2EINB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2einB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2einB02
2BHFA 1XB8A 2AANA 2IDQA 2H47C 1NWPA 4KNTA 1BXUA 4N8UA 3OMIB 3TU6A 1BAWA 4BWUA 2VM3A 2GB2A 2GC7C 2IDTA 4CSZA 1SHXA 5B7EA 1E67A 1L9TA 4M4RB 1PF3A 1WS8A 1MG2C 1RZQA 3X1EA 3S3CB 4DP0X 1OCOB 2BWDA 2NRDA 1MZZA 2P80D 5B1BB 1IBZA 4W9ZA 3IEAA 2PCFA 2XVBA 2YAOA 2FNWA 2IAAC 2WSDA 3FSWA 4E9YA 3NJGA 2CAKA 4PAZA 5B1JC 1OCRB 2IDFA 1A4AA 2UXTA 3ERXA 2IWEA 2PPAA 2ZXWB 2VW6A 1QHQA 3QJVB 5FC9A 4HALA 1CUOA 4AKPA 1AR1B 1SFDA 5D4JA 1AS7A 1SF5A 2PLTA 1GY1A 2BZCA 1NINA 5I6NA 2VSKB 3AW5A 1WA2X 1SNRA 1FWXA 3SBQA 4KOCA 4GYBA 2DYSB 3NJFA 3UABA 3UADA 2XV0A 1JZGA 4HCFA 1AZBA 1RZPA 4FA7B 4EF3A 1JZEA 1RKRA 1OE2A 3PLYA 4E9WA 1IBYA 1X9RA 3GXUB 1NICA 3QJRB 2Y1AA 3AG3B 2GBAA 1HAUA 4Q8BA 3SQRA 2IDSA 5I5IA 5PAZA 1OE1A 3UAAA 4DPAX 1W6LA 2I7SA 1J9SA 3AZUA 1N70A 1NIEA 2W88A 2HLEB 1PZAA 2MRYA 2OV0A 2PPDA 2W8CA 3CZUB 1JZIA 2J55A 5AKRA 1AZCA 5B3SB 4DP7X 1NZRA 1L9OA 2UXFA 1OCZB 1NDTA 2TSBA 2VW4A 1KGYE 1J9RA 2ZOOA 2HX9A 3EF4A 2BW5A 2P80A 4GP5B 4N4YB 3EHBB 2RACA 3IE9A 4KNUA 2FQEA 3WI9A 3FQ1A 5I26A 2VW7A 2FT6A 1ZDSA 4YSOA 1GR7A 2XV3A 1MDAA 3NJIA 1AG6A 1L9SA 2FJSA 3FYIB 2IWKA 1JXGA 1PZCA 4BXSV 1ZPUA 4K9JA 2UX6A 1E30A 3QJTB 1T5KA 2IWFA 4JHUA 2UXVA 2YAFA 4G7QB 1JOIA 3KW7A 1DZ0A 1RCYA 2I85A 4DP1X 1M56B 2FWLB 1QLEB 2YAPA 1XB6A 1OF0A 2H5UA 2FQGA 3EH3B 4GY4A 1KCWA 4A68A 3C75A 2FQDA 2QDWA 3PAVA 1BQRA 3NYKA 3KW8A 5AFAA 3EH5B 4YL4A 1PNDA 1BEXA 3D12B 2CCWA 1MZYA 4YSTA 4YSRA 3CVBA 3JT2A 5B7MA 4BDVA 5PCYA 4YSSA 2ZONA 1AIZA 4YSEA 1ILSA 3ABMB 2BZ7A 1XMEB 3IN0A 4WTQA 3FSZA 3NJNA 1JXFA 2PPCA 1ET8A 2B3IA 3V9EA 3PPSA 2Q9OA 1VLXA 2DWTA 5ANHA 4NERA 1ET7A 4G70B 3NJLA 2JFCA 1TKWA 4YSQA 3ZIYA 1OOWA 5TK2A 3S3BB 4HCIA 1JZHA 2PCYA 5AZUA 3WNIA 2XX0A 3FYEB 1OV8A 1AOZA 2IDUA 3FU8A 2EIJB 3NJHA 1JZJA 1ILUA 2YXVA 3ABLB 3UGEA 1PNCA 1FA4A 5IY5B 1KDIA 1PY0A 4A2FA 5B1JA 1WS7A 1PLAA 3IN2A 2J56A 5EHFA 1KYAA 3WKQA 4BWWA 4AZUA 5B1AB 4NAJA 1URIA 1PLBA 1KBVA 2B08A 2PP8A 1AS6A 1NPNA 3NJJA 5I5MA 4YSDA 4BK5C 1GY2A 1L9PA 2XX1A 3AG2B 3T6ZA 2JKWA 4G71B 4HZ1A 4JKNA 4A2DA 2EILB 1I53A 1MG3C 3IBOA 3PCYA 1TU2A 3CVCA 3GYRA 1TEGA 2A3TA 3NP3A 4QKTA 4DPCX 2WO3B 1BYPA 1AAJA 4P5RA 4AI7A 5B1KA 2GC4C 3FQ2A 4A2HA 1NIFA 1WA1X 1L9QA 2EIKB 1N68A 1V55B 3S8GB 1JXDA 3T71A 3CVDA 3FPXA 1WA0X 1SF3A 2XLLA 2HXAA 3NSCA 2LLNA 2PP9A 4YVUA 2FQFA 3UACA 2AZAA 4AX3A 1GYCA 1SDDA 5E9NA 1HFUA 2CUAA 1GS8A 3H4FA 1KDJA 1E5ZA 3NSYA 3HB3B 5D4HA 3AG4B 3X2QB 1NTDA 1ZDQA 2Q5BA 2WO2B 3NSFA 4A2GA 3ZX1A 4YVNA 2EIMB 4YSCA 2J5WA 4KNSA 1CC3A 5F7AA 4DP6X 4TXVB 3WG7B 4GP8B 2N0MA 4Q89A 4A2EA 4JHVA 4KOBA 1J5DA 3EH4B 4KO5A 2YXWA 2HRHA 4BWTA 2EINB 2QDVA 1NIBA 4MFHA 2UX7A 4RH4A 5I6LA 3CG8A 4YSAA 4M3HA 1IC0A 2FT8A 3TBCA 4HCGA 1HAWA 3SBRA 9PCYA 2CALA 1IUZA 3FS9A 1NIAA 2CJ3A 2I7OA 3L45A 1ASOA 2QPEB 4A67A 4A66A 1L9RA 1PAZA 1BQ5A 1OE3A 2ZWNA 1A4BA 3X1NA 5A7EA 5I6OA 3T6VA 1NWOA 4WKXA 4UF7C 2GHZA 2XUWA 3OMNB 2GI0A 2VSMB 2PP7A 3QJUB 4BXVA 3HEIB 1DYZA 1AZNA 3QPKA 4GP4B 1SDDB 1AACA 3FPYA 1PMYA 3N2JA 4UAHA 4AKQA 1B3IA 1M9WA 2AFNA 1CYXA 2Y69B 4DPBX 4PCYA 2BWIA 2E86A 3G5WA 5TK4A 2HX8A 2DWSA 1BXVA 3QJQB 2IH9A 3FU7B 1KCBA 3QJSB 1PCSA 1BXAA 2QT6A 1PLCA 1GS7A 2YAEA 3X1BA 1NIDA 2HX7A 3ASNB 2R7EB 8PAZA 3GDCA 2PPFA 1SFHA 1V54B 3X1GA 4QLWA 3NJKA 1JERA 1JVOA 3CDZB 1SJMA 2XXFA 3OQRA 3SBPA 3FT0A 4AKOA 3MX0B 1TEFA 2BO0A 3V9CA 2HZHA 1ZV2A 2YAMA 2VM4A 2YARA 1SHWA 3H4HA 3S8FB 3FU9A 1JVLA 2XXGA 4DP8X 2BP8A 1ASPA 2JXMA 3FSVA 2VN3A 3BQVA 1JZFA 2XU9A 4DP2X 2VMJA 3MBWB 2XWZA 4GXFA 5I6MA 2OJ1A 4HAKA 1W6WA 1KV7A 4ENZA 3OM3B 1V10A 3S3DB 3OMAB 1ZIAA 4HIPA 1UATA 1CURA 1OCCB 3FSAA 4F2EA 2OCCB 4E9SA 3ABKB 2YAHA 4G7RB 4YSUA 1ZIBA 2XYBA 4DP5X 1XB3A 1YLBB 4YSPA 2MTAA 2BP0B 1AZRA 4UANA 3T9WA 5I5JA 3PAZA 3WIAA 5I6PA 1GS6X 4ZK8A 2CBPA 1AQ8A 3OD3A 3NP4A 5F7BA 3PXLA 2X88A 3DKHA 3AG1B 3FQYA 3WNJA 3ASOB 1EHKB 4L0PB 4NB7A 2DV6A 6PAZA 3H56A 3TA4D 3ABGA 1J9QA 1WAEA 3PAUA 1E5YA 4W1TA 3UAEA 4CSPA 3TASA 4FAAB 1KBWA 1ET5A 1BYOA 4BDVB 1A4CA 1AZUA 1M57B 2AVFA 3AY2A 2X87A 1EZLA 3QQXA 7PAZA 6PCYA 7PCYA 3X1FA 3TBBA 4E9XA 1R1CA 1PZBA 3NSDA 2BP0A 2BP8B 2YAQA 3RYMA 4HHWA 1BQKA 1IKOP 1A3ZA 2FT7A 2QPDB 5LDUA 4KO7A 2GSMB 2DY2A 1X9UA 3WKPA 3NT0A 1E65A 4KO9A 1ID2A 4F7KA 4E9RA 1CYWA 4DP4X 1ASQA 1AS8A 1J5CA 1ADWA 5D4IA 2BW4A 4P5SA 4E9VA 1FFTB 1AG0A 2R7EA 3DIVA 2IH8A 4E9QA 1NPJA 2YQBA 3ZDWA 2FTAA 4X4KA 3U25A 5B7FA 1J9TA 3JTBA 4HHGA 5I28A 1W8EA 1A65A 3FU7A 2AZUA 1F56A 4G7SB 3T6XA 2TSAA 3ZBMA 3CDZA 2DYRB 3T6WA 2UXGA 3DTUB 4G72B 2XV2A 4DP9X 2HRGA 3BVDB 4F2FA 1GW0A 1ETJA 1GSKA 3N55A 2PPEA 4KO6A 5I6KA 1AANA 1QNIA 2J57A 2YEVB 1A8ZA 4E9TA 2GIMA 3NJMA 2H3XC
chains in the Genus database with same CATH superfamily
