1H2LA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2lA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2lA01
1MZFA 2CGOA 2WA3A 4AI8A 3P3NA 3KCYA 4Z1VA 4B7KA 2WA4A 2W0XA 4BIOA 2ILMA 3D8CA 1H2LA 2YDEA 5JWPA 1MZEA 1H2MA 2CGNA 2XUMA 3OD4A 1H2KA 1H2NA 3KCXA 4NR1A 4JAAA 2Y0IA 1IZ3A 1YCIA 2YC0A 4B7EA 4QU2A 4Z2WA 3P3PA
chains in the Genus database with same CATH superfamily
4LKSA 3S5QA 1RVF1 1VBC1 2NLJC 5GZCA 1EZVH 3ETQA 3ZYJB 2CAUA 3HKDB 4CDWC 4CUCA 2ZACA 4CH6A 3ZFFA 1OVPA 2Q1FA 4AFDA 5A3NA 5AVAA 1WMEA 4MGYE 5IYYA 5FZ6A 4QB6A 4XXAA 2OS2A 3F7YC 5EFUA 4FFBB 2OCCC 4YG6A 4C7UA 4PDMA 1RMU2 2GTAA 5DAPA 3WD5A 2QA4V 2ZM6B 1VQOV 3OBZA 4GYCB 2XUMA 4ONUA 3I2HA 3CRAA 4C0BA 4KQ7A 3OCPA 5GZFA 3I3MA 4F4LA 1OF3A 4QXBA 5IYZB 2YG0A 3WG7C 5L3GA 2J1RA 4Q0PA 1QWRA 1OLME 3BN6A 3M3OA 4LBJA 4TTGA 3N35A 3SEPA 1Z7S1 2DUQA 4J9YB 3ACFA 3AG2C 1K92A 3ZSKA 2FHRA 1DYOA 3OUJA 3HD8B 4PDRA 4QX0A 4FPKA 1F8VA 5E8AA 4ES8A 5BY5A 3MPBA 1W59A 1Q8VA 1V0AA 2YDEA 1NR7A 1NH2D 2C24A 2PHFA 4AI9A 3V0AA 1IZ3A 4CU9A 4YPJA 5K0UC 4UXAA 4CZZA 4N7IA 5D5QA 5FZOA 3KWVA 5FREA 3D4KA 2XJPA 1VF5B 5K0UA 4NAMA 4X1KA 3AYDA 4XCBA 4YY3O 4DR2O 2B7YA 5GLUA 3AG3C 2CYFA 2ZE5A 5KXBA 2BVBA 4UWDA 1SG3A 4JCKA 2FDJA 1EZJA 4H33A 2RS13 5L73A 1WPXA 2ZMLA 4XW3A 2VOWA 5A9GA 3P30A 1AR91 3K3OA 1OFSA 4ICGA 5JR7B 3L9DA 3DCQA 4D7SA 4QQLA 3ASOC 2DVBA 4XC9A 1HKDA 5JOXA 5IVVA 1Y4MA 2VQFO 4AQSA 3WQ1A 5BNOA 3MGUA 4AI0A 3G4SV 4QKBA 2D3RA 2YICA 3CRQA 2RDCA 2WLLA 3HN3A 5CA1A 1N47A 3D5OA 2Z0AA 5EV7A 2RR12 4CH4A 5FY4A 3THTA 4XBFA 4X62O 3KV9A 2ZKNA 3ZFEA 4P9XA 4L99A 1NTKH 2QQMA 5IJ0B 4ASMB 4X65O 5FFOC 3FL7A 2GBOA 1S0GA 4Y5Z0 3SC7X 4BHPA 2HWC2 1V6MA 1RUG3 2RMU3 1X9PA 3D8CA 3K03A 5M0TA 3JZVA 1B3QA 4RD7A 4RSUA 4Y22A 1QH7A 2WSSG 4IV1C 1N33O 4AQYO 2RDSA 3FMGA 2HJDA 2PYJA 3WF4A 5BMVA 2XQRA 2VUDA 1SPPB 1B06A 1OCOC 2P5BA 2Q1MA 4YGCA 4BQ1A 5LA0A 2ET1A 2VBBA 3BYWA 1C28A 3QLQA 1RUF2 3VD9A 2OZJA 1UF2C 4X6QB 3E5QA 3FD9A 4I4TB 4EEQA 4FOYA 4N21A 2CWMA 3NV4A 3VB9A 1IX9A 2PZSA 2CAVA 4XQ4A 2WO2A 3VBRB 1VJ2A 2YYOA 5A7SA 2W1UA 3WP4A 2Y60A 2ZS6B 1UZ0A 5LGTA 2K0GA 1IS3A 4B3TB 3NR7A 2Q7EA 2C9AA 4XAAA 4UW5A 1YQ2A 1RUH1 1V9U2 1MEC3 4UBGA 1FV2A 3U4SA 1N34B 2DYRB 1CP9A 1NCRB 3KMHA 1NQDA 5FNVA 4K0KO 1ULFA 3ELNA 4XJZA 2CE4A 1TMF2 4JYBA 2W2IA 4JYCA 1Q81W 1RM1B 1I5ZA 1AZDA 3SYOA 5KA6A 5T5OA 3MZHA 1PVXA 4QX3A 2ZMNA 5TSWA 3DPRB 5ABJC 5EPAA 3TOJA 3M8LA 1I3HA 1CONA 1POV3 2RG4A 1EPWA 3VZOA 4MVZA 3L9JT 1LNQA 1OH3A 5T3NA 2Y8KA 5FLJA 5JSRA 3ZXEA 4K7JA 1PVC3 3DV8A 4HLTA 1NA1C 2EVXA 2BEOA 1ZM1A 1OKOA 1NA1A 3ZXJA 2WYFA 4CTEA 3JARB 1UIKA 5A32B 2PN5A 3AMPA 1WMXA 4L2NA 4ATFA 3KHCA 2Q0AA 3CKHA 3VQWA 2AXTZ 1ZBE1 3CNAA 4S2HA 3K3NA 1GH6A 2JDIG 4OZXA 4CCCA 2YPDA 4DW0A 5FQ0A 1VBB1 2A75A 3IAYA 3G80A 3OPTA 1J3QA 4Q4X3 1M57B 1QJEA 2QJVA 2C1FA 1W3XA 2YUAA 5FKBA 1Y6XA 3T2PA 5CKNA 2A7WA 1BYHA 2YXLA 1THZA 4X88A 1GOGA 4A6SA 3FLRA 4FFIA 2CK3G 5ACA3 2VVFA 3T4VA 4R9BA 2VQUA 4N9HA 5A3UA 5FAXA 5LBFA 2ZX1A 3CP1A 2WT1A 4BW5A 1K34A 4GXLA 2BNNA 2B5HA 4YW4A 5FP4A 1HNZO 2HR3A 4XOGA 5DN2A 1LGBA 3K04A 4AAPA 5F3CA 5L3CA 2NR5A 1CAUB 3RZMA 4EYUA 5HBAA 5DDJ3 2UWCA 1ACCA 2LJ2A 1ZZ8A 2E26A 4AEJA 1AHSA 1SESA 1JZ6A 2QQKA 4G3YC 3LIHA 1S0IA 3ZMZA 4EWAA 2VR4A 3WDTA 2XAQA 3RYPA 1KS4A 1WLWA 5BPXA 3MPPG 5LGUA 1L7QA 3M3EA 5LY2A 1US3A 1GN6A 4Q4V2 3TB0A 4CBCA 1QXJA 1XYPA 1D4M1 4YGBA 2VWJA 1LOGA 2IFWA 2VGDA 5IDJA 5FP8A 5ITZA 1GNYA 5FZ3A 3T1HO 3V0BB 1A34A 2LUWA 3LSDA 1MS8A 4S2DA 3POJA 2HVKC 3APBA 2DYSB 1IGOA 5FJHA 4CUBA 1ND3A 3S30A 4TLFA 3EXUA 2QQIA 4X64B 4UCSA 2QJ1A 4BA6A 1A3KA 2EIJB 4JGZC 2DTWA 3I2OA 3NRUA 1QIQA 3BTXA 5EIYB 1GO3F 3I59A 2EIKC 3URFA 2ZCWA 1Z0HA 1JZ4A 2BE3A 2XBO2 2IU3A 1R091 4XF4A 3UO3A 1C1LA 3VD7A 4GQ7A 4NPRA 4RR3A 5FZCA 3TNPB 4O4JB 1W0NA 1M93A 4A2UA 1PMJX 5J1XA 1ND2B 4URAA 2VZRA 3LCPA 1WNSA 1YF2A 1ZL8A 4XBQA 1SHWB 1UJWB 4Q0UA 2ZHKA 2JDYA 1BEV3 3LF7A 4K40A 5CISA 1CEZA 1R3LC 1N3PA 2GMPA 5J09A 1I6XA 5FPRA 4BK4A 1KFXL 1OCCB 2ITDC 2BPA2 3SCHA 1UFIA 5HV4A 3WX5A 1UPSA 4P14A 1VBD3 4I0AA 4IHJB 2QWRB 4I9QA 5IVCA 3THDA 1NG0A 4G27B 3ZFGA 1RB8G 1RFYA 1TQ5A 1GYKA 1PX3A 1AX0A 4A3XA 3F7VC 1YJLA 4A6OA 1FPN1 2JG9A 2B9ZA 1WA6X 1HRV1 2X7RB 3M3IA 3HQXA 1TEIA 3CCEV 4NUBA 5IK4A 1ENVA 1XYNA 4H7LA 4XAEA 2N05A 4TV8B 1X8EA 4AE2A 2E7QA 3DGTA 5A7NA 3WCRA 4FTSA 4CEWC 1SDWA 3VOUA 4YIPA 4JI0B 2D7FA 4CEWA 3N2GB 3GM8A 4CC5A 5FPXA 3WNNA 3A2FA 3OUSA 1S2KA 2BBVA 1I7FA 2UXBB 1ASJ2 5B4NA 1XYOA 1CVNA 3H1YA 1RPRA 1KJLA 4X1YB 1DQ4A 3ZS8C 3EBRA 3W58A 3STLC 1KC8W 2F93B 2ZCEA 5IE9A 4BJ0A 2VTXA 3AL5A 4NPLA 1AR81 4AVTA 3HT2A 3W59A 1NVPD 5EJ3A 1PIV1 1WP8A 4QXKA 4XFAA 3EHKA 2YSUB 3U0ZA 2R9IA 2C5DA 2JGDA 3K48A 4UV9A 1GICA 5KMGB 3ASNB 3DC5A 2EULA 2ZXWC 3FB8C 3PTRB 4AVAA 4EV0A 5A6ZA 1MVQA 5CAZA 