2EINB

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2einB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2einB02
2GB2A 3ABMB 1N70A 4JHVA 4YL4A 4DPAX 1GSKA 3IN2A 2VSKB 4NERA 2TSBA 1JZHA 1AS7A 1J9QA 3QJVB 2XVBA 5AFAA 4AI7A 2UX7A 4AKQA 1SF5A 4BWTA 2PPAA 4M4RB 4X4KA 1L9SA 1X9RA 4KO9A 4TXVB 4A2HA 2QDVA 2CUAA 1NTDA 3T71A 1CUOA 2FQEA 4BXSV 4YSUA 3NP4A 4YSPA 5D4HA 2VSMB 1JVOA 1AZBA 4FA7B 2IDSA 1A4CA 1SDDA 3FS9A 3H4HA 4HIPA 1M56B 4HHGA 1AS6A 2AANA 2GBAA 1L9RA 3DTUB 4K9JA 3SQRA 3OMAB 1MDAA 1FWXA 1OV8A 2GIMA 2BWIA 2PLTA 4DP4X 3FQ2A 2HX8A 3G5WA 2XX0A 3WKQA 4M3HA 1ID2A 3TA4D 3FQ1A 4YVNA 5ANHA 1AG6A 4BDVA 1M57B 2Q9OA 3MX0B 4FAAB 2FNWA 3HB3B 3UABA 1L9QA 3TBBA 3FSAA 1KCWA 2FJSA 3ERXA 2A3TA 3QJTB 4DP9X 1BQ5A 2GC7C 3V9EA 5I5JA 4CSZA 4CSPA 1JZIA 2QPEB 1JXGA 4HHWA 2OJ1A 1A8ZA 5TK2A 3X2QB 4DP8X 2EIJB 1GS7A 2PP7A 3NSDA 2OCCB 1RZQA 4YVUA 4YSAA 3CDZB 3OM3B 1J5CA 1GYCA 4WTQA 4BK5C 1PZBA 3NJFA 3NJMA 4AX3A 1SHXA 2ZXWB 2DY2A 3FSVA 1URIA 2ZOOA 1TU2A 5I6MA 1BAWA 2XUWA 5I26A 2YAFA 2PP8A 1ILUA 2FQGA 1KCBA 1ILSA 3AZUA 3KW7A 1WS8A 1E65A 1SFHA 2VW4A 1OE3A 3D12B 1KV7A 2LLNA 4F2EA 3X1FA 2IH9A 2EIKB 5D4JA 2J5WA 4G71B 4A2GA 1KBWA 5A7EA 1ET5A 3GXUB 1EHKB 3OD3A 5D4IA 2YARA 3DKHA 1W6LA 2XX1A 4DPCX 2EIMB 3QJSB 3QJUB 1CURA 1J5DA 1BYPA 1YLBB 2W88A 1V10A 5B1KA 5I5MA 4KNSA 2GSMB 3FQYA 4G70B 2WO2B 2N0MA 2PP9A 5I6LA 3UACA 2WO3B 5I28A 2Y69B 2Y1AA 4RH4A 4N4YB 2FT8A 5I6OA 1PLAA 1PLCA 1GY1A 1PZAA 5PCYA 3FPXA 4DP5X 5AZUA 4E9TA 1JZFA 3NT0A 1RKRA 4PCYA 1R1CA 7PCYA 4E9RA 3BQVA 2AFNA 3IEAA 3T9WA 3AG2B 1J9SA 1TEFA 4ZK8A 2XV3A 2MRYA 3OMIB 4A2DA 1CYWA 1ADWA 1N68A 4A66A 5PAZA 3CZUB 3PAVA 2DYRB 4YSRA 1GY2A 3UADA 4HCIA 4G7RB 2CJ3A 3T6VA 2GC4C 1MZZA 3WIAA 1UATA 1F56A 1WAEA 5I6PA 3IE9A 4BWUA 2YEVB 3N2JA 1BQRA 1PMYA 5B1JC 2JXMA 1E30A 2VM3A 3ASOB 1AQ8A 1AACA 2BZCA 5TK4A 1FFTB 3TASA 3QJRB 1FA4A 2NRDA 2RACA 4WKXA 1JVLA 2I7OA 1BEXA 5IY5B 1AZRA 1NIAA 2DV6A 3S3BB 3FYIB 2PPFA 1BXUA 1IC0A 1ETJA 1NIFA 3ABKB 2BO0A 2X88A 2BP8B 3NJNA 4MFHA 3NSFA 2IWFA 3NJGA 1T5KA 3NJHA 3AG1B 5AKRA 1GS6X 2HRGA 1W8EA 3AG4B 3RYMA 1BYOA 1PNDA 2DYSB 3EHBB 1OCCB 2HRHA 2J56A 1NICA 2VM4A 9PCYA 3KW8A 3FSZA 3SBQA 4KOCA 2YAMA 4QKTA 3T6ZA 4Q8BA 1ZV2A 4BXVA 1ZIAA 2H5UA 4E9WA 3JTBA 1ASOA 1KDIA 1PZCA 4JHUA 1XB8A 1XMEB 4GY4A 4KO6A 2UXFA 4KNTA 3EH5B 1V55B 2IDTA 1NIBA 1X9UA 3UGEA 2AVFA 1RCYA 2JKWA 2BW4A 2VMJA 2XV0A 1JOIA 2ZONA 4F2FA 1J9RA 1J9TA 1RZPA 4E9YA 4E9SA 1IBYA 4GYBA 2XXFA 4G7SB 4KO7A 3FSWA 3UAEA 4EF3A 3OMNB 1QNIA 2QPDB 1B3IA 4NB7A 1NIEA 3H56A 2PPDA 3QJQB 4YSSA 2YAEA 1ASQA 3PXLA 3ZIYA 4N8UA 3SBPA 1AZCA 3IN0A 3ABLB 5I6KA 1ZDQA 4L0PB 2HXAA 4P5SA 2J55A 4G72B 2B3IA 4HZ1A 4DP7X 3QPKA 3GDCA 5B1BB 3PCYA 2MTAA 1QLEB 3FU9A 1OCOB 1NPNA 1XB3A 5B7FA 1NINA 2FTAA 4YSTA 4PAZA 1PCSA 1OCZB 1CYXA 1AOZA 4GP5B 2FQFA 2I7SA 2IWEA 1EZLA 2UXVA 3AG3B 4GP4B 2H47C 2QDWA 3X1GA 1OF0A 2BZ7A 1E5YA 1SFDA 2YAHA 2BP0A 1WA1X 2EILB 1PLBA 3EH3B 2BHFA 1PNCA 4KOBA 1JERA 1CC3A 2VW6A 2BP8A 1SHWA 2IAAC 3FPYA 3QQXA 2AZUA 3TBCA 3V9CA 1AR1B 3CVBA 4W9ZA 1SF3A 1OE2A 3T6WA 1MG2C 4F7KA 1HAWA 1NDTA 1NWPA 1A4AA 2B08A 2FWLB 3X1EA 2IH8A 3DIVA 3ZBMA 1XB6A 3NJIA 3PAZA 1NPJA 4E9XA 1KBVA 4A67A 4A2EA 2BP0B 1NIDA 2HLEB 2UXGA 1MG3C 3S3DB 2YAQA 2YXWA 2PCYA 4A68A 3PPSA 2IDQA 3T6XA 5EHFA 4HCGA 1A3ZA 5B3SB 1BXVA 4Q89A 2EINB 4UAHA 4AKPA 4DP2X 1E67A 3FYEB 4GXFA 1GR7A 4UF7C 3EH4B 3FT0A 2PPCA 1A65A 1JZGA 1ZDSA 2IDFA 1OOWA 2PPEA 3AW5A 3NYKA 1PAZA 1AZUA 3FU8A 3GYRA 1DYZA 1WA0X 4YSCA 1AAJA 3IBOA 3PLYA 2CAKA 3ZDWA 3AY2A 1MZYA 4JKNA 1SJMA 2YAOA 1A4BA 4DP6X 2CBPA 4E9QA 2XLLA 5B1AB 1DZ0A 1KGYE 2IWKA 2P80D 2QT6A 5B7MA 4G7QB 2Q5BA 3WI9A 7PAZA 2P80A 4KO5A 1QHQA 2J57A 1OE1A 2UX6A 2XV2A 3NJKA 4A2FA 2IDUA 3MBWB 1ASPA 1SNRA 1IBZA 1L9TA 2CALA 4P5RA 3UAAA 2HX7A 3U25A 3WKPA 2XXGA 3CG8A 1AIZA 4GP8B 5I6NA 5F7AA 4YSOA 3ABGA 1PY0A 2WSDA 2TSAA 1E5ZA 2HX9A 4YSDA 1WA2X 1HFUA 3WNJA 3CVCA 1IKOP 1W6WA 5E9NA 1AG0A 2X87A 1SDDB 2YAPA 2HZHA 3SBRA 3N55A 3X1BA 3HEIB 1ZPUA 1AZNA 4QLWA 2W8CA 1IUZA 2BWDA 3TU6A 1GW0A 3S8GB 4DP1X 2XYBA 4ENZA 2I85A 1OCRB 2UXTA 4DPBX 2CCWA 4W1TA 3S3CB 3PAUA 1BQKA 1WS7A 2XWZA 1NZRA 3NJLA 3WG7B 1I53A 2E86A 2PCFA 1ET8A 2YXVA 1ET7A 3S8FB 3H4FA 4BWWA 1HAUA 4HAKA 4KNUA 2DWSA 5F7BA 3NSYA 4HCFA 1M9WA 1JXDA 3CDZA 2JFCA 2FT6A 1NWOA 5FC9A 1L9PA 4UANA 2FT7A 3NP3A 3ASNB 2ZWNA 2YQBA 1BXAA 2DWTA 3ZX1A 1TEGA 3FU7B 4YSEA 4HALA 2GI0A 3C75A 1PF3A 1VLXA 4NAJA 2AZAA 4AKOA 5I5IA 4YSQA 4BDVB 5B1JA 2VW7A 3CVDA 4E9VA 3EF4A 6PAZA 1JZEA 5LDUA 2R7EB 2R7EA 1JZJA 1KDJA 2H3XC 1V54B 3BVDB 8PAZA 3WNIA 2BW5A 2GHZA 4DP0X 3X1NA 1AANA 1ZIBA 1TKWA 3NJJA 3JT2A 6PCYA 3OQRA 1L9OA 2VN3A 2OV0A 5B7EA 3L45A 2FQDA 4AZUA 3NSCA 1AS8A 2XU9A 1GS8A 1JXFA 3FU7A 1KYAA
chains in the Genus database with same CATH superfamily
