1R3KC

Potassium channel kcsa-fab complex in low concentration of tl+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
total genus 39
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3kC00
3STZC 2EIMC 4KFMA 1K4CC 4WFEA 2WLLA 4MVQA 4LCUC 4XDJA 3X2QC 3ZJZA 3AG1C 2Q69A 4F4LA 4PA9A 2EIKC 5CBGA 3WG7C 2WLJA 5KUMA 1LNQA 2ITCC 5EBLC 5J9PC 1R3IC 4HYOA 4QE9A 2KB1A 2JK5C 2K1EA 3STLC 4P9OA 4MTGA 4CBCA 2YEVA 2AHYA 3E89A 3OR6C 2ATKC 4G27B 4EKWA 3KG2A 3E8GA 2HG5C 2Q68A 2DWEC 2WLHA 3AG2C 3LDCA 4MVOA 4R7CA 4GX1A 4MTOA 5EK0A 3FB8C 4GX0A 4I9WA 1M57C 4P2ZA 2AHZA 5E1AC 2H8PC 3K03A 3SPHA 1OCOC 4WFGA 1R3LC 3FB5C 5KUKA 3T1CA 3K0GA 3TCUA 2BOBC 3E8BA 2ZD9A 4MSWC 4XDKA 3ABMC 2A79B 2EINC 2X6BA 3E86A 3IGAC 3SJQC 3EFFK 2HJFC 1V54C 1BL8A 3ABKC 4JTCB 2HVJC 4RAIA 4H37A 3TETA 5EBMC 1ORQC 2BOCC 2EIJC 3AG4C 4G28B 4MTFA 4MVMA 4PA6A 3RVYA 3SYAA 3T2MA 2NLJC 2W0FC 3K0DA 2WLLB 1OCRC 3LUTB 3VOUA 3OGCC 3SPIA 2WLIA 5CBFA 3RBZA 2P7TC 2X6CA 3IFXA 4XDLA 1R3JC 2WLNA 3SPCA 4MVRA 4MVSA 5B3SC 4WFHA 2R9RB 2Y69C 1P7BA 4OXSA 2ZXWC 3K06A 4J9YB 4PDRA 2DYSC 3E8FA 4MW8A 1S5HC 4R6ZA 4PDLA 5CBHA 3SYCA 4JTDB 3OUFA 4TWKA 3FB6C 4ZBMA 1XL6A 3F7YC 2EILC 2Q6AA 4LBEC 4GX2A 4QE7A 3SYPA 3SYOA 3JYCA 3OR7C 3R65A 3K04A 2X6AA 2ITDC 4PDMA 2IH1C 1QLEC 1ZWIC 4PA3A 3FB7C 2DWDC 4PDVA 4RUEA 3E83A 1XL4A 2A0LA 2IH3C 1G4YB 3RVZA 5EC1C 3ZRSA 2QTOA 3UKMA 3ASNC 3E8HA 3ASOC 1V55C 1KKDA 4BW5A 4QNHB 5EBWC 3AG3C 4P9PA 1M56C 3K08A 3SPJA 4HZ3A 2QKSA 4R50A 4X88A 4RO2A 4WFFA 5BZBA 4LP8A 4JTAB 1OCCC 3LDEA 1R3KC 3BEHA 3PJSK 4R8CA 3T4ZA 2WLIB 4PA4A 3GB7C 4MW3A 5B1AC 2OCCC 4MS2A 3LNMB 4MVZA 4PA7A 2WLMA 4DXWA 3LDDA 2HFEC 1K4DC 3RW0A 3UM7A 1JVMA 3OUSA 4GX5A 1J95A 4X89A 4UUJC 2DYRC 4J9ZB 4H33A 5B1BC 5IY5C 3SPGA 4X8AA 4P30A 2HVKC 3F7VC 4RUFA 5EC2C 2Q67A 3T4DA 2WLKA 4MVUA 2A9HA 3ABLC 3F5WC 1OCZC 3HPLC 3SYQA
chains in the Genus database with same CATH superfamily
4J7KA 3IC9A 1ZAUA 1I94B 4BR6A 2PY5A 2CE4A 4HNAA 1K7DA 4QIWF 4JI3B 5LP6B 4I55B 2F23A 3VQWA 1BQ0A 5CA1B 1IZ3A 1SERA 2LW7A 3L72H 2ZR2A 4ZHQB 3C90A 4EFEA 1BGYH 3T1YO 2UUCB 3ETGA 2EJRA 4MTOA 3L71H 5FLXN 2VS0A 4FLYA 4ZKIA 1MZEA 3TJTA 1GM9A 1YHQV 2BOBC 4MSWC 4ZIBA 2HJFC 3ETQA 2HVJC 4X1IA 4Z1MG 3ZMZA 5JQGB 1VQ4V 3JASA 1JA8A 4X64B 2Z3YA 1MA1A 3APQA 3A0RA 2Q7EA 4DV0B 2R9RB 3B4SA 1YTFB 3AEIA 1V55B 3HKEA 4J41A 4JYCA 2Q9LA 2ODMA 1AR4A 2PGGA 2QEXV 1FXKA 1BE3H 3BA8A 2B1GA 2BTQB 1MG1A 3SYOA 3RYHA 2KG7A 1VEWA 3TGUH 1QHTA 3KCXA 2OCCB 1SRYA 1IBMO 1GK9A 4FFKA 4P9PA 3CRMA 5C8YA 3ZRXA 1US6A 4LP8A 2YDEA 2W0XA 3S3XA 1WP8A 4MW3A 5KA6A 2WLMA 3P3NA 3RYCA 3OTOO 1K5QA 4J80A 4FLWA 4XDLA 3UT5A 2CH7A 4WFEA 4MVQA 4NXMB 5C93A 3AG1C 3OAAG 2N04A 2YS8A 3JATA 3JARB 1GN2A 3RFRA 3K59A 5KUMA 2ITCC 4TUYB 1NH2B 4B7KA 2ZNJA 2ZE8A 3ABMB 1GH6A 1HNZB 4FM0A 4O4HA 3ICXA 2Q5ZA 4HBNA 4U7OA 3SPHA 1AP5A 2A7WA 3M99B 1OCOC 1JPXA 4B3TB 3ETEA 5KX5A 4I50B 3B40A 1YI2V 4GKJO 4JI8O 1Y74B 5LXTB 3OD4A 2UXBO 4PA6A 1PP9H 2F66C 5LYJA 2YICA 1GN3A 2CTPA 1R3JC 4MVSA 4WFHA 2F93B 5H6RA 3CCLV 2LFRA 3ABTA 5B5EZ 2JS5A 2LFSA 1SQQH 1XDCA 5EYPB 4JI2O 4ZBMA 1J5EO 4NXNO 5CB4B 3L74H 3SYPA 1AR1B 4F6EA 4YHHO 3H01A 2X6AA 2IH1C 4WBNB 1RM1B 2FKXA 3J80N 4JV5B 5LMUO 3OMIB 5JCOA 1NVPD 4FFBA 4O4IA 2XHBA 2BCCH 2P6JA 1N8RW 4FM2A 1QVFU 2GDSA 2XOKG 1YTFD 1KQSU 2ZIOA 5JJNB 4LF8O 2EIMB 1PNKA 3X2QB 3D3QA 1S5JA 5TISZ 4H44B 3K5OA 1G1XB 1NTZH 1SZTA 1TVKB 2AZ0A 1AP6A 3W7XA 1Q7YW 1M90W 2YIDA 2IU3A 5BR8B 5E79Z 1RFYA 3H1HH 4KFMA 4LFBB 4DR1B 3ZMUA 3I55V 2RMKB 1AJPA 4G2KA 3BHPA 3JAMN 5CBGA 1FKAO 1R1BA 2JRIA 1XNQO 4LF6B 1M4UA 3ZN1A 2EINB 4DV5O 3HKBA 4BIOA 1S77D 1BQZA 3LDCA 1NJIW 5B1NA 3CXCU 4GX0A 4JZ2A 1L0LH 3VBBA 3MHSC 2YIAA 5IWAB 1OZ0A 2UXDB 1PV0A 3FB5C 3JD0A 5JJEB 2RDCA 5B3SB 1WPBA 4UV8A 2ZXWB 4U7NA 4D7TA 2ZCEA 4RAIA 2IJHA 1IXMA 3UO3A 1WJZA 1PNMA 4G28B 1IDSA 4J42A 1NH2D 4DV4B 2AZ2A 2FB5A 2QWPB 3CCSV 4AI8A 3TXSA 2P7TC 3ZHVA 2QA4V 1ZUQA 4YJ3A 1VP7A 3ZCCA 5KMGA 2PYLA 2DYSC 4H0LB 4JYAB 1SKVA 3AK2A 4GX2A 3ZBHA 3CEIA 2HHHO 3CC4V 2QKAA 2JEXA 4DK0A 1XMOB 2DWDC 3R66A 1P7GA 1TA8A 1P49A 1NQTA 3W7TA 3BVOA 1F4NA 3CRCA 3CD6V 5LMNB 3DC5A 1VQ9V 4RO2A 1H2MA 4WFFA 2V1DA 4FM1A 2R9IA 1OJHA 4PI0A 2QWOB 1P84F 3ML0A 5B1AC 1MZFA 3I56V 3CHXA 3HB3B 3JCZA 1ZTEA 4GUNA 5B1BC 3L70H 1YIJV 1FFTB 5AG2A 2KQXA 1DGSA 4B3RO 4MVUA 3K3WA 4O2BB 1IBKO 3SJCC 4CH4A 5IYZA 4LFCB 1CEZA 1KKCA 2Z0AA 1HNWO 2K1EA 4JI1B 2UUBB 2F43G 3E89A 3A0HZ 5K1XA 4X65O 1SETA 2ZR3A 5GONB 2DN9A 5EK0A 2AHZA 1WNSA 2YC0A 4WFGA 2RQ6A 1GM7A 3JALA 4FLTA 1I0HA 2D2CB 2FMLA 3BFRA 1KC8W 3SR2C 2WWWA 4CS4A 3OGCC 4FLXA 2JDIG 2UXXA 2LJ2A 4OX9B 3SPCA 2Y69C 5BXZA 3CCEV 4J9YB 3RYFB 5DEDA 4QJFB 1VF6C 4PDLA 4O4JA 4RWUA 2F4VO 3OUFA 3ZEDA 5D5PA 5EZYA 3A2FA 1JQ0A 3JYCA 3OR7C 1K34A 5CA3A 1G6UA 1SQBH 2QWQB 3BRCA 2H3OA 4JAUA 3OW2U 4RUEA 3MAQA 2A0LA 4JI4O 3K5NA 2ETNA 2Y4UA 4F6RB 1F7YA 5IT9N 1NR1A 1UFIA 2HJDA 3RYHB 3HKDA 1N34B 4IIJA 1EN4A 1HNXO 4BAYA 2VQFB 1QQCA 2FYUH 1Y67A 1PM9A 3AG1B 1BZKA 2YIBA 3CB2A 1JVMA 4GX5A 2LGWA 1IXBA 4X8AA 3F7VC 2CTWA 2IM9A 4GT1A 3CC7V 1Q82W 5LA6A 4X66O 1JX9A 3RYCB 4BIZA 1FPOA 3ZHRA 4K0KB 4F4LA 4X1KA 3WG7C 1OCOB 1GMGA 3D8CA 1DTOA 4J7JA 1YDXA 2ATKC 2CH7B 2OTJV 2YXLA 4LF5O 3JATB 3RYIB 4WFBV 1I08A 1HDJA 3AG2B 5IDJA 4JI7B 3G80A 4JI6B 2GUZA 4NTYA 4XDKA 5K1PA 3U10A 3E86A 1AI4A 2EZPA 3JD3A 5LGNA 5J2TA 1WA8B 1TUEB 4H37A 1B04A 3CMAV 2Y48A 2QWRB 4UCOA 3K0DA 3RBZA 2VQEO 1O9HA 4FJCC 5JWPA 4YJ2B 3JD4A 5LOVA 4EB6B 1H8HG 3RGBA 4UCTA 4LBEC 3CCUV 4IGGA 1W59A 1DF5A 1SQFA 5KHIA 4DR3B 1G4YB 3P32A 4Q6GA 1NKDA 1WAZA 1SESA 1M56C 3U11A 4HZ3A 1KP2A 1XUQA 3MD0A 4DRXB 5H5NA 3OE7G 2CUGA 3ZRWB 4U3JA 1G8MA 4PA7A 2XAHA 1YJ9V 3LDDA 2UU9O 4UVAA 4YIOA 4AQYB 1BS3A 4DR5O 3JCUZ 1IVSA 4H33A 1EZJA 3S3WA 3FAVA 1VQ8V 1HWYA 