4DYLA 2P1BA 4XQWA 3SLIA 2RDQA 3NKTA 4LFCO 1QNWA 4XFHA 2QKDA 1OLMA 5C4WB 1VRH2 3E1F1 3NAPC 2VL4A 2FZ1A 2V5DA 1HR0O 1LODA 4P5YA 1H8EG 5C8YA 4TSVA 1QLNA 1F7YA 1WCKA 3HQRA 3SJBC 5B4XA 1K97A 4E4HA 4HAMA 5H5NA 1BJQA 4IIJB 4P9PA 4N53B 1RUJ2 1OT5A 2CGPA 3VBSA 1PGSA 4PA6A 2ETNA 5DXDA 3POYA 1N3QA 3CSXA 1KRIA 3OTOO 4EN8B 4K8FA 4Q20A 2DTYA 1H6XA 3B9IA 2W5FA 4Q8KA 1H6YA 3SH4A 5A33A 4IEWA 4I50A 3AC0A 3J7MA 4P9LA 4Y26A 4DR5B 3D3IA 3AG4C 1Q7YW 2GN7A 1BBT2 2R72A 3H42B 4NVPA 2EZOA 2XR4A 1RUD1 1X33A 3NO8A 2V4AA 2Y38A 2V7QG 5CB7A 3BY6A 1JZ2A 2DVDA 4FLYA 2R0HA 2C0ZA 4R9CA 4TOIA 5FTTC 1HDJA 2O8QA 3QO8A 2A70A 1RUE1 3B02A 4M0HA 3LB9A 1AI6A 4GKKB 4UCTA 4GWJA 5CFCA 1AVMA 3RS6A 1JVMA 5KXDA 4CA9A 5LK7B 4I02A 1RUI2 3ZR6A 4RUEA 3BRCA 2OUJA 2NQYA 5A3MA 4HONA 1K8AW 2UUAO 4J7ZA 3RJRA 2FQPA 2Q8OA 5FO7B 3VL8A 4Q6GA 2XQXA 5D8AB 3UK9A 1G9AA 1RMU1 3ME2A 2WZEA 5JSPA 4DR3O 4J7JA 4RS5C 1NVPB 2P3JA 3G6BA 2K1EA 3OT7A 5FY1A 3ZYBA 4RS5A 5C5TA 4Q29A 5IK5A 5FPUA 3FHIB 1QR9A 2IM9A 2QM8A 2ZJCA 4CP0A 4B1LA 5JDBA 1NR1A 4UFMA 3BFRA 3E35A 2D3PA 2BGPA 5B1AC 1LCLA 1ODMA 1TUBA 4HVRA 2FYUH 3I2FA 2RJKA 2C4XA 1DGWA 5IY5B 2Q4SA 2LROA 2EINB 4O2BA 3EYPA 5KUMA 1HW7A 5F39A 1NS1A 4COUA 2Q1ZB 4FPCA 1K45A 2BSKB 2XUEA 5GJ6A 4AGGA 3OEEG 3ZN5A 1NY71 2VU9A 4PIZA 4GUNA 1NYWA 4DW1A 5FZGA 2FMYA 1WKYA 3VHPA 3O14A 1WCDJ 4FXGB 3RYCA 1NZ6A 5JJEB 2V4DA 4MGKE 1KECA 2VMGA 1Q5OA 4BB3A 4LFAB 3SPIA 4Y5TA 2C9KA 3GZUC 3TCUA 4YG3A 2XNDG 3T1YO 4HFSA 4AK3A 4XJ8A 3AEIA 4JYAO 2VMHA 5FK8A 4DUVA 4MYEA 3OR6C 1W2TA 2EJRA 2ATKC 4FOVA 3GWKC 1H2LA 1SQXH 3ZDSA 4EB6A 4BM8A 3ZRVA 3CS5A 5CKMA 2OW4A 4GJZA 4GT1A 4X66B 3HR9A 1ZA4A 2RR11 3JALA 3FZ3A 3SYCA 5LYJA 5IWAO 1ZRIA 4DV3O 1K73W 4FT8A 3FN9A 4FJCC 1K33A 1J1LA 3AKRA 1O4TA 3KHBA 2HWC1 4FFHA 2I74A 3AK0A 5JIUA 1RUG2 2KR2A 3GHMA 2RMU2 4YFWA 4FPPA 1BHAA 5F6LB 1WJZA 1YCIA 5IVFA 2CTWA 4E4SA 1QJZA 2IXJA 5LMUO 1UZYA 1GFF2 4LNUB 4OFGA 3RG0A 4Z82A 3WU2Z 2WNVC 4I01A 2WT2A 1QGLA 4MZUA 1RYYA 3DL3A 1DGLA 3ZMSA 2WC2A 3WNMA 2VZPA 3OGJA 1KKDA 3S0MA 3DECA 3MHZA 2ZHNA 4M0NA 3L73H 4FFFA 1PMIA 4AQTA 4LIUA 3ZHQA 1YJWV 1LR1A 3DF0A 2QTWB 2WNUC 3CEWA 4GMP0 2WFF1 4AI8A 5FY9A 4UVAA 1H4HA 3OBRA 2WNUA 2WINB 4NRQA 4EJRA 3AK1A 4XDKA 1MR5A 1HWYA 1W39A 5FMDA 2BTOA 5CBHA 2P7TC 1FNZA 2HBUA 4FLWA 1PZ7A 1MEC2 1JHNA 2ZXQA 1TMF1 3ZRXA 5B1BC 3ITQA 2ZD9A 1S0EA 5FP3A 2AENA 2DQ0A 4O4LA 4CDWB 4EN0A 1MS1A 3FKSG 4RQPB 2PHXA 1OCZC 3BU7A 2HVJC 1WUVA 3HT1A 3Q9OA 5LY1A 5JJNB 4LBOA 1QXPA 5EYYA 1H8TA 2LGQA 3ABKC 3TEWA 4U3JA 4D0QA 2XJTA 1NXD1 2A71A 2PLV3 4I7ZB 2FTKA 2W68A 2PQQA 1YJNV 2JEUA 4Y1XA 2VCAA 1GP6A 4FPHA 3K58A 3ST7A 2VXJA 3WG7B 1PVC2 3ETDA 4L9BA 1DGSA 5DUXA 3VL9A 4AF9A 1AYM3 4NJ4A 1WMFA 3PMSA 1XNBA 4KWJA 1ZSPA 2UXXA 1G9DA 5KA5A 4DY3A 4A42A 4JI2O 3VBFA 4HSLA 1TZOA 1F9KA 4R50A 2E63A 1D0HA 3WNKA 2XG3A 2EIGA 3JSLA 1KQRA 1W6QA 2R49A 4HN0A 2L35A 2ZGUA 3CYOA 3UT5B 2Q8EA 5EQUA 3IBMA 4LXLA 4N43C 3MBWA 4Q4X2 5C8CB 1N1SA 4GX0A 2PYLA 4N43A 4CUAA 3AL6A 1CAXA 3T30A 1W6MA 1DZTA 4X8PA 3VD3A 1VRBA 4TN7A 5ACA2 4RHV3 4PDLA 2ZX2A 3WNXA 1ZREA 2VMIA 5DUVA 3BGAA 5KAFZ 4ISQA 4UW6A 3H1HH 4NXNO 2DWDC 2JVDA 2P4EA 1EFRG 2VW2A 3FAVB 4YJ2B 5C71A 4RGKA 3DYPA 2X05A 3B7MA 2Y64A 3WQ0A 1L3JA 1RUOA 4YRDA 3IIAA 4MVQA 1DIWA 3BEHA 5DDJ2 2JJ2G 1B6QA 4MVTA 3O1UA 1HRI3 3KGLA 5KX5B 2DCTA 3G67A 3RGBA 4Q4V1 5L36A 3ZHRA 1N0NA 4ET7A 3FUOA 1M9NA 4LCUC 3I3BA 1VP6A 1W6OA 4Q8LA 4BIUA 3J9SA 5BNNA 4BU2A 5CEHA 2WLQA 4JDMA 3FLTA 5FY8A 3BVCA 2HWE1 4IV1B 2W1WA 3CU7A 2GUZB 5L9BA 4FPEA 2K2SA 4N90A 3SPJA 1UQXA 2CTVA 1OCOB 4LHSA 5CFDC 1FAFA 1JJ2U 3K75B 1UZZA 5FPVA 1ZBA2 2G9FA 2RQ6A 2XBO1 3U4XA 2E33A 3TAYA 4B3SB 4DMIA 4WFFA 1W3VA 2VZQA 4V2VA 4FOWA 2W6IG 1JBCA 1UY0A 4M3CB 4GWMA 4MVMA 2BOCC 1K4DC 4AXOA 1LU2A 4UYBA 1LOAA 2XLGA 1XNKA 4LBKA 1QCEA 4KWLA 3MF6A 4Z1VA 2R063 3ZYPA 1W6NA 2VRZA 4TUYA 2ZQMA 1GN3A 3D36A 1OD5A 3UGHA 1E79G 1BEV2 4TWTA 1GQHA 2HG5C 4GKJO 1QQP3 1SFNA 3ZXDA 1HJFA 3BIWE 4I5SA 1VBD2 4R52A 3UJQA 3W20A 4XHXA 1S3JA 2D6KA 4FMTA 1N36B 2GH2A 1T6BX 1SA0B 4DRRA 2EXKA 5GLWA 2HHHB 2RS53 3OB8A 3L70H 1HQLA 3POBA 2WQ8A 1UX6A 4LORA 4MTFA 3PU3A 2AZ2A 1H2SB 5DECA 2RDRA 5F1RA 3JBG2 2WAAA 5ABJB 3JAMN 1WW7A 4XJAA 1SQBH 1EN6A 1K5QA 4PDWC 3ZKYA 1Z2GA 1LTEA 2DBNA 2CGOA 4Z2AA 1DGRA 5B1OA 4QJFB 2CSGA 3DXUA 5BZBA 1YFYA 2Q6AA 1BCXA 3K5LA 5FPZA 4GIQA 4QKFA 3LOBA 1DQ5A 1I5PA 3N36A 4FZ0A 2CL2A 4XACA 1I5XA 2DQ3A 4LF9O 4DS0A 1IDSA 2HBTA 3DC6A 2ITCC 1AL21 2G38A 2DOSA 3HKDA 4PIXA 2XL9A 4N23A 4DV4O 1U12A 4MGIE 4KHPO 4FFBA 3H7JA 3RZHA 4QX7A 1IS5A 5I8SA 3QH6A 2OYQA 4E27A 5LMNO 4TV9B 5E88A 3AP7A 2LFSA 5FOJB 4R8HA 1R082 3PDQA 4MX3A 3ZYGA 3WSOA 2JG8B 1G6NA 2OA2A 2MPFA 2DW4A 1FMD3 4IV3B 2JDHA 1AR4A 3GCWA 4LKEA 3VKLA 4YM0A 1YHFA 5IYZA 2KXLA 4CS3A 1GQPA 3I55V 4RFT0 