1R3KC

Potassium channel kcsa-fab complex in low concentration of tl+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3kC00
1OCOC 3RBZA 4MW8A 4DXWA 4MVSA 3E8HA 3EFFK 2Q68A 4G28B 3SJQC 2Q67A 1R3JC 2EIKC 3E89A 3BEHA 1ZWIC 2QTOA 4J9YB 3SYPA 2HG5C 3T2MA 3X2QC 3SPCA 4X88A 4WFGA 1R3IC 4PA9A 2IH1C 4ZBMA 5KUMA 3F5WC 3SPIA 2ATKC 2HVKC 1V55C 2A79B 4WFFA 2EIMC 1M57C 5EBMC 2WLLA 4WFHA 3ABMC 3FB8C 3KG2A 1KKDA 2ITCC 2DWDC 2W0FC 3AG2C 2EINC 4QE9A 2KB1A 4RUEA 3E8FA 4MVOA 2DWEC 3IFXA 4MSWC 1M56C 3K03A 3SPHA 2K1EA 3T4DA 5IY5C 2A9HA 3E86A 1OCRC 4TWKA 3ABKC 2R9RB 4P2ZA 3T4ZA 1LNQA 2NLJC 4RUFA 3F7VC 3HPLC 4PA4A 3LDDA 4R50A 5CBGA 3AG4C 3E83A 3OUSA 3ASOC 2EIJC 3OR6C 4PDVA 4MVRA 1K4CC 2WLLB 1OCZC 3JYCA 2QKSA 1G4YB 2BOCC 4JTCB 2WLJA 3STZC 3ZRSA 1OCCC 5KUKA 4XDJA 5EK0A 2P7TC 2ZXWC 1XL4A 2X6CA 1P7BA 2AHYA 3UM7A 3SPGA 3SPJA 3TETA 3K04A 2DYSC 2AHZA 4G27B 4P9OA 2IH3C 3ABLC 4WFEA 1JVMA 3ASNC 3OR7C 4P9PA 3IGAC 1R3KC 2ITDC 2WLNA 4HYOA 3LDCA 5EC1C 2WLIA 3FB5C 2X6AA 4MVZA 5EC2C 3VOUA 4MVQA 4PDRA 4RAIA 5EBWC 4QNHB 4JTAB 3K08A 2Q69A 2Q6AA 2ZD9A 2BOBC 4HZ3A 4MVUA 2WLMA 1S5HC 5E1AC 4JTDB 5J9PC 1QLEC 2DYRC 2HJFC 2WLKA 4GX5A 3STLC 3ZJZA 3TCUA 3WG7C 3SYAA 3OUFA 1BL8A 3LUTB 4H37A 2WLHA 4MTOA 4J9ZB 2OCCC 1XL6A 3T1CA 1K4DC 4LBEC 1R3LC 3SYOA 5B3SC 3PJSK 2A0LA 5B1AC 3RVYA 4LCUC 4LP8A 1V54C 2HVJC 3R65A 4RO2A 3GB7C 4R8CA 4R7CA 2WLIB 3F7YC 2YEVA 2X6BA 2H8PC 3UKMA 4EKWA 4R6ZA 2JK5C 4KFMA 4PA7A 4PA6A 5EBLC 4MTFA 3RVZA 1ORQC 2EILC 4BW5A 4PDMA 4PA3A 3E8BA 3LNMB 3LDEA 4MTGA 4GX0A 4OXSA 4QE7A 5B1BC 4CBCA 4X89A 3OGCC 3K0GA 4GX2A 3SYCA 3K0DA 4MVMA 4XDLA 3FB6C 4XDKA 5CBFA 4GX1A 4H33A 3K06A 3SYQA 2Y69C 2HFEC 5CBHA 4UUJC 3FB7C 4P30A 3RW0A 1J95A 3AG1C 4I9WA 3E8GA 4MS2A 4MW3A 4X8AA 4F4LA 4PDLA 5BZBA 3AG3C
chains in the Genus database with same CATH superfamily
3NXSA 5LMNB 1MABG 3JAWA 2XASA 3G6BA 3IAYA 2P5OA 1RSOA 3M7MX 5IYCO 2UXDB 3H1HH 3LSQA 5KA5A 1H2LA 2EZOA 4DV6O 3ETEA 4DR5B 3C3TA 4JV5O 1VQNV 3K57A 4NVPA 2R9RB 2YC0A 3RYIB 5C8YB 3F7VC 2GBOA 5IYBO 3UO2A 3F5TA 4JI4B 3D36A 1F23A 1N34O 4MVRA 3UM7A 1F51A 3TETA 4P9OA 4ZKIA 2F1MA 3K5OA 1KUQA 2UXCB 3ABKB 4MVZA 3IJ4A 1SQQH 4DV3B 4NXMB 4RQEA 4DO2A 4PI0A 2WLKA 4YIOA 4UVCA 4J9ZB 1K4DC 4LBEC 1R3LC 3CCSV 2QEXV 2PZSA 3HKBB 4R7CA 4DR7O 4DR1B 1QLNA 4MTFA 3CC4V 3CCLV 2FMLA 3LDEA 1W0JG 4Z1MG 4OXSA 2QE7G 3FAVB 3OGCC 1EZVH 1G1XB 4GX2A 5AG2A 1IBMO 4IIJA 1KP3A 5LBQA 4X8AA 4UCRA 5B1OA 1XEQA 1KB9F 4NR1A 2A7WA 5IT9N 1U96A 1N36O 2VRZA 3CJHA 2VWKA 1NR1A 5KHHA 3N2GB 5LOVA 4N23A 1K5SA 3SR2C 3KCXA 1BGYH 1Z5VA 1HNZO 1QBZA 2M7WA 1HW7A 2IH1C 4PA9A 4JI6B 3CXCU 1Y6XA 4LFBO 1M57C 1RM1C 4HAMA 2GUZB 3AG2C 3CHXA 3N2KA 1W59A 3E8FA 4H13B 2P06A 1JJ2U 4EB6B 5CA1B 2JS3A 1KMIZ 4P2ZA 3ZRWB 4DUYO 2LFRA 2DMXA 4HBNA 1S76D 2XNDG 5LHHA 4JI1B 1PL0A 3DXRA 4YIPA 4KXRA 3CC7V 2QWRB 2WAMA 1PKXA 4DV5O 4PDVA 2A3QA 3RYFB 4TV8B 2AHYA 2BTQB 1OJHA 3EVKA 3SPJA 5H5NA 3K04A 4LF4B 2F93B 1EM1A 2OYQA 5GONB 4HYOA 5EBWC 1E1RG 2VS0A 2ZDIA 1VF6C 1Z2GA 2ARHA 1YJ9V 1WB7A 5GTIZ 1JMKC 4MT8A 3ZHVA 4LFAB 1RM1B 1OCCB 1F4MA 3AG2B 4JI3B 2IM9A 4IYHA 1D5NA 2AW9A 2L6LA 2QA4V 4O4HA 1NZ6A 2C2AA 3JD0A 3VQWA 3WB1A 3W7WA 1ZLZA 4I0XA 1NU1H 4PELA 4O4IA 3U0ZA 2Y69C 2HFEC 5FNVA 4JI2B 4LF9O 2Q9LA 2Y0PA 4RWUA 4LF5O 1M5IA 4JAVA 1BQ0A 2YIBD 5EYPA 2H94A 2EIKC 4EFBA 3BEHA 2QJ1A 4DR4B 2YUAA 2Z5UA 3CCUV 3FD9A 1GM9A 1AP6A 4QJFB 4U3FH 5IJ9A 1A32A 4MSWC 2K1EA 3JAWB 3JSLA 1JFFA 2BSKB 4FIPC 2ZM6B 4B3MB 1NQTA 3CCJV 1WP7A 3HPLC 1RSOB 2W0XA 4UXNA 4UVAA 5J2TA 1OCZC 4X1KB 4EEQA 2BOCC 3STZC 2Y69B 4GKJB 2Y4TA 3QO8A 4LF7O 1U97A 1HNXO 5BMVA 4TQDA 3ICXA 4U3JA 2LO1A 4PDRA 3TXQA 3K08A 3JATB 2BOBC 1GH6A 2GV9A 2WA3A 3FYEB 1NH2B 3BHPA 3D3QA 3CMAV 1N32O 3RWRD 3HKEB 3TCUA 3WG7C 3OUFA 2DOSA 4AQYO 3HKCA 1M9NA 5L3FA 2F95B 3PN1A 4RO2A 4PI2A 5L3EA 3FYIB 5J2UA 5EBLC 3AG7A 4X1IA 5CA0B 4KUMA 1YTFB 5LMNO 4LNUA 4CBCA 3H1JH 3GWOA 2WWWA 1OCZB 4JYYA 4YHHB 3OEHG 2UXDO 3FFQA 4MW3A 3AG3C 1SERA 3RBZA 4DR5O 1QR8A 3B4SA 1ZWIC 1WAZA 3X2QC 2JEXA 4U7NA 2RJZA 3BAAA 2YIAA 1KYOF 3K9AA 1P49A 2ZT9B 4ZOLA 4IIJB 4TT3G 3FB8C 3T1HB 2DWDC 4JI4O 2NN4A 4D7SA 3IFXA 4NTXA 1YI2V 3T4DA 2D2CB 1Q82W 3IC9A 4JZGA 4BIOA 3P30A 1FFTB 5KMGB 1MA1A 3ZRXA 3ZHSA 2UXCO 1XUQA 3RYHB 4DV3O 1WPBA 1NH2D 4NXMO 1DK1A 3ZHQA 5LP6C 2JEUA 3SJBC 3N2KB 3AG3B 4P9PA 4DR2B 2WLNA 1G8MA 3FB5C 1ZSPA 4IYIA 2M6YA 4MVQA 1YJNV 1IBKB 3OMNB 1P4RA 2LQTA 3DXRB 4U7OA 2EBOA 5LXTB 2DN9A 4DR1O 5H6QA 2EX3A 4I5SA 3JASA 2ZE5A 1RP3B 4JAUA 4JPRA 2XAGA 1FJGB 2KSDA 1FFXA 4JI5B 1QHTA 1KKCA 1HP8A 4I55B 3BA8A 4I7ZB 2BCCH 3UKMA 4YY3O 5IWAB 5B1BC 1GK9A 3MHSC 4LFCB 2UXNA 2ZR2A 3K0GA 1N8RW 4TV9B 2KG7B 4H33A 2NNUA 5LGNA 4JI6O 5LP6B 5HFLA 1OCOC 1N33B 3A0HZ 4O4HB 3EFFK 2Q68A 3JALA 1AB3A 3ETQA 2VQFB 1Q5OA 4J7KA 2QTOA 1VP7A 1H2KA 4I0XB 5LYJB 1XMOB 2F43G 1FXKA 2Q4PA 2A79B 4WFFA 1XOUA 4O4IB 3HR0A 5EIBD 4JI1O 5FNVB 3ABMC 3OMAB 4RUEA 2YICA 1Q3EA 3QTCA 4KL1A 2OTLV 2CGOA 4DR3B 3A8TA 2DWEC 3A0BZ 3B8NA 3K03A 3SPHA 1VQMV 4OGQB 5EYPB 4PJ0Z 4TWKA 1YVWA 1LNQA 4LF4O 1XMQB 4PA4A 1KU9A 2FTKA 5CBGA 4NTYA 2HEPA 2ILMA 4X9QA 1E1QG 4B08A 1G4YB 4XDJA 5IJ9B 1YDXA 2V1DA 4G27B 4LF6B 1JVMA 1OCOB 4LFAO 2XAHA 3CMEV 5K1XA 4JI3O 1K3EA 4LWSA 5FL7G 5JJJB 4HZ3A 1S5HC 2CE4A 2HHHB 3CS5A 2HJFC 1K5QA 3B77A 3ZHTA 2ZNJA 2HJDA 3QNEA 4MTOA 4NYKA 3ABMB 1N0NA 2JJ2G 4UCOA 1S5LZ 4H44B 1SS3A 5B1AC 1TVKB 4J41A 4GT1A 2YI9A 4TSFG 3T1YB 3R65A 5BMVB 4JI2O 2RNBA 5DECA 4U3JB 3DC5A 2WPDG 4DV7B 4W4KA 2V4DA 3OGIB 4LH6A 4BAYA 5JQGB 4O2AA 3E8BA 1M93A 2DYRB 2CTQA 1FPOA 4XDLA 1YF2A 1TUBA 5CBHA 4P30A 1L0NH 2OCCB 3HKCB 4DR4O 2GSMB 3E8GA 1PNLA 2CGNA 3BVOA 4O4JA 2YIDA 1ZX3A 2ZIOA 1EBOA 4J7JA 4MVSA 3E8HA 3RFRA 3I56V 3SJAC 3CRAA 2Q67A 2K9PA 5EZYA 5J2UB 4X1IB 1GM8A 