2EINB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2einB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2einB02
4JKNA 9PCYA 1NINA 2FJSA 5I6LA 4DP0X 3DIVA 1OOWA 4HAKA 3AG1B 2Y69B 2YAOA 2WO2B 5F7BA 1JZGA 3N2JA 1RZQA 1MDAA 2FQEA 3EF4A 2VN3A 2EIJB 2AZAA 3FYEB 1X9UA 1ET7A 2HRGA 4PAZA 3X1NA 2W88A 3QQXA 3D12B 3WIAA 1AOZA 3QJRB 2AANA 2FTAA 3ABLB 8PAZA 3GYRA 1SDDA 3WNJA 3T71A 2QT6A 2X88A 5I6MA 1V10A 5EHFA 4NERA 1KV7A 2FWLB 2I7SA 2MRYA 2UX6A 1XB6A 1ZPUA 4WTQA 3IBOA 3UADA 5B3SB 4DP5X 1E5YA 1NPJA 4MFHA 2GB2A 3ZBMA 2H5UA 3FQYA 1NWOA 2XXGA 3T6XA 2IH9A 1FWXA 3T6WA 1GSKA 1AZBA 4GP8B 3JT2A 1WA2X 3NJLA 1PNCA 1PZCA 4A2DA 3NSFA 4A2EA 2YAMA 1SHXA 4DP8X 4KNSA 3ZDWA 3CVBA 1PF3A 4M4RB 1J9RA 2XLLA 1JZEA 1KYAA 1MG2C 4YVUA 4UANA 3NJNA 5B7FA 2IWEA 3MBWB 1ASOA 3X1FA 1PY0A 1KCBA 3CZUB 1AIZA 1ET8A 2CAKA 2PLTA 3UACA 4BXVA 5B1AB 1J5DA 1ZIBA 3SBRA 4AKQA 2R7EB 2XV0A 5E9NA 1L9RA 1PCSA 4KO9A 4GP5B 4E9TA 2PP9A 4HCIA 1V55B 2B3IA 2IDQA 2DWTA 4E9QA 4A67A 1ID2A 3CG8A 4JHVA 3AY2A 2XV3A 1BYPA 1ET5A 3FSAA 3TBBA 3PLYA 2XVBA 3BQVA 3KW8A 3EH4B 4AI7A 3SBQA 3IN0A 4NB7A 3IEAA 1URIA 3FU7A 4YSTA 1HAUA 3NJHA 4DPAX 2Q5BA 5AFAA 2J55A 3AG2B 2CJ3A 4TXVB 3FU7B 2UXFA 3FQ2A 4CSPA 3FU8A 5I6KA 1UATA 2Q9OA 3ABKB 3T6VA 4DP1X 4HALA 1HAWA 4DP9X 3NYKA 2P80D 1KCWA 2IAAC 1AR1B 1M56B 2J5WA 1E67A 1GS7A 5AZUA 2GIMA 2GC4C 3H4HA 3TU6A 4YVNA 2B08A 1L9SA 1SF3A 1OCCB 4A2HA 2GC7C 1JXFA 3EHBB 5I6PA 3U25A 2VW7A 4KNTA 5LDUA 2BW5A 2H47C 3FSVA 3CVDA 3AZUA 4JHUA 3S3DB 1E30A 1AACA 3OM3B 3TA4D 4HHWA 1JERA 4YSOA 1AQ8A 2PCFA 1SJMA 2YAQA 1QHQA 3UAAA 1GW0A 1BQ5A 1DZ0A 4L0PB 2BZCA 3AG4B 1AANA 5A7EA 3S8FB 2XX0A 1J9TA 1QLEB 1KDIA 4YSPA 2BO0A 1GYCA 1SNRA 1IBYA 1OCZB 1WA1X 1GS8A 4YSCA 2RACA 3ABMB 2YXWA 1WA0X 4E9SA 2ZOOA 2DYSB 1M9WA 5PAZA 2VMJA 4BWUA 2IDFA 3WG7B 3WNIA 1E65A 2QPEB 2HX9A 2YAPA 1BEXA 3ASNB 1X9RA 3PAUA 4ZK8A 1ASQA 2HZHA 1YLBB 1SDDB 1CYWA 2MTAA 2AFNA 1W6LA 3QJUB 1A4AA 4F2EA 3NP4A 4E9VA 2W8CA 2GBAA 3UGEA 1N70A 1PMYA 1EHKB 3L45A 1L9OA 3NJKA 4QLWA 1TEGA 2PCYA 2BW4A 4RH4A 2UX7A 2HX7A 2N0MA 1M57B 1E5ZA 5PCYA 4N4YB 4G7SB 3FQ1A 2FQGA 3NT0A 1CYXA 4G72B 2CUAA 1BQRA 4WKXA 1ILSA 2IWKA 4GXFA 4HZ1A 4A66A 2CALA 2FT8A 2XUWA 3TBCA 1BYOA 4F2FA 1MZYA 5B1JA 2EINB 2BP8A 4UF7C 1WAEA 5ANHA 1IKOP 1EZLA 2VM4A 1PZAA 1NZRA 4DP4X 2PPEA 3AW5A 2PPFA 3DTUB 4YSSA 3X2QB 1FA4A 2QPDB 2BP8B 1SF5A 3CDZA 3QJVB 4HCFA 5D4HA 2HLEB 3EH5B 2FQFA 5IY5B 2HXAA 2VSMB 1GY2A 1I53A 1OCRB 2AVFA 2CBPA 2JKWA 1IBZA 4KO5A 1SFHA 1ILUA 1BAWA 3T6ZA 3NJFA 2UXTA 4A2GA 2IDTA 2BZ7A 5I6OA 2GSMB 3OD3A 2EIKB 1ZIAA 4KOCA 3NJGA 3ZIYA 2IWFA 1L9QA 5TK2A 3PXLA 4K9JA 3PPSA 2TSAA 1KDJA 2YAFA 5I26A 3EH3B 2X87A 1XMEB 4YL4A 3QJQB 2IDUA 1MZZA 1AZNA 2HX8A 2Y1AA 3FU9A 1JZJA 1JVOA 1RCYA 1NIAA 1ASPA 1NIBA 1DYZA 5B7EA 1KBWA 1SHWA 4ENZA 3FPXA 4F7KA 2J56A 5I5JA 1NIFA 5TK4A 5D4JA 3T9WA 2QDVA 4E9YA 1FFTB 3PAVA 1GY1A 3FS9A 3C75A 1TU2A 3FT0A 3IN2A 1AS7A 2DY2A 2DYRB 1IUZA 2P80A 3HEIB 1J9QA 3OMNB 1NPNA 5AKRA 3MX0B 4A2FA 4UAHA 1JOIA 3H4FA 2YARA 4W1TA 4QKTA 1PLBA 3PAZA 4PCYA 2GHZA 5I5IA 4DP6X 2YAEA 2NRDA 2XYBA 6PAZA 3AG3B 1XB8A 2OV0A 2WO3B 5B1KA 2JXMA 1RZPA 1N68A 1AS6A 3FSZA 4GY4A 2XU9A 3JTBA 4YSAA 4G7RB 1CUOA 3WKQA 3V9EA 4DP7X 4G71B 2BWDA 1NDTA 3NJMA 3OMIB 2IH8A 3ZX1A 1OE3A 1JXDA 2OCCB 1JZIA 4DPCX 1A4CA 1KBVA 5B7MA 4M3HA 1BXVA 2LLNA 1QNIA 2ZXWB 1B3IA 3BVDB 2FT6A 3QJTB 3V9CA 3WI9A 4KO7A 2EIMB 5B1BB 2XXFA 1L9TA 1IC0A 2I85A 3S8GB 3QJSB 2VW4A 1ZDSA 4YSRA 1BXUA 4YSUA 1A4BA 5I28A 6PCYA 1CC3A 2JFCA 3UABA 3QPKA 4YSEA 4E9WA 3IE9A 4HIPA 2BP0A 4DP2X 1JVLA 5I5MA 2VW6A 4BK5C 4P5RA 2IDSA 4N8UA 1RKRA 2XWZA 2TSBA 1OV8A 2BP0B 2PP7A 4G7QB 4W9ZA 3CVCA 2EILB 4CSZA 1J5CA 2I7OA 1PNDA 4E9RA 1WS8A 3HB3B 3N55A 4AKPA 2BHFA 4AZUA 1A3ZA 1JZHA 1R1CA 4Q8BA 4FA7B 1BXAA 4BWTA 4YSDA 2GI0A 2FT7A 2YQBA 1NTDA 3KW7A 4GYBA 3NSYA 1WS7A 3SQRA 1OE2A 4G70B 2AZUA 2UXVA 1AZUA 3CDZB 1AZRA 2VSKB 3S3BB 2R7EA 4EF3A 2PP8A 4DPBX 1A8ZA 2J57A 3GDCA 3PCYA 1TKWA 2PPAA 1AZCA 2CCWA 1JZFA 4A68A 3NSCA 4BXSV 1HFUA 3S3CB 1T5KA 1PAZA 3H56A 1J9SA 3GXUB 4HHGA 1ZDQA 1AG0A 1PLCA 2H3XC 4BDVA 3FPYA 3ERXA 2HRHA 1TEFA 2FNWA 3ABGA 4AKOA 4YSQA 5D4IA 3NJIA 2E86A 1PZBA 2VM3A 4BDVB 1SFDA 1AG6A 2BWIA 4KNUA 1NIDA 2DWSA 1BQKA 3OMAB 1OE1A 5F7AA 2OJ1A 4X4KA 2A3TA 3OQRA 1KGYE 1XB3A 7PCYA 4AX3A 1A65A 3NJJA 1OCOB 1W6WA 1NWPA 3TASA 4E9XA 7PAZA 2FQDA 2WSDA 2ZONA 4Q89A 4KOBA 2YEVB 3X1BA 1GS6X 2YXVA 1NICA 3ASOB 1W8EA 2PPDA 1CURA 2XV2A 4NAJA 2PPCA 2YAHA 4FAAB 2QDWA 3WKPA 1AAJA 1ZV2A 1ADWA 3NP3A 1ETJA 2DV6A 1PLAA 3X1EA 3X1GA 1JXGA 3G5WA 3RYMA 1F56A 2ZWNA 2XX1A 1NIEA 3NSDA 1GR7A 3DKHA 1AS8A 2UXGA 5B1JC 3FYIB 5I6NA 1OF0A 3FSWA 4KO6A 4P5SA 1V54B 3UAEA 4GP4B 5FC9A 1MG3C 1L9PA 1VLXA 4BWWA 4HCGA 3SBPA
chains in the Genus database with same CATH superfamily