5LVEA 2YGQA 4P2RB 1Q9WB 4R83A 4FKHA 3O9WA 2WIIA 4KAQH 1R3LA 3ARYA 3ZU8A 5I8OL 4X6CE 3VACA 2VXTL 3O4LE 4JB9H 1MRFH 2XAQA 3QISA 2OQJB 4PJIB 1F3DH 1GZQA 2FWSA 4E2OA 1FYTA 3ROOB 3I2CH 1NMCB 4BM7A 2BNQB 5KVGH 4JI7B 3DRTA 3L5HA 3GMNB 2CUMA 1QFUH 3LN4A 3M7FB 4Z7QE 3UZVA 2EKSA 3BN9D 3OKOA 5IHZB 4R7LA 3FSWA 2FNWA 3LUTB 2E7MA 3LDCA 3T08A 4GIAA 3X14A 4LHUA 3HZKB 2EE0A 4G80A 4J6IA 3OAAG 5IV2A 1R3KA 3FUDA 3CDGB 5J13C 3X14B 4PJBA 3CXHF 2DWDC 1VIWA 4B3TB 3QCVH 5ACZA 3KYKH 2ZXQA 2VW6A 2XJLA 1N8ZB 3IMRA 5DJZB 4DEPB 1MMMA 4CN6A 1G9MC 2R1WA 3JUYA 4TUYA 3H3BC 1K5NA 4HIXL 5IBUG 2CDFB 4K9EC 1GY1A 3X3GH 1VQ6V 4FNSA 5AG8A 3QUMH 5GTIZ 3H7LA 2XZZA 4HBCL 5DD5L 5AWNL 4JG0H 2XKUA 2QZ5A 4GKNA 4EB6A 4H8WH 5E9DD 5EPMB 1IIKA 1YZZA 5FECA 3SHSA 4EF3A 3KPQB 4UCSA 3ARGA 3OB0H 2CHXA 5LNEA 3V5KA 3WO4C 4AEIL 5BS0A 2QSCL 3V5HB 3E2HB 3WTUA 4Y2LA 3TYGH 1YEFL 4CBPA 1OE1A 5T33L 4P9HC 3CN4A 4P4KD 3CCLV 1SHSA 3BOVA 1LYQA 3KNBA 5AWNH 3L1GA 4UAOB 3TBSB 3MV8B 4NNPL 3MRIB 4NJ9L 1N70A 1S3KL 4ZUWB 2W88A 2JEUA 1EDYA 4MWFA 4LDLB 4S1RL 3R1GL 2ORBL 1F00I 4JCMA 3GK8H 1TTCA 4MA3A 4PIBA 5HVFB 1FD9A 3DX4A 2NSMA 2R0KH 3JWOL 2Y7SA 2WPDG 1AZCA 4BRJA 4PGJA 2W0FB 4PJBF 4DR1B 4O4HA 1U95A 4W9CC 3I55V 5J06A 1RK0A 1MCWM 4XHJC 4D94A 2ID5A 1I7UB 3JV4B 1NOFA 1XL4A 1PFCA 4XTRD 2GI7A 4X6BA 3KWUA 3DGGB 3U7YH 2P80A 4P4RA 3PQYD 3FHQA 3QJFA 4N4YB 4P46D 2RACA 4TV3A 5F89A 1VF6A 1XZ0A 2NUPB 2VCOA 3BP5B 3EJJX 4Q14A 2FT6A 1KUMA 2IANE 4L05A 2HEPA 1GR7A 4P3CL 5DJXA 1KTKE 3C6LA 4NGHL 1MIML 4GW5A 2DW5A 2GSGB 4L9LA 4PJBE 5HVGB 5ICYA 2JKNA 3WFCH 1O6TA 4GYCB 4NZFA 3KPSE 1BEYL 3QJTB 3SPVB 3BWUC 1H5BB 4MMXC 3JSSA 4P0DA 3MGTA 2IJKA 1N2RB 5JPNB 2R0KL 2W59A 3KW7A 2GY7B 3KGTA 3AREB 4JS7A 2LR4A 1KKCA 4MJIE 2A0LC 4MNGE 3QUXA 1ODUA 3BWAB 2HPOA 4I50A 1FV1B 1PSKH 1RULL 2YFOA 2FO4B 4R90H 1A7OH 1CI5A 4H25B 5DVLA 4YL4A 5ABZA 4FTVA 4XVOA 1ERNA 2BC4A 3A0RA 3KPMA 5E2VL 5BMFL 1SJVA 2AQQA 4XGZB 4QIWF 1J0YA 2SEBA 2KZBA 3OGCC 1VFOA 4OW6A 1CXHA 5DHVH 4ZSOB 4JPVH 4G9FE 3GMQB 2DQGH 3FN3A 4APQB 3T0AA 5DM6V 1SKVA 1JFFB 1QBLL 4LPUA 1GCYA 2J5LB 3IN0A 4V1DE 1A7NH 3K2UH 1CICB 1UWEL 3TCLA 3KPSB 4Y89A 5I23A 1HHJA 3BZDA 4FZ8H 3T4AA 5H6QA 5C0AE 1M57C 4LSUL 1A3RL 1OJHA 3LZLA 3OGCA 5DJ6A 4NFDA 2IBGA 4I2XB 3OAUH 4CADB 1KG0A 3FT1A 5IOKA 2NX5D 1TZAA 3B2VL 4FP8H 5KSUA 3WS6C 4OZHB 4Z7WB 1G4MA 3DGEA 1UGNA 4GMSL 3WFHB 4AYFA 5AAPA 2PCYA 2ATKC 1XF5B 1D9KA 1YCSA 5LGYA 4MSWA 3KL0A 4GSDH 4GSQA 5IMOB 1JE6A 2C8NA 2CO6A 5A2CA 1CD8A 2FJGB 2HUEA 4IS6A 1PY0A 1YJWV 4UTCA 3L74H 1KNOB 1U8KB 2VITB 1R47A 1ZGLB 4M1CD 2HKHL 3ORJA 1MVFA 1NBQA 4LFHG 5DQ9B 2A9MH 3B2MA 3QEGH 5BW7A 3VQYA 3MUJA 3NBNA 2ZXAA 4AMKL 4XP6L 3UTSA 1DVFD 4L1TA 3QEUB 4X1KB 1LK2B 5C0AB 2AXTZ 1LO2L 2IADB 3FHEA 1A8JH 3TBWB 5KS9A 1TUPA 4JI3B 3K4DA 4ANXA 4GAGL 5HHQB 2WTOA 4DESA 4ODHL 1U21A 2GITA 1IAII 5DJCB 4XTRC 1TJIL 3ZHTA 4HUNB 4KAQL 2RCSL 4QT5B 4XBGB 4XNXH 4BSWA 2XWBB 1PCXA 2G4GA 5GSRA 2R0WH 4NQTA 4N0UB 1TVDA 1IEAB 3TWCL 1WRFA 4I87A 4K3EL 3KPRE 1PG7H 3RVUD 2IAMC 4K5MA 3JTSB 3IJ7A 3FQ2A 4ZX3A 2Q73A 3N2KB 4JTDB 1GGYA 2WNGA 1MCSA 1E4XI 3PJSB 2BCKA 4RISL 4CSTA 1GZPA 1JXDA 4LNRB 3FPXA 4PWJA 3CFUA 1WA0X 2BSBA 4I9WD 1LL1A 1LDPH 3VRJB 3G5VB 1O9WA 2F7QA 5JJNB 1MHPL 1W0JG 3VI4E 4B7EA 3ULVE 1CLVA 2AZAA 2H2SC 2WXRA 2M8XA 2N05A 3KS0H 4QXTB 2YOCA 1NCCH 1E5ZA 4MCZB 2QQLH 4QNPF 3K59A 1YUHB 3NSFA 2BOBB 5C3TA 2QDOA 4YVNA 2BSEA 1M6OA 3SE9L 2E75B 1EZUA 3QIWB 4YO0A 1V27A 3O9OA 3PHOB 5F6HJ 2XT9A 2MQ0A 4RETB 3LNGA 3S2CA 5CUSL 3ZKQD 5D5MA 1WZLA 2ITFA 1BLNB 1WHPA 4UV9A 3CXDH 5EUOA 4B5EA 3UYOD 3VTMA 1AQDB 3FFDB 3OHXA 3VFTA 2YJQA 1OARH 1G7HB 1YPZE 4JKPL 3TZVD 4DKFL 5C8JA 2AXFA 2ESVD 3CZFB 3OE7G 4PCTA 3QO0A 1L6PA 3U82B 2O5YL 1ACYH 3N40F 5DFWH 3NA9L 1COBA 1NIAA 3D85D 3T1FB 3VRLF 4PRHE 1S46A 2VC2H 4KUZH 1N18A 5JDSA 4XMVA 1P69B 1REIA 2X4NA 1BSIA 1DVTA 4WGWB 3UP1A 3GJEB 3W38A 3GHBL 2OYPA 4PFEA 2X09A 1Q72H 1NWOA 2IOMA 2N74A 3EDDA 4Y0GA 3P3PA 3OAZK 1F11A 2VTFA 4OLXH 1KB9J 4Z7IA 1KN2H 1J0IA 2NX5A 1UXWB 3GHEH 1AR2A 4LDCA 4NKMA 1MABG 4LHUG 1C16A 4BH8B 3BMWA 3IVKB 1H15A 3QPKA 3RDTB 1Z9LA 5FPIA 3LS5L 3AJ7A 2DMXA 2XAFA 3MJGX 4YDJB 3BKMH 4Y4FA 5LHGA 2N4IA 3HE6C 2Y06L 5EN3A 2NT1A 1GMGA 2WA3A 4DGYH 1AR1D 4YHML 2NN4A 2NNUA 2Q9LA 1UQSA 1N64H 5F1NB 3WDIA 3WNNA 2X28A 1HZKA 1ETA1 1NMBL 4PRHB 4PWFA 1XCWA 2HT4C 3BT2L 4EMZA 2NY2C 4WHCA 3DV6A 4BHUI 3JBG7 3JVGA 5BUPA 3S3JA 3HBPA 2BVYA 2D31A 3W9EA 3MUGA 4ZUTB 5DMKB 3RZCB 1UB6A 3ASNB 5EIBC 1SVZA 2GTWB 4YFLF 1D7CA 5FW8A 3HE7D 4J7KA 4U6HB 5I15L 5D7JA 4LCIH 3V7AE 3IJEB 3GUFA 2XXFA 3PJLA 3ZHKA 4F8OA 1CXEA 3V4PL 3VH8B 3KYMB 3QA3A 3VFGH 4A63A 3LCYA 3DHUA 1SESA 2OTLV 2E59A 4OM1H 5ELIA 1DVQA 5CJ8A 1YSOA 3FU9A 3UCSC 1EEUA 5DC2A 2XTAA 3Q8BA 4LRNL 3EJUA 4L4TE 4P2OC 2J5LC 3HFML 2DQFB 4QE9A 5KYUB 2YD5A 1IBLO 3PYCA 1BVNT 3ASOC 1CFVL 1QLRB 2VDKH 5DJ8B 5SWZD 5C0IA 1DN0B 2CGRL 2WQSA 3AWFA 4H44C 4GXFA 4QI3A 1I3RB 4UM9D 5E2UL 2BFVL 3EF7A 3MLYH 3V6FA 3WEBA 3QFDB 2Z31B 2KDYA 1UATA 4K8RD 4YHOH 4EQ2A 5L7XL 2EYRA 3FH8A 1K8AW 3MV01 1UG9A 3QDMB 4GAJH 3OTFA 1NH2B 3QQ4B 4WWKA 4W4NA 3OJMB 1HWYA 1JPFB 4GT7A 3G7TA 4PJHB 5D7LB 1XEUA 1A3RH 2WQVA 1NAML 1MW1A 1UA7A 1JPEA 5LJYH 1JGLH 4W9IC 1CCZA 1QHOA 3MLRH 4MLIA 4ZXBC 4KKAD 1XBRA 2UVFA 4RSYA 4JLRA 3AB0B 5FB8B 3WKML 4L4TB 3TA4D 4LLQB 3U1QA 3UBGA 4JHAH 3B2XA 2X1PA 1A21A 1RP8A 1QW9A 4ZUUA 4RO2A 2Z93A 1FORH 2ZOUA 4LSPL 