3HBPA 5GJSL 5IB1B 4P5KB 1CPYA 2IW5A 3KHOA 5KZCD 4JI0O 4WSJA 2YGPA 3VI4F 3MRMA 1JZHA 4Y4FA 3KPRA 3QCUL 2JIZG 4TTDC 4QNPE 4EKXA 5KEZA 4I50B 2Y4SA 3LD8C 4ENED 5KSAD 2AW9A 5J2UB 1QAWA 2EP6A 3LKSA 3O6FA 2ZG1A 1HL9A 5JTWA 1SF5A 1FJGB 4MNQB 2CJSA 4BFNA 3L5JA 4U1NA 5CR8A 1KD1W 1A6PA 4CH6A 4GQRA 1BFVL 2YD3A 4L3CB 4UB0L 3FB5A 5DJYB 5D2LF 3PF2A 3EHBD 5I71B 1ZTXH 2XN1A 3K2UL 2AI0L 1M7DA 4URTB 3LNMB 5IWAB 4KKQA 3EO0B 1FJ1A 5SWSD 3WFCL 5SX4H 2A1WL 2BNQA 4MVUA 4JFZH 4S1QL 1ZGLB 1KTLA 1PX3A 4L3EE 3WO4B 1M56B 4AYFB 3MNZB 2VXVH 5KSBB 2NSXA 4AL8C 1S5IL 4JI2B 5JYLA 3V79C 4Y4KA 1K5NA 4CU6A 5MEND 2ZR2A 2X70A 3MMEB 2VLKD 5I1CL 5JQ6L 3HMXL 4DEWA 4PGEA 2C26A 5IJ9A 2OP4H 2P7TA 3ASWA 3PWNB 4EJ1C 4FKKA 2KS0A 4WI5A 2WNXA 3QI9B 2AKRA 4LBEB 4LWSB 4QLRA 4TLTA 5GGQH 1ES0B 1HOEA 4NHUB 4PJHA 4GJTB 4N20A 3QDMD 1SZNA 2FATL 1K9TA 1L9QA 1VKXB 5FYJD 4FK5C 2O5ZH 3HPJB 3FT2B 1UYWL 3QRGL 4QD2E 2CXGA 1YEEL 3K0GA 1RM1C 4B97A 2JIXA 3RWFA 1KB5L 3I6SA 3WNLA 4Y5YC 4F7CB 1HDJA 1QFUH 4BRVA 3TN0A 4JFFE 4EXKA 5T5FH 3CDCA 2LFGA 1AY1L 4DKFL 3ZKXB 1WF5A 3MREA 3UG4A 3IGLA 5LHIA 1LO5A 1FCGA 3GJEB 1MCLA 3R4DA 3PGDB 2F1MA 1TZOA 3I9GL 4M9PA 4BH8B 1DQMH 1ANUA 1OVZA 1Q72L 3KW7A 1KJ2H 2N7BA 4JF3A 2RFXB 5IB3A 1RHHA 1FL6A 2DDQH 3TJHC 3P02A 5H35A 3LKNA 5FB8A 3AWEA 2EIKB 4LKXA 2J5WA 3UO1L 3P32A 2E74B 3I2CL 1HXYA 2HEPA 3DOHA 5T3ZE 1PPJH 3X12B 4NEHB 5J9PC 1P4BL 1Z0MA 5E5UB 5CAYB 3OR7A 5IJ0B 5ANMB 2VXQH 4BINA 2QV4A 2H9GB 2YARA 2X5PA 2LJ2A 1F41A 3QUZB 3CP1A 3SYCA 3FTGB 2E47A 1CURA 1FNAA 4IOFC 3GSXB 4PGDB 4PDVA 1V10A 2W88A 4FXGB 4EIGB 5BRZE 5LP6A 3T8MA 2QDOA 2NUPB 1FZKA 1H9VA 5EA0L 1U3HA 4OT1L 3JD1A 1OTSC 3T1FB 1KACB 5C92A 2X6CA 1YDPB 5DN6G 2K0RA 4TUOA 5GHWH 1IGYB 4JY5L 3DMMC 1OHQA 4G1MB 2WSSG 1ZHNB 1RAMA 3TJEH 1PZ5B 1TJHH 2NT0A 1KBPA 5GZNC 2IGFL 1NGZA 1MFCL 4U6TA 4JN1H 4R50A 3DX2A 4DTGL 3BT2L 4IGBC 3DMMD 2APXA 4C57C 4XCYA 1E9QB 3HKFA 3S98A 5LOVB 1ZVHA 5I75B 3FO1B 2QLVB 2Y7QA 1PLGL 3QJOA 1IX2A 3JCZA 2Z35B 3RAJL 3KLAB 2VZOA 5HVGB 4QCIA 3U0WL 1ZT7B 5D1QA 4E9LA 2A06H 4PJ9A 5CMAA 3U4EB 1W0KG 4WUUA 3I2CH 5E6YA 1TUBB 2JJTC 4F5CA 4YXLL 4AMKL 3BKCL 4WW1A 2W1NA 4B9YA 1MFEL 4ELMF 5EN2A 3WIAA 1GA2A 4X5WA 4KKBC 1XGRB 4BWUA 2YSTA 4QIRA 4R83A 1CR9L 3G3LA 4U2ZA 5TQ0H 2AJVH 1HSBA 3EZJB 4F57L 1MJ7H 1ZHLB 1F4MA 3E2EA 1K3ZA 1MFEH 2PCPA 3OR7C 2XZAL 2XJLA 2OTWA 5FXCH 1BOGB 1KFAH 4H88L 3W3BA 2YEZA 3GHBL 4GKKB 1Y74A 4J7ZA 1KBKA 5F7DA 1XF3A 3KPPB 1FI8C 2FX9L 3W2DH 1S7VB 4R0LA 2XCMC 3FOMA 1IE5A 1N0XH 4WU5B 1N10A 2CBOA 4JJ5A 1JNHB 4D2NA 4FL4C 4AM0A 4A63A 1IEAB 1J8HE 4I18C 4OGXL 3SDDA 4XHJD 2CAZC 5IJCC 3N27A 3CPWU 3ZT7A 2BSBA 2P26A 4P05A 1JYVA 3NTCH 5LMNO 4JGUA 1GS6X 4JAVA 8CGTA 2ZX9A 2RNBA 2Y0IA 3RYMA 5C0IB 1ZLDA 5HHMD 3N85L 3C9NA 4R3SA 4NBXB 2UU9B 5HGDB 4HIIB 4KGLA 1B4JH 4IGBA 3RQ3A 5DRNB 3V9FA 3PWUA 1R4XA 1F97A 3CVIH 4XAKD 4EKWA 1GN4A 1ZTEA 4M6OL 5DS2A 5JZ7C 4L8CA 4F9LC 1S77D 3HPLB 4WU7A 3KCPB 5F21B 4A38A 2COQA 4APQC 5T3XD 2F1AA 1ZCRA 5FA4B 3D3QA 2OYPA 1AR4A 5I8OH 3C5SB 3F7QA 2QQLH 1IM3A 1FC2D 2M7WA 1YN6A 2JKWA 1Q9LA 2QPSA 3D0VA 4J3XA 4BKLB 3PYCA 1T22B 4E9SA 3MBEC 2L7UA 4G7SB 2O5ZL 4CMHB 5HHXH 2HA1A 5JMRA 1U8HA 3BVNA 2H32A 3H1JH 4JJOA 5FYLL 4Q97A 3T77B 4E42A 3BZEB 2ZDIC 1MVFA 1FGNL 3B2EE 3P9MB 5F7YC 2GJZA 3KPQA 4J7RA 4P5SA 1P7QB 2XN2A 5CEZE 4PJCF 4B7EA 4HZ1A 3J27A 2C2AA 2BIIA 1KB5B 1I85A 1T5WA 3IPEA 3A67L 3ZHKA 2JJWA 5AAMA 3FFQA 1VFOA 1MNUL 1W80A 2JKJA 4FKHA 3O3DB 4TLSA 4JRYA 5KVFH 3IFNL 3QZBA 4NKMB 2NUTA 4N6RA 4PAZA 2XWXA 1R3JB 1UTDA 3RE0A 4KFZC 3ZSSA 1JSYA 1KELH 3AABA 3IJSA 3RHWK 3MLSL 4JRXD 3ARUA 2EDFA 2VB5A 2IPUG 1A66A 4PM1A 1XCQB 1KCRH 3DX6A 3H0TB 2N74A 1MMMA 3AB0C 3L5XL 5H6QA 5DMGD 2LLGA 3VFVA 2GTSA 2CO6A 1WA1X 4TL4A 1T7WA 4H0LC 1A7BA 1KY6A 3L6FB 3Q8AA 3EH3B 4JM0A 5EUOB 1V27A 3O0RL 3GMNB 2QQKL 3LKOB 3S97C 3MRLB 1K34A 3VFUA 4JHBA 4M7JL 2DMXA 3HNTL 3FQRB 4W81A 4LFBO 5IGXH 2Z92A 4UZSA 4APQA 1Z5HA 3AXLA 4RGNC 5EOQL 2A74C 4FZ8L 4AWJC 1KGUA 5IT2L 5E0QA 5LL6Y 3R1GH 1R3KC 1Q9OA 1KBGL 3ASOC 4XGZB 5T5NF 5DC2A 5IGXL 4DV6O 3S3DB 4N0CD 1JVKA 2YAQA 5TE7H 3RTQA 3FN3A 4DV5B 5D2NA 5A7BA 5L7XH 3RZCD 2W92A 3EJQA 1P1ZB 2B2XL 3PPSA 5FO7B 1D5MB 3L3OB 5C0JB 1MHPH 1S9YB 2EDDA 3ULVF 1WGVA 2W9LA 3BH8B 2Y7OA 3W5MA 1A1NA 4LDOB 1QLEH 5E2UH 2OS7A 1A65A 4FNTA 1WC7A 3FU8A 2DYPA 4E41A 4LSVL 2J20A 5ITBH 4OCYH 1XGPA 2X28A 1K73W 2VWJA 3RRQA 2Y36H 4XPHH 4ZAKA 4TT3G 2Q8AH 4GINA 1YY8B 4NJ9L 1U36A 1A4BA 3A24A 3B56A 1OSPL 4FP8H 4RWHA 3ZE0E 4OF6A 4F57H 5CCJA 3ABTA 2EDTA 4Z95H 4MSWA 4OU3A 3CSGA 1E8XA 2Q5BA 1U2CA 3BFWA 3QXAB 1GGUA 4TNEA 1QHQA 5G4OA 2UX6A 3NJKA 1I7RA 1PAMA 2HKHH 2R27A 3N42B 3JAWA 5AVVB 4NVPA 5KHHA 2V7HA 4Z1MG 3STZA 4HS8L 2R1XB 4IRJB 4KTEL 3SDLA 4Z5RB 2AHZA 3CG8A 3T0BA 4PRHB 1OLZA 2WBJD 2WLKA 4GAAA 5F7FA 3U0WH 2WMPA 2Y9RT 5B1BC 1F00I 2V2WB 4H37A 2I07A 4LT7A 4LXFA 1KYFA 3I3BA 5C0RH 3FB6A 4JV5O 3KLHC 4BFOA 1Z7JA 2VZSA 3WNJA 3HZMB 2VTFA 3UG5A 2HLDG 3ZE1E 2GJ6A 2WQ8A 2JGDA 3P73A 2RJZA 1XEQA 3N55A 1EFRG 1MCOH 1ZS8A 3HG2A 3NFPB 5JDSA 1QLNA 12E8H 4AEFA 1OL0A 2BRQA 3M8OH 4GH7B 3RZCC 2WVVA 1YZBA 4N1CA 3AT8A 4UCUA 4LMQI 4ODWB 1BECA 3CRMA 4QHKI 4MZ2A 4PJBA 1DVZA 5M95B 2X4UA 1BIIB 3WTTA 2X9WA 4FJ6A 4TNFA 2E86A 3E3QE 4FNQA 4OFYA 5F88A 5KBNC 3SB3A 5GRYA 1GVIA 1JRHH 1QW9A 4WFBV 2DWSA 1CLOH 2VJXA 1OP9A 2BS9A 3J81N 4ZO8A 1BQLL 2NNRA 4V33A 3AG4C 4W6WB 5C3LD 2OJEA 4M7LH 1AGDA 