1H2LA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 106
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2lA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2lA01
4BIOA 1H2NA 2XUMA 2WA3A 2Y0IA 4B7KA 1H2KA 4AI8A 4NR1A 3P3NA 3KCXA 3KCYA 2YDEA 3D8CA 2W0XA 4Z2WA 1MZEA 1MZFA 1IZ3A 3P3PA 2CGNA 4B7EA 1YCIA 4QU2A 1H2MA 5JWPA 2WA4A 1H2LA 4JAAA 2ILMA 3OD4A 2YC0A 4Z1VA 2CGOA
chains in the Genus database with same CATH superfamily
4QDQA 1QBZA 2JG9C 3ZHQA 5KAIZ 5IWFA 1FV3A 2VRZA 1JMKC 1D4M2 2RS32 4NE9A 4GKKB 1NBMG 4JI1O 1IXBA 5HFLA 2WIIB 2VAUA 4PHZA 1YJNV 3H42B 1JYIA 3B09A 3GHNA 3ACGA 2Y6LA 4XQ4A 2J1SA 1UZ0A 1F4NA 1QKQA 1GZ9A 4QQPA 2OYQA 3DXUA 1FATA 5I0RA 4OPHA 5G04L 5FYCA 1VQNV 5FMBA 3C3TA 3VHPA 2WZR2 2CV6A 3IMNA 4MGIE 5FZ9A 4DV3O 2ZDIC 1DLLA 1YIJV 3TN92 2B1GA 1RUG3 4HOOA 2X5IA 1VRH1 4OHZA 4YW3A 1J5EB 1CQ9A 4HG6B 3SNMA 1OHFA 1YFXA 3K03A 4CEWB 1PK6A 5ERLA 2BRTA 2WLLB 2RS11 1NQTA 2Q30A 5DPNA 3H9VA 2CU5A 2VNOA 4DXSA 1YIFA 5F32A 5K9YA 5FPXA 1GN2A 2Z69A 5C8YA 4XDPA 4JRLA 2HVJC 4NWWA 1H2SB 2W1UA 3W5MA 1OH3A 4XJ8A 4RQPC 5FYBA 2CGPA 3SGIA 2QWRB 2R7EB 3H9AA 1QQP2 3K9SA 4LBQA 5JR2A 1URFA 2AHYA 3NNGA 2K9ZA 5A3NA 3KVAA 1W9TA 1HNWO 4FPYA 4D6QA 1C8M2 4J7JA 1JBCA 5LW9A 2DYSC 2OXBA 5JSOA 3CCSV 5FO7B 5J37A 2OCHA 1FOD3 4M0HA 1F4MA 3FX3A 4AK3A 1K45A 5KHIA 2WWSA 2NPIA 2FD8A 4GUNA 5LBFA 4WF9V 4X1KB 3LD8A 1PPJH 5JOXA 1LOBA 3VL9A 2ENRA 2EIKB 1EPZA 4FXGB 1WN7A 4BA6A 3BIWE 1EZVH 2EX3A 2VUCA 2EIEA 4URAA 1RHI1 5CFCB 5LRRA 4COZA 4BQ2A 5FLIA 4PDVA 4QPIA 3J26N 4DR2B 2WYSA 2F1MA 2ADEA 2WQ4A 4K40A 2WLMA 3VLBB 3VBSB 2QZ3A 1CWPA 3O5SA 3B9IA 3I2HA 1Q6UA 1RVF1 2HWC3 1PVXA 4IEXA 3OYWA 2WFPA 2PHXA 2RS33 1R3KC 2NYYA 3UJOA 1WA8B 5E1AC 4XCAA 1NCRB 5JH7A 3GNEA 2VUDA 4HZ3A 5B66Z 1FMD2 2XJSA 3CSXA 4AQSA 4LWSB 1NOVA 1WPXA 2E33A 5IW0A 3BFRA 3IBMA 1C4RA 3BOPA 3WDWA 3UT5B 3DKQA 3I56V 1IQDC 3FHQA 5E89A 3H1LH 2J7MA 2VMEA 5KHGA 4E2SA 3OUFA 3RW0A 2AACA 2ZAAA 5FJHA 4LA2A 4GX0A 2RNBA 4L0PA 1NTZH 4LK6A 1GN6A 1OCCC 4MLOA 1ZUQA 1W59A 5F3CA 1O5LA 1HKDA 3G4SV 3CEWA 1CZTA 1R73A 4UCSA 1ZLZA 1HR0O 1R083 1DTOA 4QWNA 3VBUC 2IBZH 1DZTA 1GMMA 2F4PA 1RUJ3 4AEKA 3BKZA 4DMIA 3NNJA 4QX1A 4CDWC 3FE5A 1OLRA 1NU1H 1FJGO 2O57A 1VBB2 2W39A 1VBB1 2YROA 2VULA 3W7SA 1V6NA 4UFJA 4P9JA 1SHWB 5JH7B 3DL3A 3LDCA 1WP8A 3E6CC 3NMBA 4DV0B 3WDTA 3H3LA 2DUPA 3KM5A 1Y76A 1QJX1 1GOHA 2YIBD 1LEMA 1T5EA 4R7CA 1BS3A 2ZM6B 2JDIG 3FHIB 5EZWA 1AYN2 2QE7G 5FY4A 1H9PA 1F8VA 5F5IA 3CDZB 3J7LA 2CWMA 4LBOA 5JXHA 3SH3A 3WQ1A 3B77A 4IEYA 1KKCA 3ZMTA 2WLQA 4I30A 3AG1B 1WW7A 3U78A 2V5DA 3AYDA 1RJ8A 2QQWA 1F4HA 1R64A 5DN6G 1W2UA 2JS3A 2ADPA 4UOJA 1GANA 3ML0A 4CEWA 3TEWA 3JAWA 2UXNA 4GH4B 1PK6C 4YM1A 2JICA 4LITA 3HQUA 4LC1A 1N36O 2R062 2Q68A 4BLJA 3K5OA 1K5JA 1OD5A 4ZOLA 1N1SA 1Z7S3 5LXTB 4ARXA 3L73H 3E8BA 1JXNA 1HV0A 5KBFA 2VZPA 2WSUA 1LGNA 3QBQA 4B7KA 4AFDA 1N34B 3GHMA 4Y22A 5CN0A 4XURA 2JJ2G 2BCCH 1JFFA 2QCSB 4CA9A 1WCUA 1UL9A 5HCBA 3HPLC 5EYPA 4XPVA 4R52A 4DV2O 3JD73 4M3CE 2AGAA 3ZKUA 3VBOB 3C7FA 1AJPA 1WLCA 1A34A 4DUZB 1C3HA 1S5HC 5GKAC 1OV9A 5B2GB 1OXCA 5GZEA 2IJKA 1K3EA 3SYPA 5LCWL 4CPBA 2QDOA 2YIBA 4YXWG 1B35A 1AYN3 4BIUA 4PQQA 2P4EA 2VBDA 2RJZA 5L7OC 1BL8A 2W92A 1MS8A 1YXWA 4AW7A 1V6LA 1S3JA 1OKQA 1GAXA 1RTVA 4H14A 1VAMA 4DINB 4EZ4A 3EHKA 2ZE7A 4CRQA 4XABA 3PL0A 2FYUH 4IV1C 4EWAA 3EMRA 4O4HA 2RVAA 1WLEA 3LKJA 3SR2C 2EXHA 1EV12 3FLRA 1WCQA 1WLWA 5FZ1A 5KXCA 4NIHA 2BGOA 2BU9A 4DB5A 5EIYB 4YVSB 2Q5ZA 4GKJO 5BY1A 4H7MA 2P22C 2R30A 3O1UA 2FDGA 5LB6A 1OJHA 5JSRA 3SYAA 1GWLA 1CPNA 4CEYC 4AR2A 4BCUA 4JI1B 1V6JA 4A5UB 3RI9A 4DW1A 4P9YA 4FPGA 3D8CA 1KQRA 3AP4A 4PI2A 3L71H 1FXVA 2QM7A 4Q0PA 3I3BA 3JCUZ 3NL1A 3MF9A 3UT0A 3I2IA 4TXWA 1W28A 1WCDJ 3D36C 3T1YB 2ZX3A 1O5UA 3NV2A 4ZS2A 5A6QA 3JD72 1N0JA 1JODA 1FXHA 5FL7G 4UCVA 5FNVA 3K9AA 2C1FA 2RS53 3WNMA 3S5AA 4COVA 2GNDA 2BSKA 4GWJA 4HKLA 3PURA 4FFBB 1KYOF 4GMP1 1RUE1 1R3LC 2BEOA 1NCQB 3NJYA 1VQ4V 1FI2A 1LOGA 2G38A 3CJIA 4YSFA 2BOIA 3FUQA 3CCRV 2WZEA 2MNGA 3LFMA 5I8TA 2Y4TA 1C1LA 5FFOC 2LFSA 2B9VA 3HMYA 4QB1A 4QXHA 4AVBA 3MF6A 2WLKA 4YVWB 5L36A 4ATEA 5ANQA 3ZSJA 4LOSA 4L8JA 3D3QA 1WLDA 2VZQA 5B3SC 1OLME 1X8MA 2RM21 2QWOB 3AMHA 1OFNA 5DZFA 4JGYA 2PFWA 3GZTB 5FO8B 5L7OB 2BSKB 2WNUB 3S3WA 1H4GA 1YXBA 5BYNA 3I4IA 3AL6A 3STLC 1SZBA 4META 5LATA 1A8DA 1CD3G 1QCEA 3ZMZA 1SA0A 1AR4A 1ZZ7A 5A7NA 3AKRA 4I01A 5LBQA 2VOVA 4GXLA 4X8NA 1RM1C 5CA0A 5T52A 2W5FA 1VMGA 1ND2B 1XMOO 4I4TA 2FZ1A 2JGUA 4QKDA 4L2NA 1WJZA 2OCCC 4OI4A 2GH8A 4MS2A 1ZTEA 1BK1A 1FFTB 2JXAA 3K51A 5CBHA 4LULA 4UYBA 5J3UA 1W3XA 3NO8A 3LUTB 4CPBD 1CX1A 4H55A 1RXGA 3BTAA 3OYWB 4PT6A 1PO12 3BUCA 1KDMA 3CLPA 4AGGA 4LCUC 4DW0A 4KG8A 2ODMA 3LE0A 4DR4O 4BW9A 4I3GA 5T5PA 2WL1A 3B02A 1JN2P 1RUC1 5LBEA 3U14A 3VD4A 3J7NA 1VQ8V 4IV3C 5F5CA 1R6NA 4RS5C 3JD1A 3CQOA 5CA6A 3FX7A 3JATB 3FAVB 3NAPB 2PHTA 3Q9OA 1PM7A 2D3SA 4IHJA 2CDYA 1VBE2 5FZ0A 2VCAA 3OOXA 5EPAA 5FZBA 3D0SA 3ASIA 2BUKA 2YS8A 5FZLA 3T2PA 3L70H 2HJDA 3QH7A 4AE2A 1JZ3A 4YWAA 3ZFEB 3S7EA 4JI2B 2UUCO 1FNYA 1NZCA 2O0OA 4CDQB 1RMU2 1J84A 3H1YA 3J4UH 