4NTYA

Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
408
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
total genus 109
structure length 406
sequence length 408
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntyA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntyA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntyA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntyA02
3N27A 2QTSA 1WP7A 4NTYA 3S3WA 2L35A 4NTWA 4NYKA 3IJ4A 4FZ1A 4FZ0A 4NTXA 3S3XA 2FB5A 1WP8A
chains in the Genus database with same CATH superfamily
2ZDIA 1YXBA 4NTXA 4LWSB 3ZMTA 4X62B 1GTOA 1HNWB 1N36B 1M56B 5JVDB 3J7AU 1GKFA 2EJRA 4WBNA 1T5EA 5C93A 4F6RB 4KP4A 5LP6C 3T4DA 1XI1A 3AG7A 1BL8A 3C90A 3RYHA 4PD4F 2P67A 4JZ2A 1S5HC 2BTOA 1VQ4V 1KD1W 2YI8A 2N74A 2UUBB 1JX9A 1TA8A 5LL6Y 4LF7O 3A0RA 2BE3A 1SA0A 4O2AB 2ZD9A 4LNUA 4O4HA 1K7DA 4DV6O 5CBGA 1IDSA 4KL1A 3CCRV 1HNZO 5CMUA 4DR1O 4K8ZA 4I9QA 4AQYO 3OR6C 2KKWA 3CMEV 1XNQB 5CB4A 3CC7V 3OD4A 3JAWB 2P6JA 2WLLB 2YUAA 3RBZA 3LDDA 1N0JA 3IC9A 4X64O 1YITV 3F7VC 1BZKA 4B7KA 3SJCC 1M57C 2GUZB 2EZPA 4O2BA 5KA6A 1F23A 1FXKB 3JARA 3AK3A 1OZ0A 3K5NA 4DYLA 4MTXA 4Z1MG 4YJ3A 3A8TA 3OUFA 2LFRA 5FLXN 1OHHG 4G27B 4GKKO 1RSOA 4KFMA 2OCCB 1JJOA 3K79A 2VRZA 1M4UA 5EYPA 1PNKA 5JH7A 2F23A 3BAAA 3ZMVA 4RUEA 3ZIAG 3ABMB 2BSKA 3HKDA 1XQ8A 1E79G 2B1GA 2DOSA 4WBNB 3CCSV 3WG7C 2PGGA 3R65A 3RYHB 3X2QC 1VQMV 4YIOA 5DEDA 5L3EA 5KHIA 1F51A 1LUWA 3OMAB 1FJGB 3JCZA 1YEWA 1YCIA 4HBNA 1FFXB 1SA0B 1JQ0A 4O4HB 2Y69B 1U97A 3IJ4A 3CC2V 2KG7A 1Q82W 4X65O 1XDCA 2YXHA 1WJZA 3GWOA 3KKYA 4GUNA 5KHGA 1I7FA 4B3SB 5IYDO 2W0XA 4B3MO 2H8PC 2YI9A 4BAYA 4BIOA 1F7YA 4DR3B 1K5SA 1QLNA 3BCCH 2YXYA 2IU3A 3JSNA 4DV2B 3BABA 5JJEB 4MVZA 4FMTA 4K35A 2KSDA 4CH4A 2CUGA 5FPOA 1K9MW 2WLHA 1V55C 1Y4MA 4O2BB 3UT5B 3AG2C 4DV7O 3JARB 4DV0O 4LF8O 1W2BU 1RPRA 2DQ0A 1FYJA 4YJ3B 5L3BA 2UXDO 3RFRA 2LO1A 4ZHQA 3SJBC 2IH3C 3GB7C 2QSAA 1RSOB 3E83A 4NYKA 2HHHO 2DQ3A 3ABTA 4XDKA 3RYCB 4WFEA 4IT5A 1FXVA 2XT9A 1MSDA 4UUJC 2A3QA 1NU1H 5GTHZ 4LH6A 3N2GA 3DTUB 2DWEC 3ZRWA 5IYZA 5FPRA 1VQ9V 1O9GA 1K4DC 5B5EZ 1Q43A 2O57A 1AB3A 2DYSB 3I55V 5AG2A 4JTCB 1HR0B 3VQWA 3BFRA 4U3JA 5EC2C 4DK1A 2WLIB 1D5NA 3IFXA 1VQLV 4UCVA 1KU9A 3MDSA 2JGDA 2KG7B 3JATA 2R9IA 4DR2B 1YIJV 4EKWA 2Q73A 3G6BA 3MD0A 5E79Z 4DV7B 4P9PA 1FXHA 2B9ZA 1AJQA 3OGIB 2RN9A 2NLJC 2VS0A 3OTOO 4RWUA 3CEIA 4PA7A 3CCUV 1QCEA 4X1IB 5BY1A 3X2QB 4UV8A 1GMGA 5TISZ 3UKMA 3SYAA 2HHHB 2CGNA 1CXZB 4GKJO 2XAGA 4UFZA 3W7SA 2Z0AA 3P3NA 3APQA 2UXBO 4GX5A 1TUEB 1EM1A 5H9CA 4BWAA 3KCXA 4I5SA 2NN4A 2EIMC 3VQXA 1HWYA 3QVNA 3G80A 4O4JA 5FL7G 4KHPB 3BA9A 1URFA 2L35A 2Y48A 3AK1A 5B66Z 2QWPB 4UCTA 4JPRA 1KMIZ 5KMGA 3AEIA 3SPHA 3STZC 2RCVA 1AROP 3UM7A 3CCEV 4TV8A 1V55B 1DF5A 4R8CA 3AG2B 4DUZO 1I94B 3ZMUA 3RVZA 1WPXA 5B1AC 1K33A 3BHPA 1R3JC 2M7WA 2Q0OC 2MW2B 2CH7B 1QVGU 3HR0A 5B1OA 1VQ6V 4MTGA 3CP1A 1IXBA 2EX3A 1HNXO 4K0KO 2RJZA 4YJ2A 1ZLZA 2R72A 2XASA 2IJKA 3H9VA 1YHQV 1SC5B 4LFCB 4ZI7A 2FB5A 3FB5C 1RFYA 2FKXA 3HKBA 4UCUA 2WLMA 1M56C 3H1JH 2PI4A 3ZHVA 3ZN1A 2Q8VA 3ZHQA 1YJ9V 4I50A 1AI4A 1CPYA 3I5DA 2R9AA 3LUTB 4NR1A 2PI5A 1X4TA 4PI0A 2EIKC 4FLYA 3OFNG 1Q86W 4I4TA 3H1HH 5CBHA 1KP2A 5KUKA 1AR1B 2EIJC 1IURA 4U3FH 4UB8Z 3JASA 4DV5B 2UUCB 5GTIZ 1SERA 2HR3A 3QNEA 3CCJV 5LXTA 3B40A 1XNRO 1GH6A 4C7UA 3A0HZ 4LF5B 1SQQH 1BHBA 1YSCA 1L8DA 1XILA 5ITZB 1PV0A 3D36A 1W59A 4NVPA 4NXNO 2OIEA 2UXCB 2P7TC 4HYOA 1YDXA 3RYFA 1TGOA 3ASOB 1Y66A 2QKAA 2R70A 2ZE5A 3QO5A 3B77A 1BS3A 1MABG 3JAMN 2F66C 4MVRA 5KMGB 3RYIB 4K0KB 2ZE8A 5BMVA 3OTFA 5CA0A 1AJNA 2RQ6A 1GM7A 2BOBC 1HNWO 1N36O 1FXKC 4ZBMA 4X66B 1PL0A 1DTOA 2FL4A 2IU0A 3P3PA 1Y74A 4NTYA 5LGTA 3T1CA 3QTCA 2ZINA 4GX1A 1F4MA 2B5UA 1P7GA 1K4CC 2CGOA 4TQFA 4YJ2B 1IBLB 1VQ5V 4TUYB 2LGWA 1XBLA 4H33A 5F2VO 2ZDIC 