4NTYA

Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
408
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
molecule keywords Acid-sensing ion channel 1
total genus 109
structure length 406
sequence length 408
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntyA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntyA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntyA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntyA02
4NTYA 3IJ4A 2FB5A 2QTSA 4FZ1A 4NTXA 3S3WA 3S3XA 2L35A 1WP8A 1WP7A 3N27A 4NYKA 4NTWA 4FZ0A
chains in the Genus database with same CATH superfamily
4OXSA 4I4TB 3BFRA 4NXMB 1XNQB 3ZX6A 2HVKC 1PV0A 2QR4A 1SQVH 4L87A 3SJCC 2IU0A 2X7RB 2QWQB 4MVSA 3QO7A 4X64B 4MS2A 3RN4A 2JK5C 2VWKA 1BZKA 1WP7A 2Q69A 1OJHA 3ZN1A 2EZOA 5B1OA 5KHIA 1THZA 3LSSA 1GM7A 3MHHC 2LP7A 2DQ0A 4ZI7B 4NKGB 1YXBA 2ODMA 4FLXA 3HKCB 3SPJA 1JPXA 3IC7A 2WLLB 3AG4B 1G6UA 5JQGB 1MG1A 3HKBA 4H0LB 3G67A 2EILC 5E79Z 3FD9A 4HAMA 1BQ0A 4DRXA 3CMAV 1QR9A 2K1EA 1OCCB 4MVOA 1K33A 2N05A 1SF9A 4KHPB 4X66B 2PYLA 2DWEC 4X89A 1H2KA 1SQBH 2YXLA 3M99B 3W7WA 2K9PA 3VBBA 1Q81W 1FYJA 2EBOA 2QWPB 2F93B 3TJTA 4LFBB 4LR3A 4LF4B 1M57B 1UJWB 3UO3A 3P30A 1NT2B 1H2GA 4JYYA 2CE4A 4H33A 3K06A 2R72A 3DC5A 1N34B 4UCSA 4FLYA 2YIDA 4L8JA 3KG2A 1GKFA 3U10A 1E1QG 5B66Z 5FPRA 4ZOLA 2CTRA 1S5JA 2ZDIC 1KECA 3EVKA 1RSOA 3T1HO 2R9AA 3EXAA 4J11A 2MK3A 4B3SO 4X9QA 3OGCC 4CC6A 3CPWU 3VQWA 5B1AC 2EJ7A 1P7GA 2CH7B 4DR6O 1N0NA 1NVPD 3HKEA 3E22B 4IGGA 4B08A 4DR7B 1WA8B 4I0XA 3H1HH 1JFFB 2XNDG 1N0JA 3QNEA 3SJQC 1SKVA 1SQXH 1G1XB 1YI2V 2GTSA 4P2ZA 4LWSA 4QE7A 5LOVB 2QGNA 4P30A 2NNUA 2QM8A 1PL4A 1VQ8V 2DOSA 4JI4O 4U3FH 2WAMA 3ZHSA 2A06H 4I9QA 1EZJA 2DJVA 3FB7C 3BPZA 1MSWD 1E1RG 5BMVB 4FLZA 4JI7O 2P4VA 5KUKA 3C3SA 4PA6A 4BIOA 4F4LA 3CS5A 1NQTA 3HPLC 2QKSA 4DR2O 3L9DA 4K0KO 3CE2A 4H37A 4EEQA 1FD9A 4JYCA 1GH6A 3H1IH 4F6EA 4F6RA 1I5XA 2EX3A 4MTOA 4X1YB 2Q4PA 1XL6A 3OTOO 2ZXWC 4FZ1A 3H1LH 3K5OA 1NTKH 2WPDG 1R3JC 1FJGO 1JOYA 1AI5A 4UB6Z 2DWDC 2EIKC 2M7WA 5EIBC 2YIBA 1MABG 4KFMA 1TAEA 1IBKO 5E1AC 4X1IB 1ZL8A 3T1YO 4MVRA 3BCCH 3C3TA 4B3MB 3N2KA 3KZIZ 4X66O 4O4IB 4EB6B 2AHZA 4ZHQB 2Q7EA 4DR7O 3GB7C 3K9AA 1FXHA 3D36A 5C93A 2Z0AA 4XDJA 5L3DA 3P3NA 4KP4A 2OTLV 1YTFD 2YEVA 2Z5UA 4UCTA 1IURA 1GK9A 2PTMA 4DV0O 5LYJB 5LHGA 1R1BA 1I08A 1NKDA 1QCEA 2V1DA 3MDSA 3QO8A 3K5LA 2JEUA 3O65A 1GMGA 2Y69B 3Q4HA 3STLC 2P6JA 3JD3A 4AQYO 1URFA 5F2VO 4UV9A 3CC2V 3CX5F 4RWUA 2DMXA 5J2UB 4EKWA 3WB1A 5LMUO 2PY5A 4G28B 2VRZA 4DUYO 3ZMUA 3AK3A 3E8GA 4FFKA 2ARHA 2F95B 2JGDA 3WB0A 3HKCA 1ROPA 4JV5B 1GTOA 2P7TC 2ZNIA 2FMLA 5LMNB 3ICXA 3R66A 1KB9F 1L8DA 1IBMO 3U11A 3K0GA 2ATKC 3E83A 2C2AA 4DV5B 4NB5A 2B5UA 4EFEA 4LFAO 1HNZO 3K5NA 4JI6B 1VP7A 1I0HA 1QQCA 3CXHF 1JJOA 3QVNA 1IVSA 4J10A 1SZTA 4Q6GA 3U0ZA 4FLUA 2QTSA 1H38A 2Q73A 2EIMC 3VQYA 2R9IA 2HHHO 3CCRV 1W2BU 1TUBB 2WLNA 2P90A 1IBMB 3A0BZ 2RMKB 1F23A 2WLHA 4K8XA 4JV5O 4LH6A 3CCSV 1RPOA 3AG2B 1HNWB 5JCOC 4HBNA 1OCOB 2IU3A 3M8AA 2WA3A 1BS3A 1KKCA 3NXSA 4ZI7A 2QM7A 4OX9B 1AILA 1AR1B 1J5EB 3P32A 4UCVA 4HNAB 4LC1A 1TA8A 5KLVH 3JATA 4J9YB 2Q8VA 5JQGA 3ZRWB 1BMFG 5L3BA 1Q82W 2QA4V 3ZHTA 1XL4A 4O4JB 4TV8B 2YEVB 1OCZB 2Q7GA 3ETEA 1GN3A 3UO2A 4YIOA 1S5LZ 1I94B 5CA3A 1VF6C 4WBNA 3SJBC 2E75B 2ZE8A 5DN6G 1RP3B 3OUSA 1GN6A 4D7SA 3FYEB 5L3EA 3AG3C 2OIGA 1XOUA 3FX7A 2UXBO 4E2LA 3ABUA 2Q7HA 2OWOA 1MA1A 1EN4A 3L73H 2HG5C 1TVKA 1YJ9V 3MD0A 4Q20A 5CB4B 2DYSC 4ABMA 1EBOA 3AG7A 2YSUB 2KSDA 4XBFA 2JS3A 3J7AU 4DUZB 4NXNO 3E8BA 5BZBA 1TGOA 2EULA 3CB2A 2GUZA 4LF5O 4PDLA 4QJFB 2ZCEA 4JI2O 1AB3A 4J7JA 3AG1C 1FXKA 4FVMA 4QGPA 5CA0B 1EZVH 4DV4O 1X59A 4PA3A 2A79B 3A0HZ 1FFXA 5JWPA 4NTWA 3UT5B 3IAYA 2DN9A 1N8RW 2E5LO 2JVDA 4KL1A 5DECA 1QR8A 4LF9B 2GTAA 2AZ0A 3CWBH 1PPJH 4DK1A 1RM1C 2YIBD 3B4SA 1AR4A 