3H50A 3I8TA 1N4CA 2ZGTA 4NHXA 4OHZA 1Q8IA 3T08A 1XDCA 2BW8A 4XDJA 3E8BA 2NPIA 1X4TA 3NNMA 1PGL2 1RUJ1 4OXSA 3LAGA 1VBA3 3O9OA 3LNMB 1AJOA 2YI8A 4QPGB 3CC4V 2W92A 2ZDIC 3RW0A 3SR2C 2UURA 2GC1A 5JSOA 3WHUA 1SZXA 2ZDIA 1YITV 1RIRA 4BQYA 2GU9A 3BALA 3D6EA 4L87A 2WZR2 4EN9B 5FYHA 1GBGA 1B04A 3LPFA 1W03A 4OX9O 1BBT1 1WP7A 3O5SA 3RYIB 4CP9B 1GZTA 2DV9A 1W8WA 3C2UA 3AMHA 3OPZA 2Q8CA 5KLVH 4K21A 1S55A 3N9LA 2NMNA 1XRUA 4LBQD 4WVZA 3POEA 5F5IA 4QM9A 5K8SA 5HCFA 1GWKA 1PO11 3H1JH 1H9PA 3BHPA 2RS32 1EY2A 3NWKA 3W7XA 3IFXA 2NM1A 2DF7A 1ULEA 4QPIA 4K35A 3KS7A 1TUEB 4LF6B 1LEDA 4JGZB 4MLOA 1FX5A 1W8FA 1R6NA 1OMIA 2B46X 1DF5A 3M7MX 2Z2SB 4JI4B 2OIIA 2EIMB 2GDSA 2BUKA 2YXHA 5FJKA 3TRSB 3KVBA 3E22B 2IWGB 3DTUB 2EIKB 4LULA 5C33A 2LP7A 4OHWA 3ACHA 1W06A 3KM5A 3H0OA 4JDOA 3ZMNA 5JWPA 5F2SA 2JJ1G 1R3IC 5FOBB 1RHI3 4CCOA 2P22C 1VALA 4JHZA 4HKWA 2OXBA 3C3SA 2VW1A 3LZZA 3MIFA 2QUOA 2JIZG 5T52A 2QQLA 4JKLA 3ILFA 3L71H 4W6XA 5FLHA 3UQ8A 1AVBA 1V6OA 2RN9A 3OBTA 5LBCA 4XJ9A 1JW6A 5CBFA 2BTQB 3H9VA 3W5MA 5LBQA 1QJU3 3JD73 3NSTA 4QM8A 3LPGA 4DV0B 4XFCA 1GLHA 2W52A 2E6VA 3BKZA 2A3XA 2QBXA 4H7MA 4RQFA 1DQ6A 5CMUA 3T1MA 2PHRA 3AZVA 4Q4W3 4I4TA 1ZX5A 2J1UA 1J58A 2R32A 4MVUA 5L7OC 3VBRC 2DE0X 1NBMG 2V4VA 3AYAA 3T0AA 3VBRA 1W8OA 2WPDG 3VHOA 3FFZA 5AC93 4X89A 4IEVA 1DDLA 4FLVA 4IQPA 4KU7A 2B8MA 5BR8O 3B8NA 1J5EB 3AFKA 2YC4A 2JE7A 2QCSB 2QDRA 2DYRC 1FYJA 1NCRC 4EWDA 3KKYA 1Y9GA 1MZFA 1NCRA 1JHJA 4XZPA 1XREA 1XUQA 4DR4O 4AI2A 2A6WA 3AXDA 4LO4B 1NJIW 1KD7A 4DXWA 2Q5TA 1W9YA 3M3QA 3ILNA 3O0VA 1NT2B 4QGPA 5DEDA 1UYXA 1ULCA 4FPLA 1KKCA 2LGWA 4I0BA 1UX7A 1O3QA 3R4SA 2GMEA 3DPRC 4LBQB 3I2DA 4JI5O 4WM8C 1LR5A 1H2GA 3N9OA 2ZXWB 4JF3A 1S0VA 1OOPA 5FMBA 3K5MA 1VF7A 4NOTA 2Y4UA 2P6CA 1AI7A 3M99B 4CS2A 5G05L 5JH7B 1FXHA 1W99A 2EXHA 5A80A 4KBBA 3R4UA 1CXZB 3CXHF 1HNWO 3S6PA 4Z92B 1N0JA 3JARA 4H0LB 2XOKG 5A32A 2RJZA 5FY0A 2BJSA 4GMP3 2H8PC 2AC1A 2BV4A 1URFA 4OUSA 1HB3A 4W4ZA 4FFKA 1CAWB 3VN4A 4CCJA 1JFFB 4QDSA 3V64A 1Y76B 3LGRA 1TA8A 1M57C 2QQOA 3I7DA 4YY3B 4DR2B 2X6CA 3AMNA 3AYCA 3FWEA 3I3DA 2A6XA 1S4CA 4IE5A 5IWFA 2A6YA 1S0DA 3JUUA 5JOWA 3E8GA 1GN2A 1X7NA 4AOCA 1GKFA 2G1MA 3JXSA 4F8AA 4XTPA 4LA3A 3ACIA 1WN7A 5C3SA 3IJ4A 2F23A 5E89A 1WLTA 3ZEDA 1PNLA 4I2OA 4XETA 2MEV3 5JPNB 3ZSJA 5IHRA 5FZIA 3N7KA 4PLOA 3AJYA 3ABZA 2CGNA 1QLEB 4Q26A 4QPKA 1ROPA 1I9RA 3SJQC 1ZA7A 3CLPA 1HB2A 2RV9A 2VQFB 1XNCA 3VLBB 4ZXEA 4Y20B 1CAUA 2HLDG 5K9YA 1C5IA 3TJTA 5GW7A 3ABLC 1GZWA 1XNRO 1MEC1 4C1WA 4QE7A 3N9PA 2GV9A 5LHGA 1A8DA 1GP5A 2VOXA 4X62B 4YZ3A 1ZZCA 5FCCA 1QJFA 4PI0A 4W8JA 1O9HA 2CUGA 3STZC 4X65B 2VVEA 4LF5O 4DR6O 2MNGA 4LF8O 3ZN4A 3T1CA 4R4XA 5CZKA 3WF2A 5FBJA 1JOYA 5C7GA 4IGQA 4MW8A 4WM7C 1XSQA 1RVF3 3C7GA 3A0HZ 1OPMA 4DXTA 4ZKTB 4AQYB 3V0BA 4LPLA 4CYDA 2DYSC 1POV1 1IURA 1JYIA 3HVDA 4AQ2A 2XB6C 2A9HA 2PLV2 1KUQA 3BIEA 5C8WA 3QOPA 1PVC1 1YUDA 2SLIA 2QEXV 4JI3O 4XE9A 4COZA 4B4PA 3ZX6A 3SKJE 4OYUA 2VQEO 1TVKB 5FRAA 3JU9A 2NP0A 2QQUA 1AJPA 5FZMA 1LOCA 4NAOA 2CTPA 3CRRA 1QJX1 1GZ9A 1F4MA 1AYM2 3U10A 1PNGA 3WEZA 4GALA 3A0NA 4BQ4A 4P9OA 4IE0A 4LE3A 2IJKA 4O4JA 3FB6C 5FZ4A 2GNBA 5E1AC 1XMQO 4Q4X1 1ND2A 1AXKA 1Q8PA 1QBZA 5H6QA 5DAXA 5H9QA 5AVPA 1SERA 1RUC2 1MOFA 1K12A 1AI5A 1OCCC 2P4VA 5J36A 2QSAA 4K0KB 5B1NA 2VVDA 4QX8A 5ACA1 1KJRA 4JI1O 5FBZA 5C9AC 2EIDA 4IHJA 5FZDA 5T5JA 4XMAA 3HKCB 3MDPA 4COYA 4RHV2 4MTOA 3PUSA 5D5PA 5JZGB 3PJYA 2JDAA 1W05A 4D6QA 1OA3A 4YZ1A 3SNMA 4GKYA 1SRYA 3OY8B 3VBHA 4LNVA 2P6JA 3B3QE 1HN0A 1KDKA 3BTAA 1RSOB 4TV8A 5DDJ1 2VW0A 4WFBV 4URTA 2HWF2 1VF6C 3T4HB 4HBNA 2R043 2WLKA 2BBAA 4NRPA 5F8PA 1VF6A 3AKPA 3N2GA 2W08A 3PVOA 4ORFA 1SLBA 2E53A 4X20B 2EF6A 2XJSA 3FUQA 2MHFA 4XIKA 3ZLIA 2WZ8A 1HRI2 1RUNA 1BXHA 3ZPYA 3H8OA 5J2TB 5FIXA 1Q43A 3R65A 4JRAA 4DUYO 2F4VO 3NL1A 1A6CA 2WA3A 4X1YA 3RZLA 1CIYA 4IEOA 5A1LA 3H8RA 1D2DA 4EWEA 4A7KA 3ZFFB 2XJRA 4FPFA 2GTSA 3R0RA 2XLFA 2J1TA 2WT0A 3KV5A 3ON7A 3ASNC 4LFBO 3THPA 5KMGA 1TNFA 4JKKA 2WNVB 1KEXA 3HKBB 1ZBA1 1QY4A 4COVA 3K9AA 1Y9QA 1WA4A 3N7JA 5FYZA 2Y6JA 4ZPIA 3DKWA 2IFRA 5L19A 2CDOA 3RDIA 1HNZB 4NPMA 5C4WA 1MS4A 3KQRA 1US2A 3JASB 4PA7A 3E86A 4LT5A 4ISRA 1BQ0A 4JI8O 4AW7A 4MTGA 4HNAB 5LOVB 2VMFA 2Y0OA 2XOMA 4N53C 1BS3A 3VV1A 1BQZA 1BK1A 1L8DA 1OXCA 5I93A 4TQDA 3H1IH 1BEV1 4K8ZA 5SV5A 1EP0A 1XE7A 2EZPA 1E5HA 3ZJZA 3ZHUA 2YC2A 4WFAV 1BSMA 2FKXA 2P17A 1BVP1 1YSCA 1XBLA 1PP9H 1VBD1 2BFUL 4P9JA 1QQP2 3WQ7A 4NO4A 3DYMA 3GBWA 4RFRB 4DRVA 1PM4A 4BQXA 5LW9A 1YQ8A 5B1BB 1NX9A 3MYXA 3B01A 3I97A 5EBMC 1GANA 4QPJA 5F7UA 3LNNA 5EWSA 2O0OA 3T1HB 3VDAA 3GNEA 2HWB1 1DZRA 3JBG1 4OI1A 3UETA 1NE6A 1JXNA 4ZZ5A 3DSQA 2IXHA 3VZNA 4MUVA 2QTSA 3O65A 4PA9A 1E5RA 1W0PA 3ORJA 1VQ4V 2VE1A 2QM4A 3OW2U 5D1IA 1NCQA 3PN1A 1PK6C 