1NTZH 2JGUA 4X88A 5F2VO 3UO3A 3H9VA 4ASUG 3F5WC 2ATKC 2ZM6O 4B3MO 1TAEA 1P84F 3AG1B 2OIGA 1XNQB 2A06H 5B1AB 5IY5C 1H38A 2WA4A 3ABKC 4GKJO 4CH3A 4RUFA 1ZL8B 1FXVA 2LW7A 2AGAA 3JD3A 1WA8A 2QKAA 2EIJC 3BA9A 3ABTA 1GN3A 3E22B 4ZOLB 3SDLA 2WLJA 2PGGA 2DYSC 3JARA 2ZINA 3H1LH 4ICGA 4G2KA 1IX9A 5C93A 4JTAB 3SJCC 5CB4A 1PNKA 5E1AC 2LGWA 4IHJB 1ZAUA 1K8AW 3STLC 1XILA 1JOYA 1I5XA 1HDJA 1SZTA 5IY5B 4OX9B 4YHHO 4JI8B 2XTAA 1AR1B 1URFA 2FB5A 3CE2A 4FJCC 3W7SA 2P90A 2AXTZ 3KZIZ 4YJ2B 5KLVH 4X89A 2EIJB 3ML0A 1SQFA 1Q8IA 2IJKA 4HNAB 2DYSB 3CCVV 2X0LA 4DXWA 1OV9A 1I5YA 3T1HO 3W7TA 2IW5A 1VQ9V 1O9GA 3B2EE 3K5LA 4I50A 2OTJV 1R3IC 2GDSA 2ADPA 2HVKC 1ZTEA 1GN2A 4X65B 2HKOA 1ROPA 3AK1A 4KHPB 1SESA 3VBBA 4PD4F 1WN7A 4X1YA 1GMGA 1TGOA 2IJHA 1DF4A 2DQ3A 1NTKH 2JGDA 3D8CA 5LMUB 3APQA 2V7QG 2E5LB 1FXHA 1THZA 4DR2O 1FXKB 5IJ0A 1DGSA 1IBKO 4B3SB 1OCCC 2X7RB 4GYCB 1QR9A 4CH6A 4WFEA 4UCTA 1Q6UA 5JWPA 4O4LA 1H8EG 1FJGO 4JI5O 1I08A 5JJNB 1MMMA 5IYZA 4FLTA 3K58A 3JSNA 3R66A 1SF9A 1BZKA 1CXZB 5KHGA 4D7TA 5IWAO 3LUTB 2ZXWB 1XL6A 3AK3A 4UV9A 4LFCO 3RVYA 1K33A 1HWYA 1ZUQA 2HP8A 1SRYA 4R6ZA 4PA7A 2XAQA 2W6JG 5DM6V 1N33O 4FM1A 5JCOC 2RMKB 1YHQV 2VQFO 1NJIW 2QM8A 4K0KB 1VQKV 4FM2A 1NBMG 1H2SB 3O65A 4YJ3B 1XMOO 5BZBA 4I4TA 1D5AA 3CCEV 1NKDA 3OE7G 2EZPA 4LF8B 3T2MA 4DR3O 3CD6V 4O2AB 3S3XA 3K5NA 1VQ7V 4L87A 5JH7A 1XMQO 2CH7A 4WFHA 1KKDA 4DK1A 1MZEA 2ITCC 2W0FC 1PV0A 4JGSA 4O4JB 1XHZA 3OT7A 1OCRC 1WNSA 1AI4A 3BABA 4X64B 5EZYB 2XAFA 4LF6O 4JI0B 3ETDA 1WP8A 4FFBA 3D36C 1S3JA 2F23A 1EFRG 1K4CC 3JYCA 2IBZH 2QKSA 1M4UA 2NR5A 4X20A 3VQVA 5KUKA 1SC5B 3C90A 2HHHO 4FM0A 3MAQA 4A5UB 1M56B 4J11A 4JF3A 5E79Z 4ZHQA 4NXNB 3IGAC 1F7YA 5IYDO 1KBHA 3RYCA 3U10A 1VEWA 3OTFA 5L3DA 4DV1B 4JTDB 2FKXA 5GW7A 1K92A 4DV7O 1K34A 1GN4A 3SYAA 2E76B 2Q5ZA 3GWKC 1OZ0A 3K9SA 3ASNB 1K7DA 1R73A 3L9DA 2YEVA 1OCRB 1EN4A 4OPHA 5KHJA 4PA6A 2O57A 3RVZA 1QLEB 3SYCA 2N05A 5CBFA 1K97A 2R70A 2ZE6A 3APOA 1J95A 1R1BA 4FZ1A 4MS2A 1Z5WA 5BR8B 2PTMA 4RQFA 2Z0AA 1S72V 2EULA 3L75H 5DN6G 1BMFG 5L3BA 1XNQO 3E89A 4J9YB 1W2BU 2Q0OC 5EIBC 1XI1A 4UB6Z 3JAKA 4N21A 3JD2A 1L1FA 4FLWA 2Y0IA 2JS5A 1GN6A 3UQ8A 2UUCB 5D5QA 1SQPH 1AJNA 3E86A 3G6EV 5GTHZ 2JRIA 3G67A 3B8MA 4DRXA 1Y74A 2CK3G 2ZCEA 2EJ7A 1AILA 2HLDG 3OR6C 4NKGB 3ZRSA 1YXBA 2ZKOA 2P7TC 4X1YB 5JJEB 5B66Z 3L73H 2JDIG 2Q7GA 3P32A 5JVDA 1CEZA 2L35A 4QGPA 1Y66A 2RN9A 4CC5A 3CJHB 5EC1C 2KQXA 3G80A 1KC8W 3E35A 1IDSA 5LOVB 2Q69A 3N27A 2ZDIC 3H01A 3CRCA 4OX9O 4JI8O 5J9PC 1H2MA 2CAZC 1AI6A 2YXHA 1NVPB 3T1CA 3CCQV 4FLZA 5FPOA 2QWNB 3C3SA 4O4LB 3CRMA 1VQOV 1WB8A 3HKDA 4QIWF 1YZBA 2CTWA 3OTOB 4KFMA 4E4EA 5IYZB 3LNMB 4GX0A 4GKKB 3JCZA 3B09A 4MVMA 2UXXA 3FB7C 2EJRA 4DV0B 3ZMVA 1VIBA 2XT9A 2XOKG 3CX5F 4X65O 3OFNG 3G71V 4FLYA 4KHPO 4G28B 4PV1B 4DR6B 2B1GA 5LMUO 5D5PA 4DUZB 2HR3A 4B7EA 1FD9A 2E5LO 1V55C 1HNWB 2RDCA 1AP5A 2YSUB 2Q7EA 4K35A 3TK1A 3TXSA 4AI8A 5B5EZ 4MVOA 3EXAA 3ZMUA 3W7XA 4B3SO 4Q20A 1OHHG 1AJQA 1VQLV 1K73W 3S3WA 3LDDA 2FL4A 2OCHA 3FAVA 1BT8A 1XBLA 3ZX6A 4LC1A 2E74B 2IU0A 1KQSU 4GZRB 2N04A 1AI7A 2IH3C 3ABLC 1IZ3A 4FMTA 1NVPD 3N2GA 1T5EA 1VF7A 3Q4HA 4K3AA 2Q6AA 3TGUH 3OMIB 3ZHRA 1XNRB 4K8XA 4FFBB 3QO7A 1YITV 2DYRC 4JYCA 4LR3A 1V55B 3E2EA 4GUNA 2GUZA 4UFZA 2OWOA 2OCCC 1K9MW 2D3OW 2DE0X 4ZHQB 4K0KO 4IL6Z 5CA1A 1UPGA 3HB3B 2B9ZA 1JFFB 3ZRWA 2H8PC 1Q90D 4CC6A 4JYAB 3A0RA 4PDMA 1IXBA 2UXBB 5J2TB 3ZMZA 4LF8O 3UT5A 3SYQA 3RYFA 2CTRA 4JI7B 4TV8A 3AG1C 4ZIBA 2BTQA 1IXMA 1S0VA 5BXZA 1M90W 3ABLB 4JZ2A 2YEVB 3CP1A 4QPJA 3SJQC 3ZEDA 3LSSA 1FAFA 1R3JC 4J10A 3L70H 2EILB 2B5UA 3MDSA 4ZBMA 2GHYA 3QO5A 1LUVA 2KKWA 5ITZA 4X64O 2UU9B 1B6QA 3BY6A 3KKYA 5EBMC 4JI0O 4QPKA 2KB1A 4GLXA 5KHKA 1N0JA 2UUAB 3ZN1A 5KHIA 2QKCA 3T4ZA 1SKVA 4NXNO 1VQ5V 4FZ0A 1TA8A 3AG4C 4LNUB 3OUSA 2PY5A 3JAKB 1R6TA 1IBLB 1IURA 4UVBA 4JAAA 1LR1A 3BFRA 4DV1O 2ZQMA 5EK0A 4UV8A 2H3OA 4GCZA 2QR4A 3OR7C 1BHBA 2LGQA 2WLIA 3G4SV 2X6AA 1E79G 4RAIA 4QNHB 2ZD9A 3H1IH 1VF6A 3GVMA 4BWAA 5LA6A 1VARA 4DK0A 2F4VB 4NTWA 1I7FA 1BSMA 5H9CA 3SGIA 3EHBB 1YIJV 3JCUZ 4FLVA 1V54C 1DF5A 1FKAO 3CYOA 3GB7C 3I5DA 2CUGA 2BSKA 2QTSA 4EKWA 5BR8O 2LP7A 1RPOA 2ADQB 1I94B 1H8HG 3AG4B 4PA3A 4QE7A 3U11A 1SQBH 2BTOA 4X1KA 2Q8VA 4UUJC 4ABMA 1QCEA 4F4LA 4OPAA 4I9QA 3OEEG 4MW8A 5B1NA 1P7GA 3HKDB 4AILC 2QM4A 4UB8Z 2UUCO 3JATA 4WFGA 5KUMA 1FXKC 4J7ZA 3HKEA 3J81N 2DJVA 1NS1A 1AI5A 3JASB 4Z1VA 3KG2A 1VQ8V 2XHBA 1FFXB 2QWQB 1V54B 2NLJC 3ZS8C 4X62B 2OT5A 5CA0A 2R9IA 1BCCH 2RQ6A 3W7UA 2P6JA 1J5EB 4J80A 1VQPV 2IU3A 1Q7YW 5H2FZ 2YXYA 2ZE7A 5DEDA 4JTCB 5LHIA 4CH5A 2ZXWC 3ZN0A 1DLBA 4X66B 1HR0B 3O9OA 1R3KC 1JA8A 3B40A 3JALB 3OM3B 1SA0A 4CZZA 4B3RB 1PP9H 2WLMA 1JPXA 3OTOO 2W6IG 4H37A 4F6EA 2ZR3A 4GKKO 4NB5A 4YY3B 1Q6HA 4WFAV 4LCUC 1AVMA 4WBNA 3MD0A 2P4KA 4DV0O 1IVSA 3Q4HB 3ZIAG 3P3NA 5KMGA 1ORQC 3K5MA 3ABUA 2PF4E 1WLEA 1B06A 1EN6A 1GRJA 3RYHA 4DR6O 3K0DA 3RT3C 4GX1A 3H1KH 3M99B 4DUZO 1PM9A 1HNWO 3ZMSA 4DW0A 4UCUA 5IE9A 4EFEA 3FKSG 1MSDA 4LWSB 4B7KA 3SYPA 2QWPB 1YJWV 5LXTA 1X59A 2PUSA 3UT5B 5KX5A 2EIMC 5HFMA 4B3TB 2WLLA 2VWJA 4L8JA 2PI5A 4ZI7A 1GTOA 3WB2A 1BQZA 5KA6A 1D2DA 1M56C 4CH4A 4I55A 2UUBB 1SZXA 3ZRVA 4WFBV 2AZ0A 1AROP 2AZ2A 5IDJA 1Y76A 3E83A 2FYUH 5ITZB 3ASOC 3K59A 1Y4MA 4TV9A 1M57B 2KG7A 1TUBB 1XNRO 1XL4A 2X6CA 5L3CA 3SPGA 5LP6A 4F6RA 1UJWB 1AJPA 3ASNC 1US6A 1Q43A 3CEIA 3LDCA 4LH7A 2VQEB 3BRCA 1Q86W 5LYJA 2XAJA 1QLEC 1LUWA 2QWOB 3ZJZA 1SQXH 2EIMB 3WU2Z 4Z2WA 4JYAO 3MHHC 3CC2V 2ZE8A 2UXBO 2RCVA 3AK2A 3J7AU 5LGTA 3P3PA 4DV4B 5K1PA 4JI7O 1Q6IA 2WLIB 1TUEB 2P22C 1MZFA 4XBFA 3CRRA 4W4LA 5CN0A 2IJIA 1AR4A 4CS2A 4MTGA 5LA6B 3T1YO 2QM7A 4DW1A 2LFSA 3ASOB 1WA8B 3KCYA 4JYBA 1FS0G 3VQXA 1JX9A 5A9GA 1COWG 1DTOA 2UU9O 3JARB 