4LF5B 4PD4F 1WMXA 4IDZA 3N9MA 5EFUA 5C3PA 3F5TA 3O1VA 1F5FA 3W7XA 4G9SB 3AZYA 1GM8A 3DTUB 2D6PA 2VQFO 1PL4A 5BNPA 2VBBA 3LF7A 1PK6B 3OTFA 5IYDO 1N1VA 3TK1A 1FJGB 2OW4A 2ZX4A 2VY0A 2V72A 1UMHA 1WW4A 1FMD1 4KBZA 4OPAA 5AC91 4GA9A 1NY72 2K1EA 4IEWA 5GLTA 1JZ4A 1TG7A 3TOJA 1FNZA 3IM0A 5J98B 3FFQA 1LNQA 1UU4A 1HB4A 3MI8A 2GHYA 2YB7A 4AEDA 1Q6IA 1UYZA 4FAHA 3HB3B 3NNLA 5JJJB 1EUUA 2Z4FA 2DCJA 1JQ0A 5I8SA 5K0UB 1GP6A 1Y66A 4YRDA 2EIMC 2W1SA 3Q8EA 2HWE3 2H6CA 3W7WA 5C8CC 2R061 2VR4A 4P14A 5J96B 5LHHA 3MICA 4XXAA 4LF9O 2IZWA 3WG3A 4XQWA 3FHAA 4MXWB 2F43G 1XC6A 2EXJA 2Z2SB 4YZ4A 3D5OA 4UUJC 1AJQA 2C4XA 3R66A 2Z5UA 4UB8Z 3RG0A 3H8XA 1JA8A 1N36B 4I9WA 4GLXA 1QY4A 2HEWF 2CK3G 5LK7B 4KU7A 1TUEB 2QQKA 3TXQA 2OIEA 1TMF3 1UOBA 1Q7YW 2WT2A 1SKVA 4DR1O 4FTSA 3ALQA 1AROP 1W6PB 3IDEA 4FTEA 5C33A 1CAXB 4I9QA 1NAEA 2VGDA 2KM2A 4N43B 5IWAB 3P32A 4XDQA 2WLJA 3ETDA 4YW7A 1YJKA 3NQHA 3ECQA 4FFIA 5LA9A 4YVSC 4DV4O 5CFCC 1W6MA 3AG2C 5L3FA 1GOFA 1QVFU 4IE7A 1YI9A 1IPJA 1HJGA 1OF4A 1DHKB 3CCQV 1G1XB 1CR7A 4OQ8A 2KSDA 5E8AA 2P6CA 4TSFG 5APAA 2X09A 3I2OA 3QTCA 3HVDA 4Z2AA 3KQ4B 1TMF1 2PA7A 1EN4A 4QX2A 4LWSA 1SF9A 3U4SA 2WLLA 4UCRA 4FVMA 3SEPA 4X89A 4Z1VA 5A7OA 4N23A 4H3WA 3OMIB 4ISQA 2JB4A 4JHZA 1MR5A 4YJ2B 4Y4RA 2NP0A 2ID4A 1D4M3 4IXLA 1VF7A 2QWPB 5C4WA 2OKXA 5JVDA 5FYZA 1VIBA 1VQ5V 2X6CA 5KA5A 2WZR1 4UT5A 3RYIA 2V4VA 3VQWA 3WU2Z 4K20A 2HEPA 2OTJV 4CC6A 1H1AA 4B3RO 1I5XA 1KS4A 4ZI7A 1P49A 1OA3A 5LBCA 1Q82W 4R4XA 3CCLV 1F35A 5IYZA 3WDUA 2CTPA 1ULFA 1YRZA 1Q43A 1RUF3 4IE6A 1W9FA 3THDA 2YFZA 3HKBA 4JQRA 2ZMKA 5CKNA 3BODA 3FLTA 1RVF2 5KHJA 1RSOB 4UBGA 3UK9A 3HAGA 4FLZA 4TV9A 2BFUL 5LA6B 1WGPA 1H1MA 1LNSA 4J80A 3A0RA 5LMUB 3JALA 1S2BA 1RGSA 4CH4A 4UVCA 2RM22 2GP5A 4QGPA 1OPMA 5GZDA 4I50A 2P4KA 2WLIA 4O4IA 4A41A 3E6BA 2NNUA 1JYVA 2UYAA 2BV4A 1ZREA 4RS5B 1ZBA2 2BVBA 1JJOA 3LDEA 1ZRCA 2WA3A 3MFCA 3T1HB 4O4LA 4I55A 5FWJA 2UWCA 1PNGA 4I0XA 2IVIB 3ZRSA 1F2NA 5IJ9B 1DQ5A 2WLIB 4O4IB 2GN3A 1EV11 1O7FA 2AEZA 3JARB 3NVCA 3N3HA 4K0KB 1XMQO 2FB5A 3N4MA 3M2MA 2ETNA 5LP6B 2JKBA 3PVNA 1ZRDA 4H0LB 1JHNA 1C5HA 2HWF2 5EHDA 2HFEC 5IYBO 3UQ8A 1SQPH 1ND2C 3GGLA 3EJKA 1GV9A 3T09A 1C8M1 4NHYA 1VF6A 4C91A 1AR91 2ARXA 4RHV3 3K04A 4E4DX 5KC6A 3CRCA 5FZKA 4DR7B 2XUMA 4AEDB 2V7QG 3H1KH 4TZDA 2P1BA 3MEPA 4XIKA 4YG3A 3M4FA 4IYIA 4BIFA 5IK7A 1HIXA 2JGDB 4E2QA 3G7DA 5FBZA 4I0WB 4WBBA 1EM1A 4IGQA 4NTXA 3WFVA 2YXLA 3L2YA 3S0MA 1H1IA 3V64A 5A2QN 3MHZA 3WNOA 3L74H 4JKLA 1V54C 1OFSA 2Y69B 4N8MA 2PMWB 1U5IA 5T50A 1RXFA 4RAIA 5FZFA 2OA2A 1KFUL 2BJSA 2E75B 2BE3A 5IATA 2A7WA 1SACA 1YCIA 3LEIA 1G8WA 1VBE3 5DAVA 4AZZA 2JG8B 1SQVH 4BMBA 5T5JA 2CTVA 5KA6A 2D6OX 3MLKA 5D1IA 4IIJA 1BYHA 4AQ6A 2ITCC 2YIDA 1AR92 4BK4A 5JCOC 5HXMA 2FDHA 1VEWA 2EIJC 4ARYA 2FQPA 3AKQA 1IS3A 3CPWU 3RZHA 4E4EA 1QR9A 2XLGA 3AYAA 4JI5O 5IAVA 1JZ8A 3BVCA 2XWJB 3B5LB 4U3FH 2ORZA 1J59A 1PGW2 1QHTA 2P67A 4U7OA 2KKWA 3JBG3 3W21A 1FAFA 4LFBB 1TNRA 2WO2A 3EQEA 1LOAA 4LF6B 3VBFC 5B1NA 1BQPA 2DUOA 2QQNA 1BBT2 3AEIA 1BCCH 1GN4A 2UUCB 3WNPA 5F39A 1YJWV 5FMOS 1Z7S2 4TTGA 2Q7HA 2E32A 5F5AA 3DXRA 1YSCA 4P08A 3E6DA 3ZIXA 3VBSA 1DZRA 4LO4B 4EB6A 1YUDA 5LHIA 4UCOA 3WG4A 2HWB1 2OZJA 1NT2B 1V6KA 3LCPA 1VP7A 5AG2A 1RC6A 3SCFA 2D40A 2JDMA 1W6QA 5KC5A 4KWLA 4MGYE 4JI8O 3H50A 1R092 3QCWA 1LHUA 4XETA 4AQYB 1XB9A 3AP7A 3OBRA 2PHDA 3R0RA 4V1PA 3B93A 4NIGA 1LU1A 3AZZA 4LA3A 4QKFA 4B3TO 1VPHA 5FZ7A 5IJRA 2WNVC 2LS6A 2WLPA 4IGOA 1NY71 3J8F3 3HD8B 3TNQA 4AWDA 2P6HA 2B5UA 3IAYA 2NMNA 2RJLA 3E5UA 2R042 1GNYA 4YHHO 4O61A 5DUVA 2VZOA 5K4LA 2QM4A 1RP3B 2XPJA 4I02A 3VL8A 1HV1A 3BPSA 5FQ0B 4CZSA 5KHKA 1SFPA 1W6NA 5T55A 3N9QA 1N34O 1UWWA 3ZYFA 4BJ0A 4FLXA 4V2WA 2W2IA 3ZRWA 1GZTA 4CEYB 1DF5A 1R1BA 4ES9A 2VBPA 2ZX1A 2ZGSA 1X7NA 1UQXA 1BGYH 3K46A 2Q1MA 1AX0A 2OX0A 2VNRA 2YDEA 2D6MA 3M7AA 1B09A 5E1RA 3MUY1 2A6VA 3ZYRA 1QWRA 3E1F1 5G05L 1TVGA 3A0HZ 4TLGA 2J22A 4GX5A 4JGZB 1S5LZ 4PLNA 2RJ2A 2ORXA 3AVSA 3HKDB 5DZGA 3SJCC 1H30A 4M3CF 5HI0A 1WAZA 1EP0A 1HNXO 4CDQC 2O8OA 3UJQA 2CTRA 3VKMA 3ZSKA 3LNNA 3URFA 2JIZG 1PIV3 2VZRA 1SLBA 1PO21 3PVBB 3C7GA 3A8TA 3WOGA 4B4QA 1QOSA 4TOIA 4X1KA 4JGZA 1IURA 3AJYA 5L9RA 5FMOL 4CCLA 4L8QA 3OGCC 3HKBB 3K5LA 2NN8A 2OZ6A 4CU8A 3TEYA 4CH3A 4ITCA 1Q8OA 5FY8A 1VQ6V 1ONAA 5BY5A 4ZBMA 2QQOA 1H6XA 4HPKA 1ENVA 4KHPO 2ZGNA 4FSJA 4U3JA 2A75A 5JVDB 1LOCA 2BP6A 3KMHA 3DGTA 2FBEA 1V6IA 4RQPA 3VQYA 4AI9A 3SPGA 2ZEXA 1MVQA 4MVTA 1L0NH 4AI0A 3KD4A 1RITA 3HQXA 1PMHX 1AI5A 1SETA 3B3QE 4CXYA 4KMQA 2FCUA 1XE0A 4FZ1A 3MPBA 4NVPA 3QACA 2ZNIA 1W2NA 4BQYA 4B29A 2DVGA 3FMGA 5GZFA 1EY2A 1CPMA 3POGA 2DYRB 4JVAA 2WSVA 3VKOA 4IV1B 1U96A 3USUB 3ILFA 2KA3A 5FZMA 1IS4A 4NR1A 2P06A 2YICA 3UO2A 2QQIA 5K1PA 5D8AA 3VN4A 4FXKB 3WVJA 2Q0AA 2Y6JA 1A78A 2DYCA 1DGLA 1DQ0A 3E89A 4F6RB 3JALB 4M3CA 3I49A 5IFTA 4YW5A 1VQLV 4OUSA 4YY3B 3CYOA 2RMU3 1UJWB 4NPRA 1PZ9A 2R1DA 2DYSB 4FT8A 3RRDA 5JQGA 4JDNA 1XNBA 1GBGA 2ZOEB 2DBNA 4D94A 2AW9A 1LRHA 3ZFFB 3BTZA 1M1KW 5C9AA 4CS4A 4LO8A 5A3TA 1EFRG 1K12A 3QO5A 3SH4A 3E22A 5JJEB 5LA1A 1H9WA 3AB0A 2H8PC 3PTRB 2DVDA 