4NRXB 4XPTH 3B5GA 3PPEA 4L1HA 1DANU 1JRHL 2FWOB 3H6AA 1U8LB 1W0JG 3BDYL 4JDVB 2YQBA 5CCHE 5LG6A 2Q7HA 1DF4A 5JR1L 5EG6C 2K7PA 3MRIB 1N9PA 5E8PA 3CHQA 3FZUC 2J88H 3WY4A 1TQSA 2HYMA 3TZVA 2EIDA 2CK0L 3NEXA 2Y07L 3S35H 5D8JH 2HJLA 4H8PA 3FQWB 1FLTX 4XVSL 4M93B 4I77L 2RQ8A 4KX7A 3G6DH 2Z0BA 4KROC 2NCMA 5H94A 3RNQA 4E41E 3VQ1C 2GEEA 3ZRWA 1A4KA 1SY6H 5D2LA 5E8OB 5B22A 2OMVA 3HI5L 3FT3A 1VPOH 3IDIB 3JTTB 4XC3H 5DR5H 3NCYP 5DMIH 2CH7A 4JFFB 3UZEC 1L5GB 5D5PA 2FZ3B 3D3VD 5DVLA 3SBWC 3DJSA 1COWG 3GXMA 4Z77B 3G6EV 2IWGA 2UY6B 3C6LB 4AT6A 1KCRL 4NO2A 3UJIL 2CUHA 5JO5A 1KNOB 2CDFA 3DV4A 4MCYB 1CZ8L 2AJXH 1Y6MR 1F18A 3SQBB 2FEEL 5LMUB 1YPZA 1A1OB 1FORH 1B9KA 1CL7I 4PW3A 1DVQA 4JI5O 4XPBL 1TJIH 2I60H 3IDGB 2YXHA 3EDKA 2DWDB 2EIBA 4FFZA 1SRDA 3K5RA 4JPVL 2VIRA 1P84F 2AJUH 1S3KH 1AS7A 1QFHA 3QO7A 3R1GL 4GXUM 5BS0A 1A4JB 4UOQA 3KBFA 2HLAA 1UM6L 1HXMA 5ANME 3SDAD 4MA3B 5AFAA 4G5AA 3IDJA 2NY3B 4U7MA 2QKIA 3VSUA 1W2KT 5T33H 4M6AA 4OFIA 1JPGA 2Z9TA 4JM2F 3BHBB 1E6OH 3SDXB 3WHXA 1FBIL 2M2DA 2CUIA 1HILA 2VLRD 3MRHB 4JW3A 4OLVL 3QORC 1KLFB 2XACC 3GMRA 3M7OA 3KG2A 4A2HA 2V2XA 4KK5C 5DZOA 5E9DB 5E1QA 3SODB 3Q5YA 4CILA 2BNRB 3UP1A 3C09B 4FA7B 3FJTA 4DV2O 4HMCA 1SDDA 3CFJB 3FS9A 4NO5A 3CMEV 1ZL8A 3EFFK 2GTAA 3MJWA 3OXSA 2AW2A 1BVNT 4KDWA 4NQVB 1OAKL 3PREA 3GUTA 4IJ3C 4MAYA 4F8LA 2HX8A 1HN1A 1F3JB 2H8PA 3FQXA 1YEHH 3OF6A 4XRCB 1DEEA 3TA4D 4FZ1A 4YZFE 3LB6C 1FXKC 2DIAA 2ZCHH 5KVMC 2ZP0T 1O6VA 3JZ7A 43CAB 2JKIS 2UZPA 2CRYA 4QNHB 1LJMA 2YSSB 2YRLA 3L71H 4IIJB 4NWUH 5TE6H 1YYMH 3PN1A 1RU9H 2FL5B 3ABZA 4WHYG 5EPMA 5A2CA 4DERA 5D5MA 1V3MA 2FL5A 4PRAA 4FQHB 4D7BA 3FU3A 1BQ5A 4JG1H 1J8HB 5LCVA 5TGBB 2GC7C 43CAA 1VQPV 5E7BA 3WNNA 3WS6A 4ZMOA 1MXGA 3B5TA 5G55A 5T33L 3MA7B 1Q0YL 4ZSOE 1BVZA 2A9ML 2NTFA 3PDOB 4HBCL 4OSUL 4Z0BL 3ARDB 2Z3FA 3SD2A 3CDZB 3DYMA 1J5CA 3GHBH 4NQVA 4BIZA 2BCKA 1ZL8B 1JS4A 4PJDF 2WTPA 4QTHA 2DE0X 2F8OA 1SYSA 1URIA 4IHJB 3PNWB 1T89A 4XVOA 5EC1C 4HETA 3P0GB 4F5CE 2LHAA 3K08A 1B04A 3BGAA 1YAZA 4OX9O 2DJSA 3TZVD 5DHDA 3WD5H 1LEIB 1MFUA 1P49A 4MT8A 1NL0H 3GI8L 3N40F 4I9WE 4MMZB 2QVKA 4OUOA 3WHXB 1DVFA 5IB5A 2Z93A 3W0WA 1I82A 2EBOA 2VH5H 4FQPA 5AVUB 1JGUL 4DR7O 1T7ZA 1M7UA 2NY5H 4NOBA 4PGCB 3TIEA 2Q7NA 1E9PB 4KH9A 1XNRO 4X5LA 1BQLH 3T3ME 2VDRL 5CN0A 3D36A 1S3RA 3O11B 1R3LC 2P8PA 1WV7T 1RJZA 2DWDA 4GG6B 4M7ZB 4XP6H 1P7BA 5EZOL 4MDIB 1LNUB 2OMUB 5B1KA 2HMIC 1KZYA 4HGWA 4Q2ZB 2C9RA 1B3QA 3LIZL 3Q8BA 2XAGA 1A1OA 1IM3D 1O6SB 2C9QA 5KYNA 2Y69B 1ACXA 3QUYD 1BLIA 2ZDIA 3DV4B 3MV11 3FUIA 3PWLA 4P9HH 1XR9A 2EDXA 2Z31A 4L5FL 5JHLH 4JO3L 4B60A 2BNUB 1M05A 1RLBA 3CBKB 2A4EA 3ZTNH 1ITBB 4FFZL 5C0EB 3JAMN 5CR1A 3IDIA 4DV1B 1KTKE 2R0KL 5ABAA 3RDJA 4RMQA 1HE8A 3V0WL 1R5VB 2X7LA 2RMKB 1MWAH 4NKGB 2X4RB 5H94B 4P5TB 2XWDA 5BRQA 3WJMA 3T65A 3APOA 4GKSA 1RPOA 4PJFB 4QHNB 4WFED 5LB1A 1KPUA 2CXKA 4IRJC 4LBAA 4QRRB 3P4OA 2Q68A 1F2QA 4GI9A 5IWLC 1IXBA 3ZE2E 2BTQB 3SDCD 1DJWA 2LW7A 3TZVB 3QZLA 3EFOB 4F27A 2WYHA 4AIZB 4K8RD 2DB8A 3CJJA 3K2IA 2Q20A 4JUTA 4UT6L 1KB3A 4BFJA 2VM3A 1HK6A 3M45A 4GKZB 4GNKB 3LIZH 4XB3A 4PJHF 4PV1B 3V10A 1FA4A 5CB4B 1WG3A 3ZQWA 3ZS8C 1IAKB 3LZNA 1FC1A 5AVXB 2DL2A 1G1KA 3BD3A 4JCMA 4PH8A 2Y6SD 3AJ7A 4FFVD 5IP4A 3VD1A 2KLRA 3CHOA 4JGJA 3S3BB 5ITZB 1S78C 2BHYA 3O0RH 2JJVA 3WY3A 5CCKL 4DVRL 2Y5QA 3RWCB 4M6ML 3HKZA 3FT9A 3P3YA 4JDTH 4Y4HC 4GW4B 1DCLA 2ZIDA 4PJHE 4WUKH 4M5TA 4A7VA 4DTGH 4N5EC 3AK2A 1B4TA 4J3OC 4HZAA 4F8TA 1GYVA 4LVOC 4RO2A 4ODHH 5CZVL 2BHZA 4EN3C 4O2AB 1SA0B 5L2JA 3MZGB 4XCFL 1DDHA 4MTFA 2VM4A 4J1UA 4FQIL 2RQEA 1IAMA 1TJMA 1F45A 4QO1B 4RMTA 3OJDA 1XMWA 3LH2L 3K03A 2ZIOA 3NA4A 4FX5A 2V2WA 4GBXD 4LFCB 1ASOA 3OKLA 4ZMAT 1NLDL 3QORD 1YF2A 1DO5A 4R90L 5M94B 2R9AA 1NUFA 2DKMA 3QCVL 2CO2A 3EJCA 3GXPA 4LCYB 1A9BB 1X6NA 2Q87A 2R1XA 1DTUA 4IRJA 4QT5B 3F62A 5JOPD 2VZVA 1PV0A 4N2IA 2VLJB 4ZW3A 1U93B 2P52A 2EC8A 2XXFA 5L4IA 4HT1H 3S37X 1X44A 4XXCA 3ZKMC 4N2BA 1X5AA 4U1MA 3CSPA 1TTUA 3A4EA 1M1XB 1ECZA 4MSWB 2QQLL 4ISVB 3I6GA 2ZUXA 1XR8B 4OZIA 1U8IA 1JGVL 1ZDQA 4EBQL 4GO9A 2TRYA 4QWWD 5D7JD 4ADJA 3L3IB 5F9JB 1TG8A 3HAEG 2MMXA 5C09E 4L8SB 2ZT9C 1RZKC 2DOSA 1YNTF 3PWVA 5FOBB 1WBYB 2WUBL 2V5TA 1A7QH 5IHBA 4ZFQA 1SOKA 1K72A 3DI2B 1IL1A 4DKTA 2Q7YB 1ZHBA 3GSWB 3G5XA 4UQ2B 3DRQA 1IRAY 3K72A 2KQXA 2HT2D 4XXWC 4P59H 2P4VA 3SOBH 3IAPA 1YNKL 4P30A 1CDGA 3EYOA 5FGBC 1YEFL 2P47B 4G9FE 1ID5I 2ID5A 1I1YA 4FI6A 2WB1A 4QOKB 2GHYA 3HZVA 1AKJB 1EDHA 4LGPB 3HC3H 2FUQA 5HDBF 2UVFA 4XVJL 2FB4L 4GFTB 3T0EC 4KOBA 4XGZA 2B4CC 5KJ4A 3K80A 4UIKH 4PW9A 4RFEB 5LHGA 4MJ5B 3DBXA 1FO0B 5F9OH 2BH0A 1D6EA 1EXHA 1P5UB 5KSUA 4FZ0A 3QORB 4KRPC 4A6YH 5FLVA 5TDOA 3AK3A 4APQB 3DTXB 1U41A 2DQIH 1AR1B 2X4TA 1BX2A 3MC0A 5KX5A 3G6DL 5GGRB 2D03H 4YEFA 3E86A 1KB9K 1QNZL 3V4UL 4GQPH 5DFAA 2YD6A 2P8MB 4QRQB 3ULUF 1TJXA 4X99B 4R84A 2EEBA 3TCLB 3AU1B 4U2YA 3KE0A 2CO6B 5DO2C 4PJCE 3VWJC 2OKMA 1GTFA 2H3NB 3BP5A 3L95B 1CIUA 1AC0A 2YXWA 4Y5XB 1XCQA 3B7RL 2Z91B 3DX6B 3FQNA 2PCYA 3FT4A 5T1KB 3BLKA 4NXNO 5DMJB 5AKVA 2FLBT 3ARPA 2EULA 3JT0A 3L74H 4PW4A 4BFKA 