4NTYA

Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
408
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
total genus 109
structure length 406
sequence length 408
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntyA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntyA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntyA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntyA02
1WP7A 3S3XA 4NTWA 4NTYA 4NTXA 4FZ1A 2QTSA 3S3WA 1WP8A 4NYKA 4FZ0A 3IJ4A 2FB5A 2L35A 3N27A
chains in the Genus database with same CATH superfamily
3QTCA 2A0LA 3J81N 3A2FA 1NH2D 1Y76A 3QG5A 1XL4A 2ZIOA 2OIGA 5DECA 3FB8C 1H38A 4U3JB 1DK1A 2UUBO 4DV4B 4J11A 3JD4A 5J2TA 2WPDG 4JYCA 3RGBA 2QDOA 2ODMA 3ABLB 4NTYA 3BA9A 5EZYA 4JF3A 2ZD9A 4I50B 3ETQA 3E8GA 2GBOA 2CTRA 4RAIA 5LGUA 4X1IA 4AQYO 1K97A 1KU9A 4UCUA 2PYJA 3JAMN 1S0VA 1IXBA 4UB8Z 5L3EA 2Y0IA 3IGAC 4YJ3A 5EYPB 5LP6C 3F5TA 1MZFA 1MMMA 4DR3B 3OAAG 2ADPA 3BRCA 4MS2A 1SC5B 4J41A 2XUMA 5EIBD 4X1YA 1EN4A 4JV5O 1AB3A 4JI0O 4FFBA 5KX5B 2YS8A 3HKCB 4DR1B 5CA0B 3HKDA 1WA8A 5ITZB 1WP7A 1FXKA 5CA3A 3T1HB 2FKXA 2GTSA 3JARB 4UCVA 4F6RA 3P3NA 3KG2A 1VQNV 1GM8A 2JK5C 3I5DA 3CXCU 5LMNB 3JASB 1XHXA 1MSWD 5JJEB 2PZSA 5H9CA 1NI8A 1MA1A 5AG2A 2Y0PA 2EILB 2F93B 3DC5A 1XEQA 3SGIA 1JQ0A 2Q68A 4N21A 4FLUA 2P5OA 1NH2B 4NXNO 1GN6A 2BTOA 3E8FA 4X1KB 4J7JA 4JI7O 2QWQB 4FIPC 1Q43A 4J80A 3P30A 4KHPB 4X66O 4J42A 3ZCCA 1J5EO 4DV7B 2DE0X 2B5UA 3D36C 1TUBA 2ZINA 4MTXA 1U96A 3SDLA 3CCRV 4UXNA 4B7EA 2YXLA 4OXSA 2PF4E 1IBKB 3BA8A 3E8BA 3A8TA 5CBHA 1OCRB 2O57A 1XMOO 4BIUA 2LGWA 1ROPA 3W7SA 2P4KA 4FZ1A 4ZI7B 4CBCA 2E76B 5LYJA 4J9YB 3WU2Z 2OIEA 1SF9A 1B06A 1GM9A 3A0HZ 2JEUA 2F1MA 4GX2A 2HJFC 3P32A 1H2KA 3JAKB 3SJBC 5HFMA 2ZQMA 2M6YA 3K5NA 1OCOC 2QM4A 3JATA 4WFFA 2QTSA 3B8MA 3ETGA 3SPHA 2Q7GA 3K5OA 1GN3A 4KP4A 4JI5B 3ZMZA 3ML0A 3JYCA 1QVFU 5L3DA 2LP7A 3SYPA 1ZL8B 1H2GA 1N36O 1KMIZ 3CC2V 2H3OA 2GSMB 1BGYH 3O9OA 3ZHUA 2UUBB 4JAVA 1Q90D 2CGNA 1I94O 3ZRSA 4DW0A 2NNUA 2WLIA 4AQYB 2AHZA 3EFFK 4B3MO 2UUCO 2IH3C 4PDLA 5IJ0B 2P7TC 4LF5B 4DV2O 1K8AW 2H8PC 3CXHF 3IAYA 4GCZA 3G80A 4IHJA 1BZKA 3CCJV 4OGQB 2GV9A 4JV5B 4JI0B 3AG7A 3VQWA 3Q4HA 4GT1A 3DTUB 3N2GA 4YIPA 1VARA 3L70H 1Z5WA 4R6ZA 1VF5B 1RM1B 1ZAUA 4UVAA 3ABLC 3MAQA 4PJ0Z 3RVZA 3B77A 1URFA 4DYLA 4W4LA 1R3IC 3ABTA 1T5EA 1Z5VA 1WB8A 4Z1MG 1VF7A 2AZ0A 2LW1A 3U11A 5IY5B 4FMTA 4FLZA 4WFGA 3ETEA 1XQ8A 1AI4A 1YITV 3WB2A 1BSMA 5FLXN 4O2BB 4JAUA 1MZEA 4B3TB 3ZIAG 4NXNB 4EEQA 1ENVA 4TQDA 2EIKB 3OMNB 3H01A 4AILC 2XASA 4ZHQB 1AI5A 4GKKB 4KUMA 2RNBA 1EM1A 1K3EA 5JQGA 4HYOA 3L71H 4CH3A 2ZCEA 2XAFA 2IBZH 2KG7B 3UCSC 2ZNJA 3M8AA 3M99B 4I5SA 1P7BA 3CB2A 2EILC 4JI1O 5CB4B 3CCVV 2D2CB 5EBMC 2XHBA 1X59A 2K9PA 2P22C 1XMOB 1Y66A 1HNXO 2W6IG 1WB7A 1S76D 3G6BA 1E1QG 1NTKH 1QQCA 1Q6HA 4X62O 4LF8O 5A9GA 4K35A 3RYHB 4TUYB 4ZOLA 1YXBA 1BQZA 3SYAA 1BCCH 2ZXWB 1FJGO 3EVKA 3ZMSA 4JI4O 4J7KA 4UV9A 4NYKA 1NU1H 3RYCA 1OCRC 4JI3O 1HWYA 4KFMA 1HR0B 4X8AA 4NXMB 3OE7G 1PL0A 2DWEC 5JJJB 5EIBC 3BHPA 3ABKB 3ASNB 2RJZA 4LP8A 1TAEA 4MSWC 4O4HB 4I55B 1VIBA 4XDJA 2BOCC 5KAIZ 3DC6A 2PUSA 3LNMB 2UXDB 1ZTEA 5LOVB 2JVDA 1I94B 2XOKG 3MHSC 2GHYA 4UCRA 4XDKA 2P90A 3S3WA 4Z1VA 4K0KB 4B3MB 3UKMA 2DWDC 3LDCA 2WLKA 3W7WA 4PA7A 4OPAA 1FD9A 4DV2B 2OT5A 1AR1B 5LP6B 3PN1A 2ZE8A 1AJPA 4FLVA 3JALB 1G1XB 1AVMA 4DV4O 4YHHB 4B3SB 1YJ9V 5DN6G 3OGCC 1QR8A 3HKBA 5E1AC 1KB9F 2JS3A 1M5IA 1AP5A 4PA9A 3SR2C 2LO1A 2EX3A 2Q8VA 3DGEA 4L87A 3L72H 3TETA 3OW2U 1HDJA 1XILA 2RDCA 1VQMV 5LHHA 3SPJA 2HR3A 4JYAB 4GLXA 1SA0B 1FS0G 3VQXA 2ZKOA 4DR6B 2Y48A 2RCVA 4DO2A 1M4UA 3OGIB 2Q0OC 4Q6GA 4LC1A 2LGQA 1RM1C 4X20B 4LR3A 1IURA 3SYQA 3T2MA 1N4CA 1WJZA 1XDCA 3E89A 5B3SB 4O4IA 5FNVA 1XMQO 4FM0A 3FAVA 1WLEA 1CXZB 5H6RA 5IY5C 1KYOF 4JI1B 3BVOA 1NTMH 3K03A 3GB7C 