2EINB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2einB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2einB02
2HX8A 2X88A 2JFCA 1AR1B 1ILUA 2YXVA 5AZUA 3FS9A 3T6XA 5EHFA 1ET7A 1DZ0A 2GSMB 4W9ZA 4E9XA 4MFHA 2P80D 7PCYA 3OQRA 4JKNA 1SJMA 5AKRA 1N68A 3AG4B 2DYRB 3N55A 3CG8A 2HX7A 1NPJA 2CBPA 1PF3A 2MTAA 6PCYA 4M3HA 5A7EA 1ZIAA 1VLXA 1EZLA 1SNRA 5I6MA 2WSDA 2UX6A 2JKWA 3PAVA 1SDDB 4X4KA 1X9UA 4YSUA 1GY2A 3HEIB 2WO2B 2PPCA 1BEXA 3NSFA 1UATA 2BP8A 1JVOA 5D4HA 3BQVA 4BXSV 4F2FA 4KNSA 3NJHA 3IE9A 1E5YA 5LDUA 3FQ1A 2IWKA 4HHWA 1GS8A 4HCFA 3V9EA 3FYIB 1AG6A 1JXGA 2BWDA 3NT0A 5TK4A 1SHXA 5I6LA 3D12B 2AVFA 3PPSA 2XYBA 4NERA 4E9RA 3H4FA 1KCBA 2MRYA 4A66A 1PCSA 1FFTB 2FWLB 1NIDA 4KO9A 2YXWA 4YSRA 2YARA 3TASA 4M4RB 2N0MA 1KV7A 3C75A 3QPKA 4DPAX 5TK2A 2EIMB 2W8CA 1ZDSA 2QT6A 1ET8A 4P5RA 2CCWA 2DV6A 1M57B 2Y1AA 1GS7A 3SBRA 2ZXWB 3X1NA 4DP4X 2B3IA 1ASPA 1CURA 3FT0A 1B3IA 2Q9OA 2XLLA 2HRGA 2XX0A 3FSVA 3KW8A 4BWTA 1L9OA 3CVDA 3FSZA 2ZONA 4AKOA 1BYOA 4E9QA 5B1KA 2OCCB 2HRHA 1NIBA 5I6OA 2IH9A 3OD3A 4DP5X 4KOBA 4A2FA 5I6PA 1KGYE 1WA2X 1L9TA 3TBBA 1L9RA 1IC0A 5PCYA 3AW5A 1OCZB 1CUOA 4JHUA 3UAAA 1ETJA 3PCYA 4WTQA 3SBPA 2VMJA 2GI0A 1BXAA 3AZUA 2I7OA 2CUAA 4F2EA 1NIFA 2E86A 2PP9A 4GYBA 1KYAA 3FU8A 2TSBA 2GIMA 3ABMB 2R7EA 3ASOB 1PLBA 3GDCA 4GP4B 1V55B 5I6NA 4FAAB 1BAWA 5AFAA 2HX9A 1I53A 3DIVA 3ABKB 1L9SA 1BXVA 1KBVA 2Y69B 4G7SB 3X1BA 2IDTA 2EINB 2FT8A 4TXVB 4HAKA 1QHQA 1J5CA 3OMAB 3CDZA 2PP7A 3QJQB 2FTAA 4G70B 1T5KA 2RACA 2FQDA 1W6WA 2PPDA 1EHKB 1QLEB 1KBWA 1JZIA 1AIZA 5ANHA 2J55A 3EHBB 2CALA 3ERXA 3UADA 3ZIYA 1A65A 1XMEB 2W88A 4RH4A 2BP8B 1A4AA 1AZUA 1PLAA 2IDQA 2EILB 1A3ZA 3EH4B 1AZRA 2YEVB 2AANA 4YSCA 1NDTA 3BVDB 1X9RA 2YAFA 2XUWA 1RCYA 1JXDA 4YSQA 1IUZA 4DP8X 5F7BA 6PAZA 1QNIA 2P80A 3H4HA 4DP2X 4KNUA 2XV2A 2XXGA 4EF3A 4HCIA 1GSKA 4GXFA 1F56A 3H56A 1AQ8A 1TU2A 2CJ3A 3MX0B 3FYEB 3DKHA 3NJMA 4YSOA 3WIAA 1AS6A 4E9WA 3JTBA 1SFHA 4E9TA 1PAZA 3WNIA 4KOCA 4BWUA 3NJLA 4AKPA 1KDJA 1ZDQA 2J57A 2XVBA 3WNJA 2YAPA 2HXAA 2BO0A 1YLBB 3OMNB 1PZAA 4HIPA 2VW4A 1A8ZA 4CSPA 2DWTA 2YAEA 1ET5A 3L45A 2UXFA 1BQRA 4KNTA 3ASNB 1JZJA 1WA0X 3JT2A 2BWIA 4BDVA 1SF5A 1WS7A 4A2GA 3NP3A 2QPDB 2EIKB 4QKTA 5B7FA 3NJJA 4GP8B 3AG1B 4A2DA 3ABGA 4G71B 4YSPA 1E5ZA 1AS8A 1RZQA 4E9SA 1JZFA 3PAZA 3CVBA 3T71A 1FA4A 5I28A 2VW6A 2VN3A 1PMYA 4DP1X 9PCYA 2J5WA 4CSZA 5F7AA 2AZUA 3FPYA 3NSDA 4N4YB 4FA7B 3IEAA 2IDUA 1NTDA 2JXMA 1XB3A 5B1BB 1WA1X 3PLYA 1AZBA 3UABA 2BP0A 1JERA 3NP4A 3EH3B 3NJFA 3S3DB 2J56A 5I26A 1J9SA 4BXVA 4W1TA 1OCCB 1J9QA 3NSYA 2YAHA 1M9WA 1XB6A 3WKQA 3OM3B 3EF4A 2GBAA 4K9JA 5IY5B 3G5WA 4ZK8A 1PNDA 2IDFA 4BK5C 3QJSB 4AX3A 1JOIA 5D4IA 3CDZB 4HZ1A 4YSTA 1AZNA 2VSMB 2CAKA 3IN0A 4AKQA 1IBZA 3QJTB 1J9TA 1N70A 2FJSA 1OE1A 7PAZA 2GHZA 2TSAA 1NPNA 4AI7A 2PP8A 1GS6X 1XB8A 1NWOA 2IAAC 2QPEB 2HLEB 4HCGA 4YVNA 2ZWNA 2YAOA 1RZPA 1IBYA 2EIJB 1GYCA 3S3BB 1AG0A 3FSWA 1BXUA 3DTUB 3EH5B 1TEFA 4DPCX 3GYRA 1PZCA 2H5UA 5I6KA 4UF7C 2XX1A 5B1AB 4QLWA 1BYPA 2PPFA 4KO5A 2IH8A 1RKRA 3WG7B 2I85A 1JXFA 4A68A 1OCRB 1V10A 3V9CA 4GP5B 4JHVA 4HHGA 5B7EA 2XXFA 3ZDWA 3KW7A 3MBWB 3TBCA 4G72B 3UGEA 4YSEA 1E67A 1OV8A 3U25A 2BZCA 4HALA 2PCYA 5B3SB 5I5JA 3ZBMA 5D4JA 2H3XC 1JZEA 2GC4C 4ENZA 2FT6A 3FSAA 4UANA 1J5DA 2FQGA 2UXGA 2NRDA 1L9QA 1PZBA 2YAMA 3NYKA 3N2JA 4PCYA 1MZZA 1URIA 5PAZA 4DP7X 4GY4A 3ZX1A 2QDVA 1HAUA 1HAWA 1AACA 1CYXA 2ZOOA 2FT7A 3S8FB 4BDVB 5FC9A 1AANA 1NWPA 1KCWA 1ID2A 2DWSA 5B1JC 2VSKB 5I5IA 1R1CA 2YAQA 2GC7C 2H47C 4DP9X 3S3CB 1FWXA 1GR7A 4WKXA 5B1JA 5I5MA 3AG3B 1OE2A 4NAJA 1NZRA 3CVCA 3QQXA 3UACA 2BHFA 1WAEA 1E65A 3SQRA 4YSDA 2PCFA 4BWWA 2BP0B 2XV3A 1MZYA 3FPXA 3NJKA 4YVUA 2I7SA 3QJRB 1BQ5A 1ASQA 1NIAA 1CC3A 1SF3A 2FQFA 3FU7A 2BW5A 1JVLA 2GB2A 2IWFA 3GXUB 4Q89A 3FQ2A 4AZUA 3PXLA 1NIEA 4A2HA 3IN2A 1M56B 2DYSB 1GY1A 1AS7A 2PPAA 3WI9A 2UX7A 3X1EA 4G7RB 1PNCA 2VW7A 1JZGA 1NICA 4DPBX 4L0PB 3SBQA 1OE3A 2UXTA 2AFNA 2DY2A 3TU6A 2XWZA 4P5SA 1J9RA 3RYMA 2A3TA 2R7EB 1ASOA 3OMIB 1ZPUA 1KDIA 2B08A 2AZAA 1JZHA 4Q8BA 1HFUA 1ILSA 3AG2B 1SDDA 1PLCA 1MG2C 4N8UA 2BW4A 4E9VA 1L9PA 1W6LA 4KO7A 1BQKA 1WS8A 3QJVB 5B7MA 3IBOA 2VM3A 4E9YA 1ZV2A 4UAHA 2X87A 1IKOP 1TEGA 2QDWA 3NJNA 3UAEA 2XV0A 1ADWA 3FU9A 3AY2A 1CYWA 2UXVA 3X2QB 5E9NA 3T9WA 3NJIA 1E30A 3X1FA 3T6ZA 3ABLB 4F7KA 4NB7A 2XU9A 1AAJA 1NINA 1DYZA 4PAZA 1ZIBA 1PY0A 4KO6A 2PLTA 1A4CA 1SHWA 4A2EA 2PPEA 4A67A 3S8GB 2LLNA 1AZCA 1AOZA 3HB3B 2WO3B 1V54B 2FNWA 3NJGA 2VM4A 8PAZA 1A4BA 3QJUB 4YSSA 3WKPA 4DP0X 3TA4D 2BZ7A 2OJ1A 2OV0A 1OF0A 1OCOB 2IWEA 2FQEA 3FQYA 4G7QB 3NSCA 1TKWA 2Q5BA 4YL4A 3CZUB 1GW0A 2YQBA 1MG3C 3T6VA 4YSAA 1MDAA 1SFDA 3FU7B 3T6WA 2IDSA 3PAUA 4DP6X 1OOWA 3X1GA 2HZHA 1W8EA
chains in the Genus database with same CATH superfamily