3B1UA 1UZGA 4HISA 4LQFH 4AVJA 2O5NA 5IB4B 1M7DA 4N1HB 4NNPL 4IBLT 3FB8C 2XAFA 3V0HA 1MWAA 5FXCH 4LHUA 2FX9L 4PGBB 1I1YA 1KYFA 4TRPH 3FB5A 5D5PA 1ZA6A 2DW5A 5DURB 5JUEL 3NH7H 3VQLA 5KBLA 1MNNA 2EIZB 2VITA 4JI1O 1B0IA 1SYSB 3MRKB 2CXGA 1AP2B 1AYOA 3FCTA 1I1AC 1X6LA 3T71A 1LO3H 4B7EA 4JDEA 4ZXBB 3VXRD 2UUBB 1GGYA 4L23A 2VDQL 3KPRB 4O4LA 4WV1C 2QVKA 4NERA 4WSKA 5DMIH 2MRYA 3DIFA 5I1LA 4DR7O 2VC2H 1VFMA 4KMTH 5E94A 1NGPH 3UADA 2FLBT 5J3HC 2WLJA 1AJ7L 4RFEA 2IQ9L 4MFHA 4XOCA 2FKXA 1QFUL 1B6QA 4ODSL 2LLLA 3ISYA 1KFAL 1KLGA 3CWGA 4FE9A 3HR5A 1KIRA 3Q9QA 3T6XA 1KB5A 4H1LA 1G9NL 2OLDA 2O93L 4QUOA 3MLXL 4B5EA 4HUWB 4X9GA 3WIFA 2VDLL 1B4JL 1GN2A 5CR1A 4N1CA 3EVKA 5CINH 3V6ZA 4FNLL 3RBSA 4CVWA 1NCDL 5EIIG 3DROA 3MXWL 4N0RA 1GC1L 1ZHNB 4KJWC 2P8LB 5IB3A 5MP6L 4GKZB 3SGJC 5B1NA 1CO1A 1FCGA 3JV6B 3GXIA 3QFJA 4XE5B 5HDQH 5A2JH 4DV7B 4KK6D 3LSOA 3QW9A 1K85A 4PS8A 1C8QA 1YEWA 1RY7B 4MW8A 4MAZA 3UACA 5TDNA 3BHPA 5LP6A 4M7ZC 3G08B 5GRJL 3VI3A 4KO9A 5LGHH 2VAAB 5BRQA 3LQAC 1SJHA 4OGAD 2ZJSH 1PKOA 2JKRM 3NK4A 3TH2T 1HILB 3MCLH 3ECUA 4BK4A 1VFOA 1TXKA 1HHHA 4IRJD 5BMVA 5BVPL 2H8PC 1JPXA 1UYWL 1UD6A 3V4VH 1IEAA 1P84J 3OZ9H 3TBBA 3F5TA 2EIMC 3U7WL 2DOSA 1MCFA 3KLKA 4NRXB 3L2NA 1K4DB 4LVOC 4Y4KC 5I1HL 4WEEA 4ZMPA 1Q0XL 2J6EA 2HHHB 3LS5H 4YSTA 3ATBA 3FRPB 5EOQH 3E89A 1VF5C 4HIHA 4XBFA 3ZMZA 4EZLA 1N9PA 5A6MA 2Q8AL 3B8MA 3WGUB 4HVBA 4K8XA 2JIXA 2YPVH 1BD2B 1YYLH 1WUNT 4JPSA 2QKIC 4OJFL 5D72H 5L9DH 1UATA 2HP8A 4NQDA 2GUYA 4XP6L 4DP9X 1ZEAH 2R9HD 1QKZL 1SKVA 1Q0YH 2AS5M 3ATDA 3HE7C 3VFNB 5HGBA 2GHYA 1PQZB 4HGWB 3ZKSD 4P4KB 1HHIB 4CU6A 1PZSA 1N6QL 4BSJA 4YPGB 3U9UA 5GGVL 3N40P 4BQBA 5DF0A 1SZXA 1M6UA 3D8CA 5JHAA 1CPUA 5DHVA 3LZFL 2AXFB 1U92B 4LZKA 1J88A 3PWPE 5C0CB 1Q0EA 3T8XB 4DZ8B 4EI0A 3FSVA 3CVDA 4RRPG 1P53A 1C7TA 3D05A 3HBQA 1CDCA 5HJ3B 1B0GA 5HHOD 1BGXL 1CD1A 3ULUD 1KENH 2J3SA 4FFTA 4I55A 3B2MA 5LCVA 3T1HO 2Q5ZA 2YMXL 4J2QA 1MCLA 5ESAA 5K9JH 5AKTA 1J95A 1SEBB 5DD0L 2WLIB 1OT4A 2LFEA 2JB5L 5A7EA 4AQZA 1L0LH 1K72A 1PNKA 4LF5O 4YSPA 4U3SA 4JPWL 2WWKT 1GS8A 5IG7A 1JPEA 2NY6D 2OMTB 2XWTB 3IGFA 1KPRB 2XZCH 3QR2A 3ZUNC 5IGXH 3K03A 4IIZA 4HFWB 4DQOL 3OZKA 5DT1H 4GCZA 2VMJA 2BMKB 2VISA 4Y1AA 3TJEL 1F42A 2P5WB 1OAZL 1KV3A 3E1ZA 1UGNA 4LCYB 1OEZW 1TQSA 2I07B 5GZOC 4Z7UA 2FB5A 3KPTA 4AENA 1WCBA 1F11A 3PAUA 4O02A 3HNTH 4HWEL 3ULVF 1RP9A 2DEXX 4G3YH 2FBJL 4NP4L 3FRUA 1P4RA 2L6LA 3KPRE 2EJRA 1BAGA 1NSNH 3HBPA 2LGWA 2ADIA 5T5FA 3RVUD 2BRRL 1H3GA 2W8CA 3D85A 2YLKA 2KG7A 4LF9O 1NL0L 2E7BA 4UOW0 2HX7A 3BAEL 3N9GL 5DFVC 2P90A 5JLZA 1WZKA 1G7JA 4N4YB 2AJXL 1J0ZA 2FQGA 3MOAL 5IJCC 3MUZ1 4MMXC 5EBMC 1JI2A 3C5ZC 3FQTA 2OK0H 4OFYD 2CALA 3PGCA 3ALPA 4OFPA 3W57A 3NFNB 2H0FA 1JE6A 4Y2DA 3DX7A 3P9LB 2LVEA 3RFRA 5LBGA 4KRLB 4YHNB 5IUCA 4ABMA 1T22A 3HHMA 3DTUB 4JZNA 4KC3B 3O0RL 4AEHL 2R70A 1FFNB 4IL6Z 4GSUA 1SQPH 2BP8B 1ZK9A 5C09B 1IAKA 5FV2A 3SE4A 2FQFA 1GO3F 2WWNA 1AGDA 4OZFG 4AM0A 3FB8A 1VQ5V 1X5XA 3TBYB 4R7LA 3S4SB 2EDXA 2VLJB 3FTUA 4P2YA 1HOEA 4FQLH 4DW2H 2CTRA 2LFSA 5E9DD 4BA0A 4ELMF 2NYYC 1MAML 4FLQA 4LPUA 5FNVA 2YD1A 3S96A 2CXKA 3LKPB 1QUNB 1EN4A 2EIKB 5DLML 1ZS2A 3KPLA 4KOCA 4CW1A 4WJG3 2CK2A 3B2UD 2ADYA 4EOWL 1F00I 5HGAB 3RKDD 4PGEB 4PJGA 1EJOH 2H0PA 3BGMA 5C0AD 3VFSA 1ZTEA 5MI0B 1DTOA 2Z0AA 4PJ9B 4X6FA 4Z6AT 2XFXB 3QUXC 2Z8SA 2BY2A 4LC1A 2ZX6A 5BUGA 1EEYB 2JCWA 2YAFA 4WTWA 5BNXD 4JY4A 3RIAF 2IDUA 1MZZA 2LQRA 4Z78B 4YFDB 1DVFD 12E8L 1S8DB 3KNBA 3MV7E 3U0TA 3QDMB 4QXUL 1MCDA 1DYZA 3INOA 1HOCA 1SHWA 4WTXA 4YDKL 4EZMA 4MMZA 4ENZA 4B97A 1BD2E 3BSHA 1ACZA 5TK4A 4JCMA 1IEHA 3GRWH 5AZ2L 2QDVA 2YK1L 3VB9A 4ETYA 4GZRB 2X09A 2CZNA 1DE4B 5JXAH 4JN1L 4YIQA 2GK0A 5BO1L 4R90L 4QNPF 2BNQE 5L2JB 2DYRB 4AV0A 2EC9U 2P80A 3HEIB 4R0LB 4XP4L 1U2CA 5GTHZ 3MRRA 1QG3A 2PGGA 4PV9A 4QTHB 5DJDB 4JFEB 5C0CE 3IKCB 5FO2A 4GKJO 1DVSA 3CDGB 4IKKA 3RYFB 1HEZA 2ODIA 3ZIAG 1WA8A 1FZMA 2NX5E 4XO3A 1RZPA 3DXAA 1J9CT 3FU5A 3IDGA 1AS6A 3MBXH 1MCIA 3VH8A 5LLIC 1E5CA 2C3WA 5B38B 1BHAA 1TQCC 2BWDA 3OB0K 4M6AA 4NC1C 4Z2WA 1JXDA 4WI5A 3TCTA 3Q6GL 4HS6A 4L05A 5CLTA 4ZS7L 4WWNA 1A4CA 2ADGB 2HMID 4JN2B 3VAEA 2QWNB 3UJTH 2XKUA 4WEBH 1CDGA 3ZRFC 4CZZA 1F86A 1P7QB 2FJGA 1C5DA 2BWQA 2R56L 5EUKB 1T03L 3H3BC 4Q4IA 1BQHG 4PJ7B 4Z1MG 2QSVA 4PRAB 1JYXA 4TV8A 1JGUL 1NAMH 3WO3B 1GPOL 3RAJH 3GLDA 4PMFA 3E8GA 1SETA 1JHLL 4CBPA 1OZUA 2QKIA 3A6CL 5A7BA 5ERWB 1ZDSA 2AQ2A 2V3EA 4TUKL 1DBKL 2GBVA 5IVXE 3HE7A 4ELKB 3K0WA 1WWWX 3ROLA 1DLHA 2AV1B 2Y2YA 3RIKA 4Q0XL 3SO3C 5EB9A 3DETD 2CO3A 2DQIH 2VW6A 3HKZA 4OGQC 5LGJA 5I15L 4X4XA 2VE6A 3MGOA 2XTSA 2DWEA 1VZIA 1W8OA 1OSYA 1CL7L 1P9MC 4IYHA 1OV8A 1QFOA 2PP7A 2LW1A 1J1PL 1RJZB 5I82A 3RDTD 2B1GA 2GT9A 1RJLB 1G6RH 5SWZA 1KLUA 2F53A 1XBLA 3OKYA 4ONHA 1GCYA 2FYVA 4M1GL 1SQXH 3K08A 3L3OB 2J73A 3H3PH 2Y5TA 3MRGA 3WFBH 3BJ91 2DBJA 2YEZB 1R1CA 2NXZC 2A9AA 2D2CC 2WXQA 5DMKB 1S9VB 3CMAV 2VDKB 5TDPA 4OV5B 1MIEH 3MJ6A 1U95B 3N6YA 3JATA 4LSPL 4N8CL 4X6BB 1WK0A 2XKSA 3APFA 4FZEL 5C09E 1FORH 1FVDA 3QT2A 2LGQA 2XAGA 1DQML 2G60H 2D0FA 3H3KA 3BSZA 5DS1A 2I32A 2VLJE 1VQKV 5EU4A 3AG4C 2CBOA 2OBGA 3GDCA 3PCYA 3BRGC 4YE4H 5L4FA 2IM9A 3HG1B 1KUQA 3DVNB 4UAOB 3CFNA 5DJYB 5T3ZH 5GZOA 2CCWA 4QAMB 2BDNL 3C5SB 4MVMA 4L8SB 5DDHA 1LEGA 2B4CC 1VPOH 2BH0A 1RMFH 1MCOL 5MEOA 4AJYV 3PV6B 2Q86A 3RVYA 1RM1C 3HFFA 1PLCA 3SBWC 3WJLA 1G5AA 3SKNB 