2PYJA 1KB9F 3N27A 4X20A 4L87A 1Z2GA 2UUBO 3G71V 4ICGA 1AI5A 3HKBB 4AHCA 4Z2WA 4MVOA 1COWG 5LYJB 4JI7B 3I56V 2N04A 1S77D 4FM0A 4FLZA 1FS0G 4J41A 1KQSU 4QPKA 3UO2A 3K58A 1L1FA 4H13B 4CH5A 2E5LB 1Q3EA 5B1AB 4IHJA 3SYCA 2ZNJA 4IL6Z 1YJNV 1XNQO 3BVOA 2YEVB 4LF6B 2PZSA 3ZX6A 1AP5A 2FTKA 3CRCA 2XNDG 1MZFA 1NH2B 3L73H 1BSMA 3JASB 4D6TH 3TJTA 5IYCO 1M5IA 3H1LH 1Y6XA 5JQGB 5BR8B 2OWOA 4GX2A 2JS5A 3ZRSA 2X6BA 1ZL8B 1P4RA 3NR7A 4JV5B 4FFBB 2VWJA 1UFIA 2Y4TA 5L3FA 2N05A 2Q5ZA 1Z5VA 2XAFA 3RYFB 1R6TA 1N0NA 2A79B 2AGAA 2EINB 1VF7A 3MAQA 2V4DA 3SJAC 5H5NA 4W4KA 4YY3B 4TSFG 4E2LA 1KECA 3CSXA 1EZVH 1SQBH 1IBKB 3DC5A 3ZHUA 4MVSA 2JK5C 3EVKA 1XHXA 1QBZA 2EIKB 1WA8A 1PL4A 2K9PA 2CTRA 5BMVB 1B04A 1JCHA 2EIJB 2LQTA 1XHZA 2LP7A 1SZTA 2UXXA 1L0NH 3K03A 2G38A 2ZIMA 5DECA 1NT2B 3SYOA 1H8EG 1Q6HA 2PTMA 3G4SV 5LGUA 1H2LA 3OAAG 3D3IA 3W7XA 1I5YA 1FPOA 3HB3B 5KLVH 4GZRB 4OX9B 4X20B 5KHKA 3ETDA 3CCVV 1FJGO 1WPBA 4QPJA 4UVCA 4DR6B 3DXRB 1G8MA 1N34B 4LR3A 3T1YB 4J10A 2HJFC 1XMOB 2YDEA 1Y67A 4TWKA 4JAVA 3CD6V 5LOVA 3UQ8A 1NVPB 1TUBB 1M93A 3VQVA 3JSLA 4IHJB 4B3SO 4TV9A 1ZAUA 2DYSC 1NR1A 5KHHA 1YJWV 4OGQB 1J5EB 4DR3O 1L0LH 2QM8A 3RGBA 2GV9A 4LF4B 2QKSA 4GT1A 1R3IC 4JYYA 4DV2O 2Z5UA 1Y76B 4K3AA 5IWAB 2CTWA 4EEQA 1PD3A 2HFEC 2IM9A 4DUYB 3UO3A 4UCSA 3SDLA 3B8NA 1U96A 2CK3G 2PUSA 2RMKB 1XL4A 1OCZB 1Q6UA 3FB6C 1OCRC 1QU7A 4LFAB 1S76D 2LGQA 3MHHC 1NBMG 1NTKH 3ZRXA 5KAIZ 1ORQC 3U10A 1DGSA 4IYHA 3THOA 2Q9LA 4JI4B 3JD1A 2ATKC 4LNUB 3LNMB 2R9RB 5HFLA 3T1HB 2KB1A 5JJJB 4FZ0A 2XOKG 3DSQA 5J2TA 3K5OA 5CB4B 2K1EA 5HFMA 4ASUG 2YIAA 1HR0O 3R66A 2JJ2G 1MG1A 1SQXH 4I7ZB 2DWDC 4RUFA 4PDLA 1BQ0A 2C2AA 4PI2A 2ILMA 1ZTEA 3Q4HA 4ZIBA 4DR2O 1ROPA 2WWWA 1NTZH 4TT3G 3QO7A 1NS1A 3G6EV 3K0GA 1SS3A 5IDJA 4TV9B 2ZM6B 2HP8A 4MTOA 5EC1C 2UUAB 4UCRA 3EXAA 1IBMB 3FAVA 4I9WA 1CEZA 4CH6A 2FYUH 4LFBB 1Q90D 2VQEB 3CRQA 3VOUA 4DR7B 5EK0A 1Q81W 4DV4B 4EFEA 4LC1A 1S72V 5EYPB 4MVUA 5FNVA 5JH7B 4MSWC 3LDCA 3J80N 1N33B 2WLJA 1E1RG 2BSKB 4B3TB 1KYOF 3HKDB 5J2UA 3OMIB 3OE7G 2YS8A 4I0XA 2JRIA 4MVMA 2OTLV 4U7NA 3E22A 1YZBA 4DRXA 1WN7A 1RP3B 2CDYA 4F4LA 1GK9A 3CB2A 2GSMB 5CA3A 3CXHF 3AG4B 4KHPO 1GRJA 3LSSA 1AVMA 1EN6A 4R6ZA 1JMKC 1OJHA 1M1KW 3SPCA 4PA3A 2AHZA 4J11A 1WP8A 1X59A 2YC0A 1EBOA 3LSQA 2D2CB 1D2DA 3K08A 3GWKC 1K34A 1I94O 4JI0B 1VQ8V 2Y69C 5IJ0A 3JALA 1NKDA 5L3CA 1GO3F 2F4VB 3E89A 1WB8A 3ASOC 3SR2C 4JYAB 4NXMB 3J81N 2Q4PA 2Q68A 2AHYA 1FFTB 4PA6A 4OPAA 3AG1C 1OCRB 1NJIW 4GX0A 1R3KC 3K3WA 1H2KA 3ABLB 4MS2A 4CBCA 4LFCO 2IH1C 1FAFA 3Q4HB 1NH2D 3CX5F 2NNUA 1VQ7V 2FMLA 4FLTA 3JD3A 4X1KA 2ZQMA 3K5MA 1QVFU 2PY5A 2B1IA 3C3SA 4NB5A 1MNGA 4D7SA 4FLXA 4FJCC 4F6EA 5IT9N 4NKGB 4WFFA 5D5QA 3N2KA 3FAVB 3OW2U 4ZHQB 3CCQV 4JI8B 4JTAB 1IVSA 3FB7C 2F95B 1LR1A 3C3TA 4N21A 2P5OA 5KHJA 5FNVB 4I55A 3JAKA 4DV5O 3HKEA 1DK1A 2UUCO 2ZNIA 1QNMA 4KUMA 4LF5O 4I0XB 1AI6A 2IW5A 3TXSA 4O4IA 3N2GB 1MMMA 3K9AA 3FB8C 4PV1B 3SPJA 2ITCC 3ZRWB 3E8HA 5IYZB 1VEWA 3BPZA 1M90W 2UXCO 1VF5B 3TGUH 3DC6A 3BA8A 1QHTA 1VQPV 5CN0A 4IIJA 3IGAC 1JA8A 3VBBA 3CRMA 4NTWA 4GCZA 3RVYA 3OEEG 1ZX3A 4JI3B 3ZMZA 3K06A 4J7KA 1VF6A 4X9QA 1FD9A 3ZHTA 2DE0X 2JGUA 4U3JB 4PDRA 1QQCA 2Z3YA 2UU9O 1KP3A 5L3GA 2JGDB 3JATB 4WFAV 1K3EA 4PHZA 3D36C 4X66O 3JALB 4BR6A 2WLKA 4O4LA 2EINC 4LP8A 4EB6A 1SQVH 1PNLA 5LGNA 1NVPD 3OM3B 3ZN0A 2Q7HA 2X6CA 4B3RB 3CYOA 1BHAA 1IBLO 1H2GA 3ABKB 4LCUC 3OGCC 1XUQA 5EZYA 3ML0A 1BGYH 3FFQA 3H1KH 3S3WA 3IAYA 3T2MA 3CXCU 4X1KB 1PPJH 1NI8A 4JI7O 4FK5C 4HZ3A 2CE4A 1RM1B 3TXQA 4JI6B 4FLUA 4AILC 2E5LO 1QR8A 2ADQB 4EFBA 1LNQA 4JASA 4O4JB 4W4LA 1JVMA 1VP7A 4G2KA 4LF6O 2EILC 3HKCA 4FM1A 3K0DA 2XAJA 2Y0PA 1JR9A 3CJHA 3WU2Z 4FVMA 1OCOB 4BW9A 2QWQB 4B08A 2DW4A 5DN6G 5BR8O 4FFKA 3L70H 4LWSA 2QM4A 3AG1B 1H2MA 1R73A 5JVDA 3OR7C 4JV5O 2ZE6A 4TV8B 1R1BA 4LF9B 