5D1QC 4PS7A 3FQNA 3SO3C 4HUCA 4YNYB 1A7BA 3Q3GA 4JPKL 1KTRL 3CX5J 3Q4HB 1EAQA 1S46A 2WWOA 4PS8A 4LF4O 2ZE5A 1FJ1A 1P7KB 2LVEA 3GSXB 3GXPA 2PCPA 4OCNC 4HC1H 5KVGL 3HKEA 2RJZA 1TNNA 2IMNA 2P80D 2WIIA 3BAEL 5F3HA 4TNGA 1A3RL 3C09C 4N85A 4XXCC 3S37H 5AYUL 1DHKA 3IXTA 2ENQA 4FNUA 3KVQA 1F3JB 5HGBB 5IB5A 2KUTA 3CRMA 2HKFL 2P22C 5GTHZ 2E74C 5F1NA 2AV7B 1I3GL 2MTAA 1MY5A 2Y1ZA 4JRYE 4JRFA 5F1KC 4EIBA 1SNRA 4KV5E 3UGUA 2I5YH 2YD1A 3COOA 3MNZB 1FQ9C 1OGTA 4R0LC 3I3EA 2OK0H 3SYOA 4RIRB 2YO3A 2EDNA 2V7HB 4DK6A 5EBLA 3NCJL 3EADA 5D1ZI 4TSBL 1NCNA 4NC1C 3US1A 2Y7SA 4PRHA 4JI1O 1K8AW 1LWJA 2CDFA 1U93B 4J8RA 2AGJL 2VKXA 1WUNT 1SDAB 3R06A 3GZPA 5H6RA 3V4UL 2PO6B 4N0UB 3OAWA 1CDJA 4HCRL 5DECA 3AG4C 1JXGA 2RH0A 4M4PA 3WB1A 1LXMA 3OUSA 1HCYA 3RYHA 4C59B 2LFGA 4JLRA 3H9HB 4KHPB 5I6LA 2F68X 2EDBA 1HEJC 4WFGE 1P53A 3OR6B 4HKJA 1XGRA 3ZGIA 3K6DA 2HJLB 4MNQD 2APBA 1CE6A 5LYJB 2YXWA 3CRRA 4B0MB 2Q1EA 3QORC 1CDGA 4JANB 4E42A 5F9WC 5LB1A 3EFDL 3E8BA 4W4NA 3UTZB 4F7PA 4PJ5B 1Y76B 4O4JA 2W8CA 1YJNV 5JHAA 4DWHA 1MI5A 3HAEG 1GIGH 3L4XA 1GS7A 1GSMA 4M6AA 3IT8D 4RFOL 2B3IA 2DWDA 3GI9L 4CJ1A 5JYLA 1WCBB 3ZTDC 5CA3A 3US9A 5ACZA 2MCG1 1U8QB 4NJ9L 4XNQB 4DK5A 4ELMB 3PWUB 3U1PA 4GQ9L 4TUYB 3AM8A 5CMAA 1FZKA 1E6JH 3C6EA 2WA3A 2D03H 1OAUH 4NKOB 2ZIMA 1KUMA 3MRGA 1LWRA 4JW3A 5F9DC 4BV1A 5HGHB 3PJNA 5EU4B 1XR9B 4HWNA 5GRWA 1CFTB 2YMXL 3BUBA 1QVFU 2YPVA 2NY5H 2E5LB 1JK8B 2MQ3A 1REIA 2IH9A 4JO1L 2H0JA 4ZW3A 5L4JA 2D3LA 2ICES 4G6MH 2WIMA 1NGZA 4P3CH 1M2VA 2VB5A 3SGJA 4RSVA 4WTQA 4FMTA 1HOEA 2VLJE 3FQ4A 3P40A 4ZTPL 4OPHA 4N87A 1WBZA 3NQKA 3JD2A 1NEPA 1PJ9A 1VFAB 2X7LA 4LEOB 1CI3M 4BE5A 2DYPD 3PGFH 2YDEA 1TQBB 4DH2A 2EVHA 2MNWA 1H3TA 4QF1B 3MCYA 2EDRA 1N8RW 3VXMA 2AEPH 1QWUA 3I6KB 5D2NE 3ZL2A 3E8HA 3HR5B 3WEAA 1P5VB 2YC1A 3TLRA 2J1WA 3KPMA 4OQTL 2QJDA 4Q9RH 2OXGA 1I85C 5FB8A 1ZVYA 5DHVA 4JJHA 3H2QA 1NBYB 4XBPA 2WVTA 3L7FB 2EXWC 3LH9A 4PGCA 4EN3A 2ZT9C 4JFOA 5I8EA 2EACA 5CEXA 4MS2A 2AQQA 4XBEL 3L3IA 5CO1A 3RNQB 1ZLSH 2Y4UA 2ICWB 4C83B 1MFMA 4GKZA 2QZQA 2JWYA 3MLYL 4OT1L 1BFOA 2UXNA 1SN0A 4N8VA 4J9YB 3NUKA 2VQEB 3NCEB 1HX0A 2Y6SC 4FABL 1LP9F 4JDEB 3K81A 5D71H 2YK1H 4MQ7B 3QIUD 1V55C 2FIRT 1H9VA 4A7QA 4AGQA 1VQOV 3GSRA 3BDYL 1AXSB 2VXVH 1DEEB 3IBEA 3EH4B 4O2CB 3FUJA 5I1JL 4TSFG 2ZOKA 4Y5XB 4XHJD 2EQDA 3F5WB 4NUMA 2DMCA 5JR1H 4JYYA 4PPTA 5GRZA 3CCEV 5F7BA 3IS0X 5EDSA 3QDJD 3B09A 3WE6A 3NZHH 2XXGA 3J2PA 1VQ5V 3HB3D 3KWXA 2AEQL 4GXFA 4JFFE 5DRWB 3ULSA 4EF3A 4N8VG 5TPWL 4OLUH 2AAAA 5KHJA 3WLWC 1YEDB 4WKZA 1RZGB 1F11B 1F02I 1XNQB 2VCOA 3WD5H 5ENWB 5C0AE 3UYOD 4WBNA 1FDLL 4ATWA 5B38G 2ZIOA 4PJXF 5F44A 1U0QA 1VCAA 1DUZB 3PL6A 3Q8EA 4U6VL 5LCVH 3KGTA 1QHOA 2BTQB 4D3CH 3B9EA 1AMYA 3GFUA 1YEEL 1F90L 4WDIA 1KGIA 2UZIH 3ZE2E 3ZRFC 4N2FA 2XPYA 4AYDC 4J7KA 2PR4L 4GRWH 2ZYIA 2YAEA 35C8L 3B56A 3SODB 3L45A 4PYHA 1WGVA 1YEKL 1T0MB 4LSPH 2P5EE 3V6FA 3D7PA 5FLUA 3RY6C 2QPDB 2DKMA 1GKOA 4JZNA 3EJPA 3AG1B 1A14H 2D2CB 1MAML 3HS8A 1A0QH 1SS3A 1AS8A 1N8OE 3O9WA 4AM0A 1CICC 1MH5A 3OJDA 3S88L 1EM1A 1N36B 4QWWD 4HEME 2QTEA 2NUPA 4AQ8C 2RIKA 3UMNA 4JPWL 5K59E 4GRLD 2W38A 1JZ8A 3C8DA 4PJIF 1G9MC 3FPYA 4WJ5B 4PV8A 2VISA 2OT5A 4JQIA 4CC6A 4NT6A 4JN1H 2PZSA 4DV6O 2A4ZA 2BM3A 2GCYB 2H0EA 4EN2A 1DQVA 2EKSA 3CXFA 3IFPB 5FGBA 4WF9V 4ZT1A 5AKVA 3HG1E 1UB6B 2AQRA 4WUUA 4FQHB 2P5WA 4HJJL 4R90H 3WNMA 3LN4A 5IY5B 2W9DH 4ADIA 5DLML 3WTSA 1ZT4B 2DYSC 1MJJB 1U91A 4R7XA 3D1MC 5FCUH 1T03H 3KZ8A 2CUIA 3W11D 4HKBA 4M61B 4KV5F 4AEEA 5KHHA 2X7RB 4X89A 2IBBA 3S36H 4NJAL 2UV3A 1QVOA 1LQBC 5K93A 4IU2B 1AHWA 2YD4A 4TUOB 5LMUO 3EVKA 1OE1A 5EV7A 2R51A 4ATTA 1DANU 2QVKA 4KRPB 3AXLA 4B9YA 5GRVK 5I6XB 3NG5A 4OCMC 1AQKL 4ZX4A 4Z95L 5IFHH 4DZBB 1Q8IA 4PV9A 1ZAGA 3IU3A 2UWEB 4URKA 2VQ4A 2HVKB 4KZDH 3W0WA 3CCHB 2HTKD 3UTTD 5L0QC 4MDJA 5GS0C 4X6FB 1TYEB 4FCAA 2A0LA 4UTBA 4N9OB 5AVTB 2CRMA 4BSWA 2J1XA 2IADB 4ZFOA 1RIUL 4XR8C 4HUUB 2LAAA 4YDNA 2FEEL 1H2GA 4FFBB 1XIWC 2FLRT 4MW3A 1ORSA 2BRRL 3B1UA 2DJ4A 2CH7A 3HZ3A 3MRPB 3S34H 4YSEA 1KNOA 1WLHA 2LLLA 1HYSD 5F7LB 3WTYA 6CGTA 3V2AR 2PYJA 5K9OB 3B7SA 3ZHKA 2UXGA 5F7FA 1FKAO 4PJCA 5BV7B 1CTOA 1W2BU 1S7XB 1OWWA 4DP7X 2HG5B 2EUXA 2QGNA 3MNVA 4JHWL 2HFEC 5SV3A 2EEBA 4Y4HD 1CGSL 4GB9A 3VGDA 1S7SB 1RURH 1P7QD 4FHJA 2FT7A 3ZKQD 5LGYA 4X7CC 4MW8A 5EOTA 1RIVH 2CKBB 2DWSA 3OKOB 3A47A 2KC0A 4QXVA 1B2WL 5B3JE 3FHQA 4XO8A 5HPMB 5DD3H 2K8MA 1MRCH 1OP4A 2BJML 4HXAL 3N04A 5B1JA 1II4E 4N2IA 1S7WB 1FAKT 1XOUA 1CGTA 2IPTL 2JKIS 3IDXH 1XNRB 1Q4NX 4LAQL 4WI5A 3STLC 1JWSB 3VXUE 1RUAH 3QQXA 2CLZA 3IGUA 1DQTA 2BIPA 3F3HA 3QYMA 2PCFA 5IZ7A 1WAAA 2YOCA 3OB0K 4AVHA 3UPRB 4UUJA 2AV1A 1GN2A 4J3WA 3G67A 1RSFA 4ZFGH 5M95B 5BS0D 3HKBB 1YPZE 2ORBL 1I8IB 3FKUS 3H8NA 4BZ2H 4YXWG 2RMNA 2OMUA 2FQFA 4HJIA 1JVLA 3C08H 3MZGB 3UTQB 2OXHB 5GIRA 1X5AA 3B8YA 2FBRA 3TNMB 3GXIA 4GS7B 2C4FT 3QYCA 3ML0A 1X4XA 4PHXA 2HEPA 1NGWA 1M56B 1LE5A 3U4KA 5T1MB 4HUXA 3B2VH 5F21B 3VNZA 4XPFH 2DL2A 1VERA 4GMTH 4JZJC 3PV6A 4LH7A 3QEHA 4DETA 1WIPA 4DW0A 4F9PA 1OSPL 2HLDG 1K8DB 1NBZB 3CXDH 3R4DA 4XP4L 5AVVB 2Y36H 5DJCB 3D8CA 4C47A 2R59A 3NK3A 4APXB 3HCVA 4ZUSB 3HNSH 3QDAA 4GBXC 2M2DA 3LVEA 1MNGA 1J9RA 1TJXA 4D0BA 5C7XH 1E4JA 4YLBA 3QUYB 2CIKB 1E1QG 1U3YA 1KTLB 3U79A 3WENA 1G87A 4J3OD 5GJSH 4H26A 3B8SA 2R69H 1GYWA 3LKRA 3U2IA 5JDJA 2OA9A 4WEEA 3QJFB 1P1ZB 5F88B 3L3JB 3GRGA 