1AR5A 2P67A 4DV2B 2YXLA 3L74H 4TUYA 2HG5C 1N4CA 5CB4B 2UUAO 1KP2A 4TQFA 4KP4A 4D6TH 2Q0AA 2DW4A 5L3GA 3CRQA 3DC6A 2R9AA 3M8AA 3JAMN 3UCSC 1IBLO 1TVKA 2YDEA 2A9HA 1VQ4V 5A2QN 2EIKB 3ZHUA 4DV6B 3DSQA 5JQGA 4JV5B 1EN5A 4JASA 1O9HA 1YCIA 4BIUA 3ZCCA 4UCVA 2F4VO 2AHZA 1QNMA 1N34B 4BR6A 4FLXA 4MVUA 1NTMH 4I50B 4CS3A 2Y48A 1X4TA 2LJ2A 4DYLA 1FYJA 4O2BA 2F66C 2ETNA 1PL4A 2ZIMA 4PHZA 1I94O 2WLHA 4K8ZA 3IC7A 3CCMV 3SYOA 1XDCA 2JGDB 3RN4A 4LP8A 4R8CA 1SA0B 4BW9A 2X6BA 1PNMA 1ZL8A 1QVFU 3BPZA 4BW5A 3L72H 5IJ0B 1RPRA 3E22A 3WG7B 1XREA 2LW1A 1R6KA 4DR7B 1B3QA 4PDLA 2PI4A 1VMGA 3CCRV 4WBNB 3K3WA 1S5JA 2MW2B 5C8YA 3RYIA 1IBMB 3SPCA 2B1IA 3SPIA 4IHJA 1KECA 4X62O 3WFVA 1CPYA 1MSWD 5BY1A 1JR9A 1N36B 3ZMTA 1J5EO 1JQ0A 1SETA 5LHGA 1QVGU 1HNZB 2YS8A 2ZNIA 3RGBA 1MNGA 4LFBB 4X66O 4R50A 3X2QB 1HR0O 1BHAA 4MTXA 4YJ2A 3THOA 4B3RO 5KX5B 2WLLB 3QG5A 1YTFD 3QVNA 3A2FA 2ODMA 1G6UA 1H2NA 4HNAA 4ZI7B 4DUYB 2PYJA 1V9PA 1L8DA 4I4TB 2Z3YA 4J42A 3HKBA 2ITDC 5FLXN 1MOFA 3VOUA 2QSAA 4DV5B 1SQVH 5CA3A 1Y76B 3AEIA 3DGEA 3I55V 4IT5A 4GX5A 4Q6GA 5JH7B 2CH7B 5FPRA 1JJOA 1KD1W 1L0LH 3DTUB 2XUMA 4F6RB 1NT2B 4WCEV 5B3SC 3PJSK 2A0LA 3LNNA 2E75B 4CS4A 1MG1A 5H6RA 5CMUA 2E3CA 1NR7A 2JK5C 4FPPA 1PPJH 2EILC 2DQ0A 2R72A 1GO3F 1GM7A 4UCSA 3FB6C 4XDKA 2QDOA 2BE3A 3VQYA 4FLUA 5TISZ 2G38A 4X20B 3RW0A 4FVMA 2MK3A 2YIBA 1RFYA 2JIZG 1Y67A 4H0LB 3FX7A 4B3TO 2OIEA 4YXWG 4EB6A 4BIZA 3D3IA 1R6NA 1VQ6V 3RYCB 2UUBO 4LF9B 2CTPA 5B1BB 4WF9V 3LSUA 4LF5B 1XQ8A 1B04A 1JCHA 1SQGA 1UFIA 3JD4A 1WPXA 1XHXA 2EINC 4QE9A 2JVDA 3CWBH 2WSSG 2P4VA 5B3SB 2N74A 1S77D 5GONA 4TUYB 1PD3A 1YEWA 3ETGA 5KAIZ 2PYLA 3QF7A 1BS3A 2VQEO 2JJ1G 1I0HA 1CP9A 1QQCA 1NI8A 4YJ3A 3OW2U 1P7BA 4FK5C 3CSXA 1H2GA 4TOIA 1ENVA 5EC2C 1GAXA 1F4NA 2IJJA 3TJTA 4IGGA 4DV4O 1W0KG 3NR7A 3L71H 2GTSA 5LGUA 4LF7B 1BL8A 3CB2A 5LL6Y 2Y4UA 1HNXB 3CPWU 2EINB 1GKFA 3JD1A 1YSCA 1BE3H 3K79A 2HVJC 3J80N 3WB0A 4E2LA 3F7YC 3OD4A 1Q81W 1N32B 1VF5B 4C7UA 1EZJA 1WJZA 2YI8A 2Q73A 4DRXB 5JCOA 1QU7A 1Y74B 4O2BB 4AQYB 3ZBHA 4DV2O 2CDYA 2QGNA 5KAFZ 2GTAA 3K06A 4FFKA 1M1KW 3CXHF 4I9WA 5JVDB 2Q7HA 4AHCA 3BCCH 3OAAG
chains in the Genus database with same CATH topology
1OCOC 3NXSA 1S72V 3EFFK 2Q68A 1MABG 5DN6G 1BMFG 2XASA 5L3BA 3FKSG 3E89A 2QTOA 4J9YB 3SYPA 1W2BU 1YJWV 5IYCO 2F43G 1FXKA 3LSQA 5KA5A 2A79B 4N21A 4WFFA 2EZOA 2EIMC 3ETEA 3JD2A 1L1FA 5HFMA 2WLLA 3ABMC 3OMAB 4RUEA 2OTLV 2PI5A 1VQNV 1GTOA 2DWEC 5KA6A 1M56C 3B8NA 3K03A 3SPHA 1VQMV 1AJNA 3E86A 3G6EV 3ZRVA 4WFBV 4TWKA 2R9RB 1LNQA 3F7VC 3B8MA 4PA4A 1AROP 5IDJA 2FTKA 5CBGA 5IYBO 2CK3G 3E83A 1E1QG 3ASOC 3D36A 2HLDG 1F23A 3OR6C 1Y4MA 4MVRA 1M57B 3ZRSA 1G4YB 4XDJA 2P7TC 1XL4A 2X6CA 3UM7A 5L3CA 3P32A 2JDIG 3SPGA 1F51A 3TETA 1CEZA 2V1DA 4G27B 4P9OA 4ZKIA 1UJWB 1AJPA 1JVMA 1OCOB 3ASNC 2XAHA 1Y66A 3CMEV 3LDCA 3ABKB 5EC1C 4MVZA 1K3EA 1KC8W 3E35A 1Q86W 2Q69A 5FL7G 4HZ3A 2ZDIC 1S5HC 2XAJA 3H01A 4RQEA 4DO2A 5J9PC 1QLEC 2HJFC 2WLKA 3ZJZA 1K5QA 3B77A 2EIMB 4UVCA 3QNEA 4MTOA 1AI6A 4J9ZB 1NVPB 3ABMB 3T1CA 2JJ2G 3MHHC 3CCQV 3CC2V 1K4DC 4LBEC 1R3LC 3CCSV 5B1AC 2QEXV 5LGTA 4GT1A 4TSFG 3R65A 1VQOV 4R7CA 2WLIB 1TUEB 4QIWF 1QLNA 4XBFA 2WPDG 4KFMA 5CN0A 4MTFA 4BAYA 3CC4V 2IJIA 3CCLV 3E8BA 3LNMB 3LDEA 1W0JG 4GX0A 2DYRB 4MTGA 2QM7A 4OXSA 4Z1MG 2QE7G 3JCZA 2LFSA 3ASOB 3OGCC 4GX2A 4MVMA 4XDLA 4JYBA 1FS0G 2UXXA 5CBHA 3FB7C 2EJRA 1JX9A 4P30A 1KP3A 2OCCB 5LBQA 3ZMVA 2GSMB 3E8GA 4X8AA 1PNLA 1COWG 1DTOA 2XOKG 5B1OA 1EBOA 3OFNG 3G71V 4MVSA 3E8HA 2P67A 3I56V 1NR1A 4G28B 2Q67A 4N23A 1K5SA 2HG5C 2B1GA 1GM8A 4X88A 1QBZA 2M7WA 1KP2A 4PA9A 2IH1C 4ASUG 3F5WC 2HR3A 3CXCU 2ATKC 1V55C 4KP4A 1M57C 1RM1C 2YSUB 4HAMA 3AG1B 3AG2C 3TK1A 2DW4A 5L3GA 3E8FA 4MVOA 3ZMUA 5B1AB 5IY5C 1JJ2U 3W7XA 1H38A 2A9HA 4Q20A 1VQ4V 1OHHG 3ABKC 4P2ZA 3ZRWB 1AJQA 2EIKB 2LFRA 4RUFA 1VQLV 1K73W 1S76D 2XNDG 3LDDA 5LHHA 1PL0A 1FXVA 3CC7V 2WAMA 1PKXA 3JD3A 2EIJC 4PDVA 3ABTA 4JASA 2WLJA 4LC1A 2IU0A 1KQSU 4BIUA 2AHYA 3ZCCA 1AI7A 3SPJA 3K04A 2DYSC 2AHZA 2IH3C 3ABLC 4G2KA 4FMTA 4HYOA 1NVPD 5C93A 5EBWC 1E1RG 4JTAB 2Q6AA 4MVUA 3OMIB 2ZDIA 1YJ9V 1PNKA 2Y48A 5E1AC 3QO7A 1YITV 1K8AW 2DYRC 3STLC 4JYCA 1V55B 3E2EA 4MT8A 1RM1B 1OCCB 2WLHA 3IC7A 1JOYA 2OCCC 1F4MA 1K9MW 3AG2B 2D3OW 1I5XA 3CCMV 3SYOA 1SZTA 2QA4V 4LP8A 5IY5B 4R8CA 3HB3B 2X6BA 3ZRWA 2H8PC 1AR1B 1PNMA 2C2AA 3JD0A 1QVFU 3W7WA 4FJCC 4BW5A 3W7SA 3A0RA 2P90A 4PDMA 4PELA 4X89A 1RPRA 2EIJB 3ML0A 3WG7B 3ZMZA 3SYQA 2Y69C 2HFEC 2IJKA 3AG1C 1R6KA 1IXMA 1S0VA 4PDLA 1M90W 2PI4A 2DYSB 3CCVV 3ABLB 2X0LA 4JAVA 4DXWA 3CCRV 3K3WA 1I5YA 2YEVB 3CP1A 4QPJA 3SJQC 3LSSA 3W7TA 2H94A 1R3JC 2EIKC 2IW5A 3BEHA 1VQ9V 2EILB 2OTJV 3SPCA 2B5UA 2B1IA 1R3IC 4ZBMA 3SPIA 2GHYA 2HVKC 3QO5A 1KECA 2Z5UA 1B6QA 3BY6A 3WFVA 1CPYA 3CCUV 1MSWD 2HKOA 1ROPA 5EBMC 1GM9A 4QPKA 4QJFB 1SESA 3ZMTA 3VBBA 1GMGA 2IJHA 2KB1A 1DF4A 1JQ0A 2DQ3A 1SETA 5LHGA 4MSWC 1QVGU 2K1EA 3ZN1A 2V7QG 4FIPC 1FXHA 3T4ZA 1NQTA 3CCJV 3HPLC 1THZA 4R50A 3X2QB 1VQ5V 1BHAA 3AG4C 4MTXA 4UXNA 1FXKB 4UVAA 3OUSA 1OCZC 2WLLB 4UVBA 1YTFD 2BOCC 3STZC 2Y69B 1OCCC 2X7RB 2ZQMA 5EK0A 4UV8A 1QR9A 4GCZA 3QO8A 4WFEA 2Z3YA 3OR7C 1BHBA 2ITDC 1MOFA 2WLIA 1H8EG 2X6AA 3VOUA 3G4SV 1E79G 4PDRA 4RAIA 5CA3A 4QNHB 3K08A 2ZD9A 2BOBC 1NH2B 3FYEB 3AEIA 3DGEA 3I55V 3CMAV 4GX5A 3TCUA 3WG7C 3OUFA 5H9CA 3LUTB 1KD1W 2ZXWB 3DTUB 4RQFA 1XL6A 4UV9A 3EHBB 1M9NA 4WCEV 5B3SC 1YIJV 3PJSK 2A0LA 5L3FA 3RVYA 1K33A 1HWYA 1MG1A 1V54C 1DF5A 4RO2A 3CYOA 3GB7C 5H6RA 5CMUA 3FYIB 1SRYA 5L3EA 1NR7A 4EKWA 2LP7A 4R6ZA 2JK5C 1RPOA 4PA7A 4FPPA 5EBLC 2XAQA 2W6JG 2EILC 5DM6V 4KUMA 2DQ0A 1YTFB 1H8HG 1GO3F 3AG4B 1GM7A 4PA3A 4QE7A 1YHQV 4CBCA 1NJIW 2QM8A 3GWOA 3FB6C 4XDKA 2WWWA 1OCZB 1VQKV 1NBMG 4UUJC 3RW0A 2MK3A 