1IDSA 1S9WA 1EN5A 4PREA 4OM1L 2OP4H 2UWEF 2WNXA 5AL8A 5JW4M 3L4TA 3LOWA 3LQMA 4P5TB 4FMKA 1K34A 1TETL 4G7YH 2XA3A 4NHUB 3KPLB 1ZEAH 5EH1A 3RYMA 3C5ZC 2P67A 4C56D 1A3ZA 5ENWB 3AMLA 2FT7A 4GS7B 5I75B 1KXVC 1FIGL 2EDNA 3NEEA 1G6RA 3PPEA 1A1MA 2PI4A 5CLZA 43CAA 2IQ9H 1H3PH 3B8SA 5ICZB 1SQPH 3MYZA 2MWCA 2X2HA 5JXEC 3MHSC 1BEYH 3C2SA 5E99L 1K4CA 1CXIA 3HZVA 4UCTA 3ARZA 3M46A 3CZEA 4WUUD 1HCFX 1A32A 2WXHA 4LSVH 1J8RA 5E99H 4UAOC 2LU5A 3SQBA 1XAUA 3POCA 3U25A 1J9TA 2ZZUT 4J3BA 4WHYH 1FIGH 2AZUA 4UV7H 4JRXA 5D5PA 2KPNA 3ZBMA 1R75A 1EH9A 3ZK0A 1IU1A 1A4JA 4RISH 2DQ6A 1SQBH 2K9PA 2X4OB 3L1OL 2BNRD 4NIYE 1Y74A 4A04A 2A6IA 1SETA 4TNVF 5F9WC 3FCSB 1R5WA 1GSKA 2JKTM 1WFJA 1A9EB 2XZQH 4B3EA 1PD6A 3IMVA 2I9LA 3BJ91 4MZIA 5TE4L 4TKWA 1DANT 2HH0H 3BAEH 2DKUA 3FO2A 2FBOJ 4P06A 4P5TD 4LIQL 5E1IA 4W6XB 2AANA 1S7VB 4ZT1A 3C8KB 1OANA 2CNYA 4ZSOE 4OGXL 1N7MH 3CUPB 3RL2A 3HG1E 2HP4A 3VGAB 5GS2H 1FFNA 5GRXG 3CXCU 1OAZL 1PY4A 3M7OA 3SKNB 3SZ6A 1BM3H 3QWOA 1M05A 5E1AB 2WTRB 1Q7YW 2NY0D 1E9OB 1QWNA 2V5SA 2ZWSA 2H8PB 5LGHL 4TV9B 5JDSB 2CIKB 3ZE1E 4R6ZA 2F08A 4DW2L 2ITCB 4N5UA 2FO1A 4LCVA 1F58L 1JSYA 4JCLA 1AIFB 4OCRL 4QF1B 4WFFA 3WUZA 2QQNH 4LLVB 4N0CC 5LHDA 1U8NB 3CRQA 5L4MA 1EO8L 1NH2D 2GUZA 1QFPA 5A2QN 2EO9A 5KYWB 4ZOLB 1YEGH 2APTA 3EXAA 3DYMA 5D5MB 3ULVL 5D1XC 1P5VA 2Z35A 2PPAA 4YE0A 3WELA 2QGNA 2CLRB 1C08B 2JIXA 4KHPB 1Q9LA 1OP5K 2DI8A 4HIIA 4DV6O 5C6WH 4LGRB 5DUBA 1RHHB 5I76A 1ZVYA 4HS8L 5J2TB 1M42A 2W91A 4N8CH 4X9BA 3VBBA 4LCUB 4RAUA 1SJEA 3N04A 3OR7A 3GEWB 5I1GL 3KVPA 3NK4A 4OIFA 3FKUS 4WV1B 5TTRA 4G9FD 1TTUA 4Q9QH 4E41A 5JOEA 2F58L 4XH2B 1LE5B 3RPKA 2AK4B 1MFMA 2Y72A 4XMPH 3VWJD 3T6QC 3WLWD 1KPUA 1KTBA 2EDWA 4H20L 4ELMB 5BUGA 1D5MA 5KTEL 1KY7A 3BEWB 4LF5B 3LDBB 1EMTH 1QUPA 1X5LA 3P40A 2HJKA 5G4MA 4N5EC 12E8L 2OMZB 2Z9TA 4M7LH 3ZGIA 3OR7C 3G6AB 3TOPA 1PM9A 2L7EA 3ATAA 2Z7YA 4LCCB 3RZCD 1G1CA 1FC1A 3K6SA 4JFOB 2Y1AA 2NYKA 3AG3B 2W38A 5D5ME 5FOBB 2Y0IA 5EBLA 4Z0XB 4WU5B 1T22A 5DD5H 5IT2H 4JF3A 1EDQA 3UBXA 2TRHA 3W82A 1T21B 1RMFH 4PBDA 4DPAX 2QJDA 4DQOL 1TJGH 2I7SA 2RJMA 5CAYB 4LKXB 4P3WA 3JAKB 3TA3C 2GITB 5KVDH 2QEJA 4PRAA 3O11A 1AI7A 2AMGA 4JM2D 1BFVH 2NY4C 5GRZA 2EXYC 5HHPB 4QNHB 2PTTB 4P2ZA 4KK9D 3QEUA 2BVPA 4WO4D 5CR8A 5H2BB 3T2NH 3BZEB 3UTSB 3D8MA 4ZOEA 4B3VA 3O65A 1ETZA 5KTEH 1MH5A 1OP4A 1JP5A 3P9WB 3VGFA 3HFMH 5JPNC 2GK2A 1P1ZA 1SN2A 1U6AH 2HA1A 3MJ9H 1IGTA 35C8H 4AIOA 2E6QA 3NUKA 4NM4H 1KIPB 2OMXB 1P7BA 1F4XH 3ZCCA 2JGUA 5EA0L 1E2WA 2XT1B 5BRQA 2Q7YA 3DX7A 4K5NA 5E8PA 2A2QT 4MVRA 1QR4A 4M7LT 1L0LH 4HJTA 3KD4A 2MPAL 1HH9B 5FPRA 5IESH 1WFIA 4TTDC 2NYYC 4QRQA 2G3ZA 1I8LC 3JV6A 4Y4FD 2KB1A 3CZGA 4MNGA 3CVIH 3QNYB 5K39B 3MCYA 2Y0PA 3FONA 3T2NL 2O61A 1JXGA 3DSNA 1UOWA 3LQAH 3KS0J 2XTJE 4UOZA 5CNHA 4XO4A 2BHUA 2YFNA 1WC7B 5EBMB 1U6AL 3MJ9L 4OR1A 2UXVA 2VDNB 1B6UA 2YAFA 1JOIA 5I1LB 1U3HB 3KBFA 4RWUA 1HDMB 1I1AB 5HBBA 3P0YH 5DFVC 2XQYK 3PL6C 3AG4C 1LEGA 2C1PB 1JF6A 4IQHA 3G08A 4KQ3L 3RBGA 1XIWD 4GY4A 4P4KC 5SX5K 4Z78B 4F4LA 1NCGA 4FKEA 3VGDA 3BIBX 2BMKB 2A79B 1QUNA 4DPRA 1QBAA 4DZ8B 1PNDA 3VJ6B 1QLEC 2HG0A 1G0YR 4TUJB 3DYPA 4Z3FA 1N5AB 3TJEH 1L7IH 1UWGL 1VEWA 4F57L 3EIFA 1XDCA 4I3GA 1FZJA 1IFRA 1I8MA 4WSJA 1ILSA 3G9AB 4OIIH 4P49A 1CDJA 3IMWA 2NR5A 1RURL 3OXSB 4R90L 3F8UB 3QUXB 4OFPA 1FNGA 5LAPA 4HZAA 3BWUF 5F9OL 1F2QA 3BSZA 4AYSA 1RP9A 3SR2C 3B9EA 4N2FA 5ANHA 4PS4L 3JAWA 4OJYA 4YJ3A 3U9PH 4KJWC 4JFZH 3SGIA 1XGPA 2YWYA 3WHXB 4KUZL 3N42B 4Q6GA 3COOA 4WNQA 3ISYA 4EN3C 4NM8L 3SOTA 4GAAA 1FPOA 2IANB 1WWWX 4CMMA 1N26A 2VISB 3DBXB 1IXMA 4BW9A 4FFYH 4CDHA 5BMVA 1ZSHA 3TO4A 1RZKL 3W7XA 1P7KA 3MJ8B 3IN2A 4O02A 3CD6V 2AABH 4GMSH 3RNKA 4EQ3A 1FO0L 3E8UL 2B08A 3QIUC 1X4XA 4QRFA 3VWJB 4HUVB 1Q1JH 3CDYA 4W4OA 4PB0L 1MWOA 5JWPA 3HRZC 5I5MA 5D2LB 2QFPA 3J7AU 1J48A 4PGEA 2XFXB 3N1PC 3FQUA 3UT5A 4PR5A 5J0BA 4BR6A 3N43B 2DQGL 1K92A 3H01A 3ZMNA 3VXTB 1R6TA 3P32A 5DMIH 2F53A 5DVNA 4AV5A 2DMBA 1TU2A 1J18A 1X5GA 1URFA 3GXFA 2P22C 1V05A 4Y4FC 3KYNA 5AVWB 4ZZKA 2M7WA 3GI9L 4K55A 4OX9B 4HUXA 2D3OW 1RZJC 1ZHNB 1A7OL 1PL3A 2NY1D 2ZOKB 4NCDA 4KMTH 4YPGB 5DGQA 4J6RH 1XNQB 3CFEA 4FI7A 2XWJA 1FORL 5E56A 3V4VB 1XH2A 2JDIG 3V0GA 2N7SA 4J28A 4NQVA 3UOAB 5JR1L 5IMKA 3P73A 4G9DA 1FFOB 5BXZA 3CMOH 4GKNB 2VLKE 5J4MA 1FZOB 3ZO9A 4YE4H 2V5TA 3KMDA 2WVVA 2C7FA 1DQKA 2PUQT 1Z2KA 3H53A 4ZOBA 4OGYH 2FECL 1PBYA 3QUMB 1LWRA 5BXFB 4JJHA 4WF7A 4NN6B 1VEPA 4UQCA 4OGQB 5J1TC 4Y88A 1HP8A 5E2TH 5KVGE 4JFPB 4XP6H 2IGTA 5IIEB 5SWZE 2R39A 3JD4A 4P3CH 3VSVA 3K5NA 4S1DC 1TCRB 3FOLA 1VF7A 1JF1B 3NACL 1T1WA 5DHYA 2P43B 1XZWA 1IKNA 3HE7C 4XVTH 2XNAB 4NJAL 3ESVF 4XNMB 1R3KB 4JHZA 1QEXA 2WAQA 1JUFA 3W56A 2EINB 4IRZL 2E9GA 5ALBL 5DZVA 2E7CA 4KGJA 1DL7H 3HHSB 5I6LA 2Y9RT 1MHCB 2YKLL 3ETGA 2R9HC 5D1QA 2KQMA 1HAWA 1I7ZB 2NY6C 4RFNB 2NY0C 1XCTB 3M17A 1CL7H 1H3PL 1IC5L 3QXTA 2C1OA 1N3NA 1SBSL 2IC2A 3MDSA 2V2WB 3PUCA 4O2EA 2WA4A 3HKDB 2P8LB 3FJTA 3L48A 4X20A 4I18C 4WJKB 2B1OA 4I55A 4HW6A 3BCCH 4JFDB 1FYTB 5DVMA 2AP2A 2FL5A 2ROXA 2M6YA 2PO6C 2EEDA 1E4JA 1FBIH 2X42A 4WW1B 