1R3KC

Potassium channel kcsa-fab complex in low concentration of tl+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3kC00
3AG1C 4TWKA 2WLIB 3F7VC 4MTGA 3T1CA 5EBWC 2ATKC 1V54C 1R3IC 3KG2A 4G28B 4PA7A 1R3JC 2WLLB 4LCUC 3FB7C 2A79B 5J9PC 1K4CC 1R3KC 4RUFA 4GX2A 4QE9A 4PDMA 1OCCC 3VOUA 3T4DA 3SPHA 5CBFA 1JVMA 4XDJA 3ZRSA 2A9HA 3LDDA 1V55C 1M57C 2Q68A 3ASOC 4H33A 3OGCC 3ZJZA 2ZXWC 1OCZC 2H8PC 3LDCA 1LNQA 2ITCC 2K1EA 4G27B 2BOCC 3AG4C 3T4ZA 3IFXA 5B1BC 3ABMC 3E8HA 4J9ZB 5CBHA 3LDEA 3GB7C 4R6ZA 3F7YC 2DYSC 3RBZA 2ZD9A 3HPLC 4X89A 4EKWA 4PA6A 1M56C 4MVRA 3F5WC 1BL8A 3E83A 4BW5A 4RAIA 3E89A 3K04A 4PDRA 3FB8C 3PJSK 5EBMC 1K4DC 1XL6A 4MSWC 4WFHA 4P9OA 3SPGA 2IH1C 4JTAB 3UM7A 3SYOA 2Y69C 3SYCA 3X2QC 4P2ZA 3OR7C 3ASNC 4JTDB 4R7CA 4DXWA 3RVZA 5BZBA 2Q69A 3TCUA 3E8GA 5EBLC 3LUTB 4X88A 1S5HC 3UKMA 3FB5C 4X8AA 4MVOA 1KKDA 4P30A 2IH3C 2KB1A 3R65A 2HJFC 1R3LC 4MTOA 4P9PA 3WG7C 1OCOC 2Q6AA 3AG3C 3K0GA 2EINC 2Q67A 2WLMA 4PA4A 4MVQA 2OCCC 2AHZA 4F4LA 4ZBMA 4J9YB 2EIKC 2A0LA 4PDLA 2WLNA 3RW0A 4PDVA 4GX0A 5EC1C 3SYAA 1ZWIC 4H37A 4KFMA 4MW3A 2AHYA 4WFFA 3EFFK 3K0DA 4XDLA 4OXSA 5EK0A 2X6AA 3E8FA 2DWDC 4MTFA 4RO2A 2WLKA 4QNHB 4HYOA 5KUMA 2X6BA 4GX1A 3ABKC 2HVKC 2P7TC 3BEHA 4I9WA 2DWEC 2EIJC 2JK5C 4MVMA 3OR6C 3T2MA 5CBGA 2NLJC 2EIMC 4MVSA 3TETA 2WLHA 2QKSA 1P7BA 4RUEA 2WLJA 2YEVA 3OUFA 2QTOA 3OUSA 3SYQA 3RVYA 3STZC 4PA3A 3K06A 3E86A 3K08A 3SYPA 1J95A 2HVJC 4UUJC 5KUKA 1QLEC 2WLIA 4PA9A 4R8CA 4MW8A 4MS2A 3AG2C 2EILC 3IGAC 2HG5C 5B1AC 4JTCB 3SPIA 2R9RB 2WLLA 3E8BA 3SPJA 3STLC 1XL4A 4WFEA 1G4YB 3FB6C 3ABLC 1ORQC 3JYCA 4QE7A 5EC2C 4LBEC 4MVZA 4LP8A 4CBCA 2HFEC 4HZ3A 3LNMB 4MVUA 3SPCA 4WFGA 2ITDC 2BOBC 1OCRC 2W0FC 5IY5C 4R50A 3SJQC 3K03A 2X6CA 5E1AC 5B3SC 2DYRC 4GX5A 4XDKA
chains in the Genus database with same CATH superfamily
2CE4A 2ATKC 1ZAUA 4O4LB 4TV9B 2L6LA 4I4TA 1K3EA 5EYPB 1MG1A 4O4IB 1K9MW 2A9HA 1Z5VA 3K5LA 4L8JA 3RYIA 1BHBA 3GVMA 3ZMTA 4LC1A 4DR6B 5J2TA 1PL0A 5CBHA 4KHPO 3L71H 2Z5UA 3JD3A 4Z1MG 3D3IA 3H1JH 1PKXA 4K0KB 3W7UA 1YSCA 1GN3A 1H8HG 4MSWC 4ZOLB 2BCCH 3LNNA 3NR7A 1OHHG 1FFXB 2VQEO 5C8YB 2CH7B 4R7CA 5EIBC 3CWBH 1AR5A 1EBOA 1G6UA 2FB5A 3CB2A 3JASA 4LWSB 2KB1A 4P9PA 3L73H 5H2FZ 4DW1A 3IC9A 1MOFA 3K3WA 4H0LB 1VQOV 3CRMA 3U10A 4GT1A 2E5LB 4MW3A 1SF9A 4FLTA 2DOSA 1XBLA 2OWOA 2PZSA 2HVKC 2P7TC 3L70H 1PNLA 1R6NA 4GCZA 4B3SB 1HNWB 2IBZH 3M99B 4X1IB 4MVSA 5B66Z 1N36O 2HJDA 3QNEA 3U11A 1KBHA 3ZRVA 2D2CB 3K58A 4X64O 4MS2A 3CHXA 3FB6C 4JI7B 4GKKO 4DR5O 2PI5A 4UCRA 1NQTA 2ITDC 1N34O 1P49A 4U3FH 4JZGA 3JSLA 3K03A 3MDSA 5B3SC 5IYCO 4N23A 2QDOA 1W0KG 3OGIB 4P30A 4FJCC 5B5EZ 2KKWA 2WLLB 1PPJH 1SKVA 5LGTA 3OTFA 2ZIMA 4XDJA 4JI1B 1F4MA 1Y74A 3W7XA 3OGCC 4B7KA 3ICXA 1K73W 2QM7A 1VF6C 1S5LZ 5J2UB 4CC6A 4G27B 4Q6GA 4DR1O 3MHHC 4BIOA 4NXMO 2HHHB 1XHZA 3E8HA 1FJGO 1WPBA 3PN1A 5LOVA 4JAVA 1QQCA 3K04A 2IM9A 1AILA 1B04A 1SESA 1VF5B 3J7AU 1S72V 4UV8A 3CRQA 3CXCU 4C7UA 1FS0G 1LR1A 2QKAA 1FFTB 3LUTB 1COWG 4MVOA 2VQFB 2C2AA 1JOYA 3RYHB 1AP6A 2P90A 1PM9A 4GX0A 1YJ9V 4J10A 4OGQB 5KX5A 2IJJA 2EZOA 5IE9A 1RSOA 3E8FA 2A06H 4LF9B 1HNZB 3AK2A 4NB5A 4X62O 1IBKO 3CC4V 5LXTA 3L9DA 1YJNV 3E86A 1KYOF 2HVJC 4UB8Z 1R6TA 1R73A 1E1RG 1N4CA 4UCOA 2WPDG 4MW8A 3AG2C 4G2KA 4B3TO 1YEWA 4A5UB 1GM8A 4QE7A 3HKBB 2BOBC 2YI9A 1WB7A 3DXRB 3RYFB 4GX5A 4XDKA 3AG1C 4X20B 2ARHA 5JCOA 4YJ3B 3MD0A 2NNUA 1GH6A 3EVKA 3VOUA 5IYBO 4OPAA 2JGDB 4DV0O 3AG2B 1M57C 2Q68A 5KMGB 1BGYH 3BAAA 4UVAA 4FZ0A 2NN4A 2YDEA 3LDCA 4LNUA 5EZYB 1AI4A 1M1KW 4J9ZB 3F7YC 4DR7B 2XNDG 4EKWA 2P4KA 5FL7G 3ZRWA 1Y66A 3AG1B 4N21A 2AW9A 4O4JB 5CN0A 4JTAB 5CA1B 4Z2WA 4QPJA 4DUYO 3CP1A 4PI2A 4HAMA 1M57B 4JGSA 1SZXA 3TCUA 3C3TA 2W0XA 2GSMB 4DR4O 1S77D 1K33A 4CZZA 4J7JA 1MZEA 5LHHA 1SQQH 4J9YB 2WLNA 1KB9F 1QLNA 4KHPB 3TJTA 4PHZA 5FPOA 5GONB 4FLYA 4LF4O 2UUCO 1X59A 5JQGB 1D5NA 2ZNJA 5IJ9B 1KD1W 3T2MA 4UFZA 2WLHA 5FNVB 2JJ1G 1HW7A 4NKGB 2VQEB 3G71V 3T1HO 3L75H 3K06A 5L3CA 4BR6A 3STLC 5IJ0A 3CC7V 1ORQC 1YIJV 1NS1A 3JAWA 2QKCA 5L3GA 2LJ2A 1GN4A 4R50A 2QWQB 1UFIA 3N2GA 3K57A 3CC2V 2DJVA 4J7ZA 4LFAO 1FKAO 1N36B 1KQSU 3CRRA 1JVMA 1K8AW 1GKFA 3QO7A 4YJ2B 2R70A 4DK1A 4X64B 3IFXA 4I55A 4DR5B 1ZL8B 5TISZ 1O9HA 3CPWU 4PA6A 2CDYA 1VP7A 5JVDA 1N34B 4FIPC 2F4VO 4RAIA 1GAXA 4KXRA 4DV7O 4ZIBA 4DV5O 2Y69C 4JI5O 3KCXA 4P2ZA 3ZHTA 2PF4E 4DR3O 2QSAA 3ZIAG 1S5HC 2EULA 4ZI7B 2Q6AA 2WA4A 1GK9A 1SZTA 1V9PA 2UU9O 4DR1B 4JAUA 1Q86W 4NXMB 1ZWIC 1FJGB 3K0DA 4OXSA 3B77A 2CGNA 2Y69B 2QWPB 4D7SA 4TUYB 2RN9A 2YSUB 4RUEA 1VEWA 1K34A 3ZMVA 3RVYA 2KSDA 2BTOA 3HKDA 4MT8A 2B1IA 1QLEC 4O4LA 3IGAC 4TV9A 2O57A 3EHBB 1WNSA 5KHHA 2P4VA 3VQVA 3JAMN 5LHGA 2XAFA 2GTSA 3R66A 3U0ZA 1YITV 2WLIB 3F7VC 3T1CA 5EBWC 4F6RA 2GUZA 1AI6A 3JATB 4JI0O 4NTYA 5KAFZ 4X62B 1IBKB 1QLEB 1WN7A 5KHJA 5JJNB 4DRXB 4RQEA 1HWYA 2YIBA 4WBNB 4B3TB 2UXBB 4O4HB 1FFXA 1JFFB 5C8YA 2CH7A 4RQFA 1Y6XA 4GUNA 1TUEB 2HKOA 2FL4A 4MVRA 1BL8A 2UXNA 5KLVH 1MSDA 2JJ2G 3K9SA 4GZRB 3J81N 2OTJV 2RMKB 1FYJA 2KG7A 1NU1H 4DO2A 3E35A 3JD4A 4UVBA 1VQ8V 1KKDA 3BRCA 2HJFC 2WLMA 3K5MA 4X1IA 1N8RW 4CS3A 1FXVA 3MAQA 2B9ZA 1JR9A 2RDCA 4YIOA 4NTXA 4KP4A 2DW4A 1AROP 2CTQA 4MTFA 3ABTA 3OW2U 3BPZA 4LFBO 4CH4A 4JI3O 1QCEA 3FD9A 3DC6A 2PUSA 1XNQB 1SA0B 3M7MX 2ILMA 4I9QA 3APOA 5LMNB 2E3CA 1TGOA 1SETA 3AG7A 4EB6A 4DR4B 3JAKA 1HP8A 1TAEA 2DMXA 2EILC 3UCSC 4JTCB 4X1KB 2WLLA 5KHIA 4CBCA 3OFNG 4EFEA 1SQPH 1WP8A 5KHGA 4MVUA 3G6EV 3RYCB 4NYKA 1XILA 3VQWA 1FPOA 2ZM6O 4UV9A 4D7TA 4LF4B 1HDJA 2UUCB 1R3IC 3KG2A 1WA8A 4G28B 5DM6V 1L8DA 2XOKG 4JZ2A 3FB7C 1XQ8A 1JJ2U 3SJCC 3LDDA 1Z2GA 2EILB 1HNXO 5ITZB 2DN9A 2JS3A 2Q73A 1N0JA 3TXQA 2K1EA 1NKDA 1BZKA 2UUBO 1GN2A 3ABMC 3ZX6A 3CYOA 4Z1VA 1VF6A 3D3QA 3JD2A 