3OEHG 1QCEA 4MW3A 4F4LA 2JIZG 5BZBA 3AG3C 1SERA 3RBZA 3OEEG 4MW8A 4YXWG 5B1NA 1NKDA 3OE7G 3CCEV 1QR8A 2EZPA 4BIZA 3D3IA 1R6NA 1VQ6V 1ZWIC 3T2MA 3X2QC 3CD6V 2JEXA 4WFGA 4U7NA 5B1BB 5KUMA 1FXKC 4WF9V 3K9AA 1VQ7V 4L87A 1AI5A 1JCHA 4TT3G 4WFHA 1KKDA 3FB8C 3KG2A 2ITCC 2DWDC 1WPXA 2W0FC 2EINC 3JD4A 4QE9A 4JGSA 1VQ8V 2WSSG 5B3SB 1S77D 3IFXA 1YI2V 3T4DA 1Q82W 1V54B 1OCRC 1AI4A 2NLJC 3P30A 2XAFA 2OT5A 1PD3A 1FFTB 2R9IA 3ETDA 3ZRXA 3W7UA 3ETGA 2P6JA 1VQPV 2IU3A 1Q7YW 1S3JA 1EFRG 2JJ1G 1K4CC 3JYCA 4JTCB 1CP9A 2QKSA 5LHIA 5KUKA 1NH2D 2ZXWC 3OW2U 1P7BA 2JEUA 3ZN0A 4FK5C 3AG3B 1DLBA 1M56B 4JF3A 1H2GA 4P9PA 3IGAC 1R3KC 2WLNA 5IYDO 3OM3B 1G8MA 3FB5C 1ENVA 5EC2C 4MVQA 4CZZA 1F4NA 1YJNV 2IJJA 2WLMA 1JPXA 1P4RA 3OMNB 4U7OA 5L3DA 2EBOA 4JTDB 5GW7A 1W0KG 5H6QA 1K92A 1K34A 4I5SA 3SYAA 2W6IG 5LGUA 1BL8A 4H37A 4JAUA 4JPRA 3CPWU 2XAGA 1OZ0A 2ZR3A 2EINB 1GKFA 3JD1A 1YSCA 4WFAV 3ASNB 3K79A 4LCUC 2HVJC 3MD0A 1K7DA 1R73A 4E2LA 3F7YC 2YEVA 1Q81W 1OCRB 3UKMA 3ZIAG 4PA6A 1EZJA 3RVZA 1ORQC 3ABUA 5B1BC 1GK9A 1QLEB 1WLEA 3MHSC 2UXNA 2ZR2A 3K0GA 3SYCA 3K0DA 1N8RW 5CBFA 1K97A 4GX1A 4H33A 3K06A 2NNUA 1J95A 5LGNA 1M1KW 3M99B 4I9WA 4MS2A 3OAAG 3ZMSA 5HFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  3RBZ A;  4MW8 A;  4DXW A;  4MVS A;  3E8H A;  3EFF K;  2Q68 A;  4G28 B;  3SJQ C;  2Q67 A;  1R3J C;  2EIK C;  3E89 A;  3BEH A;  1ZWI C;  2QTO A;  4J9Y B;  3SYP A;  2HG5 C;  3T2M A;  3X2Q C;  3SPC A;  4X88 A;  4WFG A;  1R3I C;  4PA9 A;  2IH1 C;  4ZBM A;  5KUM A;  3F5W C;  3SPI A;  2ATK C;  2HVK C;  1V55 C;  2A79 B;  4WFF A;  2EIM C;  1M57 C;  5EBM C;  2WLL A;  4WFH A;  3ABM C;  3FB8 C;  3KG2 A;  1KKD A;  2ITC C;  2DWD C;  2W0F C;  3AG2 C;  2EIN C;  4QE9 A;  2KB1 A;  4RUE A;  3E8F A;  4MVO A;  2DWE C;  3IFX A;  4MSW C;  1M56 C;  3K03 A;  3SPH A;  2K1E A;  3T4D A;  5IY5 C;  2A9H A;  3E86 A;  1OCR C;  4TWK A;  3ABK C;  2R9R B;  4P2Z A;  3T4Z A;  1LNQ A;  2NLJ C;  4RUF A;  3F7V C;  3HPL C;  4PA4 A;  3LDD A;  4R50 A;  5CBG A;  3AG4 C;  3E83 A;  3OUS A;  3ASO C;  2EIJ C;  3OR6 C;  4PDV A;  4MVR A;  1K4C C;  2WLL B;  1OCZ C;  3JYC A;  2QKS A;  1G4Y B;  2BOC C;  4JTC B;  2WLJ A;  3STZ C;  3ZRS A;  1OCC C;  5KUK A;  4XDJ A;  5EK0 A;  2P7T C;  2ZXW C;  1XL4 A;  2X6C A;  1P7B A;  2AHY A;  3UM7 A;  3SPG A;  3SPJ A;  3TET A;  3K04 A;  2DYS C;  2AHZ A;  4G27 B;  4P9O A;  2IH3 C;  3ABL C;  4WFE A;  1JVM A;  3ASN C;  3OR7 C;  4P9P A;  3IGA C;  1R3K C;  2ITD C;  2WLN A;  4HYO A;  3LDC A;  5EC1 C;  2WLI A;  3FB5 C;  2X6A A;  4MVZ A;  5EC2 C;  3VOU A;  4MVQ A;  4PDR A;  4RAI A;  5EBW C;  4QNH B;  4JTA B;  3K08 A;  2Q69 A;  2Q6A A;  2ZD9 A;  2BOB C;  4HZ3 A;  4MVU A;  2WLM A;  1S5H C;  5E1A C;  4JTD B;  5J9P C;  1QLE C;  2DYR C;  2HJF C;  2WLK A;  4GX5 A;  3STL C;  3ZJZ A;  3TCU A;  3WG7 C;  3SYA A;  3OUF A;  1BL8 A;  3LUT B;  4H37 A;  2WLH A;  4MTO A;  4J9Z B;  2OCC C;  1XL6 A;  3T1C A;  1K4D C;  4LBE C;  1R3L C;  3SYO A;  5B3S C;  3PJS K;  2A0L A;  5B1A C;  3RVY A;  4LCU C;  4LP8 A;  1V54 C;  2HVJ C;  3R65 A;  4RO2 A;  3GB7 C;  4R8C A;  4R7C A;  2WLI B;  3F7Y C;  2YEV A;  2X6B A;  2H8P C;  3UKM A;  4EKW A;  4R6Z A;  2JK5 C;  4KFM A;  4PA7 A;  4PA6 A;  5EBL C;  4MTF A;  3RVZ A;  1ORQ C;  2EIL C;  4BW5 A;  4PDM A;  4PA3 A;  3E8B A;  3LNM B;  3LDE A;  4MTG A;  4GX0 A;  4OXS A;  4QE7 A;  5B1B C;  4CBC A;  4X89 A;  3OGC C;  3K0G A;  4GX2 A;  3SYC A;  3K0D A;  4MVM A;  4XDL A;  3FB6 C;  4XDK A;  5CBF A;  4GX1 A;  4H33 A;  3K06 A;  3SYQ A;  2Y69 C;  2HFE C;  5CBH A;  4UUJ C;  3FB7 C;  4P30 A;  3RW0 A;  1J95 A;  3AG1 C;  4I9W A;  3E8G A;  4MS2 A;  4MW3 A;  4X8A A;  4F4L A;  4PDL A;  5BZB A;  3AG3 C; 
#chains in the Genus database with same CATH topology
 3NXS A;  5LMN B;  1MAB G;  3JAW A;  2XAS A;  3G6B A;  3IAY A;  2P5O A;  1RSO A;  3M7M X;  5IYC O;  2UXD B;  3H1H H;  3LSQ A;  5KA5 A;  1H2L A;  2EZO A;  4DV6 O;  3ETE A;  4DR5 B;  3C3T A;  4JV5 O;  1VQN V;  3K57 A;  4NVP A;  2R9R B;  2YC0 A;  3RYI B;  5C8Y B;  3F7V C;  2GBO A;  5IYB O;  3UO2 A;  3F5T A;  4JI4 B;  3D36 A;  1F23 A;  1N34 O;  4MVR A;  3UM7 A;  1F51 A;  3TET A;  4P9O A;  4ZKI A;  2F1M A;  3K5O A;  1KUQ A;  2UXC B;  3ABK B;  4MVZ A;  3IJ4 A;  1SQQ H;  4DV3 B;  4NXM B;  4RQE A;  4DO2 A;  4PI0 A;  2WLK A;  4YIO A;  4UVC A;  4J9Z B;  1K4D C;  4LBE C;  1R3L C;  3CCS V;  2QEX V;  2PZS A;  3HKB B;  4R7C A;  4DR7 O;  4DR1 B;  1QLN A;  4MTF A;  3CC4 V;  3CCL V;  2FML A;  3LDE A;  1W0J G;  4Z1M G;  4OXS A;  2QE7 G;  3FAV B;  3OGC C;  1EZV H;  1G1X B;  4GX2 A;  5AG2 A;  1IBM O;  4IIJ A;  1KP3 A;  5LBQ A;  4X8A A;  4UCR A;  5B1O A;  1XEQ A;  1KB9 F;  4NR1 A;  2A7W A;  5IT9 N;  1U96 A;  1N36 O;  2VRZ A;  3CJH A;  2VWK A;  1NR1 A;  5KHH A;  3N2G B;  5LOV A;  4N23 A;  1K5S A;  3SR2 C;  3KCX A;  1BGY H;  1Z5V A;  1HNZ O;  1QBZ A;  2M7W A;  1HW7 A;  2IH1 C;  4PA9 A;  4JI6 B;  3CXC U;  1Y6X A;  4LFB O;  1M57 C;  1RM1 C;  4HAM A;  2GUZ B;  3AG2 C;  3CHX A;  3N2K A;  1W59 A;  3E8F A;  4H13 B;  2P06 A;  1JJ2 U;  4EB6 B;  5CA1 B;  2JS3 A;  1KMI Z;  4P2Z A;  3ZRW B;  4DUY O;  2LFR A;  2DMX A;  4HBN A;  1S76 D;  2XND G;  5LHH A;  4JI1 B;  1PL0 A;  3DXR A;  4YIP A;  4KXR A;  3CC7 V;  2QWR B;  2WAM A;  1PKX A;  4DV5 O;  4PDV A;  2A3Q A;  3RYF B;  4TV8 B;  2AHY A;  2BTQ B;  1OJH A;  3EVK A;  3SPJ A;  5H5N A;  3K04 A;  4LF4 B;  2F93 B;  1EM1 A;  2OYQ A;  5GON B;  4HYO A;  5EBW C;  1E1R G;  2VS0 A;  2ZDI A;  1VF6 C;  1Z2G A;  2ARH A;  1YJ9 V;  1WB7 A;  5GTI Z;  1JMK C;  4MT8 A;  3ZHV A;  4LFA B;  1RM1 B;  1OCC B;  1F4M A;  3AG2 B;  4JI3 B;  2IM9 A;  4IYH A;  1D5N A;  2AW9 A;  2L6L A;  2QA4 V;  4O4H A;  