5CEXB 5HY9B 3NZ8B 1EJ8A 2ZWNA 1A14L 2VLJD 3QWQB 1HHGB 1Q9WA 3CPLB 1JV2B 1UVQA 3IMBA 3MV9A 2HMID 3CWBH 3RZWA 3NH7H 4PJFF 2HT2C 4QY8B 2OCHA 5H35A 2Z1KA 4P30A 3KLAA 1DLHB 4P9MH 4ADGA 3LZQA 5KEZA 3POHA 1RZFH 2P5EA 1CU4H 3ES6A 3RIKA 4X50A 2XASA 1SYSA 5FKAB 4HUWB 4UAHA 3DROB 4LBEC 1TQTA 1YEDA 1V8HA 2NZ9C 4YHIB 2BRQA 4GW1A 2AHYA 3CIAA 5ETUA 5IROC 2EIEA 2WCGA 4HWZB 3C5ZA 3NESA 3CGTA 4IHOB 2W9DH 2ZXEB 3TJHD 2ZOTA 1K5WA 4PV9B 2ZR3A 3OL2A 4WK0B 3OFNG 2FYYA 4EI0A 1KIRB 4PY7A 4X6EB 2FGWH 1BFOB 3DECA 4C56A 4HFUL 3FMGH 3HI5H 4TUUA 4FQXC 3BGMA 2F23A 4O4YL 2VDOL 3VM5A 4R3SA 5EV7A 1MKFA 4OD3L 5FHBH 3NJXA 1H6UA 2YN3A 1L6ZA 4FMVA 3II1A 3UKMA 3HPLA 5ABDE 2WLZA 4FS0A 3RWJB 3IFXA 2GBOA 1D9KC 2H6UA 2FLRT 3I85A 3VCLB 1MFEL 1Q9KB 3REVB 3QZWA 2HLAA 5F3HB 1EZVY 2PY5A 1AHWC 5DHVB 5AKSA 3G6BA 1SDYA 2FHFA 4HMDA 1LLAA 5I15H 2BVQA 5ADOL 3QI9A 3FOMB 2R2HA 2LLLA 5GRVL 4ZXBB 3KJ6L 1N7ML 5E4AA 5EEUA 1XCXA 5LA6B 1KV7A 4KI5E 3JCZA 3PN1A 4YHMH 5L8LB 1J8KA 3QQ3A 3T04D 2DH2A 3HJ0A 1T6BX 3CCEV 1ZLSH 1OCCB 1NGXA 4F2EA 3GSRB 5EO0B 5B21A 1XMQO 3QI9C 5E4EB 1ZIBA 5L6YL 3ZYIA 1XR8B 2R1YA 4BFIB 1AQHA 2MQGA 2BIQA 4FZEH 5DVKA 1OEZW 2ZJSH 5FA4A 2YMXL 3TIEB 4TNFA 3OD3A 1SQVH 1DEDA 3WIHH 5E2UH 2R72A 4K8RC 4H20H 5LGJB 2UZPA 2WB1A 4KRMB 3AG1B 5TISZ 2WWMD 3BFOA 3BUBA 3HLKA 2X4QA 3ASOB 2QKSA 2VLME 3GHBH 4LHUD 1GOGA 2AJSL 4MJHA 3ISRA 4CRPA 1L3NA 1E6JL 2WY3B 4Y2DA 1BQHB 2G60L 3O8XA 1M7DB 3NIGB 1M7XA 1UKTA 3VU1A 2FH8A 1EZLA 2NY3B 2O72A 5T3ZD 3L3IB 3TCTA 3BE1L 3LZFL 1PZBA 2EE2A 3IDXL 1FO0H 3NSDA 2YAQA 3ZQ9A 1I7TA 3BP7A 1OARL 3B8YA 3H2QA 4NBYB 3QXUA 1HYSD 1BVKB 3KR3H 4HNAA 1J5EO 5LDUA 1Y6XA 3RNQA 1INEL 5FUCE 3MLZL 5MHSD 3F7RA 3QQ3B 5CFAA 1KIQA 4FYRA 4Q2ZB 4NXNO 1E65A 3FQTA 2GK0B 3RPBA 1JWMA 1TETH 4G7YL 4ZIBA 1CFQA 4O2CB 3DTDA 4X83A 5FYJU 4AIEA 4FABH 3UX9B 5B38A 5KYYA 4EAEA 3STLB 3QO1A 5TDPB 3O4OC 1HNWB 3OKKA 5INDB 4D3CL 1QRNA 2D9QB 1NR7A 1OT1A 2X6AA 1KB9K 4Z7QB 3SYQA 1RUPL 1KCSL 1Q9KA 3NCEB 3S5YA 1F56A 3IU4L 3B5TA 1FG9C 3M45A 1TUBB 1YTFB 1U8OA 2NXZD 4QUOA 3RDTC 3RWJA 3QC6X 4DVRH 5IHBA 3PUUA 1PIGA 2UWEB 3RWRD 3ZN0A 3CLEH 5A7BA 2R4RL 3VFVB 1UA3A 5E1AC 1PU0A 2OMWB 2AK1L 5IHUH 3NIDB 5DU7A 2OI9B 1VENA 5IHWA 1N32O 4PJ8D 3RJDA 1UB5B 3MFFA 4ANVA 3RIAF 4UT9A 1HW7A 5C07A 3T0BA 5BRPA 3PWPB 1IT9L 2WINB 5T3XL 4PJ5B 4FABL 4IHOA 3BWSA 1MCDA 5F0PB 1U8LB 3CZLA 1TPXB 3CBRA 3TNMA 2Y07L 3L9DA 3X17A 3RZCC 1WPCA 4LMQE 3P4NB 1DTOA 3OMIB 1R5IB 2Z8RA 3CFCL 2B16A 3I9IA 5HI4C 5JZ7D 3OT7A 5KAFZ 1KCSH 2Z4QB 3RTQD 3LX9A 2GB2A 4H33A 6CGTA 4FFKA 2V2TB 1GRJA 1MVUB 4POUB 1FFXB 2C9VA 2D7NA 5FLVA 5EO9B 3VFPA 2UVEA 2WLLB 4NUMA 2ZX8A 1MCKA 5EOTA 4PCSA 5CBAA 3FD9A 1TDQA 2FX9L 2NY4D 3L9RB 3LKRA 4W9ZA 5D71L 5T1MA 3VQXA 3D39A 2BOBC 3HNVL 3IGAB 3ULUL 3HZMB 1DVFA 2KERA 2IDFA 2A6JB 3TXAA 1A4AA 2DQDH 3QAZB 1IARB 4OLZL 3LY6A 1HYRC 5KSAB 2IWEA 4KJQC 4I55B 4JFDA 1OLLA 5HGDA 2Q7AA 4FQXD 2ZXWB 1CDGA 2P8LA 1RZIA 2VDRB 1EUUA 3J8F7 4HALA 3E9UA 3LPWA 4GAFB 4Y5YA 3MGAA 2GUOB 1I4FB 4KROC 3HHSA 3DMMB 2P4AB 3T3PF 4JPKL 4UBDC 3WDHA 1AD9A 5IZ7A 3ARPA 4HGWA 3SGDH 4X7TB 3T1WA 3VA6A 3CV5A 1YECH 4WKZB 4XXCC 5I19H 3ARBD 3APFA 5HYQA 3SE3C 5F9OH 5DK0B 3B6SB 4FNUA 2GBVA 2ITEA 4Y5YC 4HCFA 1WTGT 1OK8A 1C12A 3GBML 2X9WA 3QHTC 1Y0LA 5FYJE 2EILC 1IBYA 1USZA 2GFBB 2YMOA 4FLOA 2W0PA 1FYJA 4HJJL 7CGTA 3U0PB 5I5IA 2FYVA 4YDIL 1VF5B 1KQSU 2GJJA 2JI2A 4QWWC 4KZDL 4M61B 4XN9A 1FL5B 3UAJC 1VFBB 3X12B 2ZOWA 4MD4A 4NQVB 3LS4H 3V0IA 4ODVH 2HLEB 1E4WH 2MQCA 2VDKB 3GM0A 1OM9A 1KELL 3ZMUA 2W8CA 3B9VA 2K9FB 4AEIH 4DCQA 1T2QL 1Z5VA 1SLWA 2WKOA 1WB7A 3CC5B 5B1CA 1WSST 4QIRA 4XO9A 3QUXD 4N0RA 3H1JH 3LRHA 4AQ1A 2YO3A 3AADB 3QE5A 1O0VA 4WO0A 1CDUA 4YUEH 5SWQA 1J1PL 4MVSA 3DV4B 4Q9RL 4QAMB 2YXYA 2AKRB 1ZHBA 3HKFA 3EXLA 4DEUA 4HPOL 3K08A 4HOMA 4LCYB 4HWEL 1S7TA 3WI9A 3UT5B 3VWKC 4NZ8A 1MCLA 2RH0A 4CS3A 2OI9C 4LPTA 2XN9A 4LSUH 4UQ2B 4HBQA 4XNUH 5GONB 4FLRA 1EXUA 3B3IA 4JFHD 4YHLH 1MI5B 3JWOH 4U7OA 5DVPA 3VI4A 1F23A 3T2OA 1HQ4B 1GVIA 4L3EE 3H3PL 4PTTA 3RNKB 1UWFA 1BAFL 2NR6C 3E38A 4JFDE 5HDRA 5BOPA 3LXBA 1DZ0A 4N6RB 4FLHA 5EZIL 4ABMA 4X8CA 4DR2O 2R9IA 5CGYC 4YGVA 2X6CA 1LHZA 1SZTA 1BHAA 3EH3B 2CH8A 4DGUA 4YAQA 3B9KD 3C75A 3QH3A 5J1SC 4J4PD 1EFXD 2EDFA 1HWGB 1BQRA 1ZOXA 4NRZA 2K45A 3QQ9D 1G9NH 3EH5B 3VXQA 5ID1A 2P49B 3S5LG 5E70A 5E4OA 4ZJ9A 2VUKA 2A73A 3HB3D 2L3BA 3HAEA 3O6MH 4YSTA 3MROA 1ZLEA 2JJUA 1IEHA 2DIJA 2X4TB 1MLCA 2EXTA 4LEXH 4WK2B 3DJZA 1HOCA 1CR9H 4Q74A 1ENVA 1CZ8H 4K9EL 3FH7A 4IRSA 4QRBA 4U1GC 5FM8A 3RE0A 3R7RA 2AC0A 4HAMA 1CP9A 3DOSA 1MJ8L 5G55A 4DETA 1NBVH 3N1MC 4TSAH 4RMQA 5L0QC 4KMQA 5BO0D 5GIRB 4QJ4B 1KLFB 2YR3A 5GRUH 4HK3J 4J3SA 3RWEA 4LPVA 3RWGA 4S2SB 5BCAA 4FFVD 1E8ZA 3HUJF 4HCIA 4L1HA 5EZYB 1CFSB 3C60A 4NKOA 5C6PB 3L9YA 5E94A 4PS7A 2F4VB 3G08B 4F8QA 2DJUA 1E6OH 4RQQB 1JN6A 4WI0B 3BMVA 3GSNH 1RSOA 4UFZA 1P4BL 2VYRE 1WJZA 3MLTB 2EZ0D 3H9SD 3P4MB 1SLVA 1D5ZA 1R34A 3D36C 5FYLL 3L72H 4AEFA 4QRRA 5I73B 5K9JH 3O2VL 2NY5H 2PO6A 4E0RB 1EVUA 1CFTB 4JI8B 3WY2A 1DE4A 1JGUL 3KL3A 3O9WC 1VF6C 5CN0A 3BVNA 3BP4B 4PV8A 3T0ED 