4Y1AB 5JA9A 1JGUL 4Y9EA 3DMMD 4H8QA 4G6KH 2DLFL 2AJXL 2FECI 4P4KD 1YAIA 4ACPA 4MA3B 1HL9A 4ASUG 4ANWA 5EU6A 1X5YA 5KOVC 5EH1A 2R9HD 4FNRA 1ID5I 4PLOB 5ABZA 4LLVA 1W8NA 2ODHA 5JZ7D 4LF6O 4UT9H 1VMGA 1MHPH 4JL2A 3VD0A 4U3JA 1DF4A 5D93C 5IB1B 5MP6H 3QS2A 1IC4L 1UQSB 1S9XB 3O0RL 3U30C 4KNQA 2HMIC 2BIQA 1T1ZB 2BXZA 3EYSH 2YS8A 5EYPB 1A22B 4IBTA 3ABLB 3JYCA 3ESPA 1EZJA 4OSUL 2DQFA 1YYMH 3PPEA 3K06A 2Y6TE 4I3RL 1ZK5A 5FYJU 5IHHA 1UFUA 3T8XB 4RZCB 4W9DC 1FORH 1SBBA 4A67A 4K35A 2KQNA 4L4TE 3BP4B 5J6GA 4WO4B 4CW1A 4LF4B 2EULA 4DV0B 1OM3L 3BUIA 3J81N 2BSED 1CTMA 3CXHJ 2C3GA 4KJQC 3QUML 3GSNL 4FNSA 4JY5L 5F7DB 3P30H 3DX7A 3KLHC 1UOVA 2IXQB 2HA1A 5BOPA 3JV4A 3OG6B 3FHEA 3BDXA 1YMHB 1KYOK 1E9OB 5FPRA 2L0DA 4PS4H 3RWCA 3K2IA 1TTBA 4AVJA 3FD9A 3WDIA 4M02A 2CSPA 5E5MA 3RVXD 4FXTA 3MODH 4BHUI 1SMAA 3BVVA 5B39B 2CLVB 4HSAC 2YKKA 2RALA 2XTJD 5EIQA 3HKDA 1QEWB 2LAGB 1MCCA 4LR3A 3HE6C 3NABL 4J4PC 3T0EC 4JI1B 4H44C 2BERA 4U1IA 3NH7H 4G8FB 1SPDA 2IH3A 2Y2TA 5LQBH 5MHSE 3L1OL 3CDGB 2DW4A 1M7DB 3HKFA 1J8SA 3L4VA 4ZPVB 2RB8A 4XPAH 3BWUC 2BOLA 1ADQH 4OI9A 4MS8C 4TN9A 5D7IA 2ADQB 3X11B 5FF6A 3A8TA 3ABKC 3CHSA 3T6XA 2DQUH 2V4DA 3I74A 4QY8A 4FXGC 4BHUA 3QFJA 2MNJB 1DDHA 4WI4A 4E9XA 3RX9A 2C9PA 3CFKA 3NGBC 3MV8E 4UQ3A 5A9GA 5AKRA 1Z7JA 3UO2A 4M5ZH 3BKCL 3II3A 1AQDB 5BOZG 1PFOA 2VDOL 5MENE 1EGJH 2PUQT 2UZYB 1KCSH 4JHBA 4OAWA 4Z7UB 4ETQB 4DFHA 1PF3A 3KPPB 4CZZA 3U6RB 2WLKA 2WSDA 3KXFE 2ZX6A 4P2QA 4NZJA 5CGYC 4HP5A 3IJEB 1AR1C 2VXSL 1O75A 4J28A 1QTPA 2EIZA 4MVBC 4XNBA 2A3QA 4DV7O 3H9SA 1WBYB 1KYUA 1AO7B 3MRBA 4H1LH 5JVDA 2TRYA 1WWAX 2AXFA 1QZ1A 3FMGL 3SKMA 2RTTA 1T7XA 3BZDA 4L8SB 2Z93A 3QZPA 3CHRA 2C9RA 1PD3A 1SXZA 1KG0B 3BE1L 4JM2B 1CVRA 2IBZX 3NIGE 1JCHA 2RBLA 4PJDA 1NSNH 3EO1A 1KCBA 3VI4B 4H0LB 2MRYA 4Y16A 4LO9A 5F9JA 5C6TL 2ZR3A 3W7XA 3I9IA 2CPCA 3MCG1 3U1SL 4PJHB 3VFNB 3HG0A 2E4TA 1JFHA 4KKPA 3N85L 5B3JF 4GO9A 4KDVA 3MR9A 3L5HA 3R19A 5CILH 4MZ3A 3BH8A 1NMCC 5EUOE 1VHPA 1QFHA 3IKCB 2N7SA 3GMPB 4IKIA 1IIIA 5ILTL 2EUZA 3LIZH 5D9SA 3DXAB 3NIFE 3WFZA 4K23H 4B9JA 2NNUA 2FJFA 1D5MB 2L7QA 1ANUA 3BHBA 2F54A 3ZE0B 4AGLA 1R5VA 1CBVH 2B1HL 3KW8A 3DGGA 3G6JB 1TF4A 4NSKB 3SDCD 2ARJQ 1IKFH 4IIJA 2V33A 4MNQE 4KX8A 4JO2H 3MLUH 4HOZA 5I8OH 1HIML 2C9UA 2OMXA 1S7UA 3TCLB 1YPZF 3FU5A 5C0CA 5ICZB 4L3EA 1XBLA 3X13B 3OD3A 4OCRH 5EOCJ 5GONB 3OKKA 1B3JA 4J10A 5HHOB 2NY7L 3TBBA 2KI6A 5BVJA 2F1BA 3D50A 3KPQA 5E8EB 5C0EA 3LUTB 3S35H 3ULVL 4UNVA 1KP3A 2DJUA 3AZUA 2I7OA 2ZSVA 4BM7A 1P4IH 1KYAA 4JE4B 4IRZH 2JKTM 2EEFA 4FXKA 3BFRA 4NQEA 2WKGA 1WWBX 3PJSA 1E9PB 3F7KA 4P9HL 1TZAA 3ASOB 3SPGA 2XKNB 2ETNA 1HKFA 4GP4B 2FB5A 1TVKB 1L9SA 2X1QA 4FQXC 3CRQA 2FK9A 3GSQA 4IHOA 4EN3C 4P2YA 5EPMB 1FLRL 4F57L 2BVOB 5IESH 1NJ9B 3FJTA 5D6DA 5D7SH 4Q97A 2CJTA 3PDDA 2BHYA 3EJQA 2V5MA 4PRIB 4M43H 5DJ6B 4XCYA 1JJ2U 3LQAL 3PWPA 4Y8DC 4DTGL 2FR4A 2PWGA 2WV3A 2EE3A 3MBEA 4WUKH 4AENA 4JKMA 3MV9E 1CGXA 2B4CH 5KANI 2W94A 1AQHA 2LHAA 3BMVA 4UDUB 3VG0L 5LA6B 1D5ZB 4ORGB 4HIJB 4KU1A 3MO1A 3TV3L 1D7FA 4X0KA 4IGBC 5J0BA 4ABQA 2J21A 4WCYH 5IV2A 2XBZA 2VJ0A 5IUSA 1KFAH 2Q7YA 2P4KA 2YQ3A 1JPFA 2CO4A 4OV5B 4X7TB 2P44B 2OCJA 5SV4A 2H32B 4QHKI 2O57A 1FF5A 3JUYA 4KI5D 5G4OA 4D8OA 4PW3A 1GSKA 2QV4A 2XZAH 4LCYA 5KVFE 5I1EL 1B0RA 2VIRA 2BVQB 3T3MF 2Q0ZX 5FKAB 4PW9A 1XBRA 4GNKB 3BZEA 3O4OB 3VDCA 1S7TA 4E41B 1NDGA 1HL4A 1UADC 4GIPD 4KOCA 4JI0O 5FS5A 1GHFL 4DV6B 3EGDA 3DYMA 3L5WA 1ZDQA 4XC3L 4Z0XB 1PX3A 2VDQH 4CNIB 5KYWB 1U8IA 3LKSA 4IRJB 3ARGB 4AZ8A 1L0QA 1FIEA 4AYEC 1N5AA 1L6PA 2SODB 1N19A 4V11A 2GUOB 1S5JA 1TQCC 5IBUB 4HK3N 2A7BA 5GGRA 3U83A 4OB5H 5A6MA 1DJGA 1GYUA 2A74C 1JHLH 4G8GA 4PJ9A 5H35A 3QDJE 2V2TB 5DD5H 3SSGA 5CF3A 4XPBL 3QZLA 1T7ZA 4UOW1 3K6IA 4OLXL 3F85A 4LE8A 5BY1A 1QRNA 2A7WA 2D31B 3O9WC 4R7VA 1LQSR 2N0KA 1FV1B 5HPOA 4HWBA 4G27B 1J0JA 5A2BA 5LMUB 1JRHL 2AJSH 4L3FA 2ED7A 1BZEA 3DUSB 4FADA 5EUKA 4NBZB 4OVVA 3VYNA 1SHSA 2VDRL 2VTFA 1EHNA 4HISA 3AY4A 3GBMH 4I5BA 4PP2A 2ILLA 4OZGB 4G9FD 5BZDB 4K5OA 3M7MX 4NZDA 1P5UA 1BD2D 4MXVE 4P57A 4AYID 4IDLA 5IKCB 3OWEA 3UTSD 1WIUA 3DPDA 3RIAK 3O4LA 4KHTH 5J12B 3BVUA 2ETWA 1OXYA 1MW1A 1Z9MA 5FGBC 1R0AH 4FLOA 1T0NB 3NP4A 4K0KO 3ARDB 3NJFA 4FZ8L 4NS0A 1YYLH 5E1AB 3RWGB 4F33B 3FH5A 4OLWH 3UJJL 1J9SA 3KYKH 5FOJA 2J8UB 2WBJA 1DLFL 3TL5A 4DKTA 1JZ4A 5JW5A 4ENEC 3EF4A 5KSBB 5FYKU 4PWFA 2NXYD 4J3BA 1HL5A 4HUWA 5EFIB 3PWLB 4LDEB 1N10A 4RDQF 2NR6C 3CDZB 3EYUL 1WC7A 4N86A 3S5LB 1IEAA 3LRLA 1HC1A 5C3LD 1T2QL 1G94A 3T3PF 3LSSA 1MAKA 1A1MB 4HKZB 4MA8L 2W6JG 2ZCLH 5HYSG 3B7YA 1SEQL 3WKML 5EC1B 2L6LA 4PR5A 1ZE3H 5DJZA 3CSXA 1NPNA 3QJOA 4CN4A 4XVUC 4JTDB 5L3FA 5C0FA 4L3CB 1URLA 2AQ2A 5KVEE 3OAZK 1GTNA 1FL3A 4FFVD 1YVWA 3A4EA 1MJ7H 1R3KB 5F9OL 1IBYA 1IMHC 2NN4A 3M17A 2EIJB 4JFXA 1LDPL 4N0RA 5CKGA 1I7UB 3MUZ1 4AYMC 3BSZA 4MMXA 5JQIB 3JYBA 3DTUB 4X1IB 4TQEL 2H5UA 3FUMA 5CP7A 5LLIC 3NIGF 1UWXK 3IXAB 4KO5A 5JLZA 1RKRA 4NQQA 1V7MH 2R0WH 3OHXA 3TPKA 4PGEA 1V10A 5JMOC 1M05A 3PABA 2A2QT 5I16A 4WU7A 3WNOA 4OGQB 3O3AA 1NL0L 3VXSA 3BZ4B 4GI9A 4BCXA 4KAQL 4KJWD 