1R1A2 2OPKA 1FS0G 1OC1A 4GB31 5LMNB 1L7LA 2EZOA 2HWD1 1OOPA 3ETPA 4XE9A 3U75A 5IVJA 3BA9A 1GK9A 4JI3O 1GN3A 2VC9A 4XHXA 3CBNA 4YVWA 1IBLB 5L3GA 1R082 2QZ2A 4WM8A 2XBO3 2IXHA 4J1WA 1K73W 2VVFA 4A3XA 4RUEA 2JDHA 1UKRA 1YFUA 2Q7GA 1POV3 3DYMA 1S0BA 3S7IA 1K5MB 4IEPA 2Y6GA 3SISA 3ILNA 2WNEA 4EWDA 2A6WA 3K57A 4NXNO 1UMZA 2ZQMA 3WLUA 2XVGA 1PVC2 2JE9A 3ZSLA 1US6A 4DR7O 4XACA 1O8SA 1MACA 1PNFA 3VDDA 2PN5A 3BCCH 2LGWA 2IWGB 1HRI1 2EF6A 3BTXA 4MADA 1PIV1 3TETA 1VMHA 1Q90D 4BR6A 1GR3A 2GDSA 3V0BB 5FPOA 2ZGQA 1VMFA 5I0DA 4Q1PA 3T1LA 3J8F2 2UXCO 4QB2A 2PHFA 2A73B 4DR6O 1S77D 4LR4A 2RV9A 1DQ6A 4XUOA 2ZJCA 4MH0E 3A0NA 2DVAA 1HJFA 2XUEA 3O1PA 1C5IA 4OMCA 2R0HA 1XYPA 2EAKA 5F9TA 4XZPA 2VM9A 3WP3A 1G9FA 1XBFA 1HRV2 1SLLA 4BQ1A 4HVRA 2VQUA 2UXDB 2UUBB 1R1A3 5B5EZ 1OUSA 2KXLA 3ZSMA 1EN5A 3SEEA 1N1TA 5IY5C 1QJU1 5BR8B 1URXA 4E8DA 2W9XA 2A7AA 4V2VA 1PX3A 1WA8A 2MK3A 1OI6A 3NKTA 3OPZA 1G86A 5JCOA 1NTMH 2VL4A 5FY1A 1M06G 3BA8A 4W6XA 2LRPA 5A6XA 1RUF2 2FCVA 4DY5A 1H8TC 2A6ZA 3ZHRA 4QXKA 1WA4A 4XDJA 1JFFB 2ARAA 3ETEA 1YC61 3CJXA 4BU2A 3RYCB 1XEQA 2R1BA 1MS1A 2O8QA 1GWKA 4BIZA 3F2ZA 4WFEA 3ZHUA 4CCMA 3QOPA 3BY6A 3U11A 5L3CA 2P3KA 5FRAA 1JW6A 5I8YA 4UBHA 1V54B 5EZYA 5C3OA 3X2QB 2VQFB 4FM1A 1WB7A 3RVHA 3VD5A 4AGVA 1COV2 1BEV1 3A2FA 3H8UA 3ZMOA 4U2AA 2CTWA 5DAXA 2IXLA 3OTOB 4Y5TA 2NZ9A 2WDBA 4CCEA 3ZN6B 4AOCA 2PI5A 2UY8A 5GLZA 2EICA 2XGXA 4ZHQB 3A22A 2KQXA 1ND3C 3OR7C 1AR71 3GM8A 3MIHA 4XVHA 1AL22 2WAMA 3H01A 4R8HA 2E9QA 4XUQA 2P17A 5EYYA 3FL7A 3T1CA 3EO6A 1B3QA 4CXXA 3ENRA 4DK1A 4INDA 3UV9A 4I2OA 5K7PA 1LU2A 1LESA 3J9SA 4BOWA 4UXNA 3HKDA 1MS4A 3DYPA 2VO5A 4Q4Y2 1BKZA 3F5WC 2D3OW 1AYN1 1N32O 1DGWX 1KP2A 2OUHA 4AVVA 4QPIC 1HW5A 4K8RB 3WNLA 2Q4SA 1JR9A 4LF9B 3I5DA 4DUVA 3B00A 3GWKC 2CTQA 1WB8A 1DQ1A 3GCXA 2YPJA 1EUTA 4QGNA 2ILMA 1X4TA 4X62B 3ABLB 4IEOA 3N9LA 3HKEA 2A5ZA 2DTYA 2BVVA 3N2KB 4DRVA 3ZPOA 1VBC1 4FIPC 1K92A 1BXHA 2BNNA 2YC2A 1O3QA 5DDJ1 5CKMA 3R05A 1M57B 1DGWA 4ABMA 4E4SA 1K4CC 2V09A 2C24A 3B4SA 2HHHB 3I2GA 2B9ZA 1ULOA 1AHSA 4WFAV 1W8FA 5M0TA 2K9PA 2QEXV 1ULEA 3F7YC 3ZMUA 5IWAO 3GZAA 2E3CA 4DR5B 1UX6A 5FYUA 2ZKNA 1XQNA 4NAOA 1E5RA 1RUG1 1YEWA 1ZZBA 3IDAA 3G67A 5A7SA 3HKCA 2RHPA 1WPBA 1GYKA 5EBWC 2XMLA 1A3KA 4LLFA 1J1TA 1I1EA 2W0FC 2PTMA 1AL0G 4XUPA 3W20A 1NXMA 5JOYA 4JGZC 1FXKA 3SH5A 3RYHB 4LNUA 2A79B 3T0BA 1HDJA 3PNAA 2OUJA 4L87A 1JX9A 4GX1A 1J3QA 3NV3A 2VS0A 5F2SA 3FBYA 3WR0A 3HNYM 3WZ1A 3KKYA 3MIGA 3CX5F 3WP6A 4LFCO 4GT1A 4BE3A 4JKKA 1NTKH 1UY0A 1SFNA 5LHGA 2WZPP 4FFKA 1KJRA 3KV4A 1W6OA 1H8VA 1BK0A 3AG3C 3AL5A 3C3SA 3WW4A 2DVBA 2G1MA 4AXOA 3JB4C 2BTOA 2YC4A 3SKJE 1W8HA 4BQ3A 5C6CA 1XYOA 5J2UB 4GX2A 2MW2B 4RFRB 5KXBA 3T1MA 1KEXA 2MEV2 1RHI2 3BYWA 5FXWA 3K58A 5T54A 1BBT1 1CIWA 3BU7A 5J2UA 5FZ8A 2JKXA 1SDDB 4CCNA 2H94A 2M6YA 4M3CB 4IE4A 3Q8FA 2LFRA 1I9RA 1PO11 1YIPA 1EYBA 5FPVA 1MG1A 1B04A 2C9AA 2AUYA 5H2FZ 1ZRIA 1IGOA 4MO3M 2PAKA 3ABKC 2WO3A 5CFCA 1ENRA 2CGNA 4N43C 4GKKO 1BBT3 3Q4HA 3TB0A 1QH7A 2CH7A 4DEVA 3IWZA 2XHNA 3OPWA 1SQFA 2DCYA 3ZXAC 1OURA 4FPCA 1LR1A 4LBJA 5E6HA 4Y3OA 1OH4A 1F9KA 1DQ2A 4PF1A 4EFEA 1ULPA 1S72V 4Q4W3 3DPRB 3T4VA 4B08A 1I08A 3JD3A 5ABJA 4I50B 4LUMA 2HKOA 1H6YA 2YXHA 1UYPA 3ZMNA 2ET1A 4OZOA 3T1HO 1G6NA 2GP3A 2PLV2 5FY5A 3FD9A 3VBBA 1LGCA 3S30A 1YYNA 2N04A 4CS2A 1R091 3K4AA 1W8WA 4QHZA 4HSJA 2QWQB 2PHWA 4HXCA 4J7KA 3EBRA 1OF3A 4JGSA 2W87A 1NQDA 1CONA 1XSQA 1E57A 1YNAA 2YI8A 3HN1A 3I97A 3RBZA 3NR7A 2UUAO 5FXVA 3WQ0A 3QLQA 5C8CA 4JAAA 1VF5B 3S6PA 3E83A 4D0QA 2AC1A 4LKDA 3NXSA 1DF4A 1RUD2 4LHLA 4Q1RA 3CWBH 2ZDIA 3SYQA 4AAXA 4QPGB 4EWEA 1QXRA 1C8M3 3LPFA 1OLQA 5JCTA 4MSVA 1VBD2 2Z42A 3FYEB 4FOQA 1PM4A 1NLRA 1QMJA 3RZZA 1XI1A 5DDJ3 5B1AB 1DGRN 4Q26A 2FL4A 3ABZA 4KNCA 3PJYA 5IY5B 2X10A 3RI8A 1AR72 3UKVA 4YIOA 5C3QA 3OMAB 4MTFA 2W0XA 2I45A 2DQ3A 3JASA 5CA1B 1ENQA 4FP2A 5FAXA 4YW4A 2QQJA 1L8DA 2GALA 3WW3A 4J42A 4TN7A 4DXTA 1IG3A 4L92A 5EJZB 1YQ6A 4RHV2 4XHBA 4JGYC 1MMMA 4LP8A 3QVNA 4FPKA 5IUQA 3WUCA 1PV0A 3VDBA 1AILA 1S0GA 2GTAA 5K0UA 3ZFEA 5B4NA 5DUWA 3VV1A 3LFIA 5I91A 3ACFA 5C3RA 2WFF1 3HEIA 3FKSG 4JTCB 1GKBA 3VBHA 4COUA 1D5NA 1EBOA 3KZ4C 3ASNB 5AC93 4LORA 4O9GA 2QKSA 2SBAA 3DXRB 3OE7G 1N3QA 3PVOA 2QSAA 4H33A 4KUMA 3H7JA 5KWRA 5FDBA 1YQCA 1X36A 3AG4B 1PL0A 2D3RA 1NQJA 1PNMA 1LEDA 1W8ZA 4LE3A 4ZOLB 2ZZQA 3V65A 4XTMA 2UUBO 3WDVA 5IK8A 3VHNA 2C2AA 2R043 2Y69C 2ZGTA 1BMV1 5JVVA 4LKEA 1CJDA 4CDXB 2YY1A 2L6LA 1MQTC 4BK5A 2LQTA 3K0GA 1MSWD 3ZPYA 2XAGA 3KV5A 2XL7A 2XWBB 3MW4A 1PM9A 3D36A 2DWRA 1NKGA 2B46X 3N9NA 3EB7A 1JYNA 3RWNA 4LF4B 1W0KG 3BCWA 5LY1A 2QA4V 5H9RA 3W58A 3ZMSA 3TCUA 2JD4A 3AK1A 2X5IB 2XOMA 2ZE5A 3RZMA 2YBPA 2UU9B 2Y4UA 2HWB3 1R6KA 1SS3A 5FKCA 3K77A 3GXUA 2IH1C 4N9IA 4NAMA 3I59A 4NB5A 3D4KA 4NTWA 4AI1A 1X50A 5FYMA 4ZKIA 3I2FA 1GKFA 4CEYA 4KQ7A 3KT4A 4BDVB 3KV9A 1BHBA 4P30A 3R65A 5A3MA 2WS91 1CEZA 3H1IH 1L7RA 3LDKA 1YFYA 1QHDA 4XDKA 2DU1A 2BNMA 4YYOA 1W2TA 2Q8OA 4JF3A 4FO9A 4PJYA 2ADDA 1F7YA 4PLOA 1UYXA 4NWVA 3D3AA 1VE0A 5HPOA 2R70A 2ZM6O 1Z5WA 2HEYF 3UM7A 4FFFA 4UFHA 1DG6A 3M3IA 4LF7B 