1WLEA 4R7CA 2GBOA 3K57A 1YTFB 1R6NA 4JI1B 1GN6A 2HVKC 3ETQA 4YY3O 1IBKO 3W7WA 4QE7A 1QR9A 2P90A 4U7OA 2YIBA 2DN9A 2ZXWB 2IJHA 1I08A 2HEPA 4WFGA 3BY6A 2EULA 4X88A 1S3JA 4ZI7B 4O2AA 5JCOA 4QNHB 5BZBA 1PKXA 3AK2A 1BE3H 4J9ZB 3U11A 1VMGA 2Q69A 3JCUZ 3K04A 5LMUB 4YHHB 3RN4A 4DR4B 2JEUA 2X7RB 2E76B 3SPIA 4I50B 4UVAA 2H94A 2Q67A 2HKOA 1OCZC 5EBMC 1R3LC 3JAWA 4L8JA 4MW8A 4DR5B 3P32A 4DV3B 4H44B 2EZOA 5KAFZ 1IXMA 4OX9O 4I4TB 2ODMA 3BEHA 4DV1B 3NXSA 3ZHSA 3P30A 1Q7YW 2DJVA 2IJJA 4DR6O 1P49A 2KQXA 1NQTA 2F1MA 5A2QN 2GUZA 2ZIOA 1N34O 3T1YO 5LXTB 1XMOO 2XUMA 1YI2V 1OCCB 4WFHA 5K1PA 1H2NA 1FXKA 2MK3A 2RDCA 3B2EE 4CH3A 2ZE7A 2JVDA 5JJNB 1O9HA 4ZOLA 4Z1VA 3CS5A 4KXRA 3HKCB 4JI2B 3LDEA 3OEHG 4CC5A 1KC8W 3QG5A 1VQOV 1J5EO 3CC4V 2VQFB 4LF4O 2BTQA 2CTQA 1TVKA 4P30A 4WF9V 5IWAO 4R50A 5CA0B 4DUYO 2AZ0A 5H6QA 3FYEB 1AJPA 2E74B 2JJ1G 2A06H 1Y74B 5CA1A 4JGSA 3ASNB 4BIZA 1N32B 3K9SA 3QO8A 4JI5B 3W7TA 1N4CA 3JD0A 3CCLV 2HJDA 4LFAO 4OPHA 2Q7EA 2EILB 1GAXA 1FFXA 3ZCCA 2DYRB 2GHYA 5IJ9A 1XMQB 2ETNA 2P4VA 2QGNA 4JI4O 5B1NA 3CE2A 5CBFA 3CRAA 3ZJZA 1HDJA 3FX7A 3K5LA 3KCYA 1SZXA 4Q6GA 3OUSA 2YICA 1PM9A 3KZIZ 1XEQA 5D5PA 3T1HO 2IJIA 3F5TA 4DXWA 1MOFA 2Q7GA 2ARHA 1JOYA 3AG4C 2ZR3A 3SGIA 5LP6A 4CS2A 3E8BA 1US6A 5JWPA 3ZBHA 2P06A 3A2FA 2UU9B 2E3CA 2GDSA 1V9PA 2LW7A 3UT5A 5KUMA 4RAIA 3H01A 3A0BZ 2QA4V 1GM9A 1SQGA 4UCOA 5B3SC 3F7YC 1I0HA 5KA5A 1GM8A 4ZOLB 3AG3B 2ZM6O 3HPLC 1BCCH 2UUAO 3L9DA 1K8AW 1E1QG 4JF3A 1R6KA 3SYQA 1IBMO 2BTQB 3APOA 1TVKB 3E35A 3TETA 4LFBO 3RYCA 2VQEO 3M7MX 4DR7O 1WA8B 3FYIB 1J95A 3ABLC 4LF7B 1G6UA 4DV4O 2NR5A 1Q8IA 1JJ2U 2W6IG 1Z5WA 1N33O 3ABUA 4H0LB 2QTSA 4DV6B 4B3TO 4PDVA 3ETEA 5CA1B 1HNZB 2W0FC 4GLXA 4DR1B 3WB2A 2YXLA 3L75H 4AQYB 3FD9A 4A5UB 3OT7A 2P22C 1QLEB 1Q6IA 1F4NA 4FPPA 1XREA 4AI8A 2HVJC 3IC7A 4X64B 5B1BC 2WLIA 5IJ9B 2WSSG 3B09A 5A9GA 5KX5A 4P2ZA 2XTAA 5GONA 4QJFB 1NTMH 3WFVA 4JI0O 5LOVB 1KUQA 1YVWA 4TQDA 1AILA 1XOUA 2Q6AA 3L71H 2F4VO 2HLDG 4PDMA 1B3QA 4JYAO 5LP6B 5H6RA 4NXMO 4X1IA 4RO2A 4GKKB 3O65A 2Y0IA 1SRYA 5EIBD 4XDLA 2A0LA 2PYLA 1G4YB 3K59A 1MA1A 2IBZH 2ITDC 2OTJV 4J9YB 2JEXA 1RPOA 4WFBV 2WAMA 4E4EA 2AXTZ 4D7TA 3L72H 1EFRG 1WNSA 1YF2A 4YIPA 2BCCH 3OMNB 2UXNA 2XAHA 2PF4E 1YTFD 2QKCA 4ZKIA 3ABKC 5H2FZ 5BXZA 4JI8O 3ICXA 3U0ZA 4H37A 1HP8A 1M9NA 1CP9A 4UV9A 2QWRB 3TCUA 3JYCA 1M57B 2F43G 4UXNA 1GN2A 1SETA 4X65B 1P84F 4CS4A 1RM1C 3JD4A 3RWRD 2RNBA 1LUVA 1UJWB 2AZ2A 4B3MB 5B3SB 1VIBA 2A7WA 3EHBB 2CH7A 1ZUQA 2Q0AA 5EIBC 2P4KA 4X8AA 2OIGA 4FIPC 1AP6A 5J2TB 1SQPH 1I5XA 3B4SA 4JI3O 3CPWU 1OCOC 4FM2A 1H2SB 3ZS8C 5IYBO 1ENVA 5KX5B 3ZEDA 1S5JA 5GONB 2XAQA 4DV0B 1IX9A 4LF8B 4J80A 4XBFA 3F5WC 1FKAO 3ETGA 4RQFA 3RT3C 2QEXV 3WG7B 3STLC 2UXDB 5LMNO 2CTPA 1IZ3A 3CWBH 1WB7A 2V7QG 4B3RO 1VF6C 3E8GA 4CZZA 1THZA 4JAUA 2ZXWC 4YXWG 3D3QA 2QWOB 3G67A 4JAAA 1S5LZ 1SF9A 4MVQA 4DK0A 3CMAV 1OV9A 1EN5A 5B1BB 3QF7A 4FZ1A 1MSWD 1BMFG 3MHSC 5ITZA 1V54C 2F93B 4FLWA 5J2UB 3LNNA 1H38A 4IYIA 2M6YA 3CRRA 4JI6O 4K8XA 3FKSG 3E22B 1MZEA 4X1YA 4DRXB 2HG5C 1SESA 5LA6A 4DW1A 2E75B 3RYIA 5IY5C 1B6QA 3SJQC 4DO2A 2YIBD 1W0JG 2QR4A 2A9HA 4RQEA 1KKCA 2YSUB 5J9PC 2ZCEA 1K5QA 1OCCC 1K92A 4DW0A 2ZT9B 1BQZA 4IGGA 4LF9O 4BIUA 1DF4A 2WA3A 2H3OA 2QTOA 4HNAA 3OTOB 5IJ0B 2CAZC 3S3XA 4UVBA 5LMNB 1VQNV 4JI1O 1KBHA 1JFFA 2ZR2A 4TUYA 3EFFK 3PN1A 2AW9A 4WCEV 2ADPA 4PA4A 5EBWC 5DM6V 3VQYA 4J42A 2LW1A 1VARA 2OT5A 5E1AC 1XL6A 4GKJB 3RW0A 3GVMA 5LYJA 4CC6A 3CCMV 2JDIG 1B06A 1EZJA 4TOIA 1G1XB 2JS3A 2UXBB 1EN4A 5LMUO 4FLVA 4YHHO 4DR4O 1JPXA 2ZKOA 3PJSK 5L3DA 3KG2A 3ASNC 4PA9A 3N2KB 2YEVA 2D3OW 4QGPA 4DR5O 1KKDA 4DV3O 3ZMSA 5C8YA 3CHXA 4JYCA 4DV1O 4JTDB 3L74H 2VWKA 2X0LA 5JCOC 5JQGA 5GW7A 2DYRC 1AR4A 4I55B 1WAZA 4ABMA 3JAKB 1TAEA 4LBEC 3HKEB 1ZL8A 4QE9A 1HW7A 1NR7A 1K73W 2GTAA 2DMXA 4PJ0Z 4FFBA 2QWNB 