4JI6B 2YUAA 1NBMG 1HNXB 4DR2O 3K5LA 3AK1A 5CBGA 3ZMVA 1XI1A 4I4TA 1WPXA 1Y76B 4X62B 4LF8B 1KKCA 3H9VA 2EIKC 2PTMA 1NJIW 4GX1A 1G4YB 4E2LA 3HKEA 5JCOA 3JAWA 2A9HA 4MTFA 3FX7A 5J2TB 5D5PA 4K8ZA 2RMKB 4L8JA 5EC1C 1Q6UA 3D8CA 3MHHC 3OR7C 5EZYB 3ZJZA 1YJNV 1XHZA 2VRZA 1FJGB 5IT9N 4X1IB 4JI4B 4TT3G 2JJ2G 1EBOA 1M56B 2E74B 3J80N 1FXHA 3ZMUA 4JI3B 3SYOA 3LSQA 1QLEB 2YXHA 2QWPB 1JR9A 4ABMA 4YJ3B 4PA6A 3OR6C 4D7SA 2JS5A 2AXTZ 5CN0A 3ZMTA 3KZIZ 2Q7HA 1LUWA 4MT8A 4K8XA 2BE3A 2IJHA 3ZX6A 1KP3A 4X1YB 5H2FZ 4BW9A 5J9PC 4FFBB 2DQ0A 1IZ3A 1JX9A 2C2AA 3HKDB 5H6QA 1WA8B 3CE2A 4DK0A 4U7NA 1SQFA 1FXKB 4MTGA 2ZXWC 3CJHA 4H44B 4IYHA 2DN9A 4F6RB 1F7YA 2JGUA 2YEVB 2F4VB 2YI8A 5EK0A 3JD0A 4E4EA 3FFQA 1L8DA 2GUZA 2HFEC 2YIAA 5KHHA 3ABKC 3ASNC 2X0LA 2IH1C 2NLJC 3OEHG 4DRXA 2HP8A 3SJQC 2EULA 2HVJC 3LDEA 3K9AA 5IYZA 1P49A 1J95A 1YSCA 4RQEA 1AI6A 2FL4A 3FB7C 3TXQA 5JVDA 4CH4A 4MW3A 1QR9A 3OFNG 4PDMA 1F4NA 2DOSA 3AG2B 2LQTA 1TUBB 2ILMA 1O9GA 3BAAA 4IL6Z 4LF5O 3UM7A 1I5YA 2NR5A 1A32A 3RFRA 4UV8A 4ASUG 1SESA 2Q5ZA 1IBLO 4CS3A 1FXVA 1YIJV 4LFBO 2BSKA 3HPLC 2JJ1G 1KUQA 1GK9A 4CZZA 4OX9B 2CAZC 3CCMV 5HFLA 5LYJB 5B1OA 3K57A 4GKJO 1Q7YW 3A0BZ 1XMQB 4FFKA 4HZ3A 4AHCA 2Y69C 1F23A 3OUFA 3KKYA 3J7AU 4H37A 2YXYA 2CTQA 1AILA 1Y74A 2PGGA 3JATB 4XBFA 2ATKC 2QJ1A 1UFIA 1VF6C 3GWOA 3THOA 3AG4B 4DR4O 4X89A 4X88A 3ASOB 4B3TO 5BMVA 3WB1A 4DR2B 2L6LA 3CCQV 1FKAO 3L9DA 3CRMA 4O4JA 2ETNA 3CRCA 2ZDIC 2QKSA 4DUYO 5B3SC 4GKKO 1D2DA 2KB1A 1PV0A 5LA6A 3I56V 2HJDA 4HAMA 2HEPA 2W6JG 2EINC 5KAFZ 2WLIB 4G28B 4RO2A 1B6QA 1YJWV 2BTQA 5IJ9A 2WLHA 1YZBA 3QF7A 1XNRO 4P30A 4LNUA 1QNMA 2JIZG 4IYIA 4QJFB 3DXRA 2DMXA 1UJWB 1DTOA 1AROP 4IHJB 4YJ2A 3CC7V 1N34B 1W0JG 5KUMA 3B4SA 4TV9A 1E79G 2EJ7A 3Q4HB 3N2GB 1L1FA 2B9ZA 5FL7G 3ZHQA 4ZIBA 3CCUV 3HB3B 2QWOB 1YTFD 4P9PA 3K79A 2UXBO 4YY3B 1M56C 3B40A 4GYCB 1HR0O 3VQVA 1QLEC 2N74A 5JJNB 4NXMO 3N27A 2Q7EA 1RP3B 4ICGA 3RWRD 1GAXA 2Q6AA 3RYFA 1V9PA 5D5QA 3W7UA 3ZHRA 2KQXA 3CCEV 5LMUO 2UXDO 4U7OA 3ZRWA 1H8HG 1FXKC 1W59A 2N05A 3O65A 3RYIA 2DQ3A 4K0KO 2ZR3A 3LSUA 1RPOA 4IIJA 4I9QA 1G6UA 5JQGB 5KA5A 3T4DA 3BPZA 2LFSA 2Z0AA 4MVSA 3EHBB 1GN4A 1FPOA 1HNWO 4FLXA 1IBLB 2P67A 4JYBA 4DR7O 4LFBB 4U3FH 4YHHO 1Y67A 3QO5A 4B3SO 2RN9A 2QKAA 1WN7A 2PY5A 1I08A 2HLDG 3F5WC 2VQFO 4FM1A 4GKJB 1VQOV 5GONB 1R6NA 5L3CA 4ZOLB 3AG2C 2QM8A 1H8EG 2MW2B 5KUKA 1NZ6A 5B66Z 2ZIMA 5JWPA 1HW7A 1JJOA 4DV5O 1B04A 4JYAO 1XL6A 5IYCO 5H5NA 3RYCB 1O9HA 4JZ2A 4DR6O 1Z2GA 3L73H 1WPBA 4DR4B 4BW5A 3C3TA 3JCUZ 5J2UA 1M93A 1SQBH 2QKCA 4FK5C 1GKFA 1VEWA 2A3QA 3E83A 1N32O 3ICXA 5BR8O 3TK1A 4DUYB 3K04A 1SQVH 1XBLA 1S5LZ 3FYIB 4PV1B 2QWRB 1OV9A 3BY6A 5EC2C 4DXWA 1MABG 3NXSA 3X2QB 2F95B 3H1KH 2B1IA 3AG4C 4JI6O 3ASOC 3RVYA 3APOA 5IYDO 4HNAA 3DSQA 2R70A 1XNRB 4A5UB 4WFHA 1BQ0A 1QBZA 2OTLV 4IT5A 4O2AA 2R9RB 1OHHG 3B8NA 5IYBO 4TV8A 1YCIA 2EBOA 2F66C 3GVMA 1PM9A 4DV0B 3HKBB 1LUVA 4WCEV 4LH6A 3OTOO 2VS0A 4QNHB 2UXBB 3R66A 1NVPD 1KKDA 1PD3A 1M1KW 2DYRB 5FPRA 4FLTA 4BAYA 1NS1A 3ZEDA 2YSUB 1COWG 1VQ6V 2ZE6A 4FJCC 2Q4PA 2IJIA 3CX5F 5LMUB 2XNDG 4WFBV 4WF9V 5C8YA 2P4VA 5K1XA 5KHJA 1JFFA 4MVUA 3JD1A 4BWAA 1N33O 5C93A 5IWAB 1V54B 1KBHA 1F51A 2F4VO 4O4IB 5FNVB 1HNZO 2WLNA 2P6JA 4ZHQA 1RPRA 3FAVB 1SQPH 2V4DA 1RSOA 4GX0A 3ZHTA 1HNWB 3JCZA 1Q86W 1IVSA 3CCLV 1VP7A 4DR7B 1D5AA 4O4LA 2ZM6B 1AI7A 2FTKA 3OMAB 3APQA 1CEZA 3OT7A 2CH7A 4LH7A 1NR1A 1M57B 3N2KA 2WLMA 4IGGA 1UPGA 2Q9LA 2VQFB 1Q81W 4FVMA 3AEIA 3HKEB 5E79Z 3JAWB 1HP8A 2R9IA 5GW7A 3BFRA 1GO3F 2Y69B 1NVPB 3U10A 1PL4A 2PYLA 4I7ZB 4B3RO 5JH7A 4DV5B 1SZTA 2Q73A 2CGOA 3RBZA 3JD2A 3OMIB 4OX9O 1EZJA 3QNEA 1DF5A 1PNKA 2YIBA 3E2EA 3CEIA 3FB6C 5KHIA 1N32B 1L0LH 5BR8B 1TVKA 2JEXA 2W0XA 1KD1W 1I7FA 3LNNA 3SPCA 1K73W 3CS5A 1Q8IA 3K3WA 3HR0A 1JA8A 1XNQO 3T1YO 1EN5A 3E8HA 2OCHA 2EINB 5FPOA 