3W7WA 2YFUA 3OE7G 1YQ5A 2EBOA 2V1DA 1JU3A 2FDKA 2FDHA 3VD5A 4BR6A 4AR2A 4KXRA 1WLDA 4QU1A 3LKJA 3JD2A 3ML0A 1RL3A 5BNPA 4QB1A 5I8YA 2B1IA 4P2ZA 5CA1B 4R7CA 2W0XA 1K5MB 5A3PA 3K5NA 4NIHA 4B3MO 4LH6A 2GN3A 4JGYC 1YYNA 5D8AA 1C4RA 2XMLA 4OQ9A 3JD3A 4FZ1A 4IDZA 1O91A 3L2HA 3RZKA 1XILA 5FXZA 4GKXA 1R3KC 1VQKV 2WFPA 1R081 4V2WA 5DUUA 3WCSA 2PI5A 3PHMA 5BUVA 2BDRA 2FCUA 4FPGA 2Q8VA 4CCEA 1CPMA 2W0FC 1VBB3 1AXYA 3WG2A 5E1RA 3TXQA 1RP3B 5BMVB 2ARXA 3MUZ1 2LRPA 2JDNA 3NW4A 1FMD2 3B8MA 1XNTA 4OI4A 2FCVA 2W3JA 1QEXA 4UCOA 4LK6A 2DVFA 3JAWB 3MUY1 3UYJA 1RITA 2UYBA 5FMCA 4Y4YA 5J2UB 5FZLA 2UUCO 4CS4A 4HSJA 1DYPA 3CJIC 3BOWA 2BFUS 4L92A 4CRQA 1SQVH 1VBA2 1XMOO 2BSKA 1DFQA 5A7WA 2WZR1 4YWAA 2QKSA 1PGW2 5CA0B 1G9FA 2VCBA 3RI8A 4IEQA 4A5UB 2XVLA 3KV6A 3GHNA 4MV2A 2G4IA 3RT3C 2JX9A 3CCUV 1UU4A 1G4YB 4E2GA 5DMYA 1CESA 2G9GA 4FPOB 1UOBA 1UXZA 4ZXKA 3ACGA 3GJAA 4B3NA 4J1XA 1U97A 4XF0A 4NIIA 2RS31 1YZBA 2MW2B 2VZ3A 5K1XA 1QMJA 1JQ0A 2UWBA 2WAMA 5KHHA 2OT5A 3NNLA 4HL0A 2BNMA 4NN0A 3VBOA 2GC0A 1J1TA 3CJHB 1YIPA 4LFCB 1R73A 4JC1A 3IWZA 4X6RB 5CFDB 4GB32 4S2FA 1JX9A 3CEIA 1HR0B 4LE4A 4PA4A 2A6VA 4ZS2A 4NWVA 5AG2A 3S3WA 1H9WA 4QHZA 4GX2A 1D4VB 4Y1YA 1W9WA 4O61A 5K1PA 2WLPA 3I2JA 3U07A 1PX4A 2OPWA 3PURA 1L0LH 2ZIMA 1RHI2 3WXPA 1R093 4L8JA 2ZNJA 3OTOB 1HXS2 5FQ0B 5FUIA 1GV9A 3TEXA 3L2YA 3NMBA 1W6PB 3CCSV 4ITCA 1DLLA 4LNUA 1FD9A 4XF1A 2E76B 3ZXKA 1GTOA 1AUYA 4XUOA 4D8MA 3AK2A 1LENA 3ZSEA 4DOUA 3C3TA 1C3HA 1W2UA 4B29A 2DCJA 4CSWA 3K0DA 2VXRA 5JAXA 3W7UA 3AMQA 4Q1PA 4FI9A 4O7XA 3LEMA 4NIDA 3CCRV 4EZ4A 5IK7A 1FPN3 3FX7A 3OF1A 2YI9A 1ZZ6A 2HYKA 2UU9O 3N7LA 4Q4Y3 5KHJA 1Q6HA 4PJ0Z 5AC92 1GWLA 1R64A 3AZYA 4PV1B 3KV4A 4Y33A 4DEQA 1AP5A 4YM2A 4XEZA 1JYTA 4LHLA 2UUAB 1AB3A 4H55A 4UT5A 1ZRRA 4GD4A 4JASA 2JEMA 4U36A 4LJHA 2YS8A 2YBSA 4RQPC 4IGOA 2ZT9B 3ZRSA 4CDWA 4ZBMA 4DR3B 2WO1A 1UPGA 1SBDA 5DZGA 3ABUA 3MI8A 3GZAA 4YW3A 1YDXA 5L3EA 3CCJV 4Y1VA 2KSDA 1AR83 1HX6A 1DQ1A 2GC3A 2GC2A 2WIIB 1PIV3 3QO5A 1CN1A 1E1RG 2VZUA 1ND3B 2F1MA 1VMFA 4ZI7B 4TXWA 4FXKB 1VMHA 1UO9A 2R70A 3ZBHA 4DINB 2Q5ZA 1OFNA 4AVCA 2YGMA 3UKTA 2LO1A 4AHWA 3QBQA 4JRLA 2XT9A 3CCLV 2CWSA 3OGSA 2IU0A 2OIEA 4QXHA 4DFSA 3OAAG 2PMWB 2RHPA 1GOHA 1IHMA 4WFHA 3CCVV 4LWSB 2ZAHA 4JI7O 2Q68A 5IT6A 1YQCA 3LEGA 1FXKB 4RR3B 4NROA 4WCEV 2DVGA 4NTWA 2OQ7A 4NRMA 3UT5A 1QQCA 4CDQC 5C8CC 1K5JA 1M4WA 3J7LA 1ZL8B 2R6QA 4MVRA 2WS93 5FMOS 2BNOA 3PL0A 4OHVA 4O2AB 4UFHA 1LHNA 3W7SA 1K7DA 1SLCA 4OZOA 3MW4A 3T1YB 5JI7A 2WWJA 1O4YA 1JCHA 1EBOA 3W21A 4CDUB 4JYAB 3LEKA 2X29A 3LDDA 1FFXB 2NN8A 2ZEZA 2LM3A 1JZ3A 4RQEA 3K08A 3WZ1A 3QNEA 1NXMA 3VDCA 2JG9B 2TEPA 1BHGA 1RUD3 1XJAA 1REEA 3FAVA 4YJ2A 5LEJA 3LSSA 5LB6A 1DTOA 3PUIA 4BLIA 4OCTA 1IPJA 1MSDA 1Q82W 3PU8A 4PLNA 2DVAA 1JMUB 3A8TA 3BPZA 5IWAB 4DV3B 1RUE3 5GKAC 2H0BA 2Y6LA 3LA7A 1W0JG 4I55B 5KX5A 5LCWL 3BU0A 2ZA9A 4C8DA 3MIHA 5I8TA 2QQJA 4OMCA 2YV8A 3DXTA 5A1FA 2RJLA 1Y3TA 1D7PM 3AJZA 5C3QA 1IPSA 2FDFA 4BLJA 4GCZA 2EIEA 1AR1B 2AZ5A 1PL0A 5LMUB 4HT1T 5FZEA 2E51A 1XPWA 2K46A 4RUFA 2PLV1 4JHTA 2XDVA 4QU2A 1H8VA 1VE0A 1COV2 1XNQO 2JGDB 4ZOLB 4IV1A 1L0NH 2XJUA 1OF4A 2QE7G 3S7IA 2XH6A 4AHYA 4TQFA 1ZYBA 2R072 3AYEA 3I3QA 4AEDB 3LOIA 5C3RA 4K8XA 1N3OA 3ZOIA 1US6A 1AYM1 1XBFA 4DV6O 1LJ7A 4B3RO 3ZCCA 3PJSK 4RGAA 1B35B 1UCXA 1VB2A 5DN6G 2DWRA 3GZEA 1LRHA 4M3CA 5L7OB 4NXMO 3J8F1 4JVAA 4BOWA 3RWKX 4DUZO 5LA9A 4CCMA 1RUC1 1HV1A 1C1FA 3KCYA 1RJ7A 2GP5A 3ZMTA 4RYDA 4YZ2A 1OLQA 5GONB 2W47A 3G6JB 1LESA 4RAIA 3E6CC 3NV2A 3VBSB 5GZGA 1ZZ9A 1U5IA 3WDXA 1CX1A 3ECQA 3IN9A 1HNXO 4UUJC 1SC5B 4LOTA 4RHV1 1W2NA 5HPOA 3ZM8A 4I50B 3BODA 2VZTA 1AL0G 1G8MA 4GX5A 3H1MA 3HBZA 4XDPA 1STMA 3GVMA 5KBFA 1SA0A 3ZN6B 4J11A 4QE9A 2CV6A 5JCOC 5H9SA 3BVOA 1YRZA 3C7EA 2YY1A 1I0HA 4WM8B 2HWF1 2ZAAA 4UXNA 3KSCA 5ABJA 3QO7A 5CIRA 2WLIB 5DZEA 2PYTA 3RMYA 3WNLA 2JXAA 1HRI1 4UV8A 3HWJA 1CJDA 4HMZA 4WZFA 1CPNA 2R042 2JD9A 1JUHA 1R1BA 2OX0A 1S0BA 2AW9A 4UFKA 4YGEA 2DWEC 2YC0A 1OD3A 2WRAA 2D6MA 4JI2B 4B4QA 5HXVA 1MS5A 3HNBM 5LP6C 1W2BU 4XBLA 2PI4A 2WQ4A 4JV4A 4KG8A 5FZ7A 4ATEA 4H2AA 4KG0A 2X09A 3HJRA 4FQ4A 4IEYA 4ZY9A 3HAGA 5JMCA 2HWC3 1PMHX 3KF3A 2PGGA 4CXYA 1UZVA 2Q67A 3SITA 5J7MA 1KITA 3ETPA 3ZSMA 4B8EA 5A3WA 2DFBA 1ZLZA 2JG8C 2RM23 4O4IB 2Y0IA 4HK9A 3E83A 4IV3C 4B7EA 2AACA 1H38A 2B4KA 4IE7A 4IV3A 1V70A 3ZKUA 4JTAB 2BOBC 4NXNB 4QT6A 1NTZH 1KBHA 1SLLA 1UKRA 2ORXA 2IVIB 5CN0A 4Z07A 1ZNPA 2ODMA 1VQ8V 4BH9A 4YG0A 4XVHA 3D82A 4QPGC 2Z79A 4E4DX 3WDUA 4DRXB 4H37A 4QPGA 4JV5O 4JAUA 3VZMA 1GWMA 2OTLV 1LHUA 4P30A 5LRRA 5EZYB 2VAUA 4CEYB 3F5WC 5DM6V 3MV01 3ASIA 1QQP1 3ABLB 4R9AA 4CDXB 2WFF3 3OJBA 2XKPA 3ZYRA 1SBFA 3ZIAG 2A1XA 1YI9A 1R1A1 4ASUG 2D5HA 5FXWA 1RXFA 3IKWA 1JZ5A 4UW3A 2JB8A 5C70A 3RYIA 1L1FA 