1PP9H 1N8RW 4DUZB 3M8AA 4O4IB 3WB0A 4B7EA 2LFSA 4QIWF 4JYBA 1NZ6A 4JZGA 4J7ZA 4X1YB 3BRCA 5LBQA 3WB1A 3DGEA 3E8FA 1W0KG 5LA6B 1BT8A 4F6RA 4JI2O 1SQFA 3H1IH 4IIJB 1H8HG 1HNXB 4N23A 3B8MA 1WP7A 2VQFO 5LHGA 2QDOA 2QM7A 4UB6Z 3E86A 1ZWIC 4X62O 1AR5A 3ZRVA 1VQKV 2W6JG 2L6LA 2QE7G 3JD2A 3UCSC 1PNMA 1ZSPA 4GYCB 4J7JA 2YIDA 5LHHA 2WLNA 5IE9A 4OXSA 2Y4UA 4HNAB 3TK1A 3AG3C 4LH7A 4CS3A 4O4LB 1Q5OA 1GN3A 1V54B 2XHBA 3ZHRA 2WPDG 2X6AA 1AI7A 1DLBA 1JFFB 2EIMB 4EB6B 4HAMA 1N32O 2OCCC 4JI5O 3SYPA 2WLLA 4X89A 4XDJA 3LSUA 1K97A 2BOCC 4PELA 3DXRA 3ABMC 4BW5A 5LHIA 5EZYB 1S0VA 2EJ7A 1D5AA 3SPGA 5IY5B 1XMQO 5EBLC 1XNRB 4MW3A 5K1XA 2V1DA 3O9OA 1TUBA 4P9OA 4NXNB 1UPGA 3E2EA 2WA4A 1GN4A 3M99B 3D8CA 3W7UA 2JIZG 1QLEC 1SKVA 4G28B 4MT8A 3T4ZA 5C8YB 2EBOA 1A32A 2OYQA 2GTSA 1P7BA 2OCHA 4Q20A 2LJ2A 3CJHB 2QJ1A 1Y76A 4MTFA
chains in the Genus database with same CATH topology
3N27A 2QTSA 1WP7A 4NTYA 3S3WA 2L35A 4NTWA 4NYKA 3IJ4A 4FZ1A 4FZ0A 4NTXA 3S3XA 2FB5A 1WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N27 A;  2QTS A;  1WP7 A;  4NTY A;  3S3W A;  2L35 A;  4NTW A;  4NYK A;  3IJ4 A;  4FZ1 A;  4FZ0 A;  4NTX A;  3S3X A;  2FB5 A;  1WP8 A; 
#chains in the Genus database with same CATH topology
 2ZDI A;  1YXB A;  4NTX A;  4LWS B;  3ZMT A;  4X62 B;  1GTO A;  1HNW B;  1N36 B;  1M56 B;  5JVD B;  3J7A U;  1GKF A;  2EJR A;  4WBN A;  1T5E A;  5C93 A;  4F6R B;  4KP4 A;  5LP6 C;  3T4D A;  1XI1 A;  3AG7 A;  1BL8 A;  3C90 A;  3RYH A;  4PD4 F;  2P67 A;  4JZ2 A;  1S5H C;  2BTO A;  1VQ4 V;  1KD1 W;  2YI8 A;  2N74 A;  2UUB B;  1JX9 A;  1TA8 A;  5LL6 Y;  4LF7 O;  3A0R A;  2BE3 A;  1SA0 A;  4O2A B;  2ZD9 A;  4LNU A;  4O4H A;  1K7D A;  4DV6 O;  5CBG A;  1IDS A;  4KL1 A;  3CCR V;  1HNZ O;  5CMU A;  4DR1 O;  4K8Z A;  4I9Q A;  4AQY O;  3OR6 C;  2KKW A;  3CME V;  1XNQ B;  5CB4 A;  3CC7 V;  3OD4 A;  3JAW B;  2P6J A;  2WLL B;  2YUA A;  3RBZ A;  3LDD A;  1N0J A;  3IC9 A;  4X64 O;  1YIT V;  3F7V C;  1BZK A;  4B7K A;  3SJC C;  1M57 C;  2GUZ B;  2EZP A;  4O2B A;  5KA6 A;  1F23 A;  1FXK B;  3JAR A;  3AK3 A;  1OZ0 A;  3K5N A;  4DYL A;  4MTX A;  4Z1M G;  4YJ3 A;  3A8T A;  3OUF A;  2LFR A;  5FLX N;  1OHH G;  4G27 B;  4GKK O;  1RSO A;  4KFM A;  2OCC B;  1JJO A;  3K79 A;  2VRZ A;  1M4U A;  5EYP A;  1PNK A;  5JH7 A;  2F23 A;  3BAA A;  3ZMV A;  4RUE A;  3ZIA G;  3ABM B;  2BSK A;  3HKD A;  1XQ8 A;  1E79 G;  2B1G A;  2DOS A;  4WBN B;  3CCS V;  3WG7 C;  2PGG A;  3R65 A;  3RYH B;  3X2Q C;  1VQM V;  4YIO A;  5DED A;  5L3E A;  5KHI A;  1F51 A;  1LUW A;  3OMA B;  1FJG B;  3JCZ A;  1YEW A;  1YCI A;  4HBN A;  1FFX B;  1SA0 B;  1JQ0 A;  4O4H B;  2Y69 B;  1U97 A;  3IJ4 A;  3CC2 V;  2KG7 A;  1Q82 W;  4X65 O;  1XDC A;  2YXH A;  1WJZ A;  3GWO A;  3KKY A;  4GUN A;  5KHG A;  1I7F A;  4B3S B;  5IYD O;  2W0X A;  4B3M O;  2H8P C;  2YI9 A;  4BAY A;  4BIO A;  1F7Y A;  4DR3 B;  1K5S A;  1QLN A;  3BCC H;  2YXY A;  2IU3 A;  3JSN A;  4DV2 B;  3BAB A;  5JJE B;  4MVZ A;  4FMT A;  4K35 A;  2KSD A;  4CH4 A;  2CUG A;  5FPO A;  1K9M W;  2WLH A;  1V55 C;  1Y4M A;  4O2B B;  3UT5 B;  3AG2 C;  4DV7 O;  3JAR B;  4DV0 O;  4LF8 O;  1W2B U;  1RPR A;  2DQ0 A;  1FYJ A;  4YJ3 B;  5L3B A;  2UXD O;  3RFR A;  2LO1 A;  4ZHQ A;  3SJB C;  2IH3 C;  3GB7 C;  2QSA A;  1RSO B;  3E83 A;  4NYK A;  2HHH O;  2DQ3 A;  3ABT A;  4XDK A;  3RYC B;  4WFE A;  4IT5 A;  1FXV A;  2XT9 A;  1MSD A;  4UUJ C;  2A3Q A;  1NU1 H;  5GTH Z;  4LH6 A;  3N2G A;  3DTU B;  2DWE C;  3ZRW A;  5IYZ A;  5FPR A;  1VQ9 V;  1O9G A;  1K4D C;  5B5E Z;  1Q43 A;  2O57 A;  1AB3 A;  2DYS B;  3I55 V;  5AG2 A;  4JTC B;  1HR0 B;  3VQW A;  3BFR A;  4U3J A;  5EC2 C;  4DK1 A;  2WLI B;  1D5N A;  3IFX A;  1VQL V;  4UCV A;  1KU9 A;  3MDS A;  2JGD A;  2KG7 B;  3JAT A;  2R9I A;  4DR2 B;  1YIJ V;  4EKW A;  2Q73 A;  3G6B A;  3MD0 A;  5E79 Z;  4DV7 B;  4P9P A;  1FXH A;  2B9Z A;  1AJQ A;  3OGI B;  2RN9 A;  2NLJ C;  2VS0 A;  3OTO O;  4RWU A;  3CEI A;  4PA7 A;  3CCU V;  1QCE A;  4X1I B;  5BY1 A;  3X2Q B;  4UV8 A;  1GMG A;  5TIS Z;  3UKM A;  3SYA A;  2HHH B;  2CGN A;  1CXZ B;  4GKJ O;  2XAG A;  4UFZ A;  3W7S A;  2Z0A A;  3P3N A;  3APQ A;  2UXB O;  4GX5 A;  1TUE B;  1EM1 A;  5H9C A;  4BWA A;  3KCX A;  4I5S A;  2NN4 A;  2EIM C;  3VQX A;  1HWY A;  3QVN A;  3G80 A;  4O4J A;  5FL7 G;  4KHP B;  3BA9 A;  1URF A;  2L35 A;  2Y48 A;  3AK1 A;  5B66 Z;  2QWP B;  4UCT A;  4JPR A;  1KMI Z;  5KMG A;  3AEI A;  3SPH A;  3STZ C;  2RCV A;  1ARO P;  3UM7 A;  3CCE V;  4TV8 A;  1V55 B;  1DF5 A;  4R8C A;  3AG2 B;  4DUZ O;  1I94 B;  3ZMU A;  3RVZ A;  1WPX A;  5B1A C;  1K33 A;  3BHP A;  1R3J C;  2M7W A;  2Q0O C;  2MW2 B;  2CH7 B;  1QVG U;  3HR0 A;  5B1O A;  1VQ6 V;  4MTG A;  3CP1 A;  1IXB A;  2EX3 A;  1HNX O;  4K0K O;  2RJZ A;  4YJ2 A;  1ZLZ A;  2R72 A;  2XAS A;  2IJK A;  3H9V A;  1YHQ V;  1SC5 B;  4LFC B;  4ZI7 A;  2FB5 A;  3FB5 C;  1RFY A;  2FKX A;  3HKB A;  4UCU A;  2WLM A;  1M56 C;  3H1J H;  2PI4 A;  3ZHV A;  3ZN1 A;  2Q8V A;  3ZHQ A;  1YJ9 V;  4I50 A;  1AI4 A;  1CPY A;  3I5D A;  2R9A A;  3LUT B;  4NR1 A;  2PI5 A;  1X4T A;  4PI0 A;  2EIK C;  4FLY A;  3OFN G;  1Q86 W;  4I4T A;  3H1H H;  5CBH A;  1KP2 A;  5KUK A;  1AR1 B;  2EIJ C;  1IUR A;  4U3F H;  4UB8 Z;  3JAS A;  4DV5 B;  2UUC B;  5GTI Z;  1SER A;  2HR3 A;  3QNE A;  3CCJ V;  5LXT A;  3B40 A;  1XNR O;  1GH6 A;  4C7U A;  3A0H Z;  4LF5 B;  1SQQ H;  1BHB A;  1YSC A;  1L8D A;  1XIL A;  5ITZ B;  1PV0 A;  3D36 A;  1W59 A;  4NVP A;  4NXN O;  2OIE A;  2UXC B;  2P7T C;  4HYO A;  1YDX A;  3RYF A;  1TGO A;  3ASO B;  1Y66 A;  2QKA A;  2R70 A;  2ZE5 A;  3QO5 A;  3B77 A;  1BS3 A;  1MAB G;  3JAM N;  2F66 C;  4MVR A;  5KMG B;  3RYI B;  4K0K B;  2ZE8 A;  5BMV A;  3OTF A;  5CA0 A;  1AJN A;  2RQ6 A;  1GM7 A;  2BOB C;  1HNW O;  1N36 O;  1FXK C;  4ZBM A;  4X66 B;  1PL0 A;  1DTO A;  2FL4 A;  2IU0 A;  3P3P A;  1Y74 A;  4NTY A;  5LGT A;  3T1C A;  3QTC A;  2ZIN A;  4GX1 A;  1F4M A;  2B5U A;  1P7G A;  1K4C C;  2CGO A;  4TQF A;  4YJ2 B;  1IBL B;  1VQ5 V;  4TUY B;  2LGW A;  1XBL A;  4H33 A;  5F2V O;  2ZDI C;  2PYJ A;  1KB9 F;  3N27 A;  4X20 A;  4L87 A;  1Z2G A;  2UUB O;  3G71 V;  4ICG A;  1AI5 A;  3HKB B;  4AHC A;  4Z2W A;  4MVO A;  1COW G;  5LYJ B;  4JI7 B;  3I56 V;  2N04 A;  1S77 D;  4FM0 A;  4FLZ A;  1FS0 G;  4J41 A;  1KQS U;  4QPK A;  3UO2 A;  3K58 A;  1L1F A;  4H13 B;  4CH5 A;  2E5L B;  1Q3E A;  5B1A B;  4IHJ A;  3SYC A;  2ZNJ A;  4IL6 Z;  1YJN V;  1XNQ O;  3BVO A;  2YEV B;  4LF6 B;  2PZS A;  3ZX6 A;  1AP5 A;  2FTK A;  3CRC A;  2XND G;  1MZF A;  1NH2 B;  3L73 H;  1BSM A;  3JAS B;  4D6T H;  3TJT A;  5IYC O;  1M5I A;  3H1L H;  1Y6X A;  5JQG B;  5BR8 B;  2OWO A;  4GX2 A;  2JS5 A;  3ZRS A;  2X6B A;  1ZL8 B;  1P4R A;  3NR7 A;  4JV5 B;  4FFB B;  2VWJ A;  1UFI A;  2Y4T A;  5L3F A;  2N05 A;  2Q5Z A;  1Z5V A;  2XAF A;  3RYF B;  1R6T A;  1N0N A;  2A79 B;  2AGA A;  2EIN B;  1VF7 A;  3MAQ A;  2V4D A;  3SJA C;  5H5N A;  4W4K A;  4YY3 B;  4TSF G;  4E2L A;  1KEC A;  3CSX A;  1EZV H;  1SQB H;  1IBK B;  3DC5 A;  3ZHU A;  4MVS A;  2JK5 C;  3EVK A;  1XHX A;  1QBZ A;  2EIK B;  1WA8 A;  1PL4 A;  2K9P A;  2CTR A;  5BMV B;  1B04 A;  1JCH A;  2EIJ B;  2LQT A;  1XHZ A;  2LP7 A;  1SZT A;  2UXX A;  1L0N H;  3K03 A;  2G38 A;  2ZIM A;  5DEC A;  1NT2 B;  3SYO A;  1H8E G;  1Q6H A;  2PTM A;  3G4S V;  5LGU A;  1H2L A;  3OAA G;  3D3I A;  3W7X A;  1I5Y A;  1FPO A;  3HB3 B;  5KLV H;  4GZR B;  4OX9 B;  4X20 B;  5KHK A;  3ETD A;  3CCV V;  1FJG O;  1WPB A;  4QPJ A;  4UVC A;  4DR6 B;  3DXR B;  1G8M A;  1N34 B;  4LR3 A;  3T1Y B;  4J10 A;  2HJF C;  1XMO B;  