8AA 3GI8L 1J18A 5LAXB 4ZK8A 2HT2D 2D0FA 3U4EA 1P9MA 3PGDA 2KS0A 4HCRA 2E3VA 3H42H 3BGFC 3UJIH 3CMOH 3RWCA 3AU1A 5HDBB 5D2LB 5A6LA 3MRQA 4PN6A 2H94A 5J7CC 3VXPB 1JFFB 3EBAA 1JZ6A 2VWEE 2NR6D 4ZMAT 3RGBA 2XV2A 3BPLB 1U41A 2DYPB 2PYEB 5ALCH 5IHUH 4KX7A 2D7PA 3IJSB 1PTZA 1NEPA 1QI5A 2QTEA 3E22B 4U3SB 4FLQA 4UQEA 1IKOP 1G4YB 3I3DA 3TO4C 4ENED 3BSHA 2CR3A 4OFKA 5HI3C 4WNSA 1VP7A 3HZMA 3ZT6A 2QPFA 1NCBH 4E36A 4IQHA 3TVMC 1Y76A 1C1EH 1K6QL 1P5VB 2E56A 2EDKA 2G30A 1U3ZA 2H3XC 2VXVH 3WNKA 1CMOA 1QLRB 3MREA 4P5TA 4A7UA 1S5HA 3FUMA 4LNUA 4JKPH 1HAUA 3VYNA 4PGDB 1XDTT 3L4TA 5HYQA 5ESQB 4U3JA 1G1KA 1VGEH 4KBPA 5EU5A 5LHDA 4GUNA 2FQGA 4JMNA 1X5XA 3ULUL 3QCTH 4K71C 5GZNC 3OR7B 1SQFA 4NIYE 3P4MA 2KZBA 1N68A 3TA3A 2Z5UA 1IAOA 5C07D 2NY4B 2VJ8A 2WLYA 3MJ8A 4LOEA 1AJPA 2JCWA 1IGYB 2GIXA 5CCJA 3FB7B 3LZRA 1KYOF 4HWNA 1NJIW 4H1LG 4HK0A 4J8RB 3SDCA 3UIZA 3H2PA 4GKJO 4NUQA 1TMQA 3U2SA 1Q9LA 2UUCB 1FZMA 3WFZA 3CD4A 1MRDL 1G7MB 5F7WC 4WW1B 3WIFA 2PN5A 3FUJA 1CN4A 3Q48A 2YK1L 3DIFA 4O00A 4P2QA 4LNVA 4I2XA 3CUPB 4BV1A 1ZTEA 1L8DA 4XOEA 3LVEA 4GO6B 1JVMA 4JRXE 5I0XA 2B9AA 3K5NA 3F00A 1Y4MA 1E4XH 3JARA 2XWXA 4L37B 3DTXB 1DVFD 4QAWA 1FORL 4JFVA 1RFDL 4WI0A 1T3FB 5F6HJ 4Y9EA 4U3CA 2FEDC 3AG3B 4JFOB 2EXSA 5IROD 2XWDA 3FSOA 5HYJD 2BSKA 1HWWA 4OBRA 3WEXB 4ZFGH 1QTSA 1U97A 3L5JA 2ISDA 4KDVA 5GGUA 3L5WB 2NSMA 4PY8I 1AS8A 5CB4A 1SVBA 2ARJB 2Z6FA 5IYBO 4I48B 2X41A 4X4ZA 3FU9A 4XNMB 5KJRL 3LEYH 1KTBA 1Z9NA 2ATPA 3MTXA 1G9NL 4HXBL 5DEFB 4AYBA 4BQ8A 3F85A 3IRCA 1QNZL 2DIJA 3LSQA 4MJIA 5FA4B 2D7TL 4GO8A 4HJGA 1L7TL 5BOZG 1JV2B 4RCAA 3QUMA 2YGQA 4NXKA 3PY9A 3S6CA 3H3KA 3ZUNC 3I6SA 1I5YA 4O2EA 5HDLA 2BHYA 5LCVH 3V0EA 2WLMA 2X53A 4A1RA 3DX6A 2C4FT 3V55A 5DURB 2OMYA 3EVKA 3NZUA 3GMLA 2FJFA 4HUUB 4CRPA 2OMXA 4CSZA 4UIKL 5AW9B 3QIBB 1MFEH 3QJQB 5I6NA 3DV4A 5DRNA 1I1AC 1IBZA 1NFDE 1TTGA 1YYMH 4H1LA 4IGBA 4LCVA 4JFHD 3WE6A 2ZXAA 3BVDB 1K72A 4H0LC 1IFHL 3TPUA 3QW9A 1HI6A 1OAUL 1BD2D 3T2QA 1WZLA 1H6EA 3FZUD 3FS9A 2F23A 5DTFB 