1Z5WA 1SC5B 1NS1A 3HPLC 3SYQA 1X4TA 2Q0AA 4LCUC 1XI1A 4JI0O 4DR7B 4I4TA 2C2AA 3K58A 4DV6O 4DUYB 2HEPA 5J9PC 2E3CA 3MDSA 4IL6Z 3GWKC 2E5LO 3UCSC 2YEVA 1K5SA 3CRQA 4LFAO 3KG2A 1FJGO 3W7WA 1YXBA 4R7CA 1THZA 4GX1A 2ADQB 3K57A 2H8PC 2QJ1A 2ZM6B 2IBZH 3HKBB 4MTXA 4U3FH 5L3GA 1MABG 3N2KA 1WPXA 2DYSB 5EBMC 3ZHQA 1K33A 3N27A 1M9NA 3CSXA 3GWOA 1L1FA 4GYCB 1K3EA 4UXNA 3BCCH 1JJOA 1PL4A 2LO1A 1RSOA 1IX9A 4LF4O 5JH7A 3H1IH 1I5YA 3BA9A 4MW8A 4NB5A 3NR7A 3FB6C 2DJVA 2QR4A 1Y66A 3T1HO 3FB7C 5B1AB 5KHHA 1NVPB 3RN4A 5B1BB 4FLVA 2A3QA 4JYYA 1QVGU 4FIPC 5BZBA 4ZOLB 4JTAB 2R70A 5DM6V 3PJSK 4DR4B 2YI9A 3GB7C 4N21A 4MVZA 5KHJA 2QGNA 4LF7B 2JEUA 2ZE6A 2DYRC 4X62B 1HR0B 3L73H 4RUFA 5HFLA 1SQXH 1R6KA 2XAFA 3G4SV 4LC1A 2RN9A 3IC7A 5DECA 1Q81W 1U96A 3CRRA 3HR0A 2E75B 3M8AA 1EZVH 5EBLC 2IW5A 4DV1O 1FXVA 4E2LA 3THOA 1FXKC 3FFQA 5IE9A 3E8GA 5IYBO 3J81N 2IJJA 1AI5A 4JASA 1Q3EA 5J2UA 2N05A 3UQ8A 1XHXA 3JAWA 3K0GA 2X6BA 4O2AA 1PNLA 2Y69B 1V54C 3I5DA 4X1YA 1PL0A 2OYQA 3W7SA 1FD9A 3T1YB 2Q8VA 4I9QA 1B06A 4MVMA 3RVYA 3T2MA 4IHJA 1PD3A 2W0FC 2ZE7A 1KYOF 4BW9A 1AB3A 5ITZB 5L3BA 2DE0X 2V4DA 1Y76A 2OWOA 4NTXA 4DR1O 1Q86W 4LF9O 3WU2Z 4LNUB 4ZI7A 3RVZA 2R72A 2IH3C 3CS5A 2JGDB 4O4JB 3ASNC 3N2GA 4PD4F 2D3OW 5FNVA 3ZRVA 3JAKA 2NR5A 2HLDG 4TQFA 2EX3A 2P06A 1DLBA 1ZL8A 1GN4A 2B5UA 3EXAA 1YJNV 1JFFA 4KXRA 5B66Z 1TUBB 3T4ZA 2UXCO 1IBMB 2DQ0A 2JS3A 3DXRA 1ROPA 4IIJB 3WG7B 5JVDA 5L3FA 1VQ7V 2GHYA 3A0BZ 1S72V 1EM1A 3H1JH 1K4CC 2WLLA 4K8XA 5IJ0B 1KB9F 1K92A 2BE3A 3OTOB 1VQ6V 1BHBA 4QE9A 5LA6B 5CA0A 4FZ0A 1EBOA 1MMMA 5LL6Y 3CJHA 1R73A 5A9GA 4YY3O 2M6YA 2X0LA 4CH5A 1NZ6A 3K03A 1R3LC 3B2EE 5JCOC 4QPKA 5HFMA 4CC6A 3IGAC 3QO5A 2KSDA 3SJQC 2BTOA 3LSUA 1CPYA 2QM4A 2QM8A 3SYAA 2EIJC 5FPRA 3EHBB 4FMTA 2GUZB 2M7WA 4YXWG 1RPOA 2QM7A 2X6CA 5J2TB 1CP9A 2V7QG 1U97A 1IBLO 1VF7A 4GKJB 4JI8B 3E8FA 5L3DA 1M56B 1VQOV 1VMGA 4JI5B 5CBHA 1JJ2U 2QWNB 3F7YC 2PF4E 2GSMB 4UCUA 1FAFA 5CN0A 5LOVB 3K04A 4DV3B 1QLEC 4PA3A 4KUMA 4PDVA 2UUBO 2OT5A 3SDLA 5LP6A 3UKMA 2P90A 5EBWC 3KCYA 1QU7A 1GTOA 2BSKB 4JI2B 3C3TA 2ZNIA 4ZHQA 1J5EB 4NXNB 4PJ0Z 4YHHB 4R8CA 2WLIB 4PA4A 3LNMB 5LMUB 3LSQA 1PKXA 1OCCB 1N33O 1DK1A 5IYDO 2W6JG 4J11A 5JQGA 5IJ9A 1I5XA 1Y4MA 4LF8B 1SA0B 1T5EA 4TOIA 2XASA 4PA9A 4X20B 4OPAA 3FAVB 1M93A 3QTCA 2OCHA 4B3SB 4CBCA 5BMVB 4CS2A 1Q43A 1M1KW 1S76D 1AILA 2Q68A 2BTQA 3FKSG 2R9AA 1VQKV 3CE2A 2YEVB 4UVCA 1N36O 3L75H 2YIBD 4UV9A 1W2BU 1XNQB 1HP8A 4DV5B 3QF7A 2Q4PA 4B3MO 3P3PA 1A32A 2NLJC 1UJWB 3G71V 3CCQV 3VOUA 4HNAB 3E2EA 4B7EA 4DV7O 4XBFA 3E22A 2WAMA 4R6ZA 3PN1A 1GAXA 5LGUA 4Q20A 4TWKA 1GKFA 4K0KO 2QDOA 3B8NA 2UUAO 2GBOA 3D36A 2IU0A 1XMQB 1KUQA 3JARA 3ZRSA 5L3EA 1KKDA 1S5LZ 2DYRB 4X1IB 4KHPO 1N32O 3K08A 2ZIMA 3JASB 2ZDIA 1Q6HA 1ZSPA 2Q73A 3OFNG 2HHHB 1NTMH 4AILC 4FZ1A 3Q4HA 3OEEG 1MSDA 2VWJA 3AK1A 2AW9A 1VQPV 3HKEB 3QVNA 3BPZA 3BABA 1QBZA 2JVDA 1FXKB 1Y74A 3T4DA 5LXTA 2A9HA 3ABLC 4QNHB 2XT9A 2KG7B 3ZHTA 3NXSA 3APOA 1N0NA 2LW1A 2ZDIC 4I0XA 4LH6A 2NNUA 4TQDA 4HYOA 1KD1W 2IJKA 2ZQMA 5C8YB 4DV2O 3LSSA 4B3RB 1V54B 1VQMV 1SF9A 5EYPA 1AJQA 4MVOA 3LNNA 5LGTA 1H2KA 2CDYA 1TGOA 2P5OA 3CCVV 1IBKB 2CTQA 2YI8A 4CH6A 4WBNA 1YF2A 1HNWB 3T1CA 2YUAA 1YZBA 1SQGA 3EFFK 1D2DA 1XNRO 4MT8A 1EN5A 4X65B 3DTUB 5J2UB 2BOCC 2O57A 2YXHA 3FYIB 4X9QA 3UT5B 1XREA 1OCRC 1H8EG 3ZMTA 3HKCA 1TVKA 2HKOA 4Z1VA 4OXSA 3ASNB 4DO2A 4J10A 1H2NA 1XBLA 5BY1A 2XAJA 1M5IA 1L8DA 4DR2O 2EILC 4O4HB 4QE7A 4ICGA 2EULA 1WB8A 1Q90D 3QG5A 3K79A 4D6TH 5KAFZ 4DR6B 3E83A 5KX5B 5EC1C 1YEWA 2N74A 1XOUA 4DUZO 4CC5A 2F4VB 1AROP 2QKSA 4GKKB 1JMKC 3LDEA 2JIZG 5LYJB 3ZHSA 2ZE5A 1I94O 4JI4B 3RW0A 3KZIZ 2QSAA 4JI3O 1VQNV 4X89A 1YSCA 1MOFA 4P30A 2LGQA 3QO7A 4JGSA 1HNXB 4TV8A 3GVMA 5E1AC 1QR9A 4BWAA 2UUCO 4ASUG 4XDJA 4KL1A 3K9AA 5F2VO 1Q6IA 2KB1A 1Q8IA 4UB8Z 4FFBB 4O4IB 1RP3B 1VARA 2AHYA 5EIBC 1NI8A 2DMXA 2GTSA 1E1QG 4X66B 3MHHC 2DW4A 2NN4A 4FVMA 2EIJB 1K73W 1KBHA 4X64O 2JGUA 4NKGB 5LHHA 4O4LA 2L35A 4DV0O 2HR3A 1ZX3A 2QTSA 3ZIAG 2L6LA 2PZSA 4JTCB 4LF5B 1S0VA 2KKWA 4NYKA 3D3IA 1QNMA 2CK3G 3CPWU 5JJJB 5CBFA 4GLXA 1X59A 1QLEB 4PI2A 1HR0O 1AJNA 2ZINA 1F23A 4NTWA 3WB2A 1P7BA 4PDRA 1OV9A 1S5HC 3KKYA 2LP7A 1QCEA 3RWRD 1NTKH 1H38A 4L87A 2YSUB 5IYCO 2PI4A 2VQEB 3C3SA 1MNGA 1UPGA 2DOSA 3JSLA 1FYJA 3CWBH 4YIPA 4TV9A 3SPJA 1BHAA 3OEHG 2QE7G 2HP8A 2ADPA 5KHKA 3DSQA 3BEHA 5GONA 3OT7A 3FYEB 4NXMO 5FL7G 3JD1A 4YJ3B 2ZKOA 2HFEC 2XAGA 4E4EA 1VQ5V 5KMGB 1V9PA 3UO2A 4K35A 4TT3G 2P4KA 1AI7A 1HNZO 2WLKA 1PPJH 1JR9A 1OCZC 3CMEV 1F4MA 4UB6Z 2LQTA 2UU9B 3WB0A 1N4CA 2GTAA 4DR5B 3ZMSA 3VQVA 4B3TO 2JK5C 5IJ9B 3STLC 4JF3A 4P9OA 3B77A 4UCVA 3RYFA 3IAYA 4I5SA 4I7ZB 3FB8C 4JI0B 1M57C 4DV6B 3ZHUA 2H94A 4CH3A 3CXHF 2PI5A 4W4KA 2E5LB 4F6RA 2FTKA 3DC6A 1LR1A 4LFAB 3ABKC 4IT5A 1FJGB 3M7MX 1BT8A 4C7UA 1BCCH 1H2SB 5IYZB 1GO3F 3H9VA 2WPDG 4JV5O 2DQ3A 2CTRA 4DW1A 3OMAB 1IURA 2RCVA 1HW7A 3E22B 1SZXA 1XHZA 1B6QA 4PDMA 1YVWA 2FL4A 1URFA 4K3AA 4LF4B 2IJIA 1AR5A 5CMUA 1COWG 3JALB 3ZN0A 1AI6A 4EFBA 1W0KG 5GTHZ 4R50A 2AGAA 4NVPA 1QR8A 5BR8O 4PELA 3ABLB 2E74B 3RYIA 3T1HB 4LFBO 4WFAV 3BY6A 1K4DC 5H9CA 3B8MA 2X7RB 3OUSA 4K8ZA 1YJWV 2RJZA 3TK1A 1TAEA 5IY5C 4WF9V 4LF6O 3ZX6A 5EC2C 1WA8A 3CX5F 1EN6A 2F95B 2Q67A 3E35A 5EZYB 3Q4HB 3STZC 3IJ4A 5FPOA 1EFRG 1R6TA 2GV9A 5IWAO 1KU9A 2UXDO 4RQFA 4YJ2A 2XUMA 1FFXA 4CZZA 4JI5O 1W0JG 4G27B 3OR6C 3HKDB 3WFVA 1LUVA 1Z2GA 4EB6A 1XILA 3AG2C 4DV3O 4I0XB 4KP4A 4I9WA 1XEQA 4DV4O 1OCRB 5KUKA 4DYLA 4DV1B 3RT3C 4NR1A 1D5AA 2F1MA 1SQPH 2CGNA 1P4RA 3AG4C 4FLUA 2RNBA 4DRXA 4JYAO 2EILB 2EBOA 3LUTB 4UFZA 1DF4A 4X1KB 3ZRWA 4JPRA 2WLNA 1XMOO 2JJ1G 4LR3A 3K06A 3ZS8C 2W6IG 5H6QA 4LWSA 4PV1B 3SYCA 5LMNO 3HKCB 2Y0IA 3R65A 3CRAA 3SJAC 4B3SO 3G6BA 1Y6XA 3ASOC 