2YDE A;  1Y67 A;  4TWK A;  4JAV A;  3CD6 V;  5LOV A;  3UQ8 A;  1NVP B;  1TUB B;  1M93 A;  3VQV A;  3JSL A;  4IHJ B;  4B3S O;  4TV9 A;  1ZAU A;  2DYS C;  1NR1 A;  5KHH A;  1YJW V;  4OGQ B;  1J5E B;  4DR3 O;  1L0L H;  2QM8 A;  3RGB A;  2GV9 A;  4LF4 B;  2QKS A;  4GT1 A;  1R3I C;  4JYY A;  4DV2 O;  2Z5U A;  1Y76 B;  4K3A A;  5IWA B;  2CTW A;  4EEQ A;  1PD3 A;  2HFE C;  2IM9 A;  4DUY B;  3UO3 A;  4UCS A;  3SDL A;  3B8N A;  1U96 A;  2CK3 G;  2PUS A;  2RMK B;  1XL4 A;  1OCZ B;  1Q6U A;  3FB6 C;  1OCR C;  1QU7 A;  4LFA B;  1S76 D;  2LGQ A;  3MHH C;  1NBM G;  1NTK H;  3ZRX A;  5KAI Z;  1ORQ C;  3U10 A;  1DGS A;  4IYH A;  3THO A;  2Q9L A;  4JI4 B;  3JD1 A;  2ATK C;  4LNU B;  3LNM B;  2R9R B;  5HFL A;  3T1H B;  2KB1 A;  5JJJ B;  4FZ0 A;  2XOK G;  3DSQ A;  5J2T A;  3K5O A;  5CB4 B;  2K1E A;  5HFM A;  4ASU G;  2YIA A;  1HR0 O;  3R66 A;  2JJ2 G;  1MG1 A;  1SQX H;  4I7Z B;  2DWD C;  4RUF A;  4PDL A;  1BQ0 A;  2C2A A;  4PI2 A;  2ILM A;  1ZTE A;  3Q4H A;  4ZIB A;  4DR2 O;  1ROP A;  2WWW A;  1NTZ H;  4TT3 G;  3QO7 A;  1NS1 A;  3G6E V;  3K0G A;  1SS3 A;  5IDJ A;  4TV9 B;  2ZM6 B;  2HP8 A;  4MTO A;  5EC1 C;  2UUA B;  4UCR A;  3EXA A;  1IBM B;  3FAV A;  4I9W A;  1CEZ A;  4CH6 A;  2FYU H;  4LFB B;  1Q90 D;  2VQE B;  3CRQ A;  3VOU A;  4DR7 B;  5EK0 A;  1Q81 W;  4DV4 B;  4EFE A;  4LC1 A;  1S72 V;  5EYP B;  4MVU A;  5FNV A;  5JH7 B;  4MSW C;  3LDC A;  3J80 N;  1N33 B;  2WLJ A;  1E1R G;  2BSK B;  4B3T B;  1KYO F;  3HKD B;  5J2U A;  3OMI B;  3OE7 G;  2YS8 A;  4I0X A;  2JRI A;  4MVM A;  2OTL V;  4U7N A;  3E22 A;  1YZB A;  4DRX A;  1WN7 A;  1RP3 B;  2CDY A;  4F4L A;  1GK9 A;  3CB2 A;  2GSM B;  5CA3 A;  3CXH F;  3AG4 B;  4KHP O;  1GRJ A;  3LSS A;  1AVM A;  1EN6 A;  4R6Z A;  1JMK C;  1OJH A;  1M1K W;  3SPC A;  4PA3 A;  2AHZ A;  4J11 A;  1WP8 A;  1X59 A;  2YC0 A;  1EBO A;  3LSQ A;  2D2C B;  1D2D A;  3K08 A;  3GWK C;  1K34 A;  1I94 O;  4JI0 B;  1VQ8 V;  2Y69 C;  5IJ0 A;  3JAL A;  1NKD A;  5L3C A;  1GO3 F;  2F4V B;  3E89 A;  1WB8 A;  3ASO C;  3SR2 C;  4JYA B;  4NXM B;  3J81 N;  2Q4P A;  2Q68 A;  2AHY A;  1FFT B;  4PA6 A;  4OPA A;  3AG1 C;  1OCR B;  1NJI W;  4GX0 A;  1R3K C;  3K3W A;  1H2K A;  3ABL B;  4MS2 A;  4CBC A;  4LFC O;  2IH1 C;  1FAF A;  3Q4H B;  1NH2 D;  3CX5 F;  2NNU A;  1VQ7 V;  2FML A;  4FLT A;  3JD3 A;  4X1K A;  2ZQM A;  3K5M A;  1QVF U;  2PY5 A;  2B1I A;  3C3S A;  4NB5 A;  1MNG A;  4D7S A;  4FLX A;  4FJC C;  4F6E A;  5IT9 N;  4NKG B;  4WFF A;  5D5Q A;  3N2K A;  3FAV B;  3OW2 U;  4ZHQ B;  3CCQ V;  4JI8 B;  4JTA B;  1IVS A;  3FB7 C;  2F95 B;  1LR1 A;  3C3T A;  4N21 A;  2P5O A;  5KHJ A;  5FNV B;  4I55 A;  3JAK A;  4DV5 O;  3HKE A;  1DK1 A;  2UUC O;  2ZNI A;  1QNM A;  4KUM A;  4LF5 O;  4I0X B;  1AI6 A;  2IW5 A;  3TXS A;  4O4I A;  3N2G B;  1MMM A;  3K9A A;  3FB8 C;  4PV1 B;  3SPJ A;  2ITC C;  3ZRW B;  3E8H A;  5IYZ B;  1VEW A;  3BPZ A;  1M90 W;  2UXC O;  1VF5 B;  3TGU H;  3DC6 A;  3BA8 A;  1QHT A;  1VQP V;  5CN0 A;  4IIJ A;  3IGA C;  1JA8 A;  3VBB A;  3CRM A;  4NTW A;  4GCZ A;  3RVY A;  3OEE G;  1ZX3 A;  4JI3 B;  3ZMZ A;  3K06 A;  4J7K A;  1VF6 A;  4X9Q A;  1FD9 A;  3ZHT A;  2DE0 X;  2JGU A;  4U3J B;  4PDR A;  1QQC A;  2Z3Y A;  2UU9 O;  1KP3 A;  5L3G A;  2JGD B;  3JAT B;  4WFA V;  1K3E A;  4PHZ A;  3D36 C;  4X66 O;  3JAL B;  4BR6 A;  2WLK A;  4O4L A;  2EIN C;  4LP8 A;  4EB6 A;  1SQV H;  1PNL A;  5LGN A;  1NVP D;  3OM3 B;  3ZN0 A;  2Q7H A;  2X6C A;  4B3R B;  3CYO A;  1BHA A;  1IBL O;  1H2G A;  3ABK B;  4LCU C;  3OGC C;  1XUQ A;  5EZY A;  3ML0 A;  1BGY H;  3FFQ A;  3H1K H;  3S3W A;  3IAY A;  3T2M A;  3CXC U;  4X1K B;  1PPJ H;  1NI8 A;  4JI7 O;  4FK5 C;  4HZ3 A;  2CE4 A;  1RM1 B;  3TXQ A;  4JI6 B;  4FLU A;  4AIL C;  2E5L O;  1QR8 A;  2ADQ B;  4EFB A;  