1AKJD 3ZQWA 3SY6A 3GXNA 3MKKA 4WCYH 3PHAA 4JFTA 2WN2A 4D2NA 2K7QA 3HZYB 3FHEA 3Q1EA 2ZNIA 3LH2H 2P80A 2ETWA 2J1WA 3BAIA 3LNMB 5IWAO 3MU3A 4AWJC 4QJ3B 1RPOA 1XX9C 1J7VR 3MLUH 4NKQB 5CR8A 1ZHNA 5DK0B 2PO6B 1QBZA 3GSRB 4CA4A 2HMID 3FFCE 4OQTA 2VMJA 4JY4A 1MHCB 4PTTA 3FT4A 1DBAH 1F1AA 5LO7A 1RM1C 3O41B 1UM6H 4PDVA 1ANUA 1OE1A 3TJEL 5EFIB 5JORA 3O2DL 4XPGL 1MVUB 3HLAA 3HMWL 3LRSA 3QQNA 4ERSL 5AW0B 5HGBB 3WY3A 4FFYA 1ZHKB 2QGDA 4AUJA 4HKXB 2EXWC 3JTSA 4M93C 4Z3HA 3NJJA 2F1BA 4JFWA 1I9JH 4G6JH 5FGSA 3UTTD 3ZRWA 3X1GA 3QO1A 2IAAC 1LO4H 1W0WA 4GMTH 4UMSA 3T2NL 2G5BB 4KUMA 4XPFL 2XT9A 3G6BA 1FPOA 2O5ZH 4Z95H 3W1ZA 5JQ6H 3OMAB 3RZWA 1S3RA 5I30H 2BCCH 3VFWB 1WLEA 2EDMA 1Z9MA 1PZ3A 4BAYA 1NIAA 5L0QB 2NR5A 2X4TA 1PL3A 3SDXF 1LNUB 2AS5M 4H2AA 2FYUH 1EO8L 2X9XA 4GW1A 1WBYA 1MFAH 3E3QC 3GTNA 4XBEH 1E4WL 3HTLX 4NT6B 4F7TA 4MVZA 4PRIE 5I1EL 3LH8A 5IVNA 5EK0A 4KK8D 3FJTA 4LCCC 4G6ML 4JDEB 1MHEB 5FM5M 3TN0B 2F1MA 1CJYA 3G6JE 4N86A 5B4MC 3PJSB 1JYNA 4J3OC 1FVEA 4AKOA 4APXA 5DHYB 2B1HL 5T1DL 3ZUCA 5JTWA 1I1YB 3MV11 5I6PA 4JKWA 2KDGA 4NCC1 1N0NA 4HALA 3M17B 4TTDC 2BIQA 1M71B 3R66A 4HEMA 4NTYA 1XR8A 4GXUN 4J4PA 2WKOA 3QPXH 5IQ7H 4PJ9D 2A0LA 1BS3A 5AVTB 3T6WA 5J5EA 4XBGB 3WS6C 4XBPB 2BRRH 3AM8A 3D33A 3D18A 4NO0D 3BHBB 4JFFA 3B34A 4F24A 1FO0B 1PDKA 2P26A 3CC1A 4PJCE 3SBWC 3K81A 2DKUA 5FAAA 4OXSA 2CR6A 2FGWL 2G0LA 1BWWA 5C6TL 1SBBA 4BZ1L 3QG7L 4JI0O 5KVGH 5LWYH 5CHNB 2J8UF 2CU9A 3K9SA 2AK1L 4U33A 2P8LB 5FA3A 3IN0A 4NJ9H 3TO4D 3WFHA 3NCWA 1ROPA 1ZD6A 3BDXA 2QEXV 2OS7A 5E1HB 1JGEB 3VE0A 1CVSC 1X5YA 5BZBA 5BOPA 3TVMD 4OLVL 1KTCA 3ZE2E 1UWEL 4JE4B 4OD3H 3HI1B 5TDNA 5TDOB 3VMPA 5IR1B 1KEGL 1PF3A 5GONA 2EDLA 3K0DA 1OGSA 3UJTH 2RFXA 2E8YA 3M45A 4GAYB 4U2ZA 1BIHA 3REVB 3UO8B 3CFEB 5I6MA 2CJUL 4JRYA 2NUTA 1YUHA 2H3OA 4JO1L 2ZWNA 4O5LH 2UZIH 3C60B 3E8UH 5DS1A 5GZND 3Q1SL 4XMLH 3HG1A 4P23C 5EO9B 1U21A 3QDMA 3WEBA 3P9LA 4BZ2H 2P7TC 1V9PA 2W38A 1NGZB 3ARGB 3WS3A 1WNSA 4IK7A 1TVBB 4PJ5B 3QPKA 5HDOA 3ZMSA 2YUAA 