3NEOA 1MWAB 2NY6C 3IGUA 4O2EA 4UAHA 4WHDA 3CSBA 3QQNA 4FHJA 2BSED 4JQIA 4LOEA 3W0WE 4U7KA 4PDMA 2C5DC 4F7TB 1USQA 2ZSVB 5EBWA 2FIKB 2JS5A 2UXCB 2PPEA 3CIQA 3OGCB 2DH3A 2E75C 1BGYH 3QUYC 4WEMB 2D9QB 3OGCA 4OCLC 4PCTA 3AXHA 3APCA 3L1OL 4FHKA 3ZDWA 5F89A 5H4YA 5K33A 4K5OA 1TLKA 1IMHC 1BM3L 1JHTB 1BQUA 4NM8H 1MWAA 4BK8A 3GIZH 3CFTA 3BRGC 3HHSB 2DLEA 2HFGL 5FEBA 3TX4A 2B1AH 1K5SA 4U7OA 2GDSA 4Y9EA 3RWHA 4JX0A 4CZZA 3FQNB 3UMNA 2ZM6B 2J57A 1MUJA 2VCOA 4DK6A 5HYSG 3A0HZ 1E9OA 3LEYL 3DUUB 1QBBA 2G5RA 5LMNB 1MFMA 3SJBC 3Q9QA 1YN6B 5KHJA 4JANB 3UJIH 4PWHA 2FO8A 4L3EA 3L13A 4LL1A 4M6MH 3VVVA 2VLJE 4G59C 1B0GB 3II2A 4JKKA 1AD9B 1AR1D 1CE6B 4NQSA 2X4TB 4WU7B 1N33B 3E6HA 3DIDA 3IGKA 4WFHE 3DBXB 3CFKB 3OMZA 2Y3AA 4L18A 1HZHL 2MOGA 1AJ7L 3ZJZA 3GNMH 4KHXH 1JGEB 4QTIH 2X6MA 2EYRA 1V05A 3VQWA 4R3SB 2LQTA 2HZHA 2DEYX 5C0IA 1JPSH 3Q9PA 4L3AA 1ROWA 2BWDA 3N44B 3L9YA 4WIQA 2E3CA 1K4CB 4JO5A 4XCFH 5HP5A 1AXTH 2IIJA 3OJVC 5I5RA 2Q2LA 3DMMA 3GSUB 4D8OA 1NOAA 1ENVA 2CCWA 4KQ0A 3PAUA 3E1F1 3VX1A 1JNHA 5CEZD 1JF6A 1LEKB 1JPSL 2WKOF 3ARFB 4LCWA 4OV6F 2QEXV 4KY1L 3DI3B 4ZXBD 4MNGA 1EZVH 4WW2C 1LEGA 3SYPA 4HAKA 4LLYA 5FOBA 1XF3B 4LPWA 4UTBA 1Q0YH 1HIMH 4QXWA 4IKLA 1BOYA 2HRPL 5GGTL 1ADQH 3ZYZA 3IXAA 3UEZA 5FHAL 4JCWA 4NTWA 2IH3B 3LKRA 3QH3B 2NX5E 3G04A 2YXYA 4JFEE 1ZOXA 3UCQA 2D73A 2EXSA 4HS8H 1OW0A 4KTEH 3T3PB 4QRPB 4XNMA 1TA8A 3D4YA 2JE8A 4YZFF 3FU7B 5F1IA 3MV01 5MHSE 1CB4A 1X5YA 4MD5B 4FQQA 3MNWB 4FQCL 1OSPH 4ZMWA 2AZAA 4Z95L 1A9BA 2BS71 1I1AC 4QTIL 4OGAD 4OAWB 2QKIC 3Q2VA 4YY3O 2OL3B 4TYUA 4YGVB 5DVKA 4IRZH 3TFBA 4UV4H 5ABZA 4NZFA 3Q48A 3V0FA 5EO0A 2Q9LA 2NY2D 1NGWA 5CINL 1KDJA 4GMTL 2XRAH 4LSPL 5LOVA 5D7IF 3VM7A 4PB9L 5IIEA 1MREH 1LGVA 4J1UB 4M5YH 4NLHA 3SPCA 2D3VA 3MBXH 3O9WA 2AVGA 2JIXD 2QWPB 2Y48A 1JNJA 1QPKA 1UOWA 2OV0A 3SGKC 4F93B 5CJOH 4R9HA 2FATH 1T89C 4TUOB 3ULSB 5AW6B 3T1FA 3S0PA 2KQMA 3U7YL 3LRHA 2BY1A 1FZKB 2NUPA 1OT2A 5C0FA 1WWBX 1WZ1H 3EDDA 4YL4A 4IKIA 4K5NA 4XC1L 3F3HA 2VDKL 4GG8B 3BRCA 1T4KA 1FXKA 4HWUA 4KFMA 2HTKD 3VXME 5L4MA 4MA7H 1IU1A 4NUPA 4JZJB 3QDJB 3EFFB 5CB4A 1SQXH 4POZD 5ANMA 5GS0C 4JDEB 2Y4TA 1TPXC 4H2AA 3X13A 1BQHG 3VE0A 4IOSA 3X12A 3JYBA 2C3HA 1F3DJ 2VDRH 3O6KH 1NC4B 1MW1A 4HSAC 4P06A 1JP5A 4XR8C 4QRPD 5JQIB 1PDKA 2KUTA 4LZKA 4J8RB 5FX3A 5FYLH 2OULB 1INEH 1RL1A 1FLRL 2QBWA 3EFOA 1HKFA 2NXZD 1QBLL 3TT1L 2BJMH 4W9CC 2D2CC 5EBGA 1NTDA 4X8JB 1XF1A 4N2FA 4YSUA 4LF6B 5LGTA 1KFGA 2MQCA 4BUGA 2F7RA 35C8L 5EZYB 3EXAA 4G11A 4N22A 3P4OB 4J3WA 3HI5H 2IDSA 4BK4A 5IR1A 4MD4B 4MAUL 1BD2E 1FL5B 3H4HA 5DQDH 1XBLA 2VLME 4QHNA 4HHGA 4PJFA 5KVFL 1USZA 2DOCA 2EO1A 2WLYA 3UC0L 1LP9F 3CCEV 3AMKA 1DN2A 2X4RA 3P4NB 3RVYA 3S3JA 4ZHQB 5AYUH 2XAQA 1UFUA 2IH1B 4O58L 2JKSA 3CFCH 4JQIH 4KUMA 2UUDH 3H9SB 4HDIB 3QJHA 4LQFH 4ORGB 2XG5B 4XTRD 5IFJA 4GX0A 1T03H 4F7CA 3T1YO 4BZYA 4YHYC 1AI1L 4M1DL 5F7MC 1OPOA 1M05B 2JIXB 4JREC 3RWFB 1U92A 1Z9OA 1WFIA 3K6IA 2HPTA 1IT9H 1GH7A 1I8KB 3L9RB 5ISZE 4Y5XC 2C1PB 3FSAA 3SGKA 4I3SH 4WUKL 2AGJH 5BMFH 5K9KB 4JO1L 5T1MB 5BR8O 2EXYC 4PJHB 4PJDA 4TQEH 1OGTA 3ZMZA 1J0YA 1JWSA 1ROCA 1M57C 4JHWL 4P9OA 5D55A 3AK1A 3WJLC 2BSSB 3OJ2C 1RJZB 3CXDL 3HKBA 2VDPH 5C07B 5GZOA 1H8OA 1UJWB 5JMOC 1DUYA 1K5NB 2EH8L 4FYTA 1E9PA 4YE4L 5GRVK 4RFOL 1BZ7B 3P30H 3OZ9L 1O7DC 4P3DB 1HINH 4ZZKA 1BAWA 2HJKB 1N34B 1R24B 1AI6A 3HUJB 4FLHA 2BOLA 3EO0A 4HIQA 4NAQA 4WFEE 1MCOL 2A6JA 2NXZB 1AQHA 3EJJX 3OXRA 4X6CB 1M7DB 4P2CG 1LEIA 2WN3A 4HK3J 3US0A 4B08A 5DJYA 3B8NA 5JXEA 1QSEA 3DIFB 4DGVH 1IQWL 4IHJA 2VZ1A 3PNWA 2R8SH 4FNPA 1QEWB 3SDYH 3N44F 3D9AL 1TQWA 1KTDA 4LNUA 5DS8A 1AI7A 2DYPD 4E41D 4E0RB 2WZ6A 5BXFA 1NH2D 3QK0A 4I50A 3DKHA 1L8DA 5JA9A 2EJ7A 2KMWA 5C0CA 2R29A 4OGQB 1U2HA 1GW6A 3GKZA 4XCEA 4BSVA 5ISZD 5DZVA 2JCCF 3AACA 1KIRB 2NQCA 4JFYB 4QRFA 1KC8W 3VMNA 2WA3A 4JPRA 5C2BH 4KNSA 1T2QL 3N9GH 2N0MA 1MA1A 1FFNA 3P11L 2WO3B 2X4OA 4FQHA 2ZOLA 5F3BB 4CJ1A 1DZBA 3CRAA 3BDXA 1M1KW 4N4YB 5EPMB 1H8LA 3GI9L 2Q10A 3RYIA 2AAAA 1QSZA 3I75A 3LTVA 4DV0O 5DWUL 1S76D 2QM7A 4G9FB 4JY6B 3CE1A 3BEWA 1MJUH 3ZQXA 4X7TA 5C70A 4XRCA 2MCMA 4MW8A 1QI4A 4MAYB 1C08B 5C0RL 2ATPB 1G0DA 3R66A 3LZFL 1MHHA 2HT2C 3BPOB 4ZPTA 4JI1O 4LP8A 3AQDA 4A2DA 3DXAB 2EEXA 3ZTNL 2DKUA 3AVEA 1KPRA 3QEUA 3RZWA 3L3HB 2WQUA 3GJFB 3LVEA 3GMOA 3DJ9A 5LGUA 1RK0B 2R0KH 1NGQH 3D39B 5ABDE 3L4WA 4XBEL 5D7IB 1T0MA 4AITA 2B39A 4ZX6A 5JW5B 4K3AA 7FABH 1YG9A 1KLFA 3QAZB 3OKOB 4CH4A 1SQMA 5FCUH 3SDXA 5T1DL 5JCOC 2ROYA 3QWOB 5HJ3B 1HW7A 3IBEA 1QBZA 4IRSD 3S5ZA 3FH8A 3AM8A 3TO2A 3LNHA 1AACA 1MCWW 3L3JB 1HR0O 3MOAL 3V52H 2XWBB 2RD0A 5KANG 4WTZG 4TQDA 3G6JE 1OV9A 4HPOL 2UWEF 5D1ZD 4JM2A 5LBGA 3UZQB 4H25A 1EEZA 4HX1B 4LPUA 4BCXA 5D1ZA 1JGUH 5ESQA 3GSQB 4XN2A 1BXXA 3QCTL 2ZYRA 5KJ7E 2DN7A 2LOEA 5GRJH 1QBMH 3BAEH 4POYA 4BSJA 1TXKA 4U3SB 3SGEI 1BJMA 1DVFD 2R4SH 4HHAA 4P57A 3ZHVA 4IIZA 4NO2B 1PNDA 4G9FD 1E28B 1BF8A 3VWJA 3US1A 2FZ3A 1JWMA 5DZPA 2F4VB 1KIQA 3AITA 3L72H 2BTOA 3KW8A 2CM6A 2DWYA 2NNAB 5JHBA 4JDZA 2PYLA 3CN3A 1KJVB 2AQ2A 2OMVB 4BXVA 3TCXA 1BM7A 1I3GH 1PZCA 3AY4C 