1NZ6 A;  2C2A A;  3JD0 A;  3VQW A;  3WB1 A;  3W7W A;  1ZLZ A;  4I0X A;  1NU1 H;  4PEL A;  4O4I A;  3U0Z A;  2Y69 C;  2HFE C;  5FNV A;  4JI2 B;  4LF9 O;  2Q9L A;  2Y0P A;  4RWU A;  4LF5 O;  1M5I A;  4JAV A;  1BQ0 A;  2YIB D;  5EYP A;  2H94 A;  2EIK C;  4EFB A;  3BEH A;  2QJ1 A;  4DR4 B;  2YUA A;  2Z5U A;  3CCU V;  3FD9 A;  1GM9 A;  1AP6 A;  4QJF B;  4U3F H;  5IJ9 A;  1A32 A;  4MSW C;  2K1E A;  3JAW B;  3JSL A;  1JFF A;  2BSK B;  4FIP C;  2ZM6 B;  4B3M B;  1NQT A;  3CCJ V;  1WP7 A;  3HPL C;  1RSO B;  2W0X A;  4UXN A;  4UVA A;  5J2T A;  1OCZ C;  4X1K B;  4EEQ A;  2BOC C;  3STZ C;  2Y69 B;  4GKJ B;  2Y4T A;  3QO8 A;  4LF7 O;  1U97 A;  1HNX O;  5BMV A;  4TQD A;  3ICX A;  4U3J A;  2LO1 A;  4PDR A;  3TXQ A;  3K08 A;  3JAT B;  2BOB C;  1GH6 A;  2GV9 A;  2WA3 A;  3FYE B;  1NH2 B;  3BHP A;  3D3Q A;  3CMA V;  1N32 O;  3RWR D;  3HKE B;  3TCU A;  3WG7 C;  3OUF A;  2DOS A;  4AQY O;  3HKC A;  1M9N A;  5L3F A;  2F95 B;  3PN1 A;  4RO2 A;  4PI2 A;  5L3E A;  3FYI B;  5J2U A;  5EBL C;  3AG7 A;  4X1I A;  5CA0 B;  4KUM A;  1YTF B;  5LMN O;  4LNU A;  4CBC A;  3H1J H;  3GWO A;  2WWW A;  1OCZ B;  4JYY A;  4YHH B;  3OEH G;  2UXD O;  3FFQ A;  4MW3 A;  3AG3 C;  1SER A;  3RBZ A;  4DR5 O;  1QR8 A;  3B4S A;  1ZWI C;  1WAZ A;  3X2Q C;  2JEX A;  4U7N A;  2RJZ A;  3BAA A;  2YIA A;  1KYO F;  3K9A A;  1P49 A;  2ZT9 B;  4ZOL A;  4IIJ B;  4TT3 G;  3FB8 C;  3T1H B;  2DWD C;  4JI4 O;  2NN4 A;  4D7S A;  3IFX A;  4NTX A;  1YI2 V;  3T4D A;  2D2C B;  1Q82 W;  3IC9 A;  4JZG A;  4BIO A;  3P30 A;  1FFT B;  5KMG B;  1MA1 A;  3ZRX A;  3ZHS A;  2UXC O;  1XUQ A;  3RYH B;  4DV3 O;  1WPB A;  1NH2 D;  4NXM O;  1DK1 A;  3ZHQ A;  5LP6 C;  2JEU A;  3SJB C;  3N2K B;  3AG3 B;  4P9P A;  4DR2 B;  2WLN A;  1G8M A;  3FB5 C;  1ZSP A;  4IYI A;  2M6Y A;  4MVQ A;  1YJN V;  1IBK B;  3OMN B;  1P4R A;  2LQT A;  3DXR B;  4U7O A;  2EBO A;  5LXT B;  2DN9 A;  4DR1 O;  5H6Q A;  2EX3 A;  4I5S A;  3JAS A;  2ZE5 A;  1RP3 B;  4JAU A;  4JPR A;  2XAG A;  1FJG B;  2KSD A;  1FFX A;  4JI5 B;  1QHT A;  1KKC A;  1HP8 A;  4I55 B;  3BA8 A;  4I7Z B;  2BCC H;  3UKM A;  4YY3 O;  5IWA B;  5B1B C;  1GK9 A;  3MHS C;  4LFC B;  2UXN A;  2ZR2 A;  3K0G A;  1N8R W;  4TV9 B;  2KG7 B;  4H33 A;  2NNU A;  5LGN A;  4JI6 O;  5LP6 B;  5HFL A;  1OCO C;  1N33 B;  3A0H Z;  4O4H B;  3EFF K;  2Q68 A;  3JAL A;  1AB3 A;  3ETQ A;  2VQF B;  1Q5O A;  4J7K A;  2QTO A;  1VP7 A;  1H2K A;  4I0X B;  5LYJ B;  1XMO B;  2F43 G;  1FXK A;  2Q4P A;  2A79 B;  4WFF A;  1XOU A;  4O4I B;  3HR0 A;  5EIB D;  4JI1 O;  5FNV B;  3ABM C;  3OMA B;  4RUE A;  2YIC A;  1Q3E A;  3QTC A;  4KL1 A;  2OTL V;  2CGO A;  4DR3 B;  3A8T A;  2DWE C;  3A0B Z;  3B8N A;  3K03 A;  3SPH A;  1VQM V;  4OGQ B;  5EYP B;  4PJ0 Z;  4TWK A;  1YVW A;  1LNQ A;  4LF4 O;  1XMQ B;  4PA4 A;  1KU9 A;  2FTK A;  5CBG A;  4NTY A;  2HEP A;  2ILM A;  4X9Q A;  1E1Q G;  4B08 A;  1G4Y B;  4XDJ A;  5IJ9 B;  1YDX A;  2V1D A;  4G27 B;  4LF6 B;  1JVM A;  1OCO B;  4LFA O;  2XAH A;  3CME V;  5K1X A;  4JI3 O;  1K3E A;  4LWS A;  5FL7 G;  5JJJ B;  4HZ3 A;  1S5H C;  2CE4 A;  2HHH B;  3CS5 A;  2HJF C;  1K5Q A;  3B77 A;  3ZHT A;  2ZNJ A;  2HJD A;  3QNE A;  4MTO A;  4NYK A;  3ABM B;  1N0N A;  2JJ2 G;  4UCO A;  1S5L Z;  4H44 B;  1SS3 A;  5B1A C;  1TVK B;  4J41 A;  4GT1 A;  2YI9 A;  4TSF G;  3T1Y B;  3R65 A;  5BMV B;  4JI2 O;  2RNB A;  5DEC A;  4U3J B;  3DC5 A;  2WPD G;  4DV7 B;  4W4K A;  2V4D A;  3OGI B;  4LH6 A;  4BAY A;  5JQG B;  4O2A A;  3E8B A;  1M93 A;  2DYR B;  2CTQ A;  1FPO A;  4XDL A;  1YF2 A;  1TUB A;  5CBH A;  4P30 A;  1L0N H;  2OCC B;  3HKC B;  4DR4 O;  2GSM B;  3E8G A;  1PNL A;  2CGN A;  3BVO A;  4O4J A;  2YID A;  1ZX3 A;  2ZIO A;  1EBO A;  4J7J A;  4MVS A;  3E8H A;  3RFR A;  3I56 V;  3SJA C;  3CRA A;  2Q67 A;  2K9P A;  5EZY A;  5J2U B;  4X1I B;  1GM8 A;  1NTZ H;  2JGU A;  4X88 A;  5F2V O;  3UO3 A;  3H9V A;  4ASU G;  3F5W C;  2ATK C;  2ZM6 O;  4B3M O;  1TAE A;  1P84 F;  3AG1 B;  2OIG A;  1XNQ B;  2A06 H;  5B1A B;  5IY5 C;  1H38 A;  2WA4 A;  3ABK C;  4GKJ O;  4CH3 A;  4RUF A;  1ZL8 B;  1FXV A;  2LW7 A;  2AGA A;  3JD3 A;  1WA8 A;  2QKA A;  2EIJ C;  3BA9 A;  3ABT A;  1GN3 A;  3E22 B;  4ZOL B;  3SDL A;  2WLJ A;  2PGG A;  2DYS C;  3JAR A;  2ZIN A;  3H1L H;  4ICG A;  4G2K A;  1IX9 A;  5C93 A;  4JTA B;  3SJC C;  5CB4 A;  1PNK A;  5E1A C;  2LGW A;  4IHJ B;  1ZAU A;  1K8A W;  3STL C;  1XIL A;  1JOY A;  1I5X A;  1HDJ A;  1SZT A;  5IY5 B;  4OX9 B;  4YHH O;  4JI8 B;  2XTA A;  1AR1 B;  1URF A;  2FB5 A;  3CE2 A;  4FJC C;  3W7S A;  2P90 A;  2AXT Z;  3KZI Z;  4YJ2 B;  5KLV H;  4X89 A;  2EIJ B;  3ML0 A;  1SQF A;  1Q8I A;  2IJK A;  4HNA B;  2DYS B;  3CCV V;  2X0L A;  4DXW A;  1OV9 A;  1I5Y A;  3T1H O;  3W7T A;  2IW5 A;  1VQ9 V;  1O9G A;  3B2E E;  3K5L A;  4I50 A;  2OTJ V;  1R3I C;  2GDS A;  2ADP A;  2HVK C;  1ZTE A;  1GN2 A;  4X65 B;  2HKO A;  1ROP A;  3AK1 A;  4KHP B;  1SES A;  3VBB A;  4PD4 F;  1WN7 A;  4X1Y A;  1GMG A;  1TGO A;  2IJH A;  1DF4 A;  2DQ3 A;  1NTK H;  2JGD A;  3D8C A;  5LMU B;  3APQ A;  2V7Q G;  2E5L B;  1FXH A;  1THZ A;  4DR2 O;  1FXK B;  5IJ0 A;  1DGS A;  1IBK O;  4B3S B;  1OCC C;  2X7R B;  4GYC B;  1QR9 A;  4CH6 A;  4WFE A;  4UCT A;  1Q6U A;  5JWP A;  4O4L A;  1H8E G;  1FJG O;  4JI5 O;  1I08 A;  5JJN B;  1MMM A;  5IYZ A;  4FLT A;  3K58 A;  3JSN A;  3R66 A;  1SF9 A;  1BZK A;  1CXZ B;  5KHG A;  4D7T A;  5IWA O;  3LUT B;  2ZXW B;  1XL6 A;  3AK3 A;  4UV9 A;  4LFC O;  3RVY A;  1K33 A;  1HWY A;  1ZUQ A;  2HP8 A;  1SRY A;  4R6Z A;  4PA7 A;  2XAQ A;  2W6J G;  5DM6 V;  1N33 O;  4FM1 A;  5JCO C;  2RMK B;  1YHQ V;  2VQF O;  1NJI W;  2QM8 A;  4K0K B;  1VQK V;  