2EJ7A 2ODMA 3E89A 3IC7A 2ZR2A 3GWOA 2ADPA 4P9OA 4UCTA 3RYHA 2YIAA 4DW0A 1RM1C 4LFAB 3ZCCA 3RVZA 3E8GA 2YI8A 1W0JG 2CTWA 3ABMB 2XAGA 4X66O 2A0LA 3RW0A 4PDVA 3E22A 4J42A 4UVCA 3BVOA 5KHKA 1ZLZA 5LYJB 1XUQA 4U3JB 4HYOA 2X7RB 3B8MA 2YEVB 1RM1B 2F4VB 2Q4PA 2R72A 4DV7B 1M93A 3H1HH 2BSKB 2CUGA 4DV5B 4DUZO 4JI5B 3CRAA 2Q9LA 2YXLA 4BAYA 2IU0A 2QM8A 4DR3B 3RYFA 2JDIG 3JARB 4BIUA 3B4SA 1K5SA 4IIJB 1OV9A 2ZIOA 2E75B 3NXSA 2PGGA 4YJ3A 2OYQA 2N05A 5CA0B 2JGDA 3LSUA 1W59A 4WFGA 5KA5A 5KMGA 2HLDG 4DV2O 1BE3H 3CSXA 2EZPA 4W4LA 4I50B 1OZ0A 1JMKC 5J9PC 1SRYA 4MTXA 2DQ0A 2F43G 3H1KH 1D2DA 2GHYA 3CCUV 3OE7G 4O4JA 3H9VA 4UB6Z 4I7ZB 5CA1A 1ENVA 4EEQA 4GYCB 4R6ZA 1F23A 3ETGA 5FLXN 1RP3B 2RNBA 1CPYA 4ABMA 4FMTA 3LSSA 1VF7A 1J5EB 1I94O 1MSWD 3CX5F 3CD6V 4FPPA 3ZMZA 4UCVA 1DF5A 4JI0B 1L1FA 1AR4A 2LW1A 3CJHB 1U96A 3WFVA 5GONA 3FB5C 4MTOA 5JQGA 1EM1A 4LR3A 5IJ9A 5B3SB 2Q67A 2OCCC 4F4LA 1TVKB 2ETNA 5JH7B 4JASA 1EZJA 2F23A 2V4DA 2EX3A 5H9CA 1Z5WA 2JK5C 5IYDO 3ABUA 4JYYA 1P7BA 1Q3EA 1JCHA 4PA3A 5IYZB 1GRJA 4FFKA 3K5NA 3RN4A 2UXCO 2OCCB 4PA9A 4TQFA 1NTZH 4TOIA 1IURA 1G4YB 1GTOA 5LP6C 5H6QA 5JWPA 1XDCA 4YJ2A 4JI6O 3BA9A 3F5TA 3T1YO 2UXDO 2H94A 4YHHO 1QR8A 4LFBB 4DV3O 4JI3B 1S3JA 5L3DA 3OD4A 1YTFD 3ETEA 4PDMA 1MZFA 4WCEV 1IBLO 1NTKH 1Q7YW 3M8AA 4X1YA 1KU9A 3JALA 2H8PC 1LNQA 5LP6B 2BOCC 4TV8B 1H38A 2Z3YA 1YZBA 3GB7C 3A8TA 3A0BZ 5D5QA 2ZM6B 4ZI7A 3FB8C 5GTIZ 2Q7GA 3BHPA 1QNMA 1VQ6V 3HKEB 1PP9H 3SYCA 4YXWG 3JASB 3OR7C 3JD0A 4DXWA 4YIPA 3A0HZ 3I55V 1ZTEA 1HNXB 2G38A 2IH3C 2YICA 4TUYA 3B2EE 2YS8A 5CB4B 4JAAA 2Q5ZA 2UUBB 1Y4MA 3A2FA 3HB3B 1BQ0A 4IHJB 3P3NA 2LO1A 2GDSA 2EIJC 3KKYA 4PV1B 1S5JA 1OJHA 2EIMC 2AGAA 1NVPD 2OIEA 4FLUA 3SDLA 1U97A 2WLIA 1Q8IA 3JATA 5B1AC 3J80N 1XMQO 3E8BA 1CEZA 3W7SA 1MA1A 2XUMA 3OTOO 4O2BB 1YVWA 1LUWA 4FFBA 5IY5C 4DRXA 1VMGA 3OMAB 1WJZA 3G80A 1RFYA 1GM9A 1IDSA 2FYUH 4AHCA 2EIMB 4PJ0Z 1YJWV 3G67A 3S3WA 1JFFA 1JQ0A 1Y74B 5LGUA 1R3KC 1H2GA 4DUZB 1PL4A 4PELA 1NZ6A 1KMIZ 4OPHA 1ZX3A 1YDXA 5JJJB 1JA8A 4AILC 4DV6O 1FD9A 5LOVB 3T4ZA 4CH5A 5IY5B 5B1BC 5AG2A 2PTMA 5C93A 4FLWA 1M56C 2LFRA 1BCCH 2ZKOA 1M9NA 4Q20A 4DV2B 2FKXA 1VQ4V 1PV0A 3H1LH 3CMAV 1K4DC 3L72H 2M6YA 3SPGA 3THOA 3UM7A 2PYLA 2WA3A 3X2QC 2QA4V 3Q4HA 2XAQA 1VQNV 1JX9A 5LA6B 2ADQB 4IT5A 1O9GA 3ETDA 4GKKB 1Q6UA 5B1BB 1SA0A 2XAJA 2EIKC 2Q0OC 3O9OA 3N2KA 2LW7A 3CRCA 2IW5A 1XREA 3CCMV 1NR1A 1L0NH 2B5UA 2E74B 2Z0AA 4GX1A 5LXTB 2X0LA 4X1KA 1ZUQA 1VARA 1I94B 3X2QB 1QU7A 4K0KO 3OR6C 4LFCO 5CBGA 2NLJC 4NVPA 2QTOA 4ASUG 3N27A 2JRIA 4FVMA 4JI2O 5KUKA 2P67A 2H3OA 2ZDIA 4HNAA 2EIKB 2ZQMA 2K9PA 5L3EA 4WFBV 2VWJA 1THZA 1B3QA 1K7DA 3ABLC 5DECA 4LBEC 3OMNB 3SPCA 2CTRA 2ZINA 1YF2A 2ZE6A 5ITZA 1LUVA 1I0HA 3SYQA 4PA7A 4AQYO 2MW2B 4LCUC 3B8NA 4RUFA 2CGOA 3QF7A 3SPHA 4X9QA 4LNUB 3ZRSA 3FAVB 5EYPA 5IWAO 2UXCB 3ABLB 3ZRWB 4O4IA 5BMVB 4I5SA 4QPKA 3I5DA 3RGBA 2P5OA 3CE2A 1SQXH 4OX9O 2FMLA 2LGQA 1TA8A 3F5WC 4JI6B 3T1YB 2UXDB 4YHHB 5GTHZ 3PJSK 4I0XB 2AZ0A 1IX9A 4DV3B 2IH1C 1JJOA 1MABG 2WSSG 1GN6A 4K3AA 2Q0AA 4B3RO 2D3OW 1EN5A 4JYBA 4TSFG 4ZOLA 5LYJA 1Y76B 4LH6A 1IBLB 1EN6A 3BCCH 4JF3A 4XBFA 3TXSA 2Q7EA 1YHQV 1QVFU 3DTUB 4LH7A 4ZBMA 1AB3A 2GBOA 1QHTA 4LWSA 3SYAA 2L35A 4JYAO 4WFFA 1H2LA 3JARA 1A32A 3KZIZ 1AI5A 1VQ5V 4BW9A 2NR5A 4DV0B 1VQPV 2RCVA 4WFAV 5CA0A 2WLJA 3OUSA 1IXBA 2QEXV 3CS5A 2W6JG 3JCUZ 1SQVH 2RQ6A 1J95A 5IJ0B 2YC0A 4UUJC 1H2KA 3RFRA 1VQ7V 1AVMA 3JAWB 4CC5A 1N32O 4ZHQB 3RT3C 2HG5C 4ICGA 4I50A 5BXZA 2YXYA 4JV5O 2VQFO 4LF8O 3WU2Z 1BS3A 3C3SA 1SQFA 1M5IA 3ZHUA 4QJFB 5A9GA 1FAFA 2Y0PA 2W0FC 3D8CA 4BWAA 1TUBB 1BT8A 3OMIB 2JS5A 5FPRA 1N33O 4DUYB 1AP5A 2ZR3A 2WAMA 1Q43A 3W7TA 2DE0X 1VQMV 1Q5OA 5CBFA 2EJRA 1F51A 3SJAC 2AZ2A 4FM0A 2P6JA 1OCZC 2YUAA 1VQLV 1R6KA 3CCSV 3WB0A 2ITCC 3EXAA 4UXNA 3CCLV 1H8EG 1SQGA 2UUAO 3LDEA 2GV9A 5J2UA 3OTOB 1XOUA 5L3BA 2W6IG 3IJ4A 4WFHA 1TVKA 3T1HB 3BY6A 1K92A 2OT5A 1OCZB 3OAAG 4L87A 4B08A 5KA6A 1OCOC 4PA4A 2XASA 4TT3G 1WB8A 1KP2A 5LBQA 4DV6B 3MHSC 2VS0A 3P30A 3JD1A 4FLVA 4XDLA 1Q81W 2XAHA 5DN6G 1AJQA 3UT5B 2X6BA 2JVDA 1YXBA 4FLXA 4AI8A 2QGNA 2YIBD 1KUQA 1OCOB 4NXNO 4DV1O 3WB2A 4F6RB 3K59A 2GUZB 3JCZA 1NBMG 4JI8O 4EFBA 1KP3A 5LHIA 2QWNB 3W7WA 3HKBA 5HFMA 1NJIW 5LP6A 4E2LA 4TV8A 4X65O 4UCSA 3DXRA 4LFCB 3CCEV 4KUMA 4NR1A 1B6QA 4X20A 1AR1B 5IDJA 5EIBD 1KC8W 2A7WA 1FXHA 4JI2B 3ZJZA 2UU9B 2OTLV 3BFRA 3HKEA 2LGWA 2CK3G 1FXKC 4ZKIA 4JPRA 2DYSC 1P4RA 5DEDA 5EZYA 2BTQB 3E83A 3OM3B 4BW5A 4FLZA 1VQ9V 4IYHA 3SGIA 1XL6A 1H2MA 3QO5A 2KG7B 4CH6A 5CB4A 4AQYB 4J80A 2M7WA 1QVGU 4DYLA 4FZ1A 1HR0O 1H2SB 3UO2A 1FXKB 2ZT9B 4IHJA 3D36C 3HKCB 5IWAB 3SR2C 2V1DA 2DYSB 1BMFG 1DK1A 1T5EA 4OX9B 3CCRV 3GWKC 4RO2A 1BQZA 2EBOA 1MMMA 1Q90D 3ZS8C 2QKSA 4EB6B 3JAKB 4O2AB 4O2BA 3STZC 2PYJA 4B3RB 4GKJO 1L0LH 2B1GA 5FNVA 1K5QA 2ZE7A 2QE7G 2XHBA 1X4TA 3SPIA 2XT9A 4WFEA 5EC2C 1IBMO 4JYAB 4LF6O 1WA8B 5E79Z 1UJWB 5LGNA 3JSNA 1KKCA 3AK3A 1YCIA 1BHAA 1P7GA 1XEQA 2A79B 5D5PA 1GO3F 5JJEB 4QE9A 1CXZB 1WPXA 4IYIA 1Q6HA 1SQBH 3ASOC 4K35A 5LMUO 4H33A 1UPGA 1E1QG 1N32B 1MNGA 1WAZA 2JEUA 1CP9A 4I4TB 1XMOO 5A2QN 4JV5B 1P84F 3FX7A 3CMEV 4LF8B 3CCVV 1H2NA 5LA6A 5HFLA 3RYIB 1ZL8A 2Q7HA 1N33B 3SYOA 5K1PA 5J2TB 1I5YA 4KL1A 3ASNC 1R1BA 3ASOB 4IL6Z 3ZHVA 5BR8O 1DF4A 3TK1A 1NH2D 1QR9A 5IT9N 1GMGA 1IVSA 3R65A 3E22B 3AG3C 3DC5A 4DR2O 3ZHRA 1WLEA 4H44B 2UXBO 5LL6Y 2AHYA 2UUAB 3OT7A 5KUMA 2YIDA 1YTFB 3ABKC 3FYIB 1G1XB 2MK3A 3ASNB 4TQDA 4YY3O 4J7KA 2QWRB 3OUFA 3P32A 2HEPA 3K5OA 1NH2B 3AG3B 1I7FA 1JPXA 1XHXA 2XTAA 4JI4O 4K8XA 4W4KA 3ZN0A 2JEXA 1XL4A 2VRZA 3B09A 2HFEC 2IJHA 4LF5O 3ABKB 2ZE8A 3SJQC 3FAVA 1AI7A 5E1AC 2P22C 2OCHA 4TWKA 2IJIA 5BMVA 1R3JC 3CEIA 2QM4A 2JGUA 4GX2A 1XNQO 2ZCEA 1US6A 5LMNO 