2JRIA 3CRRA 4DV3O 1KP2A 2A06H 4UUJC 5GTIZ 2L35A 4ZKIA 1YVWA 1I5XA 3B2EE 1ZX3A 1JPXA 1R3JC 3A0RA 2E3CA 4N23A 5CA1A 4X64O 4WFEA 2GUZB 1R6KA 4CH6A 4DRXB 5LP6A 1VQ7V 2DW4A 1VQ9V 1KQSU 4GX5A 3K08A 2G38A 5IYZB 2XAGA 4UCTA 3T4ZA 2FB5A 1E1RG 3K58A 3CD6V 1PKXA 5JVDB 3ETDA 1K5QA 1FFXA 1V55B 4R7CA 3OTOB 4DW1A 3E22A 3H1JH 3X2QC 3T1CA 1JVMA 1G8MA 3WG7B 1QU7A 2KKWA 2N04A 3UQ8A 4DR5B 4Z2WA 3UT5A 2QSAA 4F6EA 1VQ5V 2OWOA 4BR6A 1FFTB 5TISZ 1XUQA 1N34O 2BSKB 3D3IA 4D6TH 2NN4A 2FMLA 4JTDB 4X9QA 1U97A 3WFVA 2ITDC 2ZE7A 3AK2A 1N33B 2EIJB 4JGSA 4BIZA 4YY3O 3ZRXA 4RQFA 5IE9A 2IW5A 3AG1B 1K7DA 1HNZB 4JI8O 2DYRC 1BE3H 3U0ZA 2IJKA 1IBMB 3D36A 1Y74B 5LGTA 1H2SB 2HHHO 1R1BA 3PJSK 2EJRA 3H1HH 1LR1A 5BMVB 2W0FC 3OTFA 1US6A 4OPHA 3TXSA 3WB0A 4O4JB 4FPPA 2DYSB 3VOUA 2K1EA 4CH5A 1KC8W 2VQEO 5KLVH 3FYEB 5LXTA 5B1BC 1V54C 4LFAO 3CSXA 1NT2B 2ARHA 3TGUH 5LA6B 4EB6A 3E35A 4I0XA 1Q5OA 1VQLV 4QPJA 4PDRA 4B3RB 3K5MA 3F7YC 4WBNA 4FZ0A 5L3FA 1BL8A 5KMGA 5B5EZ 3CYOA 2BTQB 4W4KA 2QM7A 3E86A 2CDYA 5IJ9B 4DV1B 1SETA 1GRJA 2CTWA 1BMFG 4LNUB 2QR4A 3R65A 3DXRB 5LGNA 1M57C 4HBNA 3QVNA 4UFZA 4YJ2B 3UO2A 4NKGB 4TV9B 3ABUA 5JCOC 1Q82W 1K4CC 1R3LC 2A79B 2JGDA 4TQFA 1XNQB 3T1YB 1TGOA 1SQXH 2WLLA 2IU0A 4DV3B 4LWSA 2LJ2A 4PI2A 2GDSA 1TA8A 2A7WA 2Q0AA 2YEVA 1I0HA 4X64B 3RYFB 4NR1A 5K1PA 3G4SV 1S3JA 1SERA 1ZWIC 2IJJA 3TCUA 3B09A 2UXXA 3ZN1A 1YI2V 1EN6A 4U3JA 1JMKC 3ZRWB 2DJVA 1D5NA 1NKDA 1AP6A 1N0NA 2AW9A 3RYIB 2E5LO 1GM7A 5DEDA 1H2MA 1YDXA 4I50A 4IIJB 3ZHSA 3CHXA 5DM6V 2XT9A 1L0NH 5F2VO 1DGSA 1R6TA 4QIWF 1R3KC 5EYPA 4MTOA 5CMUA 5KA6A 2X6CA 1FAFA 1F4MA 2OCCB 2YDEA 1W0KG 5KX5A 2ITCC 4DV0O 3HKCA 5CA0A 4P9OA 5LHIA 1V55C 4H0LB 2Y4UA 5ITZA 2H94A 4MVMA 3WG7C 1S5JA 3JARA 4TWKA 4LF6B 4JI8B 3CRQA 2WA4A 4P2ZA 3P3PA 2IM9A 3GWKC 1W2BU 3JASA 3RT3C 4X65B 3ZRVA 5BXZA 2UUAO 2RQ6A 4CS2A 2EZPA 1VQ4V 2HHHB 1S72V 1PNMA 4UB6Z 5J2UB 1EFRG 2HG5C 2VWKA 3EXAA 4YIOA 5B1AB 1AR4A 4GZRB 4UVBA 4X1KA 4G27B 2VQEB 5IWAO 1ZLZA 2EIJC 3ABMB 3AG1C 4LFAB 4J10A 3G67A 3BEHA 1K4DC 1QVGU 1SQGA 1PPJH 1MOFA 1WNSA 1N8RW 2Z3YA 2Y4TA 3OUSA 2XAHA 1OCCB 4CS4A 3KCXA 4LBEC 1ORQC 4H13B 2F23A 5LL6Y 2ZM6O 2KSDA 3K0GA 4HNAB 4EFEA 1SKVA 5BZBA 4LCUC 2DYSC 4ZI7A 4O2AB 3CC4V 3H1LH 4TV8B 1GN2A 1CPYA 2QA4V 1YTFB 2OYQA 1JCHA 2UU9O 4FLWA 4J9ZB 4RUFA 1P84F 3JAKA 4WFAV 4NB5A 1GTOA 2WWWA 1MSDA 2WLJA 2ZR2A 3JSNA 4H33A 4KXRA 3I55V 4EFBA 5IDJA 4LF7O 4KL1A 1PP9H 1OCZB 3FB5C 4PHZA 1M90W 3CMEV 1AR5A 2PI4A 1R73A 3LSSA 3JSLA 1IXMA 1ZL8A 2EZOA 2Z5UA 2YIBD 3IJ4A 4AI8A 2AGAA 3K59A 4QE9A 1EZVH 2CTPA 5C8YB 4JASA 2QGNA 4D7TA 4B7KA 4UCSA 1JFFB 1N0JA 2XAQA 4QGPA 2E5LB 4JI7B 2LW7A 2X6AA 3CPWU 1SRYA 1WP8A 2QWNB 2B1GA 4X66B 4NTXA 3KCYA 1J5EB 1OJHA 1RSOB 5IJ0A 1QCEA 2ZE5A 3JD3A 5EBWC 5A2QN 4PELA 1H2LA 1OZ0A 2UXCO 4DV6O 1KECA 2VWJA 4LF9O 3MD0A 4JPRA 4J7ZA 3C3SA 4O4LB 2D3OW 2ZT9B 1YF2A 3M7MX 4R50A 2CH7B 1NQTA 3N2KB 1K33A 3H1IH 1BS3A 3IC9A 2UXNA 4MVQA 5L3BA 2V1DA 4TOIA 1YHQV 1X4TA 2YICA 3SYCA 4ZBMA 4JI2O 4Q20A 1Q6IA 1DF4A 4MVOA 5GONA 4DR5O 4C7UA 2EIMB 3G6EV 2OTJV 2QE7G 4PA4A 4XDLA 5JH7B 2UUAB 4DUZO 1Q3EA 3FD9A 4MVZA 4TSFG 3OEEG 3TJTA 4R8CA 3AG3B 4O2BA 4UVCA 4I9WA 2OCCC 1TUEB 2ADQB 2XAJA 3QO7A 3ZS8C 1FYJA 1AJNA 1PNLA 5B1BB 1SZXA 4K3AA 1TVKB 3RN4A 2XTAA 1N36B 4EKWA 3NR7A 4LF4O 1WAZA 2X7RB 3SJAC 1IBMO 2CE4A 1S5HC 2KG7A 3G71V 1NR7A 4G2KA 5EBLC 3VBBA 1K5SA 3LDDA 5CB4A 3IC7A 3L74H 4GUNA 5CA1B 4LFCO 2UUCB 1BT8A 3FKSG 2CUGA 3AK3A 2BCCH 1H2NA 4I4TB 1IX9A 2HKOA 5B1AC 4JAAA 2Q67A 3F7VC 1BHBA 3IFXA 1DLBA 1QHTA 3ABMC 3C90A 3RYHA 2FYUH 4TUYA 2UU9B 2JDIG 1FFXB 3K9SA 4MW8A 3E22B 1LNQA 1OCCC 3CP1A 3K0DA 4PDVA 2GTAA 3VQYA 3CWBH 4LF7B 1YEWA 3OD4A 4DV1O 1BHAA 3SPIA 3UT5B 1M9NA 3S3XA 3SJCC 4B08A 2IU3A 3ZN0A 1P7GA 2MK3A 2P06A 4DK1A 1XREA 4DR3O 3RW0A 2QTOA 1P4RA 4QE7A 3BCCH 1XOUA 4QPKA 1VMGA 4O4HA 