4FM2 A;  1NBM G;  1H2S B;  3O65 A;  4YJ3 B;  1XMO O;  5BZB A;  4I4T A;  1D5A A;  3CCE V;  1NKD A;  3OE7 G;  2EZP A;  4LF8 B;  3T2M A;  4DR3 O;  3CD6 V;  4O2A B;  3S3X A;  3K5N A;  1VQ7 V;  4L87 A;  5JH7 A;  1XMQ O;  2CH7 A;  4WFH A;  1KKD A;  4DK1 A;  1MZE A;  2ITC C;  2W0F C;  1PV0 A;  4JGS A;  4O4J B;  1XHZ A;  3OT7 A;  1OCR C;  1WNS A;  1AI4 A;  3BAB A;  4X64 B;  5EZY B;  2XAF A;  4LF6 O;  4JI0 B;  3ETD A;  1WP8 A;  4FFB A;  3D36 C;  1S3J A;  2F23 A;  1EFR G;  1K4C C;  3JYC A;  2IBZ H;  2QKS A;  1M4U A;  2NR5 A;  4X20 A;  3VQV A;  5KUK A;  1SC5 B;  3C90 A;  2HHH O;  4FM0 A;  3MAQ A;  4A5U B;  1M56 B;  4J11 A;  4JF3 A;  5E79 Z;  4ZHQ A;  4NXN B;  3IGA C;  1F7Y A;  5IYD O;  1KBH A;  3RYC A;  3U10 A;  1VEW A;  3OTF A;  5L3D A;  4DV1 B;  4JTD B;  2FKX A;  5GW7 A;  1K92 A;  4DV7 O;  1K34 A;  1GN4 A;  3SYA A;  2E76 B;  2Q5Z A;  3GWK C;  1OZ0 A;  3K9S A;  3ASN B;  1K7D A;  1R73 A;  3L9D A;  2YEV A;  1OCR B;  1EN4 A;  4OPH A;  5KHJ A;  4PA6 A;  2O57 A;  3RVZ A;  1QLE B;  3SYC A;  2N05 A;  5CBF A;  1K97 A;  2R70 A;  2ZE6 A;  3APO A;  1J95 A;  1R1B A;  4FZ1 A;  4MS2 A;  1Z5W A;  5BR8 B;  2PTM A;  4RQF A;  2Z0A A;  1S72 V;  2EUL A;  3L75 H;  5DN6 G;  1BMF G;  5L3B A;  1XNQ O;  3E89 A;  4J9Y B;  1W2B U;  2Q0O C;  5EIB C;  1XI1 A;  4UB6 Z;  3JAK A;  4N21 A;  3JD2 A;  1L1F A;  4FLW A;  2Y0I A;  2JS5 A;  1GN6 A;  3UQ8 A;  2UUC B;  5D5Q A;  1SQP H;  1AJN A;  3E86 A;  3G6E V;  5GTH Z;  2JRI A;  3G67 A;  3B8M A;  4DRX A;  1Y74 A;  2CK3 G;  2ZCE A;  2EJ7 A;  1AIL A;  2HLD G;  3OR6 C;  4NKG B;  3ZRS A;  1YXB A;  2ZKO A;  2P7T C;  4X1Y B;  5JJE B;  5B66 Z;  3L73 H;  2JDI G;  2Q7G A;  3P32 A;  5JVD A;  1CEZ A;  2L35 A;  4QGP A;  1Y66 A;  2RN9 A;  4CC5 A;  3CJH B;  5EC1 C;  2KQX A;  3G80 A;  1KC8 W;  3E35 A;  1IDS A;  5LOV B;  2Q69 A;  3N27 A;  2ZDI C;  3H01 A;  3CRC A;  4OX9 O;  4JI8 O;  5J9P C;  1H2M A;  2CAZ C;  1AI6 A;  2YXH A;  1NVP B;  3T1C A;  3CCQ V;  4FLZ A;  5FPO A;  2QWN B;  3C3S A;  4O4L B;  3CRM A;  1VQO V;  1WB8 A;  3HKD A;  4QIW F;  1YZB A;  2CTW A;  3OTO B;  4KFM A;  4E4E A;  5IYZ B;  3LNM B;  4GX0 A;  4GKK B;  3JCZ A;  3B09 A;  4MVM A;  2UXX A;  3FB7 C;  2EJR A;  4DV0 B;  3ZMV A;  1VIB A;  2XT9 A;  2XOK G;  3CX5 F;  4X65 O;  3OFN G;  3G71 V;  4FLY A;  4KHP O;  4G28 B;  4PV1 B;  4DR6 B;  2B1G A;  5LMU O;  5D5P A;  4DUZ B;  2HR3 A;  4B7E A;  1FD9 A;  2E5L O;  1V55 C;  1HNW B;  2RDC A;  1AP5 A;  2YSU B;  2Q7E A;  4K35 A;  3TK1 A;  3TXS A;  4AI8 A;  5B5E Z;  4MVO A;  3EXA A;  3ZMU A;  3W7X A;  4B3S O;  4Q20 A;  1OHH G;  1AJQ A;  1VQL V;  1K73 W;  3S3W A;  3LDD A;  2FL4 A;  2OCH A;  3FAV A;  1BT8 A;  1XBL A;  3ZX6 A;  4LC1 A;  2E74 B;  2IU0 A;  1KQS U;  4GZR B;  2N04 A;  1AI7 A;  2IH3 C;  3ABL C;  1IZ3 A;  4FMT A;  1NVP D;  3N2G A;  1T5E A;  1VF7 A;  3Q4H A;  4K3A A;  2Q6A A;  3TGU H;  3OMI B;  3ZHR A;  1XNR B;  4K8X A;  4FFB B;  3QO7 A;  1YIT V;  2DYR C;  4JYC A;  4LR3 A;  1V55 B;  3E2E A;  4GUN A;  2GUZ A;  4UFZ A;  2OWO A;  2OCC C;  1K9M W;  2D3O W;  2DE0 X;  4ZHQ B;  4K0K O;  4IL6 Z;  5CA1 A;  1UPG A;  3HB3 B;  2B9Z A;  1JFF B;  3ZRW A;  2H8P C;  1Q90 D;  4CC6 A;  4JYA B;  3A0R A;  4PDM A;  1IXB A;  2UXB B;  5J2T B;  3ZMZ A;  4LF8 O;  3UT5 A;  3SYQ A;  3RYF A;  2CTR A;  4JI7 B;  4TV8 A;  3AG1 C;  4ZIB A;  2BTQ A;  1IXM A;  1S0V A;  5BXZ A;  1M90 W;  3ABL B;  4JZ2 A;  2YEV B;  3CP1 A;  4QPJ A;  3SJQ C;  3ZED A;  3LSS A;  1FAF A;  1R3J C;  4J10 A;  3L70 H;  2EIL B;  2B5U A;  3MDS A;  4ZBM A;  2GHY A;  3QO5 A;  1LUV A;  2KKW A;  5ITZ A;  4X64 O;  2UU9 B;  1B6Q A;  3BY6 A;  3KKY A;  5EBM C;  4JI0 O;  4QPK A;  2KB1 A;  4GLX A;  5KHK A;  1N0J A;  2UUA B;  3ZN1 A;  5KHI A;  2QKC A;  3T4Z A;  1SKV A;  4NXN O;  1VQ5 V;  4FZ0 A;  1TA8 A;  3AG4 C;  4LNU B;  3OUS A;  2PY5 A;  3JAK B;  1R6T A;  1IBL B;  1IUR A;  4UVB A;  4JAA A;  1LR1 A;  3BFR A;  4DV1 O;  2ZQM A;  5EK0 A;  4UV8 A;  2H3O A;  4GCZ A;  2QR4 A;  3OR7 C;  1BHB A;  2LGQ A;  2WLI A;  3G4S V;  2X6A A;  1E79 G;  4RAI A;  4QNH B;  2ZD9 A;  3H1I H;  1VF6 A;  3GVM A;  4BWA A;  5LA6 A;  1VAR A;  4DK0 A;  2F4V B;  4NTW A;  1I7F A;  1BSM A;  5H9C A;  3SGI A;  3EHB B;  1YIJ V;  3JCU Z;  4FLV A;  1V54 C;  1DF5 A;  1FKA O;  3CYO A;  3GB7 C;  3I5D A;  2CUG A;  2BSK A;  2QTS A;  4EKW A;  5BR8 O;  2LP7 A;  1RPO A;  2ADQ B;  1I94 B;  1H8H G;  3AG4 B;  4PA3 A;  4QE7 A;  3U11 A;  1SQB H;  2BTO A;  4X1K A;  2Q8V A;  4UUJ C;  4ABM A;  1QCE A;  4F4L A;  4OPA A;  4I9Q A;  3OEE G;  4MW8 A;  5B1N A;  1P7G A;  3HKD B;  4AIL C;  2QM4 A;  4UB8 Z;  2UUC O;  3JAT A;  4WFG A;  5KUM A;  1FXK C;  4J7Z A;  3HKE A;  3J81 N;  2DJV A;  1NS1 A;  1AI5 A;  3JAS B;  4Z1V A;  3KG2 A;  1VQ8 V;  2XHB A;  1FFX B;  2QWQ B;  1V54 B;  2NLJ C;  3ZS8 C;  4X62 B;  2OT5 A;  5CA0 A;  2R9I A;  1BCC H;  2RQ6 A;  3W7U A;  2P6J A;  1J5E B;  4J80 A;  1VQP V;  2IU3 A;  1Q7Y W;  5H2F Z;  2YXY A;  2ZE7 A;  5DED A;  4JTC B;  5LHI A;  4CH5 A;  2ZXW C;  3ZN0 A;  1DLB A;  4X66 B;  1HR0 B;  3O9O A;  1R3K C;  1JA8 A;  3B40 A;  3JAL B;  3OM3 B;  1SA0 A;  4CZZ A;  4B3R B;  1PP9 H;  2WLM A;  1JPX A;  3OTO O;  2W6I G;  4H37 A;  4F6E A;  2ZR3 A;  4GKK O;  4NB5 A;  4YY3 B;  1Q6H A;  4WFA V;  4LCU C;  1AVM A;  4WBN A;  3MD0 A;  2P4K A;  4DV0 O;  1IVS A;  3Q4H B;  3ZIA G;  3P3N A;  5KMG A;  1ORQ C;  3K5M A;  3ABU A;  2PF4 E;  1WLE A;  1B06 A;  1EN6 A;  1GRJ A;  3RYH A;  4DR6 O;  3K0D A;  3RT3 C;  4GX1 A;  3H1K H;  3M99 B;  4DUZ O;  1PM9 A;  1HNW O;  3ZMS A;  4DW0 A;  4UCU A;  5IE9 A;  4EFE A;  3FKS G;  1MSD A;  4LWS B;  4B7K A;  3SYP A;  2QWP B;  1YJW V;  5LXT A;  1X59 A;  2PUS A;  3UT5 B;  5KX5 