2JF1A 1AD9A 4Z0BL 1WNSA 2HP8A 5BRZD 2QSCH 5HDQL 4XPGH 3ZK0A 3WB2A 1RPQA 3BPCA 4A6YH 2BFGA 2VWEC 1GOGA 1KN2H 1U6AL 1U8LB 1P84J 5EUOF 2UUDH 3BAKA 1YCSA 1N2RA 5D7JC 1VQPV 1P4LA 1KJVA 2CBMA 2YIHA 2WTRA 3GZKA 1ITCA 3UTTE 4D0CB 3APQA 1CLZH 4ERSH 1IARB 4GY4A 2NQDA 2FD6L 1VJSA 4JFPB 1BS3A 2FLBT 3D9AL 3C60C 3MOBL 4F7MB 1QBML 4MA7H 1JGEB 4PRDA 1J8HA 1CYXA 4WCEV 3P77B 4K3HA 4FX5A 4LCUC 3CZFA 2PW2B 2J4WH 4IKNA 4HKJB 3U11A 5B1JC 2P43B 2ESVD 5D1ZB 4GT7A 1VGEH 3O6KH 3FTSA 1MVFA 1Z2GA 4LQFH 5AVXB 4BKSC 5L3CA 1KIUA 5A2FA 3EOYG 1YVLA 4GRWB 2GTQA 4X9QA 3QI9D 4P0DA 3OEEG 3N06B 5DJ2B 4FNLL 4JKWA 4UUJC 3QIBD 1M1XB 1TJMA 2FYYA 1GM9A 2NY2C 4O5LH 1ED3B 5T1KD 4BIOA 2RJMA 2B1IA 4YVUA 3EJRA 1QA9A 1BREA 4M1CD 4LVOB 3OVUB 3F62A 2EEDA 4LCCA 1I75A 2NXZD 1OB1B 1VEOA 4JFWA 4OD2B 2CHXA 2PR9A 2BP3A 5KAQF 4A7TA 4FYSA 3L2MA 4Q89A 3G9VA 2IGLA 3PXLA 2NY1D 3KYAA 2EDJA 4LBEB 1R6NA 4LF6B 2CGRL 3HRPA 5EMYA 5IW3A 4U1GB 4TSAL 3WEBA 2ALWA 2UX7A 5KUMA 2JSFA 5C07D 4O58L 5ISZE 1SM3H 2XAHA 5EZIL 5HGAB 4ZW7A 5KVGE 4HUMB 2NYYC 3ZKMD 1I8KB 5BS0E 4OF0A 2IM9A 4CKQA 1PL4A 1YEHL 2D0GA 4JV5B 1SVZA 4BFNA 2DIBA 4Y4FC 1KKCA 2DM2A 3JBG7 1S5HA 4OIFA 5FO7B 2ALAA 1PPIA 2EXYC 2KB1A 2EIEA 3WEXA 3WELA 4JI4O 1IVLA 5LHDA 2NCMA 2W0XA 4L8DB 3KZIZ 1ILSA 3UAJA 2O6FA 1Z32X 5IFAH 3TNNB 5GS3A 2P26A 2RA1A 2YEZA 4AUUA 3T4DA 3HHSB 3GJFH 2PWFA 5D5PA 4ONFL 3SJVB 1KC5H 2QQLH 5IB3A 2J44A 2ARJA 4ZAKC 1LLAA 1SUHA 1HEZA 3IBOA 3EJYD 2X1XR 4N0FA 4QR7A 2CO1A 4DR7O 2E3CA 1F7YA 1JNLL 1ZV5A 2X87A 3JCUZ 4Y2DB 5IEKB 3V79C 3SE9L 3UQ8A 3QEUB 5KSAC 1GZHA 1US6A 3VM7A 4UM8A 5E9AA 5E24E 4R2GD 3A23A 4KUZH 4HPOH 3ZTNH 1HL8A 1MOEA 5EF3A 4JJ5B 2F1EA 1TCRB 2CG9X 1J0KA 2CHNA 2K7QA 1NFIB 3LNFA 4ZOCA 3GB7C 3V6BR 4AEIH 5HHQA 4J2XA 15C8L 2CQVA 2WANA 1SGKA 1KTDA 1R75A 2I07B 2KL6A 1NINA 2K6ZA 1LO4L 2XG4B 3QFGA 2PLTA 2CGZA 3K72A 5E7BA 1QNZH 1QSVA 4Y9GA 1ZGLA 5JQGA 1AKJB 4X5XA 1MHEA 5B1CA 3JAKB 1J87A 1EJOH 3ULVD 3F7QA 1DQQA 1RH8A 3FULA 1E8ZA 4RZKA 5EOQL 1IGIH 3CDCA 4IMLB 5BQ7A 2ITCB 1F13A 3OF6A 2EDEA 3V0HA 5IYZB 1TTRA 4MXVF 3QPXL 1RK0A 3OR7C 3FBQA 3VXRD 3PL6B 1BVLB 5F97E 2CDGA 3W1ZA 1A8JH 1JVMA 1T5WB 3EZ8A 3FTZA 1SQQH 4XAWH 4KXDA 5E8PB 3STZB 1DJHA 2X70A 4WI3A 4MD5B 4ZG1A 1YITV 3VB9A 1KIRB 5JPNA 2IH3C 2CK0L 3OZ9L 1H0DA 2VLRB 4KROB 3RT3C 2YPLA 4FLQA 4RCAA 1DBAL 4X4YA 1FZOB 5H5NA 3H7BB 1BP3B 1C08B 3FU7B 3AT0A 4NQXA 3RHWF 1HCVA 2DQEH 3WL9A 2MEJB 2CRIA 2X4RA 4NDMB 4DKDC 4CC4A 5F93C 1BG1A 4AKQA 5A1AA 1RUMH 1CIDA 1CD0A 1G1OA 2Z3FA 4P59H 4X4XA 4HIIA 2NTSP 4I1PA 3DRQB 5E4EC 2OMZB 1OTSC 3AMKA 2K4AA 4NHUA 2JS3A 3RL2A 2NUPB 3TIEA 3JV6A 3UPAA 3T4YB 4YQXH 2YWYA 5SX4I 3VH8A 2DD8L 2FEJA 4Q58C 4S1RL 4XP1H 4XC1L 3L4WA 1T7VA 1HVXA 2B9AA 3B3IA 3JTTA 5I82A 3QUZB 2XTJE 2DYRB 3BW9A 1FJGO 5IBTH 5EULV 1IGML 5IFJA 2BNQD 4KZ0A 4UB0H 2X4TB 2CBPA 1QTYT 1RZ7L 1SYSA 5E6IB 4CL7A 3TZVD 1KB5L 2W0LA 4G43A 4QHUA 3MCLH 5J1AA 3I75B 2A79B 1B4JL 1G9NH 1XCXA 4JRWA 4J6IA 3CE2A 3FTXA 2V9QA 3VACA 1KB9F 1KJ2A 4Z1PA 1Q9OA 4XMXA 1U91B 1RFDH 4JFEB 4KMTH 4JDVB 1NKOA 4JO3L 1A7QH 5E8OA 2F53B 1BEXA 4L4VD 1JHTA 1JVOA 5I0VA 3ZDXE 2J8HA 1RUKH 2X4PB 5FA4A 5LDUA 5CNHA 1YNTF 3MDJA 1QVOB 4DQAA 2XKUA 4R7LA 4P5MB 1E9QA 4Q20A 1RJZB 1CFNB 3BH9B 1NAKL 2W80C 1C16A 3ZZLA 1SESA 4HNAA 1X4ZA 2YUZA 4R3SB 1ZK9A 4LMQE 4IS6A 4OIIH 4PA9A 2D0FA 1SHXA 1AFVL 3LEYL 5DVNA 4NWUL 4CSTA 3ARXA 1JVKA 3MGOA 2A77H 1TZIA 2CGNA 3MRLB 4I1RA 4MNHB 2AEWA 3MX0A 4OZHA 2M7WA 4LLUB 1QZNA 1IGTA 1I0HA 1WEJL 3Q2NA 2VLKA 2Q4PA 4HWEL 4ZQKA 3L72H 4KUMA 3C75A 1EEUA 2C3VB 25C8L 5TK2A 5I75C 1E3XA 2YD7A 1D2OA 2BVTA 4P5RA 2CO6B 4N5UA 3L95B 4GW4A 5CZRA 1RP3B 5JH7A 5E2TL 2JB5L 3SBRA 5DJYB 2NLJB 2E8ZA 1RUPL 4JTAB 4A55A 4TV8A 1DVXA 3ORJA 4XN2A 3KE0A 1AGFA 5IG7A 1UACL 5DQ9A 5KHIA 1BSIA 2IH1B 4PJIB 3BT0A 1CU4H 3D39E 3GI8L 4JO5A 1WZLA 3QULA 1JWMB 2VJXA 3GHBH 3RDTD 1F23A 1VF5B 2NR5A 5B1KA 5TDPA 4BSVB 3SE8L 4PJFE 2Z8WC 4PG2A 2GSGA 4AG4L 3P4NB 4FEMA 4KOBA 4M8VA 2JI2A 4BFJA 5ID1B 3ZDYF 1N64H 3GBDA 3C3SA 3DOHA 4JS7A 4M6NH 5FYLL 2F9BT 1S7RB 3PCYA 3ECQA 1E5CA 1G4YB 3IMTA 4GLRI 5CCHE 4MS6A 4YMPA 1CT8B 1NIFA 5JMRA 1LO5B 1SBSH 5IGXL 4KXAA 1GH7A 2R0ZH 1N0LA 3GTTA 3QW9A 2R7EA 1E1RG 3S0PA 3ZZ1A 4YR6A 5I6NA 5KVFH 3RPBA 3RWEB 1I53A 1NOAA 3EO9L 3WV0A 4MLIA 5AL0A 2XVLA 1L7TL 2EXSA 3G5VB 4ZS7H 4UB6Z 5D6DC 3MA7A 5J9PA 4X66O 2FT8A 1EAPA 5FWRA 2J7LA 3FX7A 4ZNEE 1V3KA 4X8AA 1C5CL 1JSYA 4JI0B 4NCC2 3OMAB 1DQLL 2HFGH 3PP3K 4YJ3A 5IMOA 4FZEH 1D6VH 5LXGL 1YNLH 2XZQH 3QXAA 3HR6A 3ESUF 5EB9A 4HJTA 3QO0B 3A2FA 1S3KL 3WFBH 2DDQL 2DQDL 2G4GA 4JG0L 1T0OA 4TULH 2XWXA 4BZ1A 2KG7B 1L7IH 1WB7A 2CALA 2C26A 1QWHA 4KDWA 3AMLA 2X40A 3S9DB 4OKVA 2XN0A 3ATBA 2L8AA 1TZOA 5IHBA 1WV7T 1AJ7L 5CP3H 2G75B 3DA0A 5CBEB 3SPVB 4WW2B 4KKNA 2YJLA 2P8PA 1KTCA 4GMSL 5D8JL 1HNWB 1MCOL 4DK1A 3KDMA 1B6DA 2J5LB 1D7DA 4HWUA 2ID5A 1V27A 5C08D 4JRXA 3C3TA 4J3OF 1AVAA 4XNZB 4RO2A 1E50A 1QNIA 4WI7A 3W81A 3BVXA 4KNUA 5GSRA 1J5EO 1FAIH 4RMUA 4PJ7A 2XASA 4XO9A 3TA3D 4YZFE 3MJ9A 4R7NA 3SZ6A 4H1LB 3IJ7A 4K9EH 1IBGL 2B5IB 3NJLA 4K0KB 4MHHI 4AKPA 3BX7C 5T1LD 5FPIA 3P0YH 