2ILMA 3AG3C 4D7SA 3OMNB 3U0ZA 4UCRA 2CAZC 4X88A 4WCEV 3DGEA 1KECA 4LF9B 4AHCA 2ARHA 3OTFA 2UXBB 2UXNA 1N0JA 5LHGA 4LFCO 3UM7A 3A8TA 1RPRA 2OTLV 1Q6UA 3H1KH 5B1OA 4JI1O 4IYHA 3G67A 3O65A 4I55A 5CA1A 5H2FZ 3BAAA 2Q69A 2UXCB 2EIKC 1GM8A 4FK5C 4TV8B 2B9ZA 3SGIA 4EKWA 1GN6A 3J7AU 2HG5C 3JSNA 3P30A 1K8AW 1E1RG 3JD2A 2G38A 1XMQO 4U3JB 3OM3B 2Q7GA 5LP6C 3AG7A 2WA3A 4OX9O 3CP1A 1NU1H 4YY3B 3VQYA 4O4LB 4ZOLA 1BMFG 4I4TB 3IFXA 1QLNA 3H1LH 4MVRA 1WLEA 2Y4TA 3FX7A 1XQ8A 1ENVA 2B1IA 5A2QN 2A06H 1XL6A 4N23A 1N34O 2Q6AA 2ITDC 4LH7A 2VQFO 4JYBA 1XL4A 4A5UB 1IBLB 1NBMG 2QTOA 1V55C 3N2KB 2CGOA 1ZLZA 5KHGA 2MW2B 1H2GA 2Q0OC 3FD9A 1R3KC 1OCZB 2OCCC 2K9PA 4TV9B 1RSOB 5JH7B 2HVKC 3CCJV 4TUYA 1K9MW 1VF6A 1FXHA 2PTMA 5DN6G 3K9SA 1JOYA 1B3QA 1M57B 5KA5A 3CC2V 1Z5VA 1VIBA 3ETDA 1N33B 4JI7O 1R3IC 4JI6O 5ITZA 2P67A 3OGIB 1YITV 3ABKB 1VF5B 2WA4A 4I50A 2DWEC 2WLHA 4H13B 3D36C 4DR6O 4LNUA 4OGQB 4ABMA 2EJ7A 2P22C 5EIBD 3TCUA 3E8BA 1Q5OA 2JGDA 2Q7HA 2VRZA 2A79B 3ABMC 2ZD9A 4PHZA 4CS3A 1BL8A 4GKKO 2MK3A 3CCRV 3TETA 1ORQC 3K5MA 2Z5UA 1NR7A 2OIGA 2P4VA 1TUBA 1BSMA 3AK3A 1N36B 5CB4A 3ABUA 4GCZA 4DR3O 3L9DA 4UVBA 5L3CA 4B3MB 4JTDB 1FS0G 1WP7A 4Z2WA 4TSFG 5GW7A 5KAIZ 4DV7B 1ZWIC 5IJ0A 4EEQA 1VQLV 3JAWB 1NT2B 4AQYO 4O2AB 4OPHA 4X1YB 1D5NA 5IY5B 3WB1A 2JJ2G 3TXQA 2ZT9B 4IHJB 2UUAB 2QKCA 3F5TA 1RM1C 4B08A 4MS2A 3ZMVA 4QGPA 4DR7O 5KLVH 4W4LA 3CYOA 4DUYO 3W7UA 3CCMV 4UUJC 1CXZB 4J9ZB 1N32B 4KHPB 1Y76B 2PUSA 2Y0PA 3QNEA 2EIMC 3X2QC 3ZJZA 3SJBC 4ZI7B 4IYIA 2PYJA 1S3JA 2ZM6O 2WLJA 1LNQA 3N2GB 3K5LA 1O9GA 3O9OA 5FNVB 3JAKB 2XAQA 4MTGA 4QPJA 2AXTZ 2WSSG 1WN7A 1ZL8B 4HAMA 5D5QA 2EZOA 1H2LA 1JFFB 4L8JA 3B09A 3AG4B 1GRJA 1FFXB 4P2ZA 5LBQA 3VQXA 1L0NH 4UCSA 3DXRB 5JVDB 2EINC 4DV2B 2XTAA 2BSKA 1I7FA 4GZRB 4MTFA 2WLLB 1R6NA 5GTIZ 3SPIA 2VWKA 2WLIA 1KP3A 1SQVH 1SS3A 5B3SC 1WB7A 4JZGA 1KMIZ 5CA0B 1XNRB 2ZXWC 1F51A 4RQEA 3ASOB 4FPPA 3CJHB 4DW0A 3AG3B 1AVMA 2E76B 1E79G 2OIEA 1MSWD 4JAVA 1SA0A 4DR4O 3G6EV 4X20A 4LWSB 3E8HA 4LF7O 4BW5A 3QO8A 4DK1A 4X62O 5BMVA 4FLZA 4DR2B 1OCCC 3EVKA 4J7ZA 4DXWA 4O2BA 2XNDG 2EIKB 1OHHG 2YXYA 1J95A 1LUWA 1YCIA 4JAAA 4DUZB 5LHIA 3SPGA 1JCHA 1K97A 3F5WC 4BIUA
chains in the Genus database with same CATH topology
4BIZA 1I5XA 1Y4MA 3STZC 1EFRG 2XASA 4PA9A 4F4LA 1K7DA 4QIWF 3WG7C 1OCOB 1GMGA 4RQFA 1DTOA 4CZZA 1W0JG 4CBCA 1SERA 4G27B 3OR6C 2ATKC 3WFVA 2OTJV 2ZR2A 1M1KW 1S76D 2Q68A 3AG2C 3ETGA 2EJRA 4KP4A 4MTOA 4WFBV 3FKSG 4I9WA 1VQKV 1OCRB 4ZKIA 2YEVB 3AG2B 5IDJA 1GM9A 5KUKA 4UVCA 1YHQV 4UV9A 2BOBC 1W2BU 4MSWC 4XDKA 3E86A 1AI4A 2EZPA 3JD3A 2HJFC 5LGNA 2HVJC 4Z1MG 1TUEB 3ZMZA 1VQ4V 4H37A 3CMAV 1P4RA 2Y48A 3AG4C 2NLJC 3K0DA 1UJWB 3G71V 3CCQV 2EILB 2EBOA 2Z3YA 3LUTB 3VOUA 1DF4A 3E2EA 3RBZA 3A0RA 3ZRWA 4JPRA 2WLNA 4FJCC 4XBFA 2JJ1G 2R9RB 3JD4A 1YTFB 3K06A 3AEIA 1V55B 2WAMA 2W6IG 4JYCA 4R6ZA 5H6QA 1H8HG 5LGUA 2QEXV 1FXKA 4Q20A 3SYCA 4TWKA 1GKFA 2B1GA 4LBEC 1MG1A 3SYOA 3B8NA 3CCUV 3R65A 3D36A 2IU0A 2OCCB 1DF5A 1SRYA 3ZRSA 1G4YB 3P32A 1NKDA 5L3EA 3ASOC 1KKDA 1GK9A 3AG3C 1SESA 1M56C 4P9PA 2DYRB 3K08A 3ZRXA 3OMNB 4HZ3A 1KP2A 4X88A 3MD0A 4WCEV 2ZDIA 3DGEA 1KECA 4LP8A 3OFNG 3OE7G 4MW3A 3ZRWB 5KA6A 1G8MA 4PA7A 2UXNA 2WLMA 2XAHA 3LDDA 1YJ9V 5LHGA 3UM7A 4UVAA 3OEEG 1RPRA 2OTLV 4H33A 1EZJA 1K5QA 1VQPV 1QBZA 5B1OA 1FXKB 3T4DA 1VQ8V 1HWYA 2A9HA 3ABLC 4XDLA 4QNHB 3HPLC 3SYQA 3NXSA 4WFEA 4MVQA 4LCUC 5C93A 3AG1C 3OAAG 2Q69A 2C2AA 2EIKC 2ZDIC 5KUMA 2ITCC 2NNUA 1GM8A 5J9PC 4FK5C 4HYOA 1NH2B 1KD1W 2IJKA 3ABMB 2ZQMA 2YEVA 3LSSA 1K5SA 4EKWA 1V54B 3KG2A 1VQMV 2HG5C 3W7WA 3P30A 1AJQA 4MVOA 4R7CA 1K8AW 1E1RG 1THZA 3JD2A 4GX1A 5LGTA 3CCVV 3OM3B 2H8PC 4U7OA 3SPHA 3M99B 1OCOC 1JPXA 4MTXA 3T1CA 3ETEA 5L3GA 1YI2V 1MABG 3CP1A 3EFFK 4MT8A 1WPXA 2DYSB 3DTUB 5EBMC 1K33A 1M9NA 2BOCC 4PA6A 3FYIB 3GWOA 1OCRC 1BMFG 1H8EG 3ZMTA 1L1FA 1K3EA 4UXNA 3IFXA 1QLNA 1R3JC 4MVRA 1WLEA 4MVSA 4WFHA 2HKOA 3CCLV 5H6RA 2LFRA 4OXSA 3ABTA 3ASNB 4DO2A 1ENVA 2LFSA 1I5YA 4MW8A 2B1IA 2XAJA 3FB6C 4ZBMA 1XL6A 4N23A 2EILC 2Q6AA 4QE7A 3SYPA 1AR1B 3H01A 2X6AA 2ITDC 2IH1C 1Y66A 1RM1B 3FB7C 5B1AB 3K79A 4JYBA 3E83A 1XL4A 5EC1C 1NBMG 1NVPB 2QTOA 3OMIB 1V55C 1NVPD 5B1BB 1N8RW 2P6JA 1QVGU 1AROP 2QKSA 4FIPC 5BZBA 1QVFU 1H2GA 4JTAB 5DM6V 2XOKG 2JIZG 1R3KC 3LDEA 3PJSK 1YTFD 1OCZB 1KQSU 2EIMB 3GB7C 1PNKA 2OCCC 3X2QB 4N21A 4MVZA 3RW0A 1SZTA 2JEUA 1VQNV 4X89A 1YSCA 1MOFA 2DYRC 4P30A 2HVKC 4RUFA 3CCJV 5HFLA 3QO7A 4JGSA 3W7XA 1Q7YW 1M90W 1K9MW 1R6KA 2IU3A 2XAFA 3G4SV 4LC1A 5E1AC 1QR9A 3IC7A 1FXHA 5DN6G 4KFMA 4ASUG 4XDJA 1Q81W 1JOYA 3ZMUA 3I55V 1M57B 5KA5A 3K9AA 3CC2V 1AJPA 4G2KA 5CBGA 3ETDA 5EBLC 1R3IC 2KB1A 2IW5A 2P67A 3ZN1A 1YITV 1FXVA 4E2LA 2EINB 1FXKC 2AHYA 1S77D 3ABKB 3E8GA 1E1QG 5IYBO 2DWEC 2WLHA 3LDCA 1NJIW 3MHHC 2DW4A 2IJJA 5B1NA 2EIJB 3CXCU 4GX0A 1K73W 3VBBA 1AI5A 3MHSC 4JASA 1OZ0A 5LHHA 3FB5C 3K0GA 3TCUA 3E8BA 3JD0A 2ZD9A 2HR3A 3ABMC 2A79B 2X6BA 3ZIAG 5B3SB 1PNLA 2Y69B 1V54C 4UV8A 1BL8A 2ZXWB 4JTCB 4U7NA 4RAIA 2MK3A 1PL0A 2IJHA 1S0VA 3W7SA 3CCRV 3TETA 1IXMA 3D3IA 1ORQC 1PNMA 2CK3G 4MVMA 4G28B 3RVYA 3T2MA 2Z5UA 1PD3A 1NR7A 2W0FC 1NH2D 3CPWU 3CCSV 5CBFA 2P7TC 2QA4V 1QLEB 1AJNA 3ABUA 3ZCCA 4GCZA 1F23A 1P7BA 5L3BA 4PDRA 2DYSC 1S5HC 4UVBA 2LP7A 1QCEA 5L3CA 4JTDB 1FS0G 1Q86W 1H38A 4L87A 2YSUB 4GX2A 5IYCO 2PI4A 3CC4V 4TSFG 5GW7A 2JEXA 1ZWIC 1VQLV 2DWDC 3RVZA 2IH3C 1NQTA 3W7TA 3ASNC 2D3OW 3ZRVA 5IY5B 2HLDG 2JJ2G 3SPJA 1F4NA 1BHAA 3CD6V 3OEHG 1DLBA 2QE7G 4RO2A 4WFFA 2V1DA 1VQ9V 2B5UA 2R9IA 1YJNV 3BEHA 3T4ZA 1RM1C 3ML0A 3FYEB 4MS2A 5B1AC 3ZMVA 5FL7G 3I56V 3JD1A 2HFEC 3HB3B 2XAGA 3JCZA 2DQ0A 1VQ5V 3CYOA 3W7UA 3CCMV 3WG7B 1ROPA 5L3FA 4UUJC 4J9ZB 5B1BC 1YIJV 1FFTB 1VQ7V 2GHYA 4TT3G 1AI7A 2WLKA 3QNEA 