4GT1A 4B7EA 2Q0AA 4WFFA 1K7DA 1AI4A 5B1BC 1R6KA 2UU9B 1ZL8B 3WG7B 2UXCO 3ZN0A 4GX1A 1W0JG 4YJ3B 1DLBA 3VOUA 3D3QA 1ZSPA 2FTKA 4TT3G 4G27B 4MVQA 1LR1A 3SYPA 2ZE6A 1OCOC 3B09A 4MVZA 1K92A 3OE7G 1SETA 4MTGA 2HHHB 2JJ1G 1XMOO 3D36C 1D5NA 3CJHB 1A32A 3JD2A 4MVMA 4JPRA 1B3QA 3ML0A 4O4JA 4TV8A 1HNXB 1KYOF 4FFBA 4JGSA 3BHPA 5LP6C 2ITDC 4QE9A 1PM9A 3RVYA 1XREA 3JAWA 2QWOB 4RUEA 4CS4A 5DEDA 1GAXA 4TQFA 1K73W 4JTDB 3JASA 3JD1A 5EZYA 1HDJA 1ORQC 4EFBA 2UUBO 2PUSA 3RYHA 3FYIB 4X62O 2PF4E 2WLMA 3ETGA 1EFRG 2ZR2A 3BVOA 1YTFB 2DW4A 2CTWA 4JI3O 1XI1A 4WFAV 5LHHA 5BR8O 1QHTA 2ZM6B 4WFEA 3EFFK 2XAFA 3ABMC 1M9NA 1OCCC 3ASNB 2CTQA 3JD0A 2HJDA 2F66C 1RFYA 5GTIZ 4UCUA 4BR6A 5IJ9B 4CZZA 4DR4O 3ABKB 1NH2B 3CJHA 5LP6B 5EC2C 3DSQA 5KAFZ 1FFXB 2OCHA 4CS3A 4YY3O 1V54C 2X0LA 1Q6UA 2YI9A 4AHCA 1ZUQA 2UU9O 4JI3B 4J7KA 4LFBO 1XNQO 1RPRA 3JAKA 4IL6Z 1KU9A 3W7XA 3S3WA 2CGOA 4JI4B 4DV7O 4YJ3A 2NN4A 4DYLA 2EILB 5B3SB 3CCUV 3PJSK 1ENVA 2IW5A 3I55V 5JVDB 1P7BA 4I4TA 5IYZA 4BAYA 3UM7A 1FKAO 1ZAUA 1XILA 4JTCB 3SPCA 4JI2B 4H44B 3JSNA 4WF9V 4TOIA 4MSWC 1NBMG 1GN4A 4UCRA 3K3WA 4PA9A 2N74A 2UXDO 5EZYB 1JQ0A 1K9MW 3L74H 2HFEC 3ZMSA 4B3TB 2OCCC 3F5WC 1B04A 1QU7A 1OCRC 5LP6A 4I55B 4JYBA 5LA6B 5D5QA 3ZMTA 1O9GA 1IDSA 1LUVA 2X6BA 3AK1A 1ZWIC 5GONA 3OTFA 5LBQA 1Z2GA 2YI8A 4DR5O 1MZFA 1X4TA 2KG7A 1S72V 2ZM6O 2XAHA 2ETNA 3CCEV 2Q68A 1AROP 5L3GA 5IJ9A 4DXWA 4LF4O 4TV9A 5EBLC 4UXNA 5LMUB 4O4LA 5KA5A 3J81N 4LH7A 4UUJC 3RYHB 4DV2B 3FAVA 4NYKA 3LSQA 5JH7B 3OGIB 1AVMA 1S5HC 3SGIA 1SQPH 3DTUB 2HLDG 2XTAA 2ZE5A 2KG7B 3H01A 2XT9A 4MW3A 4IHJA 1FS0G 4DV7B 1HR0O 2BTQA 4RQEA 1XMQB 1VQLV 4X8AA 1F7YA 1CPYA 1XHXA 3E35A 3ETDA 3IFXA 3RYFA 5CBFA 4FM1A 5LXTA 4DR1O 1Z5VA 2YIAA 3CEIA 3SYAA 2ZT9B 3GWKC 4DV6O 1VQ9V 3CCLV 3N27A 4RUFA 3B2EE 2YC0A 4QPJA 1N4CA 4N21A 5ITZA 3T1HB 4JI8O 3CRQA 5A9GA 1OCZC 4R8CA 1Q43A 1FXKC 1FXKB 3UQ8A 1JVMA 2WLIB 3HR0A 2E76B 5JVDA 5FLXN 5HFMA 2LFRA 1SA0A 1EN6A 2YXYA 3ABLB 1Y76B 1D5AA 4O2BA 2E3CA 4B3RB 2ZXWB 1AI7A 2Q6AA 1BT8A 4JAVA 1YZBA 1SQFA 1Q86W 2GSMB 2PGGA 2W6JG 3RFRA 3CXCU 4DO2A 5KHGA 3DXRA 4KXRA 1XBLA 1GO3F 2OYQA 4LF5B 1AJPA 1VF7A 1N33B 4UVAA 3T1CA 3OD4A 3OR6C 1SA0B 1Y6XA 4KHPO 4NTYA 1NTZH 4ICGA 2ADQB 2P4KA 3K04A 2NLJC 2IJKA 3B8NA 3ASOC 1VQNV 1VF6A 5KMGB 4RO2A 4FFBB 3JAMN 4HYOA 4ZHQA 2WWWA 1L0NH 2FB5A 5BY1A 3FB5C 3BABA 3QTCA 1RSOB 4D6TH 1M90W 2LW7A 1KBHA 1MNGA 1Y74B 3H1JH 3A0RA 1UFIA 4GUNA 1KP3A 4LWSB 3LDCA 5LGTA 3T4ZA 4I7ZB 1TVKB 3CMEV 1SS3A 4DV6B 2A9HA 1QVGU 3ZHQA 4UCOA 1N36B 2HEPA 4JI1O 4DV1B 2Z3YA 5B3SC 1Z5WA 1IBKB 2A7WA 3T4DA 1P49A 2EIMB 3SPIA 1FJGB 5L3FA 3B40A 1TUBA 5B1AB 4D7TA 4FK5C 1BQZA 2XASA 5H9CA 5FNVA 4BIUA 2ZD9A 4DW1A 4AQYB 1KD1W 1AJQA 2MW2B 4GKJB 2H8PC 5C8YA 3APOA 2ZIOA 4FZ0A 4IT5A 2AGAA 2W0FC 3SPGA 3KCYA 1K4CC 3ABMB 4JI8B 5B5EZ 2QKCA 3DGEA 1MZEA 1F4NA 2WLKA 3L75H 3JALB 3SJAC 3HKDA 3LDDA 2BTQB 2F43G 2UXXA 5CMUA 3K79A 2UUCB 1N36O 3BRCA 3GWOA 1B06A 3TXSA 5IT9N 2RCVA 1NJIW 2A0LA 3SYCA 5CA1B 3SYOA 4LFAB 3E89A 3SPHA 4DV5O 1VQ5V 4E4EA 2R9RB 1Q90D 4R50A 5IWAO 2DYRB 3K58A 1VQ6V 4B3MO 4CH3A 2AW9A 1N33O 1N32O 3T1YB 2DE0X 4I9WA 4JI0B 4MTXA 1PNKA 4O2AA 3JCZA 3ZRVA 1HNZB 1K8AW 3ASNC 3CP1A 4JI0O 4DUYB 4O4HB 4U3JA 4XDLA 3LNNA 5EBMC 2E74B 5LL6Y 1IX9A 1PL0A 3CCQV 2QEXV 2CK3G 2DYSB 1K4DC 5LHIA 4TUYA 3X2QB 2RNBA 4JI5B 2IBZH 4CH6A 4MTFA 2VS0A 1G4YB 1VQOV 1F51A 4DR4B 4ZOLB 4CC5A 4BWAA 3K03A 3TXQA 4LF7B 2Q67A 1U97A 1JX9A 3I5DA 4B3RO 4X20A 3K57A 2X6AA 2XOKG 3OUFA 4OPAA 2YUAA 3AG1B 4PDRA 1HNWO 5IYZB 2ILMA 4CS2A 4PA4A 3A8TA 5TISZ 1XNRB 1R3IC 5JJNB 3WG7C 2IH3C 2P22C 4PHZA 2UUBB 3RYIA 1YVWA 2GDSA 1NH2D 2KQXA 1YSCA 5J2UA 3OMAB 2V7QG 5EK0A 4AILC 3I56V 3HKBB 1KC8W 1WN7A 3GVMA 3RT3C 4LNUA 5KHJA 4ZKIA 3E8HA 1S0VA 2UXNA 4TV9B 2H3OA 2QM4A 5KUMA 3JCUZ 2A3QA 4JI7B 1LNQA 3B77A 4WFBV 4JF3A 4X1KA 4IYIA 