4KZ0A 1EZUA 3GO1H 3C8KA 1BZQK 3RWCB 3CFUA 2IH3C 3NJIA 4OGZA 4PVNA 1N33B 4XNZB 5FA3A 4YDIH 4HPOH 2OZ4H 3QDME 4BFJA 3UP6A 4HG4J 1NIDA 1YECL 4ZOAA 4WW2A 4B3MO 1DP0A 3QDHA 3NABL 2QE7G 1JGEB 3S7GA 3C5ZA 4HWBA 3D2UB 1MLBA 1QBZA 3HPLC 4AX3A 3TP4A 2HRPL 5KUMA 1FIGH 1FYTB 4P2QB 1UM6L 3BVTA 1YA5A 7PAZA 1X5GA 2Z9TA 3IDNB 3LEVH 1JTTA 2F5AL 3IMRA 1QR1B 3QCTL 4UNIA 3GB7C 4P23C 1KCVH 1IEBB 2YXVA 4NUPA 4FKKA 3IU4H 3AT9A 4KX9A 5D96C 2XIIA 3V0FA 5F89B 4NQCB 2NW2A 5H4ZA 1QACA 1U8JB 3AB0B 4JAVA 1HINL 4J12A 3H9HA 4JFEE 4KQ4H 4F37F 3JWOC 5ALBL 5I1GL 4NB5A 3QCVH 4BINA 1GYUA 4P2RB 4Z7OF 2MCMA 3CC5A 1VERA 3ZGIA 2YSSB 3CS5A 5ID1A 1NBCA 4HAFA 2OMXA 1I5YA 5D7LD 3CFBA 1GR7A 2HFFA 2XWBB 4K5NA 3ZXAC 4MTFA 3GF8A 2HEPA 4FYTA 4QCIA 1CU4H 1OF0A 3TPUA 4A04A 1FPTH 5AB1A 1R3IL 4GG8B 4TVUA 1MG3C 5KVGH 4MX7A 3C60D 5E8PB 4UYPA 3A2FA 2BY0A 5AG2A 2OP4L 4HCGA 5BZXA 3QUXA 2EH7H 4R96A 4DGVL 4DF9A 4MTGA 3HCVB 1KQSU 4QHNA 3D08A 3FH8A 3G6JF 2BSCA 2GSGA 2N4IA 4NLAA 4QOKA 2MNUA 5FCSH 4GW4B 2AK4D 1E4WL 3NCYS 4PJ7E 1LO4H 1XGYL 3QIBD 4MNQB 5KBNC 4GUQA 5G4MA 1IGFL 4N6RA 4YHHB 4LGRB 2AGAA 2UZXA 4MB1A 1ZLEA 2ZCKH 3EOBB 3O8XD 1DJIA 2BC4B 2W60B 2KLRA 1X5YA 2KQMA 4UB8Z 4HSQA 4RBPH 3VFUB 1G7LB 4B50A 1G0YR 1UKSA 4X5RA 1D5ZB 4Q20A 1IT9L 4TSBH 4ZO9A 3QZWA 4FQJL 4XI5C 4NKMB 3P4OA 2FWLB 4PM1A 3QNXB 4AYFA 3OEEG 4AQYB 1AROP 1FNSH 5E2UL 2BIQA 3W7UA 43C9B 4J9YB 1UACH 4BH8B 4CA4A 1Z2GA 2VN5A 3O3DB 4P3DA 1U3HB 1OXYA 2VJXA 4DAGL 3MC0A 4NJ9L 1MJUH 1JPFA 2H5UA 3GSNA 5DUMH 1E3FA 2XXGA 3WELA 4TQIA 3GHEL 4Z0BH 4Z7WF 2YN3A 4GAYB 1VCAA 4RFOL 2FECL 3TZVD 2EKSB 1T0NA 3BT2L 4DEUA 4DKTA 3ZUCA 3W56A 2IANB 1PF3A 2IPUG 2IXQA 3CVBA 4KFZC 5IREA 1R5WA 4JB9H 4H8WL 2IJIA 2BOCC 1MG2C 4D2NA 5EZIH 4UTAH 3ZHSA 2L7UA 3ILQD 4QY8B 2E47A 4JK0D 3GMQA 3LRHA 4KY1H 1P5UB 3DVFA 1VQMV 5AAWA 5E8OB 4YXWG 4FZ1A 4L5FL 1PD0A 3BVUA 3HG1E 4E9TA 3S6CA 2H6PB 2JKLA 5IWAO 2J2ZA 1QWNA 4AQEA 2YOAA 3GSQB 2WTRA 2FEDD 2W81C 4JI1B 5KTEL 2A9HA 3HHRB 4DPRA 2R4RL 4BZYA 4UOQA 1S7XA 5DSCA 1EERB 4JHWH 3V0VB 1AZVA 3DK0A 1NBZB 2VXUL 4HS3A 3HI6H 1XT5A 1PIGA 1D7CA 1QHTA 1SS3A 4HUMB 3KZIZ 4J6IA 4LLDA 2VXVH 3BESR 2CKBA 4DR7B 4O51A 5FA4B 3PIQB 1L8DA 1X5AA 4S11A 5L3BA 1D5MA 3RYCB 2D8KA 3QIUD 2EVGA 1CZ8L 1BVKA 1I9IL 2AEWA 2J20A 5D1QC 1C5CL 1WWCA 3WNNA 5EK0A 4WO4C 1H15A 3W7TA 2MEJB 2RGSA 4LPYA 5HVHB 4NXKA 1FYTE 4P2QE 2EDNA 1AR1B 1H8OA 4NOBA 3N27A 1H38A 2Q0OC 2VR5A 3NIDB 5JR1L 3GFUA 4NAQA 3L4ZA 2HFTA 2H3NB 4M61A 1IVTA 1M1XA 3FFCD 3SQOH 3I6GA 4KY2A 4HEME 1EDYA 4BZ1H 2CR6A 4EIBA 4W81A 3N40F 4G8GB 1T4KA 4W9EC 2M6YA 2FSEA 5I30L 3RUGA 4XNQB 3CVHL 1L9MA 5JO5B 3VTTA 3FUEA 1FNLA 3AZUA 3M8OL 4X5WA 3HKDB 4P2RE 5F2VO 4YSOA 1AE6H 4CH5A 1PG7W 2DLTA 5CP3H 1AQ8A 3FT9A 3MR9A 1H6UA 4GRMB 5EF2A 4P9MH 4OKDA 3TN0D 3S34H 2EO7A 5AYUH 3HE6D 4ELMB 2H6UA 5E95B 2C2AA 1J9TA 5E51A 2W1NA 3SBWA 1R19A 4N2EA 2E74C 2D9QB 3AGWA 2NTFB 3K06A 3CHQA 4TS6A 1ZANL 2G0LA 3SZ6A 4BYHA 5LUMA 1BQLH 2A2QT 4LHUD 3JZYA 3HMWH 4JAUA 3RVXD 3WKMH 1MPAH 4LARH 1A32A 4MNQE 3KDMA 2IDFA 3EKCA 4Y4FC 4Z3GA 5HHPA 3L3JB 1E65A 4WO0A 2F4VO 4FHJA 4R3SA 1R0AL 2MIZA 3LPPA 2BXYA 1JI1A 3RY4A 3MCG1 1F6FB 2PYJA 4HV8B 4G59C 3HPLA 5ANMA 4JG0H 4ASUG 4OX9O 3W7SA 1N8OE 3G5ZA 3K2MC 5AVRB 1Q9LB 2ZIDA 3MNWA 5L0QB 4NO2A 3ATEA 2Y7QB 3J27A 4I4WA 2YGOA 4ES8A 1VQ7V 4ZFGH 3FT1A 3ML9A 3KPOB 1I4FB 3KBEA 1QBBA 2OJEB 4HUUB 1QRKA 5L6YH 1KIUB 3LRSB 3G9AB 4H2CA 1VENA 1O9GA 1NQBA 3KGTA 4IBSA 3FQ1A 1PD3A 1XF3B 2VKXA 5SX5H 3UERA 3VRIB 5HHNB 5I8KH 1O6SB 2IWKA 4HZ1A 4A66A 4ZG1A 4FG2A 4KVCH 4FCAA 1TJHL 3GSUA 3U7YL 3ISRA 5CLXA 4A5UB 4M6MH 4Z7NE 3FB7C 1E7VA 1UWXH 1IKOP 4YBQD 3QCUH 3CCRV 3JTTA 2MHAA 4LP8A 3BFRA 3QFJD 5IR1A 4KJQD 4LF5B 4IJTA 4Y16A 1ZS8A 5E4EB 3OWRA 3T4DA 2AK1L 4OPHA 1UUSA 4V33A 4LF3B 2X3CA 3LVTA 4NQEA 2IEPA 1XIWC 3OHXB 4LCWA 5IF0B 2X28A 4H26B 1DDHA 2IALB 2WBXA 3OGOE 4MJIA 1CDBA 3MHZA 4KO5A 1G7IA 2ODHA 3D07A 4X0NA 2EX3A 4JAMA 2FBOJ 5CKAA 3LDEA 4QRPD 1EQWA 3LNMB 4MCZB 1OCWL 3IETB 5F70A 5T1LA 1NFDA 4BD4A 4KROD 3DI2B 2D03H 3FHEA 3QTCA 3MXVL 5E6IB 1VGKB 2OTWA 3ECQA 3ULVE 4QJ4B 1KDJA 3FH7A 1QSFB 2ESVB 3LPWA 4G80A 3K3WA 1FO0B 1KGCE 4LPTA 1TVBB 4XPHL 4LF9B 1BM3H 3FBKA 2XWJB 4M6NH 4D9QD 4UOJA 3C12A 3DURB 4ERSH 4H8HA 3L7EB 3CHSA 1R6VA 1AGBB 4ZZKA 5B39A 1TETL 5JXEA 1V27A 1B3QA 4ZXBC 4AY0A 3CCSV 4PP1C 2X4TA 4YN3A 1EPFA 3GXTA 1YSOA 2HP4A 3JXAA 4OZ4B 1UFIA 5D4JA 5E6ZA 3RZCB 3ZHFA 1ZA3B 2R9IA 1CE6A 3QVAA 4ANKA 1JDAA 1ODUA 4X0KA 4OI9A 2KZBA 1TU2A 4FQHA 1BEYL 2WSSG 3BP6A 5C70A 3K0GA 4FTVB 4XMPH 4LSDA 3NBNA 2BOCA 1MFNA 3BVXA 5LN4A 1T04B 4K71B 4HUCA 3EYSH 4GYCB 2IPTH 4A7VA 3L75H 4AUYA 5E2VH 4L18A 1PLBA 3B83A 4MSWA 4AV4A 2XFGB 5EO0B 5IJDC 1NDGB 5F96L 3MUGB 3GT6A 3L5XL 2Z4TA 3PJNA 1JCHA 4FQXC 1URZA 1ZTMA 3OPUA 2WBKA 4ELME 4K3AA 3OMIB 3U46A 5GZNC 2ZXCA 4HXBH 5JORA 2WP3O 3ESVF 4DIXA 3D30A 5DHMC 4PDVA 3KLSA 1N7MH 2Y23A 2V3DA 5DJZA 4XCCH 1HNFA 3BKCL 4EUPB 1YNLH 3DC0A 5CB4A 1R73A 5DJ6B 1B3IA 1ZLDA 3WN5A 1CLOH 4IHJB 4AQ1A 4MS6A 4YEFA 2D0HA 3JWNC 3NEEA 5ID0A 1ES0A 5I1DB 3Q13A 2J6WA 5D1QA 4NZ8A 4XRCA 3GKZA 5EU3B 1DQIA 3EFFB 