4MVUA 3K3WA 1S72V 1OCZC 3CMEV 2EIMC 1F4MA 3X2QC 1K4CC 3ZJZA 2WLLA 1K92A 1CEZA 1VQ6V 1S3JA 2WLJA 1BHBA 1LNQA 3ZMSA 4QE9A 2JK5C 2K1EA 3STLC 4JF3A 4P9OA 2F43G 1EBOA 2XAQA 4MTGA 4QPJA 3E89A 3B77A 1R73A 2WSSG 4HAMA 2EZOA 1SETA 2ZR3A 4I5SA 2X0LA 3AG4B 5EK0A 3FB8C 1M57C 4P2ZA 2AHZA 5LBQA 3K03A 2H94A 4WFGA 1R3LC 4QPKA 2PI5A 5HFMA 1GM7A 3IGAC 2EINC 3QO5A 3SJQC 2FTKA 3ABKC 1CPYA 1KC8W 2QM8A 3SYAA 2EIJC 4MTFA 3EHBB 4FMTA 2M7WA 2WLLB 1R6NA 2WWWA 1RPOA 4YXWG 3OGCC 3SPIA 2JDIG 1GO3F 2QM7A 2WLIA 2X6CA 1KP3A 1CP9A 2UXXA 2WPDG 2V7QG 3SPCA 5B3SC 2DQ3A 2Y69C 2ZXWC 1F51A 4RQEA 4J9YB 3CCEV 3ASOB 4FPPA 4QJFB 3E8FA 5L3DA 3AG3B 1M56B 3OMAB 1VQOV 4PDLA 5CBHA 1JJ2U 3OUFA 3F7YC 1E79G 2GSMB 1MSWD 5CN0A 4JAVA 3JYCA 1JQ0A 3OR7C 3K04A 1K34A 1B6QA 4PDMA 5CA3A 1QLEC 3G6EV 4PA3A 4JAUA 4KUMA 3OW2U 4PDVA 4RUEA 2A0LA 2OT5A 2IJIA 3UKMA 3E8HA 1NR1A 2P90A 4BW5A 5CMUA 3QO8A 1COWG 5EBWC 3ZN0A 1AI6A 1W0KG 1GTOA 4R50A 1QR8A 1OCCC 4BAYA 4PELA 3ABLB 4R8CA 2WLIB 4PA4A 3LNMB 4DXWA 4WFAV 3AG1B 3BY6A 1K4DC 2XNDG 2EIKB 3LSQA 1JVMA 1OHHG 1PKXA 1OCCB 2X7RB 3B8MA 1J95A 3OUSA 4GX5A 5H9CA 1YJWV 3TK1A 5LHIA 5IY5C 3SPGA 1JCHA 4X8AA 4WF9V 3F7VC 5EC2C 4GT1A 3E35A 2Q67A 5IYDO 3CC7V 2W6JG 1Q82W 1K97A 3F5WC 1JX9A 4BIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STZ C;  2EIM C;  4KFM A;  1K4C C;  4WFE A;  2WLL A;  4MVQ A;  4LCU C;  4XDJ A;  3X2Q C;  3ZJZ A;  3AG1 C;  2Q69 A;  4F4L A;  4PA9 A;  2EIK C;  5CBG A;  3WG7 C;  2WLJ A;  5KUM A;  1LNQ A;  2ITC C;  5EBL C;  5J9P C;  1R3I C;  4HYO A;  4QE9 A;  2KB1 A;  2JK5 C;  2K1E A;  3STL C;  4P9O A;  4MTG A;  4CBC A;  2YEV A;  2AHY A;  3E89 A;  3OR6 C;  2ATK C;  4G27 B;  4EKW A;  3KG2 A;  3E8G A;  2HG5 C;  2Q68 A;  2DWE C;  2WLH A;  3AG2 C;  3LDC A;  4MVO A;  4R7C A;  4GX1 A;  4MTO A;  5EK0 A;  3FB8 C;  4GX0 A;  4I9W A;  1M57 C;  4P2Z A;  2AHZ A;  5E1A C;  2H8P C;  3K03 A;  3SPH A;  1OCO C;  4WFG A;  1R3L C;  3FB5 C;  5KUK A;  3T1C A;  3K0G A;  3TCU A;  2BOB C;  3E8B A;  2ZD9 A;  4MSW C;  4XDK A;  3ABM C;  2A79 B;  2EIN C;  2X6B A;  3E86 A;  3IGA C;  3SJQ C;  3EFF K;  2HJF C;  1V54 C;  1BL8 A;  3ABK C;  4JTC B;  2HVJ C;  4RAI A;  4H37 A;  3TET A;  5EBM C;  1ORQ C;  2BOC C;  2EIJ C;  3AG4 C;  4G28 B;  4MTF A;  4MVM A;  4PA6 A;  3RVY A;  3SYA A;  3T2M A;  2NLJ C;  2W0F C;  3K0D A;  2WLL B;  1OCR C;  3LUT B;  3VOU A;  3OGC C;  3SPI A;  2WLI A;  5CBF A;  3RBZ A;  2P7T C;  2X6C A;  3IFX A;  4XDL A;  1R3J C;  2WLN A;  3SPC A;  4MVR A;  4MVS A;  5B3S C;  4WFH A;  2R9R B;  2Y69 C;  1P7B A;  4OXS A;  2ZXW C;  3K06 A;  4J9Y B;  4PDR A;  2DYS C;  3E8F A;  4MW8 A;  1S5H C;  4R6Z A;  4PDL A;  5CBH A;  3SYC A;  4JTD B;  3OUF A;  4TWK A;  3FB6 C;  4ZBM A;  1XL6 A;  3F7Y C;  2EIL C;  2Q6A A;  4LBE C;  4GX2 A;  4QE7 A;  3SYP A;  3SYO A;  3JYC A;  3OR7 C;  3R65 A;  3K04 A;  2X6A A;  2ITD C;  4PDM A;  2IH1 C;  1QLE C;  1ZWI C;  4PA3 A;  3FB7 C;  2DWD C;  4PDV A;  4RUE A;  3E83 A;  1XL4 A;  2A0L A;  2IH3 C;  1G4Y B;  3RVZ A;  5EC1 C;  3ZRS A;  2QTO A;  3UKM A;  3ASN C;  3E8H A;  3ASO C;  1V55 C;  1KKD A;  4BW5 A;  4QNH B;  5EBW C;  3AG3 C;  4P9P A;  1M56 C;  3K08 A;  3SPJ A;  4HZ3 A;  2QKS A;  4R50 A;  4X88 A;  4RO2 A;  4WFF A;  5BZB A;  4LP8 A;  4JTA B;  1OCC C;  3LDE A;  1R3K C;  3BEH A;  3PJS K;  4R8C A;  3T4Z A;  2WLI B;  4PA4 A;  3GB7 C;  4MW3 A;  5B1A C;  2OCC C;  4MS2 A;  3LNM B;  4MVZ A;  4PA7 A;  2WLM A;  4DXW A;  3LDD A;  2HFE C;  1K4D C;  3RW0 A;  3UM7 A;  1JVM A;  3OUS A;  4GX5 A;  1J95 A;  4X89 A;  4UUJ C;  2DYR C;  4J9Z B;  4H33 A;  5B1B C;  5IY5 C;  3SPG A;  4X8A A;  4P30 A;  2HVK C;  3F7V C;  4RUF A;  5EC2 C;  2Q67 A;  3T4D A;  2WLK A;  4MVU A;  2A9H A;  3ABL C;  3F5W C;  1OCZ C;  3HPL C;  3SYQ A; 
#chains in the Genus database with same CATH topology
 4J7K A;  3IC9 A;  1ZAU A;  1I94 B;  4BR6 A;  2PY5 A;  2CE4 A;  4HNA A;  1K7D A;  4QIW F;  4JI3 B;  5LP6 B;  4I55 B;  2F23 A;  3VQW A;  1BQ0 A;  5CA1 B;  1IZ3 A;  1SER A;  2LW7 A;  3L72 H;  2ZR2 A;  4ZHQ B;  3C90 A;  4EFE A;  1BGY H;  3T1Y O;  2UUC B;  3ETG A;  2EJR A;  4MTO A;  3L71 H;  5FLX N;  2VS0 A;  4FLY A;  4ZKI A;  1MZE A;  3TJT A;  1GM9 A;  1YHQ V;  2BOB C;  4MSW C;  4ZIB A;  2HJF C;  3ETQ A;  2HVJ C;  4X1I A;  4Z1M G;  3ZMZ A;  5JQG B;  1VQ4 V;  3JAS A;  1JA8 A;  4X64 B;  2Z3Y A;  1MA1 A;  3APQ A;  3A0R A;  2Q7E A;  4DV0 B;  2R9R B;  3B4S A;  1YTF B;  3AEI A;  1V55 B;  3HKE A;  4J41 A;  4JYC A;  2Q9L A;  2ODM A;  1AR4 A;  2PGG A;  2QEX V;  1FXK A;  1BE3 H;  3BA8 A;  2B1G A;  2BTQ B;  1MG1 A;  3SYO A;  3RYH A;  2KG7 A;  1VEW A;  3TGU H;  1QHT A;  3KCX A;  2OCC B;  1SRY A;  1IBM O;  1GK9 A;  4FFK A;  4P9P A;  3CRM A;  5C8Y A;  3ZRX A;  1US6 A;  4LP8 A;  2YDE A;  2W0X A;  3S3X A;  1WP8 A;  4MW3 A;  5KA6 A;  2WLM A;  3P3N A;  3RYC A;  3OTO O;  1K5Q A;  4J80 A;  4FLW A;  4XDL A;  3UT5 A;  2CH7 A;  4WFE A;  4MVQ A;  4NXM B;  5C93 A;  3AG1 C;  3OAA G;  2N04 A;  2YS8 A;  3JAT A;  3JAR B;  1GN2 A;  3RFR A;  3K59 A;  5KUM A;  2ITC C;  4TUY B;  1NH2 B;  4B7K A;  2ZNJ A;  2ZE8 A;  3ABM B;  1GH6 A;  1HNZ B;  4FM0 A;  4O4H A;  3ICX A;  2Q5Z A;  4HBN A;  4U7O A;  3SPH A;  1AP5 A;  2A7W A;  3M99 B;  1OCO C;  1JPX A;  4B3T B;  3ETE A;  5KX5 A;  4I50 B;  3B40 A;  1YI2 V;  4GKJ O;  4JI8 O;  1Y74 B;  5LXT B;  3OD4 A;  2UXB O;  4PA6 A;  1PP9 H;  2F66 C;  5LYJ A;  2YIC A;  1GN3 A;  2CTP A;  1R3J C;  4MVS A;  4WFH A;  2F93 B;  5H6R A;  3CCL V;  2LFR A;  3ABT A;  5B5E Z;  2JS5 A;  2LFS A;  1SQQ H;  1XDC A;  5EYP B;  4JI2 O;  4ZBM A;  1J5E O;  4NXN O;  5CB4 B;  3L74 H;  3SYP A;  1AR1 B;  4F6E A;  4YHH O;  3H01 A;  2X6A A;  2IH1 C;  4WBN B;  1RM1 B;  2FKX A;  3J80 