2QGEA 4X5PA 3MGTA 3IPFA 1XMEB 3KYNB 4KZEH 2BW4A 2YMXH 4P2QA 2HJLB 1KUMA 4J4PD 5AW5B 2FO4B 1QR4A 3B7SA 1O7DE 1P4BH 5E51A 5FYJH 4NZRH 2JKLA 4I9WD 3PP3K 3WDHA 5K9QI 4TQEL 4HA1A 4GKJB 1I5XA 1PKQB 4EB6A 3QJQB 4GUPB 3U30C 4M00A 1SHSA 4JDVA 3CX2A 5DF0A 3IXTB 1KP2A 2WZ5A 1EZVY 1BLNB 4L0PB 4NRXA 3PHQA 2O26U 5C0GA 2B3IA 5KHIA 2HN7B 3HC4H 1ZT1B 3KS0H 2XZQH 1FPOA 3HKCA 4DP7X 2WLNA 4O51B 1AGEA 1T03L 4HF5L 2R0WL 5DQ9A 5IBTL 2XN9A 3ZR5A 4FEMA 4RWYL 4AQEA 3TBYB 1F13A 2VNCA 3KNBA 4DAGH 1YMMB 1IZKA 3HC4L 3LSOA 4M8QA 4XP9L 4OUUA 2W91A 3EO1A 3CRCA 3CFIC 1Y6KR 3QUML 1A9EA 1CZ8H 4FTVB 1IZ3A 1EFXD 3K2UH 4TTGA 2W65A 1K7DA 4QHUB 5IHUL 1A02N 1OF0A 1IGMH 5EBWC 4JFEB 3P73B 3QAZC 2RIKA 4PJAF 4OF0A 2V2TA 1BQSA 1WLHA 3UTQA 3TA3A 3G7TA 3HZMA 2K45A 1DL7H 1PZ2A 3CZJA 3P3NA 4HQQL 3U6RA 3UJTL 3VDCA 3DHMA 4I7ZB 3FXIC 3ZL4L 2APTA 4HKJA 4P0DA 1HEZB 2I07B 3LNEA 5HYJB 5KUMA 4V1DE 4LRIC 3V9CA 2PO6A 4JZ2A 4W9ZA 3O3AB 3T6WA 1H3UA 1OCWL 2QGNA 1WCBB 5DQJB 3LZRA 3T1HO 4KAQH 1FVEA 1LVEA 5TQ0L 2NY4B 2YA1A 5I0DA 1L7TL 3UG3A 2X4NB 4DR3B 1SKVA 1KBVA 3GJFK 3KLQA 5FV2A 4LPCA 4Q9CA 3IETA 1ZKAA 4NNXB 4OZ4A 2MIZA 2Y7NA 4Q4EA 1J0JA 4OJYA 2Y06H 5E56A 4NI6A 5EHFA 4O4IB 5FWRA 3QQDA 1OW0C 3ZUCA 2EKSB 2IBZY 1RJLB 5DUPH 3ROOA 5HHOB 1SESA 1KLGB 3KYMB 4NN5B 1BZEA 2ITDB 4JO4L 3L3DB 4LLUA 2Z6FA 1ZLVH 1JZGA 4F37K 4LOVA 1NMAL 5CP3H 3MODH 3NACH 4D6TH 1AAJA 2P24B 3WYRA 4IL6Z 1JD9A 2Y1YA 3RVUC 5A6MA 2P5WD 5EU3A 2YS8A 3BH8A 5BJTA 3QDMB 3MN8A 2F66C 3RWJA 2VZTA 5DMGC 1MCEA 4OQ1A 3LMJH 3ZTEA 3NJXA 1JPXA 3F2LA 4D9LH 4JFED 1R3IL 3BVWA 1MCKA 2XV2A 3GMLB 3L3OC 1A5FH 2L04A 4IBSA 3P4MB 4FRWA 4MVMA 4V1DD 4Z7WA 4XI5C 5AOKA 2IAMD 3H3BC 2JVUA 2HX7A 4J3OG 1QYGL 3TGXA 2E8YA 3VRLE 1J1PL 5AG8A 4GP8B 4NSKA 2EDLA 5AW3B 4CS2A 4UIMB 3OKMA 5FM8A 5KBPA 3VYNA 3SZKC 3S36H 5B8CA 2BP5M 5I8EB 3T8XA 3VG0H 3KL0A 1WA2X 4OCWH 1S46A 1TQVA 4NC2B 5KBLA 3GMNA 2XYCA 4HKZA 2D7OA 4YS4A 1XTLA 1MY5A 1NJIW 2X4PA 1JJ2U 3F7YC 2CIKA 4NQUA 3H0TA 3LDEA 3CZFA 5FYKU 1RIVL 4HH9B 3MBED 2XYBA 3B8MA 3IJHB 1RZ8B 3FBQA 4CSTA 3CLWA 2WQRA 3ZRFC 2DWEB 2XZCL 1N5AA 3GNML 4KHXL 3S3CB 1AY1H 5CWSA 1NZRA 2NUTB 4AM0Q 3M7FB 4TV8B 3GBDA 5DD1H 4FG4A 5C09A 3HB3C 4L1LA 1MCWM 4IOFD 4HCFA 5F96H 4WJ5A 3WN5B 4YJ2B 1DQJB 1I94B 4NWTH 2WWMD 3MXWH 1RFDH 4XZUB 2AITA 4HKBB 1XHXA 3DVGB 1DBBH 3KZ8A 1AIFA 5DXWA 4H8QA 2SEBB 1FYHB 2CGYA 3QO1A 4KY1H 3RVZA 4LAQH 5A2JH 1P7HL 2WW8A 3EJYD 4PA6A 2WINA 5DA0B 4Z3IA 1CLCA 5K1XA 4RESB 2H32B 4HBNA 2AXFB 4P4KB 3RYCB 4XX1E 2IAMB 4HS3A 5IFAH 1G7PA 4G6KH 2BDNL 3W7SA 5T5FA 1IM3B 1X7QA 1QPPA 1SQVH 5BVJA 4N25A 4K71C 1GOGA 2IQAA 1JUFA 4RMWA 5GISL 4DKFH 4W4OA 4J3SA 4DR5B 1M7XA 1FVCA 1HNYA 1SM3H 4X8AA 3HPLA 1D5BB 2XXCB 3M1CA 5DZLA 5LAXB 1E4XI 5LAXA 1TYJA 4JFVA 3VXMD 1FVCB 2HTKC 3CDGA 1LMIA 3K59A 1RZFL 5FV1L 4IGBB 1NLBL 1OANA 5E2VH 2VABB 3QIBC 1X7QB 3F00A 1J87A 3OLGA 2EXTA 3B7UX 5IHUH 2E0PA 4ZX3A 1TFPA 4HS3B 3RUGE 3V0JA 3NZSA 3CQFA 4Z3HA 4D9RD 3NSCA 1DBMH 3SDDB 1JHKL 2C9AA 3UIYA 3GI9H 1SZTA 3GO1H 4JFDE 4Y2DB 2HVKA 5JW4Q 1JK8B 1YMHA 3WIHA 1NR1A 3F7LA 4J39A 4ZOAA 2YI8A 4IEFA 4BKTC 5FLXN 1JV2A 3VDAA 2ZNJA 4MQSB 3ZYJA 1FRGH 5MP6L 4GT1A 3FTYA 3GZQA 4WJ5B 4I4WA 1OAKH 1ZE3C 3GO1L 3T0DA 4AKQA 1Q1JL 4P2RA 4KTGA 5D7LB 1AQKH 3QIWD 1FVDB 2FHFA 2VN4A 5F9DC 3DX9A 5G5DA 4JO2L 1S5HC 1LO4L 3CCHB 5L4FA 1X9QA 4X5WB 3UX9B 2F5BH 5EN2B 3H2PA 3SQOH 1VB9A 5I23A 3CZFB 2X2UA 5I82A 4P07A 4NWUL 3DARA 3V4PA 3NN8B 3U4EA 1XIWB 2X4PB 3A4FA 2M8XA 4OX9B 2VR3A 4Z7OF 2WP3T 5EMYA 1XMQO 3KLAA 3QS2A 3QUXB 1WAPA 3TP4A 1S7SB 2UUAO 3MNVA 2OI9B 1XCWA 4KAQL 3SGDI 3T8XB 4LSQL 4NTYA 4HFWA 1OY3B 2BWIA 4XDLA 2DQGL 4UM8A 4Y4FD 5AZ2L 5BPPA 2OIEA 5KG9B 5BOZG 1PIFA 4YFLF 5EZIL 3SJVB 3WKQA 1OARL 3FQ1A 3HA0A 1IC5H 5C08E 2JEUA 2R1YB 1MH5B 3MRDB 4Z7NE 5DSCB 5IMLB 5IROA 1UGNA 4Z7VB 1WITA 4Q14A 2ZKOA 4Z7WB 3UT5B 4FM0A 3K71B 1MW3A 1NCCH 1C5DB 2I27N 2H6PA 4IS6B 1YDPA 5GGVH 3RJDA 5I6XB 1E3FA 4Y2DD 5IMLA 5DHYB 43C9B 3QZWG 4BIUA 4H26B 5I5JA 5LP6B 5AOMA 4R4FL 4KVNH 5DHEA 1AQKL 4NM4L 4PREA 3WTSA 3VG9B 3NH7H 2F9BT 2YOCA 1AO7B 5EIBD 1SJEA 2OCCB 2B4CH 1EHAA 1RZQA 1SYVA 3OB0H 1SOQA 2XOTA 3V0DA 1S7SA 3MNVB 2YZ1A 4K2UL 4NYLB 4BK5C 3MACH 2DD8H 2EH7L 5JQ6H 2NW3B 1A8JH 3O6LL 2J25A 2ZKHH 1CJYA 4H0HB 1VQKV 2I60L 3K0WA 1JFFB 5I1DB 5D7JB 3QIUB 2EDQA 1U0QA 3D06A 1MFVA 1KWKA 1VEWA 2CK2A 2H6OA 3BAEL 4ODUA 3FQTA 3D12B 4YHHB 3K2KA 2N0KA 3Q06A 4F6EA 3PGDA 4P2ZA 3M6DA 2VL4A 1QBML 3K79A 4P2RB 2WLLB 4KJQC 4XHQA 3K5OA 2DWXA 1ZVYA 4J7KA 3QVNA 3K1DA 1L0XA 1GGBL 5L0QB 4PRBB 3KWWA 4TNWF 5JIDA 1CI3M 3V0WH 4Z1PA 4LLQA 5AWNL 1QUNB 1S9XA 4P5TC 4UTBL 3MLWH 3KDMA 4AVIA 4PUBL 3SCMD 2VOTA 4BZ2L 4MS6A 5F7UA 2Y0SA 1XCXA 2WO2B 3SGDH 1M6OB 1HNGA 5I1EL 1IO4C 1AP5A 5TISZ 1T83A 3RUGA 3WXVH 5I24A 4J4PA 3K5LA 3I85A 5B39G 5GHWL 1WISA 5CSZA 3ARXA 4DFIA 4LWSA 4NUGL 5DD0L 1PLCA 5CEYB 3VD4A 4AHCA 2DWEC 3M8AA 1PZAA 3QWRD 4HWEL 4AYGA 3ZT5A 1A9EB 4RGOL 1P4IH 3QHFL 5E1AA 5LHDA 4PCYA 3QFJB 3DVFA 4M8QB 2FGWL 4I8DA 2EJRA 4NWTL 2AFNA 3QG7L 3ILQD 3ZKMD 3CFDB 2KG7B 3MUJA 4BZ1L 4PB9H 5KSBA 4PJ7B 4PGJA 4LEBA 5GPRA 1N68A 5BVJB 