5BMVA 5LYJA 4WCEV 5GONB 1Y67A 4TWKA 4LF8O 3ZMZA 3LDEA 3F5TA 1M93A 4DR6B 3ABTA 5IWAB 3ZIAG 3H9VA 3Q4HB 1H2SB 2F4VO 3ZJZA 1NS1A 5KAIZ 3ABKC 4LF8B 4K3AA 4MW8A 1FAFA 3FB8C 5IY5B 5C8YB 5IY5C 1WB7A 4X1KB 5KHKA 3BAAA 2ADPA 2OT5A 5CBGA 2Q5ZA 3ZRXA 4FIPC 1R73A 3UCSC 3SDLA 1VQPV 4DRXB 3TETA 2GHYA 5B1BB 1Y74A 4LF7O 3W7TA 1BCCH 2EJRA 2ZIMA 1R6TA 1VQMV 1YITV 2L35A 3A2FA 3N2KB 2BOCC 1K5SA 1NZ6A 1U96A 1MMMA 5LGNA 3ZCCA 2ZE7A 4PJ0Z 4XDKA 1OHHG 4I50B 1JFFA 2BSKB 2JJ2G 4Z1VA 1BE3H 2ZDIA 5CA0A 4NR1A 2IJJA 4DV1O 1PD3A 2JS5A 4GKKO 2KKWA 1SRYA 3BA9A 2AZ2A 2QWNB 2XAJA 2FYUH 1NU1H 4JZGA 4OX9O 1K34A 1M1KW 2LGQA 2IH1C 1S3JA 3CRCA 4RAIA 3X2QC 4JZ2A 3CC7V 1V54B 2QDOA 3JARB 4IHJB 3ABLC 1KMIZ 4O2AB 1YDXA 4DUZO 4NXNB 4UVBA 3H1KH 5H5NA 2DYRC 1QVFU 1NR1A 2JIZG 2GBOA 2RN9A 5D5PA 1BHAA 1R6NA 3TK1A 1Q8IA 1VIBA 3OR7C 3HKEB 1FFTB 3QG5A 2PI5A 3S3XA 2UXBB 2PI4A 4OPHA 3JYCA 3AG3B 2PZSA 3HB3B 1IZ3A 5EIBD 5FNVB 5KMGA 2HJFC 3SYQA 4LP8A 1Q6HA 2LJ2A 3N2GA 4DV3O 1HNXO 4LF6B 4YHHO 1HP8A 5J2TA 3K0DA 3JALA 4J9ZB 3UKMA 2FKXA 1IXBA 2WLLA 2D2CB 4DV3B 5IYBO 5H6QA 1O9HA 1QLEC 1BL8A 1QLEB 1M5IA 3W7SA 4X88A 5FPOA 1V55C 4LFCO 1Q5OA 3N2GB 4JI1B 3QF7A 1YIJV 3FAVB 4GX5A 3E22A 1Q7YW 2DQ3A 1Q3EA 3G6BA 4LFCB 5EBWC 1E79G 3DC6A 2LO1A 3QO5A 3K9SA 1H8HG 2PYJA 3CCVV 4AI8A 1Q6IA 4NXMO 3O9OA 1M56B 3VQVA 1AI6A 1I5YA 1JCHA 3KCXA 5HFLA 5JH7A 3LUTB 4LNUB 1SERA 5LXTB 2EINC 3WU2Z 1HWYA 2UXCB 3BY6A 1VEWA 4H13B 2GUZB 1AR5A 2XAQA 1OZ0A 3G80A 1JR9A 1V55B 3JARA 3MAQA 5B1NA 3K5MA 2E5LB 2NR5A 2CH7A 1WB8A 5IE9A 2XAGA 5K1PA 5K1XA 4BW9A 4UV8A 4X20B 4UB8Z 4A5UB 4PI0A 1KP2A 1XQ8A 3FFQA 1DF4A 3ZRSA 3G6EV 2Y0IA 4O2BB 5EYPB 4DR3B 1WJZA 2ITCC 1BSMA 2HP8A 4CH4A 2V4DA 4DR5B 4TUYB 2BSKA 3JAWB 5LOVA 3EHBB 4BW5A 4X62B 2F23A 1VMGA 4GX0A 4G2KA 1XDCA 4J80A 1VQ4V 1R3KC 1Y76A 4DV0B 3P3PA 4PELA 1FPOA 4QIWF 2EIJB 1H8EG 3CRMA 5LMNO 4KUMA 1YJNV 1WPBA 2UUAB 1YCIA 4R6ZA 1DK1A 4DR1B 3RBZA 4GKKB 3D8CA 3WB2A 5BXZA 3ASOB 2QE7G 3SR2C 1L0LH 1Y4MA 1FXVA 3JASB 4O4LB 3M7MX 4X1IA 3THOA 1VF5B 1Y66A 3WFVA 2BTOA 1S76D 2JEXA 1IBLO 1QBZA 2BOBC 4RQFA 1AP5A 1JMKC 4PDVA 1CEZA 1BGYH 3B8MA 2AHYA 2IJHA 4PI2A 3W7UA 3E2EA 1US6A 2QWRB 3RWRD 3AG4C 2P5OA 1SQGA 5KHHA 2H94A 2XHBA 1G8MA 2WSSG 4CH5A 4Z1MG 1QNMA 2F1MA 4OGQB 4UVCA 1NVPB 1WNSA 3F7VC 3NR7A 1BHBA 2JRIA 1M4UA 3ZMVA 5H2FZ 4JASA 4FLTA 1JA8A 3L72H 4NTXA 5J2TB 4YJ2B 4X65O 4PD4F 2ZKOA 1P84F 3ZHUA 2YXHA 2Y4TA 1M56C 1H2MA 4DV4B 1PNLA 2CDYA 1W0KG 2W6IG 4PA7A 3OFNG 3MHSC 2CAZC 2VQFB 3G4SV 2EINB 5J9PC 2IJIA 1COWG 4HZ3A 3TCUA 3OAAG 4YXWG 1XMQO 3OEHG 3F7YC 2L6LA 4JI5O 3BA8A 2FL4A 2WA4A 3ZS8C 5KX5B 3ZBHA 1DTOA 1WA8A 4I0XB 3RYCB 2BE3A 3C90A 4JAUA 4MVUA 5IDJA 4ZBMA 4TSFG 2D3OW 4FMTA 4P9PA 4TQDA 4B3SB 4I50A 3LNMB 1ZLZA 2WLIA 3RYFB 1B6QA 2O57A 1NR7A 2VQFO 1XNRO 1QLNA 1GM9A 3FB6C 4ZIBA 1N34O 1YF2A 4IYHA 3K08A 5KA6A 3CCMV 1ZTEA 2YICA 2XUMA 1EM1A 4B7KA 5IYCO 1WLEA 3OTOB 4X65B 3AG2C 2OIEA 3CD6V 1OCRB 3K59A 1D2DA 1SESA 3OM3B 1NTMH 1PP9H 3IC9A 2QJ1A 1PKXA 5AG2A 5CN0A 4B3TO 2YDEA 1IBLB 1K3EA 2HR3A 2ZNJA 5BR8B 1VARA 4P9OA 3ETQA 2QKAA 3OW2U 3PN1A 4UFZA 3RGBA 3ZHRA 1SQQH 4FLVA 3E8FA 2Y4UA 2M6YA 1WAZA 2VQEO 4K8ZA 1P4RA 4QNHB 5JJEB 3J80N 2LFSA 3JSLA 5IYDO 2BCCH 2B1IA 3ZHVA 4GKJO 2QTOA 4GLXA 3JATB 3L70H 4NVPA 3ZRWA 1HW7A 2CTPA 2ZQMA 4CBCA 1XEQA 1JJ2U 3TGUH 2HKOA 1KQSU 5JCOA 3L71H 4K35A 3DXRB 4IIJA 4J42A 2RJZA 1N32B 2UUCO 2EIJC 3T2MA 4K0KB 4JAAA 3VQXA 2UUAO 1ZX3A 3APQA 4U7NA 4X1YA 4YY3B 1VQKV 1M57C 2OTJV 2N04A 3E86A 4ASUG 5A2QN 2LGWA 5CB4A 1J95A 2QSAA 2VWJA 2JGDB 4FM0A 1T5EA 3STZC 2LQTA 2CGNA 2F4VB 1AJNA 4FJCC 4DK0A 2IM9A 2RDCA 1GRJA 4LCUC 1DF5A 4MT8A 3CYOA 3RYCA 1LUWA 2UXDB 1YEWA 3D3IA 1I94O 1AP6A 5GW7A 2RQ6A 1K5QA 1MOFA 1RM1B 1I7FA 1OV9A 4U3JB 4O4HA 4PDMA 3CRAA 3IGAC 4JYAO 4W4LA 2AXTZ 3UT5A 4FM2A 4YIPA 5IJ0A 1J5EO 4QPKA 5EYPA 2R70A 3OT7A 