N;  4JV5 B;  5LMU O;  3OMI B;  5JCO A;  1NVP D;  4FFB A;  4O4I A;  2XHB A;  2BCC H;  2P6J A;  1N8R W;  4FM2 A;  1QVF U;  2GDS A;  2XOK G;  1YTF D;  1KQS U;  2ZIO A;  5JJN B;  4LF8 O;  2EIM B;  1PNK A;  3X2Q B;  3D3Q A;  1S5J A;  5TIS Z;  4H44 B;  3K5O A;  1G1X B;  1NTZ H;  1SZT A;  1TVK B;  2AZ0 A;  1AP6 A;  3W7X A;  1Q7Y W;  1M90 W;  2YID A;  2IU3 A;  5BR8 B;  5E79 Z;  1RFY A;  3H1H H;  4KFM A;  4LFB B;  4DR1 B;  3ZMU A;  3I55 V;  2RMK B;  1AJP A;  4G2K A;  3BHP A;  3JAM N;  5CBG A;  1FKA O;  1R1B A;  2JRI A;  1XNQ O;  4LF6 B;  1M4U A;  3ZN1 A;  2EIN B;  4DV5 O;  3HKB A;  4BIO A;  1S77 D;  1BQZ A;  3LDC A;  1NJI W;  5B1N A;  3CXC U;  4GX0 A;  4JZ2 A;  1L0L H;  3VBB A;  3MHS C;  2YIA A;  5IWA B;  1OZ0 A;  2UXD B;  1PV0 A;  3FB5 C;  3JD0 A;  5JJE B;  2RDC A;  5B3S B;  1WPB A;  4UV8 A;  2ZXW B;  4U7N A;  4D7T A;  2ZCE A;  4RAI A;  2IJH A;  1IXM A;  3UO3 A;  1WJZ A;  1PNM A;  4G28 B;  1IDS A;  4J42 A;  1NH2 D;  4DV4 B;  2AZ2 A;  2FB5 A;  2QWP B;  3CCS V;  4AI8 A;  3TXS A;  2P7T C;  3ZHV A;  2QA4 V;  1ZUQ A;  4YJ3 A;  1VP7 A;  3ZCC A;  5KMG A;  2PYL A;  2DYS C;  4H0L B;  4JYA B;  1SKV A;  3AK2 A;  4GX2 A;  3ZBH A;  3CEI A;  2HHH O;  3CC4 V;  2QKA A;  2JEX A;  4DK0 A;  1XMO B;  2DWD C;  3R66 A;  1P7G A;  1TA8 A;  1P49 A;  1NQT A;  3W7T A;  3BVO A;  1F4N A;  3CRC A;  3CD6 V;  5LMN B;  3DC5 A;  1VQ9 V;  4RO2 A;  1H2M A;  4WFF A;  2V1D A;  4FM1 A;  2R9I A;  1OJH A;  4PI0 A;  2QWO B;  1P84 F;  3ML0 A;  5B1A C;  1MZF A;  3I56 V;  3CHX A;  3HB3 B;  3JCZ A;  1ZTE A;  4GUN A;  5B1B C;  3L70 H;  1YIJ V;  1FFT B;  5AG2 A;  2KQX A;  1DGS A;  4B3R O;  4MVU A;  3K3W A;  4O2B B;  1IBK O;  3SJC C;  4CH4 A;  5IYZ A;  4LFC B;  1CEZ A;  1KKC A;  2Z0A A;  1HNW O;  2K1E A;  4JI1 B;  2UUB B;  2F43 G;  3E89 A;  3A0H Z;  5K1X A;  4X65 O;  1SET A;  2ZR3 A;  5GON B;  2DN9 A;  5EK0 A;  2AHZ A;  1WNS A;  2YC0 A;  4WFG A;  2RQ6 A;  1GM7 A;  3JAL A;  4FLT A;  1I0H A;  2D2C B;  2FML A;  3BFR A;  1KC8 W;  3SR2 C;  2WWW A;  4CS4 A;  3OGC C;  4FLX A;  2JDI G;  2UXX A;  2LJ2 A;  4OX9 B;  3SPC A;  2Y69 C;  5BXZ A;  3CCE V;  4J9Y B;  3RYF B;  5DED A;  4QJF B;  1VF6 C;  4PDL A;  4O4J A;  4RWU A;  2F4V O;  3OUF A;  3ZED A;  5D5P A;  5EZY A;  3A2F A;  1JQ0 A;  3JYC A;  3OR7 C;  1K34 A;  5CA3 A;  1G6U A;  1SQB H;  2QWQ B;  3BRC A;  2H3O A;  4JAU A;  3OW2 U;  4RUE A;  3MAQ A;  2A0L A;  4JI4 O;  3K5N A;  2ETN A;  2Y4U A;  4F6R B;  1F7Y A;  5IT9 N;  1NR1 A;  1UFI A;  2HJD A;  3RYH B;  3HKD A;  1N34 B;  4IIJ A;  1EN4 A;  1HNX O;  4BAY A;  2VQF B;  1QQC A;  2FYU H;  1Y67 A;  1PM9 A;  3AG1 B;  1BZK A;  2YIB A;  3CB2 A;  1JVM A;  4GX5 A;  2LGW A;  1IXB A;  4X8A A;  3F7V C;  2CTW A;  2IM9 A;  4GT1 A;  3CC7 V;  1Q82 W;  5LA6 A;  4X66 O;  1JX9 A;  3RYC B;  4BIZ A;  1FPO A;  3ZHR A;  4K0K B;  4F4L A;  4X1K A;  3WG7 C;  1OCO B;  1GMG A;  3D8C A;  1DTO A;  4J7J A;  1YDX A;  2ATK C;  2CH7 B;  2OTJ V;  2YXL A;  4LF5 O;  3JAT B;  3RYI B;  4WFB V;  1I08 A;  1HDJ A;  3AG2 B;  5IDJ A;  4JI7 B;  3G80 A;  4JI6 B;  2GUZ A;  4NTY A;  4XDK A;  5K1P A;  3U10 A;  3E86 A;  1AI4 A;  2EZP A;  3JD3 A;  5LGN A;  5J2T A;  1WA8 B;  1TUE B;  4H37 A;  1B04 A;  3CMA V;  2Y48 A;  2QWR B;  4UCO A;  3K0D A;  3RBZ A;  2VQE O;  1O9H A;  4FJC C;  5JWP A;  4YJ2 B;  3JD4 A;  5LOV A;  4EB6 B;  1H8H G;  3RGB A;  4UCT A;  4LBE C;  3CCU V;  4IGG A;  1W59 A;  1DF5 A;  1SQF A;  5KHI A;  4DR3 B;  1G4Y B;  3P32 A;  4Q6G A;  1NKD A;  1WAZ A;  1SES A;  1M56 C;  3U11 A;  4HZ3 A;  1KP2 A;  1XUQ A;  3MD0 A;  4DRX B;  5H5N A;  3OE7 G;  2CUG A;  3ZRW B;  4U3J A;  1G8M A;  4PA7 A;  2XAH A;  1YJ9 V;  3LDD A;  2UU9 O;  4UVA A;  4YIO A;  4AQY B;  1BS3 A;  4DR5 O;  3JCU Z;  1IVS A;  4H33 A;  1EZJ A;  3S3W A;  3FAV A;  1VQ8 V;  1HWY A;  1Z5W A;  1SC5 B;  1NS1 A;  3HPL C;  3SYQ A;  1X4T A;  2Q0A A;  4LCU C;  1XI1 A;  4JI0 O;  4DR7 B;  4I4T A;  2C2A A;  3K58 A;  4DV6 O;  4DUY B;  2HEP A;  5J9P C;  2E3C A;  3MDS A;  4IL6 Z;  3GWK C;  2E5L O;  3UCS C;  2YEV A;  1K5S A;  3CRQ A;  4LFA O;  3KG2 A;  1FJG O;  3W7W A;  1YXB A;  4R7C A;  1THZ A;  4GX1 A;  2ADQ B;  3K57 A;  2H8P C;  2QJ1 A;  2ZM6 B;  2IBZ H;  3HKB B;  4MTX A;  4U3F H;  5L3G A;  1MAB G;  3N2K A;  1WPX A;  2DYS B;  5EBM C;  3ZHQ A;  1K33 A;  3N27 A;  1M9N A;  3CSX A;  3GWO A;  1L1F A;  4GYC B;  1K3E A;  4UXN A;  3BCC H;  1JJO A;  1PL4 A;  2LO1 A;  1RSO A;  1IX9 A;  4LF4 O;  5JH7 A;  3H1I H;  1I5Y A;  3BA9 A;  4MW8 A;  4NB5 A;  3NR7 A;  3FB6 C;  2DJV A;  2QR4 A;  1Y66 A;  3T1H O;  3FB7 C;  5B1A B;  5KHH A;  1NVP B;  3RN4 A;  5B1B B;  4FLV A;  2A3Q A;  4JYY A;  1QVG U;  4FIP C;  5BZB A;  4ZOL B;  4JTA B;  2R70 A;  5DM6 V;  3PJS K;  4DR4 B;  2YI9 A;  3GB7 C;  4N21 A;  4MVZ A;  5KHJ A;  2QGN A;  4LF7 B;  2JEU A;  2ZE6 A;  2DYR C;  4X62 B;  1HR0 B;  3L73 H;  4RUF A;  5HFL A;  1SQX H;  1R6K A;  2XAF A;  3G4S V;  4LC1 A;  2RN9 A;  3IC7 A;  5DEC A;  1Q81 W;  1U96 A;  3CRR A;  3HR0 A;  2E75 B;  3M8A A;  1EZV H;  5EBL C;  2IW5 A;  4DV1 O;  1FXV A;  4E2L A;  3THO A;  1FXK C;  3FFQ A;  5IE9 A;  3E8G A;  5IYB O;  3J81 N;  2IJJ A;  1AI5 A;  4JAS A;  1Q3E A;  5J2U A;  2N05 A;  3UQ8 A;  1XHX A;  3JAW A;  3K0G A;  2X6B A;  4O2A A;  1PNL A;  2Y69 B;  1V54 C;  3I5D A;  4X1Y A;  1PL0 A;  2OYQ A;  3W7S A;  1FD9 A;  3T1Y B;  2Q8V A;  4I9Q A;  1B06 A;  4MVM A;  3RVY A;  3T2M A;  4IHJ A;  1PD3 A;  2W0F C;  2ZE7 A;  1KYO F;  4BW9 A;  1AB3 A;  5ITZ B;  5L3B A;  2DE0 X;  2V4D A;  1Y76 A;  2OWO A;  4NTX A;  4DR1 O;  1Q86 W;  4LF9 O;  3WU2 Z;  4LNU B;  4ZI7 A;  3RVZ A;  2R72 A;  2IH3 C;  3CS5 A;  2JGD B;  4O4J B;  3ASN C;  3N2G A;  4PD4 F;  2D3O W;  5FNV A;  3ZRV