1R3LC 4X9FA 3NR7A 3NJJA 3DX9A 1DQML 4JR9L 1NBCA 2W6IG 1IQDB 1KCUH 2KMWA 5D96B 5FUOL 5EEVA 3T4YB 2ARJB 3H9SB 3FU5A 4AVJA 4TV8B 1BG1A 2FB4H 4A2DA 2QLVB 3IPFA 3TC9A 2BJMH 3P2TA 1OD7A 3LKSB 4OTXL 1NUNB 4MJ5B 5FUOH 3PCYA 4XAWL 1KF9B 4LK4A 1IGIH 2WUBH 1MH5B 1OT4A 3WOVA 1JNNH 2DYPB 5DS8A 1S72V 4UT6A 5I17A 1I85A 4S10A 2DLFH 5IWLC 3QS2A 5GSVA 1MFCH 5JH7A 2DTML 3MNWB 2OULB 1TQBC 1K9TA 5IW6A 3QXDA 1AJ7H 4P23C 1HXMB 1FZMA 1L9QA 3LZRA 4Q52A 4AVHA 4HGKC 1OCWH 1PX8A 1LO0L 1K97A 2VDLB 4X8GA 3UZEA 1KYOK 4ABUA 1JZ8A 1KN2L 3T71A 4GEJA 1P84J 5IHHA 3UC2A 3ZMRA 4U49A 5BS0D 1ZPLA 5FLXN 1YC8A 3MU3A 5E6ZA 3MRHA 2WYIA 5DO2D 3GIZL 3PWLA 4Z0XA 3QXAA 5M7QA 4J5VA 5CEZL 3K4ZA 2DYRC 1RIUH 2VZ1A 4LOUC 5T3XE 2ADYA 3G6AA 3HB3B 2DM3A 2ZUQC 3AG4B 5CP7A 5D7IE 1CD1A 4XPBL 3U0TA 5JXED 1MCEA 4H8PA 4ZW6A 3BEWA 4LF7B 5GJTL 1RM1B 4NX0A 2AEIT 3S37X 1I1FA 3CK0H 4A7UA 2OK0H 1BVZA 1RSFA 2X1XR 4OLWL 4OV5B 4TXVB 5F7EH 2Y3NA 1XCQB 1EK3A 4BQBA 4MJID 4A2EA 2OMVB 1VMGA 5ADPH 4HFWB 1RK1B 2YMTA 5DO2C 2EXSA 2Q76A 2RMKB 1UA6L 4G7VH 4RH4A 1N6QH 4DO2A 4O5LH 2CK0H 5AZ2H 4K3DL 5A3IC 5FR3A 3RGVB 2MJWA 3UPCA 5GQBA 3F7KA 3I6GB 4Q7DA 4JW3A 1I8LA 3X13B 4AUYA 3FCTB 1ES0A 3MRFB 1RPOA 3ZMTA 4HEMA 1ZJBA 5TPWH 1HXYB 3A6OA 3TF4A 2IEPA 4HFWA 3VD7A 1W16A 1CBVH 1OE3A 5T33H 4NHCL 4YX2L 4AI8A 1NDGB 4KZDH 2XOKG 4WSKA 3JWDC 3UJIH 4L29B 3AQYA 5F7YC 1EAPB 4ODWB 2OW7A 5I74B 2QTSA 5IFJA 3IKCB 3LRSB 4QAWA 3QQDA 1GC1C 2M1KA 4ACPA 3FTXA 4NB5A 1GRWA 1B6QA 5DUPH 4EIGB 1SDDB 2WTRA 1ZL8A 3REWB 4LRIA 2KZ1B 1RPUA 4NUPA 4MDIB 1E28B 1Y07A 2CIIB 3R0MA 4MD5B 4JFFB 4WO4C 4X8JA 4GRMB 4LDEB 4XCYA 2Q3XA 1C5DB 2CDEB 3CUPA 1WFMA 3BIKB 3T0DA 3THMH 4XE0A 2EC9U 4QGYA 2WSKA 1FZMB 1IM3B 4PJCE 3RWCA 4WI2A 5HD8C 5LG1A 5IW6B 5BQ7B 4LO9A 5I16B 1G1OA 1OAUH 2YKLH 4P5KB 2QT6A 1T0MB 1PLCA 5L3DA 3PHSA 5DEGA 3K7UA 4X5PA 2LGWA 3MRLB 3OKDA 4HBNA 2KHAA 2DYPA 4UU9B 4PVLA 5I17B 3NCYS 4L4TD 5HVHC 2EDXA 3I50L 5LB1A 4TVSa 5JQ6H 3GDCA 4X66O 2OMYA 3G6DH 3K0WA 3NPZB 4D9LL 3L4UA 3WJMA 4X1IB 2FX8H 1ECZA 4PHXA 5AW6B 4QLWA 1JERA 5CR1A 3D0VA 2YUXA 3B7SA 3WTTA 3U9WA 3BAYA 4FM1A 2NTFB 1C1EH 1F4HA 2IM9A 2WZ0A 2IOIA 3H54A 3OZ9H 5KVFH 4JO2L 4FQQB 2F0CA 3ZTCC 2ZG1A 5H37G 2WD0A 4NKDB 15C8L 3N91A 2C3VA 3BVNB 2CJUH 3G04B 5E6IA 3FB7B 1FNHA 3SEPA 3VFSB 5L4FA 3UQ8A 2CRMA 5IEKB 4JM2F 5A43C 1D5ZB 1DLFH 2R29H 3INUH 3GBMH 3P4MA 1PVHA 2R8SH 2LTQC 4FQXB 2A74C 3FRPA 4GI6A 4W4OC 5IBTL 5HTSA 1YMMA 5F7DB 4ADIA 1BF8A 5ILTL 1A64A 3CE2A 4L1DA 2EDKA 2QKIB 3HKZA 4XN1A 5ENWA 2YAHA 3SDDA 4LNUB 2O30A 2G4EA 5JHDE 4YSPA 2BIMA 5C2BL 2MTAA 4U1SB 1K8DB 5GRVK 43C9B 4PA9A 5C9KA 3WN6A 1ACCA 2A74A 2Y36H 3T0VA 1BBJA 4M5YL 4G27B 5C8YA 1NBYA 3P3SA 3N44B 3P11L 1IGJA 5TDNA 4ZW8A 2Z93B 3QQNA 4C56E 4D0DB 5DRNB 1FO0A 4FLXA 2IG2L 2XCMC 4MD0A 2LP7A 3N27A 4QGPA 3W7UA 3JATB 3UG3A 2ZKMX 1MFAH 5DRNA 2XA8L 1OF2B 5E5RB 5KANI 1MWAB 4WJG3 2GJRA 3BDXA 1RZJL 2P8PB 4XWOC 4XZUB 5DZNA 1R1CA 4PY8J 1F4WH 1JWSB 4F2MB 1KOAA 2Z0AA 4WWKB 3QIUD 5AQ0A 1F2XK 3QF7A 3WSQH 4LNUA 1HC1A 5I66A 3WY3A 1DJZA 4WGKA 2Y1YA 5JHDB 4TPRL 3BJLA 2WBKA 4BINA 5ISZE 2GSMB 2DY2A 2IW5A 2EX3A 4R5VA 3D06A 4CC4A 5GS0D 3L7FB 4JPRA 4FQ1H 3L08A 2ZSVB 2BNRE 5IBUB 1HNGA 1NS1A 2HH0L 3BAEL 1G7QA 2JK5A 5CCKL 1A6PA 4RGNC 1FE8H 4JFQA 3VFWA 5CA0B 4O2BB 4M7JH 5J5EA 2ZX5A 5C6TL 2I69A 2WQXA 4JO1H 5H94B 2DLFL 3QUZD 2CLZA 1USQA 4CVZB 5BZDB 4H8WC 4B53A 4BWAA 3UP6A 2HLDG 4BQ6A 3CHOA 5HJDA 5EZJB 3QA3B 5EU7E 3UTZB 2Z92A 3AY4A 3NIGF 4N2IA 4F2ME 2FHCA 3WFBL 4U6HA 3HI1B 4Z3JA 4AL8L 2IMMA 2LVEA 5D7KD 2BSKB 3Q43A 3NIFB 3A4FA 1VKXB 2ZWZA 5DK2B 3RIFF 5JHDD 1J0JA 1VB9A 3WKNA 4F7PB 3OJVC 3JD0A 4JI5B 2YEVB 3UXFA 1UWEH 2NQCA 4KI5F 5IVXE 1YQVH 1WYJA 5JUEH 2WW8A 3MRMB 4UINL 5CD5D 4YHNB 4M93B 2H3XC 1YJDH 3OG4B 4AHCA 3UM7A 4Z2WA 3HC3H 4WTXA 4FLVA 5ICXB 3BIKA 3KG2A 2WP3O 3TU6A 4GKSB 5I9QB 3WGVB 3Q5OA 4HX1B 4PA7A 2QVKA 4MDIA 3K3QA 4DTGH 3WDJA 2PW2A 4Y4KA 2WXNA 4CSZA 4HUUA 1PPJH 5CFHA 3B7UX 5DD3L 1HSAB 5KVEH 2Z31C 5JOFB 3KLHD 3VVVA 1OCOB 3IGLA 3K6DA 1MZZA 1GGBL 2YA0A 3PREA 1NDGA 3U10A 1YMME 4IL6Z 2DRUA 2V4LA 1VQOV 1X5HA 4GG6A 5IYDO 5DHDA 3CC2V 3K0YA 5F96H 3S88H 4GSRA 2DQIH 2Q67A 3DMMA 4Q4EA 2R2EB 5TD4A 5A6MA 5A2JH 4XPHL 1Q81W 1YEIH 3U1PA 1BPVA 3OR6B 4M1DH 2AXFB 5B39A 1F3JB 4OCWH 3AWEA 2A4EA 4M4RA 5EU6E 1XF3A 5I2IB 2R83A 4JHAL 4V33A 1SRYA 2CCLA 2JKIS 3ASNC 1H8LA 1DVFB 2UUAO 5TQ0L 3UABA 5DJDB 4JCWA 1WCBA 5T1MB 1LMKA 1A7PH 5HHXL 5D7SH 3FO1A 1CIDA 5AB9A 2WLLA 4I9WA 4PI2A 3A21A 4H1LH 4MA7L 4HWNA 3DJTA 1QG3A 4J3OD 4AJWA 2XKNA 4TYUA 4JKLA 1WBXA 5C0BD 3D25A 3P3RA 1G87A 3LEXB 3O6FD 3PWLB 3FFQA 4QHMB 1M93A 3AT9A 1Z0NA 2P5EE 5CJQL 4ATTA 5IQMA 4DUYO 4AXWA 3ULUD 3JYCA 3BXNA 2VKXA 3KXFE 4NS0A 5GS2D 3T65B 3RUGE 4QHLB 4ZUSB 4Z3GA 4LF9B 5GISH 1RXLA 1JHKH 3FUHA 3L4ZA 3KBHE 1HNFA 4X64B 1L0XA 1FFPA 3CLFH 5C97A 1EHLL 2VDMH 5EU6B 2WINA 3NQKA 1WFUA 1SS3A 5HDWA 2DN9A 1P9MC 2AEQH 4P46C 4YEFA 3QZBA 5GSVB 3KPSD 4OJCA 1HL8A 1L9OA 3CSFA 1OCZB 5HPOA 4J27A 4FQHA 4BA0A 5T1LD 1QSEA 2JTDA 3FFCE 3HLAB 5DZOA 4F7EA 3EF4A 4GBXC 1IEBA 3VD3A 2ADIB 3LS4L 4X1YA 3GS7A 2ZQKA 2LFSA 