5CBHA 4U7OA 1DGSA 3RVZA 3CHXA 2VQEB 3R65A 1SC5B 5JJJB 1EN5A 1WP8A 2EIKB 5CA1A 2Y0PA 1H2NA 3JD4A 1UPGA 2YS8A 2OCCB 3AEIA 4DR3O 1K97A 1HR0B 4WFGA 5FL7G 1VQ7V 3HKDB 1KUQA 2ZR3A 3OEEG 4PV1B 2WLJA 4YHHB 5GTHZ 2B1GA 2P67A 2KB1A 4WBNB 4N23A 4J7ZA 4O4IA 4EB6A 4YJ2A 3CCJV 3G71V 4R7CA 4IIJB 3AK2A 4DW0A 3RW0A 4C7UA 4GZRB 1YJWV 1CP9A 5LGUA 4HNAA 2JGUA 4LF6O 4FLWA 5L3CA 2CUGA 4JTAB 1PNMA 2Y69C 1CXZB 3LSUA 4DR2B 5LA6A 4GCZA 2G38A 1H2LA 1V9PA 4WFHA 1XUQA 3IJ4A 3BEHA 2Q9LA 2ZINA 3JAKB 3FKSG 3RYIB 3OMIB 1MSDA 4X64O 2X6CA 1R3LC 2Y48A 4F6RB 4JI6O 1XMOB 2EZPA 2Q0OC 4J41A 1W59A 1KKDA 1L1FA 4GX2A 3CSXA 4I5SA 1XHZA 1GN2A 3CC4V 4BIZA 4I55A 1S77D 4JYAB 4FPPA 5DM6V 1YHQV 2JDIG 5H6RA 5ITZB 4DV2O 4GYCB 5IJ0B 5KX5A 1GM8A 2LW1A 2GV9A 1IXMA 5EC1C 3ZEDA 3CRRA 4Z2WA 2P06A 1F4MA 2B9ZA 1WPXA 3KKYA 2W0XA 1TUEB 1SZXA 4LF9O 2HVJC 1NI8A 4LBEC 4W4KA 3OMNB
chains in the Genus database with same CATH topology
4NTYA 3IJ4A 2FB5A 2QTSA 4FZ1A 4NTXA 3S3WA 3S3XA 2L35A 1WP8A 1WP7A 3N27A 4NYKA 4NTWA 4FZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTY A;  3IJ4 A;  2FB5 A;  2QTS A;  4FZ1 A;  4NTX A;  3S3W A;  3S3X A;  2L35 A;  1WP8 A;  1WP7 A;  3N27 A;  4NYK A;  4NTW A;  4FZ0 A; 
#chains in the Genus database with same CATH topology
 4OXS A;  4I4T B;  3BFR A;  4NXM B;  1XNQ B;  3ZX6 A;  2HVK C;  1PV0 A;  2QR4 A;  1SQV H;  4L87 A;  3SJC C;  2IU0 A;  2X7R B;  2QWQ B;  4MVS A;  3QO7 A;  4X64 B;  4MS2 A;  3RN4 A;  2JK5 C;  2VWK A;  1BZK A;  1WP7 A;  2Q69 A;  1OJH A;  3ZN1 A;  2EZO A;  5B1O A;  5KHI A;  1THZ A;  3LSS A;  1GM7 A;  3MHH C;  2LP7 A;  2DQ0 A;  4ZI7 B;  4NKG B;  1YXB A;  2ODM A;  4FLX A;  3HKC B;  3SPJ A;  1JPX A;  3IC7 A;  2WLL B;  3AG4 B;  1G6U A;  5JQG B;  1MG1 A;  3HKB A;  4H0L B;  3G67 A;  2EIL C;  5E79 Z;  3FD9 A;  4HAM A;  1BQ0 A;  4DRX A;  3CMA V;  1QR9 A;  2K1E A;  1OCC B;  4MVO A;  1K33 A;  2N05 A;  1SF9 A;  4KHP B;  4X66 B;  2PYL A;  2DWE C;  4X89 A;  1H2K A;  1SQB H;  2YXL A;  3M99 B;  3W7W A;  2K9P A;  3VBB A;  1Q81 W;  1FYJ A;  2EBO A;  2QWP B;  2F93 B;  3TJT A;  4LFB B;  4LR3 A;  4LF4 B;  1M57 B;  1UJW B;  3UO3 A;  3P30 A;  1NT2 B;  1H2G A;  4JYY A;  2CE4 A;  4H33 A;  3K06 A;  2R72 A;  3DC5 A;  1N34 B;  4UCS A;  4FLY A;  2YID A;  4L8J A;  3KG2 A;  1GKF A;  3U10 A;  1E1Q G;  5B66 Z;  5FPR A;  4ZOL A;  2CTR A;  1S5J A;  2ZDI C;  1KEC A;  3EVK A;  1RSO A;  3T1H O;  2R9A A;  3EXA A;  4J11 A;  2MK3 A;  4B3S O;  4X9Q A;  3OGC C;  4CC6 A;  3CPW U;  3VQW A;  5B1A C;  2EJ7 A;  1P7G A;  2CH7 B;  4DR6 O;  1N0N A;  1NVP D;  3HKE A;  3E22 B;  4IGG A;  4B08 A;  4DR7 B;  1WA8 B;  4I0X A;  3H1H H;  1JFF B;  2XND G;  1N0J A;  3QNE A;  3SJQ C;  1SKV A;  1SQX H;  1G1X B;  1YI2 V;  2GTS A;  4P2Z A;  4LWS A;  4QE7 A;  5LOV B;  2QGN A;  4P30 A;  2NNU A;  2QM8 A;  1PL4 A;  1VQ8 V;  2DOS A;  4JI4 O;  4U3F H;  2WAM A;  3ZHS A;  2A06 H;  4I9Q A;  1EZJ A;  2DJV A;  3FB7 C;  3BPZ A;  1MSW D;  1E1R G;  5BMV B;  4FLZ A;  4JI7 O;  2P4V A;  5KUK A;  3C3S A;  4PA6 A;  4BIO A;  4F4L A;  3CS5 A;  1NQT A;  3HPL C;  2QKS A;  4DR2 O;  3L9D A;  4K0K O;  3CE2 A;  4H37 A;  4EEQ A;  1FD9 A;  4JYC A;  1GH6 A;  3H1I H;  4F6E A;  4F6R A;  1I5X A;  2EX3 A;  4MTO A;  4X1Y B;  2Q4P A;  1XL6 A;  3OTO O;  2ZXW C;  4FZ1 A;  3H1L H;  3K5O A;  1NTK H;  2WPD G;  1R3J C;  1FJG O;  1JOY A;  1AI5 A;  4UB6 Z;  2DWD C;  2EIK C;  2M7W A;  5EIB C;  2YIB A;  1MAB G;  4KFM A;  1TAE A;  1IBK O;  5E1A C;  4X1I B;  1ZL8 A;  3T1Y O;  4MVR A;  3BCC H;  3C3T A;  4B3M B;  3N2K A;  3KZI Z;  4X66 O;  4O4I B;  4EB6 B;  2AHZ A;  4ZHQ B;  2Q7E A;  4DR7 O;  3GB7 C;  3K9A A;  1FXH A;  3D36 A;  5C93 A;  2Z0A A;  4XDJ A;  5L3D A;  3P3N A;  4KP4 A;  2OTL V;  1YTF D;  2YEV A;  2Z5U A;  4UCT A;  1IUR A;  1GK9 A;  2PTM A;  4DV0 O;  