4I55A 3ZHVA 4DR1O 3CRAA 3CJHB 2YI9A 2E75B 3STZC 3CCSV 5LOVA 1ZUQA 3T1HO 4PD4F 3STLC 1K9MW 3SPGA 5LMNO 1OCZC 1VQKV 4PA3A 3L75H 4BIOA 5BY1A 4NTWA 5LBQA 2UXCB 4DV6B 2V7QG 1GMGA 1QLNA 3LUTB 3JALA 2ZNIA 4LF9B 1MNGA 4UCOA 1Y6XA 2PI5A 1NTZH 1VQPV 2YC0A 2BOBC 3K06A 5KHKA 2AHYA 2R72A 1JJ2U 3CMAV 5LXTB 1SS3A 1VQ8V 3UO3A 1S77D 5GTHZ 2F43G 4KHPO 5KHGA 4FM2A 4DV7O 4EB6B 1K34A 4JI2B 4I0XB 2R9AA 4JZGA 4NVPA 3QO8A 4RUEA 4JYYA 1CP9A 1OCOB 1Y4MA 4WBNB 4DUZB 4CC5A 3OM3B 4F4LA 1IBKO 5KMGB 1GH6A 2CK3G 2WA3A 4PI0A 1VF6A 1SA0A 1MG1A 4JTCB 2M7WA 3ZBHA 1RFYA 1B3QA 2WSSG 2QEXV 2AZ2A 3MDSA 4X20A 2YIDA 3W7TA 4CC6A 2ZDIA 4LF6O 1K92A 1ZSPA 3D3QA 4RWUA 4FLYA 1THZA 4LF4B 2JGDB 2HVKC 2WAMA 2EIMC 2LFRA 4X65O 2WLLB 4LWSB 4MVRA 5L3GA 1SQQH 2Q69A 5B1NA 1IDSA 4JTAB 5LHGA 3W7XA 4JI5O 4LFCB 2X6BA 3AG3C 3BABA 1AJQA 1JOYA 5CBFA 4YXWG
chains in the Genus database with same CATH topology
1WP7A 3S3XA 4NTWA 4NTYA 4NTXA 4FZ1A 2QTSA 3S3WA 1WP8A 4NYKA 4FZ0A 3IJ4A 2FB5A 2L35A 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP7 A;  3S3X A;  4NTW A;  4NTY A;  4NTX A;  4FZ1 A;  2QTS A;  3S3W A;  1WP8 A;  4NYK A;  4FZ0 A;  3IJ4 A;  2FB5 A;  2L35 A;  3N27 A; 
#chains in the Genus database with same CATH topology
 3QTC A;  2A0L A;  3J81 N;  3A2F A;  1NH2 D;  1Y76 A;  3QG5 A;  1XL4 A;  2ZIO A;  2OIG A;  5DEC A;  3FB8 C;  1H38 A;  4U3J B;  1DK1 A;  2UUB O;  4DV4 B;  4J11 A;  3JD4 A;  5J2T A;  2WPD G;  4JYC A;  3RGB A;  2QDO A;  2ODM A;  3ABL B;  4NTY A;  3BA9 A;  5EZY A;  4JF3 A;  2ZD9 A;  4I50 B;  3ETQ A;  3E8G A;  2GBO A;  2CTR A;  4RAI A;  5LGU A;  4X1I A;  4AQY O;  1K97 A;  1KU9 A;  4UCU A;  2PYJ A;  3JAM N;  1S0V A;  1IXB A;  4UB8 Z;  5L3E A;  2Y0I A;  3IGA C;  4YJ3 A;  5EYP B;  5LP6 C;  3F5T A;  1MZF A;  1MMM A;  4DR3 B;  3OAA G;  2ADP A;  3BRC A;  4MS2 A;  1SC5 B;  4J41 A;  2XUM A;  5EIB D;  4X1Y A;  1EN4 A;  4JV5 O;  1AB3 A;  4JI0 O;  4FFB A;  5KX5 B;  2YS8 A;  3HKC B;  4DR1 B;  5CA0 B;  3HKD A;  1WA8 A;  5ITZ B;  1WP7 A;  1FXK A;  5CA3 A;  3T1H B;  2FKX A;  2GTS A;  3JAR B;  4UCV A;  4F6R A;  3P3N A;  3KG2 A;  1VQN V;  1GM8 A;  2JK5 C;  3I5D A;  3CXC U;  5LMN B;  3JAS B;  1XHX A;  1MSW D;  5JJE B;  2PZS A;  5H9C A;  1NI8 A;  1MA1 A;  5AG2 A;  2Y0P A;  2EIL B;  2F93 B;  3DC5 A;  1XEQ A;  3SGI A;  1JQ0 A;  2Q68 A;  4N21 A;  4FLU A;  2P5O A;  1NH2 B;  4NXN O;  1GN6 A;  2BTO A;  3E8F A;  4X1K B;  4J7J A;  4JI7 O;  2QWQ B;  4FIP C;  1Q43 A;  4J80 A;  3P30 A;  4KHP B;  4X66 O;  4J42 A;  3ZCC A;  1J5E O;  4DV7 B;  2DE0 X;  2B5U A;  3D36 C;  1TUB A;  2ZIN A;  4MTX A;  1U96 A;  3SDL A;  3CCR V;  4UXN A;  4B7E A;  2YXL A;  4OXS A;  2PF4 E;  1IBK B;  3BA8 A;  3E8B A;  3A8T A;  5CBH A;  1OCR B;  2O57 A;  1XMO O;  4BIU A;  2LGW A;  1ROP A;  3W7S A;  2P4K A;  4FZ1 A;  4ZI7 B;  4CBC A;  2E76 B;  5LYJ A;  4J9Y B;  3WU2 Z;  2OIE A;  1SF9 A;  1B06 A;  1GM9 A;  3A0H Z;  2JEU A;  2F1M A;  4GX2 A;  2HJF C;  3P32 A;  1H2K A;  3JAK B;  3SJB C;  5HFM A;  2ZQM A;  2M6Y A;  3K5N A;  1OCO C;  2QM4 A;  3JAT A;  4WFF A;  2QTS A;  3B8M A;  3ETG A;  3SPH A;  2Q7G A;  3K5O A;  1GN3 A;  4KP4 A;  4JI5 B;  3ZMZ A;  3ML0 A;  3JYC A;  1QVF U;  5L3D A;  2LP7 A;  3SYP A;  1ZL8 B;  1H2G A;  1N36 O;  1KMI Z;  3CC2 V;  2H3O A;  2GSM B;  1BGY H;  3O9O A;  3ZHU A;  2UUB B;  4JAV A;  1Q90 D;  2CGN A;  1I94 O;  3ZRS A;  4DW0 A;  2NNU A;  2WLI A;  4AQY B;  2AHZ A;  3EFF K;  4B3M O;  2UUC O;  2IH3 C;  4PDL A;  5IJ0 B;  2P7T C;  4LF5 B;  4DV2 O;  1K8A W;  2H8P C;  3CXH F;  3IAY A;  4GCZ A;  3G80 A;  4IHJ A;  1BZK A;  3CCJ V;  4OGQ B;  2GV9 A;  4JV5 B;  4JI0 B;  3AG7 A;  3VQW A;  3Q4H A;  4GT1 A;  3DTU B;  3N2G A;  4YIP A;  1VAR A;  3L70 H;  1Z5W A;  4R6Z A;  1VF5 B;  1RM1 B;  1ZAU A;  4UVA A;  3ABL C;  3MAQ A;  4PJ0 Z;  3RVZ A;  3B77 A;  1URF A;  4DYL A;  4W4L A;  1R3I C;  3ABT A;  1T5E A;  1Z5V A;  1WB8 A;  4Z1M G;  1VF7 A;  2AZ0 A;  2LW1 A;  3U11 A;  5IY5 B;  4FMT A;  4FLZ A;  4WFG A;  3ETE A;  1XQ8 A;  1AI4 A;  1YIT V;  3WB2 A;  1BSM A;  5FLX N;  4O2B B;  4JAU A;  1MZE A;  4B3T B;  3ZIA G;  4NXN B;  4EEQ A;  1ENV A;  4TQD A;  2EIK B;  3OMN B;  3H01 A;  4AIL C;  2XAS A;  4ZHQ B;  1AI5 A;  4GKK B;  4KUM A;  2RNB A;  1EM1 A;  1K3E A;  5JQG A;  4HYO A;  3L71 H;  4CH3 A;  2ZCE A;  2XAF A;  2IBZ H;  2KG7 B;  3UCS C;  2ZNJ A;  3M8A A;  3M99 B;  4I5S A;  1P7B A;  3CB2 A;  2EIL C;  4JI1 O;  5CB4 B;  3CCV V;  2D2C B;  5EBM C;  2XHB A;  1X59 A;  2K9P A;  2P22 C;  1XMO B;  1Y66 A;  1HNX O;  2W6I G;  1WB7 A;  1S76 D;  3G6B A;  1E1Q G;  1NTK H;  1QQC A;  1Q6H A;  4X62 O;  4LF8 O;  5A9G A;  4K35 A;  3RYH B;  4TUY B;  4ZOL A;  1YXB A;  1BQZ A;  3SYA A;  1BCC H;  2ZXW B;  1FJG O;  3EVK A;  3ZMS A;  4JI4 O;  4J7K A;  4UV9 A;  4NYK A;  1NU1 H;  3RYC A;  1OCR C;  4JI3 O;  1HWY A;  4KFM A;  1HR0 B;  4X8A A;  4NXM B;  3OE7 G;  1PL0 A;  2DWE C;  5JJJ B;  5EIB C;  3BHP A;  3ABK B;  3ASN B;  2RJZ A;  4LP8 A;  1TAE A;  4MSW C;  4O4H B;  4I55 B;  1VIB A;  4XDJ A;  2BOC C;  5KAI Z;  3DC6 A;  2PUS A;  3LNM B;  2UXD B;  1ZTE A;  5LOV B;  2JVD A;  1I94 B;  2XOK G;  3MHS C;  2GHY A;  4UCR A;  4XDK A;  2P90 A;  3S3W A;  4Z1V A;  4K0K B;  4B3M B;  3UKM A;  2DWD C;  3LDC A;  2WLK A;  3W7W A;  4PA7 A;  4OPA A;  1FD9 A;  4DV2 B;  2OT5 A;  1AR1 B;  5LP6 B;  3PN1 A;  2ZE8 A;  1AJP A;  4FLV A;  3JAL B;  1G1X B;  1AVM A;  4DV4 O;  4YHH B;  4B3S B;  1YJ9 V;  5DN6 G;  3OGC C;  1QR8 A;  3HKB A;  5E1A C;  1KB9 F;  2JS3 A;  1M5I A;  1AP5 A;  4PA9 A;  3SR2 C;  2LO1 A;  2EX3 A;  2Q8V A;  3DGE A;  4L87 A;  3L72 H;  3TET A;  3OW2 U;  1HDJ A;  1XIL A;  2RDC A;  1VQM V;  5LHH A;  3SPJ A;  2HR3 A;  4JYA B;  4GLX A;  1SA0 B;  1FS0 G;  3VQX A;  2ZKO A;  4DR6 B;  2Y48 A;  2RCV A;  4DO2 A;  1M4U A;  3OGI B;  2Q0O C;  4Q6G A;  4LC1 A;  2LGQ A;  1RM1 C;  4X20 B;  4LR3 A;  1IUR A;  3SYQ A;  3T2M A;  1N4C A;  1WJZ A;  1XDC A;  3E89 A;  5B3S B;  4O4I A;  5FNV A;  1XMQ O;  4FM0 A;  3FAV A;  1WLE A;  1CXZ B;  5H6R A;  5IY5 C;  1KYO F;  4JI1 B;  3BVO A;  1NTM H;  3K03 A;  3GB7 C;  4JI6 B;  2YUA A;  1NBM G;  1HNX B;  4DR2 O;  3K5L A;  3AK1 A;  5CBG A;  3ZMV A;  1XI1 A;  4I4T A;  1WPX A;  1Y76 B;  4X62 B;  4LF8 B;  1KKC A;  3H9V A;  2EIK C;  2PTM A;  1NJI W;  4GX1 A;  1G4Y B;  4E2L A;  3HKE A;  5JCO A;  3JAW A;  2A9H A;  4MTF A;  3FX7 A;  5J2T B;  5D5P A;  4K8Z A;  2RMK B;  4L8J A;  5EC1 C;  1Q6U A;  3D8C A;  3MHH C;  3OR7 C;  5EZY B;  3ZJZ A;  1YJN V;  1XHZ A;  2VRZ A;  1FJG B;  5IT9 N;  4X1I B;  4JI4 B;  4TT3 G;  2JJ2 G;  1EBO A;  1M56 B;  2E74 B;  3J80 N;  1FXH A;  3ZMU A;  4JI3 B;  3SYO A;  3LSQ A;  1QLE B;  2YXH A;  2QWP B;  1JR9 A;  4ABM A;  4YJ3 B;  4PA6 A;  3OR6 C;  4D7S A;  2JS5 A;  2AXT Z;  5CN0 A;  3ZMT A;  3KZI Z;  2Q7H A;  1LUW A;  4MT8 A;  4K8X A;  2BE3 A;  2IJH A;  3ZX6 A;  1KP3 A;  4X1Y B;  5H2F Z;  4BW9 A;  5J9P C;  4FFB B;  2DQ0 A;  1IZ3 A;  1JX9 A;  2C2A A;  3HKD B;  5H6Q A;  1WA8 B;  3CE2 A;  4DK0 A;  4U7N A;  1SQF A;  1FXK B;  4MTG A;  2ZXW C;  3CJH A;  4H44 B;  4IYH A;  2DN9 A;  4F6R B;  1F7Y A;  2JGU A;  2YEV B;  2F4V B;  2YI8 A;  5EK0 A;  3JD0 A;  4E4E A;  3FFQ A;  1L8D A;  2GUZ A;  2HFE C;  2YIA A;  5KHH A;  3ABK C;  3ASN C;  2X0L A;  2IH1 C;  2NLJ C;  3OEH G;  4DRX A;  2HP8 A;  3SJQ C;  2EUL A;  2HVJ C;  3LDE A;  3K9A A;  5IYZ A;  1P49 A;  1J95 A;  1YSC A;  4RQE A;  1AI6 A;  2FL4 A;  3FB7 C;  3TXQ A;  5JVD A;  4CH4 A;  4MW3 A;  1QR9 A;  3OFN G;  4PDM A;  1F4N A;  2DOS A;  3AG2 B;  2LQT A;  1TUB B;  2ILM A;  1O9G A;  3BAA A;  4IL6 Z;  4LF5 O;  3UM7 A;  1I5Y A;  2NR5 A;  1A32 