1P7QA 1BMFG 3F6IA 1ET7A 2WXMA 3CFKA 2NY3C 1DBBL 5F72S 2QVTA 3O9WA 4FFVC 2D3OW 5DMKB 1FI8C 2XLLA 2EEBA 3WIHA 3CCQV 1CYXA 2XAJA 1XVSA 1SXAA 3H54A 3HMXL 3LN9A 2UXDB 1L9PA 3KXFE 4TUKH 4F33B 1Y18A 4GAJH 5T3ZE 2OMTA 5INDA 4ZMVA 2X2JA 3HG4A 3IWUA 3Q43A 2PP7A 4WI7A 5F7AA 4CBPA 4E41D 4OF8A 5AWNH 3F5TA 1HKLL 1P53A 1GGCH 3QE5A 1TETH 2WYIA 3GRWA 5CBEA 5E7BA 2VXUL 1UXMA 2C9AA 3HKZA 4JO3H 1IGFL 4LIQL 1JK8B 4XHQA 3RIFF 4ONFH 3QEQE 4FLRA 2FEDD 4LGSB 2QFPA 4GJTB 1CR9H 4GQPH 4MCYA 4Y4HB 4TKWA 1XNQB 3VI3F 3O3BA 3WKML 5J1AA 1WEJL 2ILLA 5A2QN 3L45A 3O8XB 4N2DA 3WFDL 3WYRA 3IJ4A 4P9PA 5DXWA 3MV01 1JR9A 2EYTB 4TT3G 3N85L 3OTOB 2IWGA 3POHA 5I26A 2AJZB 1FL6B 3WKNA 2NY6C 3INOA 3VI4F 4YHKH 4GP8B 3CU1A 3SPVB 2OXGB 3KL0A 3S97C 2OZ4H 1OAKL 1CDHA 3C6LC 2GUOA 3CSGA 3I75A 3MI6A 4L9LC 2Q8AL 2X05A 5LGUA 3WMPA 3R1GH 2JB5L 5LGHL 1VQ9V 4ZOLA 3ASNC 4KKCC 1IVLA 1MZEA 3PU7A 4L2LA 2Q7YB 5D7IE 3STLB 1FCCA 4MS8C 3UZQA 2UWEB 3TBYB 1C16A 1EXUA 2VLLA 3FH5A 2YXMA 3DMMB 1M2OA 3FC8A 1JPGB 4M7JH 1N3NB 3B5HA 1KCKA 5EG6C 3U0ZA 4LF8O 2VERN 4L29B 4IDJH 4R84A 5DUBB 3UC0L 3ARTA 4HKJA 4JI8O 4LLWA 4WAFA 1J8RA 5FCSH 2JLLA 2X1PA 1YRKA 4XPAH 4JKNA 5SWSE 2AJUL 2Z7UA 3KYNB 1L0YA 4MD0A 1FNHA 1SQQH 1VKXB 1KT2A 4GKSA 4Q6IC 5C0DB 4J6IA 1GS8A 3GHBL 2OR9H 5BXZA 2X89D 3GNMH 5DJ6B 3VG9C 4MJ6A 3ZHNA 2AW2A 1MSPA 5CBHA 1CLOL 4Y1AB 1NJ9B 5GGSY 3M1BB 2W65B 3Q7JA 5D96B 2X4UA 5A7EA 1I8IB 2YEZA 5I66A 3T1YB 3U46B 4WW2B 4B3RO 4ORZC 3CXHF 2AQQA 1U8CB 3MLXH 4G72B 4FQJL 1FSKC 5IJDC 3DX9B 3ASOB 1ACXA 1SBSL 3P0YH 3LHAA 1EHLL 1QSVA 5DHVH 3V9CA 3NFNA 1R3JB 1JZJA 2YJLA 3W0WD 1SN0A 1X9RA 3D4CA 1SDAB 3VXRA 3B7TA 2F4VB 3RY5A 5KVFE 3K58A 3VFVB 2E5EA 1J8HA 3RWHB 4NHCL 3NIGF 4RRPM 5AZ2L 1MHPL 5HGGS 4NZUL 2CDEB 1T21A 3D0LA 5EZIH 5GPRA 4PTUB 4QIRA 4X20A 4M4PA 4UQ3A 2Q7GA 1JRHH 4O58L 3UCQA 3L74H 3EFOA 2WLKA 3QFDA 4XO9A 1FF5A 1W9XA 1S72V 4RRPG 4ZMNA 2C4FU 4X6DA 3V4VL 4J3BA 1QYGL 5DQJA 2W07A 4S2SA 5D71L 5HI4D 4UCRA 1AQKL 3AREA 2GJPA 5D72H 5DMJB 3LB6C 5ACMA 4F2FA 3PL6A 1MCQA 