4DV5O 3JSNA 3CJIB 2ZTNA 3AXEA 1YTFB 2HYXA 2X5IC 4JI0O 1JHJA 4LFAO 5BMVA 5JZGC 4GD4A 4EJRA 4E2LA 1N32B 4DV6B 1TAEA 4CCDA 3CXHF 4A6OA 1WW6A 3FUOA 3BTYA 2P6JA 3P1IA 2WSSG 3WF1A 3FB5C 4TV9B 3VGIA 1ZZCA 1MA1A 2RDRA 2DCZA 1OQEA 4PI0A 3S5QA 1VLNA 3G6JB 5J1XA 3WW1A 5FJKA 4OHVA 5CFDC 2UWBA 3ZFGA 2AGSA 2DV9A 4XILA 1AYM3 2W52A 4B1MA 2JEXA 4JV5B 1UYYA 5JXJA 5CMUA 2DWEC 5JAXA 1Y9GA 1H8EG 2JK5C 1RUG2 1G4YB 1P7BA 4CDUC 1HWYA 2LJ2A 3C7OA 5GLVA 2HLEA 4W6YA 1Y9QA 3UT5A 2OTLV 1VQOV 4RQPB 2V1DA 5JI9A 1VJ2A 5D5PA 2GC2A 1KB9F 1HNXB 4X88A 3D3IA 4JZ2A 3SJAC 1WCKA 1YHQV 1IPKA 1VQ7V 3SCHA 1F31A 5H6QA 2FMYA 3RYHA 1SEFA 3IIAA 3PVEA 3VOUA 3DPRA 1ENSA 4Y1XA 4LTAA 2R72A 4F83A 3MYXA 5J48A 3AMPA 2E5LB 1O4YA 1T6BX 3OEEG 2DF7A 4NJ4A 4C8DA 1ZRFA 3JYCA 4XF0A 2XDVA 5FR3A 4FTBA 1YQ8A 4NRQA 3M1HA 4Y24A 4AAPA 4LFCB 5ITZB 3A0KA 2Z5WA 1Y76B 1VRBA 4HPKB 1MSDA 2RDCA 1N8RW 3RFRA 1AJNA 4C7UA 4CS3A 1KD7A 4X65O 3KF5A 4J9YB 5BZBA 2HG5C 3OW2U 3FB7C 3ETQA 1KRIA 4JI6B 2V5YA 3JCIA 2BBAA 1M57C 2PXJA 1QJY1 3G80A 3SKVA 1PGL2 3L75H 1UIKA 2IFRA 5JXIA 1WMFA 4YJ2A 4QT6A 1ASJ2 1P8JA 1YI2V 3APBA 4LIUA 3HBKA 3PDQA 2MEV1 4NPMA 1J5EO 2HR3A 2VWKA 3LGRA 5DM6V 2QM8A 5GLUA 1DGRA 4QX7A 5FPLA 5FY9A 5LYJA 5F2VO 4D69A 5FO9B 4N53A 2X6BA 3ZEDA 4YY3O 3V0AB 4RN5A 5AFBA 3SITA 2JEMA 1FFXA 4GYCB 1IG0A 1GRJA 3WHUA 3O14A 1AI6A 3TYJA 3AKSA 3QG5A 5GM0A 5ACA1 2EA7A 5A3UA 4CBCA 2J1UA 4FFBA 3RGBA 2BOBC 3THPA 5EC1C 4DV7O 1WUVA 3DC6A 1DP0A 2UXBB 1I6XA 2SLIA 4LLOA 4BXSV 4XZUG 1XE7A 1QNYA 4N53C 3VBSC 3T1YO 2J1RA 1IQAA 1KECA 4QU2A 3CC7V 3GCWA 3E86A 3U1XA 1I5PA 3PIJA 1M9NA 3IC7A 2ZMLA 1S5JA 4EFBA 1Y6XA 1IBLO 4WFFA 2Q73A 2BFUS 2XT9A 2JB8A 3SC7X 2P5BA 1FD9A 3ETGA 3THOA 3AMMA 1KGYA 3ZSEA 4QKNA 4F7ZA 2JWPA 2BWAA 4E9KA 4QHBA 1L3JA 4ES8A 4Y1VA 1ZNPA 4LF8B 3H1JH 4KI5M 1Q6HA 4WM7B 3HR0A 5A6YA 2VCBA 4JV4A 1KS5A 3OY8A 4OUMA 1UPSA 2D2CB 1TME2 5DDJ2 2E26A 4G27B 2UURA 2EILC 2XH6A 2GMPA 4QE7A 1OD3A 1US3A 1FXZA 4K9SA 4X66B 2D3PA 3ZHVA 2BZDA 3USUA 3CKHA 4ZS3A 3WHTA 5EQUA 1NE4A 4LBKA 5J2TB 3ZFGC 4I09A 4Q4X2 1JOYA 4IYHA 4PIZA 2J1EA 4NO4A 5BXZA 1UD1A 1ROPA 3KT7A 5DMYA 2VTXA 4QAWA 3K3WA 4M4RA 5I93A 2G9GA 5FY0A 5BNNB 2IJIA 5FPAA 2ZX0A 5FPRA 1NJIW 4EYUA 3LSUA 2RDNA 1HN1A 3B2EE 3KHCA 3PUAA 2Q8VA 4QGMA 3QO8A 3WF4A 2ATFA 4D7SA 1THZA 2D43A 2VNGA 1PGW1 3F95A 1DZQA 3POEA 4HYOA 5L9BA 2I2SA 1GLHA 4ONUA 4XFFA 5B3SB 3LEMA 1R6TA 2VJXA 5DABA 4GWMA 4Q2FA 1PNKA 1AR83 1REFA 5FP3A 5B1AC 5FZ4A 2R063 4IUGA 2Q8EA 1GNZA 1I94O 3OBAA 1V55B 5CFDA 5DXDA 1AB3A 1LHVA 4JI7O 1V9U2 4RFT0 4W65A 1SQ4A 1A8MA 2W95A 1AXYA 4C1WA 5EYPB 3ZRXA 1ZZ9A 2DU0A 3WXPA 2JDNA 5CVRA 5FYIA 1IDSA 1MVEA 3JBG1 3UGGA 3BU0A 3ZYGA 5IVEA 1F5JA 4XQDA 3RPQA 2ETEA 3OF1A 4XBLA 5J9PC 3P3NA 1FKAO 2BTQA 1LECA 1S0JA 3OBTA 1CAXA 4YARA 1JOPA 1MS3A 3WEZA 1RUH1 1E5SA 5SV5A 4QIWF 1KU9A 4IEUA 4XFHA 4PA4A 4R9BA 2WNVA 3POWA 5LL6Y 4XAEA 4JTOA 2VZVA 5DG2A 4OMDA 4LR3A 1UPGA 2WQ8A 1HRV1 5F1RA 5IAXA 4Y26A 1ZX5A 4FLVA 3IPVB 1V9U1 1RPRA 1AZDA 3EHBB 1HQWA 3ATGA 1AR1B 5I0TA 2P37A 2Z3YA 1UW8A 2RS31 2D98A 4JTNA 3BGAA 1AX2A 3MO4A 3WG2A 2JG9A 5C8CB 2D7FA 3ZDSA 2I74A 2X7RB 4OXSA 4UCUA 4NOTA 3T2QA 4Z82A 5F3EA 5JLVA 1OCZB 1Q8IA 4ASKA 1PO23 1KJLA 2TBVA 3V0AA 3OBZA 1IX9A 3VZJA 4N21A 4A7KA 4J41A 5LP6A 1UY4A 1W0OA 1SG3A 2QJVA 3KV6A 4BQ5A 1HRI3 4B3MO 1PVC1 3MV01 1QH6A 2R9IA 3RYKA 5FUPA 3A0BZ 3T3YA 3DECA 2ZGMA 2HHHO 2GTSA 3ZM8A 3DEMA 5ACA2 3OEAA 5BNOC 1FMD3 2VQTA 4JKMA 1NLSA 5CB4A 1RUD1 4UWDA 2UWAA 5LA0A 2P90A 2XLAA 4CC5A 3ABMC 1WA6X 2YUEA 1GZWB 4AGRA 4I0XB 1OPOA 1W8TA 2XJPA 3JASB 5CA1A 1D0GA 3ZFGB 1FOD1 4MGTA 3GBFA 4UW3A 4MVUA 1UKGA 2WABA 2UY9A 4OX9O 3LWCA 1ASJ1 3JSLA 5F5QA 5F8PA 1GZCA 4YFZA 4O2AB 4Q29A 1Y74A 4QJFB 2Y38A 1AR73 5FMCA 1VBA1 1REDA 4Z1MG 4ZPIA 5KXEA 2PYLA 5GONA 3EXUA 3VD7A 5DAWA 3C3VA 1GU3A 1NA1B 4XBFA 4D3WA 1DLBA 3N2GA 2IXIA 2JDKA 2WT1A 5T3NA 3RNSA 1Q86W 3CXCU 2BGCA 2V73A 2WRAA 4MX3A 1YZBA 1H8TA 2PELA 3ZXKA 4EE2A 1SLTA 2XJUA 4DV4B 2VW2A 5C93A 1RB8G 1VBA3 1TEIA 1ODMA 1LCLA 5BNOB 3WQBA 4NUBA 2Q4PA 4UF0A 2PUSA 4B3SO 2ZHLA 2UXXA 1RIRA 2JE7A 5FZ3A 5BNOA 4WFHA 4ASUG 4JAUA 2IH3C 5EWSA 1XNDA 5CIRA 4R4ZA 2ZEWA 2C26A 3RN4A 1PZ7A 4LHSA 1FFXB 1NR1A 5EP9A 4GWIA 4HONA 1NA1C 3KT1A 1ZA7A 4UI9L 2VCMA 4I4TB 4Y20B 3MGUA 1V00A 5EBMC 3N2GB 4X65B 3OUHA 1TNFA 1MEC3 1CXZB 3VBRB 5JJNB 3PUSA 2DQ0A 4RGAA 4MVOA 1CZVA 1W3VA 2F4LA 4JI6O 3OEHG 1QIQA 2A0LA 5L3DA 1K97A 2WNUC 2XASA 4FPHA 4QPGA 4WVZA 3RVZA 4TSVA 5JOWA 1P84F 1X33A 4Y20A 3PJQA 4OI2A 2FDIA 1YJ9V 5FBJA 1VARA 1D7PM 1F51A 2WQZC 2F23A 4IEZA 3GBGA 4WM8C 4YNIA 4R50A 2VVDA 1OCRB 1JUIA 4A7ZA 2BTQB 4GKXA 3RYFB 5LGUA 2EVXA 5CG9A 3AG3B 4Q0QA 4GJZA 4CZZA 1QGLA 5T5LA 5KAFZ 4ISRA 4Q8LA 3MHSC 2Q1FA 4EROA 2R32A 4DR3B 2A6YA 2CGOA 2JJ1G 3UGFA 4B3NA 3FC0A 2RE9A 4N43A 2CHHA 4XFCA 3ZRVA 3K4ZA 5C9AB 5IFPA 4FPEA 3SPIA 3HNBM 4O4JB 1ASJ3 2ZT9B 1POQA 5BNNC 3TAYA 3B40A 4Z07A 1HQNA 3LDBA 4MGSA 4NRMA 3O65A 3ASOC 2AREA 4URTA 1XBLA 4Z2WA 5FZ6A 2IU3A 4ZZ8A 3BABA 1BJQA 4TUYA 1N1YA 1ND3A 3APOA 4ZXEA 3JD4A 3K06A 1O3RA 3ON7A 5C4WC 2ARCA 2PHLA 1GNHA 3KLSA 1KD1W 1SBFA 4Q4Y1 4Q8KA 5CYYA 