5I1LB 3GS4A 3IC7A 2Q4PA 5GS2H 3CZUB 1ZGLA 3KLLA 1OPGL 2XKSA 5CZRA 3Q44A 1FJ1B 2P46B 3UAJA 4MTGA 3KZIZ 5AG9A 2IAMA 4WZ9A 1FDLL 1G7LB 2UVEA 1MIMH 5I6PA 1IBLB 1PCXA 3VWKC 2E7LA 2BP3A 1UD5A 2GKIA 3D52A 3NAAL 4IRJD 2E4FA 1RSOA 5C8YA 4GI6A 3DVGA 2WQXA 4B9CA 1YJDL 4HKBA 5IVZB 2J5LB 1BBDL 4XO8A 5I1EH 3MLTB 3RGVB 1DQJA 2APSA 3K71A 4QR7A 3QNEA 5EEWA 1I8LC 2I7OA 3TO4B 3P3PA 5IY5B 1S7TB 2DV6A 2DIJA 4Y1AA 2OYLA 1LUWA 1KEGH 2EUWA 2DBLH 3BPOC 4LOUC 1ORQA 3C12A 1MXDA 2IFFL 2WXPA 4PP1D 3GXTA 3RAJH 1ETJA 1A3QA 1GPOL 1KJVA 1MRFH 4JR9L 1T1YB 4B7KA 4H44C 5EO9A 5CWSB 3UROR 4BH7B 2VDQB 3F58H 3IKCB 1NEPA 4JI3B 3NJNA 1P4IL 1VFMA 3OLEA 4JG0H 2Y69C 4LFAO 3IJHA 1KU9A 4HD9A 3JD4A 4BKSC 3HVNA 3UO3A 4P59L 5LNGA 4L1SA 4OCSL 5DD5L 5E6ID 4PHZA 4UCFA 2CIKB 4P48A 4AV0A 4JFPB 1CLYL 3BP6B 1A25A 4DEUA 3BCFA 1S4IA 2O1AA 1A22B 1NEUA 1JPEA 2Q3AA 1GMEA 1KYOK 4LSQH 2QGBA 2Y36L 3B1UA 2H5UA 1KIPA 4O58H 5D1XB 5D96B 3VXRB 4HC1A 4MD0A 4DZBA 2XOKG 2NTSP 3NIGF 4LSSL 1UWEL 3ARZA 1UUNA 1QWNA 3HRPA 1VFAA 3ARFD 4MRCA 2XWBA 1HH6B 2FYUH 1XEUA 4FN0A 3HAEB 4ZXBB 1ZRUA 4LMQE 4X7EC 2IOOA 2AABH 4PRIB 4PTTB 3G5ZA 4OIIH 2OK0L 5GONB 1EVTC 2E7LC 5GGVL 1D7DA 1F4HA 4YFEA 1Q86W 3NIGE 5E70A 2C3XA 3LXBA 4YDZA 4UQBA 1ADQA 1FIGH 4P46D 1AZCA 5DJDB 2NR6C 2OP4L 4A6YB 5T3ZD 3SY0B 2NY1C 4XPGL 3L3HA 4IDJL 3US9A 1XSOA 2DQGH 1UA7A 3F7RA 1EHLL 5EZIH 3B1TA 2FD6L 3C8DA 4DVBB 4JM4H 1KY7A 1T7YA 4Y19E 4RGNE 4GOSA 3QAQA 5EK0A 1SQQH 4B50A 3ZDXE 5D7EA 2ITDA 3E80A 4LLUB 5F9OL 1GJUA 2E74C 1GN2A 4U49A 1F23A 2EKSA 4ANKA 3GHEH 4GP5B 4DSYA 4G5ZL 5DK0A 2IWEA 1B0IA 2QVFB 3IJ4A 4O4IA 5GGSA 3P3RA 3QXWA 3BP6A 1RK1B 4LCIL 3QARA 4UOW0 3ZHFA 1S72V 2GUOA 3OPZL 4HUUB 3UYPA 4J2XA 1AMYA 4L3FA 5KA5A 1SFDA 3IETB 2EILB 1VIBA 5F3BA 4AQ8A 1IGCL 4PTUB 3A0BZ 1MSDA 1WZKA 3IKCA 1FFNB 4BH7A 1MSWD 4X8CA 5DEDA 5DQJA 4HOMA 2F1BA 4M1DH 2CGZA 1RJYA 5TH2B 5LCVL 4JL1A 2PO6B 1ORQB 4BR6A 1ONQB 1UEMA 3ETTA 4XCEB 4BSVB 3ZJAA 3FU0A 5JUEL 2FEJA 4S11A 1FF5A 5F71A 3H3KA 5EU7E 5TF1L 4LF9B 4H20H 3IE4A 3UXFA 1FORL 3ZMTA 3QPXH 4PRID 2V2TB 3QZNA 3KCXA 5IZ7A 4M93C 2J88L 1QEWA 3APFA 5F2FA 2BNRD 3JXAA 1N8OE 3R7RA 1JNLH 5EZJB 1QSEB 3DIFA 4JGMA 4U3FH 3VOUA 4HK0A 4G82A 5KSVB 4W4LA 2NY3C 3RFZA 5TQ2L 3OXRB 4JPQA 1YCIA 4X6CA 1INDL 1YEWA 4X65B 3V8OA 3CCSV 2HT3D 2WLJA 4IBYA 3ECVA 1L9NA 1CDCA 2CZNA 2FHBA 1QRNA 2H2PC 1KENL 4MYWB 5IQNA 5DQ9B 4A04A 2LW1A 1VPOL 4Z7UB 1JDDA 5CSGA 1E7VA 2XAFA 4O02H 2JB6A 2XFGB 4YSCA 5I9QC 1LE5A 5H6RA 4YMPA 3NZ8A 4UXNA 4TRPH 1QSFD 4GRWF 2EZPA 2EADA 1FRGL 2BSTB 1I9IH 1W15A 5MP6H 1F42A 3HKBB 2YGOA 5C07A 5EEZA 5K5YA 3NGBB 4KRLB 4OLWH 1FSKC 4DV5O 2DTMH 1URFA 4GUPA 2RA1A 2IWKA 4G6FD 2LLLA 4LL4A 1J8HD 4JKPL 1OGTB 3DGGA 4G6MH 5MERB 5CEYA 4QRPE 4PJDB 3WI9A 5C3IA 5EZJA 1UHVA 2IAND 4A2FA 1MZFA 1X7SA 3ECBA 2YN5A 3LXCA 1ACYL 1KCSH 3MLRL 4Y2OA 5A2AA 1ASPA 3RUGB 3MSPA 3BABA 2VITB 2IU3A 2H32H 2WXGA 4DGYH 1I9RH 1A7NL 2EZ0D 1M6OA 4IMLB 2J8UB 1PY0A 3KDMB 1S5JA 4FDWA 5J7CC 3E8BA 2D0HA 3UTZA 25C8H 4HDIA 4LLQB 3H9SA 1E5ZA 5TPWL 4JDZB 5KVGL 3ISWA 2XDHA 4LEXL 5BV7C 1JWMB 3JSLA 3NQIA 3QR1A 5CJBA 3WENA 4L1DA 2WLLA 4J7JA 3RU8L 2IEPA 3CXHF 4HHAB 4HUUA 5HGAB 2GUOB 1Z3RA 4L5FH 4RGMB 4QHPA 5GTIZ 5F72S 1GW0A 3FQTB 5GGSB 3P1VA 3B2PA 1BPLB 2NQ3A 5GRVL 5LVEA 5D7JA 1NC4A 2XTJE 2GABA 2DMCA 3FH5A 2NDGA 3TPKA 1AE6H 2NW3A 3X13B 5F7BA 1WFOA 4X4YA 5CA0A 1XNQB 1ETB1 3BT0A 4PP1C 5DWPA 5H37H 4S10A 2AAVA 4JR9H 1M9WA 1QSFB 5D72L 2KPWA 4L0ZA 3VXQA 3FAVB 5IROC 1DJHA 5AVQB 1FXKB 5K9JH 4A6YA 1WBXB 3WFVA 4AIXA 2IANE 2IO5A 1Q9WA 4RUFA 3CFQA 3FFOA 4DRXB 3QR0A 1O9GA 3RHWF 3AREB 3ASNB 1QACA 2YQ2A 3S5YA 5C0FB 4J5VA 4QIWF 4FIPC 43C9A 4ACTA 5IEHB 1Y07A 3OKOA 2W0KA 2L4OA 4Z7NB 3TYFA 4I1RA 4DR3O 1PY9A 1EN5A 5CJQL 3C75A 3ZHNA 3M8OL 3JBG7 1EO5A 4X5XA 4AYEC 4BUQA 3UYRL 5I1HH 3HMXH 5E95B 3LMJL 1S2EA 1KPRB 1VFAB 2E46A 3TC9A 5INCA 4NGHL 3PAYA 3QRLA 4FMVA 3HG5A 3SJVA 1EK3A 2NLJC 3RL2B 2ATPA 4DZBB 5D1XA 1C08A 5A9GA 2YFOA 2Z1KA 4JM2C 4XH2A 2YPLE 2OL3A 3NH7L 3OKEA 4D7TA 4OAWA 4G6JH 1MF2H 2BW5A 5EUOE 4Q7DA 5GQBA 3DGDA 4G9FA 2AI0H 1XIWA 3BC9A 1EXUA 5AVYB 3V4VH 5IM7B 4LSRL 2VN3A 2DQ6A 3CCVV 4AZUA 2DM4A 1C5CL 4B9KC 1JXFA 1A14H 5CLZA 4FHBD 1DUZB 4XNMB 2WJ5A 4BFBD 5DD6B 1T1YA 2NDFA 3G04B 1XGUB 3MPCA 4JFYA 4ZFZA 2FLMA 3SCMC 3VH8B 1F58L 1DE4A 2OCFD 4QAMB 4XVTH 1S7TA 5E0FA 2F5AH 3W0WD 4DUZB 3TN0C 5HI5D 4I4WB 3FU6A 5BXFB 2MFNA 4NXMO 4R6UA 3MLTA 3SZ6A 1I8MA 3LRMA 4LLYB 4P23A 1UM5L 3K0YA 5AWNH 1XGQA 3IPBA 2MKLC 2PTTB 4LF6O 3U0ZA 1EGJA 1GGBH 2X2JA 3RIAK 1RSOB 4DEPC 1SZXA 1E8WA 3E83A 5GXBB 5TQ2H 4W9IC 2XVKA 1BVKB 3ARQA 3NP4A 3BOVA 2QHLA 5IUSA 2VSMB 1OSYA 1ZAUA 1W59A 3ARBB 1P0SE 1CGSL 3MRJB 5J6GA 5D6CA 1DQDL 3NGBC 5ALCH 4OD3H 4PJ7A 4XOAA 3MJ6A 3IMBA 2PWHA 2ISDA 4YXKL 4KRPB 1HNXB 1TLMA 1JMKC 2PLTA 1JYXA 5BQ7A 4TVPL 5DJ2A 4K3JH 1NSNL 5E1AB 5L3FA 1WTLA 4CRPA 4OB5H 4MCZB 3ISRA 3LPFA 1M57B 1XMQB 1B2WL 1ZEAL 2H1PH 4JANA 4WWNA 5CSZB 2ITCB 4HIHA 4ZTEA 1Q6HA 1F90H 3AS1A 4U3HA 5EBMC 1KCWA 4XN4A 2WBXA 3L9RA 3QJTB 1MUJB 1F4WH 2VISA 1EVUA 3DC6A 3TCTA 4KXZH 2OMXA 3V0VA 1NTKH 2DJUA 4JS7A 3LN4B 