5LYJ B;  5LHG A;  1R1B A;  1I08 A;  1NKD A;  1QCE A;  2V1D A;  3MDS A;  3QO8 A;  3K5L A;  2JEU A;  3O65 A;  1GMG A;  2Y69 B;  3Q4H A;  3STL C;  2P6J A;  3JD3 A;  4AQY O;  1URF A;  5F2V O;  4UV9 A;  3CC2 V;  3CX5 F;  4RWU A;  2DMX A;  5J2U B;  4EKW A;  3WB1 A;  5LMU O;  2PY5 A;  4G28 B;  2VRZ A;  4DUY O;  3ZMU A;  3AK3 A;  3E8G A;  4FFK A;  2ARH A;  2F95 B;  2JGD A;  3WB0 A;  3HKC A;  1ROP A;  4JV5 B;  1GTO A;  2P7T C;  2ZNI A;  2FML A;  5LMN B;  3ICX A;  3R66 A;  1KB9 F;  1L8D A;  1IBM O;  3U11 A;  3K0G A;  2ATK C;  3E83 A;  2C2A A;  4DV5 B;  4NB5 A;  2B5U A;  4EFE A;  4LFA O;  1HNZ O;  3K5N A;  4JI6 B;  1VP7 A;  1I0H A;  1QQC A;  3CXH F;  1JJO A;  3QVN A;  1IVS A;  4J10 A;  1SZT A;  4Q6G A;  3U0Z A;  4FLU A;  2QTS A;  1H38 A;  2Q73 A;  2EIM C;  3VQY A;  2R9I A;  2HHH O;  3CCR V;  1W2B U;  1TUB B;  2WLN A;  2P90 A;  1IBM B;  3A0B Z;  2RMK B;  1F23 A;  2WLH A;  4K8X A;  4JV5 O;  4LH6 A;  3CCS V;  1RPO A;  3AG2 B;  1HNW B;  5JCO C;  4HBN A;  1OCO B;  2IU3 A;  3M8A A;  2WA3 A;  1BS3 A;  1KKC A;  3NXS A;  4ZI7 A;  2QM7 A;  4OX9 B;  1AIL A;  1AR1 B;  1J5E B;  3P32 A;  4UCV A;  4HNA B;  4LC1 A;  1TA8 A;  5KLV H;  3JAT A;  4J9Y B;  2Q8V A;  5JQG A;  3ZRW B;  1BMF G;  5L3B A;  1Q82 W;  2QA4 V;  3ZHT A;  1XL4 A;  4O4J B;  4TV8 B;  2YEV B;  1OCZ B;  2Q7G A;  3ETE A;  1GN3 A;  3UO2 A;  4YIO A;  1S5L Z;  1I94 B;  5CA3 A;  1VF6 C;  4WBN A;  3SJB C;  2E75 B;  2ZE8 A;  5DN6 G;  1RP3 B;  3OUS A;  1GN6 A;  4D7S A;  3FYE B;  5L3E A;  3AG3 C;  2OIG A;  1XOU A;  3FX7 A;  2UXB O;  4E2L A;  3ABU A;  2Q7H A;  2OWO A;  1MA1 A;  1EN4 A;  3L73 H;  2HG5 C;  1TVK A;  1YJ9 V;  3MD0 A;  4Q20 A;  5CB4 B;  2DYS C;  4ABM A;  1EBO A;  3AG7 A;  2YSU B;  2KSD A;  4XBF A;  2JS3 A;  3J7A U;  4DUZ B;  4NXN O;  3E8B A;  5BZB A;  1TGO A;  2EUL A;  3CB2 A;  2GUZ A;  4LF5 O;  4PDL A;  4QJF B;  2ZCE A;  4JI2 O;  1AB3 A;  4J7J A;  3AG1 C;  1FXK A;  4FVM A;  4QGP A;  5CA0 B;  1EZV H;  4DV4 O;  1X59 A;  4PA3 A;  2A79 B;  3A0H Z;  1FFX A;  5JWP A;  4NTW A;  3UT5 B;  3IAY A;  2DN9 A;  1N8R W;  2E5L O;  2JVD A;  4KL1 A;  5DEC A;  1QR8 A;  4LF9 B;  2GTA A;  2AZ0 A;  3CWB H;  1PPJ H;  4DK1 A;  1RM1 C;  2YIB D;  3B4S A;  1AR4 A;  4GT1 A;  4B7E A;  2Q0A A;  4WFF A;  1K7D A;  1AI4 A;  5B1B C;  1R6K A;  2UU9 B;  1ZL8 B;  3WG7 B;  2UXC O;  3ZN0 A;  4GX1 A;  1W0J G;  4YJ3 B;  1DLB A;  3VOU A;  3D3Q A;  1ZSP A;  2FTK A;  4TT3 G;  4G27 B;  4MVQ A;  1LR1 A;  3SYP A;  2ZE6 A;  1OCO C;  3B09 A;  4MVZ A;  1K92 A;  3OE7 G;  1SET A;  4MTG A;  2HHH B;  2JJ1 G;  1XMO O;  3D36 C;  1D5N A;  3CJH B;  1A32 A;  3JD2 A;  4MVM A;  4JPR A;  1B3Q A;  3ML0 A;  4O4J A;  4TV8 A;  1HNX B;  1KYO F;  4FFB A;  4JGS A;  3BHP A;  5LP6 C;  2ITD C;  4QE9 A;  1PM9 A;  3RVY A;  1XRE A;  3JAW A;  2QWO B;  4RUE A;  4CS4 A;  5DED A;  1GAX A;  4TQF A;  1K73 W;  4JTD B;  3JAS A;  3JD1 A;  5EZY A;  1HDJ A;  1ORQ C;  4EFB A;  2UUB O;  2PUS A;  3RYH A;  3FYI B;  4X62 O;  2PF4 E;  2WLM A;  3ETG A;  1EFR G;  2ZR2 A;  3BVO A;  1YTF B;  2DW4 A;  2CTW A;  4JI3 O;  1XI1 A;  4WFA V;  5LHH A;  5BR8 O;  1QHT A;  2ZM6 B;  4WFE A;  3EFF K;  2XAF A;  3ABM C;  1M9N A;  1OCC C;  3ASN B;  2CTQ A;  3JD0 A;  2HJD A;  2F66 C;  1RFY A;  5GTI Z;  4UCU A;  4BR6 A;  5IJ9 B;  4CZZ A;  4DR4 O;  3ABK B;  1NH2 B;  3CJH A;  5LP6 B;  5EC2 C;  3DSQ A;  5KAF Z;  1FFX B;  2OCH A;  4CS3 A;  4YY3 O;  1V54 C;  2X0L A;  1Q6U A;  2YI9 A;  4AHC A;  1ZUQ A;  2UU9 O;  4JI3 B;  4J7K A;  4LFB O;  1XNQ O;  1RPR A;  3JAK A;  4IL6 Z;  1KU9 A;  3W7X A;  3S3W A;  2CGO A;  4JI4 B;  4DV7 O;  4YJ3 A;  2NN4 A;  4DYL A;  2EIL B;  5B3S B;  3CCU V;  3PJS K;  1ENV A;  2IW5 A;  3I55 V;  5JVD B;  1P7B A;  4I4T A;  5IYZ A;  4BAY A;  3UM7 A;  1FKA O;  1ZAU A;  1XIL A;  4JTC B;  3SPC A;  