A;  3RFR A;  4UV8 A;  4ASU G;  1SES A;  2Q5Z A;  1IBL O;  4CS3 A;  1FXV A;  1YIJ V;  4LFB O;  2BSK A;  3HPL C;  2JJ1 G;  1KUQ A;  1GK9 A;  4CZZ A;  4OX9 B;  2CAZ C;  3CCM V;  5HFL A;  5LYJ B;  5B1O A;  3K57 A;  4GKJ O;  1Q7Y W;  3A0B Z;  1XMQ B;  4FFK A;  4HZ3 A;  4AHC A;  2Y69 C;  1F23 A;  3OUF A;  3KKY A;  3J7A U;  4H37 A;  2YXY A;  2CTQ A;  1AIL A;  1Y74 A;  2PGG A;  3JAT B;  4XBF A;  2ATK C;  2QJ1 A;  1UFI A;  1VF6 C;  3GWO A;  3THO A;  3AG4 B;  4DR4 O;  4X89 A;  4X88 A;  3ASO B;  4B3T O;  5BMV A;  3WB1 A;  4DR2 B;  2L6L A;  3CCQ V;  1FKA O;  3L9D A;  3CRM A;  4O4J A;  2ETN A;  3CRC A;  2ZDI C;  2QKS A;  4DUY O;  5B3S C;  4GKK O;  1D2D A;  2KB1 A;  1PV0 A;  5LA6 A;  3I56 V;  2HJD A;  4HAM A;  2HEP A;  2W6J G;  2EIN C;  5KAF Z;  2WLI B;  4G28 B;  4RO2 A;  1B6Q A;  1YJW V;  2BTQ A;  5IJ9 A;  2WLH A;  1YZB A;  3QF7 A;  1XNR O;  4P30 A;  4LNU A;  1QNM A;  2JIZ G;  4IYI A;  4QJF B;  3DXR A;  2DMX A;  1UJW B;  1DTO A;  1ARO P;  4IHJ B;  4YJ2 A;  3CC7 V;  1N34 B;  1W0J G;  5KUM A;  3B4S A;  4TV9 A;  1E79 G;  2EJ7 A;  3Q4H B;  3N2G B;  1L1F A;  2B9Z A;  5FL7 G;  3ZHQ A;  4ZIB A;  3CCU V;  3HB3 B;  2QWO B;  1YTF D;  4P9P A;  3K79 A;  2UXB O;  4YY3 B;  1M56 C;  3B40 A;  4GYC B;  1HR0 O;  3VQV A;  1QLE C;  2N74 A;  5JJN B;  4NXM O;  3N27 A;  2Q7E A;  1RP3 B;  4ICG A;  3RWR D;  1GAX A;  2Q6A A;  3RYF A;  1V9P A;  5D5Q A;  3W7U A;  3ZHR A;  2KQX A;  3CCE V;  5LMU O;  2UXD O;  4U7O A;  3ZRW A;  1H8H G;  1FXK C;  1W59 A;  2N05 A;  3O65 A;  3RYI A;  2DQ3 A;  4K0K O;  2ZR3 A;  3LSU A;  1RPO A;  4IIJ A;  4I9Q A;  1G6U A;  5JQG B;  5KA5 A;  3T4D A;  3BPZ A;  2LFS A;  2Z0A A;  4MVS A;  3EHB B;  1GN4 A;  1FPO A;  1HNW O;  4FLX A;  1IBL B;  2P67 A;  4JYB A;  4DR7 O;  4LFB B;  4U3F H;  4YHH O;  1Y67 A;  3QO5 A;  4B3S O;  2RN9 A;  2QKA A;  1WN7 A;  2PY5 A;  1I08 A;  2HLD G;  3F5W C;  2VQF O;  4FM1 A;  4GKJ B;  1VQO V;  5GON B;  1R6N A;  5L3C A;  4ZOL B;  3AG2 C;  2QM8 A;  1H8E G;  2MW2 B;  5KUK A;  1NZ6 A;  5B66 Z;  2ZIM A;  5JWP A;  1HW7 A;  1JJO A;  4DV5 O;  1B04 A;  4JYA O;  1XL6 A;  5IYC O;  5H5N A;  3RYC B;  1O9H A;  4JZ2 A;  4DR6 O;  1Z2G A;  3L73 H;  1WPB A;  4DR4 B;  4BW5 A;  3C3T A;  3JCU Z;  5J2U A;  1M93 A;  1SQB H;  2QKC A;  4FK5 C;  1GKF A;  1VEW A;  2A3Q A;  3E83 A;  1N32 O;  3ICX A;  5BR8 O;  3TK1 A;  4DUY B;  3K04 A;  1SQV H;  1XBL A;  1S5L Z;  3FYI B;  4PV1 B;  2QWR B;  1OV9 A;  3BY6 A;  5EC2 C;  4DXW A;  1MAB G;  3NXS A;  3X2Q B;  2F95 B;  3H1K H;  2B1I A;  3AG4 C;  4JI6 O;  3ASO C;  3RVY A;  3APO A;  5IYD O;  4HNA A;  3DSQ A;  2R70 A;  1XNR B;  4A5U B;  4WFH A;  1BQ0 A;  1QBZ A;  2OTL V;  4IT5 A;  4O2A A;  2R9R B;  1OHH G;  3B8N A;  5IYB O;  4TV8 A;  1YCI A;  2EBO A;  2F66 C;  3GVM A;  1PM9 A;  4DV0 B;  3HKB B;  1LUV A;  4WCE V;  4LH6 A;  3OTO O;  2VS0 A;  4QNH B;  2UXB B;  3R66 A;  1NVP D;  1KKD A;  1PD3 A;  1M1K W;  2DYR B;  5FPR A;  4FLT A;  4BAY A;  1NS1 A;  3ZED A;  2YSU B;  1COW G;  1VQ6 V;  2ZE6 A;  4FJC C;  2Q4P A;  2IJI A;  3CX5 F;  5LMU B;  2XND G;  4WFB V;  4WF9 V;  5C8Y A;  2P4V A;  5K1X A;  5KHJ A;  1JFF A;  4MVU A;  3JD1 A;  4BWA A;  1N33 O;  5C93 A;  5IWA B;  1V54 B;  1KBH A;  1F51 A;  2F4V O;  4O4I B;  5FNV B;  1HNZ O;  2WLN A;  2P6J A;  4ZHQ A;  1RPR A;  3FAV B;  1SQP H;  2V4D A;  1RSO A;  4GX0 A;  3ZHT A;  1HNW B;  3JCZ A;  1Q86 W;  1IVS A;  3CCL V;  1VP7 A;  4DR7 B;  1D5A A;  4O4L A;  2ZM6 B;  1AI7 A;  2FTK A;  3OMA B;  3APQ A;  1CEZ A;  3OT7 A;  2CH7 A;  4LH7 A;  1NR1 A;  1M57 B;  3N2K A;  2WLM A;  4IGG A;  1UPG A;  2Q9L A;  2VQF B;  1Q81 W;  4FVM A;  3AEI A;  3HKE B;  5E79 Z;  3JAW B;  1HP8 A;  2R9I A;  5GW7 A;  3BFR A;  1GO3 F;  2Y69 B;  1NVP B;  3U10 A;  1PL4 A;  2PYL A;  4I7Z B;  4B3R O;  5JH7 A;  4DV5 B;  