1V55C 2N74A 3ML0A 1WP7A 3QTCA 1DGSA 4I0XA 4X66B 4NXNB 4J11A 4DV1B 3AG4C 3O65A 3VQYA 1VIBA 2Y4UA 2EIJB 2UXXA 2YXHA 3ZN1A 4DK0A 3ZRXA 2FTKA 2ZD9A 3HPLC 4X89A 3VQXA 4WBNA 1Y76A 4NTWA 4O4HA 4JI8B 4LF7O 3UQ8A 1NVPB 2QR4A 5EBMC 3ZHSA 1DLBA 1S0VA 4B3MO 4X65B 2PY5A 2QTSA 3FYEB 5B1AB 1NI8A 4JTDB 1V55B 3QO8A 5BZBA 1NT2B 4X88A 1URFA 1QBZA 3E2EA 3AG4B 1R3LC 1XNRO 3WG7C 1DTOA 4DV4O 4MVQA 2AHZA 5EC1C 4KFMA 3EFFK 2X6AA 2DWDC 1XI1A 2Y4TA 4QNHB 2R9IA 3KCYA 4ZHQA 2V7QG 2DQ3A 2LFSA 3BEHA 3B40A 2GTAA 4I9WA 2A3QA 1PD3A 2LP7A 3OEEG 1I08A 1Y67A 5KX5B 5CA3A 1RSOB 3WG7B 1TUBA 3UO3A 1HR0B 1G8MA 1M56B 2QWOB 4DR6O 1B06A 3SJBC 1K97A 5L3FA 1NR7A 4HZ3A 1OCRC 5JCOC 1GM7A 3RYCA 1ZSPA 4WF9V 4PI0A 1K4CC 4X1YB 4PD4F 3JALB 3BABA 4GKJB 5B1NA 1PNMA 3IAYA 1NTMH 5H5NA 2E5LO 3DGEA 1OCRB 1EZVH 1AJPA 2PI4A 1IBMB 4LF6B 1M90W 4PDRA 3ETQA 3P3PA 3QG5A 2CAZC 4B3SO 1HNWO 4BIZA 1I5XA 1Q6IA 2IU3A 1ROPA 2Q69A 3K9AA 4F6EA 5EBLC 3WB1A 3UT5A 3LSQA 2JIZG 3CXHF 4UCUA 3UKMA 2Y48A 3G4SV 5LMUB 3I56V 1RPOA 4FK5C 1SERA 4FM1A 4JI7O 1KECA 4H13B 3CCJV 1XMOB 4QGPA 4JYCA 1S76D 1VQKV 1D5AA 2WLKA 2OIGA 2DWEC 2R9AA 1YI2V 4U3JA 1J5EO 2YEVA 2LQTA 1AJNA 4JI1O 3K08A 2VWKA 5BR8B 2BSKA 4J41A 2F1MA 4R8CA 2F95B 4QIWF 4FFBB 3RWRD 4RWUA 3C90A 2HHHO 1BSMA 1SS3A 4E4EA 4FM2A 5H6RA 4DR2B 4LP8A 3FKSG 3LNMB 4IIJA 4CH3A 2KQXA 3TGUH 4U7OA 4U7NA 5B1OA 3A0RA 2DYRC 5K1XA 4MTGA 1V54C 3AEIA 2QJ1A 5F2VO 1F7YA 4YY3B 2F66C 1OCCC 3T4DA 2BTQA 2F93B 1M4UA 1N0NA 3BA8A 3N2GB 5GW7A 2ZXWC 1F4NA 2HR3A 4HBNA 4JI4B 2CTPA 2WWWA 4CS2A 3HR0A 5KAIZ 3ZMUA 1RPRA 1SC5B 3H01A 2HP8A 2DYRB 3RBZA 4LF9O 1HNZO 1EFRG 4LF5B 1FXKA 1V54B 3ZEDA 3Q4HB 2P06A 3HKCA 3FFQA 2N04A 1OCCB 5CMUA 3L74H 3CCQV 4I55B 1W2BU 2ZXWB 2ZDIC 5JVDB 4X8AA 1XMQB 3N2KB 3ZBHA 2Q8VA 3K0GA 1E79G 2EINC 3G6BA 3CJHA 4PDLA 4GLXA 2Y0IA 4O2AA 1EN4A 1IXMA 2AXTZ 4H37A 4D6TH 5EK0A 3D36A 3AK1A 3QVNA 4LF7B 5JH7A 2BE3A 3OEHG 3ZMSA 4MVMA 3S3XA 2RJZA 4B3MB 3TETA 2ZNIA 4B7EA 4IGGA 1PNKA 4HNAB 1Q82W 2E76B 3SYPA 2EINB 3APQA 4K8ZA 3H1IH 1XNRB 2R9RB 5IYZA 3SPJA 3DSQA 4DV4B 3ZHQA 2ZE5A 3JYCA 4MVZA 4DR7O 4CS4A 1IZ3A 5BY1A 3VBBA 2IJKA 2X6CA 3K79A 3HKDB
chains in the Genus database with same CATH topology
1YITV 2WLIB 2EIMB 3F7VC 3T1CA 5EBWC 2ATKC 1AI6A 1BHAA 1YJWV 1K3EA 1JQ0A 2A79B 1GO3F 5LGUA 1R3KC 1H2GA 4QE9A 1MG1A 4PELA 1QLEB 1K9MW 2A9HA 1WPXA 4RQEA 1HWYA 3ASOC 4H33A 1BHBA 1E1QG 3ZMTA 4LC1A 2JEUA 3T4ZA 1CP9A 1PL0A 5IY5B 5B1BC 5CBHA 3CMEV 4RQFA 5C93A 2Z5UA 1TUEB 2HKOA 1M56C 3CCVV 3JD3A 2LFRA 4Z1MG 4MVRA 3D3IA 1BL8A 1PKXA 2UXNA 5HFLA 1M9NA 4Q20A 1VQ4V 2JJ2G 3W7UA 1YSCA 1K4DC 3CMAV 4MSWC 1H8HG 3SPGA 1OHHG 3SYOA 3UM7A 2OTJV 3X2QC 1I5YA 2QA4V 3ASNC 4R7CA 3ASOB 2XAQA 1VQNV 1DF4A 3TK1A 4DO2A 3E35A 3JD4A 1EBOA 1JX9A 4UVBA 1NH2D 1QR9A 1GMGA 1VQ8V 1KKDA 2KB1A 3ETDA 2HJFC 3R65A 4P9PA 3AG3C 5B1BB 2WLMA 2XAJA 1MOFA 3K3WA 2EIKC 1VQOV 1N8RW 4GT1A 1WLEA 1FXVA 4MW3A 2AHYA 4KP4A 2DW4A 1AROP 2IW5A 4MTFA 3ABTA 3OW2U 3CCMV 1NR1A 5KUMA 2B5UA 1YTFB 4GX1A 3ABKC 2HVKC 2P7TC 2X0LA 3FYIB 1PNLA 1QCEA 1R6NA 2MK3A 3OR6C 3ASNB 4GCZA 3X2QB 5CBGA 2NLJC 3M99B 4MVSA 3OUFA 2QTOA 4ASUG 3QNEA 3P32A 3ZRVA 1NH2B 3AG3B 1JPXA 1SETA 5KUKA 2P67A 2ZDIA 4MS2A 2EIKB 2EILC 2ZQMA 5L3EA 4WFBV 4JTCB 3ZN0A 2WLLA 2JEXA 1THZA 1XL4A 1K7DA 3FB6C 3ABLC 4LBEC 4CBCA 2PI5A 3OFNG 1NQTA 3OMNB 2HFEC 4MVUA 3G6EV 3SPCA 2ITDC 2IJHA 3ABKB 3SJQC 1AI7A 3K03A 5E1AC 4UV9A 5B3SC 5IYCO 4N23A 4P30A 1W0KG 3SYQA 4TWKA 2IJIA 4FJCC 1R3IC 3KG2A 4G28B 4PA7A 5DM6V 2XOKG 1R3JC 2WLLB 4LCUC 3FB7C 3B8NA 5LGTA 4RUFA 4GX2A 3SPHA 4XDJA 3ZRSA 1JJ2U 3LDDA 1F4MA 1V55C 2EILB 3W7XA 3OGCC 3ML0A 1K73W 3ABLB 3ZRWB 2QM7A 4I5SA 4QPKA 2K1EA 1NKDA 4G27B 3AG4C 3MHHC 3ABMC 2EIJB 2UXXA 3E8HA 3ZN1A 3CYOA 3ZRXA 2FTKA 2ZD9A 3HPLC 4X89A 4JAVA 3F5WC 3JD2A 3E89A 3IC7A 2ZR2A 3K04A 1NVPB 3PJSK 3GWOA 5EBMC 1DLBA 1SESA 1S0VA 4P9OA 2IH1C 1RM1C 1S72V 4UV8A 1MABG 2WSSG 3CXCU 3FYEB 5B1AB 4JTDB 1V55B 3QO8A 3RVZA 3ZCCA 1FS0G 5BZBA 2D3OW 4JYBA 4TSFG 3E8GA 1FFTB 3LUTB 4X88A 1COWG 4MVOA 1QBZA 3E2EA 3AG4B 4JF3A 4XBFA 1R3LC 3WG7C 1DTOA 1W0JG 2C2AA 3ABMB 4MVQA 1YHQV 2XAGA 2AHZA 3DTUB 1QVFU 1JOYA 4ZBMA 2A0LA 2P90A 3RW0A 4PDVA 4GX0A 4UVCA 5EC1C 3SYAA 1YJ9V 4KFMA 4WFFA 2IJJA 3EFFK 2EZOA 2X6AA 3E8FA 2DWDC 4QNHB 1AI5A 4HYOA 2R9IA 1VQ5V 2X7RB 3B8MA 2YEVB 1RM1B 2V7QG 2DQ3A 2LFSA 3BEHA 4I9WA 1PD3A 1VQPV 2LP7A 3OEEG 4WFAV 2WLJA 3CC4V 3OUSA 2QEXV 4BAYA 2IU0A 1YJNV 2W6JG 2QM8A 3E86A 5CA3A 2JDIG 1J95A 3WG7B 2HVJC 4BIUA 4UUJC 1VQ7V 1R73A 1K5SA 1E1RG 1G8MA 1M56B 2WPDG 4MW8A 3AG2C 4G2KA 2HG5C 3NXSA 1K97A 1GM8A 4QE7A 5L3FA 1NR7A 4HZ3A 4QJFB 4WFGA 2BOBC 1OCRC 2W0FC 5KA5A 2HLDG 3OMIB 4GX5A 4XDKA 3AG1C 1GM7A 2EZPA 2ZR3A 4WF9V 1OZ0A 5J9PC 2WAMA 1SRYA 1K4CC 4MTXA 2DQ0A 2F43G 3MD0A 3W7TA 1VQMV 2NNUA 3VOUA 5IYBO 5CBFA 2EJRA 1F51A 3AG2B 1M57C 2Q68A 2P6JA 5B1NA 1PNMA 2GHYA 4UVAA 3CCUV 3OE7G 1OCZC 1VQLV 1R6KA 3CCSV 3LDCA 1ENVA 1AI4A 2ITCC 3DGEA 1OCRB 4UXNA 3CCLV 1M1KW 1H8EG 4J9ZB 1AJPA 3LDEA 4R6ZA 3F7YC 2XNDG 4EKWA 5FL7G 3ZRWA 2PI4A 1Y66A 3AG1B 1F23A 3ETGA 1M90W 1CPYA 5L3BA 4FMTA 4N21A 4PDRA 3LSSA 2W6IG 1MSWD 3CD6V 4FPPA 4WFHA 5CN0A 4BIZA 3ZMZA 4JTAB 1I5XA 2IU3A 3BY6A 4QPJA 1DF5A 3CP1A 1ROPA 1M57B 4HAMA 4JGSA 1L1FA 2Q69A 3TCUA 3K9AA 1K92A 2OT5A 5EBLC 2GSMB 1OCZB 3OAAG 3LSQA 2JIZG 4L87A 3WFVA 3UKMA 3FB5C 2Y48A 1S77D 1K33A 4CZZA 3G4SV 4MTOA 5KA6A 3I56V 1OCOC 1RPOA 4FK5C 4PA4A 5B3SB 2Q67A 1SERA 5LHHA 2XASA 2OCCC 4TT3G 4F4LA 1KP2A 1KECA 5LBQA 4J9YB 3MHSC 2WLNA 3CCJV 4JASA 4JYCA 1QLNA 3P30A 3JD1A 1S76D 1EZJA 4XDLA 1VQKV 1Q81W 2XAHA 5DN6G 2WLKA 1AJQA 2X6BA 2DWEC 5H9CA 2JK5C 1YI2V 5IYDO 1KD1W 3ABUA 3T2MA 2WLHA 1P7BA 2YEVA 2JJ1G 1AJNA 3G71V 1JCHA 4PA3A 3K06A 3K08A 1OCOB 5L3CA 2OCCB 4PA9A 4R8CA 