4JI2 B;  4H44 B;  3JSN A;  4WF9 V;  4TOI A;  4MSW C;  1NBM G;  1GN4 A;  4UCR A;  3K3W A;  4PA9 A;  2N74 A;  2UXD O;  5EZY B;  1JQ0 A;  1K9M W;  3L74 H;  2HFE C;  3ZMS A;  4B3T B;  2OCC C;  3F5W C;  1B04 A;  1QU7 A;  1OCR C;  5LP6 A;  4I55 B;  4JYB A;  5LA6 B;  5D5Q A;  3ZMT A;  1O9G A;  1IDS A;  1LUV A;  2X6B A;  3AK1 A;  1ZWI C;  5GON A;  3OTF A;  5LBQ A;  1Z2G A;  2YI8 A;  4DR5 O;  1MZF A;  1X4T A;  2KG7 A;  1S72 V;  2ZM6 O;  2XAH A;  2ETN A;  3CCE V;  2Q68 A;  1ARO P;  5L3G A;  5IJ9 A;  4DXW A;  4LF4 O;  4TV9 A;  5EBL C;  4UXN A;  5LMU B;  4O4L A;  5KA5 A;  3J81 N;  4LH7 A;  4UUJ C;  3RYH B;  4DV2 B;  3FAV A;  4NYK A;  3LSQ A;  5JH7 B;  3OGI B;  1AVM A;  1S5H C;  3SGI A;  1SQP H;  3DTU B;  2HLD G;  2XTA A;  2ZE5 A;  2KG7 B;  3H01 A;  2XT9 A;  4MW3 A;  4IHJ A;  1FS0 G;  4DV7 B;  1HR0 O;  2BTQ A;  4RQE A;  1XMQ B;  1VQL V;  4X8A A;  1F7Y A;  1CPY A;  1XHX A;  3E35 A;  3ETD A;  3IFX A;  3RYF A;  5CBF A;  4FM1 A;  5LXT A;  4DR1 O;  1Z5V A;  2YIA A;  3CEI A;  3SYA A;  2ZT9 B;  3GWK C;  4DV6 O;  1VQ9 V;  3CCL V;  3N27 A;  4RUF A;  3B2E E;  2YC0 A;  4QPJ A;  1N4C A;  4N21 A;  5ITZ A;  3T1H B;  4JI8 O;  3CRQ A;  5A9G A;  1OCZ C;  4R8C A;  1Q43 A;  1FXK C;  1FXK B;  3UQ8 A;  1JVM A;  2WLI B;  3HR0 A;  2E76 B;  5JVD A;  5FLX N;  5HFM A;  2LFR A;  1SA0 A;  1EN6 A;  2YXY A;  3ABL B;  1Y76 B;  1D5A A;  4O2B A;  2E3C A;  4B3R B;  2ZXW B;  1AI7 A;  2Q6A A;  1BT8 A;  4JAV A;  1YZB A;  1SQF A;  1Q86 W;  2GSM B;  2PGG A;  2W6J G;  3RFR A;  3CXC U;  4DO2 A;  5KHG A;  3DXR A;  4KXR A;  1XBL A;  1GO3 F;  2OYQ A;  4LF5 B;  1AJP A;  1VF7 A;  1N33 B;  4UVA A;  3T1C A;  3OD4 A;  3OR6 C;  1SA0 B;  1Y6X A;  4KHP O;  4NTY A;  1NTZ H;  4ICG A;  2ADQ B;  2P4K A;  3K04 A;  2NLJ C;  2IJK A;  3B8N A;  3ASO C;  1VQN V;  1VF6 A;  5KMG B;  4RO2 A;  4FFB B;  3JAM N;  4HYO A;  4ZHQ A;  2WWW A;  1L0N H;  2FB5 A;  5BY1 A;  3FB5 C;  3BAB A;  3QTC A;  1RSO B;  4D6T H;  1M90 W;  2LW7 A;  1KBH A;  1MNG A;  1Y74 B;  3H1J H;  3A0R A;  1UFI A;  4GUN A;  1KP3 A;  4LWS B;  3LDC A;  5LGT A;  3T4Z A;  4I7Z B;  1TVK B;  3CME V;  1SS3 A;  4DV6 B;  2A9H A;  1QVG U;  3ZHQ A;  4UCO A;  1N36 B;  2HEP A;  4JI1 O;  4DV1 B;  2Z3Y A;  5B3S C;  1Z5W A;  1IBK B;  2A7W A;  3T4D A;  1P49 A;  2EIM B;  3SPI A;  1FJG B;  5L3F A;  3B40 A;  1TUB A;  5B1A B;  4D7T A;  4FK5 C;  1BQZ A;  2XAS A;  5H9C A;  5FNV A;  4BIU A;  2ZD9 A;  4DW1 A;  4AQY B;  1KD1 W;  1AJQ A;  2MW2 B;  4GKJ B;  2H8P C;  5C8Y A;  3APO A;  2ZIO A;  4FZ0 A;  4IT5 A;  2AGA A;  2W0F C;  3SPG A;  3KCY A;  1K4C C;  3ABM B;  4JI8 B;  5B5E Z;  2QKC A;  3DGE A;  1MZE A;  1F4N A;  2WLK A;  3L75 H;  3JAL B;  3SJA C;  3HKD A;  3LDD A;  2BTQ B;  2F43 G;  2UXX A;  5CMU A;  3K79 A;  2UUC B;  1N36 O;  3BRC A;  3GWO A;  1B06 A;  3TXS A;  5IT9 N;  2RCV A;  1NJI W;  2A0L A;  3SYC A;  5CA1 B;  3SYO A;  4LFA B;  3E89 A;  3SPH A;  4DV5 O;  1VQ5 V;  4E4E A;  2R9R B;  1Q90 D;  4R50 A;  5IWA O;  2DYR B;  3K58 A;  1VQ6 V;  4B3M O;  4CH3 A;  2AW9 A;  1N33 O;  1N32 O;  3T1Y B;  2DE0 X;  4I9W A;  4JI0 B;  4MTX A;  1PNK A;  4O2A A;  3JCZ A;  3ZRV A;  1HNZ B;  1K8A W;  3ASN C;  3CP1 A;  4JI0 O;  4DUY B;  4O4H B;  4U3J A;  4XDL A;  3LNN A;  5EBM C;  2E74 B;  5LL6 Y;  1IX9 A;  1PL0 A;  3CCQ V;  2QEX V;  2CK3 G;  2DYS B;  1K4D C;  5LHI A;  4TUY A;  3X2Q B;  2RNB A;  4JI5 B;  2IBZ H;  4CH6 A;  4MTF A;  2VS0 A;  1G4Y B;  1VQO V;  1F51 A;  4DR4 B;  4ZOL B;  4CC5 A;  4BWA A;  3K03 A;  3TXQ A;  4LF7 B;  2Q67 A;  1U97 A;  1JX9 A;  3I5D A;  4B3R O;  4X20 A;  3K57 A;  2X6A A;  2XOK G;  3OUF A;  4OPA A;  2YUA A;  3AG1 B;  4PDR A;  1HNW O;  5IYZ B;  2ILM A;  4CS2 A;  4PA4 A;  3A8T A;  5TIS Z;  1XNR B;  1R3I C;  5JJN B;  3WG7 C;  2IH3 C;  2P22 C;  4PHZ A;  2UUB B;  3RYI A;  