5IB2A 3DUUA 5KHKA 2YAPA 4JYAO 3N27A 4CH3A 2NY4D 4DJMA 4U2YA 2WHVA 2P7TB 3MHSC 1YECL 4LSUL 2H4EA 2ZUSA 5EU3A 2Q87A 3U46B 4Y5XC 4G42B 5DD6A 3F5WC 4O4LB 1MY7A 2VLJB 3OKLA 3CHPA 1VQ8V 4KI5E 1WN7A 3CFEA 4UV4L 5K9JL 3JT2A 4W9GC 3ZO0A 4QRTB 1FNGA 5IJ9B 3OAYK 1VZGA 1HXYA 3VMOA 4UFZA 5B7FA 2BVPB 4U1NA 2EYSB 3MRFB 4WHDA 3O45B 2YZ1A 5D2NB 3IGKA 2UUAO 3HG4A 4TOIA 3CVBA 1P5UC 4JG1L 5KVEH 1NLBH 4YGVB 3LHAA 4HS3B 3SKJH 2AZUA 4C54A 1Z1WA 2Q76A 2HB0A 3QXDB 1RP8A 4I1NB 3MMEB 2WGXA 4CW1B 5K1PA 3KPRD 5CGBA 5LMNO 1RPOA 2AITA 3VRIB 5DUBA 4FLYA 5F7WC 3KPLA 2CHZA 2R4RL 1MRFH 5ID0B 5IYBO 5ERWA 3WFEH 4O2BB 2XQBH 1LUVA 1A7PH 4ONHB 1KD1W 1NA8A 4YBQD 1PM9A 2ZWYA 1ZTEA 5ESAB 3MV11 4ESKA 4ACTA 2VAJA 1P7BA 1UOKA 5C09D 1AGEA 1WD8A 2O30A 1F86A 2IOOA 4J3UA 1EXGA 4G9FE 4Q14A 1BD2E 2Z4TA 5DF0A 2X38A 4JKLA 3UTSE 4IRSA 1IGCL 4MMYA 3V0EA 4LHUB 5IMMA 1JYWA 2IPUG 3H3PL 4NBXB 2AK1H 1E40A 1TAEA 2Q7NA 2XAJA 4MTGA 4JFFB 5IBUG 1SXAA 3BD3A 3DROB 3ZDXF 4PLJC 3I6GB 3UL4A 1N0NA 3B77A 1FIGL 4MMXC 5LBGA 5C0AB 1TZGL 1ZHBA 5IJVA 4QEGA 1M5IA 3PNWA 4QY8B 4Y1TA 3SOBH 3VWJB 5IY5C 4P2ZA 4X8XA 2Y48A 5IBLD 1GJIA 2ZWZA 1AZVA 2VLLA 3OHXC 2WWKO 3MV01 3VFRB 1A3LH 5B1AB 3H9VA 4LEBA 3ML8A 3ZE2B 3QR1A 1KIQB 3VAEA 5CBGA 4A68A 3DSFH 4GEIA 3VTMA 1BOYA 4GP5B 2FJGA 4CBPA 2CNZA 2D9QB 3NFPA 4KITB 1I1AA 2OKMA 1T1XA 5IQNA 3BVNB 4DUXA 4XH2A 1ROPA 1J1PL 1PSKH 1T83C 3FTUA 2P5EB 3KYMA 3MRKA 4JCLA 1HH6B 4KRPC 4Q56A 4TVPL 4MAYB 3ZBMA 5D4JA 1Q6IA 5I6XC 3OE7G 3EUDA 1F4XH 3QUXD 4FG0A 1KGWA 4PSPA 4XNMB 4TPRH 1EDQA 3PGDA 4DO6A 4NN5B 1Q7YW 1L9QA 4KQ0A 3NYKA 4LF3A 4MJ2A 1IXMA 4X7SL 3ZX1A 1CXZB 5LGHL 3LXAA 4XN4A 4DV4B 1HAWA 2R1YA 4JPKH 1R3IC 1AACA 1G0XA 4N1CA 2GBVA 1BFVL 1IBKB 3MLSL 3S5LG 2Z31D 4PJDB 4F7CA 4PJFF 4FQQA 2H45A 3MLRL 1GC1L 4R8CA 1RZKC 2VDQB 3OKMA 3FFCD 3MRRB 4KKAC 1CFMA 1U8JA 3BAEH 4N2NA 3HG1B 4LMQI 3VFVA 3BRDA 4O2FA 1A3RH 1K3EA 1VQ6V 1FWXA 3K0WA 3VWKA 3FB8B 5AYUH 4U3SA 3U2JA 5DHMC 2HKFH 1P2CB 4JFDA 2QDOA 1I3GH 2F5AL 2IPKA 4Z18A 2K3TA 4H25B 4MJIA 5FFLA 3GTVA 2BSTA 2I25N 2J71A 4UAOB 1A2YA 2GV9A 1N6QL 2Z4QA 5IWLA 4Y88A 4YHML 2P90A 1DLHB 3CBKB 3NCJH 4LCCC 4TSBH 1DVFD 4Y0GA 3IGAA 1Z0NA 2AGJH 2O61B 1ASQA 2O5ZL 3M86A 2CKNA 3VXTA 4L0YA 2ESVE 1G0YR 2B15A 3V4UH 3FFDA 3GS4A 2XNAB 4H37A 4HCRH 1QKZL 2L7EA 4DR7B 3H1KH 3LNIA 3O8XB 4OZFH 2HPOA 1EXUB 4P2OB 4NQCD 4HG4J 2OMBA 2ZUWA 3WI9A 4J3OH 2ZSWA 4TUUA 3X1EA 4AV0A 1IIKA 3ISYA 2FZ3A 1PG7X 5INCB 3PFUA 4DSYA 1YY8B 1P9MA 5I1AB 3EFDH 3DOSA 1AI5A 1XZ0B 4FXKB 4J6RL 4MD4A 1S5HC 1JD9A 1EDYA 2OMVA 4I48B 4NQEB 1LEKB 1QR8A 4FZ1A 5D7LD 3OB0H 5ITZA 4HMEA 4RFOH 1J11A 3UAJC 2VDML 5IROD 3GI9H 1TTAA 1Y6XA 2W91A 1Z5LB 4XMKL 2Z65C 3VFOA 4NJ9H 1HFUA 1H3XA 3RILA 3MFFB 3AG2B 4GQ9H 4MLSA 1SZTA 3VFTB 5IB4A 4PD4F 4KXCA 3CJHA 3SDLA 1YJ9V 1XQ4A 3GMQB 5HHMD 1DQJB 4GAAA 3F6LA 4HAMA 2J2ZA 3AQZA 3RGVB 2NUTA 4YZFF 1JQ0A 2YMXH 1CG9B 2JGDB 4V1DD 5B7MA 5C0BA 2VM3A 3SGDH 1GZHC 4DVRL 1OQXA 2FR4B 4JPIB 2GJJA 4JO1H 4OUOA 3LEXA 3UCRA 2OZ4L 5JDSB 3QUYC 1ADWA 3M7FB 4Y9BA 1FXKA 4NM4L 2DLEA 3CFNA 3SB3A 1SJEB 2Y7NA 2I9TB 4X9BA 4LB8A 4ZTPH 3AS1A 2X1PA 4PBXA 3X17A 4KI5F 1A4KB 3D4ZA 1KSRA 4C4KO 3WFCL 4WEMB 1UURA 2V1DA 3QNXA 3L8QA 1LEIB 3E6FA 4J7ZA 1PY0A 4JYCA 4HFUL 5DMJB 3SPCA 2C1PA 4DR4O 1MQ8A 43CAA 5FYLD 4A6YB 5JHDD 3HBZA 1YPZB 3D25A 4OQTH 1XF5A 2P45B 1YZZA 4PWIA 5F89B 3BSHA 2X6VA 2VM4A 3IMWA 3ISRA 3I56V 5D96B 2K7PA 4WJKB 4XBEH 4FM1A 2F0CA 5I9QB 2LTQB 3PFQA 2FEEI 3LKSB 3TIDB 4PH8A 4N0CD 5HGDA 3MLYH 2YPKB 4OT1H 4WTZA 5IVXE 4KK6D 3TOPA 1KB3A 1ZSHA 1UA3A 3SKNA 3V6OE 1HHIB 3ABLC 1M1SA 4ZXBA 1TKWA 1W72A 2F7PA 3MYJA 4FABH 2R4SL 2GHWB 3SJQC 3ZOAA 1GXEA 2E75C 3ZYIA 1NR1A 2WOBA 3IJ8A 1EZUA 1JS4A 3MRQB 3ULVE 3BDYH 4ZMTA 4OCSL 5I1JH 5C0GB 3GZQA 3V4VL 2HX8A 3OKDB 5FR3A 1DN0B 5EUKB 4HJ0C 1EK3A 3KLLA 3VXRE 3IYLW 5CEZL 3F7VB 5AZUA 4I5BB 4G80A 5DQJB 2F4VB 2AEQH 3PQYD 2IANA 4P57B 5TPWH 2I9LB 1JV5B 1WA8B 3TXSA 1R73A 3K4ZA 3E86A 5SWQB 5KMGA 3RWIB 5KS9B 1I94O 2DLGA 1FDLH 2MCPL 3RPIA 2VERA 1WB8A 3GTNA 3MLWL 3AITA 4U6VH 3S48A 1R3LC 3VFPA 5B66Z 3LNEA 1CDUA 3L9RA 1YEEH 1F90H 4E36A 1NFDB 5ELIA 4QO1A 1UWFA 5KBNC 2PR4H 3AJ7A 1BFSA 4WTXA 4FLUA 2BS71 3GMNB 3ECVA 3OSVA 35C8H 4HUWB 4JZ2A 4V2CB 4DNLA 1YEKH 3OKEA 3P2DA 1WVZA 1BIIA 5C1MB 3S5ZA 3ARUA 1IO4C 3OGOE 1K5SA 2DJVA 1B0WA 3SDAB 2R2BA 2IWKA 4HHWA 2CPUA 1GS8A 4DEPB 1MAMH 1SYVA 2BNQE 1JJOA 2BSSA 5IIEB 3T0AA 3S88H 1LP9A 2CH8A 3AS0A 4HX1A 3FB7B 5J13B 4JPWH 5L8JB 1F8TL 3EYOA 2F93B 4HGWB 4P23D 1M4KA 4WSGA 5E99L 3H4FA 3GJFB 5HI3C 3GRBA 2EX3A 3GXNA 1GA2A 3RYCB 4YSRA 4KC3B 3RTQB 4CVZA 4DUWA 3SQBB 4FFWD 1E4XL 1HNYA 1O7SA 4L4VE 5CP7B 1ZEAL 1MIML 3WNKA 5L6YL 1J8KA 3FTGA 3K91A 2V17L 3MROA 4N68A 2GW5A 4HJJH 2H26B 3OKNB 4ES8A 1I7TA 2Z8SA 3K9SA 2FX9L 4I0PD 2GSIB 1QO3B 1PQZB 5DLMH 5DMGC 5AB0A 1CURA 3ARFB 4U1SA 2DQIL 4DUYO 1QACA 4L8SC 4YHIB 1O9HA 2EDFA 3O6FD 2IAMC 4DVBA 1QATA 1HXMB 3KLKA 3FSVA 4PJXA 4X66B 1CGUA 4JGUA 4NJAH 5BCAA 4WRLA 3VBBA 4P99A 3UBXA 1J05B 4L23A 1F2XK 4PG2C 3RKPA 4X1KA 3L1EA 5E6ZA 2OCCB 4U05A 3MHHC 1FNEA 4AL8C 2OPCA 1N32O 5ICUA 4X5WB 1AQKH 