1SZT A;  2Q73 A;  2CGO A;  3RBZ A;  3JD2 A;  3OMI B;  4OX9 O;  1EZJ A;  3QNE A;  1DF5 A;  1PNK A;  2YIB A;  3E2E A;  3CEI A;  3FB6 C;  5KHI A;  1N32 B;  1L0L H;  5BR8 B;  1TVK A;  2JEX A;  2W0X A;  1KD1 W;  1I7F A;  3LNN A;  3SPC A;  1K73 W;  3CS5 A;  1Q8I A;  3K3W A;  3HR0 A;  1JA8 A;  1XNQ O;  3T1Y O;  1EN5 A;  3E8H A;  2OCH A;  2EIN B;  5FPO A;  2JRI A;  3CRR A;  4DV3 O;  1KP2 A;  2A06 H;  4UUJ C;  5GTI Z;  2L35 A;  4ZKI A;  1YVW A;  1I5X A;  3B2E E;  1ZX3 A;  1JPX A;  1R3J C;  3A0R A;  2E3C A;  4N23 A;  5CA1 A;  4X64 O;  4WFE A;  2GUZ B;  1R6K A;  4CH6 A;  4DRX B;  5LP6 A;  1VQ7 V;  2DW4 A;  1VQ9 V;  1KQS U;  4GX5 A;  3K08 A;  2G38 A;  5IYZ B;  2XAG A;  4UCT A;  3T4Z A;  2FB5 A;  1E1R G;  3K58 A;  3CD6 V;  1PKX A;  5JVD B;  3ETD A;  1K5Q A;  1FFX A;  1V55 B;  4R7C A;  3OTO B;  4DW1 A;  3E22 A;  3H1J H;  3X2Q C;  3T1C A;  1JVM A;  1G8M A;  3WG7 B;  1QU7 A;  2KKW A;  2N04 A;  3UQ8 A;  4DR5 B;  4Z2W A;  3UT5 A;  2QSA A;  4F6E A;  1VQ5 V;  2OWO A;  4BR6 A;  1FFT B;  5TIS Z;  1XUQ A;  1N34 O;  2BSK B;  3D3I A;  4D6T H;  2NN4 A;  2FML A;  4JTD B;  4X9Q A;  1U97 A;  3WFV A;  2ITD C;  2ZE7 A;  3AK2 A;  1N33 B;  2EIJ B;  4JGS A;  4BIZ A;  4YY3 O;  3ZRX A;  4RQF A;  5IE9 A;  2IW5 A;  3AG1 B;  1K7D A;  1HNZ B;  4JI8 O;  2DYR C;  1BE3 H;  3U0Z A;  2IJK A;  1IBM B;  3D36 A;  1Y74 B;  5LGT A;  1H2S B;  2HHH O;  1R1B A;  3PJS K;  2EJR A;  3H1H H;  1LR1 A;  5BMV B;  2W0F C;  3OTF A;  1US6 A;  4OPH A;  3TXS A;  3WB0 A;  4O4J B;  4FPP A;  2DYS B;  3VOU A;  2K1E A;  4CH5 A;  1KC8 W;  2VQE O;  5KLV H;  3FYE B;  5LXT A;  5B1B C;  1V54 C;  4LFA O;  3CSX A;  1NT2 B;  2ARH A;  3TGU H;  5LA6 B;  4EB6 A;  3E35 A;  4I0X A;  1Q5O A;  1VQL V;  4QPJ A;  4PDR A;  4B3R B;  3K5M A;  3F7Y C;  4WBN A;  4FZ0 A;  5L3F A;  1BL8 A;  5KMG A;  5B5E Z;  3CYO A;  2BTQ B;  4W4K A;  2QM7 A;  3E86 A;  2CDY A;  5IJ9 B;  4DV1 B;  1SET A;  1GRJ A;  2CTW A;  1BMF G;  4LNU B;  2QR4 A;  3R65 A;  3DXR B;  5LGN A;  1M57 C;  4HBN A;  3QVN A;  4UFZ A;  4YJ2 B;  3UO2 A;  4NKG B;  4TV9 B;  3ABU A;  5JCO C;  1Q82 W;  1K4C C;  1R3L C;  2A79 B;  2JGD A;  4TQF A;  1XNQ B;  3T1Y B;  1TGO A;  1SQX H;  2WLL A;  2IU0 A;  4DV3 B;  4LWS A;  2LJ2 A;  4PI2 A;  2GDS A;  1TA8 A;  2A7W A;  2Q0A A;  2YEV A;  1I0H A;  4X64 B;  3RYF B;  4NR1 A;  5K1P A;  3G4S V;  1S3J A;  1SER A;  1ZWI C;  2IJJ A;  3TCU A;  3B09 A;  2UXX A;  3ZN1 A;  1YI2 V;  1EN6 A;  4U3J A;  1JMK C;  3ZRW B;  2DJV A;  1D5N A;  1NKD A;  1AP6 A;  1N0N A;  2AW9 A;  3RYI B;  2E5L O;  1GM7 A;  5DED A;  1H2M A;  1YDX A;  4I50 A;  4IIJ B;  3ZHS A;  3CHX A;  5DM6 V;  2XT9 A;  1L0N H;  5F2V O;  1DGS A;  1R6T A;  4QIW F;  1R3K C;  5EYP A;  4MTO A;  5CMU A;  5KA6 A;  2X6C A;  1FAF A;  1F4M A;  2OCC B;  2YDE A;  1W0K G;  5KX5 A;  2ITC C;  4DV0 O;  3HKC A;  5CA0 A;  4P9O A;  5LHI A;  1V55 C;  4H0L B;  2Y4U A;  5ITZ A;  2H94 A;  4MVM A;  3WG7 C;  1S5J A;  3JAR A;  4TWK A;  4LF6 B;  4JI8 B;  3CRQ A;  2WA4 A;  4P2Z A;  3P3P A;  2IM9 A;  3GWK C;  1W2B U;  3JAS A;  3RT3 C;  4X65 B;  3ZRV A;  5BXZ A;  2UUA O;  2RQ6 A;  4CS2 A;  2EZP A;  1VQ4 V;  2HHH B;  1S72 V;  1PNM A;  4UB6 Z;  5J2U B;  1EFR G;  2HG5 C;  2VWK A;  3EXA A;  4YIO A;  5B1A B;  1AR4 A;  4GZR B;  4UVB A;  4X1K A;  4G27 B;  2VQE B;  5IWA O;  1ZLZ A;  2EIJ C;  3ABM B;  3AG1 C;  4LFA B;  4J10 A;  3G67 A;  3BEH A;  1K4D C;  1QVG U;  1SQG A;  1PPJ H;  1MOF A;  1WNS A;  1N8R W;  2Z3Y A;  2Y4T A;  3OUS A;  2XAH A;  1OCC B;  4CS4 A;  3KCX A;  4LBE C;  1ORQ C;  4H13 B;  2F23 A;  5LL6 Y;  2ZM6 O;  2KSD A;  3K0G A;  4HNA B;  4EFE A;  1SKV A;  5BZB A;  4LCU C;  2DYS C;  4ZI7 A;  4O2A B;  3CC4 V;  3H1L H;  4TV8 B;  1GN2 A;  1CPY A;  2QA4 V;  1YTF B;  2OYQ A;  1JCH A;  2UU9 O;  4FLW A;  4J9Z B;  