2WINB 4S2SB 4Y5YA 5JZ7D 3RTLA 2VRKA 4JREB 4XOCA 1JXGA 4MVBC 4UUJA 3VSQA 4L37B 1AIFB 4OVVA 2BOBB 1R0AL 4ORGA 3HG0A 4HLEA 4XZUA 1J5EO 1UWYA 2WJ7A 5F89B 2B9BA 3WY2A 4YSAA 3QCVH 4ZHQA 4PJFE 2B5UA 3DYOA 1FNLA 4MWFA 3OUFA 1WBZB 2R2EB 1SHXA 1NTZH 2FIKA 2EEDA 3MLVH 4MD4A 5IQ9B 5IR1B 2WYZA 2PTVA 3G6AB 2NPLX 4CADB 5I8KL 1SXSA 2UXBO 4OCXL 4UVAA 4PLKC 1JGVH 1N5AB 1ILSA 2DWEA 3AG1C 3CN4A 5CZVH 5EORH 4M5ZL 2FIRT 4N0YL 1ESOA 1T66D 1VACB 2YK1H 4Z0XA 4L23A 1XUQA 1KV7A 4F2EA 5F6HI 2Z91A 3FT4B 5D4JA 2XIIA 5KSBF 2Z7UA 1JFFA 1FYTD 5BV7L 2KBGA 5IREA 4MA1B 1LO4H 4UQIM 3ZMSA 1MREL 1I3UA 1V7MH 3TVMD 4KRPD 2JH2A 4JZJA 4DV1O 1SQFA 3JD3A 2HWZH 4WTZA 4OZHF 4QRQA 2EIMB 2ZG2A 5I8EA 1T4KB 5HYQA 3SE9H 5TDOB 3OKMB 4PS3A 3IMUA 5D1XE 3RDTC 2GSMB 5ECGA 4I77H 1FO0A 3QCUH 2YD7A 3TBTB 2PP9A 3WUWA 3UACA 1RUPL 1UCTA 2H6PB 1H2GA 1AHWC 3P4MA 4NZUH 2DQHH 4AEHH 3RN4A 4Z7VA 1AP2B 5FDWA 4QOKA 2C3GA 1WYJA 4H5SA 4B7IA 3BPZA 3OKDB 4JQXC 5H5NA 3EYOB 4DO6A 4WENB 1VEOA 3DRQB 4PJ0Z 3G5XB 4UQ2A 3ARDD 4UM8B 1NGWB 4HFWB 4N24A 1IL1B 3KMDA 3AG2B 1YJ9V 4YGVA 4KC3B 3PWVB 1CG9A 3MROB 4X42A 1MWAL 2APBA 1Z0NA 4OM0H 5F9JA 3L3IA 5HGBB 2NXYD 4A66A 2IALA 3NK4A 5T3XE 4B3TB 3V4PB 1J12A 1MI5B 3FAXA 1U9KA 3WE1A 3KYMA 2H8PC 1RJLA 4AK2A 3L08A 3MNWA 1XSKA 2AEQH 4FLQA 3TV3H 3I55V 3CCHA 5I19L 3ZGIA 4OIBA 2YEVB 3VI4B 4R6ZA 1M1XA 2BMKB 2P5WB 2OTLV 4IYHA 3HKDB 3CB2A 1S6NA 4RWUA 3E8UL 2CMRH 1HINL 1P69B 4UNUA 2N56A 3DWTA 1OAZH 4X7SL 5D7LA 5C0DA 3PJSA 3V2AR 3TVMB 4ODTL 2X4NA 1U4FA 2NZ9C 3V0GA 4CW1B 5IQOA 3QJRB 4MYPA 1SMAA 1FVEB 1OSZA 2RACA 3M99B 3L1OH 2UXNA 2XTJC 4LAQL 4WKXA 3VNYA 1BEXA 2ORBH 3BZDA 2D9CA 4LESA 4V1DB 2Y7LA 4IEFB 3FYIB 3OKLB 4E5XA 5HYJA 3NSXA 3VGAB 1HEZA 3OAZK 5LP6C 2BO0A 5DVMA 5KVDE 2HVKB 1WUNT 3L5XH 3SDCC 2Q69A 1PJWA 4WY7L 1KZQA 4H1LH 2O6FA 1NR7A 1YA5A 2QEJA 5C09D 3S96A 1G6VK 4YQXH 4HWEH 5L3GA 3UTQB 4ZBJA 4FTVE 2VQFB 3CMOL 4NZ8A 1BIHA 4R4ND 4BE6A 4HFUH 4XVUD 5DMYA 4KNQA 2W65B 1NCBL 3F65A 3MVSA 3OPUA 3MCG1 3MHSC 1OF2A 2VABA 2YOAA 3HE7C 2OSXA 4TF4A 3MJ9L 2GJRA 3VWJD 3P30L 4TVPH 3LNDA 3QQ4A 3CDGB 1DVFC 3FUHA 4OUUB 3K57A 3I9IA 3LSOB 4PJ6A 1F4XL 4GRLD 4LIQH 1ZV2A 1YHPA 1D5BA 4EUPG 3JTBA 3TBYA 4W4OC 3T4DA 3ZW3A 3RX9A 4RMBA 3JWDL 4KNTA 4Y1AD 4L3EB 3H1KH 3LQAH 4PG2C 1OAUH 1QFWH 1ZT1A 5D5MF 3HHMA 2VMJA 4XMKH 1IM9D 2A9MH 1G9MC 5JA8B 1J9RA 3VFPA 1BLNA 1R34A 5E8DL 1PD3A 1KKDA 1NOLA 1Z9SB 3CCJV 2N4IA 3D9AH 5H2BA 2A9DA 2P5PA 2ATKB 5K9OA 1TAEA 4XCNA 3RWHB 4G83A 3U2SA 3KLDA 1XD0A 1PKQA 1OAUL 5FFOA 4E36A 4UDUB 1EX0A 1MQKH 3CBRA 4J2QA 4U3JB 1KTCA 5TDPB 5H4ZA 3H53A 4J3OF 2E56A 2YICA 1YEHL 4PJFF 1Q0XH 1OKEA 3L48A 4P2QB 3A23A 5F9AC 2DTSA 3WN5A 4LPXA 1UM4H 3T4ZA 4GKSB 4BHUA 1N18A 1NSNH 3ZN0A 3OLIA 5DFVD 5L2KD 1UKQA 4NQEB 3ETQA 1B2YA 2X1PA 4LSTL 5EBWB 5F8QC 5CIPA 3ARGD 1R5VA 2YRBA 4YSTA 4I0PC 2BPBA 1PCSA 1H6TA 1B6QA 5JPMA 1WFJA 1GGIL 3ARWA 3SPVB 4A5UB 2PY5A 5ADPL 1RZ8A 3WG7C 3TXSA 2YUVA 2EEFA 1G87A 3AG3B 2QDWA 4KRMB 3RBSA 1QBLH 3U6XA 2WBKA 3ETDA 3BSGA 3IJEA 3ZIAG 4P57B 4PBWD 2KSDA 4TTDD 4U3SA 4M7ZC 3WB0A 3AU1A 1RPKA 3EDEA 1IURA 2ICEA 3GB7C 4U6VH 5DA4A 1OAQL 2A9CA 2AK1H 4G5ZH 1ZLWH 4CDGC 1IBMO 2D3JA 3ULVL 3GSQA 5EDSA 2EDHA 3TBCA 4GMSL 3ULUC 4MJIB 1BX2B 4H88H 1CEZA 1EEZB 4H25B 2P8PB 2LT9A 2O5NA 4HX1A 2L7JA 1D6EB 3EYVB 4DGIH 1NWPA 1O9HA 2FWLB 3REVA 5K1NA 3ARBC 2LW3A 5J2TB 2BIHA 4H8UA 2EUZA 3BUIA 3QWOA 5HJ3A 3CLEL 1OTTD 4L9LB 1JXJA 3SSGA 1LO0L 3BN3B 1E42A 5HFMA 3ATBA 1DLBA 4XAWL 4FFWD 3Q1SH 3ZMUA 3RWJB 2EDNA 5JVDA 2DQCL 4KH2A 1XO8A 1G5AA 3PL6A 3GMOB 4GXFA 2R1WA 1SQGA 4NR1A 1A6VL 1SYSB 3GJFA 4JFDD 5CINH 2P24A 4YBLB 3THMH 4XN1A 1TR7A 2BM3A 3WLBB 3HS0B 3QO0B 2EIMC 2QELA 3R0NA 2MK3A 3NIFF 4YDJA 1FJGO 3LHPH 1DHKA 3L3DA 1GZPA 2F5AL 5DJZB 3J8F7 1FHNA 3MRCB 1U8IB 3MA7A 1WK0A 3BRFA 1T20B 4HMDA 4LNRB 1F6FB 1WH0A 3VFOB 4GPVA 2P80A 3L5IA 4U1MB 3AWGA 3LDBC 5CF3A 2YD0A 1H3GA 5D5MB 5E94A 4NNXA 2G2PA 1J1OL 5FK9A 5EZPA 2XSKA 4UTBH 3QI9D 4ZS7H 3UAAA 4BGDA 5MEOB 4LVHC 4Z2WA 1BDYA 4DQOL 2NYZA 1H5BC 1AIZA 2H4EA 3J2PA 4M62L 2AQ3A 5JIIA 4NRYB 3KXFB 3O6FC 3WB1A 2R2BA 2WSDA 4NZTL 4HKJB 2XAJA 3HMWL 3CQQA 3RIAF 2B16A 1I1CA 1SM3L 1KXVA 4DGYL 3TH2T 3OQ3B 3VD5A 5IV2A 3BWAB 4NQTA 1A64A 3K6NA 1JA8A 1HL4A 4O2AA 3ELAT 4DR5O 5DC4B 1JHLL 1YSCA 4F4LA 4L4TB 4GLXA 3UBXG 5CXPA 4YHKL 1T66C 4AJVA 3S35L 1PP9H 4DW1A 5LNEA 2OSLA 4ERSH 1Q6IA 4G1EA 5DJ8B 3FU5A 3GMRB 2UXTA 4GW4A 2EECA 3GRGA 5AYQA 5E08L 4YE4H 1YMMA 1I53A 2ALAA 2ZE0A 2AXTZ 3FONA 3KNBB 3Q2CA 3ZMRA 3HI1B 2NXZC 2I26N 4OSUH 5DEGA 1HAUA 5GSRB 3HKEA 4Y19D 1UT2A 1XSJA 2N1KA 3HC2A 4MA3A 2AEWA 2HVJA 4O51A 4JI1B 2LV4A 1N64L 3L4VA 1DUYB 3BKJH 3ZZLA 2X89A 2K6WA 2HN7A 5EU6A 4AL8H 3WTUA 2EDMA 2HRLA 1KCSL 3MLRH 2Y2YA 1WFTA 1Z5YD 3JWNG 4MJHA 2LO1A 2X0LA 1I9RL 2IV9A 5CBFA 4AIZA 4MXWL 2WN2A 1BBDH 4PJIB 2H1PL 3Q5OA 3OKNB 4Z7WE 4MCYA 3SQBA 5IT9N 4JTCB 2XVGA 3S3WA 4GQ9H 5GW7A 2A9NL 3QS3A 5JO5B 4RFNB 4QRRA 5E00B 2IV8A 1QFWM 2XWRA 3DPDA 2GI7A 4NPKA 1ERNA 1L5GA 1GN6A 1CXHA 2A4ZA 3FO0L 3MGTB 2XG4A 3AS0A 4KROD 3WE6B 1M7IA 5ICZA 3BPCB 2CPUA 5D7KE 3BPCA 2NNAA 4C54A 5ITBL 1RP9A 