4M1CD 5EPMB 2OX5B 2EYRB 3K5LA 1K4DC 1E7UA 3UTSA 2KYIA 1BXUA 1K8DA 4WRLA 4YSUA 5KZCB 1LDPH 3TBVB 1CFQB 3VGFA 1URFA 3QG7H 1G0XA 1CWVA 1DUZA 4URTB 1BF5A 1S2EA 5IVNA 4B9YA 4IRZH 1M6OB 1TLMA 4B3RO 2A1WL 5EU6B 4F2MB 3D85D 3VDCA 3BI9X 4GQPH 4S1RL 2ZR3A 3Q2WA 4BK5C 4JG1H 5F3HA 5J1AB 3ZYIA 4TUOA 5IOPA 4QNPE 1T2QH 1OLZA 2DKMA 2TSBA 4PRHD 3BA9A 1AKJB 3FL7A 1NAKL 4HUNB 4UQ3A 4WNQB 5HPMA 1KC8W 3OV6A 2UU9O 4GKJB 2H2SD 2ZAIA 2BNUA 1ROPA 4P4KC 4ZBJA 5HDBF 3SDCB 4E9RA 1K5WA 1ZAUA 1IJNA 2Y36L 5LYJB 1DVUA 5LMNB 5HHVH 3DPDA 4AGQA 4RWYL 3CX5K 4HK0A 3ZYOA 5BZBA 1G6VK 3ME0A 4Y0GA 3WGVB 4GW1B 2GTZB 3FN3A 2NY7L 4R5XA 3RZWA 3U36A 2GI0A 2E7LC 3IS1X 4DV4B 3C8DA 4MD4B 1V3MA 4JFXB 1LMKA 3FKUS 2K8MA 4EKWA 4YNYA 3UEZA 3AFLA 3Q8BA 4MA1B 4WFFD 5E5RB 3ZZ1A 3KPPA 2AXGB 4KXRA 2G75B 1SJEB 3A24A 1YN7B 2IBBA 3J07A 2PP8A 3WE6B 3G6JB 5IESH 3IDJA 3BHBA 4JFDE 1UKTA 3UX9B 4OZIF 3BVNB 2EDTA 5TFSL 1C16B 3WENA 3IMWA 4ZO8A 2EYSA 2FO4B 2PR9A 3EOAB 3H56A 1I1AD 4CGUB 4WLCA 1QBML 4MASA 4OLXL 4Z76B 1NGZB 4HHGA 5D7IE 1AG0A 1YPZF 4AYDC 5F88B 4TSFG 2AXWA 5ITZB 3VM7A 4LNUA 1U8KA 5JOFA 5BO0D 4XE0A 2ZKHL 2XZZA 3D39D 5J3HD 1MFAH 1QSFE 1YEEH 2ESVE 5E2TL 2E9JA 3HS9A 2R2BA 4DN3H 4KZDH 1AHWB 1QQCA 2X2UA 3WD5H 4Y1TA 2V5MA 2FEJA 3RWEB 1MY7A 3BKJL 1BE3H 5FF6B 2A3TA 1UCBL 4Z3EA 2D4DA 1KGYE 1Y76A 2DBLH 1UZ8A 1H19A 1OGAE 1YNKH 1H8LA 4YXHL 3MRPB 5C6PB 1NCGA 2ICWJ 3TASA 4E9XA 4RAVA 2Z0UA 1FG2A 2D7TH 4ELDA 1JGLH 1SPDA 2ZONA 1KYUA 4Q89A 1UA6L 3C90A 5CS7A 1T66C 1MFBL 5HFMA 3NA9H 3HG4A 3F00A 4EBQL 2FJFB 5FUOL 1AAJA 2ZCLL 1HSBA 2P3YA 3GMMA 3W9DB 1IBHA 3UPAA 2FECI 2L0DA 3M6DA 5IMMA 1F56A 4NENA 1XIWA 5BXFA 3HLKA 1A7RH 1DJYA 3TIEA 3H85A 2ED9A 2I24N 4URKA 4Y5XA 2JF1A 1WWBX 2UXGA 2FR4B 4NX0A 4AIEA 4MZ3A 2ARHA 2ITDB 4YIOA 1SM3L 4P57B 4NFCA 3JUZA 5IB4A 5A16B 5JPNB 1X6NA 2DTMH 2CTQA 4Z7VF 1RVFL 4ZW5A 1Q6IA 3MCYA 4QRAA 4Y4KD 1AO7D 3N1GC 4K7PH 2ZPKL 5J11C 3ARXA 1WGOA 2FJSA 4UIKL 2EIZA 5I1JL 1EO7A 2COQA 3LZRA 2IU0A 2EIKC 1I7RA 3U79A 1WB8A 1SYSA 1E43A 3MRKA 2Y69B 2YAOA 4GMSH 4PJ8C 1P5VB 3A4FA 3KH4A 1MDAA 1BIIA 1WJZA 3TT1L 3ES6B 1U36A 5A43C 1WF5A 1ZVSB 2X0WA 1B04A 3O41B 5H94A 4ZXBA 4IK6A 1ET7A 5MI0C 4PJ9C 3WEBA 3Q0HA 4TULL 5F7EH 4FLRA 4UCRA 1U0QA 5CD5C 3UTTB 4V1DA 3CRQA 2FWSA 3HE7D 3APCA 1A02N 2EEDA 4WJ5A 4O58L 1OZTG 1U2YA 4F2ME 2PTVA 4L4VE 4ALAC 1T20B 5IFAL 3P73B 1AY1H 3RU8L 2H32A 5C2UB 5LMUB 3F83A 1ZPUA 4W6WB 4A2LA 3B8SA 3MLUL 1MSDA 4U6XB 5TDOA 1U3YA 4HUWA 1NPJA 2CM5A 5I1KH 4E0RB 1RSFA 2QLYA 5SWZD 2GB2A 1RERA 1NWOA 1IBGL 4P3WA 4XX1E 3HZMB 4RGNE 3IVKB 4PJFF 4WI9A 1ZHNA 2IH9A 2P8LA 4DKDC 1AQHA 1U8CB 3NCEB 4GT1A 5IQMA 2DYRC 1OAXH 4Z7OE 1AZBA 4TLTA 1NCCL 2DI7A 3BWUF 3JV6A 4R0LC 4UCFA 1PZCA 4ZMZA 4A2DA 5GZNA 2YAMA 2ERJB 5KX5B 1CR9H 2K1EA 2EEFA 4U3XA 2OYKA 3ZX6A 1GRWA 1RZJL 1ZOXA 4J3BA 2MCAA 4PJCA 1HDJA 2NNXA 5D1ZB 3MNVB 2E4FA 3ZHUA 3MJWA 3MBED 3QORD 4P8QA 2F74B 5ITFB 2PLTA 5F71A 3OKEB 3VWJA 4ZX5A 1JSYA 2A99A 1S3RA 4ODXA 2Y3NA 3EF7A 5FYKL 5GZOD 1FBIH 1WBZB 3CE2A 3DUUB 3VFMB 2YIBA 4UYQA 2IDCA 1BQ0A 1NKGA 4FFZL 4XXDB 4JHVA 5E03A 1K4DA 5BRZB 4LSRH 1T7XA 3BVVA 1U8OA 3FRPA 1HL9A 2BERA 4FXLA 5TE4L 2EIBA 3M45A 4QAWA 2VLKA 2AEQL 4F5CE 4JPQA 5EA0L 4HJ1A 1F45A 4QJ3B 4BK5A 4ZOLA 2CGRH 3RNKB 3BP7B 5DFVD 5A2BA 1IC5H 2P06A 5K1XA 3A6BL 5HHXH 1PX3A 2IADB 3IB4A 4GAGL 4ZNEE 3VFNA 1BVNP 4MXWL 1PGRB 3CQFA 2EUXA 3H9YA 3TLRA 1PQZA 4HGWA 4O4YL 4Z7QF 3F85A 1HHIA 3NMEA 4FYQA 5HHQA 5GIRB 4YPGA 4YWGH 3RTQA 1A3QA 2D7OA 5BCAA 2HYMA 3WUWG 5M95B 1Q6UA 1DL7H 3G5VB 4KDWA 3I2CL 1MVUB 1U92A 3QXVA 4Z7WE 1FN4B 4DZ8A 4CH6A 3T8XA 2OI9B 1LR1A 3H4HA 3IF1A 4R26L 2B08A 3ET9F 4GRLB 4F33A 2AHZA 3GHPA 1R9FA 3I75B 3BA8A 5HJ3A 4A2HA 4GUPB 3U1QA 3EXLA 3U30B 1BWMA 3EHBB 3L3OC 3MLSL 1T0OA 4IBTA 4J28A 4K9EH 4AGMA 5CEXB 3N0AA 2WXFA 2BSED 1IBFA 1SEBA 5G4NA 2DL9A 2WLIA 2NYYD 1WZAA 4KTDH 1HH6B 2ATPB 4P5TB 2IQAB 4CU8A 4BFGA 3L3GB 1DJHA 4IRSB 5BOZG 3X14B 2TAAA 1MWAH 5IWAB 1DHKA 1KPRA 4U49A 1F1DA 5LAPA 1CIDA 4HFWA 3U9PL 1A22B 4BW9A 3DV4A 5KSUA 1SNRA 1DSWA 4KHXL 1OCZB 3HNSL 2ZP9A 3LZPA 5KSBF 1HC1A 2P5WA 4LCYA 3NFPB 4UAOC 4QOKD 2I07A 4LSSL 2P52A 3HMXL 1KJVB 3CN3A 1HCFX 2JCCF 1OHQA 2QFRA 2J1ZA 2MMXA 4GI8A 4ACPA 4Y5YA 2VDOL 3THMH 4FMFA 1TZHB 1GGTA 2AJSH 4X80H 4CMMB 1Y0LB 3AU0A 5FIEA 4F20A 4N0YL 1QSED 1MAKA 4I3SL 5FDWB 4MJ6B 2P22C 3C5XA 2PR4H 5A2KH 2AAVA 1VACB 2EICA 1VQNV 4XNZC 1SDDB 2QVIA 1CYWA 2DQDH 4MAYB 3KYAA 1KB5H 4H1LH 1VFAA 4TN9A 1R17A 5GS2D 3ALXA 4FHKA 3L45A 4N8VB 4X65O 5EC1C 1TEGA 3NCXA 3V7AE 1EZVH 2DAVA 5LXGH 4FD0A 3NFNA 1N5YH 1G6UA 2X9WA 2V4DA 2CUAA 2FATL 4WFBV 2X4QB 1ILSA 2MNWA 4GXFA 1ZTXH 1Z9PA 3F8UB 3IDMB 4CMHB 1UWGH 1CS6A 1JPSH 4TUYA 1NCAH 4XVJL 4JRXD 2BP8A 1OZ0A 2DL2A 5FHBH 3AB0C 3NH7L 1ZLSH 4MTOA 1B88A 3LNHA 1F1AA 1L5GB 3TBYA 3Q4HB 3OAUH 4ZDHB 4NQXB 4UQ2B 1P84K 4JKLA 3DHMA 1VQ9V 4CL7A 2CRMA 2CHNA 3TNMB 2QJDA 4DR1O 4JO3L 3SE6A 4XPGH 1QUNA 1Q82W 3KWUA 3WAJA 4NM8H 2AVFA 5L2KB 1WZ1L 5HGAA 4KKAC 4ODHH 4PGEA 4XHJC 5DMIL 1NC2D 2J72A 2J6EH 1UG9A 4O4IA 2VC2L 1L9NA 2V33A 2HG5B 2ZUQB 1NGPL 4KMTL 4A2GA 4PJ9A 1CBVH 3PP4H 2F18A 