1YVW A;  2GDS A;  1NH2 D;  2KQX A;  1YSC A;  5J2U A;  3OMA B;  2V7Q G;  5EK0 A;  4AIL C;  3I56 V;  3HKB B;  1KC8 W;  1WN7 A;  3GVM A;  3RT3 C;  4LNU A;  5KHJ A;  4ZKI A;  3E8H A;  1S0V A;  2UXN A;  4TV9 B;  2H3O A;  2QM4 A;  5KUM A;  3JCU Z;  2A3Q A;  4JI7 B;  1LNQ A;  3B77 A;  4WFB V;  4JF3 A;  4X1K A;  4IYI A;  5BMV A;  5LYJ A;  4WCE V;  5GON B;  1Y67 A;  4TWK A;  4LF8 O;  3ZMZ A;  3LDE A;  3F5T A;  1M93 A;  4DR6 B;  3ABT A;  5IWA B;  3ZIA G;  3H9V A;  3Q4H B;  1H2S B;  2F4V O;  3ZJZ A;  1NS1 A;  5KAI Z;  3ABK C;  4LF8 B;  4K3A A;  4MW8 A;  1FAF A;  3FB8 C;  5IY5 B;  5C8Y B;  5IY5 C;  1WB7 A;  4X1K B;  5KHK A;  3BAA A;  2ADP A;  2OT5 A;  5CBG A;  2Q5Z A;  3ZRX A;  4FIP C;  1R73 A;  3UCS C;  3SDL A;  1VQP V;  4DRX B;  3TET A;  2GHY A;  5B1B B;  1Y74 A;  4LF7 O;  3W7T A;  1BCC H;  2EJR A;  2ZIM A;  1R6T A;  1VQM V;  1YIT V;  2L35 A;  3A2F A;  3N2K B;  2BOC C;  1K5S A;  1NZ6 A;  1U96 A;  1MMM A;  5LGN A;  3ZCC A;  2ZE7 A;  4PJ0 Z;  4XDK A;  1OHH G;  4I50 B;  1JFF A;  2BSK B;  2JJ2 G;  4Z1V A;  1BE3 H;  2ZDI A;  5CA0 A;  4NR1 A;  2IJJ A;  4DV1 O;  1PD3 A;  2JS5 A;  4GKK O;  2KKW A;  1SRY A;  3BA9 A;  2AZ2 A;  2QWN B;  2XAJ A;  2FYU H;  1NU1 H;  4JZG A;  4OX9 O;  1K34 A;  1M1K W;  2LGQ A;  2IH1 C;  1S3J A;  3CRC A;  4RAI A;  3X2Q C;  4JZ2 A;  3CC7 V;  1V54 B;  2QDO A;  3JAR B;  4IHJ B;  3ABL C;  1KMI Z;  4O2A B;  1YDX A;  4DUZ O;  4NXN B;  4UVB A;  3H1K H;  5H5N A;  2DYR C;  1QVF U;  1NR1 A;  2JIZ G;  2GBO A;  2RN9 A;  5D5P A;  1BHA A;  1R6N A;  3TK1 A;  1Q8I A;  1VIB A;  3OR7 C;  3HKE B;  1FFT B;  3QG5 A;  2PI5 A;  3S3X A;  2UXB B;  2PI4 A;  4OPH A;  3JYC A;  3AG3 B;  2PZS A;  3HB3 B;  1IZ3 A;  5EIB D;  5FNV B;  5KMG A;  2HJF C;  3SYQ A;  4LP8 A;  1Q6H A;  2LJ2 A;  3N2G A;  4DV3 O;  1HNX O;  4LF6 B;  4YHH O;  1HP8 A;  5J2T A;  3K0D A;  3JAL A;  4J9Z B;  3UKM A;  2FKX A;  1IXB A;  2WLL A;  2D2C B;  4DV3 B;  5IYB O;  5H6Q A;  1O9H A;  1QLE C;  1BL8 A;  1QLE B;  1M5I A;  3W7S A;  4X88 A;  5FPO A;  1V55 C;  4LFC O;  1Q5O A;  3N2G B;  4JI1 B;  3QF7 A;  1YIJ V;  3FAV B;  4GX5 A;  3E22 A;  1Q7Y W;  2DQ3 A;  1Q3E A;  3G6B A;  4LFC B;  5EBW C;  1E79 G;  3DC6 A;  2LO1 A;  3QO5 A;  3K9S A;  1H8H G;  2PYJ A;  3CCV V;  4AI8 A;  1Q6I A;  4NXM O;  3O9O A;  1M56 B;  3VQV A;  1AI6 A;  1I5Y A;  1JCH A;  3KCX A;  5HFL A;  5JH7 A;  3LUT B;  4LNU B;  1SER A;  5LXT B;  2EIN C;  3WU2 Z;  1HWY A;  2UXC B;  3BY6 A;  1VEW A;  4H13 B;  2GUZ B;  1AR5 A;  2XAQ A;  1OZ0 A;  3G80 A;  1JR9 A;  1V55 B;  3JAR A;  3MAQ A;  5B1N A;  3K5M A;  2E5L B;  2NR5 A;  2CH7 A;  1WB8 A;  5IE9 A;  2XAG A;  5K1P A;  5K1X A;  4BW9 A;  4UV8 A;  4X20 B;  4UB8 Z;  4A5U B;  4PI0 A;  1KP2 A;  1XQ8 A;  3FFQ A;  1DF4 A;  3ZRS A;  3G6E V;  2Y0I A;  4O2B B;  5EYP B;  4DR3 B;  1WJZ A;  2ITC C;  1BSM A;  2HP8 A;  4CH4 A;  2V4D A;  4DR5 B;  4TUY B;  2BSK A;  3JAW B;  5LOV A;  3EHB B;  4BW5 A;  4X62 B;  2F23 A;  1VMG A;  4GX0 A;  4G2K A;  1XDC A;  4J80 A;  1VQ4 V;  1R3K C;  1Y76 A;  4DV0 B;  3P3P A;  4PEL A;  1FPO A;  4QIW F;  2EIJ B;  1H8E G;  3CRM A;  5LMN O;  4KUM A;  1YJN V;  1WPB A;  2UUA B;  1YCI A;  4R6Z A;  1DK1 A;  4DR1 B;  3RBZ A;  4GKK B;  3D8C A;  3WB2 A;  5BXZ A;  3ASO B;  2QE7 G;  3SR2 C;  1L0L H;  1Y4M A;  1FXV A;  3JAS B;  4O4L B;  3M7M X;  4X1I A;  3THO A;  1VF5 B;  1Y66 A;  3WFV A;  2BTO A;  1S76 D;  2JEX A;  1IBL O;  1QBZ A;  2BOB C;  4RQF A;  1AP5 A;  1JMK C;  4PDV A;  1CEZ A;  1BGY H;  3B8M A;  2AHY A;  2IJH A;  4PI2 A;  3W7U A;  3E2E A;  1US6 A;  2QWR B;  3RWR D;  3AG4 C;  2P5O A;  1SQG A;  5KHH A;  2H94 A;  2XHB A;  1G8M A;  2WSS G;  4CH5 A;  4Z1M G;  1QNM A;  2F1M A;  4OGQ B;  4UVC A;  1NVP B;  1WNS A;  3F7V C;  3NR7 A;  1BHB A;  2JRI A;  1M4U A;  3ZMV A;  5H2F Z;  4JAS A;  