4EI5A 5I2IA 4MYPA 3MV8B 4Z95H 1L9RA 2P47B 4NKGB 1D9KD 5GSVA 1DVTA 1MHHB 5MENB 4JHUA 1AGBA 3EYQD 1ETJA 2QEXV 2YSSA 3DJ9A 4TKWA 3LPGA 2HUHA 2W9EL 4DKAA 4R4FL 2CRZA 3GBNL 5IR1A 4WENB 1KXQA 3AWFA 2DEYX 1YC8A 3KXFB 1IJNA 4C4BA 1XL6A 4WQOA 4DV5O 2WCPA 3TP4A 3V0JA 2ADGA 3E3QC 3IU4L 2HR3A 5FK9B 2ICCA 4XMZA 3UBXG 2E5EA 3VRJA 1QLFA 1PGRB 1RIUH 3ZQ9A 5EO0B 3DO3A 5F2VO 5J9PC 4NP4L 4IIZA 4O2EA 2BRRH 5J6SA 1D5IL 5KX5B 1TNMA 1Z5HA 2P8LA 2NY0D 1OTUD 3EDJA 2QVTA 1G6RB 2IDTA 3BQUD 3UDWC 4FP8L 3PP4L 3OBAA 1CCZA 4O4YL 1JP5A 1XF2A 5IQOA 3V4PA 4YWGL 4WJG3 5C6PB 1EHKB 1YUHB 4JYAB 2EZ0D 3PWJA 3H01A 3MAWA 3NIGB 3TO4D 4PA7A 4JHWH 3U4EA 4ELKB 4RGNE 4RX4D 2WLHA 1IFHL 4X42A 4JRYA 4Z7WE 1QI5A 3MBXL 3F05A 2ZXCA 2ICWJ 1OLLA 2GJ6A 4LRIA 4TVPD 1A4AA 2XWTA 4NO0D 4M1DL 1WCQA 3D69A 4JDZA 4PTTA 3IDGA 4YHOL 3MGTA 1B2WH 1XSJA 4UCOA 4I2XA 1TVHB 4HXAH 3NDZE 4ZMQA 2BJMH 1LMKA 4LPCA 3GJEA 4U4BA 5FYJL 3UYPA 4XP6L 2R1XA 5EUOB 4G8AC 5GS1B 2IPTH 2UUAB 1RMFL 3RVTD 4LAQH 1S7QA 3NIFB 3CCUV 1Z9NA 4YBLC 4HCIA 1AQ8A 3EGSB 4XGZA 2OTWB 3BIBX 1I8MA 4XI5C 1UOLA 2XQYA 1S72V 1ADQA 4MNQB 1GZPB 3K6OA 3SGEH 2VQTA 5LMNB 2RMKB 3VD3A 3I6LD 5IYDO 3LNHA 4BWUA 4B60A 1KDJA 1OGAA 2ORBH 2XVBA 4JFQA 2A6DB 3JAMN 4X50A 3QDHA 2VQFB 1HQ4B 4NRXB 1BQHB 1HNXB 4M7LL 1MNUL 2AABL 3MRDA 5E00B 3HHRB 5LO7A 3RUGA 5E94A 5C08E 2IEPA 1HP8A 5EZLB 5L8LB 2QL1A 4L29B 5JPMB 2DMBA 2LV4A 2M6YA 3ZDZF 2UXFA 4UM8B 3II1A 1OSPH 1WS7A 4XP4H 1TYRA 2WYTA 2XQYG 1MCPL 4F6RB 5FNVB 3O4OC 3VI3E 3BSGA 2NYKA 5JNYB 4GIAA 3ULVF 3HN3A 2WKLA 1PG7L 3FQRA 5CWSA 1SLWA 3ARGC 5CR1A 1AXTL 4MZ2A 4RISL 4ODWA 1H2LA 5AW4B 2JK5B 2VXQL 5JQGB 3KG5A 2MW2B 1MHEB 1Y07A 2YFOA 3H53A 3P73B 5IMKA 5G55A 3CCQV 1UWEL 2ATKC 4NTYA 1JGUH 4DCQB 4LRNL 3MV9B 4LK4A 1MJ8L 2AJXH 2DLFH 2DYPB 3O3EA 4W1TA 4OF7A 4G1MB 4CSSA 3OM3B 3IF1A 5FHAL 3C87A 3SE4A 5LN8A 4EKWA 3NN8B 5CZVL 5LNEA 3IDJB 1DQML 1BLNA 4M6ML 3OLDA 4DESA 2OZNA 2Z91A 3K6SA 4QMEA 1BZ7B 4KXRA 4YXKL 4H1LG 1IKNA 1NTZH 2C1OB 3O3BA 2CM5A 1IC4H 4YSTA 2PO6D 3TO2A 3O0RH 2ZUTA 4XMTA 3KPRE 1BWMA 4FC3E 3GNML 5J12C 2FEDC 1XV8A 1EIBA 5E1AC 3ARDC 3DO4A 4X4XB 1YN7A 4I3RH 1OAJA 2WXMA 4L4JA 2UXDO 4RFNC 2DRUA 4NHUB 1H5BB 5A2LH 3TIEB 5KYUA 3QIUB 3O81A 4K7PX 5C09E 3N0PB 4KK8D 1OM3H 1AGDA 1Y18A 2OMTB 3N2KB 3HBPA 1HHJA 3GYRA 3QUMH 3GSNH 2ED9A 4JY5H 3WG7B 1JXFA 4HV8A 4U7OA 3RYIB 2PKDA 2NSMA 1Q94B 3QDJB 5T1DL 4PCKA 5EC1C 1H6FA 2A99A 3T0XA 3VXPA 3B3BA 3ZHLA 5IOKA 3ZHTA 5I5JA 2CDYA 2A9BA 4BFEA 3SN6N 1KMIZ 4JDTL 4O00A 2G4EA 4KMQA 4U3XA 3NABH 4DV3O 4NCC1 4IYHA 2EIJC 4UYQA 5HJDA 5DFAA 2G60L 3L1OH 5J2TA 1HSAB 3ZMSA 2B1AL 3OAZH 3RBSA 5F1IA 1D3CA 3U9UA 2LU7A 2VR3A 1M6OA 1MVYA 1WP7A 2UYLA 2XZCL 3CMOL 4P5TC 4WZ9A 5EU7E 2JCCF 3WY4A 4I0XB 4P30A 4OGQC 3ARQA 1V7NL 1UWXH 3AS3A 3MGOB 5TFSL 5F3FA 4LHUG 3VQ1C 4RAVA 2H47C 3HZVB 2MPAL 2A9NL 4UBDC 3ABTA 3QXUA 3BKCH 1IGTB 3W5MA 2VDOH 1DJZA 1H3WM 4ZQKB 3E8UL 1VCBC 5CCJA 3LDCA 5DRXB 1U8PB 5CEZD 1VGKA 2J88L 1KJMA 1OT1A 4O51A 2W81C 2ICEB 3BC9A 2AZ0A 4GRLB 4PGDA 3EJZC 3OV6A 1X9LA 4QTHA 2AXHA 2VXSH 3KYOA 4Y5YA 3JVFC 4WGKA 5IHUL 1NEZB 4NQSA 4X99A 4E2LA 3QJRB 1BAFL 1Y7VA 4LPYA 1CJYA 4XXDA 1TZHA 3FFCE 3OTOO 1RSOA 1OPOA 3P02A 4M7JL 1WJ3A 2GI7A 3FMGH 3FQ2A 1QQDA 3W39B 3S4SA 4GXUM 1Q9KA 3FL7A 3IN2A 4IEFA 4P9PA 3BE1H 1GY1A 1BCIA 1AJPA 5E1IA 1UXWB 5CSZA 5CHNB 5DZNA 2VZUA 2Q2LA 3F7YB 3GMRB 3TETA 1JRHI 1P9MC 5C6TH 3RX5A 5GZOD 4QHNB 1I7ZA 4Z7WF 3ILDA 1MVUB 2QSQA 2WLIA 2VAAB 3B37A 5EA0L 3U1SH 3MGAA 3LD8B 4LVOC 3G5YA 2Z6FA 4N26A 3N85H 4LNRA 1T21A 3SE3A 3U0PB 1YNTB 2R7EB 4TNVF 4HIHA 1IILE 2R1WB 4DR4B 2OI9B 2QMKA 4Q8BA 4KPHL 3S4SG 4AI8A 2DQ3A 5GRYA 3UTTB 4NQCE 4JZGA 3QZMA 3II2A 1OAYL 2BIMA 4U1GC 2B1HH 2AK4D 4I7ZB 3A0OA 4IOSA 3GMOA 4N8UA 4UIMB 5I76A 1DL7L 4KQ3L 3WOVA 3CXHK 5JORB 3DX2A 4KO7A 2QSTA 3Q2LA 3BT2L 1WS8A 3GIZL 1UWGL 3VD2A 1HIMH 4R84A 5TH2A 5F3BA 3WJMA 1HDMA 2QE7G 1IQWL 3SHSA 1FCCA 1W8OA 4DR2O 2W0FA 2NY7H 5JIHA 4OKVB 5EC2A 2CBTA 4AJYV 3ULVH 3NEXA 4OKDA 5CGTA 2Z35B 3M7OA 3QRGL 3LSUA 1DZBA 1ZMYA 5E4AA 4GKLA 1J0YA 5HHME 4NM8L 2WVVB 1MABG 4P9HH 3B2DC 3EBAA 1RZIA 1TLMA 1BQSA 4J3VA 4Q4IA 5EBMB 5HI4D 1A9EB 3MLTB 4S1SL 1EWHA 4FMFA 1OB0A 4V1DE 1P7QB 1VKXA 1WZAA 3IGFA 3VI3F 4B3EA 2O5NA 4Y2DC 1Z5YD 5JTWA 1I9RL 5EF1A 4WWNA 1FLRH 4F57H 4Z76A 4ZMOA 3BXNA 8PAZA 3K57A 4Z7IA 5CUSL 1C5BL 3VSQA 4G5AA 2O6CA 5GGQL 4OI7A 1QI3A 2AXGA 3W7SA 4NC0B 5FYKL 5JOFB 2BZ7A 1H8HG 2HWZL 3LQAH 4DTGH 4ZXBC 4X6DA 3NCBB 3CH1A 4DR6B 3G6AB 3WUWA 1U3ZA 1IBMO 2AEIT 5ISZB 2HRLA 5ECGA 2UXXA 4UM9B 4LSRH 1P1VA 3MREA 3B9KA 3BP7B 3VG0H 4B41A 5FYLE 3FB6A 5DZPA 5JHDE 5BS0B 3HMXA 3TV3H 4BUGA 5ITBL 3TGXA 2ADYA 1TYJA 3ARRA 3TN0A 4WIQA 1KPRA 3RJOA 3KH4A 2ITCC 4MZIA 1KIPA 4Y19D 4ZO8A 5DK3A 4Z3HA 4KRLB 4DR5O 2O6EA 2X88A 2YS4A 3MRNA 5C0DB 2FJUB 3L1FA 3K0GA 5HJ3A 4BBWA 1GGCL 4I55B 3DV6B 3FRPA 2B1GA 4B9CA 4IBSA 5I1EH 5LHGA 4XCNB 1TSHA 2Q76B 1M4UA 1VQNV 3RI5K 4E0RA 2Z3YA 2WVUA 3STZC 4JKNA 3MXVL 3OGCA 4WFED 5E6UB 4GSQA 2AQ3A 2B0SL 1GHFH 5FYJD 3LNMB 1HCZA 3WIHH 2FYVA 4XC3H 5EEZA 1NPJA 3N1QC 1CLYL 1VQMV 2OYLA 4DUZO 2GUZA 2XA8L 