3GMRB 2HTKC 1DQVA 4NDMA 4BKLA 2F4VB 4GJTB 5BRZE 1EEYA 1SXNA 3SDYH 1FKAO 1SHSA 3RWDB 2DQHL 5EOCH 2H4EA 3DXRA 4Z78A 1GKOA 4OX9B 1S8DA 2QELA 4MA8H 2EDDA 1TF4A 2PNDA 1XMEB 4AHCA 4V2BA 1NUDA 3RHWK 1AGCA 2C9UA 3ZRWA 4UM8B 1ASPA 3LQZA 3ARBA 5TTRA 1CPYA 1Q8MA 1DE4A 5HP5A 4K94C 1EJ6A 3STLB 4ZHQA 1PAMA 3E9TA 4JG5A 5HDQL 2B2XL 4RA0C 5DHVH 5L2JA 4X64O 4EVNB 1BLNB 3VW3H 4X7CC 3T9WA 1N8RW 3NRQA 5HDBB 4YDVA 1TSHA 3SY6A 4UVAA 4QTHA 1U3HC 3SPHA 1SQMA 4JFEA 2XPGA 3EBHA 2CRIA 3WFCL 2BOLA 1RJCA 2FUTA 3CDGA 5LCVH 5J6GA 2ZJSL 2K9UA 1R3LC 4B7IA 1MLCB 4Q58C 4XNMA 2CA4A 4BE6A 5CGMA 1BAFL 1T1ZA 1YVWA 1OHZA 2RFXB 4GW5B 2IV8A 4OCMC 5C3TA 3TFBA 3QXUA 3UGUA 3OZ9L 4PRIB 4TVPD 5DR5L 5B38A 1A2YB 3ZHNA 1XEUA 1AI7A 2OMVB 3DDGA 3EGDA 4M6OH 3LS5L 3OTFA 2V1DA 1VFUA 4ES9A 4GY4A 5EOQL 2ADGA 2A06H 3SJAC 3RVWC 4XC1H 2EH8L 1K97A 2YC0A 3K4AA 4OZIB 5EUKA 3ZX1A 4K0KO 4KTYA 1FZJB 4Q6YA 4X8GA 3SOTA 2JTDA 2OCCB 4DPCX 5I16B 1P5UC 4F7EA 5KYYB 4O02H 4MVBC 5DFWH 1YPZB 3WJJC 4KZEL 1A7QH 1X4YA 4S0SD 4HQQH 6CGTA 1KBKA 2NY4B 1J0YA 4HW6A 5ERWA 2BSTB 2JJ1G 4FNRA 2VCOA 3BPOB 3CBKB 4K23H 4MJ5B 5T5FH 3SPJA 4Z3IA 4K2UL 4RGOH 1RPRA 2AV1A 1U8QB 3NPZB 1TJGH 3UPCA 3ULVC 3ZDZF 1A4BA 4LNVA 3WL9A 2JFCA 3QPKA 3AY4C 2ZE8A 4P23D 3IE9A 1IILE 3GI9H 2AQQA 1JA8A 3W9EB 4MJHA 1RJZA 1KENL 3D0VB 3K2UL 3MGTA 5ESVA 1OCOC 3H01A 5E6UB 2QVMA 2G5BB 5HVHC 2DDQL 1T5XB 3L3OA 4AGOA 3IWUA 4MCYA 4F8TA 2YEZA 4NHCH 5CCKH 1AR1C 5JNYA 3QQ4B 5DMKA 1S9VA 4I3GA 3RL2B 1A6AB 2J43A 3VXQB 4OV5A 1OB1B 4L1BA 1E2WA 3N55A 2YUAA 4I87A 5JHDB 1E6OH 4X6BA 4ABQA 1P0SE 1NCBL 5DZ9A 5ESQB 1J5OL 2K4WA 1FFQA 2AMGA 2JI1A 5CSZA 2CJSA 3SQRA 1MMMA 5A6LA 1OAYL 3DVNA 3L3IB 4P06A 3IYLW 4Z7VB 2WXOA 1J5HA 1ORQB 3CDZB 3ML8A 4LCWD 3C5SA 4L8SA 2HVBA 4M8RA 1NQTA 5BR8B 4MJID 2OYPA 3HC2A 4JBSA 1XNQB 2YXYA 3PV6A 3L3HB 4E41D 1KEML 5FHAH 5KS9F 4ZS6C 2Q0ZX 3FT3A 3UTQB 5HYSB 5CN1A 3RG1C 3SKNA 1W59A 1HFUA 3FUIA 1T5KA 1X44A 1SRDA 2GJJA 3LOWA 2QPFA 2X7LA 4P07A 3HZVB 1SEQH 3K3QA 1S76D 1SC5B 4XI5D 1AR4A 3ULUF 4AEFA 5EZLB 1ZPLA 3FQXB 3QIWA 5DD5H 1JGEA 1S7RB 2VDNH 1WAAA 2QGEA 4GRWF 4NZFA 2EQDA 4MJJA 2AQSA 4GH7B 1GH7A 3HC4H 2OTUB 4RWHA 1FYTA 2WBJB 5L0QC 3K4DA 4H1LG 3IDNA 2X41A 1QR1A 2JLPA 5F7MC 3OQRA 2AHYA 3UBXA 4BCZA 5I0WA 3V6OA 3VXOB 4RBPK 4PBXA 4YK4B 1ECZA 2P43B 1VP7A 1O5DT 1RZKC 2HCZX 3FO0L 4OY9A 2VH5H 2XY1A 5K1NA 5HDBE 4PJFB 3PWVB 5F89A 2CLZB 2Z7UA 4NQCA 2DQEH 1A5FH 4FQLL 3RYIB 5KHKA 3WMSA 5KA6A 4OXSA 1NANI 5AVQB 2VDMB 2XV2A 4ZFZB 4ZUSA 3T2MA 5EF0A 1F51A 3PS6A 1RAMA 1N59B 2OL3B 5DEGB 3X1GA 2P5EE 4ZUUB 5ADOH 3US9A 2XWBA 4GT0A 3U0PB 2ZWLT 3WY4A 2WQVA 4PJ5D 4X7SL 5L8LB 5C3IA 4GG8A 1GMGA 2XQBH 3OWEA 1CVSC 1QU7A 4N0FB 4NO5A 5E8PA 2AQTA 5IW1B 1AC0A 5BVJB 4YJZL 3UL4A 4JX0A 3HCVA 1Q1JH 4DXWA 2PMZA 4OZIE 1DJWA 1EIBA 4ZMNA 1RPOA 3SODB 3UAEA 3B09A 3IDXL 4GW4A 1L9PA 3OHXC 1CQYA 1D6VH 1YEHH 4KH9A 3QEUA 2VMEA 4MNQA 4LVNB 5DJ8B 5J8OA 3FQUB 1TNMA 1BF2A 2Z7WA 4P59H 1RUQH 1UQSA 1HHGB 1Q5OA 1CI3M 3GRWL 3MA9H 1YPZE 3EOBA 4WF9V 3BEWB 4L8CB 5KLVH 2WV3A 2BC4A 2W60A 4MWFA 1RV6X 2AKRB 1JWMB 3HUJF 3VFUA 1G7LA 3QQDB 4PS4H 4PDRA 1BZ8A 1Y7VA 3GNMH 2NUPA 4HSAC 3CK0L 3L5WA 2XA8L 4WO4D 1X9UA 4H88L 4ORZC 5T5NG 5KEZA 1D5ZA 3F6JA 3RGHA 3CCVV 2W88A 5E6IC 3I9GL 5JQHC 4NKMA 4RNRA 3AITA 4NZRH 3QNXA 2YLHA 3D3QA 3JTSA 3L1OH 1OP4A 2YD3A 4CVUA 2GTSA 43C9A 4FP8H 4Z7QB 4BH8A 1SXCA 3O3DA 4JAAA 2E3CA 3C6SB 1U3HA 1WHPA 3CMOH 5D6DA 2X88A 5IV2A 4QYOB 1TZ8A 1T3FA 4Z1VA 2XT1B 4WFEE 3ARVA 3ESPA 2ZCZA 5C6WH 4A38A 5IQLA 3NPSC 3V8CA 4NZTH 2QWRB 1FLRH 3T0EB 3T1YB 3K9AA 3RZCC 2JEXA 2NSQA 4GAYA 2MCPH 1OB0A 4L3EB 4LEEA 3LNFA 1QTYT 2EKSA 5BMFH 4WEBL 4PCKA 1A4JB 1PNLA 2IANA 4D8OA 4EO5A 1KB9K 1B06A 1YTFD 1YUKB 1M7IB 3K8LA 3BSZH 4K71C 4LASL 5C0JB 2B5UA 4N9GB 3IJSA 3H6AA 3NFSH 4QY8A 5B4MC 3PHQA 4LSTH 1XILA 1E28A 4X1IB 1JZEA 1JWUB 4QTFA 4C56B 4TV3A 3Q5OA 3FF7A 1UOKA 4G8EB 3EFOB 3RBZA 2H6PA 1N4XH 5BZWB 4Z7VE 3WJJA 1ET8A 1T0MB 5H35B 3GSQA 3SDXF 1IKNC 4A6YL 4EXPX 5ISZE 4WWKD 4Y4FD 3KVDD 1Q9KB 3K5MA 3ABMC 2A4EA 2XVGA 3MV9B 4Q2ZA 1NOLA 3V0VA 1A4KB 2JCCB 3QI9D 5KVEE 2ADQB 5C07B 3LZQA 4HG4K 2DWTA 1NBZA 5GGQL 5GS0C 3FQWB 2H6OA 1DSFL 2OTPA 1BT8A 3HKCB 3F5WB 3FSOA 4M56A 4F1ZA 1V7MH 5ABAA 4LIQH 4HWBH 4BRVA 1HSAA 3TC9A 2P4VA 2CIKB 5KG9B 2BSSA 3RYCA 3TJTA 4R4FH 4J3OF 2D73A 4I0PB 5CWSB 5DGQA 1ANUA 4EIGB 3ZTNL 4BZ2A 3AG2B 1WTGT 3N1FC 4GIOA 1MIEL 2GJZA 1DQTA 1UCTA 1KBHA 3FU7B 1A6PA 4LSQH 3ZQWA 4PDMA 4QJFB 2GW5A 1Z5WA 2YD6A 3T6VA 4W4LA 4W68A 3BUTA 5AOLA 3F01A 3K6DA 2G60L 4BUQA 4PA3A 4F8PA 5J13B 3CVHA 4PJFE 3LDBB 4IIQB 5D1XB 2CU9A 4OLWL 4AG4H 4DGYH 3PWPD 1M56B 4G8GA 4YE4L 5HHMB 3P1VA 4Z95H 4XNQA 3TCXA 5GGUA 1EJ8A 3LH9A 2P67A 3TEXA 3HKDA 2X4OB 4Z3HA 1VPOL 2EJ1A 2EE2A 1W2KT 2XIDA 4N86A 3O4LB 4PY8J 3SDCC 2JGUA 3IKKA 2AJVH 3KWXA 1QO3B 4JCWA 5SX5K 3REVB 1EO5A 1MKFA 2G9HB 2WGXA 5GGTL 3RWIA 2LR4A 4C4KO 4ELMA 4XMKL 4MD5B 1MY5A 1KC5L 2LO1A 2YAQA 1KYOJ 2H0JA 3MV8B 3WFDH 2OA9A 3SKOB 1ML0A 1UWXK 4YDIL 1W15A 4MA1C 1QPPA 4RO2A 2OZ4L 4FNTA 4YDMA 3T09A 3VI4A 3VNZA 4G5AA 4UB0H 3HG5A 4KQ3H 1HL5A 1VJSA 3SB3A 5HYJE 