3HHSA 5EBGA 5AKSA 2EDXA 2PPFA 2DLGA 3OKEB 4OFVA 4PP2A 1HQ4A 1SDDB 4WFHD 4XMZA 5B39G 3X3FH 1KJMB 1NIDA 2A6KB 4KTYA 3ROOA 2ZIMA 3BAXA 2PABA 4Q4EA 3TP4A 1PL4A 3L9YA 2NSXA 4E9LA 2I27N 1AD9A 3AGWA 1ZE3C 4M5YL 4R97B 4H25A 3SKUD 1ETZB 2WZPD 4IRZL 2IPTL 4CU7A 4JPIA 1SJHB 4QYOA 5CLZA 3US9A 4AQ8A 4WFEE 2LU4A 3DNKA 2BRQA 2AABL 1PMYA 4NQVA 1CE1L 1XH2A 5FOBA 5LG6A 2P5EE 1CURA 1HNXB 1JVOA 5B4MD 2VQ1A 4J3OD 1XT5A 3A47A 3R4RA 4MYWB 4U7OA 3LXUX 4S0HA 5ABAA 1HINL 3ORJA 1L7TH 1Z5WA 2B15A 4LSVH 2Y5QA 3AG7A 5EBMA 1W8EA 5CEZD 4HWBA 1LILA 2Z8RA 5CZVL 1F90L 4JQVA 1OSPH 5C08D 4FHBD 4TTDD 5JPMC 2DM4A 4GXUM 5MEOA 4Z7VF 1JTOA 1UXLA 4HG4J 4N8CH 1OT1A 2VTFA 1GM9A 3U1SL 4XNDA 5IMLA 1RK7A 4FLYA 1XEUA 1XGUA 4UYQA 1U8QA 2BERA 4X1KB 2FBOJ 5KOMC 3O3UN 1MIML 3UZEC 5C2BH 3IRPX 4A2EA 4JRXB 1EGJH 4YO0A 3UPRA 2PKDA 4APQA 4HPOH 6TAAA 2VSDA 4BK4A 3ES6B 5AB9A 5IB1A 4HSQA 5JQHC 3L17A 3QUHA 3CVHA 1CXIA 3QDGE 1CXZB 1E42A 3SDLA 3MLSL 4RRPA 4BINA 3MBWB 4OLWH 2BJMH 3EOAB 3PXHA 4QHMB 5LHGA 3AADB 4D9QD 2ZXEB 1GC1H 4QF1A 2PUSA 1OAXH 4BSVA 4LEXL 1LM8V 1CD8A 5EC1C 1YO4A 3P30L 1L7IH 3LOWA 2WV3A 2XN9A 4WHCA 2XUWA 1P84J 2ALWA 5B39A 3BZDA 3GT6A 4Y19E 1LK3L 1YDXA 2DYSC 5SWQB 1IEAB 3HFMH 3OTFA 3QUXD 5HHPB 1DO6A 1OCCC 3CJHA 4YSRA 5F1NA 2R72A 5KMGA 1H38A 1DO5A 2EUWA 2CG9X 3O11A 2FWOA 5H9CA 1TSHA 1KXQE 1OHZA 3LXAA 3O4LA 3PWNA 1BG1A 3BEHA 1RLBA 2QSVA 2DJSA 4UV9A 1QSFD 4N2IA 1N67A 3MODH 4P23D 2A9ML 2EDFA 4FMKA 4J1UB 1QSEA 2GBOA 1R5WA 3MRPA 4WFFA 4OLEA 5DGRA 1JI2A 2R2EA 4WWID 4EI5B 3DYMA 3LS4H 1KJ3H 1JGDB 2DQHH 5EO0A 3SE3A 3KWXA 1HXKA 2Y0IA 3L6FA 2NY3D 2R2CA 3O3DA 3VCLB 1G94A 1Q94A 2J88L 2JWYA 4UV7L 1I8KA 4GP4B 2Q7NA 3F6LA 1PKQE 1NFDB 1EAQA 5KZCD 3KLHC 1CXHA 1TQSA 2UZXA 4EN3A 3QS3A 1VEPA 2FBRA 4G6AC 1SOKA 4DCQB 1PKXA 3VFGL 3BCCH 3HVNA 4NDMA 3X1BA 4BA8A 3KG5A 3V6FB 5D70L 3DHUA 3K6IA 2EBOA 3VXOB 2MHAB 3AGVA 4KY1L 1IFRA 2EAEA 2FYYB 1TKWA 5MI0B 4HOZA 5KBNC 1FAIL 3FTGA 1YMMA 1X7SA 3LEXA 2EE3A 4R83A 4HS6A 4X4YA 4JUSA 1A1NB 1KFGA 1L3NA 1NIEA 3IJ7A 