4QIWF 3STLC 1G4YB 3CC7V 1ORQC 1YIJV 1GTOA 5H6RA 4LP8A 3FKSG 3LNMB 5H6QA 5L3GA 4U7OA 3JCZA 1NBMG 4R50A 4U7NA 5B1OA 1KP3A 3A0RA 2DYRC 2H94A 5LHIA 1QR8A 3W7WA 5HFMA 4MTGA 1NJIW 1V54C 4E2LA 1S3JA 3CC2V 3AEIA 5L3DA 3CCEV 1KQSU 4KUMA 1YTFD 3ETEA 4PDMA 1OCCC 1B6QA 3T4DA 1JVMA 1K8AW 4WCEV 1GKFA 1AR1B 3QO7A 5IDJA 1KC8W 1Q7YW 1FXHA 5GW7A 3ZJZA 2ZXWC 1F4NA 2HR3A 2OTLV 2CK3G 2H8PC 1FXKC 1LNQA 2WWWA 2BOCC 1H38A 2Z3YA 3IFXA 4ZKIA 3ZMUA 1RPRA 4JPRA 3GB7C 3H01A 2DYSC 2DYRB 3RBZA 3CPWU 1P4RA 4PA6A 1EFRG 4FIPC 1FXKA 1V54B 3E83A 3OM3B 4RAIA 4BW5A 3FB8C 1VQ9V 1XL6A 1VQ6V 3QO5A 1OCCB 5CMUA 2Y69C 3SYCA 4YXWG 4P2ZA 3OR7C 3CCQV 3JD0A 4DXWA 1W2BU 2M7WA 2ZXWB 3ZIAG 2ZDIC 1QVGU 3I55V 1S5HC 4X8AA 1FXKB 2IH3C 2Q6AA 3K0GA 1E79G 2EINC 2V1DA 1GK9A 1SZTA 2DYSB 1BMFG 4PDLA 4JAUA 1Y4MA 1IXMA 3HB3B 1Q86W 1ZWIC 4H37A 3K0DA 3CCRV 4OXSA 5EK0A 3D36A 3B77A 4RO2A 2EBOA 2Y69B 3OEHG 3ZMSA 4MVMA 2EIJC 2YSUB 2EIMC 3TETA 2QKSA 4RUEA 1K34A 1PNKA 3ZMVA 1NVPD 3RVYA 1Q82W 3STZC 3SYPA 2B1GA 4MT8A 2B1IA 2EINB 1K5QA 1QLEC 2WLIA 2QE7G 3IGAC 5B1AC 3SPIA 2R9RB 3E8BA 3SPJA 4WFEA 1CEZA 3W7SA 3EHBB 3JYCA 5EC2C 4MVZA 5LHGA 5IY5C 2XAFA 3VBBA 1UJWB 2IJKA 3OMAB 2X6CA 5LGNA 3K79A 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 C;  4TWK A;  2WLI B;  3F7V C;  4MTG A;  3T1C A;  5EBW C;  2ATK C;  1V54 C;  1R3I C;  3KG2 A;  4G28 B;  4PA7 A;  1R3J C;  2WLL B;  4LCU C;  3FB7 C;  2A79 B;  5J9P C;  1K4C C;  1R3K C;  4RUF A;  4GX2 A;  4QE9 A;  4PDM A;  1OCC C;  3VOU A;  3T4D A;  3SPH A;  5CBF A;  1JVM A;  4XDJ A;  3ZRS A;  2A9H A;  3LDD A;  1V55 C;  1M57 C;  2Q68 A;  3ASO C;  4H33 A;  3OGC C;  3ZJZ A;  2ZXW C;  1OCZ C;  2H8P C;  3LDC A;  1LNQ A;  2ITC C;  2K1E A;  4G27 B;  2BOC C;  3AG4 C;  3T4Z A;  3IFX A;  5B1B C;  3ABM C;  3E8H A;  4J9Z B;  5CBH A;  3LDE A;  3GB7 C;  4R6Z A;  3F7Y C;  2DYS C;  3RBZ A;  2ZD9 A;  3HPL C;  4X89 A;  4EKW A;  4PA6 A;  1M56 C;  4MVR A;  3F5W C;  1BL8 A;  3E83 A;  4BW5 A;  4RAI A;  3E89 A;  3K04 A;  4PDR A;  3FB8 C;  3PJS K;  5EBM C;  1K4D C;  1XL6 A;  4MSW C;  4WFH A;  4P9O A;  3SPG A;  2IH1 C;  4JTA B;  3UM7 A;  3SYO A;  2Y69 C;  3SYC A;  3X2Q C;  4P2Z A;  3OR7 C;  3ASN C;  4JTD B;  4R7C A;  4DXW A;  3RVZ A;  5BZB A;  2Q69 A;  3TCU A;  3E8G A;  5EBL C;  3LUT B;  4X88 A;  1S5H C;  3UKM A;  3FB5 C;  4X8A A;  4MVO A;  1KKD A;  4P30 A;  2IH3 C;  2KB1 A;  3R65 A;  2HJF C;  1R3L C;  4MTO A;  4P9P A;  3WG7 C;  1OCO C;  2Q6A A;  3AG3 C;  3K0G A;  2EIN C;  2Q67 A;  2WLM A;  4PA4 A;  4MVQ A;  2OCC C;  2AHZ A;  4F4L A;  4ZBM A;  4J9Y B;  2EIK C;  2A0L A;  4PDL A;  2WLN A;  3RW0 A;  4PDV A;  4GX0 A;  5EC1 C;  3SYA A;  1ZWI C;  4H37 A;  4KFM A;  4MW3 A;  2AHY A;  4WFF A;  3EFF K;  3K0D A;  4XDL A;  4OXS A;  5EK0 A;  2X6A A;  3E8F A;  2DWD C;  4MTF A;  4RO2 A;  2WLK A;  4QNH B;  4HYO A;  5KUM A;  2X6B A;  4GX1 A;  3ABK C;  2HVK C;  2P7T C;  3BEH A;  4I9W A;  2DWE C;  2EIJ C;  2JK5 C;  4MVM A;  3OR6 C;  3T2M A;  5CBG A;  2NLJ C;  2EIM C;  4MVS A;  3TET A;  2WLH A;  2QKS A;  1P7B A;  4RUE A;  2WLJ A;  2YEV A;  3OUF A;  2QTO A;  3OUS A;  3SYQ A;  3RVY A;  3STZ C;  4PA3 A;  3K06 A;  3E86 A;  3K08 A;  3SYP A;  1J95 A;  2HVJ C;  4UUJ C;  5KUK A;  1QLE C;  2WLI A;  4PA9 A;  4R8C A;  4MW8 A;  4MS2 A;  3AG2 C;  2EIL C;  3IGA C;  2HG5 C;  5B1A C;  4JTC B;  3SPI A;  2R9R B;  2WLL A;  3E8B A;  3SPJ A;  3STL C;  1XL4 A;  4WFE A;  1G4Y B;  3FB6 C;  3ABL C;  1ORQ C;  3JYC A;  4QE7 A;  5EC2 C;  4LBE C;  4MVZ A;  4LP8 A;  4CBC A;  2HFE C;  4HZ3 A;  3LNM B;  4MVU A;  3SPC A;  4WFG A;  2ITD C;  2BOB C;  1OCR C;  2W0F C;  5IY5 C;  4R50 A;  3SJQ C;  3K03 A;  2X6C A;  5E1A C;  5B3S C;  2DYR C;  4GX5 A;  4XDK A; 
#chains in the Genus database with same CATH topology
 2CE4 A;  2ATK C;  1ZAU A;  4O4L B;  4TV9 B;  2L6L A;  4I4T A;  1K3E A;  5EYP B;  1MG1 A;  4O4I B;  1K9M W;  2A9H A;  1Z5V A;  3K5L A;  4L8J A;  3RYI A;  1BHB A;  3GVM A;  3ZMT A;  4LC1 A;  4DR6 B;  5J2T A;  1PL0 A;  5CBH A;  4KHP O;  3L71 H;  2Z5U A;  3JD3 A;  4Z1M G;  3D3I A;  3H1J H;  1PKX A;  4K0K B;  3W7U A;  1YSC A;  1GN3 A;  1H8H G;  4MSW C;  4ZOL B;  2BCC H;  3LNN A;  3NR7 A;  1OHH G;  1FFX B;  2VQE O;  5C8Y B;  2CH7 B;  4R7C A;  5EIB C;  3CWB H;  1AR5 A;  1EBO A;  1G6U A;  2FB5 A;  3CB2 A;  3JAS A;  4LWS B;  2KB1 A;  4P9P A;  3L73 H;  5H2F Z;  4DW1 A;  3IC9 A;  1MOF A;  3K3W A;  4H0L B;  1VQO V;  3CRM A;  3U10 A;  4GT1 A;  2E5L B;  4MW3 A;  1SF9 A;  4FLT A;  2DOS A;  1XBL A;  2OWO A;  2PZS A;  2HVK C;  2P7T C;  3L70 H;  1PNL A;  1R6N A;  4GCZ A;  4B3S B;  1HNW B;  2IBZ H;  3M99 B;  4X1I B;  4MVS A;  5B66 Z;  1N36 O;  2HJD A;  3QNE A;  3U11 A;  1KBH A;  3ZRV A;  2D2C B;  3K58 A;  4X64 O;  4MS2 A;  3CHX A;  3FB6 C;  4JI7 B;  4GKK O;  4DR5 O;  2PI5 A;  4UCR A;  1NQT A;  2ITD C;  1N34 O;  1P49 A;  4U3F H;  4JZG A;  3JSL A;  3K03 A;  3MDS A;  5B3S C;  5IYC O;  4N23 A;  2QDO A;  1W0K G;  3OGI B;  4P30 A;  4FJC C;  5B5E Z;  2KKW A;  2WLL B;  1PPJ H;  1SKV A;  5LGT A;  3OTF A;  2ZIM A;  4XDJ A;  4JI1 B;  1F4M A;  1Y74 A;  3W7X A;  3OGC C;  4B7K A;  3ICX A;  1K73 W;  2QM7 A;  1VF6 C;  1S5L Z;  5J2U B;  4CC6 A;  4G27 B;  4Q6G A;  4DR1 O;  3MHH C;  4BIO A;  4NXM O;  2HHH B;  1XHZ A;  3E8H A;  1FJG O;  1WPB A;  3PN1 A;  5LOV A;  4JAV A;  1QQC A;  3K04 A;  2IM9 A;  1AIL A;  1B04 A;  1SES A;  1VF5 B;  3J7A U;  1S72 V;  4UV8 A;  3CRQ A;  3CXC U;  4C7U A;  1FS0 G;  1LR1 A;  2QKA A;  1FFT B;  3LUT B;  1COW G;  4MVO A;  2VQF B;  2C2A A;  1JOY A;  3RYH B;  1AP6 A;  2P90 A;  1PM9 A;  4GX0 A;  1YJ9 V;  4J10 A;  4OGQ B;  5KX5 A;  2IJJ A;  2EZO A;  5IE9 A;  1RSO A;  3E8F A;  2A06 H;  4LF9 B;  1HNZ B;  3AK2 A;  4NB5 A;  4X62 O;  1IBK O;  3CC4 V;  5LXT A;  3L9D A;  1YJN V;  3E86 A;  1KYO F;  2HVJ C;  4UB8 Z;  1R6T A;  1R73 A;  1E1R G;  1N4C A;  4UCO A;  2WPD G;  4MW8 A;  3AG2 C;  4G2K A;  4B3T O;  1YEW A;  4A5U B;  1GM8 A;  4QE7 A;  3HKB B;  2BOB C;  2YI9 A;  1WB7 A;  3DXR B;  3RYF B;  4GX5 A;  4XDK A;  3AG1 C;  4X20 B;  2ARH A;  5JCO A;  4YJ3 B;  3MD0 A;  2NNU A;  1GH6 A;  3EVK A;  3VOU A;  5IYB O;  4OPA A;  2JGD B;  4DV0 O;  3AG2 B;  1M57 C;  2Q68 A;  5KMG B;  1BGY H;  3BAA A;  4UVA A;  4FZ0 A;  2NN4 A;  2YDE A;  3LDC A;  4LNU A;  5EZY B;  1AI4 A;  1M1K W;  4J9Z B;  3F7Y C;  4DR7 B;  2XND G;  4EKW A;  2P4K A;  5FL7 G;  3ZRW A;  1Y66 A;  3AG1 B;  4N21 A;  2AW9 A;  4O4J B;  5CN0 A;  4JTA B;  5CA1 B;  4Z2W A;  4QPJ A;  4DUY O;  3CP1 A;  4PI2 A;  4HAM A;  1M57 B;  4JGS A;  1SZX A;  3TCU A;  3C3T A;  2W0X A;  2GSM B;  4DR4 O;  1S77 D;  1K33 A;  4CZZ A;  4J7J A;  1MZE A;  5LHH A;  1SQQ H;  4J9Y B;  2WLN A;  1KB9 F;  1QLN A;  4KHP B;  3TJT A;  4PHZ A;  5FPO A;  5GON B;  4FLY A;  4LF4 O;  2UUC O;  1X59 A;  5JQG B;  1D5N A;  2ZNJ A;  5IJ9 B;  1KD1 W;  3T2M A;  4UFZ A;  2WLH A;  5FNV B;  2JJ1 G;  1HW7 A;  4NKG B;  2VQE B;  3G71 V;  3T1H O;  3L75 H;  3K06 A;  5L3C A;  4BR6 A;  3STL C;  5IJ0 A;  3CC7 V;  1ORQ C;  1YIJ V;  1NS1 A;  3JAW A;  2QKC A;  5L3G A;  2LJ2 A;  1GN4 A;  4R50 A;  2QWQ B;  1UFI A;  3N2G A;  3K57 A;  3CC2 V;  2DJV A;  4J7Z A;  4LFA O;  1FKA O;  1N36 B;  1KQS U;  3CRR A;  1JVM A;  1K8A W;  1GKF A;  3QO7 A;  4YJ2 B;  2R70 A;  4DK1 A;  4X64 B;  3IFX A;  4I55 A;  4DR5 B;  1ZL8 B;  5TIS Z;  1O9H A;  3CPW U;  4PA6 A;  2CDY A;  1VP7 A;  5JVD A;  1N34 B;  4FIP C;  2F4V O;  4RAI A;  1GAX A;  4KXR A;  4DV7 O;  4ZIB A;  4DV5 O;  2Y69 C;  4JI5 O;  3KCX A;  4P2Z A;  3ZHT A;  2PF4 E;  4DR3 O;  2QSA A;  3ZIA G;  1S5H C;  2EUL A;  4ZI7 B;  2Q6A A;  2WA4 A;  1GK9 A;  1SZT A;  1V9P A;  2UU9 O;  4DR1 B;  4JAU A;  1Q86 W;  4NXM B;  1ZWI C;  1FJG B;  3K0D A;  4OXS A;  3B77 A;  2CGN A;  2Y69 B;  2QWP B;  4D7S A;  4TUY B;  2RN9 A;  2YSU B;  4RUE A;  1VEW A;  1K34 A;  3ZMV A;  3RVY A;  2KSD A;  2BTO A;  3HKD A;  4MT8 A;  2B1I A;  1QLE C;  4O4L A;  3IGA C;  4TV9 A;  2O57 A;  3EHB B;  1WNS A;  5KHH A;  2P4V A;  3VQV A;  3JAM N;  5LHG A;  2XAF A;  2GTS A;  3R66 A;  3U0Z A;  1YIT V;  2WLI B;  3F7V C;  3T1C A;  5EBW C;  4F6R A;  2GUZ A;  1AI6 A;  3JAT B;  4JI0 O;  4NTY A;  5KAF Z;  4X62 B;  1IBK B;  1QLE B;  1WN7 A;  5KHJ A;  5JJN B;  4DRX B;  4RQE A;  1HWY A;  2YIB A;  4WBN B;  4B3T B;  2UXB B;  4O4H B;  1FFX A;  1JFF B;  5C8Y A;  2CH7 A;  4RQF A;  1Y6X A;  4GUN A;  1TUE B;  2HKO A;  2FL4 A;  4MVR A;  1BL8 A;  2UXN A;  5KLV H;  1MSD A;  2JJ2 G;  3K9S A;  4GZR B;  3J81 N;  2OTJ V;  2RMK B;  1FYJ A;  2KG7 A;  1NU1 H;  4DO2 A;  3E35 A;  3JD4 A;  4UVB A;  1VQ8 V;  1KKD A;  3BRC A;  2HJF C;  2WLM A;  3K5M A;  4X1I A;  1N8R W;  4CS3 A;  1FXV A;  3MAQ A;  2B9Z A;  1JR9 A;  2RDC A;  4YIO A;  4NTX A;  4KP4 A;  2DW4 A;  1ARO P;  2CTQ A;  4MTF A;  3ABT A;  3OW2 U;  3BPZ A;  4LFB O;  4CH4 A;  4JI3 O;  1QCE A;  3FD9 A;  3DC6 A;  2PUS A;  1XNQ B;  1SA0 B;  3M7M X;  2ILM A;  4I9Q A;  3APO A;  5LMN B;  2E3C A;  1TGO A;  1SET A;  3AG7 A;  4EB6 A;  4DR4 B;  3JAK A;  1HP8 A;  1TAE A;  2DMX A;  2EIL C;  3UCS C;  4JTC B;  4X1K B;  2WLL A;  5KHI A;  4CBC A;  3OFN G;  4EFE A;  1SQP H;  1WP8 A;  5KHG A;  4MVU A;  3G6E V;  3RYC B;  4NYK A;  1XIL A;  3VQW A;  1FPO A;  2ZM6 O;  4UV9 A;  4D7T A;  4LF4 B;  1HDJ A;  2UUC B;  1R3I C;  3KG2 A;  1WA8 A;  4G28 B;  5DM6 V;  1L8D A;  2XOK G;  4JZ2 A;  3FB7 C;  1XQ8 A;  1JJ2 U;  3SJC C;  3LDD A;  1Z2G A;  2EIL B;  1HNX O;  5ITZ B;  2DN9 A;  2JS3 A;  2Q73 A;  1N0J A;  3TXQ A;  2K1E A;  1NKD A;  1BZK A;  2UUB O;  1GN2 A;  3ABM C;  3ZX6 A;  3CYO A;  4Z1V A;  1VF6 A;  3D3Q A;  3JD2 A;  2EJ7 A;  2ODM A;  3E89 A;  3IC7 A;  2ZR2 A;  3GWO A;  2ADP A;  4P9O A;  4UCT A;  3RYH A;  2YIA A;  4DW0 A;  1RM1 C;  4LFA B;  3ZCC A;  3RVZ A;  3E8G A;  2YI8 A;  1W0J G;  2CTW A;  3ABM B;  2XAG A;  4X66 O;  2A0L A;  3RW0 A;  4PDV A;  3E22 A;  4J42 A;  4UVC A;  3BVO A;  5KHK A;  1ZLZ A;  5LYJ B;  1XUQ A;  4U3J B;  4HYO A;  2X7R B;  3B8M A;  2YEV B;  1RM1 B;  2F4V B;  2Q4P A;  2R72 A;  4DV7 B;  1M93 A;  3H1H H;  2BSK B;  2CUG A;  4DV5 B;  4DUZ O;  4JI5 B;  3CRA A;  2Q9L A;  2YXL A;  4BAY A;  2IU0 A;  2QM8 A;  4DR3 B;  3RYF A;  2JDI G;  3JAR B;  4BIU A;  3B4S A;  1K5S A;  4IIJ B;  1OV9 A;  2ZIO A;  2E75 B;  3NXS A;  2PGG A;  4YJ3 A;  2OYQ A;  2N05 A;  5CA0 B;  2JGD A;  3LSU A;  1W59 A;  4WFG A;  5KA5 A;  5KMG A;  2HLD G;  4DV2 O;  1BE3 H;  3CSX A;  2EZP A;  4W4L A;  4I50 B;  1OZ0 A;  1JMK C;  5J9P C;  1SRY A;  4MTX A;  2DQ0 A;  2F43 G;  3H1K H;  1D2D A;  2GHY A;  3CCU V;  3OE7 G;  4O4J A;  3H9V A;  4UB6 Z;  4I7Z B;  5CA1 A;  1ENV A;  4EEQ A;  4GYC B;  4R6Z A;  1F23 A;  3ETG A;  5FLX N;  1RP3 B;  2RNB A;  1CPY A;  4ABM A;  4FMT A;  3LSS A;  1VF7 A;  1J5E B;  1I94 O;  1MSW D;  3CX5 F;  3CD6 V;  4FPP A;  3ZMZ A;  4UCV A;  1DF5 A;  4JI0 B;  1L1F A;  1AR4 A;  2LW1 A;  3CJH B;  1U96 A;  3WFV A;  5GON A;  3FB5 C;  4MTO A;  5JQG A;  1EM1 A;  4LR3 A;  5IJ9 A;  5B3S B;  2Q67 A;  2OCC C;  4F4L A;  1TVK B;  2ETN A;  5JH7 B;  4JAS A;  1EZJ A;  2F23 A;  2V4D A;  2EX3 A;  5H9C A;  1Z5W A;  2JK5 C;  5IYD O;  3ABU A;  4JYY A;  1P7B A;  1Q3E A;  1JCH A;  4PA3 A;  5IYZ B;  1GRJ A;  4FFK A;  3K5N A;  3RN4 A;  2UXC O;  2OCC B;  4PA9 A;  4TQF A;  1NTZ H;  4TOI A;  1IUR A;  1G4Y B;  1GTO A;  5LP6 C;  5H6Q A;  5JWP A;  1XDC A;  4YJ2 A;  4JI6 O;  3BA9 A;  3F5T A;  3T1Y O;  2UXD O;  2H94 A;  4YHH O;  1QR8 A;  4LFB B;  4DV3 