1J1LA 1RINA 3HBZA 1OHHG 3CHXA 4DEQA 3HWJA 2TNFA 2FTKA 2X8KA 1XMOB 3SYOA 4JC1A 4Y4YA 4EN8B 5K1XA 4FOYA 2D5FA 4HBNA 1Q3EA 4CVUA 1RFYA 1J95A 1UNBA 3MW2A 4IQPA 3RYCA 1AJKA 1SERA 1FPN1 4O4JA 1I7FA 2ZHMA 1DBNA 3AFKA 5H9PA 2J42A 4K1ZA 5FPUA 3VBOA 1XOUA 4F6EA 2YXSA 4PDMA 4XF9A 1BMV2 3NJZA 2FHRA 5A7WB 2OT5A 4I0AA 3P3PA 4P9IA 2Y6FA 4AEJA 5C70A 4A6SA 1BEV2 1XHXA 1KMIZ 1YO8A 5FCCA 4FPPA 1MZEA 3WUDA 4X1YB 1BQ0A 3HPNA 3JD0A 3SXWA 4DK0A 1APNA 2Y60A 4BMEA 5T5OA 3CCEV 2QJ1A 4X1YA 1LHWA 4K3UA 2W68A 2IJHA 3OUJA 4O4HB 2Y6HA 4B7EA 3AYCA 5LWBA 5AVAA 1KQSU 1R1ZA 3AK3A 3STZC 2YC0A 1I94B 3E5QA 4LF5O 4Y1UA 4LF4O 5FLJA 3E8FA 4QPJA 3HJRA 4NXMO 1PHMA 1T6GC 4M4PA 5H9CA 3ZO0B 3LDRA 4DNYA 4X1IB 2UU9O 3USSA 3ZXEA 4XYXA 1EAH2 1U97A 5FYSA 4MVSA 2ZEYA 3C7HA 1E1QG 4XXPA 4OUEA 1W2OA 1KKDA 4A45A 1VBD3 5IK5A 2Q0OC 1LHOA 3F7VC 2A71A 2ZGKA 1O59A 2Q7EA 3ACIA 1QQP1 3ES1A 4KBBA 4YLZA 5EJ1B 2FDFA 5KUKA 4G28B 4NTYA 3OT7A 3RSJA 4UXAA 1OQ1A 1VBB3 2BYVE 4RD7A 4AFAA 1FT9A 4YM2A 3K5MA 4DOUA 3QH6A 3ZR6A 4YM0A 1GQGA 4CP9A 5A3OA 1OOPC 5LA6A 2GUZA 4UW5A 2WS92 4CCOA 3VHRA 2BQPA 4FOVA 1LOEA 1CAUA 3C90A 2HWF3 5EIBC 3H1HH 5GW7A 3PHMA 4BIOA 2A3WA 2VW0A 3K79A 4E8CA 4B3TB 4HVQA 3NJVA 1O6UA 3O1RA 3DUIA 4JTAB 2EALA 2VNVA 1XNQO 4LBQB 4C90A 1QDOA 2JE8A 4RWUA 4Y5Z0 4Q27A 3TWIA 2PQQA 3LPGA 4AVTA 3MIEA 2JGDA 4P2ZA 1ULDA 4G2KA 1CESA 5A70A 3FYIB 4JV5O 1YF2A 3MFAA 3LNMB 3WDXA 2VQEB 1FPN2 3R6SA 2CUGA 4Q0SA 2JG8A 2RMU1 4CCKA 3J8F1 2WC2A 3CC4V 4IV1A 2DFBA 3PN1A 3SMHA 4JRAA 4EN9B 5CISA 3OGGA 5F37A 1RJ7A 5FTTC 1SA0B 5FP8A 1PIV2 4BWOA 1J83A 1UCXA 2PF4E 3MDSA 1G9BA 1Y67A 3WV6A 2ADQB 2DDUA 1HXS1 3MIBA 1NA1A 1XSRA 4KGGA 1DF0A 2JIJA 2VXRA 4E4ZA 3AP9A 4QQOA 4OX9B 4NN0A 5A7PA 1LOFC 3I7DA 4X64B 3RJ2X 2ZABA 3QO7A 4GMP3 2BERA 1AXZA 2EINC 1M90W 4U3JB 4AI8A 2RG4A 1OKOA 3WNKA 1HDKA 1HNZB 3G6BA 1OA4A 1R3IC 4LNUB 3KHBA 3HKCB 1MABG 2YYOA 4M01A 3UGHA 4WBNA 2VVEA 3D6EA 3B69A 1FV2A 1JS9A 3FBMA 2X05A 2WJSA 4DO0A 1W0NA 5ITZA 4AEDC 1SESA 1W8UA 5GTIZ 4LBMA 3JQWA 3N9PA 1K9MW 2VWJA 4WZFA 5C71A 5CBFA 4B3RB 4J25A 4HNAB 2JIGA 1MNGA 2VZSA 4JGYB 3MD0A 5SV8A 1H2NA 4P9WA 3OUSA 1QXJA 3PMEA 4OHWA 1S0FA 1OBNA 2W08A 4CSWA 3IFXA 1QQP3 4NRPA 1WP7A 1GSLA 1ZYBA 3M3QA 4B3SB 4YZ1A 3AG2B 4IHJB 5FK7A 4TLFA 2AR6A 2CDOA 2XB6C 3PUHA 4LT5A 4HLTA 2EIGA 2QGNA 4C0BA 1IBMB 4MZUA 4OFGA 4XMIA 5K8SA 2ZS6B 5D2AA 2IXCA 2A3QA 1UOGA 3ZXGA 1AR61 3U37A 3GJAA 1Z0HA 2XJQA 1ZAUA 2ZMNA 1UY3A 3HR9A 3INAA 3T4ZA 1QVGU 2C5DA 2KB1A 1RMU1 2GV9A 3JCZA 5I0UA 3OGVA 4Q4X3 1VB4A 4AHXA 4HNAA 4DV7B 3PTYA 1TMF2 1V9PA 3MV11 3VKFC 3MW3A 1SRYA 4RQEA 3SHRA 4OYUA 1SQGA 3WDYA 1OCRC 4PIYA 1FYUA 4ZKTB 4QPYA 5CA3A 1HQLA 2AXTZ 4E2GA 4U7NA 1BSMA 2YPDA 3SPHA 2PLV1 1K7DA 4F3JA 1Z7S1 4KH9A 1COWG 4CDXA 4K0KO 2IUWA 3ES4A 1LTEA 2GU9A 1VMJA 2F17A 4EN7B 3G71V 5DQ0A 4J9ZB 2H0BA 3DPRC 4PDLA 3CMAV 1RUE3 4OVEA 3VBUB 2ZBJA 3A4UA 4CDQA 2BWCA 1RUF1 4MXWA 4KU8A 3FLPA 2OQ7A 4DPNA 5KHHA 4PDWA 5JIAA 5FZOA 3VDDB 4CYDA 4UFIA 5LOVB 2Y0OA 1PGSA 5FOBB 3N2KA 5EZYB 4UV9A 1HNWB 1W03A 3RJRA 5LXTA 3CEIA 3JB8A 2YHJA 1F23A 4LBQD 5LMNO 5FYHA 4MW8A 3L9DA 3V56A 4CUBA 4JI3B 3IJ4A 1IBKO 2DBIA 5FMDA 5CAZA 5IE9A 3AJZA 3OPTA 2WUHA 3N27A 1U5YA 4UAPA 3UO3A 3MBWA 1ZM1A 4QE9A 1TUBB 4XBNA 3VKNA 5I0SA 3VBFB 1I3HA 2B4KA 3QD6A 3AX4A 3ZN1A 3M3CA 2WINB 1KITA 3CF6E 2XQRA 2B39A 1UZWA 1LJ7A 2FDJA 1CX4A 3VBOC 1LOFA 1HRI2 4NXNB 1W6MB 1UAIA 1ZSPA 1LGBA 3RS6A 4IERA 1I0HA 2PHRA 1FXKB 3HKEB 4BAYA 3WT3A 1XNRO 1MQTA 4DQAA 1Q81W 4KGQA 4LPLA 4GB33 2HWE2 2Q1ZB 2DN9A 3LA3A 1NUKA 1OZ0A 4CCCA 5EXOA 3VHOA 2OCCB 2XAQA 1UF2C 3IN9A 1K5QA 2W6IG 3ZHSA 4YW2A 1CIYA 1SCRA 2WNVB 4MGKE 4X1IA 1US2A 3CJIC 2VUJA 4IE5A 4XF3A 4PCRA 1RPOA 2VQAA 4JYBA 5JWPA 1S4CA 2PI4A 3RQ0A 1LKNA 3GALA 1TUBA 4PF5A 2NR5A 2EULA 2XONA 3D82A 4RHV1 1QLEC 3TRSB 2WKKA 2BPA2 4J10A 3VZMA 2UYBA 2RS13 4LE4A 5LEKA 3LQCA 1OSGA 3RZLA 2D6LX 4RUFA 5F6LB 3K0DA 1NVPB 4MTXA 5CBLA 4NYKA 2JDPA 3WF0A 2AH2A 5JMCA 5JMOA 3HT1A 4LFBO 4LF6O 5FYTA 2AYHA 3E8GA 3GZUC 3LEGA 2VH9A 3AG7A 3AG1C 5FPBA 1EAH1 4B1LA 4O65A 1H2LA 4LQRA 5H9QA 3WSOA 2P5OA 3E22B 1WKYA 2E76B 2TEPA 2Y26A 4MVZA 2K2SA 3MDPA 4UVAA 1XQ8A 2GSMB 1RUH2 2HYKA 2JDUA 5FXZA 1O4TA 1WMEA 3ROUA 1RUC2 1MS5A 3AKPA 4P9GA 1O3SA 1CAWB 3O0VA 4RL7A 4QGLA 4JASA 1UO9A 3O12A 1JUHA 2KD7A 2OIGA 1GZWA 3WF2A 4QNHB 4YGEA 4DZGA 4U36A 5KR7A 1A32A 4Q4V2 3ZHTA 4RQFA 4HFSA 2VMHA 4QPGC 4KFMA 1GOGA 1D5AA 2WNUA 4E27A 2VCCA 5JPMB 4CXWA 3E5XA 5EV7A 1GFF2 2OWOA 3UCSC 2R0FA 3SYCA 4LO5B 4YHHB 1ZBE2 3AMNA 2E7TA 2E53A 5CFDB 4HANA 3VBHC 1NZ6A 2BDRA 2VZ3A 4IEQA 1K42A 5EC2C 5DG1A 1X59A 2XAHA 1CN1A 2RMU2 3CRMA 1HB3A 2DFCA 5IVYA 4HKWA 1S1AA 1XU1A 4ZXKA 3AP6A 1AP5A 4QDRA 4XEZA 2IVJA 3T2MA 4BB3A 4BQXA 2ZIOA 1CZSA 3ILRA 4IIJB 4P9PA 2W6JG 1MOFA 3DC5A 5CNAA 5J7MA 4X9QA 5FP7A 4JYAB 4CH6A 4F6RA 1QOOA 2J1AA 4IETA 5BUVA 4L9BA 3I8TA 3KGLA 1QU7A 4KP4A 3WCRA 4TQFA 3QF7A 1SLIA 5KXDA 1XYNA 4DV1B 1AF9A 1DYPA 1BVVA 1J3RA 4QXBA 2D93A 4MVRA 3X2QC 1W9YA 1H2KA 3U10A 2CY6A 3M8AA 3DV8A 1XHZA 2WO1A 1JU3A 2GZWA 3OB8A 5C5TA 4TV8A 2MEV3 5HCHA 3BAAA 4FJCC 1ND2A 1TME1 1NX9A 4HK9A 4C1XA 