4ZUTA 3CXDL 3W5NA 4Q97A 3RTQB 5F7EL 3U6XA 3LAFA 4GUOA 3B9VA 4OM1L 4DGIH 3FFCB 3VRLF 2R0ZH 1NWPA 4OIIL 4B3MO 3RU8H 3VYOA 1Q9KB 4LOVA 4L5FH 4WDIB 1NTZH 3BP6B 5I75B 5LKNA 3C6LD 4QRPE 1RPQA 1F5WA 4NO5A 3Q8AA 2AEQH 1NBVL 4G1MB 3NZHL 3W9DA 3FCUB 4LCIL 5E6SB 3OAAG 1EPFA 4KKCD 4MNHB 5IG7A 4KVNL 3VXNA 4DK3A 4M61B 5DRXA 4NFDA 4GQQA 1GKEA 2EUVA 2UY7A 4MS8D 3SY0B 2FATH 3CB2A 4H0GA 4HK3J 3GXTA 3OXRB 4LSSL 3SGKA 2VB5A 3QO0B 2CRMA 2HH0L 2RB8A 4U05A 3S3JA 1EEQA 3FQRB 5EC2A 3CX5K 2YD8A 5E6IB 3WD5H 1CD1A 4LU5H 1KLGA 1MFNA 3NABL 5C0IA 3T1HB 4LVNC 1QUNA 4UANA 4ADJA 2XIBA 4EUPG 4ETQA 3ROLB 2CO4A 1SHMA 1E2ZA 2R4SL 4DEPC 2WZ6A 3MJ7A 4NUMA 1I8LA 3MRCA 1G9EA 3GSVA 3ESUF 3V6FA 3SGDH 4G7RB 2NPLX 3UP6A 4HWEH 1U8IB 3UTPD 2OMUA 1OQOA 4PRIB 4N9OB 1K8IA 4GT1A 3BRFA 5CF3A 1J1OL 1VQ7V 3NH7L 4U6TA 1E28B 1TZHA 3H9SE 3VFTB 2J57A 1TJIH 2LFSA 5DRZB 5FGBA 5F6IB 3G6JB 3FAVA 4XVTL 4LWSB 3M1OA 3ZDXE 2Z4QB 2W60B 2AJXL 3H1ZA 4NQSB 4LF4B 4MTOA 1GL4B 3LYRA 5CU5A 2J6EL 5HTSA 1E4HA 1NAML 3ARPA 3WIIL 1HCVA 1XWVA 4KFZC 4JG1H 1EFXD 5CJXC 4W70A 2VXQL 2GJZB 2G2PA 2V17H 3DI2B 2J1XA 5C0GA 4QY8A 4HJJL 5BY1A 1ZY9A 4JHZA 5DD0L 4B9YA 5LOVB 2DQUH 3O6FB 1ZSPA 1IJ9A 3N55A 3IAGC 3HC4L 3K72A 3OKMA 1AO7D 5F1KC 3V0GA 4P4RB 2CK0L 4PJGF 4PJXA 3K6SA 2E7LC 2YD7A 4OD1H 3KPLA 2VQFO 2Y6TE 3BESR 3K80A 1MCPH 1F56A 1C5DB 3CK0H 4PJCB 3AS0A 3O3EA 2Y2TA 3MJ9H 5H37G 4M62H 1A7PL 4AYDC 3V0IA 3LB6D 3DECA 2PCXA 4R0LB 1ZLVH 4Y2DC 3G6EV 3DIDA 1LEKA 1HYSD 3EFFK 3G71V 2IMMA 3S98A 1KC8W 3B43A 2IXQA 4F5CA 3QNXB 4OZGA 5BXFB 5BV7B 2Y1AA 1BBJA 4EQ3A 1HR0O 3CDZB 2EINC 3C5ZC 2JS5A 5DJXA 5TH2A 1LDPL 1WE5A 5I8OL 1PKOA 2ITCA 3K1KC 1MW1A 3ZO0A 3IRZA 3MGTB 2VDPB 1FV1A 3JV6A 4PWJA 5EU6E 2HG0A 3RWGB 3T6VA 1RZKH 4FNTA 4EUPA 1CTMA 2ZTBA 1S7WA 2WW8A 1L6XA 1U58B 4GUPB 1E79G 2LP7A 3FUFA 4JPSA 2VERA 2ZCKL 2VDNL 4DOHB 4UM9A 2GQHA 1SZNA 4GXVL 1WAAF 4MNQA 1BFOB 2NDGA 1AB3A 3HB3C 4KK6C 5FKAB 5K59E 5JHLA 5E4EB 1GAFL 3T09A 4BFOA 1ORSA 1NQBA 4V2CB 3ZTNL 1R75A 2FX8H 4U7NA 2VQEB 2QLVB 