1WB7A 3IJHB 4K8RC 4A39A 3G6EV 3C87A 5DURD 3AK2A 1JPTH 3POCA 3GEWB 25C8H 2CMRL 3Q3GB 4YFLI 3SKUD 2UWEF 4FQ1H 4YSCA 2NNFA 4XZUA 3L3JA 4EI6B 1FIGL 1Y1UA 4F8OA 2ZOOA 2UUAB 1M9WA 2Q76B 4OI7A 4JPRA 3LEVL 4NPKA 3ROOB 4XC3L 1KCVL 3PHSA 4ZXBD 3BEHA 2YICA 3IU4L 4N5UA 1WG3A 1Q9LA 2WNXA 4PP1D 3KPRD 1BBJA 1R33A 4DW0A 2BVPB 2XPYA 5AKSA 5KOMC 1OQOA 3B43A 3LKSB 4UUJB 4KQ4L 3KPOA 3SCMA 5F72S 4HUUA 2JI3A 2HZHA 3E3QE 4WFGE 1KIUA 4KHPO 3LRSA 4Z7QE 4TTGA 1J5EO 3GSNH 3STZB 1AHWC 2O6PA 3ZE0F 4PGJA 2R83A 1LWJA 1KN4H 3TWCH 2C1OB 4G6KH 4DN4H 3C3TA 1O6SA 3OZLA 1FF5A 2AI0H 1N32O 1CU4L 2K3HA 2Z8RA 2RJZA 4Y7OC 3T0EE 2YUXA 4JFQA 3B5TA 3LS4L 3KCWA 3LCYA 1FGNL 3KDPB 4IOFD 3O0LA 4W9JC 4YHZH 3U4EA 5I19L 4FQXD 3IU3A 1E4XH 4YAQB 2VDPH 3S3JA 5GZND 4QT5B 1LO4L 4FI6A 4NNXA 4HAMA 3MV11 3QUZD 1FLTX 4GQ9H 4ZW7A 4Z0XB 3N41F 4QEGA 2FSDA 1QYGH 5TQ2H 4I9WA 1BFVH 3OHXA 5IF0A 4H26A 2IALA 1WIOA 3SJVA 5MHSE 1A25A 2ZYHA 3V79C 4DRXB 3TF7C 5DQJA 3PJSB 1M05B 5KSBE 3I6KB 5DD3L 3BKMH 2NYZA 1OCRB 2ITDC 4U1MB 4TQHA 2WCSA 5JPNC 2YBGA 3MV9E 2YIBD 1FHNA 2VXTL 3IETA 1FNSL 2JCCE 3ZMRA 5C07E 1Z1WA 5K9KA 4MAUH 3S36H 5E6IA 2CKBH 1VGKA 4X4ZA 5E6YA 1ZIAA 2NT1A 4N5ED 2C3XA 3WEXB 2XRAL 1QSFA 3KVPA 4HWNA 3MV7D 3WHXB 1FJGB 4DO6A 5DUML 4FLXA 2X44D 3ICXA 2XWJA 2NZ1A 5H8DA 4ANXA 3ZDZB 3TIDB 2WZ0A 1VADA 1F4XL 2QKSA 2Y6TE 3HIZA 3L7EA 1AGBA 5AAMC 5C0DB 1BD2D 3ZTCC 5IJ0B 1YRKA 3BEVB 2DD8H 2ZCHH 2XN1A 4YL4A 1IAMA 5I6XB 3VGEA 1E90A 3OT7A 4X65B 1XH2A 1JVOA 4OZ4A 3HG0A 1VESA 5AW9B 4JB9L 3RZCA 3MRFA 1ZA3A 2YGPA 1U96A 3WCYA 4IRJB 4P4KD 5T1JA 3LH8A 5AEAA 4JFVA 2BNQD 1VEOA 2MNJB 5AUMB 5AQ0A 3F2LA 2GPZA 1X5MA 4XNXH 3L08A 4FTVA 1H3UA 2C5DC 3WKNA 4ZW3A 4BQCA 4KY1L 1T04A 3AREC 4E9YA 3ZY7A 5C0CD 5HHME 4B96A 5TQ0L 4QWWC 2OM5A 3H55A 5BW7C 2NX5D 2UZPA 5CF3A 3HN5A 3KL3A 3KG5A 4RDQF 3H1KH 5I0YA 2K7PA 1NDGA 2JS3A 1CEZA 2B4CH 2CG9X 3RWGA 3D7PA 4DYLA 3MUGA 4U1LB 2YARA 2R1XA 4H33A 1FYJA 4FK5C 5F6IB 1JYNA 1VZHA 4JHWL 4BIKA 4DR1B 2GHZA 2WN2A 4P4RA 3NCJL 2ERJC 3WTWA 3HI6L 4L4JA 2IG2H 2PYEE 3ZSTA 4XO9A 4WJKB 2CHWA 5I71B 4FZ8H 4UQAA 1VFBB 2A73A 1KN2L 2DF3A 5KSAC 2VXVL 5ALCH 1IGJB 4EUPA 4RGMB 1A1NB 5F9JB 2WKOF 2QSCL 5KS9B 5TD4A 2IH1B 5DJ6A 3E8HA 1S7UA 4HBNA 2OIEA 3FUKA 3AEIA 4S2SB 5I0XA 1B2YA 4IHJA 5B7MA 1VIBA 2VNCA 2WVTA 5DRWB 4L0YA 1BXVA 2LAAA 5I1DA 4G9FA 1US6A 4JZJA 1YUHA 4QHKI 3EFFA 2LGNA 2OX5A 2YA0A 4IU2B 5B1BB 5FB8B 1KWGA 5K1JA 4DUWA 1DBMH 1W72B 2NCEA 3TBVA 2YS4A 3PGFH 1IC0A 3Q1SL 2LP7A 1M6OA 2P1YA 4BZ1L 5EU6A 3KE0A 1ZV9A 1FSKB 3CHPA 4XP9H 1MVFA 5E1GA 1JS4A 2R2CA 5I28A 3R65A 1XNRB 1VDGA 4OT1H 4X64B 1NC4B 3WOVA 4E9WA 4GXVH 1AE6L 3HZKB 1T66D 5BOJA 5LNDA 1I7TB 4GX0A 3LY6A 4WNQA 1KTDB 1FPOA 2FTKA 1GAFH 1L4IA 1LL1A 3BGAA 3P02A 3S34L 2QM4A 5EYPA 1ETB1 1TA8A 1Q94B 1U8IB 2CGZA 5AYUL 3SDCA 5ECJE 4UM9B 3P9WB 3UCSC 5LYJA 3VOUA 1ROWA 4YBLB 2WD0A 4MXVF 4ANWA 1LK2A 4N9OB 5A2AA 4F7TB 1U8PB 4M5YH 2Q8BL 2C9PA 2GTZA 4I3RH 2BS71 2NN4A 2OI9C 3BH8A 3LIZA 5IJVA 5KJRH 1L7TH 1THAA 1NZ6A 2KDGA 4GRLC 1BQLL 4MD4A 5AVZB 2BHFA 4JFXA 3HMWL 4MDRA 4N2KA 5C09D 5DMYA 1A21A 3V5DB 3WKML 1TO4A 1MPAL 4LARL 1JRHL 3WIHA 3U30C 2H7WA 3EHBC 3HRPA 1JCKA 4G43B 2G75A 4JLRB 2VLJD 4ORGB 1SJEA 4W9IC 5E4AA 4K0KB 2Y7NA 3G6JA 1T1YA 1YMMB 3OKNB 4G8IB 4HUXA 2FO8A 4JEGB 2OXGB 3BVNA 2CJUL 1C16A 2F8OA 4PJ8D 4ILDA 1G9MH 3BFOA 4IRSC 4TNGA 1KYDA 3EJPA 4ODWA 4E2LA 1A8ZA 5T1DH 4JO2H 1ZRUA 3W7XA 1NGZA 2X0VA 1LO5A 1A3LH 2C4FT 3D4GA 3HRZB 3TFKC 5IB2B 4YOKA 1H0DB 1OCZC 5ITZA 5CD5D 3V0IA 2ID5A 3HUJB 4PW9A 4FG0A 2WB7A 2RB8A 5FGSA 3S3CB 4F5CA 2V17H 3QDGA 2JK5B 1XF5B 3FUHA 4Q52A 4X6CB 1MQKH 5DJCB 1ORSB 3X3GH 3QDMD 2Z6FA 3QZWG 4FRWA 5KW9L 1GHFH 1M9NA 1CP9A 1N19A 3VX0A 2X2IA 3ZDZE 2FNWA 1VZGA 4ZNEA 4M7LT 4DUZB 4I2XE 1KXQE 1SLVA 1NGXB 1T6VN 4OTXL 3FKSG 5FF6A 5E9DB 2Z65C 1CFVL 1RJYA 4LLWB 4ZODA 4XODA 4BDVB 1G9HA 1K6QH 2HKFL 3MRPA 4GPVA 2H9GB 1FH5L 4MAYC 3FBQA 1QBAA 2APVA 2KERA 1MHPH 2FIKB 6TAAA 1AHKA 2H1PL 4UV9A 3P3PA 2PTTB 2ZTBA 4JFFB 5AVTB 1KEGH 2YR3A 5C0AB 4XXWC 1KFGA 3ZL4L 4ZMTA 3QXAB 2FJFA 5FLUA 2VRQA 1B0RB 2XVLA 4OZHA 5IT2H 1HXMB 5KAIZ 4JFED 4X4MA 3KCXA 5KVFH 3UMNA 1CK0H 3Q05A 3P0YH 2NY5L 4BH7B 4FAAB 3W0WA 3LZLA 5C0FB 3LKRA 3S97C 6FABL 1ZV2A 4TLKA 1E6JL 1V5JA 4LNRB 2FR4A 3CP1A 1WBXB 5I66A 1JL8A 2XX1A 2AQPA 4OQTL 3K79A 2VXSL 1CXLA 3TV3H 3SDXB 5LJYH 3W37A 5JQGB 5BV7H 3GLEA 2BCKB 1P7QD 5EORL 4ZAKA 1BM3L 1FNEA 3G4SV 3IC7A 5KS9E 2OFQA 2CCVA 2KQNA 4JV5O 3AQXA 4E5XA 2PYFB 2DMHA 2LW7A 1P5VA 4U6VL 3VXUB 5JA9A 4RX4A 5L7XH 3KL5A 1NGYA 3ES6A 5INDA 1ZVSA 2ZUQC 4NTYA 2HG5C 1JGVL 2JGDA 1F90H 5HJGA 2UXXA 2ZKWA 1BMWA 3TO4B 3X13A 5F7BA 1JZGA 4PTTB 1W8NA 1G7HB 4IOSD 3D2TA 4UT6L 3UTTA 4WSJA 4XMPL 3VD2A 4DR2B 4GRWE 4N2OA 1OV9A 2VLRE 5B8CB 1T20A 2IPTL 3IJ8A 3P73A 4OBSA 4KKNA 4X5QA 1OQXA 1GMIA 4YJ3B 3VA2C 3H42H 2RJMA 4DV3B 1PEZA 4U6XA 2RDCA 3UQ8A 1M2VB 5LWYL 2P4AB 4E0RA 2BVEA 4LEOA 1V10A 2Y24A 1YNTB 1JNLL 1ZGLM 1IFHH 2GY5A 3IC9A 3STLC 4P9HC 1UD5A 1IU1A 1F41A 3HZMA 5IQOA 3UCRA 1T83C 2F7IA 3F7KA 4LB8A 2VR8A 5GRXG 5DJ2A 3KKYA 4UQCA 5ETUB 4JI7B 4RSYA 5KX5A 4OF3A 