4FLT A;  1JA8 A;  3L72 H;  4NTX A;  5J2T B;  4YJ2 B;  4X65 O;  4PD4 F;  2ZKO A;  1P84 F;  3ZHU A;  2YXH A;  2Y4T A;  1M56 C;  1H2M A;  4DV4 B;  1PNL A;  2CDY A;  1W0K G;  2W6I G;  4PA7 A;  3OFN G;  3MHS C;  2CAZ C;  2VQF B;  3G4S V;  2EIN B;  5J9P C;  2IJI A;  1COW G;  4HZ3 A;  3TCU A;  3OAA G;  4YXW G;  1XMQ O;  3OEH G;  3F7Y C;  2L6L A;  4JI5 O;  3BA8 A;  2FL4 A;  2WA4 A;  3ZS8 C;  5KX5 B;  3ZBH A;  1DTO A;  1WA8 A;  4I0X B;  3RYC B;  2BE3 A;  3C90 A;  4JAU A;  4MVU A;  5IDJ A;  4ZBM A;  4TSF G;  2D3O W;  4FMT A;  4P9P A;  4TQD A;  4B3S B;  4I50 A;  3LNM B;  1ZLZ A;  2WLI A;  3RYF B;  1B6Q A;  2O57 A;  1NR7 A;  2VQF O;  1XNR O;  1QLN A;  1GM9 A;  3FB6 C;  4ZIB A;  1N34 O;  1YF2 A;  4IYH A;  3K08 A;  5KA6 A;  3CCM V;  1ZTE A;  2YIC A;  2XUM A;  1EM1 A;  4B7K A;  5IYC O;  1WLE A;  3OTO B;  4X65 B;  3AG2 C;  2OIE A;  3CD6 V;  1OCR B;  3K59 A;  1D2D A;  1SES A;  3OM3 B;  1NTM H;  1PP9 H;  3IC9 A;  2QJ1 A;  1PKX A;  5AG2 A;  5CN0 A;  4B3T O;  2YDE A;  1IBL B;  1K3E A;  2HR3 A;  2ZNJ A;  5BR8 B;  1VAR A;  4P9O A;  3ETQ A;  2QKA A;  3OW2 U;  3PN1 A;  4UFZ A;  3RGB A;  3ZHR A;  1SQQ H;  4FLV A;  3E8F A;  2Y4U A;  2M6Y A;  1WAZ A;  2VQE O;  4K8Z A;  1P4R A;  4QNH B;  5JJE B;  3J80 N;  2LFS A;  3JSL A;  5IYD O;  2BCC H;  2B1I A;  3ZHV A;  4GKJ O;  2QTO A;  4GLX A;  3JAT B;  3L70 H;  4NVP A;  3ZRW A;  1HW7 A;  2CTP A;  2ZQM A;  4CBC A;  1XEQ A;  1JJ2 U;  3TGU H;  2HKO A;  1KQS U;  5JCO A;  3L71 H;  4K35 A;  3DXR B;  4IIJ A;  4J42 A;  2RJZ A;  1N32 B;  2UUC O;  2EIJ C;  3T2M A;  4K0K B;  4JAA A;  3VQX A;  2UUA O;  1ZX3 A;  3APQ A;  4U7N A;  4X1Y A;  4YY3 B;  1VQK V;  1M57 C;  2OTJ V;  2N04 A;  3E86 A;  4ASU G;  5A2Q N;  2LGW A;  5CB4 A;  1J95 A;  2QSA A;  2VWJ A;  2JGD B;  4FM0 A;  1T5E A;  3STZ C;  2LQT A;  2CGN A;  2F4V B;  1AJN A;  4FJC C;  4DK0 A;  2IM9 A;  2RDC A;  1GRJ A;  4LCU C;  1DF5 A;  4MT8 A;  3CYO A;  3RYC A;  1LUW A;  2UXD B;  1YEW A;  3D3I A;  1I94 O;  1AP6 A;  5GW7 A;  2RQ6 A;  1K5Q A;  1MOF A;  1RM1 B;  1I7F A;  1OV9 A;  4U3J B;  4O4H A;  4PDM A;  3CRA A;  3IGA C;  4JYA O;  4W4L A;  2AXT Z;  3UT5 A;  4FM2 A;  4YIP A;  5IJ0 A;  1J5E O;  4QPK A;  5EYP A;  2R70 A;  3OT7 A;  5CBH A;  4U7O A;  1DGS A;  3RVZ A;  3CHX A;  2VQE B;  3R65 A;  1SC5 B;  5JJJ B;  1EN5 A;  1WP8 A;  2EIK B;  5CA1 A;  2Y0P A;  1H2N A;  3JD4 A;  1UPG A;  2YS8 A;  2OCC B;  3AEI A;  4DR3 O;  1K97 A;  1HR0 B;  4WFG A;  5FL7 G;  1VQ7 V;  3HKD B;  1KUQ A;  2ZR3 A;  3OEE G;  4PV1 B;  2WLJ A;  4YHH B;  5GTH Z;  2B1G A;  2P67 A;  2KB1 A;  4WBN B;  4N23 A;  4J7Z A;  4O4I A;  4EB6 A;  4YJ2 A;  3CCJ V;  3G71 V;  4R7C A;  4IIJ B;  3AK2 A;  4DW0 A;  3RW0 A;  4C7U A;  4GZR B;  1YJW V;  1CP9 A;  5LGU A;  4HNA A;  2JGU A;  4LF6 O;  4FLW A;  5L3C A;  2CUG A;  4JTA B;  1PNM A;  2Y69 C;  1CXZ B;  3LSU A;  4DR2 B;  5LA6 A;  4GCZ A;  2G38 A;  1H2L A;  1V9P A;  4WFH A;  1XUQ A;  3IJ4 A;  3BEH A;  2Q9L A;  2ZIN A;  3JAK B;  3FKS G;  3RYI B;  3OMI B;  1MSD A;  4X64 O;  2X6C A;  1R3L C;  2Y48 A;  4F6R B;  4JI6 O;  1XMO B;  2EZP A;  2Q0O C;  4J41 A;  1W59 A;  1KKD A;  1L1F A;  4GX2 A;  3CSX A;  4I5S A;  1XHZ A;  1GN2 A;  3CC4 V;  4BIZ A;  4I55 A;  1S77 D;  4JYA B;  4FPP A;  5DM6 V;  1YHQ V;  2JDI G;  5H6R A;  5ITZ B;  4DV2 O;  4GYC B;  5IJ0 B;  5KX5 A;  1GM8 A;  2LW1 A;  2GV9 A;  1IXM A;  5EC1 C;  3ZED A;  3CRR A;  4Z2W A;  2P06 A;  1F4M A;  2B9Z A;  1WPX A;  3KKY A;  2W0X A;  1TUE B;  1SZX A;  4LF9 O;  2HVJ C;  1NI8 A;  4LBE C;  4W4K A;  3OMN B; 
#chains in the Genus database with same CATH homology
 4NTY A;  3IJ4 A;  2FB5 A;  2QTS A;  4FZ1 A;  4NTX A;  3S3W A;  3S3X A;  2L35 A;  1WP8 A;  1WP7 A;  3N27 A;  4NYK A;  4NTW A;  4FZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...