3P4NA 2OMBA 2EIEA 3WAKA 2ZXBA 2O61B 2ILMA 2JI1A 4L4TD 5AOZA 1FL5A 5GRUL 1E28A 1XILA 4N8PA 2ZD0A 5EU7C 1BHAA 5DUPL 1JZ5A 1UGKA 3ZTCC 2D7TH 5EZYA 2QSVA 1M1SA 1XR9B 5GRZA 3OKNA 1GS8A 2R69H 2VDLH 5E8PB 2AQTA 3I56V 5BO0D 2DQUH 4WQOA 5A3ID 3CRQA 3M07A 2G38A 2WQAA 2XNAB 4FNRA 1U8LA 4GKOA 5D1ZB 3VE0B 1KGCE 2V0AA 4KKPA 3WNPA 1ZV5A 1AO7E 1WTGT 2TSBA 3HMXA 3P2TA 5EU6B 4ZMNA 3CLFH 5KWYC 3X17A 4OZFB 1XGYH 1J9QA 5ACZA 3CSFA 1EWHA 1WNSA 1I1AA 1GTOA 3HKEB 1NC2A 4GG8A 3WIIH 1FIGL 5DEFA 1DVFB 4WCYL 5IB5B 1GGTA 1X9RA 3E8FA 3ZHQA 4MMZA 4IM8A 1RIHH 4ODWA 3ULSA 2B9AA 5DJ8A 3VGHA 5JW5A 4CC6A 4KK5D 4M5YL 1INEL 2LFRA 3UO1H 5DLMH 2VC2H 3IM1A 5CM1A 3C6LD 4WCYH 5EWIH 4CS3A 2LVEA 4QTHB 4HIPA 3O2DH 2PWGA 2FL4A 2ADQB 2ZKXA 2BCKB 4ZPTB 5F1SA 3F05A 1OGPA 4PGZA 3D07A 4WDIB 4XP4L 1WVZA 4HF5H 5IIEB 3NSJA 1I4FA 1HC1A 1I8LA 3ARDA 1FG2B 1R9FA 5DJXA 4HAGA 4KK6D 2CCVA 2NTFB 2CTPA 3KXFA 3PDOA 2AK4E 4B9ZA 4M9OA 4X7TB 5JIKA 2H2PD 5ANHA 1WJZA 1LMKA 4M29A 1FPTH 2R9HC 4GIOA 4JI6O 4PVBA 1J8HA 3RYIB 5MEOA 4LCUC 4ZDHA 1PSKL 1QEXA 3EJZD 3NCBB 2HMID 5E94B 2VXTH 3F04A 5EC2A 3ERXA 4YQXL 1TQBC 2Z31C 3KR3L 2X4OB 2QKAA 4IIJA 1BQZA 1QG3A 2LQRA 2LE9A 4K3EH 4QRPA 1BMFG 4LNRA 3OKYA 1JZIA 2WAHA 1PSKH 4LFHD 3IWUA 2PTUA 3MRCA 2IH3A 5EU6D 5T3XH 4OBRA 2F53E 4JNXA 1GCYA 3OTFA 5LKNA 4FABH 1CFBA 5FUZH 3ECQA 1YYCA 2AZ2A 4J6IA 1ZLUH 1M2OA 2DF3A 2VLLA 4NP9A 2AJUL 5J12C 4RBPH 4LNUB 3FSVA 4LQFL 4NO5B 3OAAG 4OCNC 4PRHE 1TU2A 2Z7WA 5C0BE 1RY7B 2AEOA 3PL6B 5AYUL 1WCQA 4JQXA 5EIVA 2IOMA 5E9DA 4OD3L 5F7NC 2X41A 4ODVH 3GSNH 4G7VL 4ACPA 3L3OA 2E8ZA 3CSYB 3MRHA 2A6JB 1OP3H 1J5OH 4TN9A 3ML9A 4S1RL 2HJKA 4K3DL 1G9EA 1IE4A 4LP5A 4DUYB 1C1EH 1MJJA 4DVRH 4UCSA 3RFZC 1R6NA 3LNIA 5J2TA 1QASA 3FO2A 4OPHA 4JO2H 1WPCA 4ZXBC 4LF7O 2FE0A 2DLFL 2HLAB 1A4JA 3REVB 5B3JF 2W0LA 3CFKA 3T4AA 3BGMA 1EGJL 4GAJH 1OM3L 4DPCX 2P3YA 4KKNA 2R15A 5ALBL 3AXLB 1Q43A 3FH7A 3Q6GH 3RIFK 1CO1A 2VWEC 4LLVB 4X0KB 4XPFH 1TJHL 1NFDF 3AS3A 3RX7A 1IBGH 4BZ2A 5KHGA 3R8BB 5KOVC 5D7SL 4AJ0A 3V8CA 1NDMA 2ICEB 1FNSH 3L6FA 3DUUA 1E9OB 2MPAL 3LDBB 1WAAF 2Q7EA 2OW7A 1WD9A 3HE6C 1DBJL 4UVCA 3BPLC 4AT6B 1U92B 5F97E 3FX7A 4Z77A 1H3TA 2KH2B 1OLLA 2WYIA 3IJSB 3LEXA 4C55A 4UI2A 4XO5A 3BJ91 5J5EA 3FPXA 3HHSA 3BO8A 4D0BB 3GEWB 4J28A 3QQ9C 5IFJB 1RPUA 2E9BA 4KZDH 1QSED 1MSPA 1TJGH 3VYOA 4PSPA 5I18H 2IJHA 2GY5A 1A6WL 3O3DA 4LIQE 5H8DA 4ZK8A 3POHA 2ITFA 5F93C 3RGHA 1CFMA 2O6DA 1ADWA 3VGDA 5PAZA 1VIWA 3FQWA 4KZDL 3PGFH 1BVLA 1SLWA 3ABMC 1P7QA 4PWFA 1SN5A 2AXJA 4K0KO 3NRQA 4RLDA 2CJ3A 4DNLA 4R97B 2VR9A 1MZZA 4XN8A 2ZNWA 4UDUA 3ZE2F 3IE9A 2CM5A 5ES4B 2VDQH 3K9SA 5J06A 5CLXA 1RZJH 4LVNC 4Y5XA 1U8HB 2F61A 2QVTA 3BVNB 1YY9D 1KJMB 1P6WA 1N6QH 1Z9SA 2K1MA 1UC6A 3BGFC 1T22A 1AGDB 2WAMA 2UZXA 2BZCA 4JDEA 3EADA 3OJMB 2G4GA 3L9EA 5KVGH 2WVSA 2P8MA 3DDGA 4KZCA 5E4EB 1ED3B 3FCBA 3K06A 1OAQH 3DTXA 3B6SA 3VI3B 4YUEH 2GHWB 4PB0L 5F88B 3HE7B 2GSGB 5DJ0A 5MENE 3QXVA 3QQ4B 2BP8B 3CPUA 4J27A 3BW9A 4WWKC 3OT7A 1YEKL 1OF2B 1A5FL 4UB6Z 1AKJA 1F4YH 1QSEE 1W8EA 2C7FA 4HJ0C 1I1YB 1XGZA 2NY0D 1X5XA 1OCCB 3EYFB 2P5EB 2HVKC 3SDCB 2C4XA 3BVOA 4FL4B 4FLSA 2EH7H 3CCLV 3CU1A 2BOCA 1Y6XA 3FSZA 4AM0B 3SE8H 1ZSHA 1ZLZA 2Z0AA 5EO0B 4X4ZA 2ZF9A 2B0SL 1KDIA 3HB3D 3HN3A 1YECL 3KPPA 5LCVH 2YUXA 3NBNA 5FPRA 3FZUD 1A6VH 3B4SA 2F8XC 2XXMB 4CW1A 35C8H 2D7MA 4F2FA 2NZIA 4PJGA 3PJSB 2C1OB 1I7RB 1XR8A 4KO7A 2ADYA 1LWHA 3I6GB 3NPZB 3HKDA 2P5WA 4QAWA 1CD1B 1U3ZA 1XMOO 2QPDB 4NB7A 4HLJA 1CD1A 4R5TA 5K59E 3PXLA 3KKYA 3O41B 5AEAA 9CGTA 1IJ9A 3SBPA 3QH3A 2C1OA 1E8YA 3LKRB 2VLJA 2HPOA 3DO4A 2WWKT 2RALA 2NY7L 4P2OC 1BAFL 3O8XC 3GDCA 4LCYA 4KQ3H 1MPAL 5TJWK 1Z66A 3MROA 2WXRA 4I0CC 5KSBE 4IGBD 4C8XA 4MNGB 1JR9A 1OCOB 1JPTL 4DK0A 3B83A 1KB9J 2Y7QB 4LCWB 4CH5A 1E9QA 1IVLA 2M83A 1S9YA 2D3OW 1SLXA 4P23C 5DRZA 3Q5TA 3DHPA 1DDHB 2UXVA 2NSMA 5AB2A 3QXUA 4W93A 1K4CA 4J3BA 2P5EA 5L2JB 3EYFA 3OKDA 2ZCLH 2ETWA 2BY2A 3A6OA 3LQAC 4PJDE 4BAYA 2NY0B 4NZRL 4ABWA 1J0HA 4DKAA 2CBMA 5KZCB 4G1MA 3CZSA 4KHPB 2BSCA 2F7OA 4EOWL 3AUWB 1KEML 3P3TA 5IVXE 2DQMA 2BP8A 1I75A 3A2FA 3LQAL 3MYZA 1DEDA 3UTTE 2AZUA 1D5NA 4PV1C 2W9DL 4B9GA 4PI2A 3LQZB 2ZYHA 4K3JL 1I1RA 2Z92B 4YK4C 3SO5A 5HYQB 1ED3A 5AZ2H 4X64B 3FTGA 4PIBA 4GXVL 3FN0L 3LKOA 5GJSH 3GB7B 1XB6A 2UZXB 2W94A 1NIDA 2Z7ZA 1KJMA 2X89D 5A43C 4LKXB 4YXLH 4LC1A 4X89A 2OZ4L 5T1LB 4HJTA 3OB8A 1BD2A 1XIWD 5AB1A 2NY5C 1CMOA 4Q89A 4KITB 4PJIE 1IGML 1LO3H 4XHJC 5AB0A 4X66B 1K3IA 2EINB 4KUCF 1IBFA 5KTEL 5DUJA 1NGXA 5MENB 3GJEA 5I18L 3D0AA 5BUPA 2IDFA 1KPUB 3U6XS 3IGAC 1PAZA 1UFIA 2R2EA 4MWFB 1ORQC 2YJQA 1DYZA 3A3YB 4P5TA 4Y4FC 3T1HB 4NCC2 2A3QA 4O02A 1KB5A 2VRZA 3CN2A 4TSBH 1XHHA 5I15H 5BCAA 2WUBH 4LFCO 2GJZB 1SJMA 2BOBA 3P9MA 1DCEA 1X5ZA 3HC0B 4APQD 2FYVA 4FTVD 1I8AA 1BSMA 4FZEL 1ZLEA 3LEXB 1H5BB 1UWFA 1PNKA 2Q0ZX 2QT6A 4UOJA 4N8CL 1BPVA 5E6SB 4UNVA 1NM4A 1PG7H 2CK0H 3HPJA 1SF9A 2EILC 2PNDA 3HBQA 3LNFA 4IKNA 5J8OA 5CGMA 4LASH 1TQUA 3BKCH 4HU2A 1CGUA 3TCLA 1NDMB 3ZE2B 2ITCA 2CALA 4X99A 1O6SA 1ES0A 4G43B 3EJZC 1QX1A 3UGUA 3C5SA 4MCZA 4HZ3A 5I1IL 3L4YA 5DVNA