O;  4JI3 B;  1S3J A;  5L3D A;  3OD4 A;  1YTF D;  3ETE A;  4PDM A;  1MZF A;  4WCE V;  1IBL O;  1NTK H;  1Q7Y W;  3M8A A;  4X1Y A;  1KU9 A;  3JAL A;  2H8P C;  1LNQ A;  5LP6 B;  2BOC C;  4TV8 B;  1H38 A;  2Z3Y A;  1YZB A;  3GB7 C;  3A8T A;  3A0B Z;  5D5Q A;  2ZM6 B;  4ZI7 A;  3FB8 C;  5GTI Z;  2Q7G A;  3BHP A;  1QNM A;  1VQ6 V;  3HKE B;  1PP9 H;  3SYC A;  4YXW G;  3JAS B;  3OR7 C;  3JD0 A;  4DXW A;  4YIP A;  3A0H Z;  3I55 V;  1ZTE A;  1HNX B;  2G38 A;  2IH3 C;  2YIC A;  4TUY A;  3B2E E;  2YS8 A;  5CB4 B;  4JAA A;  2Q5Z A;  2UUB B;  1Y4M A;  3A2F A;  3HB3 B;  1BQ0 A;  4IHJ B;  3P3N A;  2LO1 A;  2GDS A;  2EIJ C;  3KKY A;  4PV1 B;  1S5J A;  1OJH A;  2EIM C;  2AGA A;  1NVP D;  2OIE A;  4FLU A;  3SDL A;  1U97 A;  2WLI A;  1Q8I A;  3JAT A;  5B1A C;  3J80 N;  1XMQ O;  3E8B A;  1CEZ A;  3W7S A;  1MA1 A;  2XUM A;  3OTO O;  4O2B B;  1YVW A;  1LUW A;  4FFB A;  5IY5 C;  4DRX A;  1VMG A;  3OMA B;  1WJZ A;  3G80 A;  1RFY A;  1GM9 A;  1IDS A;  2FYU H;  4AHC A;  2EIM B;  4PJ0 Z;  1YJW V;  3G67 A;  3S3W A;  1JFF A;  1JQ0 A;  1Y74 B;  5LGU A;  1R3K C;  1H2G A;  4DUZ B;  1PL4 A;  4PEL A;  1NZ6 A;  1KMI Z;  4OPH A;  1ZX3 A;  1YDX A;  5JJJ B;  1JA8 A;  4AIL C;  4DV6 O;  1FD9 A;  5LOV B;  3T4Z A;  4CH5 A;  5IY5 B;  5B1B C;  5AG2 A;  2PTM A;  5C93 A;  4FLW A;  1M56 C;  2LFR A;  1BCC H;  2ZKO A;  1M9N A;  4Q20 A;  4DV2 B;  2FKX A;  1VQ4 V;  1PV0 A;  3H1L H;  3CMA V;  1K4D C;  3L72 H;  2M6Y A;  3SPG A;  3THO A;  3UM7 A;  2PYL A;  2WA3 A;  3X2Q C;  2QA4 V;  3Q4H A;  2XAQ A;  1VQN V;  1JX9 A;  5LA6 B;  2ADQ B;  4IT5 A;  1O9G A;  3ETD A;  4GKK B;  1Q6U A;  5B1B B;  1SA0 A;  2XAJ A;  2EIK C;  2Q0O C;  3O9O A;  3N2K A;  2LW7 A;  3CRC A;  2IW5 A;  1XRE A;  3CCM V;  1NR1 A;  1L0N H;  2B5U A;  2E74 B;  2Z0A A;  4GX1 A;  5LXT B;  2X0L A;  4X1K A;  1ZUQ A;  1VAR A;  1I94 B;  3X2Q B;  1QU7 A;  4K0K O;  3OR6 C;  4LFC O;  5CBG A;  2NLJ C;  4NVP A;  2QTO A;  4ASU G;  3N27 A;  2JRI A;  4FVM A;  4JI2 O;  5KUK A;  2P67 A;  2H3O A;  2ZDI A;  4HNA A;  2EIK B;  2ZQM A;  2K9P A;  5L3E A;  4WFB V;  2VWJ A;  1THZ A;  1B3Q A;  1K7D A;  3ABL C;  5DEC A;  4LBE C;  3OMN B;  3SPC A;  2CTR A;  2ZIN A;  1YF2 A;  2ZE6 A;  5ITZ A;  1LUV A;  1I0H A;  3SYQ A;  4PA7 A;  4AQY O;  2MW2 B;  4LCU C;  3B8N A;  4RUF A;  2CGO A;  3QF7 A;  3SPH A;  4X9Q A;  4LNU B;  3ZRS A;  3FAV B;  5EYP A;  5IWA O;  2UXC B;  3ABL B;  3ZRW B;  4O4I A;  5BMV B;  4I5S A;  4QPK A;  3I5D A;  3RGB A;  2P5O A;  3CE2 A;  1SQX H;  4OX9 O;  2FML A;  2LGQ A;  1TA8 A;  3F5W C;  4JI6 B;  3T1Y B;  2UXD B;  4YHH B;  5GTH Z;  3PJS K;  4I0X B;  2AZ0 A;  1IX9 A;  4DV3 B;  2IH1 C;  1JJO A;  1MAB G;  2WSS G;  1GN6 A;  4K3A A;  2Q0A A;  4B3R O;  2D3O W;  1EN5 A;  4JYB A;  4TSF G;  4ZOL A;  5LYJ A;  1Y76 B;  4LH6 A;  1IBL B;  1EN6 A;  3BCC H;  4JF3 A;  4XBF A;  3TXS A;  2Q7E A;  1YHQ V;  1QVF U;  3DTU B;  4LH7 A;  4ZBM A;  1AB3 A;  2GBO A;  1QHT A;  4LWS A;  3SYA A;  2L35 A;  4JYA O;  4WFF A;  1H2L A;  3JAR A;  1A32 A;  3KZI Z;  1AI5 A;  1VQ5 V;  4BW9 A;  2NR5 A;  4DV0 B;  1VQP V;  2RCV A;  4WFA V;  5CA0 A;  2WLJ A;  3OUS A;  1IXB A;  2QEX V;  3CS5 A;  2W6J G;  3JCU Z;  1SQV H;  2RQ6 A;  1J95 A;  5IJ0 B;  2YC0 A;  4UUJ C;  1H2K A;  3RFR A;  1VQ7 V;  1AVM A;  3JAW B;  4CC5 A;  1N32 O;  4ZHQ B;  3RT3 C;  2HG5 C;  4ICG A;  4I50 A;  5BXZ A;  2YXY A;  4JV5 O;  2VQF O;  4LF8 O;  3WU2 Z;  1BS3 A;  3C3S A;  1SQF A;  1M5I A;  3ZHU A;  4QJF B;  5A9G A;  1FAF A;  2Y0P A;  2W0F C;  3D8C A;  4BWA A;  1TUB B;  1BT8 A;  3OMI B;  2JS5 A;  5FPR A;  1N33 O;  4DUY B;  1AP5 A;  2ZR3 A;  2WAM A;  1Q43 A;  3W7T A;  2DE0 X;  1VQM V;  1Q5O A;  5CBF A;  2EJR A;  1F51 A;  3SJA C;  2AZ2 A;  4FM0 A;  2P6J A;  1OCZ C;  2YUA A;  1VQL V;  1R6K A;  3CCS V;  3WB0 A;  2ITC C;  3EXA A;  4UXN A;  3CCL V;  1H8E G;  1SQG A;  2UUA O;  3LDE A;  2GV9 A;  5J2U A;  3OTO B;  1XOU A;  5L3B A;  2W6I G;  3IJ4 A;  4WFH A;  1TVK A;  3T1H B;  3BY6 A;  1K92 A;  2OT5 A;  1OCZ B;  3OAA G;  4L87 A;  4B08 A;  5KA6 A;  1OCO C;  4PA4 A;  2XAS A;  4TT3 G;  1WB8 A;  1KP2 A;  5LBQ A;  4DV6 B;  3MHS C;  2VS0 A;  3P30 A;  3JD1 A;  4FLV A;  4XDL A;  1Q81 W;  2XAH A;  5DN6 G;  1AJQ A;  3UT5 B;  2X6B A;  2JVD A;  1YXB A;  4FLX A;  4AI8 A;  2QGN A;  2YIB D;  1KUQ A;  1OCO B;  4NXN O;  4DV1 O;  3WB2 A;  4F6R B;  3K59 A;  2GUZ B;  3JCZ A;  1NBM G;  4JI8 O;  4EFB A;  1KP3 A;  5LHI A;  2QWN B;  3W7W A;  3HKB A;  5HFM A;  1NJI W;  5LP6 A;  4E2L A;  4TV8 A;  4X65 O;  4UCS A;  3DXR A;  4LFC B;  3CCE V;  4KUM A;  4NR1 A;  1B6Q A;  4X20 A;  1AR1 B;  5IDJ A;  5EIB D;  1KC8 W;  2A7W A;  1FXH A;  4JI2 B;  3ZJZ A;  2UU9 B;  2OTL V;  3BFR A;  3HKE A;  2LGW A;  2CK3 G;  1FXK C;  4ZKI A;  4JPR A;  2DYS C;  1P4R A;  5DED A;  5EZY A;  2BTQ B;  3E83 A;  3OM3 B;  4BW5 A;  4FLZ A;  1VQ9 V;  4IYH A;  3SGI A;  1XL6 A;  1H2M A;  3QO5 A;  2KG7 B;  4CH6 A;  5CB4 A;  4AQY B;  4J80 A;  2M7W A;  1QVG U;  4DYL A;  4FZ1 A;  1HR0 O;  1H2S B;  3UO2 A;  1FXK B;  2ZT9 B;  4IHJ A;  3D36 C;  3HKC B;  5IWA B;  3SR2 C;  2V1D A;  2DYS B;  1BMF G;  1DK1 A;  1T5E A;  4OX9 B;  3CCR V;  3GWK C;  4RO2 A;  1BQZ A;  2EBO A;  1MMM A;  1Q90 D;  3ZS8 C;  2QKS A;  4EB6 B;  3JAK B;  4O2A B;  4O2B A;  3STZ C;  2PYJ A;  4B3R B;  4GKJ O;  1L0L H;  2B1G A;  5FNV A;  1K5Q A;  2ZE7 A;  2QE7 G;  2XHB A;  1X4T A;  3SPI A;  2XT9 A;  4WFE A;  5EC2 C;  1IBM O;  4JYA B;  4LF6 O;  1WA8 B;  5E79 Z;  1UJW B;  5LGN A;  3JSN A;  1KKC A;  3AK3 A;  1YCI A;  1BHA A;  1P7G A;  1XEQ A;  2A79 B;  5D5P A;  1GO3 F;  5JJE B;  4QE9 A;  1CXZ B;  1WPX A;  4IYI A;  1Q6H A;  1SQB H;  3ASO C;  4K35 A;  5LMU O;  4H33 A;  1UPG