2YPJA 2UY9A 5FDBA 3ROUA 4FPJA 4IESA 1KU9A 2N74A 2QE3A 4CP1A 1ZUQA 4B1MA 1TMF3 3U14A 4Q0VA 4WM7B 5FPOA 1FI2A 1G7YA 3SMHA 2QQPA 2X6AA 3OYWA 5JLVA 4XXPA 1VLNA 1T5EA 1IQAA 3O1MA 1AR72 3OMAB 4AVSA 4JAVA 1O7FA 2VTXJ 4H14A 4K3AA 4UBHA 2EA7A 2AHYA 1ZZ7A 2ADEA 3TNQA 3OMIB 4ZKIA 2XJQA 5FZAA 1OH4A 1RC6A 4TWKA 3GDBA 4JGZA 4J9ZB 2EIMC 4C90A 1OJHA 4PBOA 2FDIA 3B09A 2ZHMA 3JALB 2P3KA 3P6BA 3E22A 1PZ8A 4G9SB 3AVRA 1H30A 3AZXA 1ULOA 2Z3YA 2XJVA 1BKZA 4W65A 1D0GA 1E1QG 5H9RA 5LASA 3A23A 1O3TA 2JS5A 4YVWC 3OTFA 1HN1A 3MD0A 2WA4A 1F2NA 2LW8A 4GKJB 3G71V 3I2KA 4F83A 1YFXA 1DQ0A 1UU6A 1O5UA 2IJJA 2HEVF 3NJYA 1DF4A 2LW7A 1PO23 1FMD1 1JS9A 1QDCA 3OUFA 3CIHA 3H1LH 5C9AB 2N04A 1OKQA 1MPXA 4YVSC 3NNJA 3B40A 3B77A 2DCZA 5IW0A 1S2EA 3F95A 5CG8A 2GH8A 4YM3A 4W6YA 1VBA1 2P3IA 4QPYA 4YW2A 2EXJA 2QGNA 5FL7G 1DU3D 1PGW1 2D98A 1VBE2 3IT8A 2VNOA 4KMQA 3ZDVA 1V55B 3VBUC 4WBBA 3S7EA 2B9UA 4I30A 1ENRA 5FXVA 5FY7A 1OHFA 4BDVB 2ARBA 2TUNA 3TN92 4LF9B 2D6LX 1FYUA 1UN1A 3DGEA 1AR5A 3Q8FA 2ZEWA 4YHHO 3WHTA 1P84F 4LTAA 3SEEA 4O4LB 1EUTA 4DV4B 3U78A 4KHPB 4X8NA 4EFEA 2OTJV 3WB0A 3OGCC 1DF0A 2QFEA 2ZR2A 1L7RA 5H9CA 5LMNB 4J42A 3MIEA 2XVKA 5ANNA 4K1ZA 4YW5A 4JQRA 1H8TB 5FO9B 4LBQA 1Z5VA 2X10A 1EYBA 3AXEA 4GB31 2X5IC 3H1KH 2DBIA 2WLHA 3KGZA 2WKKA 2HWE3 4BIZA 3LSQA 1FXZA 4PF1A 5GALA 4D6TH 5J48A 5JH7A 4X1IB 3AKTA 3RI9A 2NNUA 1H0BA 1G9BA 1PNMA 3PIJA 4C0HA 4MXWB 3OGIB 4O65A 4JPRA 3PLQA 1P8JA 1TNRA 5HFLA 3NAPA 1YJ9V 2QM7A 3JATB 4K3UA 5JXHA 2XBO3 2R9AA 1JN2P 1QJY3 1HXS1 1AP6A 3X2QB 3GF6A 1EAH2 3KF5A 1CAWA 3VBFB 4PA3A 1JFFA 2XKOA 3L72H 3SH3A 2WLNA 1Y76A 2E32A 4FTEA 1W6QB 2HFEC 3SISA 3O0WA 3E97A 4U7OA 4OX9B 1F5JA 3KZIZ 2WBKA 2AGAA 4LLFA 3D0JA 3JAKB 1GKBA 3DEMA 4D6SA 1YLLA 1ULDA 1QHTA 1X36A 1VB4A 2ZZJA 5H9PA 4GZRB 3QVNA 2PAMA 5BYNA 1K4CC 5IYCO 1RJ8A 1NAEA 4IXLA 4NHMA 1SQFA 4F7ZA 5LXTB 3ZXFA 4QMAA 2A3YA 1QLEC 5KXCA 1A8MA 1WGPA 2VULA 2VZSA 1F15A 5CADA 2FBEA 5AC91 1BVVA 2Y6GA 3V56A 1V6NA 4B7KA 1FPN2 4XTMA 3O1RA 1JOJA 2W39A 4Q4Y2 4Y20A 1PK6B 1QNYA 1OUXA 3M3CA 3WNPA 2R16A 1JYXA 1X50A 4YZ5A 1Q6IA 5CG9A 4F6RA 4QHBA 2A3WA 4OGQB 4DR7O 1EN4A 4NHYA 1HB1A 3TWIA 1U5XA 4JGYB 4BXFA 2I07B 2ZHLA 3K4AA 2ZGOA 1FJGO 1W28A 2B5UA 2QNKA 2PFWA 2VUAA 1AL23 3Q4HA 4BWAA 3O1PA 1AYN3 1UKGA 1AF9A 1QOTA 5HXMA 1TE1B 3ATGA 3JQWA 2EILC 1BHBA 2QWQB 3WFVA 1PKXA 3K59A 5CU1A 4MGQA 5KUKA 1O59A 4HANA 3EB7A 3CC7V 1PIV2 2WWWA 2VBDA 5K4LA 5FWJA 2A7AA 4BZ4A 3SJAC 4PJYA 3O1TA 1V6JA 1TVKA 1WAZA 5B66Z 3S5AA 1YTFD 3RVZA 1KB9F 3J80N 3MAQA 4GMP1 1PHMA 3O1OA 3E6DA 3P3NA 1KQSU 2AR6A 3OBAA 4Q0SA 4BIOA 2PAKA 3CF6E 3QF7A 3CJIB 3ZYIB 3HBKA 1XXNA 1GMMA 3PUQA 4D7TA 4P02B 5FUNA 5BR8B 2HLEA 3ZHSA 4AFCA 3ZPOA 1XOYA 4Y1ZA 2E5LO 1RUJ3 1HQWA 3KCCA 4IERA 1VEWA 1P7GA 3AFGA 3E6BA 4COWA 1UNBA 1XHXA 3NV3A 2WS92 3WW1A 4XPVA 1G6UA 3CB2A 4FAGA 4DR4B 2XHKA 1NZCA 4IUGA 5JZGC 3SQOA 3HKCA 3VQVA 2B1GA 5T55A 1BBT3 2RS12 4C91A 5JZGA 2VUJA 4J41A 4JI5B 3WR0A 4Y1UA 2CDPA 2E9QA 2NLRA 5A6YA 2Q30A 3QD6A 2QZ3A 5LEKA 4NHLA 2QQNA 1SLAA 3OY8A 2J7MA 1FS0G 4EQVA 2J42A 3C90A 4MO3M 1O4ZA 4DV5O 4MGSA 1RSOA 1PO13 2K9ZA 5FYYA 4UOJA 2ZR3A 1F23A 1P49A 3ZXLA 3AP6A 4OUEA 3ZMOA 4YLZA 5DAQA 3FB5C 5FXXA 3GJBA 3GBFA 1HNWB 3IPVB 1FAYA 2C6SA 5LA1A 1RUE2 4E2SA 3R6SA 4O4HB 1RINA 1AR63 2HWD3 3EXAA 5J2TA 2OVUA 2OUHA 5DQ0A 3IGAC 5CBGA 3WQBA 3ZFFC 5K7PA 5F5CA 2EAKA 4GX1A 5F32A 1D2QA 1JZ7A 1KP3A 1XOUA 1COV1 3QG5A 2HKXA 3CE2A 4IGPA 4Q1RA 2P4KA 3USSA 1XB9A 2BWCA 1JYNA 4OI0A 3DKQA 2WLMA 3AVSA 2R071 3IMMA 1RUF1 1P4RA 2WNVA 1QNMA 5LRSA 3HKBA 1UMIA 1POQA 5A7PA 1FOD3 5HCAA 2WWSA 3ETEA 3C7HA 2R0FA 5IVYA 1BE3H 1NOVA 2DJVA 1AJNA 2W87A 4XMIA 4ZONA 4JI6O 4G28B 2AUYA 4I3GA 4LBEC 1Q86W 1YTFB 3D3QA 3JASA 1AI4A 1SLIA 3JCUZ 3O12A 3LD8A 2D6NA 4P00B 4O9GA 3WVJA 4HNAA 3BI3A 3AB0A 5LOVA 3POIA 4R6ZA 1V9U1 4ZIBA 1XNRB 2J1VA 4PLMA 4FSJA 4MHUA 3B9CA 3N7MA 3ETGA 2F4LA 3H01A 3OGVA 1J84A 2D40A 1EM1A 5JPMB 4FCAA 4FLZA 4J1WA 4LF5B 4DR6B 1WA8A 4LF8B 2ZINA 1FXVA 3RRDA 2AEYA 1NY72 2GHYA 3N9QA 4MGTA 2ZZQA 1GNZA 3MLKA 3FB7C 4EFBA 2VZ1A 2J1EA 2Q0OC 1COWG 5CB4A 5JI9A 3RVHA 2IC1A 1IKPA 1IBLO 3TK1A 4XUTA 4JX0A 4ZHQB 4ARXA 2RE9A 1IG0A 4CZSA 3QACA 3U1XA 4XIOA 4I0XB 1LEMA 2Y48A 4L0PA 2JDZA 2Y6KA 5JQGB 4JI3B 2QR4A 3WT3A 4RN5A 3CWBH 2R041 4MS2A 2VQEB 4QPIB 4BCUA 4JTCB 3J4UH 4KGQA 4OUMA 4ES9A 5BNOC 1K9MW 4SBVA 2BOJA 5FYSA 1V6LA 5DZFA 5FUPA 2E7TA 3KLSA 1S5HC 2VNRA 4QX1A 4QDRA 4LHKA 3IC9A 2VQTA 3E89A 2KQXA 3AKSA 3FYIB 1K5MC 4BQ5A 2RJ2A 3RWRD 4I3PA 1V9PA 1K5MA 3CZUA 3RMXA 3ZFEC 3UGFA 1XMQB 4F3JA 1OPOA 2WSVA 4NWWA 5BXZA 3C7FA 4LO5B 1REDA 4E4EA 1V54B 3MIBA 1MQTB 4CDQB 1IBMO 4JI1B 2YFZA 2AREA 2F95B 1WLCA 3ZRWB 1NU1H 5C93A 2WSUA 3BTZA 1F31A 3K46A 3UNPA 1EV13 1VAMA 2UXDO 1Q3EA 2YIBD 3N2KA 2RM22 3JB8A 