4OZFB 1QLRA 3QNZA 2XWBA 3EHBC 1ZHNB 5IOPB 1MXDA 5C0IA 1AGEB 3CIQA 4DUYB 1KLFB 3KNBB 2CTQA 4YSUA 3BIKB 3HEIB 2F74A 4XPBH 1T80A 4LEXL 2JQZA 2PPCA 3PQYE 4OX9O 2ZXBA 3FRPG 4OLXH 5DK0A 3RY5A 2FH8A 2VDNL 5D4HA 3DMMB 2ZAHA 2LFSA 4D7BA 3CWGA 3NJHA 4HD5A 1VF7A 2CUMA 1T0PB 4ZBMA 2HG0A 2YEVA 3V9EA 1JRHH 4KFMA 2KDYA 2VDRH 3ROLA 3NT0A 1N32B 4F15B 3T2NL 5ICYA 1CGWA 2V2WA 1JNHB 4XWOC 2XYBA 3GRWL 2FIKA 4OGAC 5IJVB 1UZ6E 2XN9A 4N2BA 3RNKA 1X6LA 5HFMA 1U36A 4WWOA 2VLLB 2VOTA 3NPSC 4FZ8H 4ODSH 4X98B 3TH4T 5IJBC 4F8QA 1XVSA 1ZHKA 4GSDL 1VPOL 5TGBA 3UJJH 3T2MA 3BKML 1M6UA 3WGVB 3ETDA 1DLFH 4UI2A 4DV5B 4GG8A 2ZX8A 3SDXE 5CS7A 5A3IC 1OSYA 1GCYA 3EZJB 2R0LL 3UEQA 2FNBA 4YO0A 3V8CA 5A2CA 2B39A 2Q9OA 2XLLA 1XILA 2HRGA 4LVNB 3KYMB 4B9KC 4IJTA 4N6RB 4L4TA 3EYUH 1RL1A 2X3BA 4N5EC 5FM8A 1T2QH 1H3PL 3PE9A 1JXKA 4IKLA 3D5OF 3KBPA 4MA8H 4NRYA 2H2SC 3QHZL 1SEQH 4QRRB 3WKMH 4LF3B 2H3NA 1ZTMA 1FXVA 1QWNA 2P52A 3OUFA 5SWZA 3VXQA 4B3RB 1F4MA 1U41A 2WXNA 1U2YA 4FJ6A 4DP5X 3KLAA 1R5IB 5C9JB 3HVDA 3BAXA 1EEZB 5F9OH 2P6JA 5A16B 4I4TA 4F6EA 2NLJC 2XTJB 4GSRA 2P4AB 4ZD3L 3O2DL 1LDPH 1DBJL 3UAAA 3HBGA 4NQUA 4TQEH 4B50A 1OOAA 4P46A 3FU8A 4K7PL 2IH1C 2TSBA 3G6DL 3VWKB 4U3SB 5LBSL 2X4OA 5EN3A 4J1UA 3O3DA 2F7OA 1NL0H 3ABUA 4Z7VE 1VF5C 2VN4A 4KAQH 1UD8A 2K3HA 4Z0BH 3O2VL 5F7MC 4CC5A 2I32A 3KYNA 5HDQH 1L5GB 2XFXB 4NXNO 5IVZB 3WS6A 1U6AH 4PJGE 3TVMA 4YPGA 3A4AA 1HINL 2KYIA 3IGAB 4XCEB 4GFTB 4X6BB 1XH2A 2ZYHA 2BX5A 5IWAB 5B5EZ 5E8NB 1WIOA 5TF1L 1K4DA 2FD6H 2NNAB 1MFBL 4LRIC 1HU8A 3V0VA 3D9AH 2BLFA 2JJTA 3HLAB 3MOBH 5L2KA 1G1YA 3DETD 1COWG 1QBMH 2Y6SD 4MMZB 1MF2L 1XMEB 2W88A 3ZHUA 4RH4A 2RQ8A 1NT2B 3IJ9A 3RX8A 3HPJA 4WSJA 1NCIA 3H9YA 2AXWA 3ZHDA 1AR4A 3QNEA 1LE9A 1TG8A 4QJ3B 3Q6FA 2KKQA 2IIJA 4MD0A 4DKFL 1WT5C 3HE7C 5A2KH 2HLFC 4WO4D 2P80A 3ZKND 4Z1MG 6PAZA 2E6PA 3CSYA 2NX5D 5LBQA 1QAWA 4FNLH 1JYVA 5F8RC 5ICXB 3T09A 3E0GA 3D39B 4F5CE 4TVPE 4RDQG 4E9TA 2P46B 4NKMB 3TEXA 4JMNA 4I4WA 1RULL 2C34A 5J89A 2IV8A 2J2ZB 5CA0B 3BVOA 2BTOA 2NUTB 2DN7A 3BUDA 1IVTA 3ZSTA 5GISL 3S3XA 2BO0A 2AJZA 4XZUA 2WAMA 4AILC 1HNZO 4LGRB 4BK4A 2R83A 3SCMB 4XNZC 2ZXQA 4NEHB 2CGRH 2ZXGA 4TSAH 3LEXB 2EDQA 4TV3A 1H2KA 3DIFB 3ASNB 1XMOO 4O58H 1FXKB 1FFRA 2V2XB 4MNGA 1LWHA 4A2GA 4Q6IA 2EH8L 4FN0A 2J6WA 5EZIH 4UCTA 2IBZH 3K3WA 3NJJA 4F7EB 3IFOA 3CSGA 3I6LE 4FMVA 3AG3C 4D8PA 4PVLA 1YEHH 2AKRA 3QZWA 4WGVB 5CD3B 1TTUA 2CWRA 1MRDL 4DP1X 2C1PB 2UXDB 3N0AA 5E2WL 4OJEH 4ZO9A 3CSTA 5A7BA 4B97A 5LVEA 2AJ3A 5BUGA 5B1BB 1XF5B 3NTCL 1JDDA 1S9WA 1W0VB 4MTMA 4ICWA 4S1DD 5J3HD 2JQMA 4RMSA 1FL5A 2H6PB 3K2UL 4ONFH 3CN1A 4GW1A 1ZT1A 2HFFB 2V0AA 4OF8A 4HXBL 1KZYA 3RZCA 5BRQA 5JXEC 4JPQA 3K9AA 5HGDB 2BOBA 1BZ9B 2J43A 1PG7W 1JNLH 3NZUA 4JPVL 1ES0A 5D2NC 3SE9H 2GTAA 3OAYH 3TJTA 3W7UA 3VFGL 4KXBA 3QFDA 4GPVA 2XETA 3VYPA 2PYED 3DBSA 2W9LA 3LQZA 3AABA 5BJTA 4U0QB 3VD9A 4G82A 2HJFA 4EJ1C 4FVMA 15C8H 4OFDA 3HKCA 1ZD6A 2CR3A 4GX0A 1JIBA 3FT3A 2FUQA 2VYRE 2GHZA 4JM2D 2XV6B 1LO4H 1XB8A 4OUUA 5F1OB 3MRMB 2V3EA 1XGPB 4ZUWB 1G4RA 2VT0A 3OT7A 2GK0B 1EHLL 4U1JA 4UU9B 1S77D 1J7VR 4A7VA 4BIUA 1L8DA 5EOQH 1AG0A 3GKZA 1KCUL 4JO4L 4J8QA 5DC9B 1G4MA 1DTOA 1Y0LB 1U95B 3D18A 3OPUA 5AW9B 1UA6L 4QLRA 1BYPA 2BXYA 2IH8A 3QPXH 3EOAA 3TPUB 1OCRB 1UZ6F 3FO9B 1OQOA 2QR0B 2UY6A 2WJ7A 3C6SB 4JHVA 4ZX5A 3JAWA 4I88A 1CPUA 3CFDA 5KAQG 5DK2B 1MWAA 4E5XA 3ZE1B 2OYKA 1IM9B 2X89A 1R3JB 1E67A 1X7SA 2EYTA 1T3FA 3KM2A 5DJ8A 4Z3IA 4HALA 2DWYA 2E9BA 3P0VL 3VNYA 2XHBA 2FDBP 1L6XA 2CK0H 3OZ9H 5EEUA 3TH3T 4NB5A 4AQ1B 1XGYL 1PFCA 4M8RA 4P48A 1DBAH 2ZOLB 2JDIG 3DVFA 2X3CA 4OCYL 5FYKD 4A39A 2XRAL 3LPPA 4LWSB 1LYQA 1BHAA 2ERJB 4AT6A 2LR4A 2WLZA 3S96A 3NEOA 4NO5B 2ZKYA 2WLLA 1Y1UA 4ZFFA 5HSFA 4KJYA 4UTAA 3BA9A 1CN4A 1WQVT 3KWWB 2B4CC 3S8FB 2X44D 2ZUVA 3ULAB 3MKKA 3EYOB 3QCVL 1DQDL 2DD8H 3DX8A 4PRPD 2VSKB 4S1RH 5AOIA 4XC1H 1MCWW 4H8PA 4IMKA 1A5FL 1NMBL 1D7BA 1JFFB 2QMJA 1GR7A 4MAYC 3MNWA 1IGMH 5J1TC 5E9DA 2V7NA 3N43F 4Y2LA 1I4FB 3REVB 4FQ2L 5CIPH 1NAMA 1RZ7H 1PD6A 1KB5H 3AT9A 4AIOA 4IOIB 3CVCA 1NVPD 1DBKL 1MLBB 3I9AA 4AMKL 1BD2B 4ZW8A 1B4JH 2A6JA 1LK2B 2H2PC 5AL8A 4UT7L 3UTSB 1CL7I 1Z3RA 5AB2A 5KG9A 1R3HA 1FHGA 5CN1A 4JO3H 2NQCA 5I24A 3IDXL 5C97A 1QPPA 2GBUA 1CXHA 4A7GF 1XCQB 3C6LD 3E1ZA 4Y4KA 3Q2WA 2DQCL 2WXJA 4F2MA 1FZJB 4LPWA 1OP9A 4OZ4A 4PJGF 2R29A 1NAKH 1MFDL 1I1FB 5JHLH 2NXYB 1IZKA 3G5ZA 1GGTA 1CWVA 1WFNA 1UGKA 1PVHA 2OMWB 3U0ZA 1AFVH 3LEYH 5CEZE 1C7SA 4DR2B 2P28B 4NRZB 4NWUH 4EI5B 5I2IB 4JQIL 1XGUB 5LOVA 4NPYB 4XT1C 4UAOC 1ML0A 1RZ8B 4ZMAT 1XXFC 3L54A 1WEJH 2VW7A 3OXRA 4OCWL 3CYOA 1H8OA 3RB5A 3RKDC 4ANXA 1PDKB 4DPBX 5AUMB 3O11B 1KBBA 25C8H 5IK3A 2ZJSL 5C86A 5CCKL 1Y74B 3B2PA 3TU6A 5KAIZ 1XF3B 5EO9B 3RYMA 2V4LA 2FHCA 4YFLI 5E2TH 2EEAA 2JB5H 1ZPUA 5D5ME 5EZOL 1BF5A 3VRJB 1RUPH 4OD1L 1QLFB 5HHXL 3GLDA 5FFGA 2NNXA 3D6GA 1JNNL 5CEYA 1S4IA 3DXRB 4FIPC 1UACH 2P8LB 1S9VA 3HZMA 3O8XC 2ADJA 4IRJD 1YDPA 4P2OC 3FONA 4JI2B 4ZUUA 3REWA 2W60B 2L7UA 4MJ5B 2PTTA 4CADB 3GI8H 3M45A 2TRHA 4YDLB 3NJXA 2C7UB 4HWZB 1Z9SA 2XWJB 3HC2A 5FUCE 5AEAA 1GAFL 