A;  3JAK A;  2NR5 A;  2HLD G;  4TQF A;  2EX3 A;  2P06 A;  1DLB A;  1ZL8 A;  1GN4 A;  2B5U A;  3EXA A;  1YJN V;  1JFF A;  4KXR A;  5B66 Z;  1TUB B;  3T4Z A;  2UXC O;  1IBM B;  2DQ0 A;  2JS3 A;  3DXR A;  1ROP A;  4IIJ B;  3WG7 B;  5JVD A;  5L3F A;  1VQ7 V;  2GHY A;  3A0B Z;  1S72 V;  1EM1 A;  3H1J H;  1K4C C;  2WLL A;  4K8X A;  5IJ0 B;  1KB9 F;  1K92 A;  2BE3 A;  3OTO B;  1VQ6 V;  1BHB A;  4QE9 A;  5LA6 B;  5CA0 A;  4FZ0 A;  1EBO A;  1MMM A;  5LL6 Y;  3CJH A;  1R73 A;  5A9G A;  4YY3 O;  2M6Y A;  2X0L A;  4CH5 A;  1NZ6 A;  3K03 A;  1R3L C;  3B2E E;  5JCO C;  4QPK A;  5HFM A;  4CC6 A;  3IGA C;  3QO5 A;  2KSD A;  3SJQ C;  2BTO A;  3LSU A;  1CPY A;  2QM4 A;  2QM8 A;  3SYA A;  2EIJ C;  5FPR A;  3EHB B;  4FMT A;  2GUZ B;  2M7W A;  4YXW G;  1RPO A;  2QM7 A;  2X6C A;  5J2T B;  1CP9 A;  2V7Q G;  1U97 A;  1IBL O;  1VF7 A;  4GKJ B;  4JI8 B;  3E8F A;  5L3D A;  1M56 B;  1VQO V;  1VMG A;  4JI5 B;  5CBH A;  1JJ2 U;  2QWN B;  3F7Y C;  2PF4 E;  2GSM B;  4UCU A;  1FAF A;  5CN0 A;  5LOV B;  3K04 A;  4DV3 B;  1QLE C;  4PA3 A;  4KUM A;  4PDV A;  2UUB O;  2OT5 A;  3SDL A;  5LP6 A;  3UKM A;  2P90 A;  5EBW C;  3KCY A;  1QU7 A;  1GTO A;  2BSK B;  4JI2 B;  3C3T A;  2ZNI A;  4ZHQ A;  1J5E B;  4NXN B;  4PJ0 Z;  4YHH B;  4R8C A;  2WLI B;  4PA4 A;  3LNM B;  5LMU B;  3LSQ A;  1PKX A;  1OCC B;  1N33 O;  1DK1 A;  5IYD O;  2W6J G;  4J11 A;  5JQG A;  5IJ9 A;  1I5X A;  1Y4M A;  4LF8 B;  1SA0 B;  1T5E A;  4TOI A;  2XAS A;  4PA9 A;  4X20 B;  4OPA A;  3FAV B;  1M93 A;  3QTC A;  2OCH A;  4B3S B;  4CBC A;  5BMV B;  4CS2 A;  1Q43 A;  1M1K W;  1S76 D;  1AIL A;  2Q68 A;  2BTQ A;  3FKS G;  2R9A A;  1VQK V;  3CE2 A;  2YEV B;  4UVC A;  1N36 O;  3L75 H;  2YIB D;  4UV9 A;  1W2B U;  1XNQ B;  1HP8 A;  4DV5 B;  3QF7 A;  2Q4P A;  4B3M O;  3P3P A;  1A32 A;  2NLJ C;  1UJW B;  3G71 V;  3CCQ V;  3VOU A;  4HNA B;  3E2E A;  4B7E A;  4DV7 O;  4XBF A;  3E22 A;  2WAM A;  4R6Z A;  3PN1 A;  1GAX A;  5LGU A;  4Q20 A;  4TWK A;  1GKF A;  4K0K O;  2QDO A;  3B8N A;  2UUA O;  2GBO A;  3D36 A;  2IU0 A;  1XMQ B;  1KUQ A;  3JAR A;  3ZRS A;  5L3E A;  1KKD A;  1S5L Z;  2DYR B;  4X1I B;  4KHP O;  1N32 O;  3K08 A;  2ZIM A;  3JAS B;  2ZDI A;  1Q6H A;  1ZSP A;  2Q73 A;  3OFN G;  2HHH B;  1NTM H;  4AIL C;  4FZ1 A;  3Q4H A;  3OEE G;  1MSD A;  2VWJ A;  3AK1 A;  2AW9 A;  1VQP V;  3HKE B;  3QVN A;  3BPZ A;  3BAB A;  1QBZ A;  2JVD A;  1FXK B;  1Y74 A;  3T4D A;  5LXT A;  2A9H A;  3ABL C;  4QNH B;  2XT9 A;  2KG7 B;  3ZHT A;  3NXS A;  3APO A;  1N0N A;  2LW1 A;  2ZDI C;  4I0X A;  4LH6 A;  2NNU A;  4TQD A;  4HYO A;  1KD1 W;  2IJK A;  2ZQM A;  5C8Y B;  4DV2 O;  3LSS A;  4B3R B;  1V54 B;  1VQM V;  1SF9 A;  5EYP A;  1AJQ A;  4MVO A;  3LNN A;  5LGT A;  1H2K A;  2CDY A;  1TGO A;  2P5O A;  3CCV V;  1IBK B;  2CTQ A;  2YI8 A;  4CH6 A;  4WBN A;  1YF2 A;  1HNW B;  3T1C A;  2YUA A;  1YZB A;  1SQG A;  3EFF K;  1D2D A;  1XNR O;  4MT8 A;  1EN5 A;  4X65 B;  3DTU B;  5J2U B;  2BOC C;  2O57 A;  2YXH A;  3FYI B;  4X9Q A;  3UT5 B;  1XRE A;  1OCR C;  1H8E G;  3ZMT A;  3HKC A;  1TVK A;  2HKO A;  4Z1V A;  4OXS A;  3ASN B;  4DO2 A;  4J10 A;  1H2N A;  1XBL A;  5BY1 A;  2XAJ A;  1M5I A;  1L8D A;  4DR2 O;  2EIL C;  4O4H B;  4QE7 A;  4ICG A;  2EUL A;  1WB8 A;  1Q90 D;  3QG5 A;  3K79 A;  4D6T H;  5KAF Z;  4DR6 B;  3E83 A;  5KX5 B;  5EC1 C;  1YEW A;  2N74 A;  1XOU A;  4DUZ O;  4CC5 A;  2F4V B;  1ARO P;  2QKS A;  4GKK B;  1JMK C;  3LDE A;  2JIZ G;  5LYJ B;  3ZHS A;  2ZE5 A;  1I94 O;  4JI4 B;  3RW0 A;  3KZI Z;  2QSA A;  4JI3 O;  1VQN V;  4X89 A;  1YSC A;  1MOF A;  4P30 A;  2LGQ A;  3QO7 A;  4JGS A;  1HNX B;  4TV8 A;  3GVM A;  5E1A C;  1QR9 A;  4BWA A;  2UUC O;  4ASU G;  4XDJ A;  4KL1 A;  3K9A A;  5F2V O;  1Q6I A;  2KB1 A;  1Q8I A;  4UB8 Z;  4FFB B;  4O4I B;  1RP3 B;  1VAR A;  2AHY A;  5EIB C;  1NI8 A;  2DMX A;  2GTS A;  1E1Q G;  4X66 B;  3MHH C;  2DW4 A;  2NN4 A;  4FVM A;  2EIJ B;  1K73 W;  1KBH A;  4X64 O;  2JGU A;  4NKG B;  5LHH A;  4O4L A;  2L35 A;  4DV0 O;  2HR3 A;  1ZX3 A;  2QTS A;  3ZIA G;  2L6L A;  2PZS A;  4JTC B;  4LF5 B;  1S0V A;  2KKW A;  4NYK A;  3D3I A;  1QNM A;  2CK3 G;  3CPW U;  5JJJ B;  5CBF A;  4GLX A;  1X59 A;  1QLE B;  4PI2 A;  1HR0 O;  1AJN A;  2ZIN A;  1F23 A;  4NTW A;  3WB2 A;  1P7B A;  4PDR A;  1OV9 A;  1S5H C;  3KKY A;  2LP7 A;  1QCE A;  3RWR D;  1NTK H;  1H38 A;  4L87 A;  2YSU B;  5IYC O;  2PI4 A;  2VQE B;  3C3S A;  1MNG A;  1UPG A;  2DOS A;  3JSL A;  1FYJ A;  3CWB H;  4YIP A;  4TV9 A;  3SPJ A;  1BHA A;  3OEH G;  2QE7 G;  2HP8 A;  2ADP A;  5KHK A;  3DSQ A;  3BEH A;  5GON A;  3OT7 A;  3FYE B;  4NXM O;  5FL7 G;  3JD1 A;  4YJ3 B;  2ZKO A;  2HFE C;  2XAG A;  4E4E A;  1VQ5 V;  5KMG B;  1V9P A;  3UO2 A;  4K35 A;  4TT3 G;  2P4K A;  1AI7 A;  1HNZ O;  2WLK A;  1PPJ H;  1JR9 A;  1OCZ C;  3CME V;  1F4M A;  4UB6 Z;  2LQT A;  2UU9 B;  3WB0 A;  1N4C A;  2GTA A;  4DR5 B;  3ZMS A;  3VQV A;  4B3T O;  2JK5 C;  5IJ9 B;  3STL C;  4JF3 A;  4P9O A;  3B77 A;  4UCV A;  3RYF A;  3IAY A;  4I5S A;  4I7Z B;  3FB8 C;  4JI0 B;  1M57 C;  4DV6 B;  3ZHU A;  2H94 A;  4CH3 A;  3CXH F;  2PI5 A;  4W4K A;  2E5L B;  4F6R A;  2FTK A;  3DC6 A;  1LR1 A;  4LFA B;  3ABK C;  4IT5 A;  1FJG B;  3M7M X;  1BT8 A;  4C7U A;  1BCC H;  1H2S B;  5IYZ B;  1GO3 F;  3H9V A;  2WPD G;  4JV5 O;  2DQ3 A;  2CTR A;  4DW1 A;  3OMA B;  1IUR A;  2RCV A;  1HW7 A;  3E22 B;  1SZX A;  1XHZ A;  1B6Q A;  4PDM A;  1YVW A;  2FL4 A;  1URF A;  4K3A A;  4LF4 B;  2IJI A;  1AR5 A;  5CMU A;  1COW G;  3JAL B;  3ZN0 A;  1AI6 A;  4EFB A;  1W0K G;  5GTH Z;  4R50 A;  2AGA A;  4NVP A;  1QR8 A;  5BR8 O;  4PEL A;  3ABL B;  2E74 B;  3RYI A;  3T1H B;  4LFB O;  4WFA