3EVKA 3T0BA 4ZZ8A 4E8CA 1W2AX 3AP4A 2IXCA 4EN7B 1Q56A 1CAVA 4UF0B 1SQQH 3JAWA 2CAZC 2YIAA 5JIAA 5J2UA 4FK5C 1YIJV 3E2EA 1H8HG 2PXJA 1OLRA 5FZHA 2ZBJA 2ZGRA 4M3CF 1MZ5A 1M5IA 1X8MA 4JQTA 1S2BA 1MACA 1O6UA 2G19A 3I2GA 3OFNG 4HPKB 4BYYA 4AG4A 5T5PA 5A2QN 4DUYB 4RL7A 5CA0A 2F4VB 2WFF2 1W0OA 1NH2B 4TZDA 1Y74B 3OEHG 2YEVB 4HZ3A 3POGA 1VQ9V 4JTOA 1HQNA 4XDQA 1SMVA 2OPKA 3AK3A 2DDUA 4GH4B 2AZ0A 2GP3A 1AR71 2VUCA 4LMFA 3T4DA 4LFBB 2XHNA 3UKMA 2ORZA 2ZEYA 1F4HA 2VS0A 1N32O 1LULA 3MIGA 1IKQA 2VPVA 1U5YA 1AX1A 1YXWA 1C8M3 4PBPA 5FV3A 1GN4A 1V6KA 1OOPB 1J3RA 2VMEA 1H2MA 3CJHA 3M2MA 4IYIA 2ETEA 4DV7O 3RNSA 5CFDA 1ZRFA 1AX2A 3RSJA 4UFJA 5KAIZ 3JQXA 2A79B 3IMNA 1LAJA 2XWJB 5FZFA 4IT5A 3W9AA 5FYIA 4JI8B 4E9KA 4WVMB 1RTVA 3INAA 3T2OA 1VR3A 4ASKA 5CVRA 4YXWG 4CU6A 4MSWC 1BK0A 1OA4A 3CPWU 4AEKA 1DBNA 2AGSA 1QJX3 1G8WA 1GUIA 4Y3OA 2H94A 5JVVA 2WO3A 4WZCA 1QU0A 1JU4A 2VTFA 1ZAUA 2D6PA 2B39A 2HKOA 4EZHA 3USUA 1NQTA 2WL1A 1W6PA 5IVEA 3RYHA 2O14A 5FYBA 5FPBA 1PO22 4AGRA 1CZTA 2ZIOA 4LF7O 4XFGA 1GM9A 4CE8A 1KFUL 3Q8CA 1VQLV 3LA2A 1CX4A 1JYCA 2UYAA 2YROA 1DK1A 4AHZA 2L6LA 1OQDA 4DR1O 4NYKA 1DG6A 3O1VA 1URXA 1DHKB 3AG7A 1DCSA 4AEMA 2E7AA 2VZVA 1G86A 3NVCA 1VMGA 1VBE1 5IJ9B 1ZWIC 4N7UA 4CCKA 2Z5UA 3THOA 3SHRA 3OM3B 5GLZA 4XUNA 2IH1C 4QPWA 3ZIXA 4RGGA 1GK9A 5FO8B 4PDWA 4HOOA 3CMGA 3GCXA 3TN91 4OHYA 4TT3G 4FIPC 1ASJ1 2DUOA 3CCQV 1W0KG 1XI1A 1MZEA 3R4DB 5FYTA 1H2NA 2OIGA 3JSNA 1GZWB 5FP7A 2KA3A 3NJVA 1DQ2A 3AZZA 4B3MB 3EHBB 5LP6B 2D44A 2CHHA 1SCSA 1L7LA 4UB6Z 1JMKC 4U3FH 1DGWX 5JVDB 4EE2A 4IE6A 1HW5A 2C2AA 3R66A 1QF3A 2VMDA 1SKVA 2XVGA 2PAEA 2IBZH 1XU2A 3AG1C 3MF9A 3TETA 3BUCA 3T2MA 4IETA 2CNAA 4V1PA 2XL7A 2A0LA 3SCGA 4IYHA 3VDDB 3VD4A 2PTMA 1ND3C 3HKEB 4WVVA 1Y43B 3RYKA 5LBBA 1VRH1 4GZ9A 4BW9A 3IDEA 4LR4A 3H8UA 4HVQA 2WWUA 4ZI7A 5H6RA 4BE3A 3SYQA 2HWE2 1OQ1A 4K9SA 2FD8A 2QKAA 4DV1O 2UUCB 1UMZA 3POWA 3MHSC 1ZBA3 4XZUG 2C26A 5KC5A 1MS0A 3HPNA 4IEPA 2XTAA 4JTNA 3I5DA 1EAH1 2Y6FA 3X29B 2HJIA 3MIDA 4WV8A 1XMOB 3KT1A 4LWSA 1FXKC 4RR3C 3I49A 5F2WA 1N1VA 1FKAO 1QJY2 2Y33A 4AFBA 2JB4A 1FXKA 2IZWA 4EKWA 3AKQA 2UXCO 3A0RA 4Y24A 4Q0QA 2VNVA 4ASLA 1WD3A 1I94O 2UUBO 4DV2O 4CC6A 1WB8A 1YFUA 2ILMA 1F4NA 4GWNA 5LHHA 2GMMA 1ALYA 4O2AA 3ZHVA 2GSYA 3SPHA 4FFGA 3K4ZA 2OT7A 4YW7A 2KD7A 4A41A 4CDUC 2ZEXA 1YWKA 3ZFGC 1VP7A 4CDUA 3OMNB 3CC2V 1IXBA 1JPXA 1KP2A 1K5SA 1FFXA 3UKNA 4DUWA 1W9SA 3WP3A 2JG9C 5KWRA 3WV6A 4ZU7A 2OQ6A 1PL4A 1LGNA 4KBZA 1O3RA 2HWB3 4Q4Y1 3JBG3 3VBHB 1WW4A 5JXGA 1RUI1 4A44A 1CIWA 1LUWA 5CA3A 2CY6A 1CD3G 4CXXA 1C5HA 1SQPH 4CPBD 3K51A 3BCWA 4NTYA 1VAVA 3UGGA 1TGOA 4IL7A 1SEFA 4I55A 1IPKA 5HV0A 1F51A 1SCRA 1ENSA 1O3SA 5IJ0A 1O8PA 3C7OA 4KI5M 3TEZA 1AROP 2Q9LA 2QVSB 1IS4A 1JOBA 4YVWB 2PHDA 5I0SA 4I09A 5GLTA 1PZ9A 3JCZA 1AL22 4R9DA 2QKCA 1AYN2 3L74H 1ZZBA 4RO2A 1FV3A 1TME3 2KKWA 3WW4A 4ZOLA 3K3WA 3WW2A 1SPPA 1R083 3WF3A 3K4DA 2HJFC 1XL4A 3CCMV 4OVEA 1BCCH 3LDBA 4AEDC 4IEUA 4JGSA 4YVSB 1BMV2 5C3PA 3B94A 1GAXA 1YNAA 5A6XA 2ZPXA 5F2VO 4AEDA 1VAKA 4LF4O 5A70A 3HQUA 4FLUA 1B35C 3EO6A 4G2KA 3OEBA 3RJ2X 2AEZA 2ZE6A 1B35A 1GZCA 3VKNA 2ET7A 1BQPA 2UU9B 1PD3A 3CJXA 5L7OA 4QX5A 2IXLA 4XCAA 5F3EA 4E2LA 4BISA 2IJIA 5BNQA 3VBUB 1SF9A 3IB3A 1NI8A 1MS3A 4FTBA 3VBSC 2WS91 5GONA 2OYZA 3CBNA 1S1AA 1GU3A 4LR3A 4MVOA 2UXNA 3K79A 3WY6A 1M90W 1BL8A 3KD4A 2WZR3 2W6JG 1IBKO 4FPYA 2RS11 3WDYA 1QVFU 2Y69C 1EUUA 1W8TA 2XAGA 3ABMB 1VQ6V 2A6ZA 1J83A 2LALA 3OR7C 3RQ0A 4W4KA 1YC61 4UAPA 4WBNB 2DURA 2HYXA 4LP8A 1M06G 3MLJA 3ZN6A 2VQ0A 1MMMA 1XNDA 3DPRA 2WO7A 2RS33 4WM8A 2VJXA 5CA6A 2X5IB 4MOAA 1CQ9A 2WLIA 4Z2WA 4QDQA 3EQEA 1PO12 2JJ6A 4CCDA 4DB5A 2FMLA 3ENRA 1NCQB 4TLGA 4CP2A 2W95A 3HEIA 1F4AA 5CFCC 4NIGA 3LDEA 1NKGA 4LA2A 3S57A 4JI7B 1AR62 2HWD2 3LEIA 5KHIA 4IE4A 3ZXAC 5BNPB 1SLTA 2JDKA 1RUG1 2RMU1 2J1AA 3TYJA 2YIDA 4FLXA 5FYCA 2XGXA 2GNDA 4DEVA 5F6KA 3I4IA 1PNFA 3JD4A 5EYPB 1GMGA 2L9LA 3LIGA 1UOGA 5HCBA 5IVJA 4TYSA 5A7QA 5EIBC 2BGOA 4AHCA 2HH9A 3OG2A 2GNMA 1ST8A 3OUIA 2Q4PA 2KG7B 4UCUA 3A0BZ 3AM2A 4KL1A 3H9AA 4N9IA 5EXOA 4O4IA 2EJ7A 2ZM6O 1FPOA 3WB2A 4BXSV 4UI9L 2X53S 1FOD2 3H3LA 3K5OA 5A3OA 3UO2A 2KM2A 4XF3A 1XQ8A 4R8CA 1LB2A 1H4GA 3J7AU 3PJQA 1Q90D 1N8RW 2NMOA 4XILA 1JA8A 2DFCA 3C8XA 1FNYA 2ZOEB 4YW1A 3DN7A 4J10A 4F6EA 1QKQA 4KH9A 4ZU5A 1M1KW 1UYZA 4YM1A 4PHZA 3BABA 4DRXA 4CEYC 3IDAA 2LFRA 4META 2PHUA 2PF4E 4W6WA 3NNFA 3Q8AA 2BYVE 2YMZA 4CDXC 5HFMA 5A7WB 5EZYA 4GWIA 4FM2A 4CEYA 3RPQA 4HN1A 4CDXA 4FO9A 1APNA 1BMFG 1WW5A 1A32A 4YGDA 1WW6A 4XJUA 5A7OA 3ZR5A 3W5NA 1AJKA 2ZX0A 2RDNA 4ABMA 3WG4A 2RMKB 5L3FA 4CUGA 1RGSA 1VBC3 5GTHZ 2YU2A 3A4UA 3N27A 4WM7A 1XNQB 4FAHA 5HI0A 1LHOA 3ZYHA 5B3SB 4CH3A 2CH7B 1CGPA 2EILB 3F2ZA 3SCFA 4FM1A 5T5LA 2ZGPA 3VBOB 1SFYA 