4HSQA 1MCDA 2APXA 2B77A 3TGUH 3SE8H 2W0FC 4I0KA 2EECA 3RGBA 1IBMB 2HFTA 4NP9A 3T65B 3TCXA 4AG4H 3N2GA 5BRZB 3UM7A 2NNRA 1JI1A 1Y6MR 1NEZG 3PGCB 1G7IA 5FYLH 3ETGA 3KCXA 1D5XA 1U3HB 3QUMB 4ZPTA 3GSNB 1X9QA 2UXVA 4M5SA 3X2QB 1SQFA 5CLYA 3QEQD 1GN3A 4UB8Z 1DDTA 1CD1A 4UTBL 2KMWA 1E30A 1TTGA 5FAAA 5IGXH 2EIMC 4BIZA 2XICA 2YRBA 3CFBB 4PQXA 4QOKD 5EBWA 3AQYA 3KPOB 4NUJB 4FFKA 2AK4E 1HKLL 1MFAL 3MJ8B 3T1FB 4DR5B 1ZIBA 4KO6A 1ZE3C 3FO1A 1HILA 5B4MD 4ZFOL 2XOTA 5J6HB 2Y5QA 1YY9C 4ODHL 4MVSA 2P48B 1QW9A 5BXZA 2VL5A 3JWDL 4P9OA 3EO9H 4IKKA 4ZQTA 2ZNWA 4ZDHB 5DI8B 1L7TH 1AZCA 5CN2A 4XO3A 4W4OC 4ZMZA 3EYVA 2BNRA 3QJUB 5EU5A 3EG9B 4AC2A 1C5CH 4R4ND 1DQLH 4FTVA 5LXGH 3OMZA 2F7RA 2K6WA 3QAQA 3RWHA 4GKSA 1S3KH 4BH7A 2DDQH 1S78C 1IM3A 2DKUA 2DQDH 1OAQL 1OCOB 3QI9B 4JG0H 4OM1L 4G7QB 3QIBB 1NQBA 3IETA 4MTXA 3FB6C 1T5XB 1KTJA 5I23A 3ZT5A 3K71B 4BUHA 1FYTA 3QWQB 1AJ7H 4ZYKB 2VDOB 4Y4HA 3AU0A 2NXZB 1S2EA 2Y3AA 4GMSH 5D8JH 2AI0L 1MCOH 3X1GA 4WLCA 2E8YA 2HLAB 3LSOA 3CQPA 1XGTA 5C0NC 4F1ZA 4UZSA 3H1LH 1NBCA 1GTOA 4H33A 1DTUA 1T1YA 2XKSA 4X6CE 5D96C 2ITDA 5ADPL 4DGVL 5I9QC 2LTQC 8FABA 1ACYL 2G38A 1UM5L 4LLQA 3FQTB 2MOQA 3B5GA 4BWAA 1UCBL 4AGPA 2GSMB 4BGLA 4EZMA 5CB4A 1JTPA 1U92B 1OTTC 3ZRCC 3FB5C 1IBGH 1V9PA 4JVPA 3U6XA 4XRCA 2Y0IA 1AR2A 2QKIB 5JW4N 3IRZA 1M53A 1TVBA 4U1HB 1YMMA 4J80A 4F9LC 1ND0B 1YECH 4LSUH 4Y19E 3CEIA 2JKWA 5DFWH 3D3VA 3P32A 1OD9A 2UWEE 2Z91B 4UV4H 4I5SA 5E95B 3VFUA 3F7VC 4C57C 5F7NC 4C58B 5K9JH 3SYCA 3BY6A 4JFTA 4ZFZB 4H13B 3GWKC 4W4KA 4KXZH 5C92A 4NNXB 2HVJA 2HJKB 4PJEE 3NCMA 1HCFX 2NZ9D 4N3TA 5CJXA 3QZBA 5KUKA 4HLZH 5GHWL 4AJ0A 2LE9A 4WFEE 5FYJE 1Y1DA 1OIOA 4U6XA 3JD0A 3MUY1 3CSFA 4S2SB 3ZMEA 4JG1H 1QTSA 3C5JB 4LFBB 5ETUA 5H8DA 5TK4A 1D5RA 3D12B 2AVFA 3CUPB 5D1ZD 3LRKA 2EDXA 5KYUB 4UV9A 3GLAA 4HK0B 4N2OA 3LY6A 2X6AA 1KXVA 5BVPL 3O6ML 4N24A 3AAZB 3WDHA 5IVXB 2R4RH 2J1KA 1MI5D 3HZKA 4DN3L 4HJGB 1QBBA 4AH2A 5ESVA 2WSKA 4B5EA 5MEOB 1N18A 2DV6A 5CU5A 4OQ1A 2Y1AA 3QQ3A 3JARB 3SDAC 3BGMA 4G28B 4KGLA 1ASPA 1DUYB 3KHOA 4DEPC 4NX0A 4P4KA 5DEFA 4NUPA 5EZPA 2WYZA 4BFFA 2VC2L 2Q5ZA 3GSVA 1WICA 2VITA 3FB7C 3P3UA 5FM4A 5J57B 5DWUL 1KPUB 4XVTL 3ZRVA 1QFOA 4XOCA 3VE0A 1IGCH 3ALXA 5CZXC 3RWDA 3DTXA 3H3PH 2Y9RT 1FG2A 3PHOB 2FECL 3VXRB 4OZFG 5IJ0B 1BYOA 2JKXA 3RTQC 1XO8A 1G1CA 2Y1VA 3BP5A 3Q2CA 4J3OG 3SJCC 3MDSA 1E3FA 1A4JB 1CR9L 3CZNA 1FIGH 1L9TA 5CR8A 2UYLB 3MQIA 5L4FA 3VG9C 1TZGH 1ZSPA 4YDZA 1D6EA 3FO0L 1IV8A 2KZ1B 3QBTB 3GUTB 1AKPA 1Y6NR 1TPXB 4KQ4L 1NQTA 1O9ZA 1A1NB 3IJSA 3ARFC 4ZSOE 4XBGA 3W5NA 1TQUA 4RAVB 5TE7L 3KJ6L 1K5QA 5H37H 1EUUA 2E46A 1U33A 1OWRM 3GUFA 2YBRB 5KW9L 3GDCA 5AB9A 3ARBB 5KTEL 4JY6A 3P1VA 3MHZA 5JOPD 3CZGA 2XPGB 3HFML 2GAZB 1J1PH 3CC4V 2YQGA 3NRQA 4TVPH 1SA0A 1AYRA 3QQDA 3QDGA 4G7SB 1W0WA 4PJ0Z 4TV9A 1BJ1H 2WTPA 5E03A 2G0KA 3L73H 2CE4A 3F64A 4KKRA 2HKOA 1LHZA 2BNQB 5T3ZL 4OQTA 1MFCL 3WJLA 4D9RD 3TZVB 4YDVB 2GPZA 5HHPB 1T04B 1LTXA 3AREA 4GKNB 4X7SH 2JJ2G 4GZRB 5LGHH 1XTMA 4ZO6A 3ZPDA 3IAYA 3ERXA 3UADA 3GC3A 1HNZB 1XD1A 5DMYA 2MOGA 3DSNB 4PCSA 1K2DB 2FL5A 4MAUL 1BFVH 2GHYA 1ONQA 3MLSH 4MQTB 2JIXB 2OJEA 1AZUA 1XMOB 3MLRH 1GC1H 2W65B 4PMFA 3L1GA 2QQQA 1LEGA 2JCWA 5DM6V 3QQ4A 3JATA 4LDLB 2R0KL 2JNZA 4QHMA 2XAFA 1MOFA 2FJHA 3F6IA 1AE6L 4AY0A 3VXNB 1QLEL 2XC8A 4RA3A 3WTWA 2F5AH 3ZTCC 2XG5B 5I1LB 2DJSA 2QVMA 1N6QH 3P9WB 4B27A 2MTPA 4YHMH 4LIQL 3QH3A 1EEQA 2V5TA 3N1FC 4PTUA 3WNIA 3PHAA 4AYFA 2RCSL 3PL6D 1MCQA 5EIBD 3CZLA 2O5ZH 5HGGS 5I76B 3GMOB 1U8KA 1JMKC 2WBKA 3F12B 4LNVA 2VDRB 4M8QA 5JW4Q 5BXFB 1EH9A 3K8KA 2B20A 1QKZH 1GMIA 5TH2B 2WLNA 2VLRD 1HDMB 2UU9O 1G9NC 2XACC 4HLJA 3JXAA 5DUJA 2NX5E 2GABA 1ZSDA 4YDMA 1I9EA 5GZND 4KVPA 2WSSG 1IAOB 2ENSA 3W37A 5EEYA 1B6UA 3KCPB 3MRIA 3EBGA 3O9WD 2X9XA 5KZCD 1Z3GL 4NYLB 3RDTB 4X83A 1RQ5A 4J6RH 4K3DL 4BCYA 4OZIE 1ZA6A 2X4NA 5AQ0A 4O4IA 4PG9B 3UP6A 7FABL 1FA4A 2VN3A 3BI9X 4HZLB 2VDMH 1MLCB 5CBAA 4PJFA 3IEAA 4XMKH 3QUZD 4X6CF 3D2UA 4L37B 1XMWA 3BEHA 1GMEA 3UABA 2R70A 2BSRA 1JERA 5E6ID 5ACMA 3EFFA 3FQWA 1UJ3B 4HEPG 4WUUD 1IZJA 2WLJA 4RGNB 1QPKA 2ZKHL 4XMPL 4Z7WB 2F2HA 2GBAA 4DVRH 3WUWB 4PJ8A 2GJPA 3SDCA 5IHWA 4Q2ZB 3P4MB 4PELA 5HHNA 3D8MA 2EAEA 3W9DB 3HS0B 3F2LA 2OZ4H 4HIXL 1SXSA 2EXTA 4TUJB 2HJFC 2FLMA 4NM4H 2H3OA 2HCZX 3VOUA 2NSQA 2VSMB 3IN0A 1PY4A 1X7QB 2UWEF 3TN0B 1J9TA 3ME0B 4Z7UE 2Z8VC 4X5QA 3MV7E 3WFCH 1LO2L 2YSTA 2HVBA 2MIZA 4GW5B 5J4MA 5AYQA 3WN5B 2N74A 3AB0B 3QJZA 4HFUH 4PJEF 1H38A 3GMMB 4PVNA 4EXPX 1QOKA 4BUQA 2ZWNA 3W0WD 4L2LA 1ZY9A 2D7TL 4I50A 4KGJA 5JWPA 2YMTA 2XY1A 4Q6GA 3BP6B 1ETB1 3LH2L 4L3AA 1BXUA 1JPSL 1M7UA 1Q72L 2A0LD 1FFXA 3HG2A 1QW8A 3B9AA 3D85A 4XCCL 2FSEB 3KCWA 2PYEE 2ENYA 3BO8A 4E2OA 1VFMA 3F58H 3CDFA 3ZCCA 3K2KA 3LKPB 4O4HA 2W95A 1TU2B 1E27A 3KPSB 5EDXA 3QWOB 3SDDA 4AGMA 4UQ2A 3TA3B 2R4SH 1E90A 3ECBB 3I85A 2H3XC 1VEPA 2G3XA 4O02A 2GC4C 3C5ZA 1VFBA 3VI3B 3JALB 2IU0A 2DH2A 3IDNA 3QDMA 3QIUC 4I18A 4OCSH 5T1LB 4C8XA 1C12B 1RFYA 3AROA 3WYRA 2CHDA 3N2JA 3CMGA 3KGSA 3V0IA 4JPRA 3V4VH 2C9QA 1USQA 1ZANL 4PJBA 4RAUA 4WWKA 1E4KA 3WG7C