1S2KA 2XJTA 3Q8AA 3BIEA 5LRSA 1SC5B 1N3PA 3BB6A 2EBOA 2RDSA 1IXMA 3T0AA 1YWKA 3LSQA 3NWKA 2JX9A 3LZZA 5TSWA 4DXZA 1AI7A 2QQLA 1SDWA 5LYJB 1JI6A 4QMAA 4YIPA 3U0ZA 3OMNB 1PMIA 3ZFFC 4Q0UA 1Z2GA 2GC0A 3ZX7A 4KHPB 1YITV 2HJIA 2XKOA 3JAMN 4DY3A 5A33B 4G4FA 2EZPA 2YUAA 2ZXWB 1SLAA 3ZKYA 2PYJA 3W59A 1STMA 5FZHA 1H38A 2VE1A 1QJX3 3ACHA 2G19A 4NHXA 2A3YA 2XR4A 1W9SA 2Z0AA 3CCUV 4QM9A 3ZXLA 1Y7BA 1AVMA 4XFGA 5HBAA 4DXRA 2QNKA 1T2XA 2R9AA 3L72H 2QQUA 5DAQA 5C3SA 2OPWA 1SQBH 3VBRA 3EXAA 3CMEV 3M8LA 3HN3A 2WBKA 4AEMA 4DV3B 2Y8KA 1ZZ6A 1GO3F 1OCCB 1Y74B 1W2AX 4S2HA 3VZKA 1FAYA 1VQMV 3POJA 1UXXX 2PY5A 1AYM2 2X53S 1NCRA 4CU7A 2NM1A 4QKBA 4H7LA 3W7TA 1SZTA 2EIMB 2IFWA 3JAKB 5JZGB 1OMIA 3PLQA 4P9LA 1JZ7A 4DUWA 5L9VA 1K5MA 4UW6A 1TQ5A 1SCSA 3ZIWA 5FP9A 2YV8A 4H44B 5DZEA 5CG8A 4XCBA 3THTA 3N35A 5FZIA 1ZRRA 4TQDA 4MG2A 4WZCA 3R4DB 4P9OA 3WX5A 1LUVA 3DSQA 1WZXA 3ZDVA 4XJ9A 5FK8A 3JATA 2N74A 1AP6A 1P7GA 5C8YB 5FLHA 1IVSA 4JDOA 1Q8PA 4FLWA 4EQVA 3R4SA 5C5UA 3I3MA 1N0NA 3FB6C 5GLWA 4IE0A 1BHAA 3O0XA 4MTGA 1XNAA 3MIDA 1BT8A 2VZTA 3SCGA 5DN2A 5ACA3 1ODNA 4LBLA 2ES3A 3MIFA 2QDNA 1B6QA 4S2DA 3PU8A 5H9SA 3HNMA 2JENA 3KS7A 3M3OA 3VBRC 1DLCA 2MHFA 1GP5A 1Z5VA 4FLTA 5IVBA 4B4RA 5FV3A 2LGQA 3ASOB 3RDIA 4P00B 4AVAA 4P5YA 3K59A 4ZHNA 4QD2A 5C4WB 5FNVB 3IMMA 2XNDG 5GJ6A 4Y22B 1JZ5A 3KCCA 1HP8A 2JJ6A 4DR6B 1SQXH 5LBBA 1HXS2 1MEC1 3FJSA 2VMFA 4XOGA 1ALYA 4HT1T 5ISLA 2HH9A 4H13B 4YVSA 2F95B 4AI2A 2CL2A 3J7HA 1QU0A 4DYLA 1X8EA 3VZNA 1XNRB 3JD2A 4KL1A 4UCTA 4F8AA 5JDBA 4FK5C 1XNTA 2WLNA 3A7QA 4IV3A 3R4UA 5E79Z 2YBSA 3RWRD 3EYPA 4Q0VA 3OEBA 2G9FA 2ZHKA 2ZKOA 4W6WA 5F7UA 3POSA 2CAZC 5A32A 3CD6V 1C57A 3TBDA 4TYSA 5BNQA 3AM2A 3K48A 1XREA 4L97A 1L1FA 1SBDA 2GSYA 2Z79A 1U0AA 3ST7A 2Y6KA 1K8AW 5DAPA 4RGGA 1FPOA 1B35C 2IW5A 2QFEA 4TUYB 4JCKA 4N7IA 4YZ5A 1EPWA 1B35B 3K2OA 3AZVA 4ZI7B 2EIKC 2AZ0A 4R9CA 2PHUA 3LSDA 3WG7B 1CAVA 4QQHA 1S0DA 1E1RG 3RZGA 3ZOIA 1NXD1 5A1AA 4WM7C 2K46A 2DJVA 5CB7A 1AJOA 4LH6A 5CEHA 3Q4HB 3OTOO 1WMDA 4LIVA 5A6ZA 3M99B 2YBKA 5IT9N 1Q8QA 4ZIBA 3LEKA 4AF9A 2A3XA 4DRXA 3WG1A 4ICGA 2EJRA 1RUE2 3POYA 1W06A 4JI2O 1CJPA 3T4HB 4ASMB 1Y43B 4DUYO 3PJSK 4ZONA 1KFXL 2VXJA 3UKNA 2ZXQA 3KF3A 2LUWA 3JUUA 4Y5SA 4WVVA 1TGOA 1YI7A 1D4M1 1BVP1 1R1A1 3AZXA 4LK7A 2GMMA 3E2EA 1JTZX 1WD4A 2HBTA 1FYJA 1DFQA 4LO6B 2VTXJ 4Q5OA 4MGZE 4RS5A 1XE8A 5IVVA 2ZE6A 5C8WA 2RDQA 1QNWA 5JSPA 1UU6A 4KWJA 4O2BA 3JQXA 1FOD2 5BNPC 5KUMA 3FB8C 1VR3A 2YGMA 2AENA 2JECA 1MZ5A 4K6BA 2C9KA 4TWTA 1LAJA 5EYXA 5FP4A 2DOSA 2DURA 5KX5B 4X62O 4I55B 5A1FA 1LR5A 5A3LA 2CH7B 4KXRA 3ZMVA 1XL6A 4AI3A 2WO7A 2DYRC 3NNFA 4BXFA 1EV13 5HFMA 1FXKC 3AG4C 1TME3 2KG7B 3KQRA 2RR11 1DU3D 2QWNB 4LHNA 1VF6C 5IVFA 1CGPA 4WBNB 3SJQC 3LOBA 3W5NA 1GICA 1WBLA 4GH4C 4DR5O 2YXYA 2NQYA 2YEVA 1V6OA 4FFHA 4CU6A 4NKGB 3H3UA 2YMZA 1WLTA 4D7YA 4JYAO 4P02B 2QTOA 2OQ6A 1D2QA 1AL23 4IL6Z 2C0ZA 1UFIA 4YZ3A 3B8MA 4TV8B 1ZL8A 1OVSA 4DV1O 3CS5A 4PBOA 4GIQA 3DCQA 4O9EA 2WLHA 4QPIB 4DUZO 4AFMA 4JQTA 5JI7A 5FZCA 3ZJZA 4I7ZB 4R9AA 4TWKA 2YEVB 1IHMA 1NS1A 3WNXA 1HB2A 2N05A 1PMJX 1WWYA 4QX5A 2XVKA 4PIXA 2JDZA 1COV3 4BM8A 1JZ6A 3EVKA 2DW4A 1UXZA 1V55C 1LODA 3B9CA 4I0BA 3I3QA 5GONB 2IU0A 3CRQA 4JDMA 3VZOA 3C2UA 2DE0X 4JYCA 4JTDB 1JOJA 3WNNA 3OG2A 4GULA 4NIIA 3MAQA 2QKDA 3O7OA 3NKGA 2LW7A 1VAKA 1QQCA 5HCFA 4N9HA 1N47A 4ZU5A 3CP1A 1VB2A 3MHHC 4NROA 3GF6A 4WFGA 5BNNA 5L7OA 5K0UC 1Y4MA 3N7KA 1UU5A 3K4DA 4UFKA 4XFAA 2Q5TA 2R9RB 5FPZA 5C7GA 1IBMO 2L9LA 3AFGA 2GAUA 1IS6A 3WD5A 3RYFA 3JAKA 3NNMA 3CB2A 1RUJ2 5FUNA 5LGNA 1SMVA 1TZOA 4ZU7A 3H3ZA 2R072 3RZJA 4H2AA 4XJWA 3J7AU 1GMGA 2R073 2W46A 3IB3A 4J6GA 2PAMA 3ABKB 3B94A 5CADA 4N53B 3CO2A 4BQWA 4AHCA 2J1TA 4XMAA 2B9UA 4C0HA 4KG0A 1OT5A 3LSSA 1REEA 2F6BA 3I3EA 3WB0A 1PO22 4Y1ZA 4ZZ5A 4AYUA 2R041 1U12A 1XILA 3HQRA 5EIBD 2XHKA 4CDXC 4JZGA 1AR63 3CRRA 3ZR5A 2FDKA 1FPN3 2UUAB 4QX0A 4FP3A 1AR81 1W6QB 4QXCA 1POV1 3N7MA 3BALA 1W9WA 1JOBA 3IDCB 3AYEA 5IYZB 2WFF3 4QQLA 3AP5A 2ZAHA 2YGLA 3RVYA 3SQOA 5FZGA 4IV3B 4W4LA 4LEJA 1NCQC 2WPDG 3ZVXA 3BRCA 5B4XA 3WB2A 1JH5A 3WW2A 3I59B 5FKBA 4MOAA 2QBXA 1IS5A 1H2GA 2VECA 3IAPA 4MYEA 3CU7A 1J3PA 3ZRWB 4FI9A 2YU1A 4J7ZA 1KDKA 4NHLA 2JG8C 4MV2A 3PUQA 1NYWA 3O0WA 2VU9A 1PP9H 2HWD3 1RMU3 3NSTA 4JI4B 3SJBC 3NW4A 3VDAA 4X8PA 1MEC2 3MLLA 5TISZ 2VPVA 4UVBA 4D6RA 1QNMA 3SDLA 4MGQA 1ZZ8A 4Q20A 1S0CA 4X66O 1KBHA 1ZWIC 4DUXA 2EJ7A 3ABLC 4K8FA 3I55V 3IAQA 2ZGRA 1EZJA 5ANNA 4PA6A 1D4VB 1RL3A 2CAVA 2ZPXA 2DTWA 3CC2V 1RUJ1 3ZX6A 1COV1 4O2AA 2CNAA 2BW8A 4CEWC 3CZJA 2VTFA 1X9PA 3RZKA 2QKCA 4K1YA 2QQMA 1RM1B 2WWJA 3RMYA 1CPYA 4DR4B 1IKPA 4WV8A 2GNMA 1G6UA 4DXWA 4ORFA 1Z78A 2ET7A 4CTEA 2XG3A 2VZUA 5E16A 1E5HA 2PLV3 4LHKA 3WCSA 5LOVA 3WINE 2DUQA 2VOXA 2IXKA 4GQ7A 4DRXB 1GWMA 2V4AA 3AZWA 1C8NA 2ZX2A 5LP6C 5IJ0A 1ACCA 2IC1A 3RWKX 2GNBA 3ZS8C 1JYXA 4NIDA 5D8AC 1AR62 1G7YA 1ST8A 5F3IA 1LUWA 2DCKA 1G9CA 1D0HA 3NAPC 4JI7B 1G9AA 4OGQB 2A9HA 4LMFA 3RMXA 3N7LA 2ZNJA 4JI5B 1X9TA 3LA7A 2JS5A 2A70A 4UFMA 4DS0A 1OUXA 5JPNB 2YIAA 1YFWA 2PYTA 3MZHA 3P6BA 4UF0B 1W39A 4O2BB 1M4UA 