A;  1E1Q G;  1N32 B;  1MNG A;  1WAZ A;  2JEU A;  1CP9 A;  4I4T B;  1XMO O;  5A2Q N;  4JV5 B;  1P84 F;  3FX7 A;  3CME V;  4LF8 B;  3CCV V;  1H2N A;  5LA6 A;  5HFL A;  3RYI B;  1ZL8 A;  2Q7H A;  1N33 B;  3SYO A;  5K1P A;  5J2T B;  1I5Y A;  4KL1 A;  3ASN C;  1R1B A;  3ASO B;  4IL6 Z;  3ZHV A;  5BR8 O;  1DF4 A;  3TK1 A;  1NH2 D;  1QR9 A;  5IT9 N;  1GMG A;  1IVS A;  3R65 A;  3E22 B;  3AG3 C;  3DC5 A;  4DR2 O;  3ZHR A;  1WLE A;  4H44 B;  2UXB O;  5LL6 Y;  2AHY A;  2UUA B;  3OT7 A;  5KUM A;  2YID A;  1YTF B;  3ABK C;  3FYI B;  1G1X B;  2MK3 A;  3ASN B;  4TQD A;  4YY3 O;  4J7K A;  2QWR B;  3OUF A;  3P32 A;  2HEP A;  3K5O A;  1NH2 B;  3AG3 B;  1I7F A;  1JPX A;  1XHX A;  2XTA A;  4JI4 O;  4K8X A;  4W4K A;  3ZN0 A;  2JEX A;  1XL4 A;  2VRZ A;  3B09 A;  2HFE C;  2IJH A;  4LF5 O;  3ABK B;  2ZE8 A;  3SJQ C;  3FAV A;  1AI7 A;  5E1A C;  2P22 C;  2OCH A;  4TWK A;  2IJI A;  5BMV A;  1R3J C;  3CEI A;  2QM4 A;  2JGU A;  4GX2 A;  1XNQ O;  2ZCE A;  1US6 A;  5LMN O;  1V55 C;  2N74 A;  3ML0 A;  1WP7 A;  3QTC A;  1DGS A;  4I0X A;  4X66 B;  4NXN B;  4J11 A;  4DV1 B;  3AG4 C;  3O65 A;  3VQY A;  1VIB A;  2Y4U A;  2EIJ B;  2UXX A;  2YXH A;  3ZN1 A;  4DK0 A;  3ZRX A;  2FTK A;  2ZD9 A;  3HPL C;  4X89 A;  3VQX A;  4WBN A;  1Y76 A;  4NTW A;  4O4H A;  4JI8 B;  4LF7 O;  3UQ8 A;  1NVP B;  2QR4 A;  5EBM C;  3ZHS A;  1DLB A;  1S0V A;  4B3M O;  4X65 B;  2PY5 A;  2QTS A;  3FYE B;  5B1A B;  1NI8 A;  4JTD B;  1V55 B;  3QO8 A;  5BZB A;  1NT2 B;  4X88 A;  1URF A;  1QBZ A;  3E2E A;  3AG4 B;  1R3L C;  1XNR O;  3WG7 C;  1DTO A;  4DV4 O;  4MVQ A;  2AHZ A;  5EC1 C;  4KFM A;  3EFF K;  2X6A A;  2DWD C;  1XI1 A;  2Y4T A;  4QNH B;  2R9I A;  3KCY A;  4ZHQ A;  2V7Q G;  2DQ3 A;  2LFS A;  3BEH A;  3B40 A;  2GTA A;  4I9W A;  2A3Q A;  1PD3 A;  2LP7 A;  3OEE G;  1I08 A;  1Y67 A;  5KX5 B;  5CA3 A;  1RSO B;  3WG7 B;  1TUB A;  3UO3 A;  1HR0 B;  1G8M A;  1M56 B;  2QWO B;  4DR6 O;  1B06 A;  3SJB C;  1K97 A;  5L3F A;  1NR7 A;  4HZ3 A;  1OCR C;  5JCO C;  1GM7 A;  3RYC A;  1ZSP A;  4WF9 V;  4PI0 A;  1K4C C;  4X1Y B;  4PD4 F;  3JAL B;  3BAB A;  4GKJ B;  5B1N A;  1PNM A;  3IAY A;  1NTM H;  5H5N A;  2E5L O;  3DGE A;  1OCR B;  1EZV H;  1AJP A;  2PI4 A;  1IBM B;  4LF6 B;  1M90 W;  4PDR A;  3ETQ A;  3P3P A;  3QG5 A;  2CAZ C;  4B3S O;  1HNW O;  4BIZ A;  1I5X A;  1Q6I A;  2IU3 A;  1ROP A;  2Q69 A;  3K9A A;  4F6E A;  5EBL C;  3WB1 A;  3UT5 A;  3LSQ A;  2JIZ G;  3CXH F;  4UCU A;  3UKM A;  2Y48 A;  3G4S V;  5LMU B;  3I56 V;  1RPO A;  4FK5 C;  1SER A;  4FM1 A;  4JI7 O;  1KEC A;  4H13 B;  3CCJ V;  1XMO B;  4QGP A;  4JYC A;  1S76 D;  1VQK V;  1D5A A;  2WLK A;  2OIG A;  2DWE C;  2R9A A;  1YI2 V;  4U3J A;  1J5E O;  2YEV A;  2LQT A;  1AJN A;  4JI1 O;  3K08 A;  2VWK A;  5BR8 B;  2BSK A;  4J41 A;  2F1M A;  4R8C A;  2F95 B;  4QIW F;  4FFB B;  3RWR D;  4RWU A;  3C90 A;  2HHH O;  1BSM A;  1SS3 A;  4E4E A;  4FM2 A;  5H6R A;  4DR2 B;  4LP8 A;  3FKS G;  3LNM B;  4IIJ A;  4CH3 A;  2KQX A;  3TGU H;  4U7O A;  4U7N A;  5B1O A;  3A0R A;  2DYR C;  5K1X A;  4MTG A;  1V54 C;  3AEI A;  2QJ1 A;  5F2V O;  1F7Y A;  4YY3 B;  2F66 C;  1OCC C;  3T4D A;  2BTQ A;  2F93 B;  1M4U A;  1N0N A;  3BA8 A;  3N2G B;  5GW7 A;  2ZXW C;  1F4N A;  2HR3 A;  4HBN A;  4JI4 B;  2CTP A;  2WWW A;  4CS2 A;  3HR0 A;  5KAI Z;  3ZMU A;  1RPR A;  1SC5 B;  3H01 A;  2HP8 A;  2DYR B;  3RBZ A;  4LF9 O;  1HNZ O;  1EFR G;  4LF5 B;  1FXK A;  1V54 B;  3ZED A;  3Q4H B;  2P06 A;  3HKC A;  3FFQ A;  2N04 A;  1OCC B;  5CMU A;  3L74 H;  3CCQ V;  4I55 B;  1W2B U;  2ZXW B;  2ZDI C;  5JVD B;  4X8A A;  1XMQ B;  3N2K B;  3ZBH A;  2Q8V A;  3K0G A;  1E79 G;  2EIN C;  3G6B A;  3CJH A;  4PDL A;  4GLX A;  2Y0I A;  4O2A A;  1EN4 A;  1IXM A;  2AXT Z;  4H37 A;  4D6T H;  5EK0 A;  3D36 A;  3AK1 A;  3QVN A;  4LF7 B;  5JH7 A;  2BE3 A;  3OEH G;  3ZMS A;  4MVM A;  3S3X A;  2RJZ A;  4B3M B;  3TET A;  2ZNI A;  4B7E A;  4IGG A;  1PNK A;  4HNA B;  1Q82 W;  2E76 B;  3SYP A;  2EIN B;  3APQ A;  4K8Z A;  3H1I H;  1XNR B;  2R9R B;  5IYZ A;  3SPJ A;  3DSQ A;  4DV4 B;  3ZHQ A;  2ZE5 A;  3JYC A;  4MVZ A;  4DR7 O;  4CS4 A;  1IZ3 A;  5BY1 A;  3VBB A;  2IJK A;  2X6C A;  3K79 A;  3HKD B; 
#chains in the Genus database with same CATH homology
 1YIT V;  2WLI B;  2EIM B;  3F7V C;  3T1C A;  5EBW C;  2ATK C;  1AI6 A;  1BHA A;  1YJW V;  1K3E A;  1JQ0 A;  2A79 B;  1GO3 F;  5LGU A;  1R3K C;  1H2G A;  4QE9 A;  1MG1 A;  4PEL A;  1QLE B;  1K9M W;  2A9H A;  1WPX A;  4RQE A;  1HWY A;  3ASO C;  4H33 A;  1BHB A;  1E1Q G;  3ZMT A;  4LC1 A;  2JEU A;  3T4Z A;  1CP9 A;  1PL0 A;  5IY5 B;  5B1B C;  5CBH A;  3CME V;  4RQF A;  5C93 A;  2Z5U A;  1TUE B;  2HKO A;  1M56 C;  3CCV V;  3JD3 A;  2LFR A;  4Z1M G;  4MVR A;  3D3I A;  1BL8 A;  1PKX A;  2UXN A;  5HFL A;  1M9N A;  4Q20 A;  1VQ4 V;  2JJ2 G;  3W7U A;  1YSC A;  1K4D C;  3CMA V;  4MSW C;  1H8H G;  3SPG A;  1OHH G;  3SYO A;  3UM7 A;  2OTJ V;  3X2Q C;  1I5Y A;  2QA4 V;  3ASN C;  4R7C A;  3ASO B;  2XAQ A;  1VQN V;  1DF4 A;  3TK1 A;  4DO2 A;  3E35 A;  3JD4 A;  1EBO A;  1JX9 A;  4UVB A;  1NH2 D;  1QR9 A;  1GMG A;  1VQ8 V;  1KKD A;  2KB1 A;  3ETD A;  2HJF C;  3R65 A;  4P9P A;  3AG3 C;  5B1B B;  2WLM A;  2XAJ A;  1MOF A;  3K3W A;  2EIK C;  1VQO V;  1N8R W;  4GT1 A;  1WLE A;  1FXV A;  4MW3 A;  2AHY A;  4KP4 A;  2DW4 A;  1ARO P;  2IW5 A;  4MTF A;  3ABT A;  3OW2 U;  3CCM V;  1NR1 A;  5KUM A;  2B5U A;  1YTF B;  4GX1 A;  3ABK C;  2HVK C;  2P7T C;  2X0L A;  3FYI B;  1PNL A;  1QCE A;  1R6N A;  2MK3 A;  3OR6 C;  3ASN B;  4GCZ A;  3X2Q B;  5CBG A;  2NLJ C;  3M99 B;  4MVS A;  3OUF A;  2QTO A;  4ASU G;  3QNE A;  3P32 A;  3ZRV A;  1NH2 B;  