1LNQ A;  4JAS A;  4O4J B;  4W4L A;  1JVM A;  1VP7 A;  4G2K A;  4LF6 O;  2EIL C;  3HKC A;  4FM1 A;  3K0D A;  2XAJ A;  2Y0P A;  1JR9 A;  3CJH A;  3WU2 Z;  4FVM A;  1OCO B;  4BW9 A;  2QWQ B;  4B08 A;  2DW4 A;  5DN6 G;  5BR8 O;  4FFK A;  3L70 H;  4LWS A;  2QM4 A;  3AG1 B;  1H2M A;  1R73 A;  5JVD A;  3OR7 C;  4JV5 O;  2ZE6 A;  4TV8 B;  1R1B A;  4LF9 B;  1WLE A;  4R7C A;  2GBO A;  3K57 A;  1YTF B;  1R6N A;  4JI1 B;  1GN6 A;  2HVK C;  3ETQ A;  4YY3 O;  1IBK O;  3W7W A;  4QE7 A;  1QR9 A;  2P90 A;  4U7O A;  2YIB A;  2DN9 A;  2ZXW B;  2IJH A;  1I08 A;  2HEP A;  4WFG A;  3BY6 A;  2EUL A;  4X88 A;  1S3J A;  4ZI7 B;  4O2A A;  5JCO A;  4QNH B;  5BZB A;  1PKX A;  3AK2 A;  1BE3 H;  4J9Z B;  3U11 A;  1VMG A;  2Q69 A;  3JCU Z;  3K04 A;  5LMU B;  4YHH B;  3RN4 A;  4DR4 B;  2JEU A;  2X7R B;  2E76 B;  3SPI A;  4I50 B;  4UVA A;  2H94 A;  2Q67 A;  2HKO A;  1OCZ C;  5EBM C;  1R3L C;  3JAW A;  4L8J A;  4MW8 A;  4DR5 B;  3P32 A;  4DV3 B;  4H44 B;  2EZO A;  5KAF Z;  1IXM A;  4OX9 O;  4I4T B;  2ODM A;  3BEH A;  4DV1 B;  3NXS A;  3ZHS A;  3P30 A;  1Q7Y W;  2DJV A;  2IJJ A;  4DR6 O;  1P49 A;  2KQX A;  1NQT A;  2F1M A;  5A2Q N;  2GUZ A;  2ZIO A;  1N34 O;  3T1Y O;  5LXT B;  1XMO O;  2XUM A;  1YI2 V;  1OCC B;  4WFH A;  5K1P A;  1H2N A;  1FXK A;  2MK3 A;  2RDC A;  3B2E E;  4CH3 A;  2ZE7 A;  2JVD A;  5JJN B;  1O9H A;  4ZOL A;  4Z1V A;  3CS5 A;  4KXR A;  3HKC B;  4JI2 B;  3LDE A;  3OEH G;  4CC5 A;  1KC8 W;  3QG5 A;  1VQO V;  1J5E O;  3CC4 V;  2VQF B;  4LF4 O;  2BTQ A;  2CTQ A;  1TVK A;  4P30 A;  4WF9 V;  5IWA O;  4R50 A;  5CA0 B;  4DUY O;  2AZ0 A;  5H6Q A;  3FYE B;  1AJP A;  2E74 B;  2JJ1 G;  2A06 H;  1Y74 B;  5CA1 A;  4JGS A;  3ASN B;  4BIZ A;  1N32 B;  3K9S A;  3QO8 A;  4JI5 B;  3W7T A;  1N4C A;  3JD0 A;  3CCL V;  2HJD A;  4LFA O;  4OPH A;  2Q7E A;  2EIL B;  1GAX A;  1FFX A;  3ZCC A;  2DYR B;  2GHY A;  5IJ9 A;  1XMQ B;  2ETN A;  2P4V A;  2QGN A;  4JI4 O;  5B1N A;  3CE2 A;  5CBF A;  3CRA A;  3ZJZ A;  1HDJ A;  3FX7 A;  3K5L A;  3KCY A;  1SZX A;  4Q6G A;  3OUS A;  2YIC A;  1PM9 A;  3KZI Z;  1XEQ A;  5D5P A;  3T1H O;  2IJI A;  3F5T A;  4DXW A;  1MOF A;  2Q7G A;  2ARH A;  1JOY A;  3AG4 C;  2ZR3 A;  3SGI A;  5LP6 A;  4CS2 A;  3E8B A;  1US6 A;  5JWP A;  3ZBH A;  2P06 A;  3A2F A;  2UU9 B;  2E3C A;  2GDS A;  1V9P A;  2LW7 A;  3UT5 A;  5KUM A;  4RAI A;  3H01 A;  3A0B Z;  2QA4 V;  1GM9 A;  1SQG A;  4UCO A;  5B3S C;  3F7Y C;  1I0H A;  5KA5 A;  1GM8 A;  4ZOL B;  3AG3 B;  2ZM6 O;  3HPL C;  1BCC H;  2UUA O;  3L9D A;  1K8A W;  1E1Q G;  4JF3 A;  1R6K A;  3SYQ A;  1IBM O;  2BTQ B;  3APO A;  1TVK B;  3E35 A;  3TET A;  4LFB O;  3RYC A;  2VQE O;  3M7M X;  4DR7 O;  1WA8 B;  3FYI B;  1J95 A;  3ABL C;  4LF7 B;  1G6U A;  4DV4 O;  2NR5 A;  1Q8I A;  1JJ2 U;  2W6I G;  1Z5W A;  1N33 O;  3ABU A;  4H0L B;  2QTS A;  4DV6 B;  4B3T O;  4PDV A;  3ETE A;  5CA1 B;  1HNZ B;  2W0F C;  4GLX A;  4DR1 B;  3WB2 A;  2YXL A;  3L75 H;  4AQY B;  3FD9 A;  4A5U B;  3OT7 A;  2P22 C;  1QLE B;  1Q6I A;  1F4N A;  4FPP A;  1XRE A;  4AI8 A;  2HVJ C;  3IC7 A;  4X64 B;  5B1B C;  2WLI A;  5IJ9 B;  2WSS G;  3B09 A;  5A9G A;  5KX5 A;  4P2Z A;  2XTA A;  5GON A;  4QJF B;  1NTM H;  3WFV A;  4JI0 O;  5LOV B;  1KUQ A;  1YVW A;  4TQD A;  1AIL A;  1XOU A;  2Q6A A;  3L71 H;  2F4V O;  2HLD G;  4PDM A;  1B3Q A;  4JYA O;  5LP6 B;  5H6R A;  4NXM O;  4X1I A;  4RO2 A;  4GKK B;  3O65 A;  2Y0I A;  1SRY A;  5EIB D;  4XDL A;  2A0L A;  2PYL A;  1G4Y B;  3K59 A;  1MA1 A;  2IBZ H;  2ITD C;  2OTJ V;  4J9Y B;  2JEX A;  1RPO A;  4WFB V;  2WAM A;  4E4E A;  2AXT Z;  4D7T A;  3L72 H;  1EFR G;  1WNS A;  1YF2 A;  4YIP A;  2BCC H;  3OMN B;  2UXN A;  2XAH A;  2PF4 E;  1YTF D;  2QKC A;  4ZKI A;  3ABK C;  5H2F Z;  5BXZ A;  4JI8 O;  3ICX A;  3U0Z A;  4H37 