5E1IA 4DP7X 1XCQA 4NC2B 4KUCD 4ZUWA 4QXUL 3F7YA 2DQ6A 4E9YA 4EDWL 3UTQA 1OCOB 4RBPH 2HG5B 1RZ8A 3E89A 1H8OA 3L73H 1FN4B 4J23A 2NY0D 2QQNH 1TO4A 4FLWA 4OI8A 1WBZA 2N7SA 1H2SB 3D50A 3KXFB 4MHHI 4HC1H 1VJSA 4WFGA 4R8WH 4PW4A 3AC0A 25C8H 2DMHA 1HC1A 3B2VL 4M02A 4ONHB 4TQEL 1P5UA 4U31A 1U91A 3VTMA 3CN3A 5KS9F 1SESA 3B2PA 1V27A 5C09D 5JW4N 4FQXC 3GI9L 4PRAA 5FO7A 3S36H 4AEHH 1RAMA 3CZSA 1IC7L 4F91B 3KYMA 1K2DA 4MDJB 4P0DA 2WXKA 3L3JB 4GW5B 4H8QA 2QHRH 4PWFA 1DJIA 2R1WB 3QEQB 2IQ9L 3VACA 4BSWA 1KBWA 2QKIC 2Z34A 5EA0H 2AANA 4L9DA 3BD3A 3SJVD 4F9PA 4FF9A 5H37A 4WF9V 1S3KH 4DUZO 4XWGH 4I55B 1G9NC 4B6ZA 3S88L 1JHTA 3FTXA 5CSGA 4D9LL 4PG2A 5GGQH 3OKNA 3RGHA 4X1IB 3LDEA 3LNIA 4ZHQA 2YD1A 3EFDH 4XN8A 4OI7A 5KTEL 5H94B 5F9DC 3SZ6A 2IDFA 4FM1A 1FGNL 4KKRA 1BHGA 3U36B 5CEXA 4ZO7A 1N36O 2GK0A 1TAEA 5CBAB 2KPWA 1VQ4V 1QWHA 4LCYB 4NZUH 2G2RB 2FLBT 1ZSHA 1M42A 2HRPH 3L4ZA 3AROA 3NCYP 4GG8B 1XIWA 3ILQC 5F96L 4XC3L 1BSIA 4OJFL 2XG4B 4KZEL 1PVHA 4XVJH 3NJIA 4WF7A 1W72A 3AMKA 2A83A 3QYMA 1J9RA 5F9JA 1C08A 2YMXL 4PIRF 4UOJA 2VZ1A 3AS3A 5AB1A 2ZNJA 5SWSB 3VJ6B 1DSWA 4ABVA 4TTGA 4TNWF 3KLHD 1FFXA 1XMQB 2ENPA 1GIGL 2Y48A 3NSJA 5HHMD 3IVKA 4DEWA 5B38B 2AF2A 1NUDA 3BAEH 3L3KA 1A4AA 1OT4A 3HNSL 1JPTH 5LGTA 1AYOA 5T33H 3UIYA 3MOAL 3FUNA 5GSVB 1Q82W 1E9QA 4JKLA 4EZMA 4Y4KA 3MFGB 3A24A 1EDQA 1YQVL 4MTMA 5D5ME 3VU1A 1X9QA 2FBJH 1UZ6F 3T3PF 3Q6FA 4FKHA 4PGCA 3X11A 3BWAB 3DVGB 4OZHE 3VFNA 2VQUA 4L1HA 2KH2B 1CGTA 1RXLA 4GIPD 3OW2U 3E7JA 2GTZB 1C8QA 3HN8A 5C0CE 1RQ5A 2GSIB 4WQOA 2NLJA 3AT9A 3IJHB 4XP5H 2BIOA 4RAUA 1L9SA 4CW1A 5FEBA 2D3LA 5E8OA 4UQIM 4ZJ9A 4KNTA 5E8PA 5JMRA 4N68A 3ATAA 5HJDA 2DWEA 2WNKA 1GYWA 5HDWA 2BTQA 2AERT 3WAKA 5IJVB 3AAZA 4X7TA 2MCMA 3IDNB 2W0FB 2WVSA 1SRYA 1MFCH 1YNLH 4OFIA 4BFIB 4TPRL 4HBQA 3WJMB 4HDIA 4PY7B 1LVEA 2IDUA 1NAKH 2GKIA 1JAEA 1W0VA 2V7HA 1WAEA 2JJTA 2WYTA 3IBOA 3CSYA 4FQ2L 5BZWA 1GMEA 3FO2B 4WZ9A 1N70A 4G5ZH 3QNYA 4NZFA 5C92A 5KSVB 2V5MA 4AYFB 3OEEG 2P45B 3OPZH 4JFPB 1DANT 4NUGH 