1KS5A 3I56V 2LW1A 2VH9A 4DV6B 1W8NA 2BRTA 4LUKA 3HNMA 1M56C 5B5EZ 4B3RB 4AQ6A 1GM8A 2QDNA 3MW2A 5I0RA 3T0DA 4UCRA 3I2IA 4NXMB 4AAXA 5FP9A 3NJXA 5A3LA 1DLCA 4E2QA 5KHKA 4DUZB 3AP5A 1V00A 5CYYA 4MG2A 5J37A 4JYYA 1Z7S3 3GBGA 5FYMA 4QNHB 5I0TA 4PIYA 4P9GA 2ADPA 5BV6A 2Q7HA 3QCWA 1D2SA 2JD4A 2W46A 5DUWA 3DXRB 1HNXB 2VCCA 5JUVA 2RM21 5FR3A 2Z4FA 5IYBO 2BERA 2JK5C 1EV12 4L97A 4LUMA 2BGCA 4P9IA 5H2FZ 5J98B 5C9AA 1VQMV 2ARHA 3T09A 4FP2A 5LA6B 2Q8DA 3W7TA 1J59A 3VUOA 3K06A 1JZ8A 2XLAA 3SH5A 1VMJA 4NTXA 1LKNA 1ULPA 3ZVXA 1A78A 1T2XA 2ZKLA 2D43A 4LBNA 1AR93 3UESA 1V55C 3M70A 3BB6A 5EHDA 1WBFA 4K20A 4FVMA 5JMOA 3LDKA 2EX3A 2DCYA 2RCVA 3RYFB 1NLSA 5J9PC 1BZWA 4YJ3B 1S76D 2JICA 1VQ7V 4B3TO 1ENXA 1CJPA 4J25A 3K0GA 3P5BA 5DG1A 1D5AA 3VZLA 1UIJA 3NXSA 5LHIA 3T2QA 1N34O 2ADQB 3V65A 4X9QA 4MXVA 4IGGA 2JE9A 1AJQA 1OCRC 5JXJA 3VQYA 1SDDB 4L11A 4X8AA 2VM9A 2D2CB 1H8TC 2JRIA 2QQVA 2RNBA 3K9SA 1LU1A 2OCCB 1BZKA 3F5TA 4Q27A 2P67A 2GNTA 1UMHA 2VECA 3HNYM 2O1QA 5J96B 3ZN0A 3J7NA 1GM7A 3APOA 1YIFA 2WZPP 4FLTA 3ZIWA 1C8M2 5FWEA 1OURA 4MH0E 4NB5A 1O9GA 3A7QA 3ZMUA 2PHLA 3LE0A 3NV1A 2PY5A 3D0SA 4XFBA 4X1IA 1XE0A 4MADA 4E4ZA 5IATA 4FVVA 2QTOA 1X59A 4MXWA 1K42A 4A45A 4LH7A 2GSMB 4M3CE 2ZGNA 1SQGA 3OUHA 3JATA 3X2QC 5ERLA 1Q6UA 4LO7A 1JOPA 3AG2B 4JV5B 3VBFC 2G9ZA 4IIJA 3ZXGA 5JJJB 4N53A 3A21A 1NTMH 2YXYA 2D6OX 4GULA 1QJX2 2R062 3V0AB 3J8F3 1AILA 2H3OA 1QR8A 3B4SA 1QU7A 5FLXN 5FZOB 4FP3A 5AFEA 1UY3A 1LUVA 5K0UB 1UPIA 1RUC3 1PO21 4JTDB 3CO2A 3BPSA 4X1KB 3MV11 3NJZA 5LA2A 5FLIA 2QQWA 3JAKA 5IUQA 5FZ1A 5IAXA 3MICA 1MNGA 1RUH3 4P08A 2WYSA 1NQJA 2B45X 3AG3B 1OQEA 3FYEB 2JDUA 4Q2FA 2JEXA 4MSVA 4B4RA 1ODNA 5LWBA 4PI2A 5A3TA 5LXTA 2XWBB 5HCHA 2DU1A 2RS52 3WOGA 2Y26A 4QGMA 3RFRA 2UWAA 5LGNA 4YNIA 3FHQA 2QWNB 4XFIA 1WZXA 4D7YA 2ZGSA 2YBPA 5F3IA 3UM7A 2DMXA 2BTVC 5EYXA 2WABA 3T2TA 3CQOA 3ASOB 2HWF3 3E8HA 1PK6A 5BNOB 2VOTA 4S2GA 1K3IA 4YARA 3BAAA 2ZTNA 4LO8A 2W1SA 1JH5A 2AH2A 2WLJA 1MG1A 3SPCA 2WLLB 1OSGA 4BQ2A 2VD7A 3U37A 1YJKA 4OMDA 3DUIA 4QB2A 3ZFEB 3RVYA 4JGYA 2W9XA 4PQ9A 5SV8A 3GALA 3MDSA 4LLOA 1SS3A 3I54A 1PM7A 4B08A 3N4MA 1YVWA 1ZBE3 4XJWA 5IAVA 1Y66A 5BNNC 1GNHA 3KVAA 2ZABA 2ATFA 3GWOA 4Y22B 5IFTA 4A7YA 2XAHA 2I45A 2ZGMA 1YI2V 3E5UA 4UVCA 1QVGU 3AP9A 2YU1A 2LQTA 3HB3B 2PUSA 2UU8A 4LITA 3POSA 3PVBB 4HETA 1JTZX 4P5HA 4X64O 4QAWA 4NR1A 4JAAA 1UWWA 1PGL1 2VC9A 3OGRA 3S3XA 2VY0A 2KB1A 3M4FA 1RXGA 5L9RA 4A3ZA 2CTRA 1QJY1 3UKVA 3LA3A 5F5AA 1WD4A 3RN4A 3P32A 3CJIA 1VQNV 4QD2A 3RBZA 1HIXA 2YZ4A 1XC6A 3SYAA 5FPAA 5LBEA 4OHXA 1RPOA 2HEYF 2X6BA 2IXKA 1CZVA 1BLZA 3D36C 2OZ6A 4UB8Z 3FLPA 2ZGKA 4P9WA 1IS6A 4YYOA 1YHQV 2E31A 4YHHB 5G04L 1JODA 5DG2A 4BK5A 3WB1A 3SYPA 3K2OA 2EIBA 3WF1A 3MFCA 4KU8A 4PF5A 5FNVB 1R1A3 2NN4A 4WFGA 4KWKA 4LC1A 1Y7BA 2LS6A 1QOSA 2TBVA 3H8XA 1DZQA 1D4M3 2K9PA 4LHNA 2YUEA 2R30A 4OULA 1ZRCA 2FCTA 5IJRA 3H3UA 1BT8A 4JZGA 1QHDA 4QHOA 2F66C 4GLXA 4WVWA 2HWB2 2JKBA 1XHZA 3CMAV 4MGZE 4DZGA 2H0VA 1I08A 4YZ4A 4XFFA 1S0FA 3J7HA 4XDOA 2DN9A 3EMRA 4OPHA 3IPVA 5ANQA 5D21A 1JI6A 1UW8A 3KZ4C 1NA1B 5JCTA 2JIJA 4JI0O 1N1YA 4O4HA 3KT7A 4KP4A 2VWKA 3CX5F 3CDZB 3NQHA 2XAJA 2IVJA 3GGLA 2VNGA 2UXBO 1GRJA 4EROA 1X82A 3CD6V 1AYN1 5GZDA 2ZNIA 4EN6B 4Q5OA 5L9VA 3FBYA 2R1DA 1B09A 4GAZA 5GM0A 4A4AA 4PD4F 1TME2 1BMV1 1FFTB 5KC6A 4QXCA 4AI3A 3CMEV 3OD4A 1OI6A 3LQCA 1VIBA 2BVVA 2NYYA 1XQNA 1QJU2 3JD72 3B2EE 3EFFK 4QKNA 2HP8A 2BCCH 5FMOL 4A7ZA 4LOSA 2Z42A 2YHJA 4Q4W2 4CVUA 4DXSA 1XE8A 2WN3A 4MW3A 1HRV3 3QH7A 2XPJA 4U2AA 3VHRA 1SACA 5F3GA 4RWUA 2CTQA 1Z78A 4H3WA 4AYUA 1NE4A 2HEPA 4WF9V 3OEAA 3OOXA 1R3JC 4DR7B 4FM0A 3WDWA 3B69A 1FJGB 1LGCA 1S77D 3GXUA 4RQPA 1VQPV 1BGYH 3GB7C 3VDBA 3A0KA 5IK8A 1D5NA 5ITZB 2W94A 1E5IA 3IZOA 3RZGA 1PM9A 3O0XA 1W8ZA 5LL6Y 4DR5O 1ENQA 3AG1B 5E79Z 4YIOA 4ZHQA 4QQOA 3OYWB 2Y4TA 1NZIA 5KXEA 5JR2A 4I0XA 3ACLA 3ES4A 5JQGA 1NT0A 4QPIC 4PQQA 3H3ZA 3ZHTA 2EALA 1VPHA 1O5LA 2IH3C 2Q73A 2AHZA 2FMDA 4JDNA 1ZVFA 1UY2A 3VGIA 2F6BA 3AZWA 4GB33 1AR61 2HWD1 3TBDA 5D2AA 3B93A 4GKKO 4LQRA 2ES3A 3G6EV 3IAQA 3OD0A 3I59B 4L8QA 2XAFA 2JKXA 1UOFA 4ARYA 4LEJA 3ZX7A 5KHGA 4XHBA 1PV0A 1F35A 4LKDA 4I0WB 4D6RA 1LNSA 2P5OA 2E5LB 1NUKA 2Z69A 5T54A 1Q8OA 5EP9A 3C3VA 1V54C 3ALQA 1MQTC 4HG6B 2P37A 5IFPA 4IEZA 2RVAA 3PVEA 4NHKA 1HXS3 5EK0A 1MQTA 2JIGA 4SLIA 1U5ZA 4CDQA 4ZU4A 5C8CA 4FBFA 3M7AA 1WCSA 1MABG 3ZRWA 1LOBA 3U11A 1UAIA 1FOD1 4KNCA 3KB5A 2DU0A 4H44B 5AFBA 1QXRA 2GAUA 3MW3A 5LZ6A 3SPGA 1N1TA 3ZFGB 1FT9A 3MEPA 4E8DA 2MEV2 2BU9A 1IG3A 1IQDC 4UF0A 3APQA 2E75B 1IOAA 2WNOA 3FC0A 3SGIA 4DV5B 1JUIA 4PCRA 3E8FA 3Q8EA 4DY5A 4CXWA 3UL2A 1SFPA 2D97A 1Q8SA 3OSDA 1MSWD 1YXBA 4HPKA 4CEWB 2VOVA 2YGLA 1YI7A 2ERFA 1S0JA 1R6TA 1Y74A 1JYWA 2YEVA 2P34A 5B2GB 2W1QA 