V;  3BY6 A;  1K4D C;  5H9C A;  3B8M A;  2X7R B;  3OUS A;  4K8Z A;  1YJW V;  2RJZ A;  3TK1 A;  1TAE A;  5IY5 C;  4WF9 V;  4LF6 O;  3ZX6 A;  5EC2 C;  1WA8 A;  3CX5 F;  1EN6 A;  2F95 B;  2Q67 A;  3E35 A;  5EZY B;  3Q4H B;  3STZ C;  3IJ4 A;  5FPO A;  1EFR G;  1R6T A;  2GV9 A;  5IWA O;  1KU9 A;  2UXD O;  4RQF A;  4YJ2 A;  2XUM A;  1FFX A;  4CZZ A;  4JI5 O;  1W0J G;  4G27 B;  3OR6 C;  3HKD B;  3WFV A;  1LUV A;  1Z2G A;  4EB6 A;  1XIL A;  3AG2 C;  4DV3 O;  4I0X B;  4KP4 A;  4I9W A;  1XEQ A;  4DV4 O;  1OCR B;  5KUK A;  4DYL A;  4DV1 B;  3RT3 C;  4NR1 A;  1D5A A;  2F1M A;  1SQP H;  2CGN A;  1P4R A;  3AG4 C;  4FLU A;  2RNB A;  4DRX A;  4JYA O;  2EIL B;  2EBO A;  3LUT B;  4UFZ A;  1DF4 A;  4X1K B;  3ZRW A;  4JPR A;  2WLN A;  1XMO O;  2JJ1 G;  4LR3 A;  3K06 A;  3ZS8 C;  2W6I G;  5H6Q A;  4LWS A;  4PV1 B;  3SYC A;  5LMN O;  3HKC B;  2Y0I A;  3R65 A;  3CRA A;  3SJA C;  4B3S O;  3G6B A;  1Y6X A;  3ASO C;  2ILM A;  3AG3 C;  4D7S A;  3OMN B;  3U0Z A;  4UCR A;  2CAZ C;  4X88 A;  4WCE V;  3DGE A;  1KEC A;  4LF9 B;  4AHC A;  2ARH A;  3OTF A;  2UXB B;  2UXN A;  1N0J A;  5LHG A;  4LFC O;  3UM7 A;  3A8T A;  1RPR A;  2OTL V;  1Q6U A;  3H1K H;  5B1O A;  4JI1 O;  4IYH A;  3G67 A;  3O65 A;  4I55 A;  5CA1 A;  5H2F Z;  3BAA A;  2Q69 A;  2UXC B;  2EIK C;  1GM8 A;  4FK5 C;  4TV8 B;  2B9Z A;  3SGI A;  4EKW A;  1GN6 A;  3J7A U;  2HG5 C;  3JSN A;  3P30 A;  1K8A W;  1E1R G;  3JD2 A;  2G38 A;  1XMQ O;  4U3J B;  3OM3 B;  2Q7G A;  5LP6 C;  3AG7 A;  2WA3 A;  4OX9 O;  3CP1 A;  1NU1 H;  4YY3 B;  3VQY A;  4O4L B;  4ZOL A;  1BMF G;  4I4T B;  3IFX A;  1QLN A;  3H1L H;  4MVR A;  1WLE A;  2Y4T A;  3FX7 A;  1XQ8 A;  1ENV A;  2B1I A;  5A2Q N;  2A06 H;  1XL6 A;  4N23 A;  1N34 O;  2Q6A A;  2ITD C;  4LH7 A;  2VQF O;  4JYB A;  1XL4 A;  4A5U B;  1IBL B;  1NBM G;  2QTO A;  1V55 C;  3N2K B;  2CGO A;  1ZLZ A;  5KHG A;  2MW2 B;  1H2G A;  2Q0O C;  3FD9 A;  1R3K C;  1OCZ B;  2OCC C;  2K9P A;  4TV9 B;  1RSO B;  5JH7 B;  2HVK C;  3CCJ V;  4TUY A;  1K9M W;  1VF6 A;  1FXH A;  2PTM A;  5DN6 G;  3K9S A;  1JOY A;  1B3Q A;  1M57 B;  5KA5 A;  3CC2 V;  1Z5V A;  1VIB A;  3ETD A;  1N33 B;  4JI7 O;  1R3I C;  4JI6 O;  5ITZ A;  2P67 A;  3OGI B;  1YIT V;  3ABK B;  1VF5 B;  2WA4 A;  4I50 A;  2DWE C;  2WLH A;  4H13 B;  3D36 C;  4DR6 O;  4LNU A;  4OGQ B;  4ABM A;  2EJ7 A;  2P22 C;  5EIB D;  3TCU A;  3E8B A;  1Q5O A;  2JGD A;  2Q7H A;  2VRZ A;  2A79 B;  3ABM C;  2ZD9 A;  4PHZ A;  4CS3 A;  1BL8 A;  4GKK O;  2MK3 A;  3CCR V;  3TET A;  1ORQ C;  3K5M A;  2Z5U A;  1NR7 A;  2OIG A;  2P4V A;  1TUB A;  1BSM A;  3AK3 A;  1N36 B;  5CB4 A;  3ABU A;  4GCZ A;  4DR3 O;  3L9D A;  4UVB A;  5L3C A;  4B3M B;  4JTD B;  1FS0 G;  1WP7 A;  4Z2W A;  4TSF G;  5GW7 A;  5KAI Z;  4DV7 B;  1ZWI C;  5IJ0 A;  4EEQ A;  1VQL V;  3JAW B;  1NT2 B;  4AQY O;  4O2A B;  4OPH A;  4X1Y B;  1D5N A;  5IY5 B;  3WB1 A;  2JJ2 G;  3TXQ A;  2ZT9 B;  4IHJ B;  2UUA B;  2QKC A;  3F5T A;  1RM1 C;  4B08 A;  4MS2 A;  3ZMV A;  4QGP A;  4DR7 O;  5KLV H;  4W4L A;  3CYO A;  4DUY O;  3W7U A;  3CCM V;  4UUJ C;  1CXZ B;  4J9Z B;  1N32 B;  4KHP B;  1Y76 B;  2PUS A;  2Y0P A;  3QNE A;  2EIM C;  3X2Q C;  3ZJZ A;  3SJB C;  4ZI7 B;  4IYI A;  2PYJ A;  1S3J A;  2ZM6 O;  2WLJ A;  1LNQ A;  3N2G B;  3K5L A;  1O9G A;  3O9O A;  5FNV B;  3JAK B;  2XAQ A;  4MTG A;  4QPJ A;  2AXT Z;  2WSS G;  1WN7 A;  1ZL8 B;  4HAM A;  5D5Q A;  2EZO A;  1H2L A;  1JFF B;  4L8J A;  3B09 A;  3AG4 B;  1GRJ A;  1FFX B;  4P2Z A;  5LBQ A;  3VQX A;  1L0N H;  4UCS A;  3DXR B;  5JVD B;  2EIN C;  4DV2 B;  2XTA A;  2BSK A;  1I7F A;  4GZR B;  4MTF A;  2WLL B;  1R6N A;  5GTI Z;  3SPI A;  2VWK A;  2WLI A;  1KP3 A;  1SQV H;  1SS3 A;  5B3S C;  1WB7 A;  4JZG A;  1KMI Z;  5CA0 B;  1XNR B;  2ZXW C;  1F51 A;  4RQE A;  3ASO B;  4FPP A;  3CJH B;  4DW0 A;  3AG3 B;  1AVM A;  2E76 B;  1E79 G;  2OIE A;  1MSW D;  4JAV A;  1SA0 A;  4DR4 O;  3G6E V;  4X20 A;  4LWS B;  3E8H A;  4LF7 O;  4BW5 A;  3QO8 A;  4DK1 A;  4X62 O;  5BMV A;  4FLZ A;  4DR2 B;  1OCC C;  3EVK A;  4J7Z A;  4DXW A;  4O2B A;  2XND G;  2EIK B;  1OHH G;  2YXY A;  1J95 A;  1LUW A;  1YCI A;  4JAA A;  4DUZ B;  5LHI A;  3SPG A;  1JCH A;  1K97 A;  3F5W C;  4BIU A; 
#chains in the Genus database with same CATH homology
 4BIZ A;  1I5X A;  1Y4M A;  3STZ C;  1EFR G;  2XAS A;  4PA9 A;  4F4L A;  1K7D A;  4QIW F;  3WG7 C;  1OCO B;  1GMG A;  4RQF A;  1DTO A;  4CZZ A;  1W0J G;  4CBC A;  1SER A;  4G27 B;  3OR6 C;  2ATK C;  3WFV A;  2OTJ V;  2ZR2 A;  1M1K W;  1S76 D;  2Q68 A;  3AG2 C;  3ETG A;  2EJR A;  4KP4 A;  4MTO A;  4WFB V;  3FKS G;  4I9W A;  1VQK V;  1OCR B;  4ZKI A;  2YEV B;  3AG2 B;  5IDJ A;  1GM9 A;  5KUK A;  4UVC A;  1YHQ V;  4UV9 A;  2BOB C;  1W2B U;  4MSW C;  4XDK A;  3E86 A;  1AI4 A;  2EZP A;  3JD3 A;  2HJF C;  5LGN A;  2HVJ C;  4Z1M G;  1TUE B;  3ZMZ A;  1VQ4 V;  4H37 A;  3CMA V;  1P4R A;  2Y48 A;  3AG4 C;  2NLJ C;  3K0D A;  1UJW B;  3G71 V;  3CCQ V;  2EIL B;  2EBO A;  2Z3Y A;  3LUT B;  3VOU A;  1DF4 A;  3E2E A;  3RBZ A;  3A0R A;  3ZRW A;  4JPR A;  2WLN A;  4FJC C;  4XBF A;  2JJ1 G;  2R9R B;  3JD4 A;  1YTF B;  3K06 A;  3AEI A;  1V55 B;  2WAM A;  2W6I G;  4JYC A;  4R6Z A;  5H6Q A;  1H8H G;  5LGU A;  2QEX V;  1FXK A;  4Q20 A;  3SYC A;  4TWK A;  1GKF A;  2B1G A;  4LBE C;  1MG1 A;  3SYO A;  3B8N A;  3CCU V;  3R65 A;  3D36 A;  2IU0 A;  2OCC B;  1DF5 A;  1SRY A;  3ZRS A;  1G4Y B;  3P32 A;  1NKD A;  5L3E A;  3ASO C;  1KKD A;  1GK9 A;  3AG3 C;  1SES A;  1M56 C;  4P9P A;  2DYR B;  3K08 A;  3ZRX A;  3OMN B;  4HZ3 A;  1KP2 A;  4X88 A;  3MD0 A;  4WCE V;  2ZDI A;  3DGE A;  1KEC A;  4LP8 A;  3OFN G;  3OE7 G;  4MW3 A;  3ZRW B;  5KA6 