4OQ1A 4WSJA 3TX4A 1QR1A 1E6OH 4AQ1B 4Z8FL 2E9JA 2YPLE 3DO3A 4KHPO 1P4UA 4YDIL 4ELKB 4FVMA 3BZ4A 5C0AE 4XP4L 1NKDA 4ZODA 5C8YA 4R2GC 3CZEA 3GDCA 4MJJA 4WV1B 5SX4I 3UG4A 4I9WA 3ZKNC 3IXTB 1KB5B 3QI9D 2MKWA 1OHHG 4O4HB 1CGSL 1Q0YL 3MLVH 4AYMC 5IB2B 4P3WA 3NGBB 3QFGA 4XNXH 3VA2C 1AG6A 3MRDB 4XN9A 4U6YB 1A1OA 3BO8A 3ZYJA 5DEGB 3CZJA 4TSCL 2OTUA 2P5EB 2YEVB 2E27L 2GFBA 3TNNA 1MI5A 4QCIB 3PG2A 1TIUA 5CAYB 4AVJA 3SOTA 4QPKA 4ODHH 3KGTA 3IU4L 3HI5H 1I1FB 1F4WH 5DHXB 4DW0A 4FFWC 2YAFA 1TZGL 4PAZA 3GSNB 4PJAE 4PQXA 4PJ0Z 1EMTH 2DDQL 1UKTA 3E1F1 2V6HA 1AP2B 5CN2A 2OMVA 3GMOA 1ODAA 4D0DA 4G6FD 3DK0A 1N18A 1M6OB 2CNZA 2LTQB 5TE4L 1V3MA 4YZFF 4WUUA 3JAWA 4NQDE 1OSZB 2XV0A 2WLIA 1UOWA 3SE4A 2ZUXA 3JALB 4NAMA 1FYTA 2Z35A 4OV6F 1M1XB 1XHZA 1DLHB 5LVEA 4OZ4B 5E51A 4OCWL 2QWPB 3DC0A 3UYPA 3BP5B 1E4JA 1QKZL 1DQJA 3EYOA 3FFDA 4NQEE 4DR1B 2FVNA 3GSXB 4G8GA 4PBXA 4DK5A 3Q5OA 4GRWF 4XVSH 3QDGB 4QLWA 3CSTA 1WZMA 4I18B 1E7VA 2X0UA 4AE0A 1M93A 5E2UL 4PJDE 2LFGA 3DVNA 3PAVA 4DH2A 4FD0A 1KPUA 4HWZB 2ZNXA 4MMZA 4OD2A 4M43H 3A4DA 3O65A 4X9FA 3NCCB 3RDTC 3PQYA 3SDAB 3ZTJH 1JMKC 3RI5F 1FCGA 4MA7H 2Q2LA 2N74A 3C5ZD 3N9GH 1WO2A 4I3SL 4Y19B 5LGNA 1ES0B 2ZXBA 3HR0A 3VG0L 1IBHA 4UNUA 2MW2B 3GJEA 3P11L 4G42B 1GJWA 4P2AA 5CIPH 4YXLL 3BUYA 3M7OA 2ERJB 1MRCL 1PY4A 2WWKO 2Z1PA 3MCLL 2IH1A 3KPNA 3QXWA 4N2OA 4OM1H 4QRQB 4ZTOH 5HXMA 2UUAB 1HWHB 2TRYA 3VD7A 2F8VA 4YXKH 4D3CH 5DJ0A 4WJKB 3V0VA 2J4WH 3HB3D 4KK6D 4A2FA 1W0JG 1XZWA 4RMUA 3BPLC 3EDFA 3FF7A 4CVZB 5KHHA 3NZHH 4HGWA 3SE8L 4ETYA 1HH6A 4JZ2A 2N7AA 2YSSA 2GHYA 5KBMA 3K0YA 5KBDA 3PPEA 4DR2B 3AB0B 2YWYA 3B6SB 1YPZE 2BP3A 4U7SA 1SZXA 4AGMA 5TF0A 5IGXH 1EBPA 3FU6A 2YD5A 4RISH 4DKFL 3BKJL 2OL3B 2OQJA 4PVMA 3ABGA 4RMWA 1H15B 3PNWA 4G8EA 1AE6H 2BNRA 4G8IB 4DTGL 5LCVA 4CNIB 2V2XA 2A79B 3KYOA 4XZUA 4FQ1L 5JXAL 1CGXA 1T83C 2B9BA 4YIOA 3BVUA 5JW4M 4GKZB 2G75B 2KYIA 4FQXD 1VERA 1C5BL 3MYJB 1UH3A 5F3BB 2YXWA 3ECUA 5IQNA 4MQXC 2MQ3A 5D93B 3TF7C 2YAHA 1TEFA 3WGVB 2XASA 3IMSA 