A;  1HP8 A;  1M9N A;  1CP9 A;  4UV9 A;  2QWR B;  3TCU A;  3JYC A;  1M57 B;  2F43 G;  4UXN A;  1GN2 A;  1SET A;  4X65 B;  1P84 F;  4CS4 A;  1RM1 C;  3JD4 A;  3RWR D;  2RNB A;  1LUV A;  1UJW B;  2AZ2 A;  4B3M B;  5B3S B;  1VIB A;  2A7W A;  3EHB B;  2CH7 A;  1ZUQ A;  2Q0A A;  5EIB C;  2P4K A;  4X8A A;  2OIG A;  4FIP C;  1AP6 A;  5J2T B;  1SQP H;  1I5X A;  3B4S A;  4JI3 O;  3CPW U;  1OCO C;  4FM2 A;  1H2S B;  3ZS8 C;  5IYB O;  1ENV A;  5KX5 B;  3ZED A;  1S5J A;  5GON B;  2XAQ A;  4DV0 B;  1IX9 A;  4LF8 B;  4J80 A;  4XBF A;  3F5W C;  1FKA O;  3ETG A;  4RQF A;  3RT3 C;  2QEX V;  3WG7 B;  3STL C;  2UXD B;  5LMN O;  2CTP A;  1IZ3 A;  3CWB H;  1WB7 A;  2V7Q G;  4B3R O;  1VF6 C;  3E8G A;  4CZZ A;  1THZ A;  4JAU A;  2ZXW C;  4YXW G;  3D3Q A;  2QWO B;  3G67 A;  4JAA A;  1S5L Z;  1SF9 A;  4MVQ A;  4DK0 A;  3CMA V;  1OV9 A;  1EN5 A;  5B1B B;  3QF7 A;  4FZ1 A;  1MSW D;  1BMF G;  3MHS C;  5ITZ A;  1V54 C;  2F93 B;  4FLW A;  5J2U B;  3LNN A;  1H38 A;  4IYI A;  2M6Y A;  3CRR A;  4JI6 O;  4K8X A;  3FKS G;  3E22 B;  1MZE A;  4X1Y A;  4DRX B;  2HG5 C;  1SES A;  5LA6 A;  4DW1 A;  2E75 B;  3RYI A;  5IY5 C;  1B6Q A;  3SJQ C;  4DO2 A;  2YIB D;  1W0J G;  2QR4 A;  2A9H A;  4RQE A;  1KKC A;  2YSU B;  5J9P C;  2ZCE A;  1K5Q A;  1OCC C;  1K92 A;  4DW0 A;  2ZT9 B;  1BQZ A;  4IGG A;  4LF9 O;  4BIU A;  1DF4 A;  2WA3 A;  2H3O A;  2QTO A;  4HNA A;  3OTO B;  5IJ0 B;  2CAZ C;  3S3X A;  4UVB A;  5LMN B;  1VQN V;  4JI1 O;  1KBH A;  1JFF A;  2ZR2 A;  4TUY A;  3EFF K;  3PN1 A;  2AW9 A;  4WCE V;  2ADP A;  4PA4 A;  5EBW C;  5DM6 V;  3VQY A;  4J42 A;  2LW1 A;  1VAR A;  2OT5 A;  5E1A C;  1XL6 A;  4GKJ B;  3RW0 A;  3GVM A;  5LYJ A;  4CC6 A;  3CCM V;  2JDI G;  1B06 A;  1EZJ A;  4TOI A;  1G1X B;  2JS3 A;  2UXB B;  1EN4 A;  5LMU O;  4FLV A;  4YHH O;  4DR4 O;  1JPX A;  2ZKO A;  3PJS K;  5L3D A;  3KG2 A;  3ASN C;  4PA9 A;  3N2K B;  2YEV A;  2D3O W;  4QGP A;  4DR5 O;  1KKD A;  4DV3 O;  3ZMS A;  5C8Y A;  3CHX A;  4JYC A;  4DV1 O;  4JTD B;  3L74 H;  2VWK A;  2X0L A;  5JCO C;  5JQG A;  5GW7 A;  2DYR C;  1AR4 A;  4I55 B;  1WAZ A;  4ABM A;  3JAK B;  1TAE A;  4LBE C;  3HKE B;  1ZL8 A;  4QE9 A;  1HW7 A;  1NR7 A;  1K73 W;  2GTA A;  2DMX A;  4PJ0 Z;  4FFB A;  2QWN B;  1PP9 H;  1N8R W;  4DUZ B;  3M8A A;  4O4I B;  3WB0 A;  4B7E A;  2LFS A;  4QIW F;  4JYB A;  1NZ6 A;  4JZG A;  4J7Z A;  4X1Y B;  3BRC A;  5LBQ A;  3WB1 A;  3DGE A;  3E8F A;  1W0K G;  5LA6 B;  1BT8 A;  4F6R A;  4JI2 O;  1SQF A;  3H1I H;  4IIJ B;  1H8H G;  1HNX B;  4N23 A;  3B8M A;  1WP7 A;  2VQF O;  5LHG A;  2QDO A;  2QM7 A;  4UB6 Z;  3E86 A;  1ZWI C;  4X62 O;  1AR5 A;  3ZRV A;  1VQK V;  2W6J G;  2L6L A;  2QE7 G;  3JD2 A;  3UCS C;  1PNM A;  1ZSP A;  4GYC B;  4J7J A;  2YID A;  5LHH A;  2WLN A;  5IE9 A;  4OXS A;  2Y4U A;  4HNA B;  3TK1 A;  3AG3 C;  4LH7 A;  4CS3 A;  4O4L B;  1Q5O A;  1GN3 A;  1V54 B;  2XHB A;  3ZHR A;  2WPD G;  2X6A A;  1AI7 A;  1DLB A;  1JFF B;  2EIM B;  4EB6 B;  4HAM A;  1N32 O;  2OCC C;  4JI5 O;  3SYP A;  2WLL A;  4X89 A;  4XDJ A;  3LSU A;  1K97 A;  2BOC C;  4PEL A;  3DXR A;  3ABM C;  4BW5 A;  5LHI A;  5EZY B;  1S0V A;  2EJ7 A;  1D5A A;  3SPG A;  5IY5 B;  1XMQ O;  5EBL C;  1XNR B;  4MW3 A;  5K1X A;  2V1D A;  3O9O A;  1TUB A;  4P9O A;  4NXN B;  1UPG A;  3E2E A;  2WA4 A;  1GN4 A;  3M99 B;  3D8C A;  3W7U A;  2JIZ G;  1QLE C;  1SKV A;  4G28 B;  4MT8 A;  3T4Z A;  5C8Y B;  2EBO A;  1A32 A;  2OYQ A;  2GTS A;  1P7B A;  2OCH A;  4Q20 A;  2LJ2 A;  3CJH B;  2QJ1 A;  1Y76 A;  4MTF A; 
#chains in the Genus database with same CATH homology
 3N27 A;  2QTS A;  1WP7 A;  4NTY A;  3S3W A;  2L35 A;  4NTW A;  4NYK A;  3IJ4 A;  4FZ1 A;  4FZ0 A;  4NTX A;  3S3X A;  2FB5 A;  1WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...