4RUF A;  1P84 F;  3JAK A;  4WFA V;  4NB5 A;  1GTO A;  2WWW A;  1MSD A;  2WLJ A;  2ZR2 A;  3JSN A;  4H33 A;  4KXR A;  3I55 V;  4EFB A;  5IDJ A;  4LF7 O;  4KL1 A;  1PP9 H;  1OCZ B;  3FB5 C;  4PHZ A;  1M90 W;  3CME V;  1AR5 A;  2PI4 A;  1R73 A;  3LSS A;  3JSL A;  1IXM A;  1ZL8 A;  2EZO A;  2Z5U A;  2YIB D;  3IJ4 A;  4AI8 A;  2AGA A;  3K59 A;  4QE9 A;  1EZV H;  2CTP A;  5C8Y B;  4JAS A;  2QGN A;  4D7T A;  4B7K A;  4UCS A;  1JFF B;  1N0J A;  2XAQ A;  4QGP A;  2E5L B;  4JI7 B;  2LW7 A;  2X6A A;  3CPW U;  1SRY A;  1WP8 A;  2QWN B;  2B1G A;  4X66 B;  4NTX A;  3KCY A;  1J5E B;  1OJH A;  1RSO B;  5IJ0 A;  1QCE A;  2ZE5 A;  3JD3 A;  5EBW C;  5A2Q N;  4PEL A;  1H2L A;  1OZ0 A;  2UXC O;  4DV6 O;  1KEC A;  2VWJ A;  4LF9 O;  3MD0 A;  4JPR A;  4J7Z A;  3C3S A;  4O4L B;  2D3O W;  2ZT9 B;  1YF2 A;  3M7M X;  4R50 A;  2CH7 B;  1NQT A;  3N2K B;  1K33 A;  3H1I H;  1BS3 A;  3IC9 A;  2UXN A;  4MVQ A;  5L3B A;  2V1D A;  4TOI A;  1YHQ V;  1X4T A;  2YIC A;  3SYC A;  4ZBM A;  4JI2 O;  4Q20 A;  1Q6I A;  1DF4 A;  4MVO A;  5GON A;  4DR5 O;  4C7U A;  2EIM B;  3G6E V;  2OTJ V;  2QE7 G;  4PA4 A;  4XDL A;  5JH7 B;  2UUA B;  4DUZ O;  1Q3E A;  3FD9 A;  4MVZ A;  4TSF G;  3OEE G;  3TJT A;  4R8C A;  3AG3 B;  4O2B A;  4UVC A;  4I9W A;  2OCC C;  1TUE B;  2ADQ B;  2XAJ A;  3QO7 A;  3ZS8 C;  1FYJ A;  1AJN A;  1PNL A;  5B1B B;  1SZX A;  4K3A A;  1TVK B;  3RN4 A;  2XTA A;  1N36 B;  4EKW A;  3NR7 A;  4LF4 O;  1WAZ A;  2X7R B;  3SJA C;  1IBM O;  2CE4 A;  1S5H C;  2KG7 A;  3G71 V;  1NR7 A;  4G2K A;  5EBL C;  3VBB A;  1K5S A;  3LDD A;  5CB4 A;  3IC7 A;  3L74 H;  4GUN A;  5CA1 B;  4LFC O;  2UUC B;  1BT8 A;  3FKS G;  2CUG A;  3AK3 A;  2BCC H;  1H2N A;  4I4T B;  1IX9 A;  2HKO A;  5B1A C;  4JAA A;  2Q67 A;  3F7V C;  1BHB A;  3IFX A;  1DLB A;  1QHT A;  3ABM C;  3C90 A;  3RYH A;  2FYU H;  4TUY A;  2UU9 B;  2JDI G;  1FFX B;  3K9S A;  4MW8 A;  3E22 B;  1LNQ A;  1OCC C;  3CP1 A;  3K0D A;  4PDV A;  2GTA A;  3VQY A;  3CWB H;  4LF7 B;  1YEW A;  3OD4 A;  4DV1 O;  1BHA A;  3SPI A;  3UT5 B;  1M9N A;  3S3X A;  3SJC C;  4B08 A;  2IU3 A;  3ZN0 A;  1P7G A;  2MK3 A;  2P06 A;  4DK1 A;  1XRE A;  4DR3 O;  3RW0 A;  2QTO A;  1P4R A;  4QE7 A;  3BCC H;  1XOU A;  4QPK A;  1VMG A;  4O4H A;  4I55 A;  3ZHV A;  4DR1 O;  3CRA A;  3CJH B;  2YI9 A;  2E75 B;  3STZ C;  3CCS V;  5LOV A;  1ZUQ A;  3T1H O;  4PD4 F;  3STL C;  1K9M W;  3SPG A;  5LMN O;  1OCZ C;  1VQK V;  4PA3 A;  3L75 H;  4BIO A;  5BY1 A;  4NTW A;  5LBQ A;  2UXC B;  4DV6 B;  2V7Q G;  1GMG A;  1QLN A;  3LUT B;  3JAL A;  2ZNI A;  4LF9 B;  1MNG A;  4UCO A;  1Y6X A;  2PI5 A;  1NTZ H;  1VQP V;  2YC0 A;  2BOB C;  3K06 A;  5KHK A;  2AHY A;  2R72 A;  1JJ2 U;  3CMA V;  5LXT B;  1SS3 A;  1VQ8 V;  3UO3 A;  1S77 D;  5GTH Z;  2F43 G;  4KHP O;  5KHG A;  4FM2 A;  4DV7 O;  4EB6 B;  1K34 A;  4JI2 B;  4I0X B;  2R9A A;  4JZG A;  4NVP A;  3QO8 A;  4RUE A;  4JYY A;  1CP9 A;  1OCO B;  1Y4M A;  4WBN B;  4DUZ B;  4CC5 A;  3OM3 B;  4F4L A;  1IBK O;  5KMG B;  1GH6 A;  2CK3 G;  2WA3 A;  4PI0 A;  1VF6 A;  1SA0 A;  1MG1 A;  4JTC B;  2M7W A;  3ZBH A;  1RFY A;  1B3Q A;  2WSS G;  2QEX V;  2AZ2 A;  3MDS A;  4X20 A;  2YID A;  3W7T A;  4CC6 A;  2ZDI A;  4LF6 O;  1K92 A;  1ZSP A;  3D3Q A;  4RWU A;  4FLY A;  1THZ A;  4LF4 B;  2JGD B;  2HVK C;  2WAM A;  2EIM C;  2LFR A;  4X65 O;  2WLL B;  4LWS B;  4MVR A;  5L3G A;  1SQQ H;  2Q69 A;  5B1N A;  1IDS A;  4JTA B;  5LHG A;  3W7X A;  4JI5 O;  4LFC B;  2X6B A;  3AG3 C;  3BAB A;  1AJQ A;  1JOY A;  5CBF A;  4YXW G; 
#chains in the Genus database with same CATH homology
 1WP7 A;  3S3X A;  4NTW A;  4NTY A;  4NTX A;  4FZ1 A;  2QTS A;  3S3W A;  1WP8 A;  4NYK A;  4FZ0 A;  3IJ4 A;  2FB5 A;  2L35 A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...