A;  2EIM C;  5HFM A;  4B3T B;  2WLL A;  2VWJ A;  4L8J A;  2PI5 A;  4ZI7 A;  1GTO A;  3WB2 A;  1BQZ A;  5KA6 A;  1D2D A;  1M56 C;  4CH4 A;  4I55 A;  2UUB B;  1SZX A;  3ZRV A;  4WFB V;  2AZ0 A;  1ARO P;  2AZ2 A;  5IDJ A;  1Y76 A;  3E83 A;  2FYU H;  5ITZ B;  3ASO C;  3K59 A;  1Y4M A;  4TV9 A;  1M57 B;  2KG7 A;  1TUB B;  1XNR O;  1XL4 A;  2X6C A;  5L3C A;  3SPG A;  5LP6 A;  4F6R A;  1UJW B;  1AJP A;  3ASN C;  1US6 A;  1Q43 A;  3CEI A;  3LDC A;  4LH7 A;  2VQE B;  3BRC A;  1Q86 W;  5LYJ A;  2XAJ A;  1QLE C;  1LUW A;  2QWO B;  3ZJZ A;  1SQX H;  2EIM B;  3WU2 Z;  4Z2W A;  4JYA O;  3MHH C;  3CC2 V;  2ZE8 A;  2UXB O;  2RCV A;  3AK2 A;  3J7A U;  5LGT A;  3P3P A;  4DV4 B;  5K1P A;  4JI7 O;  1Q6I A;  2WLI B;  1TUE B;  2P22 C;  1MZF A;  4XBF A;  3CRR A;  4W4L A;  5CN0 A;  2IJI A;  1AR4 A;  4CS2 A;  4MTG A;  5LA6 B;  3T1Y O;  2QM7 A;  4DW1 A;  2LFS A;  3ASO B;  1WA8 B;  3KCY A;  4JYB A;  1FS0 G;  3VQX A;  1JX9 A;  5A9G A;  1COW G;  1DTO A;  2UU9 O;  3JAR B;  1AR5 A;  2P67 A;  4DV2 B;  2YXL A;  3L74 H;  4TUY A;  2HG5 C;  1N4C A;  5CB4 B;  2UUA O;  1KP2 A;  4TQF A;  4KP4 A;  4D6T H;  2Q0A A;  2DW4 A;  5L3G A;  3CRQ A;  3DC6 A;  2R9A A;  3M8A A;  3JAM N;  3UCS C;  1IBL O;  1TVK A;  2YDE A;  2A9H A;  1VQ4 V;  5A2Q N;  2EIK B;  3ZHU A;  4DV6 B;  3DSQ A;  5JQG A;  4JV5 B;  1EN5 A;  4JAS A;  1O9H A;  1YCI A;  4BIU A;  3ZCC A;  4UCV A;  2F4V O;  2AHZ A;  1QNM A;  1N34 B;  4BR6 A;  4FLX A;  4MVU A;  1NTM H;  4I50 B;  4CS3 A;  2Y48 A;  1X4T A;  2LJ2 A;  4DYL A;  1FYJ A;  4O2B A;  2F66 C;  2ETN A;  1PL4 A;  2ZIM A;  4PHZ A;  1I94 O;  2WLH A;  4K8Z A;  3IC7 A;  3CCM V;  3SYO A;  1XDC A;  2JGD B;  3RN4 A;  4LP8 A;  4R8C A;  1SA0 B;  4BW9 A;  2X6B A;  1PNM A;  1ZL8 A;  1QVF U;  3BPZ A;  4BW5 A;  3L72 H;  5IJ0 B;  1RPR A;  3E22 A;  3WG7 B;  1XRE A;  2LW1 A;  1R6K A;  4DR7 B;  1B3Q A;  4PDL A;  2PI4 A;  1VMG A;  3CCR V;  4WBN B;  3K3W A;  1S5J A;  2MW2 B;  5C8Y A;  3RYI A;  1IBM B;  3SPC A;  2B1I A;  3SPI A;  4IHJ A;  1KEC A;  4X62 O;  3WFV A;  1CPY A;  1MSW D;  5BY1 A;  1JR9 A;  1N36 B;  3ZMT A;  1J5E O;  1JQ0 A;  1SET A;  5LHG A;  1QVG U;  1HNZ B;  2YS8 A;  2ZNI A;  3RGB A;  1MNG A;  4LFB B;  4X66 O;  4R50 A;  3X2Q B;  1HR0 O;  1BHA A;  4MTX A;  4YJ2 A;  3THO A;  4B3R O;  5KX5 B;  2WLL B;  3QG5 A;  1YTF D;  3QVN A;  3A2F A;  2ODM A;  1G6U A;  1H2N A;  4HNA A;  4ZI7 B;  4DUY B;  2PYJ A;  1V9P A;  1L8D A;  4I4T B;  2Z3Y A;  4J42 A;  3HKB A;  2ITD C;  5FLX N;  1MOF A;  3VOU A;  2QSA A;  4DV5 B;  1SQV H;  5CA3 A;  1Y76 B;  3AEI A;  3DGE A;  3I55 V;  4IT5 A;  4GX5 A;  4Q6G A;  5JH7 B;  2CH7 B;  5FPR A;  1JJO A;  1KD1 W;  1L0L H;  3DTU B;  2XUM A;  4F6R B;  1NT2 B;  4WCE V;  5B3S C;  3PJS K;  2A0L A;  3LNN A;  2E75 B;  4CS4 A;  1MG1 A;  5H6R A;  5CMU A;  2E3C A;  1NR7 A;  2JK5 C;  4FPP A;  1PPJ H;  2EIL C;  2DQ0 A;  2R72 A;  1GO3 F;  1GM7 A;  4UCS A;  3FB6 C;  4XDK A;  2QDO A;  2BE3 A;  3VQY A;  4FLU A;  5TIS Z;  2G38 A;  4X20 B;  3RW0 A;  4FVM A;  2MK3 A;  2YIB A;  1RFY A;  2JIZ G;  1Y67 A;  4H0L B;  3FX7 A;  4B3T O;  2OIE A;  4YXW G;  4EB6 A;  4BIZ A;  3D3I A;  1R6N A;  1VQ6 V;  3RYC B;  2UUB O;  4LF9 B;  2CTP A;  5B1B B;  4WF9 V;  3LSU A;  4LF5 B;  1XQ8 A;  1B04 A;  1JCH A;  1SQG A;  1UFI A;  3JD4 A;  1WPX A;  1XHX A;  2EIN C;  4QE9 A;  2JVD A;  3CWB H;  2WSS G;  2P4V A;  5B3S B;  2N74 A;  1S77 D;  5GON A;  4TUY B;  1PD3 A;  1YEW A;  3ETG A;  5KAI Z;  2PYL A;  3QF7 A;  1BS3 A;  2VQE O;  2JJ1 G;  1I0H A;  1CP9 A;  1QQC A;  1NI8 A;  4YJ3 A;  3OW2 U;  1P7B A;  4FK5 C;  3CSX A;  1H2G A;  4TOI A;  1ENV A;  5EC2 C;  1GAX A;  1F4N A;  2IJJ A;  3TJT A;  4IGG A;  4DV4 O;  1W0K G;  3NR7 A;  3L71 H;  2GTS A;  5LGU A;  4LF7 B;  1BL8 A;  3CB2 A;  5LL6 Y;  2Y4U A;  1HNX B;  3CPW U;  2EIN B;  1GKF A;  3JD1 A;  1YSC A;  1BE3 H;  3K79 A;  2HVJ C;  3J80 N;  3WB0 A;  4E2L A;  3F7Y C;  3OD4 A;  1Q81 W;  1N32 B;  1VF5 B;  4C7U A;  1EZJ A;  1WJZ A;  2YI8 A;  2Q73 A;  4DRX B;  5JCO A;  1QU7 A;  1Y74 B;  4O2B B;  4AQY B;  3ZBH A;  4DV2 O;  2CDY A;  2QGN A;  5KAF Z;  2GTA A;  3K06 A;  4FFK A;  1M1K W;  3CXH F;  4I9W A;  5JVD B;  2Q7H A;  4AHC A;  3BCC H;  3OAA G; 
#chains in the Genus database with same CATH homology
 1OCO C;  3NXS A;  1S72 V;  3EFF K;  2Q68 A;  1MAB G;  5DN6 G;  1BMF G;  2XAS A;  5L3B A;  3FKS G;  3E89 A;  2QTO A;  4J9Y B;  3SYP A;  1W2B U;  1YJW V;  5IYC O;  2F43 G;  1FXK A;  3LSQ A;  5KA5 A;  2A79 B;  4N21 A;  4WFF A;  2EZO A;  2EIM C;  3ETE A;  3JD2 A;  1L1F A;  5HFM A;  2WLL A;  3ABM C;  3OMA B;  4RUE A;  2OTL V;  2PI5 A;  1VQN V;  1GTO A;  2DWE C;  5KA6 A;  1M56 C;  3B8N A;  3K03 A;  3SPH A;  1VQM V;  1AJN A;  3E86 A;  3G6E V;  3ZRV A;  4WFB V;  4TWK A;  2R9R B;  1LNQ A;  3F7V C;  3B8M A;  4PA4 A;  1ARO P;  5IDJ A;  2FTK A;  5CBG A;  5IYB O;  2CK3 G;  3E83 A;  1E1Q G;  3ASO C;  3D36 A;  2HLD G;  1F23 A;  3OR6 C;  1Y4M A;  4MVR A;  1M57 B;  3ZRS A;  1G4Y B;  4XDJ A;  2P7T C;  1XL4 A;  2X6C A;  3UM7 A;  5L3C A;  3P32 A;  2JDI G;  3SPG A;  1F51 A;  3TET A;  1CEZ A;  2V1D A;  4G27 B;  4P9O A;  4ZKI A;  1UJW B;  1AJP A;  1JVM A;  1OCO B;  3ASN C;  2XAH A;  1Y66 A;  3CME V;  3LDC A;  3ABK B;  5EC1 C;  4MVZ A;  1K3E A;  1KC8 W;  3E35 A;  1Q86 W;  2Q69 A;  5FL7 G;  4HZ3 A;  2ZDI C;  1S5H C;  2XAJ A;  3H01 A;  4RQE A;  4DO2 A;  5J9P C;  1QLE C;  2HJF C;  2WLK A;  3ZJZ A;  1K5Q A;  3B77 A;  2EIM B;  4UVC A;  3QNE A;  4MTO A;  1AI6 A;  4J9Z B;  1NVP B;  3ABM B;  3T1C A;  2JJ2 G;  3MHH C;  3CCQ V;  3CC2 V;  1K4D C;  4LBE C;  1R3L C;  3CCS V;  5B1A C;  2QEX V;  5LGT A;  4GT1 A;  4TSF G;  3R65 A;  1VQO V;  4R7C A;  2WLI