4E41E 1FP5A 2WLNA 1U93A 1ZTXE 1ECYA 2VQ1A 4KDTA 2F54B 4WLCA 3SE8L 4GRLB 3DX9B 4NZUL 5CJQH 1JXKA 1THCA 1TZHB 1ML0A 3CJJA 1KMGA 3MRDA 1WAPA 1JK8B 2J1ZA 2ZCLH 2ZIMA 2F74A 4F6EA 1YN7B 4NZTL 3GKWL 4K71B 3RIAK 1VESA 3STLA 1AKJB 3RAJH 4O2CA 1BD2A 1UJTA 3ZDXE 1JWMB 4G83A 4KZ0A 4RZCA 3VFNA 5KVDE 2ICWB 3BIAX 2YKKA 3KZ8A 1UURA 3FQTB 4FNPA 2UZYA 3IF1A 1YYML 4HUCA 4WFBV 2XYCA 4AGOA 2FWLB 3H2WA 2WUCL 2QHRH 2VXQA 3BLPX 5H5NA 2GABA 5I19L 4JDEB 4Z95H 4NZJA 2ODIA 1THZA 2IJIA 3GB7A 4HNAB 3EZJB 3KLLA 1CXFA 2CUGA 3DSFL 3NYKA 5DHEA 4MLSA 3KW8A 4L48A 3U0ZA 4UMSA 2H6OA 1FNAA 2YUAA 3RWEB 3WN5C 2VH5H 3LPGA 1KG0B 2AW9A 1YA5A 3FBKA 4OQTA 2IPTL 5SWSE 2CCWA 1R17A 2YD4A 4IOSD 3CVBA 4FQ2H 1PLGH 1FH2A 2KDGA 2WB7A 3F5WB 3QARA 4DRXB 2E7BA 2XBTA 3IFOB 4J3OG 1SQMA 4JANB 4JHWH 4XVTL 2HAZA 2X4TA 1HS6A 4LOFA 4IIQA 4OJAA 3VMOA 5L0QB 3GM8A 1OB0A 2SEBB 1FI8C 3CYOA 2R4SH 2A73B 2CO4A 4R4BB 1RUML 5GGTH 2D2CC 2X4SB 3QEQE 3CRAA 4XP4H 3EO0B 4JY4B 3I6LE 1S6NA 1ZE3C 2FO4A 2NXYB 5DLMH 3SKOB 2X3CA 1NCDH 2QWPB 1NGXB 3FF8A 2HG5C 1U8HA 3FYEB 4JO4L 4OCLC 5I18L 3ZL1A 1LNQA 5D6DA 4PJFA 4ZFFA 5EU5B 4FFZH 2YXVA 4LF9O 1C9SA 3IJSA 5JPNA 2P48B 2IDCA 4AGMA 3LSSA 3RBZA 2G5BB 4ODVL 2NZ9D 1NCIA 4GZRB 2EKJA 2KQNA 3R8BB 4Z7OF 2BFGA 1OAXL 1RP3B 3N3EA 4OZGA 4ZYKA 2C26A 2YSUB 2FUQA 1NVPD 2IFGA 3L81A 5LCVL 5I6XB 4OY9A 1G9MH 1NPNA 3GHPA 1SY6A 3T0EB 1S9XA 3FU3A 3T2PA 1C8QA 3VI3F 3VGEA 5HFLA 3AGWA 3T6ZA 3BP5A 1ZHKA 3U2JA 4X9QA 4LEXL 3QYNA 3PF2A 3V7AG 3S96A 4AJYV 5AW4B 3ARFC 2I25N 1MG3C 1CLOH 5TF1H 3V8CA 4KZEH 3D85A 3TK1A 1A2YB 5T3ZL 1RK0B 1H8EG 3HC4L 4ZMLA 2W0FA 1BYPA 4MJIA 1U3JA 3WO3B 1GGIH 2F5BH 4PV9A 1JGVH 5B1KA 3P69A 5KHJA 2HJFA 3RILA 3TNNB 4GUPA 3IKCA 3UJTH 3BY6A 3RX7A 5DZAA 1DUYB 4MCYB 4ZBMA 4CDGC 3T3ME 1F3DJ 2X70A 3MRIA 4YLCA 5DJYA 5D7EA 3X12A 1SF3A 2YD3A 1RI8A 3VXRE 2XLLA 3DX6A 1HKFA 5C0DA 1NJ9B 1UOKA 3T8XB 2EDMA 2DQJH 4OXSA 1YEJH 4PTUA 4F37F 3U0PA 1GYCA 4IK6A 4JRXD 5EEYA 4Z3TA 4NBZB 3MRFA 4DSYA 4YXWG 1I9JH 1OAXH 2DQHH 4YK4B 4NR1A 3H4FA 5CSGA 2GCYB 2K7QA 3MBEA 3C2AH 4V2CB 4UTBL 1K9MW 5DJ2B 1KGWA 1EZSA 2X6VA 3EYQD 2WO2B 4QNPE 3RGVA 3ZX1A 4IBTA 3BHPA 5D5QA 4B3SO 4OU3A 2JKLA 4XVJH 5B8CA 3LXAA 4UTBH 3HKBA 3NSJA 4IU2B 4ZG1A 4J2QA 5CEXA 1X4ZA 2P5WE 1E8WA 4NYKA 1K6QL 2FL5B 3VDAA 5CEZD 5ESQA 4A7TA 3QIBD 4B6ZA 3HKDA 3DUSA 3P30L 1U3HD 4ETYA 3MREA 2CBMA 4Y5YB 1BYNA 1FNEA 2B1IA 5CP7B 5KMGA 3FO9B 4PP2B 5E95B 4PJFE 5KHKA 3MREB 4HU2A 1T5WA 3EJSA 1MI5D 4DR6O 1J5EB 1KB5A 4RSVA 4JRYE 2W5PA 3C90A 3VTAA 4BUGA 1F8TL 2JKXA 2O26U 4UM8B 4ZNCD 4UB0L 4X65B 2QM7A 4DK5A 1WAAF 4K3DH 2MCPL 1TVBA 1XT5A 4OF3A 5DHYB 5FV1L 3MGOB 5KX5B 3KJ6H 4JFPA 1WEJH 3IB4A 3ME0B 1CB4A 3B56A 4NQUA 1TZGL 3QJUB 4O02H 2GCYA 4PDRA 2H3KA 3MBEB 3CXHJ 2R9AA 3FDWA 4JQIH 2BM3A 1XGTA 5E6YA 1YEHH 3HCVA 4CUCA 5SV4A 1T03L 1G0XA 3F7QA 1MFEH 3FUIA 5LBVA 2IPKA 1R3LB 3NPSC 3LZPA 2OTPA 2F18A 3O9WB 2JRIA 5ITZB 1I1YA 3EDKA 1IO4C 3HR0A 3LNFA 4IYHA 5AAMA 3MAWA 3RVTC 3L5XH 3V4VA 2G9HA 3TXSA 4O4YH 2OIGA 4OJDH 3SGJA 1IFHH 1LP9A 3FC8A 3ZZQA 5DGRA 4XNYH 1YY9D 1V7ML 1ZHNA 1NGPH 2JEXA 1GA2A 1JPTH 5K33A 2C9AA 5DSCB 1F4NA 3CJHB 1VQMV 5JPMA 1J86A 1LDSA 3OKLA 1D5XB 2F53B 5FYKE 1SXCA 3IFNH 3PHQA 3WEAA 2ISDA 2AXHA 2IWGA 4NWTH 4NC1E 2PXYC 4KY2A 1RSOB 3WE6B 3OX8A 2ODMA 4XPTL 3FQUB 2V8MA 1RJLB 2YAMA 5FUCC 3CH1B 2HPTA 3FB5A 3O4LA 1D5NA 1U8CA 4AQAA 5EZYA 3C60B 3EG9B 4MKTA 5C93A 5C1MB 2DJ4A 1WVZA 1KCVL 5KAQF 2ZWYA 1QCEA 3EO9L 1O7DE 4ZYKB 5I0DA 3MNDA 1RZ7H 1YPZA 5HHXH 1F86A 1ZWIA 1QYGH 1TFHA 1ZTXL 4LLUA 2QVTA 3V4LA 1E3XA 1PKQE 4Y4HB 1CGTA 5ESAB 5KSAD 5A40E 1ZIAA 5L2KA 2Q5ZA 2LO1A 1BVKA 4G7RB 5EU3B 4NXNB 4OCWL 2UZIH 4EN3A 4NQSB 3BRFA 3EO0A 4QO1A 1AZRA 4F80A 5MI0B 2G2NA 3ZZ1A 1X7QB 5JHBA 1RZGB 3H0TB 2GW5A 1FF5A 4PJCA 1YG9A 4K35A 1KP2A 2JKRM 3DKHA 1MFDH 1MN4A 5FDWB 3QUZB 2KC0A 1NCBH 5EU3A 3ZTDC 2R56L 4TTGA 4YAQB 2D73A 1LVEA 2PYEA 3OXRA 4GLXA 1R0AH 3TCXA 3RTQB 4RFEA 4BFRA 5ABAA 1KGXA 2VDNH 2RD0A 4F24A 1SMDA 2OKMA 4W1TA 4BELD 3GLDA 1T0OA 2MH4A 5DEJA 1CT8B 4N6RA 3HMWL 3BZ4B 1M57B 3LKOA 4LE8A 4OZGE 1IC5H 5DI8A 4Z5RA 3WB1A 3NIDE 1YVWA 3JARA 4EI5B 3V0DA 1T83C 3FSOA 4I0PA 3ARFB 2WXFA 1QUNB 3AU1B 1DJGA 4U0RC 3ZXAC 4A6YH 2ESVB 4N1HB 2Q8BL 2I07A 5EO0A 4OB5L 1JDCA 3IXAA 4Z7VB 4M6OL 4UQ2A 5T1LA 2WYZA 1N0LA 1UASA 4N90E 2VR7A 1UXSB 1BOGB 3RYHA 2R51A 2ZAIA 4BCZA 5B38G 5JA9A 1U8JB 1WQVT 2FJFB 1LNUA 3MCLH 4I0PC 3RWIB 4OIBA 3V79C 4FLUA 2ARJQ 3M1BB 2X4UA 3MODL 1H2NA 4B9FA 2BSED 3CFJA 1B0GB 4FXGA 4P99A 2I27N 3BH4A 4U6XB 3HPLC 2D7MA 4X99A 5ECJE 4FGMA 2O61B 1IL1A 1HKLH 5IOPB 2YRBA 2YPVL 3P1VA 2OYMA 3VCLA 3CVHL 1O9VA 4G7SB 3D2UB 1HIML 1ZUQA 4NXSA 2UXCO 5CA1B 2AV7A 1PS3A 3T6WA 2V7HA 4AGQA 5I0ZA 1N59B 1FVEB 3SODB 5KYXA 2H2SD 2NUTB 3EYSL 2E9WA 4QGTA 1JFQH 1UM6L 3BH8A 5E9AA 2H1LM 3N42F 4F9LA 3RVYA 1FGNL 2F8IA 2O5ZL 3DI3B 3QRLA 4GJTB 4Q0XH 3SDYH 2VMDA 4Q9BA 4C56B 2DWYA 3HCVB 1QNIA 4HS6A 1H2SB 3BYYA 1H2GA 2BOLA 1SXSA 2ZX7A 1X5AA 5EU6A 2FJHA 2QFRA 1OWRM 2AJZA 1FZKB 3GMMB 4OI9A 4FHKA 1GK9A 1BZDA 4CU7A 1GIGH 1NCAL 2EVFA 4PLKC 5EUKB 3MLSL 4ZUSA 1MFUA 2H32H 1QZ1A 4LKXA 