A;  1G8M A;  4PA7 A;  2UXN A;  2WLM A;  2XAH A;  3LDD A;  1YJ9 V;  5LHG A;  3UM7 A;  4UVA A;  3OEE G;  1RPR A;  2OTL V;  4H33 A;  1EZJ A;  1K5Q A;  1VQP V;  1QBZ A;  5B1O A;  1FXK B;  3T4D A;  1VQ8 V;  1HWY A;  2A9H A;  3ABL C;  4XDL A;  4QNH B;  3HPL C;  3SYQ A;  3NXS A;  4WFE A;  4MVQ A;  4LCU C;  5C93 A;  3AG1 C;  3OAA G;  2Q69 A;  2C2A A;  2EIK C;  2ZDI C;  5KUM A;  2ITC C;  2NNU A;  1GM8 A;  5J9P C;  4FK5 C;  4HYO A;  1NH2 B;  1KD1 W;  2IJK A;  3ABM B;  2ZQM A;  2YEV A;  3LSS A;  1K5S A;  4EKW A;  1V54 B;  3KG2 A;  1VQM V;  2HG5 C;  3W7W A;  3P30 A;  1AJQ A;  4MVO A;  4R7C A;  1K8A W;  1E1R G;  1THZ A;  3JD2 A;  4GX1 A;  5LGT A;  3CCV V;  3OM3 B;  2H8P C;  4U7O A;  3SPH A;  3M99 B;  1OCO C;  1JPX A;  4MTX A;  3T1C A;  3ETE A;  5L3G A;  1YI2 V;  1MAB G;  3CP1 A;  3EFF K;  4MT8 A;  1WPX A;  2DYS B;  3DTU B;  5EBM C;  1K33 A;  1M9N A;  2BOC C;  4PA6 A;  3FYI B;  3GWO A;  1OCR C;  1BMF G;  1H8E G;  3ZMT A;  1L1F A;  1K3E A;  4UXN A;  3IFX A;  1QLN A;  1R3J C;  4MVR A;  1WLE A;  4MVS A;  4WFH A;  2HKO A;  3CCL V;  5H6R A;  2LFR A;  4OXS A;  3ABT A;  3ASN B;  4DO2 A;  1ENV A;  2LFS A;  1I5Y A;  4MW8 A;  2B1I A;  2XAJ A;  3FB6 C;  4ZBM A;  1XL6 A;  4N23 A;  2EIL C;  2Q6A A;  4QE7 A;  3SYP A;  1AR1 B;  3H01 A;  2X6A A;  2ITD C;  2IH1 C;  1Y66 A;  1RM1 B;  3FB7 C;  5B1A B;  3K79 A;  4JYB A;  3E83 A;  1XL4 A;  5EC1 C;  1NBM G;  1NVP B;  2QTO A;  3OMI B;  1V55 C;  1NVP D;  5B1B B;  1N8R W;  2P6J A;  1QVG U;  1ARO P;  2QKS A;  4FIP C;  5BZB A;  1QVF U;  1H2G A;  4JTA B;  5DM6 V;  2XOK G;  2JIZ G;  1R3K C;  3LDE A;  3PJS K;  1YTF D;  1OCZ B;  1KQS U;  2EIM B;  3GB7 C;  1PNK A;  2OCC C;  3X2Q B;  4N21 A;  4MVZ A;  3RW0 A;  1SZT A;  2JEU A;  1VQN V;  4X89 A;  1YSC A;  1MOF A;  2DYR C;  4P30 A;  2HVK C;  4RUF A;  3CCJ V;  5HFL A;  3QO7 A;  4JGS A;  3W7X A;  1Q7Y W;  1M90 W;  1K9M W;  1R6K A;  2IU3 A;  2XAF A;  3G4S V;  4LC1 A;  5E1A C;  1QR9 A;  3IC7 A;  1FXH A;  5DN6 G;  4KFM A;  4ASU G;  4XDJ A;  1Q81 W;  1JOY A;  3ZMU A;  3I55 V;  1M57 B;  5KA5 A;  3K9A A;  3CC2 V;  1AJP A;  4G2K A;  5CBG A;  3ETD A;  5EBL C;  1R3I C;  2KB1 A;  2IW5 A;  2P67 A;  3ZN1 A;  1YIT V;  1FXV A;  4E2L A;  2EIN B;  1FXK C;  2AHY A;  1S77 D;  3ABK B;  3E8G A;  1E1Q G;  5IYB O;  2DWE C;  2WLH A;  3LDC A;  1NJI W;  3MHH C;  2DW4 A;  2IJJ A;  5B1N A;  2EIJ B;  3CXC U;  4GX0 A;  1K73 W;  3VBB A;  1AI5 A;  3MHS C;  4JAS A;  1OZ0 A;  5LHH A;  3FB5 C;  3K0G A;  3TCU A;  3E8B A;  3JD0 A;  2ZD9 A;  2HR3 A;  3ABM C;  2A79 B;  2X6B A;  3ZIA G;  5B3S B;  1PNL A;  2Y69 B;  1V54 C;  4UV8 A;  1BL8 A;  2ZXW B;  4JTC B;  4U7N A;  4RAI A;  2MK3 A;  1PL0 A;  2IJH A;  1S0V A;  3W7S A;  3CCR V;  3TET A;  1IXM A;  3D3I A;  1ORQ C;  1PNM A;  2CK3 G;  4MVM A;  4G28 B;  3RVY A;  3T2M A;  2Z5U A;  1PD3 A;  1NR7 A;  2W0F C;  1NH2 D;  3CPW U;  3CCS V;  5CBF A;  2P7T C;  2QA4 V;  1QLE B;  1AJN A;  3ABU A;  3ZCC A;  4GCZ A;  1F23 A;  1P7B A;  5L3B A;  4PDR A;  2DYS C;  1S5H C;  4UVB A;  2LP7 A;  1QCE A;  5L3C A;  4JTD B;  1FS0 G;  1Q86 W;  1H38 A;  4L87 A;  2YSU B;  4GX2 A;  5IYC O;  2PI4 A;  3CC4 V;  4TSF G;  5GW7 A;  2JEX A;  1ZWI C;  1VQL V;  2DWD C;  3RVZ A;  2IH3 C;  1NQT A;  3W7T A;  3ASN C;  2D3O W;  3ZRV A;  5IY5 B;  2HLD G;  2JJ2 G;  3SPJ A;  1F4N A;  1BHA A;  3CD6 V;  3OEH G;  1DLB A;  2QE7 G;  4RO2 A;  4WFF A;  2V1D A;  1VQ9 V;  2B5U A;  2R9I A;  1YJN V;  3BEH A;  3T4Z A;  1RM1 C;  3ML0 A;  3FYE B;  4MS2 A;  5B1A C;  3ZMV A;  5FL7 G;  3I56 V;  3JD1 A;  2HFE C;  3HB3 B;  2XAG A;  3JCZ A;  2DQ0 A;  1VQ5 V;  3CYO A;  3W7U A;  3CCM V;  3WG7 B;  1ROP A;  5L3F A;  4UUJ C;  4J9Z B;  5B1B C;  1YIJ V;  1FFT B;  1VQ7 V;  2GHY A;  4TT3 G;  1AI7 A;  2WLK A;  3QNE A;  4MVU A;  3K3W A;  1S72 V;  1OCZ C;  3CME V;  2EIM C;  1F4M A;  3X2Q C;  1K4C C;  3ZJZ A;  2WLL A;  1K92 A;  1CEZ A;  1VQ6 V;  1S3J A;  2WLJ A;  1BHB A;  1LNQ A;  3ZMS A;  4QE9 A;  2JK5 C;  2K1E A;  3STL C;  4JF3 A;  4P9O A;  2F43 G;  1EBO A;  2XAQ A;  4MTG A;  4QPJ A;  3E89 A;  3B77 A;  1R73 A;  2WSS G;  4HAM A;  2EZO A;  1SET A;  2ZR3 A;  4I5S A;  2X0L A;  3AG4 B;  5EK0 A;  3FB8 C;  1M57 C;  4P2Z A;  2AHZ A;  5LBQ A;  3K03 A;  2H94 A;  4WFG A;  1R3L C;  4QPK A;  2PI5 A;  5HFM A;  1GM7 A;  3IGA C;  2EIN C;  3QO5 A;  3SJQ C;  2FTK A;  3ABK C;  1CPY A;  1KC8 W;  2QM8 A;  3SYA A;  2EIJ C;  4MTF A;  3EHB B;  4FMT A;  2M7W A;  2WLL B;  1R6N A;  2WWW A;  1RPO A;  4YXW G;  3OGC C;  3SPI A;  2JDI G;  1GO3 F;  2QM7 A;  2WLI A;  2X6C A;  1KP3 A;  1CP9 A;  2UXX A;  2WPD G;  2V7Q G;  3SPC A;  5B3S C;  2DQ3 A;  2Y69 C;  2ZXW C;  1F51 A;  4RQE A;  4J9Y B;  3CCE V;  3ASO B;  4FPP A;  4QJF B;  3E8F A;  5L3D A;  3AG3 B;  1M56 B;  3OMA B;  1VQO V;  4PDL A;  5CBH A;  1JJ2 U;  3OUF A;  3F7Y C;  1E79 G;  2GSM B;  1MSW D;  5CN0 A;  4JAV A;  3JYC A;  1JQ0 A;  3OR7 C;  3K04 A;  1K34 A;  1B6Q A;  4PDM A;  5CA3 A;  1QLE C;  3G6E V;  4PA3 A;  4JAU A;  4KUM A;  3OW2 U;  4PDV A;  4RUE A;  2A0L A;  2OT5 A;  2IJI A;  3UKM A;  3E8H A;  1NR1 A;  2P90 A;  4BW5 A;  5CMU A;  3QO8 A;  1COW G;  5EBW C;  3ZN0 A;  1AI6 A;  1W0K G;  1GTO A;  4R50 A;  1QR8 A;  1OCC C;  4BAY A;  4PEL A;  3ABL B;  4R8C A;  2WLI B;  4PA4 A;  3LNM B;  4DXW A;  4WFA V;  3AG1 B;  3BY6 A;  1K4D C;  2XND G;  2EIK B;  3LSQ A;  1JVM A;  1OHH G;  1PKX A;  1OCC B;  2X7R B;  3B8M A;  1J95 A;  3OUS A;  4GX5 A;  5H9C A;  1YJW V;  3TK1 A;  5LHI A;  5IY5 C;  3SPG A;  1JCH A;  4X8A A;  4WF9 V;  3F7V C;  5EC2 C;  4GT1 A;  3E35 A;  2Q67 A;  5IYD O;  3CC7 V;  2W6J G;  1Q82 W;  1K97 A;  3F5W C;  1JX9 A;  4BIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...