2ZE7A 4JRYE 1YNLL 1I9JL 1XMOO 5D5MF 2WUBH 1YCIA 4GIPD 3BWAB 1DCEA 3G5XA 3ZMNA 5D1ZA 2Y25A 2XQYG 3MNVA 3QZBA 3RI5F 2V37A 4MNHB 3TGXA 3NSFA 2ZIMA 5FGCB 3ETGA 3D36C 1MI5A 1FV1A 2F74A 4KHTH 5ITFA 3ZQ9A 3OKEA 3RE0A 1YMME 3HG1D 3NJNA 3RDTB 4PJBA 4F91B 3K04A 4LSUL 2CIIB 4MLSA 1LDPL 1GOFA 4N2CA 3CX5F 4XXDA 3NVQA 5JW3H 3BUIA 3GSOA 5DJ0B 2MQGA 3L1EA 4DFIA 4TM9A 2EVFA 4HIJB 2OCCC 4M3JA 2BTOA 3MUHL 4ZRGA 3B2VH 4WHCA 2BXZA 1GTFA 3HUJE 3HOGA 2FJHA 2XNAA 1T2QL 1TENA 3UO1H 2FNBA 1S7TB 1K2DA 2HJLB 4Y7MA 3CD6V 1ZT7A 3RNKA 2NY4C 4MMYB 4JQIA 1Q9OB 3QEQB 3GWKC 3BPOC 2HN7B 2IADA 2BSRB 1XL6A 2BINA 1FS0G 5AZEL 3D2UD 3ZE0B 3WSQH 2AQ3A 1TCMA 2DLFL 1BMZA 5AFAA 4P2QD 5GIRA 1IRAY 3WDIA 5KA5A 4TOIA 2FZ3B 4AL8L 4A7GA 4MXQD 1MVUA 4BFIB 5C7XH 3P4LA 3N2KB 1FN4A 3FJTA 4JFFE 3ARDB 3L3DB 1F18A 1XF2B 4KX7A 4APQB 2IAAC 3GJFB 1HNZB 4GUPA 4Q6IC 1BJ1H 4HD5A 4QRBA 3THOA 1WPCA 3MYJB 5BQ7A 3AXIA 4OGYH 4P2RD 5F7DB 2E76B 3TYGH 1MCRA 4EIZC 5DHYB 5FM4A 4G1EB 1IKFL 3QRFM 2WJ7A 1HH6A 2ATPA 4P5TA 3C3SA 2WJ5A 1KMGA 2FL5B 4IHBA 3MAQA 5JUEH 4IRSA 3X14A 5L8JB 3OKKB 3JD2A 4KKAD 4DK3A 4XHJD 3VM5A 3WTUA 2A3QA 2AW2A 5LXVA 2LT9A 4HA1A 5LB1A 2F95B 1XGPB 2EYTB 3SDXE 5IHHA 5T33L 1MFAL 4YFLF 2HTKD 1RK1B 1X5ZA 3TEUA 1HVXA 4PA4A 4KZDL 1UH4A 2RBLA 3MRJB 3NFPA 2VDQH 1QVGU 2QGCA 1KJVA 4FI7A 2QADB 4IBVA 4MNQD 3D69A 2B14A 3KXFE 4J4PA 3EH2A 2ZAHA 3VXUE 1HKLL 1YDPB 1AJ7H 4Y9FA 1P7KA 2V2XB 1A3RL 4E68A 3JALA 1JK8B 1YNKL 2YXWA 5B21A 1QFUH 1Y0LA 1WA0X 1OTUD 3QHFH 4ODSH 5D4QA 5D8JH 4TUJB 2AJUH 1JGLL 1UB5A 5D7LB 1N64H 5B39G 1G9NH 4FS0A 4BWUA 1VACA 5CMAB 3NA9L 3V52H 1A1OB 2H32H 2VDLH 1B4JH 3ZDXF 4PD4J 2XUMA 4L8BB 3TL5A 4JANB 1SZTA 2AP2A 3MXWH 4XXWA 3MJ9L 1KWKA 1GC1H 3I6LE 1ASQA 2WNGA 4HEPA 4YHKL 1G1KA 1QA9B 1U3HD 1YXBA 1CGVA 2VB5A 3P3RA 2AFNA 2YWYA 1A7RL 4XOBA 1IO4C 5DC9B 1NUGA 2NNUA 2WBJC 5AB9A 1K73W 1HKFA 3MDSA 3QIBB 1HYRC 5LGTA 2X4UB 4YFEA 3K5NA 3SPVB 4RSVA 1MHCA 3S35L 4Q6GA 3IDMA 4YK4C 1CFSB 5GRJH 4BQ9A 5E8EB 1XTLA 5FX3A 3HW7A 1KCSL 1VHPA 1J0KA 1PX4A 4LL1A 4QRQA 5K5YA 4M7JL 4PV1B 1PM9A 4NUMA 3BWUC 4K7PL 3SY0A 1LEKB 1L5GA 1XH3A 3TBCA 3Q4HA 1MEXH 3RVWD 1UYWH 2A74A 3R19A 1WAEA 1FDLL 3T77B 5FGCE 3U7WH 3JWNH 3TNMA 1M53A 2CGYA 1Q0XH 1KJ2B 5JZ7C 2O4EA 3MFFB 5L2KA 5D2LB 2VIRB 3E8FA 3OGCA 1I7UB 4MVBD 2WLKA 3QJVB 3D5OF 1XH1A 1XVSA 2HG5A 3IGAA 3O9WD 3ZCCA 3GMRA 2UWEE 1I53A 2Q8AH 4AYID 4LFHG 4PJAF 2W07B 1QHPA 1K5NA 1F4WH 4OJFH 4YXKL 3C9NA 4RCAA 1F8TL 3N06B 4XP6H 1ILUA 4Y19B 3OD3A 4LVNC 1Z3GL 5I1KL 1AQMA 3ULVD 1YN6B 1HWYA 3CDCA 3D3IA 1JF5A 1OP3H 1KGCD 4EE2A 5J7CC 1N6QH 3CCHB 5FW8A 5GGVH 3EZ8A 4NO0D 4UM8A 3QEQE 2MPAL 1I7ZB 1TZIB 4PJHF 1E1RG 4QRUB 1CJYA 3LZFH 3QO8A 3ZE0E 2K78A 4B3SB 2WQRA 2X87A 5FYJE 4DEWA 3T1WA 4UB6Z 1CR9L 1T83A 1BSMA 4PB0H 1NIAA 4HUKB 5HYIA 1AR1D 2M7WA 1BLNA 2ENQA 2NNCA 2YC1A 3E3QC 1KBGH 4X83A 1T5EA 5D7HA 1ZGLP 1IGML 3QRBA 2YMXH 4L3AA 1DFBL 4PEEA 5F1IB 1GZHC 5IBLC 2AZ0A 2WXKA 4O2BB 1UJ3B 2JB5H 1IM3D 2PKDA 1MLCA 5J1SC 1FFTB 3FMGH 3F62A 4AQ8C 4GW5A 2RFXA 5CA1A 1PTZA 2WWKO 2X4RB 4LL9A 1KLFB 4X8JB 3UYPA 3T0EC 3QNZB 4PRIA 3IN2A 3HB3C 3UOAB 1A2YA 1FL3B 4DQOH 2GG1A 1LQSR 3QZLA 4LSRL 3DUSB 4YSDA 5TF0A 4CU7A 4FPPA 4YIPA 4HS8H 4OZIA 3PF2A 2Q87A 1AGFA 3EJQA 4O2EB 4U1HB 4ZS6D 1FZJA 6PAZA 2YA2A 3QQ3B 3T2OA 2CGRL 3L71H 3L16A 5CNHA 2XU9A 4TUUA 1IC5L 1F3JA 4P30A 3EJZD 2ZQMA 4X9HA 1QLNA 4J7RA 1YPZA 5HHXL 4P9PA 4YLBA 2ZUYA 3ARWA 3DRQB 1F6AB 1EAJA 1NL0H 1D7FA 1VGEL 4AWJC 4MJ5A 1CFBA 2AJXH 2WNWA 3E6FB 3NCYP 3OLEA 3MOAH 2R69L 3N1MC 1HXYB 3WEAA 5CZKA 1WQVT 5AW3B 3F5WC 4OCRL 4MTXA 4OJDH 2EJ7A 4RQQA 3UT5A 3DYMA 4O00A 3Q48A 2QGDA 2YJQA 2XZQH 3W9EA 2VW4A 2J4WL 4YHYB 5E7BA 3JBG7 3OKDA 1YCSA 2YD4A 2G5BA 3WFHB 2DJUA 4GQRA 1LP9A 4EDXB 5FS5A 4AEHH 5AOIA 3OB8A 1T5XA 3AG2C 1RUAL 1L7IL 4YO0B 2ZICA 5EOCJ 2E7MA 3NA4A 2AITA 2BS9A 1MWAL 2AJYH 4HIIB 3RL2A 3IJ4A 1SMDA 1CF1A 4DSYA 2ICWB 1GOHA 3VMOA 5JHDA 5J13C 3LDBC 4IIQC 2Z8WC 1T1WB 1M56C 1PDKB 2EILB 4OAWB 5ESQA 4EOWH 4FJZA 2XBZA 5I9QC 3S37L 4P46B 2G4EA 1OK8A 3B5GA 4FA7B 3L3IA 3KLHC 1TJIH 1O9HA 3THML 1ORQA 3QHTC 3S3SA 4UTCA 2X89A 1BBDL 2AJSL 2C4XA 4NAMA 4NP9A 1JF1B 4N0UA 4O2CB 4X80L 3U4AA 5JIQA 1FXVA 4JFDD 5DHDA 3L3HA 5CCJA 1OE2A 2PR4L 12E8H 3E9UA 4Q7DA 5DWPA 3S9DB 5CEZE 2G5UA 4M29A 3UTQA 1OAUL 5HYSA 1R47A 4PJ6A 4YDKH 4ZQKB 1JX9A 1KB5L 1R46A 2F54A 1I3GL 4ALAH 5A9GA 1FXKB 1CTOA 5KVDE 5FO7B 3TF4A 4JGMA 2YUWA 2XPZA 4Y19E 3TT3L 3GMPA 3KR3H 4L4TB 5AZ2H 4ZW8A 2KDYA 1FC2D 1JFQL 5A40E 4JN1H 1QSFD 1PAZA 2ESVD 1N5YL 5EU5B 4DV0B 3FQXA 4R90H 4UU9A 3RA7H 4DCQB 2E7DA 2O6EA 1S7RA 4DR4O 1ZDQA 2K6WA 5D2NE 1XDCA 1HW7A 2R23A 4XP4H 4XXCC 3T8VA 1ZTXL 5CN3A 5B1CA 1NKDA 3ERXA 2IMMA 2OTUA 2WBJA 1CBJA 4ZI7B 3MV01 2OCJA 1SUJA 4TWKA 5FHBL 1OGAD 4UUJC 3LPOA 3ILDA 3BMVA 1NTKH 1DFXA 3SE9H 1LLAA 3OAUL 3PWVA 2CLZA 3OMAB 3STZC 4CSSA 3RYIA 2XI9A 2UXCO 1MQ8A 4XNUH 2PF6A 4QHLA 2EUZA 3DX2A 4YHOH 3BUQA 3Q6GH 4ZS7H 2GY7B 3CZFB 1YSCA 4LFBO 5B4MD 5D5MB 3U7YH 3DC6A 5KN5B 5DEGA 4ZUUA 1VQ4V 3I74A 2JJTA 1T03H 3U0PA 2NSMA 1W8EA 5D7JA 3H1JH 3PP4L 4JNXA 1OLLA 2D3VA 5JQ6L 1JP5A 2IW5A 