1IV8A 1IBLB 3D2UA 1JFQH 4HIIB 4KKAC 5DVNA 1E7UA 4UYPA 1DN0A 5B1BB 2E9WA 2IGLA 1UXWB 2WKOF 3SODB 3M7FB 1OP5K 1HSAA 1N64L 4ONGL 2J6EH 3B9EA 3FCSB 1RP9A 4QHNA 1WZ1L 5EUOE 1LK2A 1HWYA 2M2DA 3CNKA 1YHQV 3QHTC 4TVPD 5BVPL 3IGAB 1ASPA 3CRAA 2VLKD 1BGXL 3QQ9D 1EWHA 4GRMA 2YR3A 4QRPB 4ZD3L 4GX0A 4LDCA 3I2CL 1M5IA 2J5LB 3WFEH 2PTTA 4KAQL 3FUEA 4NENA 3D34A 2YC0A 4LNRB 2PPEA 2NCMA 2EACA 2Z4TA 5MEQA 3P4OB 3QVAA 4URKA 3RYHB 2X6AA 4WI9A 3ILQD 4DWHA 3CDFA 4PLJD 1PZ2A 3NSYA 5C0BD 5JDSB 3NQIA 4Z3TA 1M57B 5E2WH 1PNMA 4JRLA 4DN3H 5E00A 2E9BA 2KMWA 1CFTB 3IU3A 1NQTA 2O61A 4TQHA 2RACA 3OLGA 1SJVA 4JAVA 1FH5L 1L9MA 3G08A 4PVBA 5ETUA 3VFSB 1SLXA 1NBZB 4H5SB 1Y74A 4WI5A 4AM0A 2CPCA 5IEHA 2CMRH 3OGOE 1NC4A 2HLEB 1OP9A 4PJIA 3RKPA 3T0BA 1KLFB 3QPQC 1EA9C 3MFFB 1KBKA 1CUOA 1SF3A 3CZNA 3NR7A 4YFLI 3E86A 2CRIA 5C0JB 3WI9A 4B0MM 3CP1A 4QHLA 3RVXC 3H9SB 3O6MH 4PR5A 1FIGH 1N32O 1AZCA 3ULVL 1MCCA 4XNZB 3ZDXB 3VI4B 3VD3A 2BNQA 1DQLL 2BCKA 1VADA 1ZA3A 1TTBA 4ZAKB 4DKTA 1N5YL 4ZOBA 1IILE 3RYIB 3QUYA 1CFNA 5FDWB 1J9CT 1R4XA 3CZLA 1AXSB 4I0PB 1A25A 4FXKC 2BSDA 4U49A 1BW8A 1A02N 3TA4D 2QR0B 3ECWA 5AKVA 5AENA 3BT2L 4P2OA 4UUJA 5I71B 1EBAA 2LAGB 3ALWA 1XUQA 4NQQA 5EU7E 1VFAA 4U2YA 1GZQB 3WU2Z 4ANUA 3QIBC 3UG5A 1YDPB 3CGTA 3AY4C 1DTUA 1FGVL 1N0XL 4LF7B 1X6LA 2AEPL 3DOHA 5EYPA 4JHAL 1TFPA 4LKCB 4Z1MG 2RCSH 2IMNA 5I17B 2I24N 1ZAGA 1KGCD 4IOIA 4Z18A 1L5GA 3E9UA 3RL1A 2E7MA 3C6EA 1R5IA 4C58B 1QEXA 1Q38A 2FB4H 3UJJH 1CLYH 4U1KA 4N2NA 5ID0B 4DW2L 3OG4B 5IY5B 5KOVC 2B59B 1MA1A 2J1YA 3TT3L 1DGSA 1I94B 3U7YH 5FYKE 4HIHB 4R2GD 2IANA 3VQVA 4J3OH 4JO4H 2XOKG 5KYWB 1E3ZA 5IKCB 2FL5B 3ZKND 3ZL4L 1P4IL 4JV5O 5GISH 3BQUA 5KA6A 4TULL 5CEZH 5EU6B 1CBJA 2PO6C 1VFBA 4DP5X 1EZVH 2AXFA 1E27B 2CCWA 2YBGA 3B5TA 2QELA 5IB3A 1R1BA 1S9YB 3UAJC 1BL8A 1BM7A 4XP9H 1RJLA 5CXPA 3VRJB 1G7PB 2AGJL 5DI8A 2O6PA 4I2XE 3X3GL 4PRHE 1QA9A 1BCCH 4ZS7H 5IEKA 3KPRE 4Z7IA 2AJ3A 3VD2A 2DTMH 4GZRB 1BFVH 1MCWM 1Z5HA 2CLRA 4UZUA 2CGRH 4PCKA 2PCFA 2I60L 4FFWD 3FB8C