3LEYL 4MMYB 4WCYL 3AQZA 4ZZFA 3BPLC 4P57A 2Y5TB 1T04A 1CF8H 1XH3B 2IH1C 1QLFB 3ES6B 4U3CA 4ZFZB 5CHNB 4WO4A 4B3MB 4NM8H 1XNRB 3L5WB 4HU8A 1AD9B 4KVCL 5JLZB 2J8UF 1NVPB 4PB9H 2MOGA 1T5WB 4GG6E 4N68A 4NUGH 1MHEB 2XIBA 2ZSWA 4PN6A 3B9KC 5IB5A 4M62H 4J41A 4HWBH 1JV2A 1MIEL 1UVQB 4U1LA 1OAYL 4L3AA 5DQDL 1Q90D 4A37A 1WCBB 3NJGA 3SKJH 4F8NA 3TYFB 2Z4TA 1QHTA 2AK4A 3E2HC 5IGXH 5E2WH 4IU2A 5DD3H 2FSEA 3MO1B 3K57A 5DMGC 3GLAA 2XV6B 3C5JB 2NXYD 5E51A 5I1IL 4I4TA 1NAMA 4XNQB 1MJJB 4NQCE 5CS7A 1WA8A 4MA1C 1U8QA 1GKFA 3S36L 2ETWA 1QHQA 2V2WA 3WXWH 5C08D 1PX4A 3MXWH 4OJFH 1I7ZA 5EO9A 2WZ6A 3VFPB 5D4JA 1MHCA 5IMMB 1G9NL 3T0EE 5BY1A 2JQAA 5KJ4A 1IBDA 5JLZA 2EDQA 1S5IH 3U7WH 3QP3A 2VSKB 4Y19A 3B2PA 1WA2X 4P04A 3GRBA 1V7NL 4GG6B 2V2TA 2I5YH 4RNRA 2YD9A 3LNMB 3PGDA 2C9PA 5FGBC 3RU8H 3E22A 3I84A 5F7UA 3EW3B 1QFWL 5SX5H 2VQEB 1DUYA 2FWUA 4KHXL 4P9PA 3RN4A 4YUEL 3OF6A 4GKOA 1KWGA 1KYFA 3KJ4C 5BXFA 4TV9A 4OSUL 1BFSA 1HSAA 2AXWA 2G75A 4LSSH 5AD0A 4GXVL 1BHBA 5E1AA 1S7WA 3GSWB 4I3SL 4HHAB 4KTEL 3V4PA 4NLAA 3BH8B 4NO5A 3W5NA 2F7OA 5FPOA 5KYXB 1NGQH 4UB6Z 2AI0L 4OLVH 1FVEA 5GS0C 4IT5A 3C2AL 4PWIA 4Y8DC 2UWEA 4L4VD 1CJYA 3EJZC 2HMIC 2JS5A 2PPDA 5FYKH 4FI6A 3W7TA 3ILEA 3I3EA 1S9XB 1ICTA 2DLEA 2EEBA 1FXKC 4TT3G 5B3SB 2NXZC 3O0RH 4IMKA 3RDTD 4HLJA 3T0EA 4DP7X 4U1JB 4MRBA 1NAKH 2JH2A 1R5WB 2VW4A 3ZLQC 1E7UA 1LO4H 1RJZA 3HJEA 4N2EA 5IESL 4X66B 3WL9B 1PEWA 2VQTA 1DBKH 1TOXA 4FOMA 2PWGA 4WY7L 1F4YH 1N0LB 4PGEB 2JE8A 4X5XA 5T1LB 4BIOA 4LLDB 4PG9A 5BZXA 4O51A 4G2KA 4WAFA 4ZMZA 3DWTA 1TZIB 4PBXA 4HUVA 4X5WA 5A6LA 3EHBC 1UXMA 1Q0XH 2W65A 4OSUH 3ARFA 2X4SA 4NAMA 2QV2A 3MJ7A 5BRZB 4LF4B 2EEFA 3UO2A 3L3IA 5HI3D 3LSUA 1TO5A 2ZSVA 2X10A 1TTRA 4UVBA 1MWAH 4HJGA 4RMTA 4NEHB 3P30H 4AV0A 1FRGL 4IOIA 4IIQB 2A77H 1WAZA 4I9QA 2J3SA 4FD0A 3BUIA 3ECUA 5F9JB 1IBKB 4I0XA 3UO1L 2EDBA 5I1CL 4JANA 1G6RB 1EEYB 3MNVB 4YZWA 4BA8A 1B0RB 4RZKA 5JHDA 1P84F 1HE7A 3F5WA 5DURD 1GSMA 5HHNB 2XN1A 3WXVH 4LFAB 3QIWD 2VZVA 1K5QA 2Y7MA 1HN1A 4WTZA 5K9QI 1JPGB 4LL4A 3JAWB 2A6DB 4FLYA 2ICWI 4ODSH 3E7JA 1EFRG 1TJIH 1OF2A 4DV0O 4KTGA 1FJ1A 5KN5A 3T1YB 3N0AA 2YQ2A 1QR1B 3F01A 4ZUUB 3OGIB 1VPOL 1XMEB 4JG1L 3HNTL 3H9SE 1Y18B 3V6BR 3OAWA 4JLRB 4MVQA 2LABA 2YD0A 3PJNA 1X3DA 3QI9D 4JQVA 3SD5A 1T4KB 2PPCA 1JHKL 2UZYB 2CHNA 2B3IA 1GGCH 2YUVA 3IF1B 2Q9OA 1IM9B 1YUKB 4J7RA 1QSFA 1X5ZA 2FYUH 2XHNA 3HBGA 1CD0A 3L70H 2NZ1A 5ITFB 4QOKE 4UIMB 1FVDB 4G70B 4WQOA 3K5RA 1FG2B 3BKCH 2Q1EA 1TVHA 5T5NF 3TO4C 2BMKA 2P45B 4Y9BA 1G43A 4EOWH 1UM5H 1EFXA 2NNAB 1EGJA 1U8CB 2CBQA 3GIZH 3IAQA 3MRDB 1W72H 4JRFA 3FB5B 1E8YA 3QPXL 2DWEC 3FW6A 3RB7A 4CA4A 5MENB 1LEGB 2C1PA 3NJHA 3AT8A 5BV7L 5K1PA 3ZTNH 3BZFB 1NGYA 3IDYC 4R8WH 1QBBA 4B5ZA 5I1LA 1LUVA 1IGCH 2ADIA 5B1JA 3K81A 4R0LC 3R7QA 5LOVB 1NT2B 4R3SB 5DA0B 1XGYL 4N2NA 4HXAH 1T7YA 1BZ7A 3L3OA 3KM1A 1VEMA 2ZKHH 5D2NE 5IVNA 5GHWH 1IE5A 2EYSA 4YSDA 1YNKH 3D33A 2FYYB 2XXMB 4BK5C 4IBSA 5D7IB 1WG3A 4K07A 1DQLL 4XDJA 2WKLA 2BCCH 1X59A 4AE0A 1FFPB 4LB8A 4N26A 4DO6A 2KZKA 1DJWA 3ZTEA 1N19A 2JQMA 3EGSB 3MV11 5FKAA 5KBLA 4FMTA 2YD7A 3ZE2B 1EEQA 5D5MF 2EJ7A 3K72B 2DI9A 2BVPB 1WBXB 3BZEA 1CBVL 5M95B 4KU1A 5BQ7A 4A2HA 4XP4L 5E8OA 3RWCB 3BGFC 1XNQO 1P4LA 2WLIA 5D1ZC 3O3UN 3V0VA 1MHHA 3CCHA 3OR6C 1TJHH 1YPZF 4DK6A 1UQSB 2YWZA 1LQBC 2EDJA 2JB6A 4M43L 4JHWL 4WW1A 3SKMB 1AO7E 3PDGA 2EZOA 2J6EA 4WU5A 5I2IA 4YEEA 1GS8A 4FEIA 4JZJA 5D7JC 3A2FA 3VYPA 4KJWD 3VI3B 1I5XA 5D1ZI 4MT8A 2VXUL 5I71B 4NKMB 5AKTA 4LAQL 4IU3B 4UNVA 2OMZA 1XCTA 4CC4C 1FNEB 1S5LZ 1DFBL 2B9ZA 4KNSA 2GEEA 3QNZA 5ESQB 3JSNA 3RFZB 3GTNA 4Y5XA 3RY4A 1FSKB 2JJTC 2OX5A 1LE5A 1F02I 2CRIA 2BTQB 1BQ0A 3WKMH 2CRYA 4JGMA 3P3TA 4TSCL 5C0GA 4AV4A 5FM4A 4KO5A 5J8OA 5EYPB 4N5ED 4G5ZH 5LWYL 1DK1A 1SM3L 1BPLB 1IILE 3CVHH 1OTUD 4HPHA 3BVTA 2H41A 1HNXO 3ARFD 1A3LH 2WVUA 4M3HA 1NL0L 4AQAB 2FD6L 1ZX3A 3TGXA 1JK9B 1CMOA 5C09B 4PLJD 3C87A 2EIZA 3QWRA 5DJ2A 3HTLX 1YSCA 3VXOA 2VN6A 5K9OA 3DSFH 2ZTBA 1HWWA 4KJPD 2LAGB 1PZ3A 3BGFB 1OD9A 4JY6A 3UG5A 3ZDZF 1RSYA 4PTUB 2TRYA 4HD5A 3MJ6A 4ZOLA 3T8XA 5C0DB 3IGUA 1N6VA 3JWNG 4G9DB 3GJFK 5CJBA 4Y16D 2HHHB 1S3RA 1SLUA 1N8RW 3BRCA 5HYJB 2EEXA 2CGRH 4KFZC 2D7QA 4WWOA 5IBLC 5BOZG 3TPUB 2VSMB 1JDDA 4BXVA 4RVBA 4UQIM 3ARBB 4A6YL 4ABQA 3WMSA 2PYEE 1F97A 2V8LA 2YEVA 3DRQA 3GBDA 1QVGU 3ZRVA 3TV8A 4LLAA 5I30H 4YHOL 4XOAA 3JCUZ 2OL3L 5IB2A 1K4DB 2VDNL 1B3IA 4GB9A 1F13A 4DPBX 3V6ZA 2YBGA 3C6EA 3C8KA 3G5WA 4HA1A 4HPOH 1HZHL 2YUZA 3F58H 2MK3A 2LAAA 4P4KB 3VQLA 4U2ZA 4S1DD 1VFAB 1KCBA 4ZMXA 2AGJL 3RIFK 4R2GB 4W9EC 4D9QE 1K7DA 2VLKA 5H94A 2VRZA 4CVZA 4JI5O 1OB1B 4S0TD 3BRDA 1ID5I 2A83B 3X1BA 5CA0A 4FQJH 3VFWB 3IGFA 5MERB 5HXMA 5IHLB 1NPUA 2JK5B 3EXJA 2PPFA 4QWWD 1Z0MA 3LKSA 1V54B 4OF5A 4GFTB 3SPIA 4EO5A 3QGVA 3TJTA 3O6KH 2Q69A 4AKOA 2IBZH 3LB6D 4M3KB 1IQDA 5EU5A 1GAFH 2ADGA 2OYLA 3RVWC 2E76B 2OL3H 3ZHLA 3JQOB 2IFFL 1HSBA 2PI5A 2E76C 4WHDA 2D7TL 3EYUH 1KTJA 2YIBA 3IKKA 4K7PY 5F9WB 1WP8A 4HMCA 3TVMB 4AL8H 4BK4A 2XXGA 4HAGA 4EUPH 3FTVA 1AGBA 2AXGB 4OLXL 1CGWA 4DP2X 3MBWB 2L4OA 4IBQA 5DUMH 