3D8MA 2DV6A 5C71A 4N0FA 2N74A 3ILPA 1HT6A 1PW3A 5IW1A 5BVJA 3D48R 3KPSB 3JWNG 2KBGA 3KCPB 2ZE6A 1JHLH 3A6CH 1H8SA 2NSXA 2YZ1A 2V4LA 5GS0D 4TUKH 3AM8C 4KV5F 5DJ8A 5JIIA 5HD8D 3FQUA 4PLOB 3NIFF 3QZMA 1HHGA 3SIKA 4K3GA 2Z35A 2F1AA 4Q0XH 4M9OA 4BIOA 1EVTC 3BEWA 4L8CA 1ACCA 1WC7B 4DVBA 2WLMA 1UD4A 1OCRC 2AKRA 5I15H 2DH2A 1DVQA 1JWMA 1KPUA 4ZTOL 3BYYA 4FQCL 1F4YH 3QQDA 1CL7H 3GC3A 4B60A 1TPXB 2HWZH 4GUCA 2JB6B 3WNPA 4DEPB 4JJ5B 3ZE2F 2G4GA 1Y6NR 3RB5A 1HQ4B 2WO2B 2YD5A 4NXSA 1MWOA 2YN5A 5C6TH 3ILEA 2B7DT 4YHPB 2D3OW 4KWUA 2EIJB 3LPFA 1EHAA 1BZ9B 3G9VA 4L4VD 2PETA 3C6SA 1GZHA 3LXUX 4S0TD 3QEHB 2LE9A 4TNWF 4PG9B 1QW8A 1E4JA 4QYOA 3ARFA 2W38A 3UAJA 2OMWA 1BOYA 1EGJA 5I6XC 3OJDB 3OF6D 1HZKA 4LSPH 4N8CH 1AKJD 4EN2A 1K34A 4FZEH 2OYMA 4M6OL 4ZW6A 3TO2B 4D94A 4JI0O 4RGND 4IRJC 4L3EA 1F13A 1DQMH 4XC1L 2Q8VA 1LO0H 2YRLA 3EGXB 3QUYA 1RFYA 1XDTT 3WMQA 1XF1A 2R1WB 2HRLA 1PD1A 5C0JA 3BCDA 1LE9B 3QPXH 2IO5A 2BDNH 5C9KA 1IIKA 4O02L 2XA3A 1MCOH 2IAMB 1A7QL 4C56A 4KTGA 4HQQL 4POYA 4G8EA 1U4FA 1PNCA 4A6YA 3EFOA 3KD4A 4ICWA 5EOTB 3BZ4A 5BZWA 4DOHB 4K23L 5T5FL 5F6IC 1Z0MA 4W9FC 5H35A 4K8RD 3OL2A 2C3GA 4JV5B 2B1HH 4PRHB 2GEQA 1SN2A 1S4IA 4AZ8B 4B53A 1HS6A 5I71C 3B7TA 1A4KA 1N6VA 1JZ2A 5C07A 3WB1A 4DUYO 3MJ7B 3KBPA 4HIQA 4RGMC 3FQWA 5F9OL 3IPFA 3NABH 3HKCA 2R7EB 2IH1C 4GMTH 4KRNA 2VQEO 1L9RA 3FULA 1JYVA 1BQSA 4DV2O 3EO0B 4L4TE 5CMUA 3O6MH 2B3IA 1D2PA 4A67A 3ARPA 2CIKA 2F5AH 4R97B 4DFHA 3QCTH 4IQHA 4NFBA 5KG9A 1UFUA 3ZDXB 1CE1H 4NHCL 3T0VA 3UJJH 4I0PA 2VLME 5CWSA 5GRWA 3E7JA 5ICYA 3ULUC 5B1BC 8CGTA 5KSVA 1IURA 1YEDB 1OAQH 3FU7A 2F93B 1E6OL 5I1GH 5ALBH 5C0IA 4B6ZA 5LOVB 1I94B 1NVPD 2NR6D 4DV5O 2WKLA 1BWWA 1M1SA 2GJ6B 5D1XA 1NEUA 3V6FB 1BQHB 1S72V 4J3UA 3V4VB 3FC8A 1MZEA 4XBMA 4F7CB 5JHMA 4CSPA 1S5HB 1ID5I 4WV1B 4A7QA 2X4OA 1G4YB 1YC7A 1N26A 3CHXA 2HT3C 3VNYA 2DWYA 4LF4O 1KIQA 2ICCA 3CCMV 3O4LA 5D5ME 5GGTA 4FMTA 2F6AA 2Y7LA 3D39B 4BAYA 3QFGA 5FHAL 4DGVH 1QO3A 3REVA 1EO8L 2G9HA 4J3XA 5IB5B 2MOQA 2CH7B 3SDAA 4MD5A 4BGLA 2AF2A 1BZ7B 1H8NA 3BAYA 5A6IA 1GRJA 1MRFH 3MV8A 4CRPA 2ARJQ 1GGUA 1V3JA 3KPSE 3S3DB 4G83A 1Z9NA 1H3XA 3LEYL 4XO8A 2Q2LA 3O3EA 1DUYB 1SJMA 4B9ZA 5IFJB 3IJHA 4E36A 2VDNL 4EXKA 3Q3GA 3AWFA 3DX9A 1IT9H 3CVIH 3HC4L 4HOMA 1PG7H 2IWGA 1KYOF 5I0DA 2Q76A 1F2QA 3FB6B 4RX4D 1AI5A 5E2UH 5IE9A 4ZX6A 4XXCA 3QUMB 5HVGB 1XHZA 3B9KD 3SKJL 1BVNT 3HRZC 4NGHL 4NJ9H 2BVPA 4NKGB 2DYSB 4PJHB 3SYAA 3O2VH 2VO5A 3LKSA 2IFFL 4U7KA 2JK5C 1E2VA 5F9DC 3FCUB 3LQAL 4A1RA 4S1DC 1KKDA 2QR0B 3P3YA 2Z4QB 4JFZH 3WNIA 2ZX5A 3VFPB 1DTUA 4RQEA 1N34O 3ASNB 1UWYA 3ARED 3BT2H 3AS3A 4Y4KB 4ZK8A 1HL8A 1MOEA 2PW1A 2NDFA 4JE4B 3K5OA 2ZKYA 4QWWD 3MRIB 1PU0A 3VWKD 2IF7A 5K9QG 3R0MA 5SWZB 4DV1O 4LPVA 3B2UC 3MRQA 3B4SA 1BZOA 3PP3H 3P2TA 2UUCO 4OFVA 2TRHA 2PCYA 3I55V 3AAZB 3ZU8A 2Z31D 3K6IA 3VXRA 4L5FH 3K46A 4L2YA 5B38G 4YAQA 3M1BB 3DECA 2YKLH 2ZXQA 4G7SB 3EOTH 4QT5A 5FUCC 1YEHL 4MVSA 3O45B 3VFVB 4WEMB 3R8BB 2FYYB 4KK5C 1RUQL 4Z0XA 4C55A 3MA9L 5HBBA 2D7MA 4N23A 2Y1YA 5KSAD 4F2FA 5KTEH 2R4RH 1SXBA 5DWUL 4EZJA 1RL1A 4WNSA 2GDSA 4PLNC 2Q7HA 5H6QA 3CFMA 5D9SA 4DRXA 3C2AH 1K3EA 4UT7L 4PS4L 1NZRA 2VXUH 3GNML 4WW1B 3PJSA 4DOHE 5EDSA 3IS0X 3I6KA 1M4KA 1P1VA 3AW5A 2WQXA 2P7TC 4U1MA 3VFTB 3K72B 1M5IA 1KB9F 3ULVH 3ARYA 4KITB 3RY6C 2NY0B 3ZR6A 2QM7A 3E22B 4S1QH 3M8AA 5BRZD 3QEGL 2V9TA 3OE7G 1I9IH 5FGBA 1C5CH 2FEEL 3WEXA 2X9ZA 3ORJA 5A2FA 3LN5A 3QXTA 1CFMA 3WHXA 1XAUA 2VXQA 3EJYC 2YRZA 3TIDA 4ATWA 4NZTL 4BZ2H 5C0DA 1FLRL 3ZDXE 5JR1H 3PXJA 3BEVA 4LDCA 3WBDA 3K71B 2MCPL 3BP5B 3TO4C 2Y6SC 3DX8B 5BMFL 3MBEB 3QORB 1GYAA 4RMTA 4WZ9A 5IUSA 4RAHA 3PRZA 3PL6D 4J7KA 4L1TA 3MLVH 4J3OC 4XN8A 4X6DB 4IRJA 3BSZL 3CVHH 1XCQB 4OF8A 4QYAA 4HLJA 5AUMA 4CC4C 3GQFA 3LDCA 3ZR5A 2Y1AA 3FU9A 4LSTL 2HMIC 1S7SB 4WUUE 2GJ6E 2QTVA 4C4BA 1RHHB 3GBEA 5DJXB 3EBIA 4N2IA 4GG6B 2J56A 1X7QB 2IGLA 1INQB 3QHZL 4GRLD 4MJ4A 2B1OA 3AMLA 3ZDYB 4UZSA 3B5HA 2ZUUA 2VL5B 2HFEA 2VWEC 1I9EA 3EHBD 1A6ZB 5IBUG 1O5PA 2B1AH 2VOTA 3RB7A 1K92A 2ZF9A 1IUZA 4BJLA 1RIUL 3BIKB 2XTLA 4A2FA 2L7EA 2UVFA 3CSPA 1JOIA 1CQKA 1VFBA 1OD9A 3FTSA 2VS0A 1V7ML 4PA9A 3H0TB 1IGJA 3DETC 3F7YA 1A1NA 1ROCA 5F9JA 5DHXB 5KS9A 1R0AH 4NI3A 5IK3A 1YJDC 2Y9RT 1EAPA 4S2SA 3HNVL 5LVEA 1TTGA 4PJAE 4K73A 3S3PA 3JTBA 4YBHA 1ZVNA 2W65B 5DRWA 1HCVA 1S7QA 4JY6A 2HJDA 3CRAA 2ZOLB 5FFGA 1G94A 5TISZ 4R7DA 1IX2A 1CGXA 5D70L 3AC0A 5FB8A 5LQBH 4NT6B 5FOBA 1W72A 2OXHA 5DRNB 2F7OA 1J0IA 4KMLB 3RWJB 2X4PB 2V9QA 4PJHE 4AG4L 4DGYL 2EABA 1D5BA 4IEFB 4KO7A 3BPNB 4Y4HB 4MAYD 4ZUWB 1V3LA 2J7LA 2WQWA 5I75B 3ARUA 3W38A 1IZJA 4TNFA 1G7MA 2NY2B 3UBXG 4HXAL 3TK1A 2QSTA 3D9AL 1SQBH 1IGYB 1KTDA 2X0UA 3GMOB 1U8IA 1YEGL 1CXIA 4NVPA 2Q7AA 1DEEB 3L3KB 4UM9A 5T1MB 1HXKA 3T65B 5JW4N 1LGVA 4YHLH 4D9LH 2AK1H 5ABZA 4F7TA 1U8PA 1IM9B 3T2NL 5CFHA 1JG9A 3U0ZA 1NAMB 3ARDC 4QXTB 1PZ2A 2BVUA 4QIRA 3QGVA 4UB0L 4AI8A 1NKRA 3JAKB 2DJVA 2B16A 4APQC 2GTWA 3V5DA 4U3FH 5F7UA 3UP1A 3L5IA 3EO1A 4DK5A 1WFUA 5FL7G 2KPNA 4G43A 3R06A 4JLRA 1PNDA 4ORGA 5J6SA 2E76C 1J8KA 4UQEA 1FNHA 1KJ3L 1H3PH