3AG3 B;  1JPX A;  1SET A;  5KUK A;  2P67 A;  2ZDI A;  4MS2 A;  2EIK B;  2EIL C;  2ZQM A;  5L3E A;  4WFB V;  4JTC B;  3ZN0 A;  2WLL A;  2JEX A;  1THZ A;  1XL4 A;  1K7D A;  3FB6 C;  3ABL C;  4LBE C;  4CBC A;  2PI5 A;  3OFN G;  1NQT A;  3OMN B;  2HFE C;  4MVU A;  3G6E V;  3SPC A;  2ITD C;  2IJH A;  3ABK B;  3SJQ C;  1AI7 A;  3K03 A;  5E1A C;  4UV9 A;  5B3S C;  5IYC O;  4N23 A;  4P30 A;  1W0K G;  3SYQ A;  4TWK A;  2IJI A;  4FJC C;  1R3I C;  3KG2 A;  4G28 B;  4PA7 A;  5DM6 V;  2XOK G;  1R3J C;  2WLL B;  4LCU C;  3FB7 C;  3B8N A;  5LGT A;  4RUF A;  4GX2 A;  3SPH A;  4XDJ A;  3ZRS A;  1JJ2 U;  3LDD A;  1F4M A;  1V55 C;  2EIL B;  3W7X A;  3OGC C;  3ML0 A;  1K73 W;  3ABL B;  3ZRW B;  2QM7 A;  4I5S A;  4QPK A;  2K1E A;  1NKD A;  4G27 B;  3AG4 C;  3MHH C;  3ABM C;  2EIJ B;  2UXX A;  3E8H A;  3ZN1 A;  3CYO A;  3ZRX A;  2FTK A;  2ZD9 A;  3HPL C;  4X89 A;  4JAV A;  3F5W C;  3JD2 A;  3E89 A;  3IC7 A;  2ZR2 A;  3K04 A;  1NVP B;  3PJS K;  3GWO A;  5EBM C;  1DLB A;  1SES A;  1S0V A;  4P9O A;  2IH1 C;  1RM1 C;  1S72 V;  4UV8 A;  1MAB G;  2WSS G;  3CXC U;  3FYE B;  5B1A B;  4JTD B;  1V55 B;  3QO8 A;  3RVZ A;  3ZCC A;  1FS0 G;  5BZB A;  2D3O W;  4JYB A;  4TSF G;  3E8G A;  1FFT B;  3LUT B;  4X88 A;  1COW G;  4MVO A;  1QBZ A;  3E2E A;  3AG4 B;  4JF3 A;  4XBF A;  1R3L C;  3WG7 C;  1DTO A;  1W0J G;  2C2A A;  3ABM B;  4MVQ A;  1YHQ V;  2XAG A;  2AHZ A;  3DTU B;  1QVF U;  1JOY A;  4ZBM A;  2A0L A;  2P90 A;  3RW0 A;  4PDV A;  4GX0 A;  4UVC A;  5EC1 C;  3SYA A;  1YJ9 V;  4KFM A;  4WFF A;  2IJJ A;  3EFF K;  2EZO A;  2X6A A;  3E8F A;  2DWD C;  4QNH B;  1AI5 A;  4HYO A;  2R9I A;  1VQ5 V;  2X7R B;  3B8M A;  2YEV B;  1RM1 B;  2V7Q G;  2DQ3 A;  2LFS A;  3BEH A;  4I9W A;  1PD3 A;  1VQP V;  2LP7 A;  3OEE G;  4WFA V;  2WLJ A;  3CC4 V;  3OUS A;  2QEX V;  4BAY A;  2IU0 A;  1YJN V;  2W6J G;  2QM8 A;  3E86 A;  5CA3 A;  2JDI G;  1J95 A;  3WG7 B;  2HVJ C;  4BIU A;  4UUJ C;  1VQ7 V;  1R73 A;  1K5S A;  1E1R G;  1G8M A;  1M56 B;  2WPD G;  4MW8 A;  3AG2 C;  4G2K A;  2HG5 C;  3NXS A;  1K97 A;  1GM8 A;  4QE7 A;  5L3F A;  1NR7 A;  4HZ3 A;  4QJF B;  4WFG A;  2BOB C;  1OCR C;  2W0F C;  5KA5 A;  2HLD G;  3OMI B;  4GX5 A;  4XDK A;  3AG1 C;  1GM7 A;  2EZP A;  2ZR3 A;  4WF9 V;  1OZ0 A;  5J9P C;  2WAM A;  1SRY A;  1K4C C;  4MTX A;  2DQ0 A;  2F43 G;  3MD0 A;  3W7T A;  1VQM V;  2NNU A;  3VOU A;  5IYB O;  5CBF A;  2EJR A;  1F51 A;  3AG2 B;  1M57 C;  2Q68 A;  2P6J A;  5B1N A;  1PNM A;  2GHY A;  4UVA A;  3CCU V;  3OE7 G;  1OCZ C;  1VQL V;  1R6K A;  3CCS V;  3LDC A;  1ENV A;  1AI4 A;  2ITC C;  3DGE A;  1OCR B;  4UXN A;  3CCL V;  1M1K W;  1H8E G;  4J9Z B;  1AJP A;  3LDE A;  4R6Z A;  3F7Y C;  2XND G;  4EKW A;  5FL7 G;  3ZRW A;  2PI4 A;  1Y66 A;  3AG1 B;  1F23 A;  3ETG A;  1M90 W;  1CPY A;  5L3B A;  4FMT A;  4N21 A;  4PDR A;  3LSS A;  2W6I G;  1MSW D;  3CD6 V;  4FPP A;  4WFH A;  5CN0 A;  4BIZ A;  3ZMZ A;  4JTA B;  1I5X A;  2IU3 A;  3BY6 A;  4QPJ A;  1DF5 A;  3CP1 A;  1ROP A;  1M57 B;  4HAM A;  4JGS A;  1L1F A;  2Q69 A;  3TCU A;  3K9A A;  1K92 A;  2OT5 A;  5EBL C;  2GSM B;  1OCZ B;  3OAA G;  3LSQ A;  2JIZ G;  4L87 A;  3WFV A;  3UKM A;  3FB5 C;  2Y48 A;  1S77 D;  1K33 A;  4CZZ A;  3G4S V;  4MTO A;  5KA6 A;  3I56 V;  1OCO C;  1RPO A;  4FK5 C;  4PA4 A;  5B3S B;  2Q67 A;  1SER A;  5LHH A;  2XAS A;  2OCC C;  4TT3 G;  4F4L A;  1KP2 A;  1KEC A;  5LBQ A;  4J9Y B;  3MHS C;  2WLN A;  3CCJ V;  4JAS A;  4JYC A;  1QLN A;  3P30 A;  3JD1 A;  1S76 D;  1EZJ A;  4XDL A;  1VQK V;  1Q81 W;  2XAH A;  5DN6 G;  2WLK A;  1AJQ A;  2X6B A;  2DWE C;  5H9C A;  2JK5 C;  1YI2 V;  5IYD O;  1KD1 W;  3ABU A;  3T2M A;  2WLH A;  1P7B A;  2YEV A;  2JJ1 G;  1AJN A;  3G71 V;  1JCH A;  4PA3 A;  3K06 A;  3K08 A;  1OCO B;  5L3C A;  2OCC B;  4PA9 A;  4R8C A;  4QIW F;  3STL C;  1G4Y B;  3CC7 V;  1ORQ C;  1YIJ V;  1GTO A;  5H6R A;  4LP8 A;  3FKS G;  3LNM B;  5H6Q A;  5L3G A;  4U7O A;  3JCZ A;  1NBM G;  4R50 A;  4U7N A;  5B1O A;  1KP3 A;  3A0R A;  2DYR C;  2H94 A;  5LHI A;  1QR8 A;  3W7W A;  5HFM A;  4MTG A;  1NJI W;  1V54 C;  4E2L A;  1S3J A;  3CC2 V;  3AEI A;  5L3D A;  3CCE V;  1KQS U;  4KUM A;  1YTF D;  3ETE A;  4PDM A;  1OCC C;  1B6Q A;  3T4D A;  1JVM A;  1K8A W;  4WCE V;  1GKF A;  1AR1 B;  3QO7 A;  5IDJ A;  1KC8 W;  1Q7Y W;  1FXH A;  5GW7 A;  3ZJZ A;  2ZXW C;  1F4N A;  2HR3 A;  2OTL V;  2CK3 G;  2H8P C;  1FXK C;  1LNQ A;  2WWW A;  2BOC C;  1H38 A;  2Z3Y A;  3IFX A;  4ZKI A;  3ZMU A;  1RPR A;  4JPR A;  3GB7 C;  3H01 A;  2DYS C;  2DYR B;  3RBZ A;  3CPW U;  1P4R A;  4PA6 A;  1EFR G;  4FIP C;  1FXK A;  1V54 B;  3E83 A;  3OM3 B;  4RAI A;  4BW5 A;  3FB8 C;  1VQ9 V;  1XL6 A;  1VQ6 V;  3QO5 A;  1OCC B;  5CMU A;  2Y69 C;  3SYC A;  4YXW G;  4P2Z A;  3OR7 C;  3CCQ V;  3JD0 A;  4DXW A;  1W2B U;  2M7W A;  2ZXW B;  3ZIA G;  2ZDI C;  1QVG U;  3I55 V;  1S5H C;  4X8A A;  1FXK B;  2IH3 C;  2Q6A A;  3K0G A;  1E79 G;  2EIN C;  2V1D A;  1GK9 A;  1SZT A;  2DYS B;  1BMF G;  4PDL A;  4JAU A;  1Y4M A;  1IXM A;  3HB3 B;  1Q86 W;  1ZWI C;  4H37 A;  3K0D A;  3CCR V;  4OXS A;  5EK0 A;  3D36 A;  3B77 A;  4RO2 A;  2EBO A;  2Y69 B;  3OEH G;  3ZMS A;  4MVM A;  2EIJ C;  2YSU B;  2EIM C;  3TET A;  2QKS A;  4RUE A;  1K34 A;  1PNK A;  3ZMV A;  1NVP D;  3RVY A;  1Q82 W;  3STZ C;  3SYP A;  2B1G A;  4MT8 A;  2B1I A;  2EIN B;  1K5Q A;  1QLE C;  2WLI A;  2QE7 G;  3IGA C;  5B1A C;  3SPI A;  2R9R B;  3E8B A;  3SPJ A;  4WFE A;  1CEZ A;  3W7S A;  3EHB B;  3JYC A;  5EC2 C;  4MVZ A;  5LHG A;  5IY5 C;  2XAF A;  3VBB A;  1UJW B;  2IJK A;  3OMA B;  2X6C A;  5LGN A;  3K79 A;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...