1T1YB 3HPJB 5ALBH 4XO8A 3OM3B 4LIQH 2DOSA 2YN5A 4NQXB 3U6XS 1QVOA 4MSWB 3AS0A 1HNYA 3LS5H 4MD0B 3ZSTA 4DRXA 4QRTB 1CFSA 4NIKB 4JTCB 3L16A 3FT2B 4RIRA 4E9SA 2IJ0C 2NR6D 2HVKB 2XYBA 2Q8AL 4R4FL 1D5AA 2HT2D 3CNKA 3LQZB 3N41B 1ZVSB 4OZHA 4G8FA 2D0GA 4NHUA 3GPSA 4PMEA 1WWBX 4GG8A 1DP0A 1TA8A 1V7MH 3C9NA 2E9IA 4GKKO 1Z7JA 2JCCA 1QBML 4XN8A 3QFGA 5D1XD 2ZYRA 5F0JB 4KWUA 1EN4A 3NABL 3GB7B 1KXQE 2DV6A 3NN8A 1KENH 5D2LF 3L3HB 2D4FA 5F72S 4XCEB 2DIEA 3N43F 2EICA 3HPJA 2HHHO 3JWDL 3O3AA 4TSBL 5G4NA 5MEQB 3QQ9C 3WS3B 2J1KA 2O5YH 6PCYA 4U1GB 2BC4B 1LEIB 1AGBB 1DQVA 4U6VH 2EDYA 4H25A 4LWSA 5IW3A 5IEKA 1H2LA 2FX7L 3N40P 3G04A 5CIPH 5E6IB 3ZIMA 5H4ZA 2EJRA 1INDL 2OSYA 3S37L 3SGEH 4KKCD 4CC5A 4YDVB 2WXGA 2PZSA 2GIYA 2AJXH 4G1EB 2ZUVA 3MBXL 3Q2WA 5D7JD 3RVXD 3WY4A 4OLUL 5D7KE 2JJVA 1MOEA 1ROCA 4P59H 2GJPA 2OMXA 1MJ7H 1UT1A 1ND0B 1DN0A 1RIHL 3BPCB 3O0LA 5BOJA 5GPRA 1NC2B 4E9QA 4K3AA 2A83A 4WEEA 4D7PA 3UO1H 3AK1A 1MJ7L 2VLJB 3JTBA 2XWEA 1CDBA 1W8EA 4YXLL 3NCJL 1RD6A 1OAQL 2NUPA 4W68A 1VACB 3QNFA 4G43B 1IBBA 4LSQL 4HP5A 4V11A 1ZLZA 1P7QA 1YAIA 4HF5L 2UXGA 2AKRA 3PABB 4OBRA 4DP9X 3DV4A 4J9YB 4FQCH 2GEQA 2Z64C 1VQKV 4DKDC 3RYFB 3GMRA 3ZHFA 3UBXB 1SXZA 2H0EA 4H13C 1HHKA 2H45A 3D2TA 5I6KA 3RZCA 1T22B 3N2GB 5CZXD 1P49A 2D31B 3W9EB 4PJAE 2ZAHA 4KXDA 3FQNA 3CC5A 2DYPD 2BDNL 1JTPA 2UUBO 5IJKA 3ARBA 3LIZA 2HSIA 4N24A 4RESB 1NMAL 1I8IA 1TJXA 1XH0A 4G6FB 4MWFB 4NZRH 1V3JA 3CLEL 3DOHA 2YPLB 4ZUWA 3FB8B 4MA8H 4J80A 3B83A 2YD1A 3QORC 4YXHH 5C07E 3KNBB 1CE1H 1MG1A 4J2XA 1UYWH 3VMPA 1BVOA 4I4WB 3GF8A 4Z9KB 2JKJA 3G6JE 4JPQA 2WNWA 5KG9B 4KK5D 2ESVE 3CIQA 1XF3B 4M4RB 3IK2A 1G84A 4AM0B 1F3JA 1G6UA 3X3FL 5K9OB 2K6YA 3QVAA 4TUKL 1UGKA 2P06A 2BDNH 3S3CB 3V5KB 1NEZB 2X9XA 4RMWA 5D6DC 3O45A 3ULSA 1Q9LB 5HHOE 2DH3A 5BV7B 2CLRA 4PUBH 5DFVD 2HLFC 2Q76B 3DOIA 4PAZA 1P5VB 2Z35B 3E8VA 3GRWH 1M1KW 3DVGA 5ID0A 1JYVA 4LOUD 4OZ4B 4QXGL 4Y4HD 4X4YB 4C4KT 1XCQA 2E7HA 4HJ0C 2WN3A 3IDXH 1WCQA 1M90W 5DVOA 3WEOA 1I4FA 4NLHA 2V33A 4AKPA 4BFJA 1LO5A 2V7QG 4PI0A 3EFFA 3W7WA 1KYDA 2PF4E 2ZUSA 3F04A 4XWGL 2D03L 5HGDB 4ZW7A 4HUUB 4ENED 3AW5A 3CDGA 5AVSB 2PW2B 3CVIL 4Y4KB 3F7VA 4IDLA 1CL7I 2EIBA 4GKSA 4M7ZB 2ILMA 3IS1X 4QHKI 5A2AA 4KGLA 1P7GA 1M6OB 4N2HA 2F54E 2Y4UA 3WAJA 4ZFGL 3FTSA 4UMGA 1WZ1H 4PVBA 7TAAA 3ZE2E 3DRTB 2CGOA 4TVPH 5B3JE 3AY4C 4YC2B 4FXKC 4UOJA 3G9VA 1CDCA 3TL5A 2IDSA 1U2HA 3V0WL 2BE3A 2PKDA 4ZFOL 1C8PA 5E4IA 2XTSA 4QHNB 1Z5YD 3UAAA 2O57A 2W60A 4FFWD 2A06H 4FJYA 1FN4A 2WM0A 4PJEA 4YZFF 4Z7NF 3L17A 1OZ0A 3TESA 3T4YA 3K5SA 1KXQA 4PJ5A 5C0RH 1PJ9A 3L3GA 1PLGL 5IY5C 4DR4B 3VOUA 2XBZA 3OPUA 3ZR6A 1FHNA 1J1OL 2YZ1A 2ZYIA 3V52L 1IEAA 3JZ7A 2QGBA 4L3ED 3VWKA 3M8AA 3L3OB 4K0OA 3PDDA 3TFKD 4MJ2A 3MOQA 3SJVA 4NOFA 4DO5A 4FLTA 4ZO8A 1CPYA 1SYVA 4XI5D 5CZKA 4NFBA 5EIIG 2UZXA 4WGVB 1E4XL 3EHBB 1MAKA 3MLTA 4UQ9A 3CRRA 1AR1C 4WI0A 1AZZC 1E4KC 1VADB 4NDMA 4JM2C 3TBWA 2CTPA 4N1CA 3UBFA 5MENA 3OSKA 1A1MB 2R0ZL 2KUTA 3KCPB 1EEZA 1VJSA 4RRPM 1XQ8A 1NCTA 2FJSA 5D72H 3H1KH 1L6XA 3B40A 3D18A 5CWSB 3EOTL 2D9CA 4HQQL 1A4KA 3NCBB 1KNOA 4TSCH 1HCZA 5A2LH 1IM9A 1NU1H 1MCIA 2C4FU 2NW2A 3FCBA 4GOSA 4Z7WF 3A47A 1T4KA 4U3JA 1O75A 4ALAL 4GT1A 1F6FB 2EEAA 4IRSB 3LN9A 1Y18A 2I5YL 3RNQB 3ET9F 2DQTL 1HNWO 4GXUM 1M9NA 1IBFA 4XX1E 4Q20A 1KPVA 5AG9A 2YC0A 1I7TB 1MRDH 4YIOA 2UY6A 4MNQE 1X4YA 4QRPA 3MROB 4IRSC 1NBYB 2OTUA 4I5BA 4AMWA 2WP3T 4ZNEE 3TJPA 4I1PA 3ZQWA 4H8HA 5DJ6B 5AVVB 3QEQD 3DXAD 4HXBH 4PJHA 43C9A 4YSSA 4XMKL 4NRZB 1AIZA 4DV1O 1SQXH 2BNUB 3QYCA 4GAGH 4PVNA 5C7ZA 1OGAB 1IC1A 2WAMA 4NN7C 1K33A 4Z7QF 2CKBA 2EE3A 2YK1H 5GGSY 2H1PH 2W6JG 1QRND 2GV9A 4L5FL 4OFVA 3Q6GL 4JREB 3FSZA 3TONA 3U30C 1TNNA 3UCRA 4N2LA 4NYLB 2HJLA 1MREH 3D52A 4JM2B 5FCUH 4NKIH 1LO3L 4Z1PA 1X5FA 3QCTL 5C0IB 4PJ0Z 1CTNA 3NJLA 5BRZA 3WHE0 2RAMA 3NIDF 1DL7L 1RUKL 1U3NA 3S9DB 3S34L 3OHMB 1GH6A 3AXLB 1CO1A 2C3VB 4JYYA 1EXGA 5HDLA 5I8KH 3E3QE 3HMXL 5I24A 3GXMA 2BSTB 1EO5A 1U0QA 3T3MB 3JALA 1DFXA 2PTUA 2VN7A 2XTLA 1PNCA 4J3XA 4PBWD 4R26L 1HNZB 4CH3A 4NI6A 3VXRB 5IY5B 3QEQA 5DWUH 4HF5H 2F1MA 2PYFB 2IV8A 2OT5A 2PNDA 3FXIC 4MS6A 3QI9B 5DD1H 5T5FH 3M07A 1TUEB 5B1AB 3UJJH 1KU9A 2V6HA 4Q6YA 4YFEA 4LFBO 4G28B 2WVSA 3MUGB 5DMKA 5DRWB 4XN5A 2QM8A 4XPAL 3MFGB 2BHYA 5BVJB 3WB0A 4XP1L 3FBQA 3FH5A 2N0KA 3REVA 4IBLT 4MQXC 2FL4A 2EP6A 4TNEA 4TQHA 1T20B 5SWZA 1IVTA 1J11A 4YDZA 2B2XH 3G5YB 4JKNA 2FEDC 3I56V 1SMAA 4GX5A 3BVWA 2EILB 4MD4B 5EBGA 3HZYB 1KCUL 2V5RA 3KPNA 3HS8A 5KBNC 4PJ5D 1GN4A 4JZNA 2AQSA 4JDTL 3TJHC 3W57A 4LCWE 4HJSA 1P5UA 4Y9CA 2OCJA 3KG5A 1ACZA 3CRMA 1LK3L 4FNRA 4NQEE 4MXWH 3SE6A 5LMNB 4G6AD 4XPGH 2NX5B 4GO9A 5T5FL 1F6AA 3FFCD 4XBFA 3QULA 3FCUB 3IRPX 1CXZB 3ZVVA 4KXZI 4ETQB 2IH3A 3L3DB 4FZ0A 2V9TA 3EFOA 3RY6C 1AR5A 3MRNA 5A2FA 4PVMA 4X7TA 1U92A 2KZWA 4FK5C 5EC1C 2XZCH 2ZT9C 5E9NA 2CUAA 3WJJA 3LQAC 5D7IF 4X5RA 1KIUB 25C8H 3IWUA 1Y6NR 4OQ1A 5I82A 2TAAA 3SO3C 1GH7A 2WXIA 2J71A 3MA7A 5FECB 1YNKL 5MEPB 4H88L 2G3XA 4G8EA 3WG7B 2PYLA 2P1YA 5B1AC 4FXKB 4BBWA 1CLYH 4KOBA 2NCEA 4X4XB 5K69A 5AOKA 4NQDD 4C4BA