B;  1TUE B;  4QIW F;  1QLN A;  4XBF A;  2WPD G;  4KFM A;  5CN0 A;  4MTF A;  4BAY A;  3CC4 V;  2IJI A;  3CCL V;  3E8B A;  3LNM B;  3LDE A;  1W0J G;  4GX0 A;  2DYR B;  4MTG A;  2QM7 A;  4OXS A;  4Z1M G;  2QE7 G;  3JCZ A;  2LFS A;  3ASO B;  3OGC C;  4GX2 A;  4MVM A;  4XDL A;  4JYB A;  1FS0 G;  2UXX A;  5CBH A;  3FB7 C;  2EJR A;  1JX9 A;  4P30 A;  1KP3 A;  2OCC B;  5LBQ A;  3ZMV A;  2GSM B;  3E8G A;  4X8A A;  1PNL A;  1COW G;  1DTO A;  2XOK G;  5B1O A;  1EBO A;  3OFN G;  3G71 V;  4MVS A;  3E8H A;  2P67 A;  3I56 V;  1NR1 A;  4G28 B;  2Q67 A;  4N23 A;  1K5S A;  2HG5 C;  2B1G A;  1GM8 A;  4X88 A;  1QBZ A;  2M7W A;  1KP2 A;  4PA9 A;  2IH1 C;  4ASU G;  3F5W C;  2HR3 A;  3CXC U;  2ATK C;  1V55 C;  4KP4 A;  1M57 C;  1RM1 C;  2YSU B;  4HAM A;  3AG1 B;  3AG2 C;  3TK1 A;  2DW4 A;  5L3G A;  3E8F A;  4MVO A;  3ZMU A;  5B1A B;  5IY5 C;  1JJ2 U;  3W7X A;  1H38 A;  2A9H A;  4Q20 A;  1VQ4 V;  1OHH G;  3ABK C;  4P2Z A;  3ZRW B;  1AJQ A;  2EIK B;  2LFR A;  4RUF A;  1VQL V;  1K73 W;  1S76 D;  2XND G;  3LDD A;  5LHH A;  1PL0 A;  1FXV A;  3CC7 V;  2WAM A;  1PKX A;  3JD3 A;  2EIJ C;  4PDV A;  3ABT A;  4JAS A;  2WLJ A;  4LC1 A;  2IU0 A;  1KQS U;  4BIU A;  2AHY A;  3ZCC A;  1AI7 A;  3SPJ A;  3K04 A;  2DYS C;  2AHZ A;  2IH3 C;  3ABL C;  4G2K A;  4FMT A;  4HYO A;  1NVP D;  5C93 A;  5EBW C;  1E1R G;  4JTA B;  2Q6A A;  4MVU A;  3OMI B;  2ZDI A;  1YJ9 V;  1PNK A;  2Y48 A;  5E1A C;  3QO7 A;  1YIT V;  1K8A W;  2DYR C;  3STL C;  4JYC A;  1V55 B;  3E2E A;  4MT8 A;  1RM1 B;  1OCC B;  2WLH A;  3IC7 A;  1JOY A;  2OCC C;  1F4M A;  1K9M W;  3AG2 B;  2D3O W;  1I5X A;  3CCM V;  3SYO A;  1SZT A;  2QA4 V;  4LP8 A;  5IY5 B;  4R8C A;  3HB3 B;  2X6B A;  3ZRW A;  2H8P C;  1AR1 B;  1PNM A;  2C2A A;  3JD0 A;  1QVF U;  3W7W A;  4FJC C;  4BW5 A;  3W7S A;  3A0R A;  2P90 A;  4PDM A;  4PEL A;  4X89 A;  1RPR A;  2EIJ B;  3ML0 A;  3WG7 B;  3ZMZ A;  3SYQ A;  2Y69 C;  2HFE C;  2IJK A;  3AG1 C;  1R6K A;  1IXM A;  1S0V A;  4PDL A;  1M90 W;  2PI4 A;  2DYS B;  3CCV V;  3ABL B;  2X0L A;  4JAV A;  4DXW A;  3CCR V;  3K3W A;  1I5Y A;  2YEV B;  3CP1 A;  4QPJ A;  3SJQ C;  3LSS A;  3W7T A;  2H94 A;  1R3J C;  2EIK C;  2IW5 A;  3BEH A;  1VQ9 V;  2EIL B;  2OTJ V;  3SPC A;  2B5U A;  2B1I A;  1R3I C;  4ZBM A;  3SPI A;  2GHY A;  2HVK C;  3QO5 A;  1KEC A;  2Z5U A;  1B6Q A;  3BY6 A;  3WFV A;  1CPY A;  3CCU V;  1MSW D;  2HKO A;  1ROP A;  5EBM C;  1GM9 A;  4QPK A;  4QJF B;  1SES A;  3ZMT A;  3VBB A;  1GMG A;  2IJH A;  2KB1 A;  1DF4 A;  1JQ0 A;  2DQ3 A;  1SET A;  5LHG A;  4MSW C;  1QVG U;  2K1E A;  3ZN1 A;  2V7Q G;  4FIP C;  1FXH A;  3T4Z A;  1NQT A;  3CCJ V;  3HPL C;  1THZ A;  4R50 A;  3X2Q B;  1VQ5 V;  1BHA A;  3AG4 C;  4MTX A;  4UXN A;  1FXK B;  4UVA A;  3OUS A;  1OCZ C;  2WLL B;  4UVB A;  1YTF D;  2BOC C;  3STZ C;  2Y69 B;  1OCC C;  2X7R B;  2ZQM A;  5EK0 A;  4UV8 A;  1QR9 A;  4GCZ A;  3QO8 A;  4WFE A;  2Z3Y A;  3OR7 C;  1BHB A;  2ITD C;  1MOF A;  2WLI A;  1H8E G;  2X6A A;  3VOU A;  3G4S V;  1E79 G;  4PDR A;  4RAI A;  5CA3 A;  4QNH B;  3K08 A;  2ZD9 A;  2BOB C;  1NH2 B;  3FYE B;  3AEI A;  3DGE A;  3I55 V;  3CMA V;  4GX5 A;  3TCU A;  3WG7 C;  3OUF A;  5H9C A;  3LUT B;  1KD1 W;  2ZXW B;  3DTU B;  4RQF A;  1XL6 A;  4UV9 A;  3EHB B;  1M9N A;  4WCE V;  5B3S C;  1YIJ V;  3PJS K;  2A0L A;  5L3F A;  3RVY A;  1K33 A;  1HWY A;  1MG1 A;  1V54 C;  1DF5 A;  4RO2 A;  3CYO A;  3GB7 C;  5H6R A;  5CMU A;  3FYI B;  1SRY A;  5L3E A;  1NR7 A;  4EKW A;  2LP7 A;  4R6Z A;  2JK5 C;  1RPO A;  4PA7 A;  4FPP A;  5EBL C;  2XAQ A;  2W6J G;  2EIL C;  5DM6 V;  4KUM A;  2DQ0 A;  1YTF B;  1H8H G;  1GO3 F;  3AG4 B;  1GM7 A;  4PA3 A;  4QE7 A;  1YHQ V;  4CBC A;  1NJI W;  2QM8 A;  3GWO A;  3FB6 C;  4XDK A;  2WWW A;  1OCZ B;  1VQK V;  1NBM G;  4UUJ C;  3RW0 A;  2MK3 A;  3OEH G;  1QCE A;  4MW3 A;  4F4L A;  2JIZ G;  5BZB A;  3AG3 C;  1SER A;  3RBZ A;  3OEE G;  4MW8 A;  4YXW G;  5B1N A;  1NKD A;  3OE7 G;  3CCE V;  1QR8 A;  2EZP A;  4BIZ A;  3D3I A;  1R6N A;  1VQ6 V;  1ZWI C;  3T2M A;  3X2Q C;  3CD6 V;  2JEX A;  4WFG A;  4U7N A;  5B1B B;  5KUM A;  1FXK C;  4WF9 V;  3K9A A;  1VQ7 V;  4L87 A;  1AI5 A;  1JCH A;  4TT3 G;  4WFH A;  1KKD A;  3FB8 C;  3KG2 A;  2ITC C;  2DWD C;  1WPX A;  2W0F C;  2EIN C;  3JD4 A;  4QE9 A;  4JGS A;  1VQ8 V;  2WSS G;  5B3S B;  1S77 D;  3IFX A;  1YI2 V;  3T4D A;  1Q82 W;  1V54 B;  1OCR C;  1AI4 A;  2NLJ C;  3P30 A;  2XAF A;  2OT5 A;  1PD3 A;  1FFT B;  2R9I A;  3ETD A;  3ZRX A;  3W7U A;  3ETG A;  2P6J A;  1VQP V;  2IU3 A;  1Q7Y W;  1S3J A;  1EFR G;  2JJ1 G;  1K4C C;  3JYC A;  4JTC B;  1CP9 A;  2QKS A;  5LHI A;  5KUK A;  1NH2 D;  2ZXW C;  3OW2 U;  1P7B A;  2JEU A;  3ZN0 A;  4FK5 C;  3AG3 B;  1DLB A;  1M56 B;  4JF3 A;  1H2G A;  4P9P A;  3IGA C;  1R3K C;  2WLN A;  5IYD O;  3OM3 B;  1G8M A;  3FB5 C;  1ENV A;  5EC2 C;  4MVQ A;  4CZZ A;  1F4N A;  1YJN V;  2IJJ A;  2WLM A;  1JPX A;  1P4R A;  3OMN B;  4U7O A;  5L3D A;  2EBO A;  4JTD B;  5GW7 A;  1W0K G;  5H6Q A;  1K92 A;  1K34 A;  4I5S A;  3SYA A;  2W6I G;  5LGU A;  1BL8 A;  4H37 A;  4JAU A;  4JPR A;  3CPW U;  2XAG A;  1OZ0 A;  2ZR3 A;  2EIN B;  1GKF A;  3JD1 A;  1YSC A;  4WFA V;  3ASN B;  3K79 A;  4LCU C;  2HVJ C;  3MD0 A;  1K7D A;  1R73 A;  4E2L A;  3F7Y C;  2YEV A;  1Q81 W;  1OCR B;  3UKM A;  3ZIA G;  4PA6 A;  1EZJ A;  3RVZ A;  1ORQ C;  3ABU A;  5B1B C;  1GK9 A;  1QLE B;  1WLE A;  3MHS C;  2UXN A;  2ZR2 A;  3K0G A;  3SYC A;  3K0D A;  1N8R W;  5CBF A;  1K97 A;  4GX1 A;  4H33 A;  3K06 A;  2NNU A;  1J95 A;  5LGN A;  1M1K W;  3M99 B;  4I9W A;  4MS2 A;  3OAA G;  3ZMS A;  5HFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...