2R49A 4CE8A 3CJHB 5FZEA 1NCQA 1K4DC 1RHI3 2YSUB 5GZCA 2BTVC 4PDWC 4D8MA 1PKXA 4NMIA 1QXPA 4EEQA 2LALA 5FZDA 2GBOA 4LKFA 1AYM1 1Y3TA 3N7JA 3TEXA 4LXLA 3IIIA 1SBEA 5A9GA 5DEDA 1RSOA 1JYTA 2ZZJA 2VOKA 2HWB2 5JOZA 2E7AA 4PDRA 3O1TA 4IGGA 4K3AA 4XF1A 4PA9A 3RYIB 4AQ2A 3BVOA 2XLFA 3VB9A 3A21A 4QM8A 2O14A 2ITDC 1AVBA 4DV5B 3NV1A 4K35A 2WN2A 4DFSA 1N33B 4JI0B 4CP1A 2LROA 2NN4A 3POIA 1F15A 1SQQH 5LZ6A 4OHXA 4JI8B 2RS52 5JQGB 1EN6A 4AQYO 1WD3A 1Y4WA 4LNVA 2Q8CA 4CCJA 2AHZA 3B01A 5HV0A 5FYVA 3P5BA 2VOTA 5IJ9A 2J1VA 4PELA 4IT5A 3AK0A 2XHBA 3JD71 1BCXA 4FAGA 4RSUA 5J2TA 2V4DA 1BE3H 3Q8CA 2RN9A 1M5IA 3WG7C 1OOPB 4B3MB 3IGAC 2GC3A 4FQ4A 3VD3A 2QR4A 1MZ6A 5KLVH 3ZBHA 1UN1A 3LSEA 2XAFA 1NI8A 4BZ4A 2VW1A 1Q5OA 3GYDA 1VBD1 3M7MX 1YLLA 1ND3B 4PQ9A 1NZIA 4K7JA 3ZYIB 4GMP0 4FMTA 1AUYA 4PJ0Z 1VRH3 3BEHA 3D0JA 3VQVA 2IXJA 1KC8W 1NCRC 4QPWA 3OM3B 5L19A 3H1MA 1UMIA 4XC9A 1W6PA 2Y34A 4GWNA 4FQZA 4SLIA 1GH6A 1HW7A 1OCOC 4FBFA 2Y33A 5CA0B 3G6EV 3OGSA 1VIWB 5IDJA 4YZ2A 4Q4Y3 1OCOB 4FFGA 1PZ8A 3M3EA 3UKTA 4KWKA 3HOBA 5BXXA 3LIGA 2WAAA 2Q69A 2HWD2 4UV8A 1XOYA 2Q6AA 1QJU2 4GAZA 4AVSA 4NHMA 3H7YA 4OI0A 1D2DA 4HZFA 3KSCA 1NH2D 3IT8A 2JD9A 4S2GA 4YGBA 4XW3A 4CUGA 4DRRA 1V0AA 2VG9A 2VMGA 4MSWC 1PD3A 1KP3A 4XAAA 4PLMA 1IKQA 1RUD3 1JU4A 1K5SA 1O3TA 4JAVA 1ENXA 3ZYJB 2Y64A 3QNEA 1ZBE1 3NAPA 1LB2A 1AXKA 2YU2A 1MZFA 5BMVB 2E31A 3POBA 4AL9A 4WVMA 4EV0A 5A3WA 5H5NA 2I07B 2WR9A 4YW1A 5E88A 3W9AA 1NH2B 1MQTB 2B42B 1QJY3 5H6RA 2CE4A 2OYZA 1XNCA 2VMCA 1IZ3A 4MVMA 2RR12 3GVMA 3JAWB 5LMUO 1M56C 3N9OA 2W3JA 3ITQA 2P34A 1K3IA 1QJX2 5LASA 4W4KA 4CP0A 1KXGA 3UL2A 4Q4W2 1KUQA 5FQ0A 5ABJC 4HN0A 3CNAA 4XJAA 1E5IA 3JU9A 2WA4A 3OD0A 5CB4B 2XBO1 2UXBO 4BISA 2RJKA 4IESA 3I3DA 1NT0A 4LUKA 4AHWA 2FZ2A 2BOCC 3CRAA 4YG6A 3VKLA 4HSLA 2D6KA 1W2BU 2E74B 5DECA 2LW8A 3NJXA 3H0OA 2H6BA 3KVBA 2ZACA 3SPJA 2FMLA 2OIIA 1XMQB 3OGJA 2GMEA 2VMDA 3IC9A 1SFYA 1V70A 1BZWA 3ZXJA 1RVF3 2HWC1 3K08A 1WW5A 1W8NA 4JZRA 4XUNA 4LF8O 4XUTA 3ZN5A 2VOWA 1JCHA 4FPFA 2K0GA 1BLZA 2B7YA 2YZ4A 1RUOA 1Q8VA 2WNOA 3LDDA 5FZAA 3FN9A 5JXGA 3DN7A 3IPVA 3OR6C 3IZOA 4Q6GA 1SLCA 5A32B 1UY1A 1L0LH 4Q4X1 3FWEA 5A7WA 2XTAA 1W05A 4WVWA 1XNKA 4XTPA 4JX0A 1V9U3 2CDPA 2QTWB 4QB6A 1VBE1 2CYFA 2R6QA 2HVKC 4I5SA 5DUXA 4XFBA 1AR5A 1AR82 4UW4A 4ASLA 1O4ZA 1POV0 1YQ2A 3APQA 4A2UA 5CU1A 4QQ2A 2FCTA 1UIJA 4XDOA 4XJZA 2GC1A 3ELNA 5EBLC 1VQKV 5B1BB 1N3OA 1QJY2 4XIOA 1PGL1 1ZBE3 2OVUA 2W1QA 5B1BC 3DYOA 4B4PA 4COYA 2E7QA 3OCPA 4DR2O 1XDCA 2ZKLA 1XJAA 4FLUA 4AFCA 2F66C 4RYDA 4AHZA 2B8MA 5L3BA 1I5ZA 4A7YA 1QF3A 3E35A 1RUI1 2HWC2 4CDUB 1D2SA 4EKWA 1QJEA 5HV4A 4BHPA 2HLDG 3TGUH 3K75B 3LIHA 2XXZA 3ORJA 2XVLA 4XF4A 2M7WA 4Y33A 4IW3A 2UXDO 4QDSA 4RR3A 1H8TB 2VQ0A 3L2HA 5A80A 5L3EA 1BEV3 3M70A 2P3YA 3JXSA 1YHFA 2ZHNA 4J1XA 5L73A 4MXVA 5IYYA 2OS2A 1YDXA 3AMQA 2ZR2A 4L11A 1S0VA 3E97A 3AK2A 2WWUA 3GZEA 5F6KA 3UYJA 1RUNA 2BOJA 1Y9MA 1W0PA 4RO2A 3J80N 2CWSA 4Y1YA 5BPXA 4DUYB 2ZE8A 2W1WA 3WB1A 4X20A 1W0JG 3KCYA 1LULA 3CZUA 3KGZA 2IJJA 2ZINA 3C8XA 3T2TA 2ATKC 5IVCA 3T4DA 2YFUA 2E63A 3I2JA 2GNTA 4Z92B 5JIUA 3DKWA 5IT6A 1DK1A 1VRH2 4GCZA 4S2FA 1CP9A 2B45X 1OVPA 3B7MA 1ULGA 3FAVA 3LA2A 2YI9A 1RUH3 2R16A 3T0DA 1WCSA 3TJTA 1CAUB 3RYRA 4DV0O 4YM3A 3U07A 3H1WA 2F4VB 2FKXA 4OULA 2PZSA 5EK0A 1YTFD 4R8CA 1UZYA 1K5MC 4XJUA 4QX3A 1B06A 3J7MA 1U5ZA 4ET7A 5LK5A 4L99A 5KX5A 3IKWA 2ZGLA 2AZ2A 3VBUA 3ZFFA 1N33O 1PX4A 5CKQA 2NLRA 2LO1A 4P9XA 1CAVB 1O9GA 1G8MA 1JYWA 3GDBA 2X0LA 3L9JT 4HVOA 1UZZA 3OY8B 2W91A 1ZBA3 2LM3A 2WN3A 5BNPB 2LW1A 3T2OA 4LOTA 4CH5A 2BBVA 3I54A 4QX8A 4H37A 4GH4A 1ULCA 2XKPA 4XFIA 4YW6A 4E4HA 4HETA 3WQ7A 1DCSA 2G4IA 1HRV3 2WWWA 3DXTA 4D6TH 2ZCEA 1UOFA 3ZN4A 1UY2A 2EXIA 3PIGA 3VBFA 2QVSB 2RMKB 4OI1A 2VQEO 1MPXA 1HN0A 4BW5A 1ZL8B 2QTSA 1M4WA 2EAAA 4FM2A 1JYCA 3ZN0A 3LOIA 3OJBA 1YJLA 1SZXA 4HK8A 4WFBV 3GWOA 4D6SA 4CP2A 3TNPB 4LJHA 4GZ9A 1BHGA 5KMGA 5CZKA 2CSGA 2RR13 3KWVA 3NV4A 3UKMA 2HJFC 3O9OA 4G3YC 3VQXA 5IK4A 1F4AA 4CU9A 1HLCA 1PVC3 3BOWA 4EZHA 2QE3A 3OGIB 5KMGB 2R071 3ABMB 1DYOA 1V6MA 3BN6A 2E51A 1WNSA 2H0VA 2RQ6A 4P5HA 2E6VA 5FREA 4LO7A 1E79G 4X64O 1R093 5DUUA 3GBWA 1ORQC 3WF3A 2EILB 4OHYA 2W94A 2XBO2 4YGCA 3A23A 1GTOA 2ZIMA 5FWEA 2P3IA 3ZXDA 1DDLA 4M0NA 5FXXA 2KG7A 3WP5A 1HB1A 2JEUA 3OAAG 2RM23 4Q4W1 3CCJV 4AG4A 3ME2A 4N90A 1R3JC 4JPRA 1L7QA 3T30A 3CMGA 5LGTA 2OT7A 2PQSA 2RCVA 1S55A 1A6CA 4YJ3A 2JDYA 3VUOA 3ZLIA 5LY2A 4MW3A 1MS9A 2QKAA 3X29B 2EINB 2GUZB 5IYCO 4AHYA 4Q4V3 4CDWB 3JBG2 3PUIA 4MHRA 1DQ4A 2ZD9A 2W47A 4LH7A 3ZXFA 2AZ5A 2Q67A 5C9AC 3UNPA 3B8NA 1LHNA 3AKTA 5AFEA 5FIXA 3T08A 3CJHA 2YG0A 1QOTA 1C28A 2VMIA 1RUC3 1YVWA 2ZGUA 5D21A 2HKXA 4OLLA 4EB6B 4GKJB 2VZ1A 1QJFA 2ZA9A 4JYYA 4HN1A 1TA8A 3O1OA 1Q8SA 3JZVA 4MVQA 3LAGA 1GP4A 1K33A 4O4LB 3ICXA 5A7QA 1AR93 3UESA 5FZOB 4ZY9A 2MPFA 3N36A 2P7TC 4GJYA 1GM9A 4DR3O 4QPKA 5GTHZ 5FLXN 1XL4A 3MUZ1 2PAEA 1BZKA 4UFZA 3BHPA 1UPIA 2ZEZA 3OFNG 2RS12 4CDWA 2WZ8A 4BYYA 1JJ2U 2DWDC 4Q4V1 3O1SA 2WAOA 4FOWA 5GZGA 2EIDA 3JARA 2WT0A 3TN93 4AFBA 2PGGA 4IEVA 1UX7A 4MTOA 2HWE1 2XL9A 2XOKG 3TN91 1NG0A 1CAWA 1PNLA 1W90A 2WZR3 4YG0A 1ZBA1 1GUIA 5D8AB 2H3OA 1DIWA 2L35A 1FX5A 5A3PA 1NR7A 4K21A 4AQTA 3PMSA 4YVWC 4CDUA 2FMDA 4D7TA 3K3NA 1GQHA 3ZN6A 2QDRA 3PU3A 3OD4A 4BPZA 2NMOA 4BWAA 1NLQA 2A1XA 4ZHQA 4GB32 2BNOA 4TT3G 4JI4O 1NKDA 4PA3A 4X8AA 1W6NB 4EN6B 3GB7C 3I2KA 5J09A 4RR3B 5J36A 5FOJB 1XUQA 1P4RA 5LEJA 3O1MA 3ZYHA 3ABTA 2P3JA 3CCMV 4A42A 2JDAA 1RUI3 1WBFA 1O91A 4F4LA 4A3ZA 2WYFA 1NVPD 4MUVA 3SLIA 4JHTA 4B8EA 4I3PA 2D97A 1X82A 1IBKB 2IM9A 1OCZC 1TE1B 3ZYBA 2JG9B 3THCA 2UXCB 1S76D 3CL1A 2HBUA 4A44A 5JR7B 2TUNA 1GQPA 2RS51 3OUIA 4YFWA 1I5YA 4XBQA 4K8XA 1J58A 4N7UA 1QDCA 4HL0A 1JVMA 2C6SA 3BPZA 1N4CA 4MHUA 2QQVA 2ZGPA 5BR8O 1QJZA 4RR3C 2ZCWA 5BV6A 2QUOA 3RYPA 1ZX3A 3ASNC 2CAUA 3FZ3A 3UETA 3S3XA 4OQ9A 1VBC2 3TXSA 3WP4A 2XJVA 1M56B 1XU2A 1IPSA 4X6RB 4PV1B 4QHOA 1PO13 3KG2A 1BMFG 1W8OA 1IOAA 4HMZA 5IJ0B 4BLIA 1CVNA 1W6OB 3V0BA 1H2MA 2X29A 3VD9A 4KWUA 4CP9B 1UZVA 4NXMB 2ERFA 1HR0B 3VZLA 3IDBB 4PBPA 3TEZA 5FUIA 5AC92 5F2WA 5A33A 2ARBA 2ZR3A 2HEVF 4O7XA 5F3GA 2JRIA 3J81N 1G9DA 2Q8DA 4FLYA 1Q56A 4X20B 1QLNA 1M93A 2G9ZA 4ATFA 3AXDA 2ARHA 2D5HA 1ZVFA 1XPWA 5JUVA 3K5NA 4HKOA 4GKYA 1MS0A 1RUI2 1RYYA 4YPJA 4NIAA 5FY7A 3RT3C 3OGRA 2X6AA 3W7UA 3S57A 2Y0PA 3OSDA 3P30A 1W04A 4LBEC 1OA2A 4CUAA 4W50A 1VBA2 1O8PA 2UU8A 1TVKB 4WCEV 1JZ2A 1QLEB 2VUAA 4W4ZA 2XQXA 5HXVA 2XAJA 4AILC 4YGDA 5JZGA 2P2KA 3C7EA 3WY6A 4K8ZA 4R6ZA 2DVFA 4DIQA 3BI3A 4FPLA 1VQPV 4A4AA 5IHRA 3H8OA 4IL7A 3CE2A 3H8RA 2Y0IA 2BGPA 1HXS3 3K3OA 1H8HG 4MT8A 2DMXA 5ABJB 1S0IA 3U4XA 2QQPA 1QEXA 1TVKA 2AEYA 1EAH3 4DO2A 1JPXA 1U5XA 3ZFEC 2NLJC 4LBNA 1OLMA 2HP8A 1XNQB 2GDFA 3HT2A 4W8JA 1S2EA 2F4VO 2VD7A 4PDWB 5HCAA 1S0EA 1OQDA 3ZYPA 1LENA 1VBC3 1NE6A 4BH9A 1VQ9V 5GALA 1O9HA 4UFLA 1YQ5A 4LF7O 1H0BA 4BQ4A 3NRUA 2EIBA 4OZXA 1GM7A 2KR2A 4WM7A 3KB5A 1AX1A 4FM0A 3AVRA 4FPOB 4LFAB 1SPPB 1DGSA 3E8HA 2GH2A 2ZXWC 4DV6O 3POFA 3KCXA 2B5HA 1QR8A 4WM8B 4X6QB 2Q9LA 4XDLA 4M00A 3I2DA 4YJ3B 3LB9A 2DCTA 1HX6A 1AL21 4NPLA 2GN7A 3DF0A 4QU1A 1QJU3 3ACLA 4OCTA 4DV2B 4R9DA 3MPPG 4UB6Z 3AC0A 4NHKA 2JVDA 3CIHA 1DYKA 4RGKA 2HWF1 3FFZA 4GZRB 4LKSA 3ABUA 1XXNA 4WVMB 4RA0A 4PA7A 1AI4A 3VDDC 2P4VA 4DR1B 2D6NA 3HIFA 1HNZO 3KZIZ 3Q8BA 2B1IA 2A6XA 2EIJB 2XJRA 1VALA 1H4HA 4COWA 4IGPA 1BQZA 4AVCA 1SPPA 2F93B 4FZ0A 3DGEA 5D5QA 5B1OA 1ZA4A 2LTNA 5AVPA 3GJBA 2WFF2 2Y48A 4SBVA 4FCAA 1VAVA 3VDCA 4J11A 2O1QA 2A06H 2D44A 4FVVA 3ZCCA 1VP6A 3MLJA 1R081 1K34A 3VBHB 3EFFK 4FPJA 2E5LO 2ZGOA 5LA2A 5A1LA 1W99A 1C1FA 1UOJA 1JMUB 3SPCA 2N7GA 5CBGA 2EXKA 4Z8BA 4GALA 4HAMA 2WS93 4ZU4A 4CUCA 5FYYA 3CCVV 2LP7A 5EJ3A 1XRUA 3ZIAG 4EN0A
chains in the Genus database with same CATH topology
2A75A 1IS6A 2GAUA 4R4ZA 3WD5A 1LOCA 1PZ7A 3KMHA 3DGTA 2FBEA 1GVGA 1V6IA 4RQPA 1RUJ2 2JG9C 1NA1C 3KT1A 1FV3A 1SMVA 1D4M2 2RS32 4Y20B 4ZU7A 3MGUA 1V00A 3H3ZA 2R072 2WIIB 1MVQA 4MVTA 4XJWA 1TNFA 4AI0A 1MEC3 3KD4A 1JYIA 3GHNA 1RITA 2R073 3HQXA 4J6GA 3VBRB 4J5IA 3B3QE 2PAMA 4XQ4A 4RGAA 3B94A 5CADA 1QKQA 4N53B 1GZ9A 4QQPA 3CO2A 3MPBA 4NVPA 1FATA 3QACA 5I0RA 4B29A 4XMAA 2WNUC 2B9UA 2DVGA 3FMGA 5GZFA 1EY2A 1CPMA 4FPHA 3VHPA 2WZR2 4QPGA 2CV6A 4C0HA 3IMNA 4KG0A 4JVAA 2WSVA 4WVZA 1REEA 4MGIE 4TSVA 1DLLA 3VKOA 5JOWA 4IV1B 1X33A 2F6BA 3USUB 3ILFA 2KA3A 4Y20A 1IS4A 4NR1A 3TN92 1PO22 1RUG3 4Y1ZA 2X5IA 1VRH1 4OHZA 5D8AA 4YW3A 3VN4A 3PJQA 4OI2A 4FXKB 3WVJA 2Q0AA 1A78A 2DYCA 1DGLA 1CQ9A 1DQ0A 4AYUA 3SNMA 3N6WA 1OHFA 1U12A 1YFXA 2R041 4M3CA 4CEWB 1PK6A 4YW5A 4OUSA 2WQZC 2RS11 2XHKA 4IEZA 2Q30A 3GBGA 4WM8C 4YNIA 4CDXC 2VNOA 1YIFA 2VVDA 2RMU3 3PVJA 1JUIA 1PZ9A 2R1DA 4NPRA 3V17A 1AR63 4GKXA 4A7ZA 2EVXA 4FT8A 5CG9A 3RRDA 5K9YA 1FPN3 4BHGA 4JDNA 1XNBA 5FPXA 2Z69A 1GBGA 2ZOEB 4Q0QA 1QGLA 2OG7A 5T5LA 4FP3A 4ISRA 1AR81 1W6QB 4JRLA 4NWWA 4Q8LA 4D94A 4EROA 5J92A 1LRHA 3ZFFB 5C9AA 2R32A 4LO8A 2A6YA 1POV1 3N7MA 2CGOA 4RQPC 4XJ8A 5HSXA 2CGPA 3SH4A 3BALA 4B3NA 3H9AA 3IDCB 1QQP2 3AYEA 3FC0A 2RE9A 1H9WA 2WFF3 3AB0A 4LBQA 3AP5A 2DVDA 2ZAHA 4N43A 2K9ZA 4QQLA 4XFCA 1R1A2 2OPKA 2YGLA 5C9AB 4FPYA 4FPEA 4IV3B 4LEJA 1C8M2 1NCQC 4GB31 1JBCA 3ZVXA 1ASJ3 2HWD1 1OOPA 4XE9A 5BNNC 5JSOA 3TAYA 1JH5A 4Z07A 1HQNA 3WW2A 5FO7B 3I59B 5J37A 2AREA 4XHXA 4URTA 1FOD3 4M0HA 4YVWA 4Z2WA 1IS5A 3FX3A 4AK3A 1R082 2VECA 2WWSA 4MYEA 5KHIA 3CU7A 2NPIA 1J3PA 2QZ2A 4WM8A 2XBO3 2IXHA 4J1WA 1BJQA 1N1YA 1KDKA 1ND3A 2VVFA 4NHLA 2JG8C 4MV2A 5JOXA 4A3XA 1LOBA 1NYWA 1O3RA 3O0WA 2VU9A 1UKRA 5C4WC 1YFUA 2HWD3 3VL9A 2ENRA 4NE0A 2PHLA 1GNHA 1EPZA 1POV3 4FXGB 1RMU3 1S0BA 3KLSA 3S7IA 4BA6A 1K5MB 4IEPA 3SISA 3ILNA 3NSTA 3NW4A 1SBFA 2WNEA 2A6WA 4Q4Y1 4EWDA 4X8PA 4Q8KA 3BIWE 1J1LA 1RINA 1UMZA 1MEC2 3MLLA 3HBZA 3WLUA 2VPVA 2XVGA 1PVC2 2JE9A 3ZSLA 3HWJA 2TNFA 2X8KA 1ZZ8A 1MACA 1PNFA 1S0CA 4JC1A 2PN5A 3VDDA 4Y4YA 4EN8B 1RHI1 4FOYA 2D5FA 5CFCB 4HBNA 2IWGB 1Q3EA 1HRI1 2EF6A 5LRRA 4COZA 1PIV1 3MW2A 1OIIA 4IQPA 5FLIA 1AJKA 4K8FA 1GR3A 1FPN1 3V0BB 2ZGRA 2ZHMA 1DBNA 2ZGQA 3J26N 4QPIA 3AFKA 5H9PA 4K1ZA 1D4VB 1RL3A 2CAVA 2ZPXA 2DTWA 4Q1PA 1RUJ1 3VBOA 3T1LA 2WQ4A 2YXSA 3J8F2 4K40A 2CNAA 1COV1 2PHFA 2A73<