4GH4C 2ZGQA 2VG9A 4K1YA 5I0DA 5EIBD 3AX4A 4GH4A 2VOKA 1DYKA 1GP4A 3OGGA 2IXIA 1RVF2 1VBC2 2A5ZA 4AL9A 2PELA 4DQAA 2X0LA 1RM1C 5A1AA 2CDYA 5EC1C 1RMU3 1ZX3A 4LFAO 1QDOA 1LHVA 3VKOA 2ADDA 5EBWC 4QQ2A 4HVOA 2GUZA 4BQ3A 2B9VA 5E16A 4HXCA 1OOPC 4IW3A 4M4PA 2F4PA 1KGYA 3O7OA 4AZZA 1WCUA 3ES1A 3ZYFA 3AMMA 4UCVA 2B42B 5F37A 2QWPB 3FX3A 2XXZA 1OVSA 4HKLA 4JI6B 3ILRA 3WG3A 2UY8A 1VQ5V 4WVMA 4X66O 3NAPB 3T3YA 5C8YB 4BWOA 1OA2A 1H1MA 1LOEA 1QOOA 4PELA 4XDLA 1Z7S2 3WLUA 4DXZA 2SBAA 3WP5A 1H2KA 3K77A 1PPJH 3JD1A 4JKMA 2Y0PA 2FL4A 3WG1A 1EV11 3LSUA 2CU5A 1HDKA 4C1XA 3NNGA 1YO8A 1XNAA 5A33B 1AXZA 4CU8A 3B00A 4K8RB 4GA9A 2Y69B 2YXSA 3L75H 3KQ4B 5J3UA 4BMEA 1IBLB 1HV0A 3WDVA 4LIVA 1YQ6A 2E74B 2A3QA 1J95A 3AG4B 2YIBA 5TISZ 4QQHA 3UT0A 4HYOA 2VCMA 2P3YA 3H1WA 5JCOA 4DIQA 5IJ9A 3VKFC 3JYCA 4IEXA 1CWPA 5IYDO 2EXIA 1AR92 1W04A 4K6BA 4AWDA 1P7BA 2BWAA 5CFCB 4JZ2A 2Y34A 4M00A 3MHHC 1MZ6A 4XBNA 2RR13 4F6RB 3VZKA 2OKXA 3TEYA 4UVBA 5LP6A 2XHBA 4XQDA 3WUCA 3VBBA 3P1IA 3ZSLA 3H7YA 2O57A 2ZX4A 2J22A 2ZE8A 3ZO0B 5JVDA 1IBMB 1I1EA 4KGGA 1NLQA 4QKDA 1IXMA 1UYYA 2WR9A 5EZWA 5IVBA 4LBMA 2FB5A 2PHTA 1C8M1 3Q4HB 4DK1A 2UXDB 4TV9A 3VDDC 2IJHA 1N33B 4DPNA 3ZN1A 4RS5B 1COV3 2ZE7A 3VDDA 3HKEA 3OPWA 2JG8A 1OHHG 2H6BA 2EIJC 3CXCU 2OWOA 1R6KA 3RZJA 2R073 3FHAA 3O1SA 1KMIZ 4CCNA 1RUF3 3IAPA 5EC2C 5DAWA 5GLVA 3N9NA 4DK0A 1TUBB 4AHXA 5B1AB 4QGLA 2Q7GA 3CHXA 3E5XA 1YFWA 1SQ4A 2A06H 1Q8QA 4KFMA 5JOYA 2O8OA 4O2BB 2R061 4PDVA 4QIWF 2XASA 1W8UA 4BAYA 4AVBA 4BQWA 2EAAA 4KUMA 4NKGB 2ZMKA 1ND2C 1JR9A 4XABA 2WUHA 3J8F2 4XF9A 1GQGA 3BTYA 4XUPA 5EJ1B 1XU1A 2JECA 3RYCB 5FZKA 4BMBA 1V9U3 4OLLA 3SDLA 1ULGA 1Y67A 3LFIA 5DAVA 4CP9A 3WUDA 2JDPA 4XUQA 2JWPA 3PUAA 1RUH2 2D3OW 3J81N 1UD1A 2RS51 1S72V 3PMEA 1XL6A 1N32B 4UW4A 5FKCA 3WINE 4O9EA 5FYUA 3T4ZA 4DO0A 1G9CA 2WAOA 1WCQA 1IVSA 2WDBA 2D93A 2FZ2A 3VBHC 1E5SA 4DV7B 4UFIA 4G4FA 5C5UA 4OPAA 4MHRA 4QQPA 4EB6B 1GR3A 4AI1A 3IDCB 2F17A 1M56B 4LKFA 4DNYA 1MS9A 2YB7A 1WMDA 1V6IA 5LYJB 5CBLA 3SJCC 1SZTA 1LHWA 5FZ9A 3FE5A 4DUXA 2E3CA 2QWOB 3FJSA 3BA9A 2AYHA 3MFAA 1HP8A 2BQPA 1Y9MA 2NZ9A 4LK7A 4YVWA 5C3OA 2N7GA 1ZBE2 2ZX3A 1XSRA 5L3BA 5L3DA 1JJOA 2LTNA 4R4ZA 3SXWA 1W9FA 1VBB2 1UYPA 4LF7B 5C6CA 3WF0A 1QH6A 1ORQC 2VZOA 2P2KA 2R1BA 1U96A 2JDMA 2BTQA 1NKDA 2WQZC 4DR1B 4YVSA 3BA8A 1POV0 2PQSA 1UZWA 4P9YA 4TSFG 5C4WC 3EJKA 2P6HA 5E6HA 3WP6A 2DUPA 4QX2A 3PNAA 4B3SO 5DPNA 2DCKA 3IM0A 2Y6HA 2M7WA 2OCHA 2BOIA 3ABTA 2MK3A 3Q8BA 4XURA 4MT8A 4LBLA 4D69A 2WNUB 1OBNA 5I0UA 3VBUA 1DLBA 1VARA 2GZWA 1U0AA 1GSLA 3HR0A 3IIIA 4U7NA 2ENRA 3VHNA 1WA8B 5FZ0A 3U75A 5CKQA 1MVEA 3M1HA 3ABMC 1UXXX 1YEWA 1CZSA 1SZBA 4Q4V3 5BY1A 1WPBA 3PIGA 1PNKA 3DYOA 1R1A2 3RZZA 5FK7A 4J80A 2ZGLA 1OCRB 2R9RB 1OCZB 5CB4B 4GJYA 3GZTB 4CH5A 4WBNA 5EJZB 1CR7A 1G1XB 5JXIA 2F43G 1SBEA 2BP6A 1OV9A 2JENA 1D4M2 3JCIA 1N36O 2WNEA 4N8MA 1TAEA 2GDFA 3LDCA 3B5LB 4U3JB 1AR73 4H13B 2HHHO 4PT6A 3ABKB 2P06A 5FZBA 2ID4A 1DP0A 4MVSA 2X5IA 1W2OA 4DV1B 2IUWA 1NCQC 3JD0A 4HZFA 1SETA 3PTYA 2R7EB 5KR7A 1ONAA 2WJSA 3NKGA 5T50A 5BNPC 1X9TA 1UY1A 2V09A 4NIAA 5ISLA 3IC7A 1RHI1 3TXSA 4CPBA 3RYRA 2FDGA 1GOFA 4UFZA 4AFAA 2UXCB 4NE9A 1UY4A 3CZJA 2H6CA 1Y4WA 5D8AC 1ZRDA 1I94B 2UUBB 1R092 4DV2B 1J3PA 5EBLC 5EYPA 3ICXA 1Z5WA 1E57A 1UOJA 5FYVA 3M8AA 1W9TA 1TME1 4Y5SA 3ZMVA 2D3SA 3R05A 4OQ8A 4N43B 4M01A 1CPYA 1CAXB 1W6MB 2KG7A 1QJU1 3JD71 2A73B 3UV9A 3PVNA 3HIFA 3SKVA 5FPLA 3THCA 3N2KB 4W50A 2BZDA 1KXGA 3UJOA 2JE8A 4Q4W1 4ZS3A 4J6GA 2VQAA 3JB4C 4FQZA 1M4UA 1HLCA 4LO6B 2M6YA 1CAVB 5F5QA 4YFZA 1EN5A 4IL6Z 1REFA 4BIFA 3P3PA 1WWYA 5IY5C 5FY5A 1JYVA 2EINC 4BPZA 1KYOF 2D5FA 4YW6A 3LUTB 4AVVA 3IDBB 1HRV2 3GYDA 2QDOA 3CRMA 2QZ2A 1VBE3 1WB7A 4I9WA 1ZTEA 4NMIA 2VO5A 1W90A 5LK5A 1S5JA 3T1LA 3HOBA 2P90A 3TN93 1ASJ3 3VKMA 2WN2A 2W91A 2JGUA 2YBKA 3N3HA 4DO2A 4W4LA 4RA0A 3LDRA 4HKOA 4D3WA 1I5YA 1W6OB 3KT4A 1F5FA 4QWNA 4AFMA 5BNNB 5B3SC 1O8SA 1DGRN 4FOQA 4UFLA 3WNOA 1AR82 2V73A 1WBLA 2PA7A 2CH7A 2ARAA 4XYXA 1EPZA 5I91A 4INDA 4D94A 4MTXA 3VBOC 1UU5A 1C57A 4LF4B 2V72A 4HK8A 1OC1A 3WW3A 3KCXA 3K57A 3RWNA 4YSFA 1S5LZ 1NLRA 1VRH3 4LF6O 5A6QA 2X8KA 2ZKOA 4JI4O 4M4RA 3KG2A 2ARCA 4WFEA 2V5YA 3CL1A 1MA1A 4CU7A 4OI2A 2VBPA 5JOZA 1EAH3 3A22A 4CCLA 1KD1W 3LSEA 3CRCA 2GALA 1OZ0A 1W6NB 1K3EA 1UL9A 4TUYB 4Y4RA 2PHWA 3DXRA 5BXXA 5GZEA 1IBKB 2Q69A 4DXRA 3HPLC 5F9TA 3BOPA 3USUB 2JS3A 1TG7A 4AILC 3BCCH 3RYHB 3G7DA 3MLLA 3QTCA 4Z8BA 2MEV1 4JZRA 3HMYA 1C8NA 5DABA 3MO4A 5LA6A 2J1SA 3J26N 1VIWB 2I2SA 5LATA 1TVGA 2IW5A 1H1IA 5GTIZ 1KDMA 5FZ8A 4Z1MG 2DYCA 1LECA 4DV0O 4J7KA 1WLEA 1HJGA 2Z5WA 3D3AA 1RUD2 4ZHNA 3POFA 1W8HA 3VZJA 2VMCA 2XONA 5APAA 1H1AA 3FBMA 3UCSC 1T6GC 3FFQA 1FATA 4PDWB 3HN1A 3PUHA 1R1ZA 2TNFA 1LOFC 3VQXA 4X20A 3LFMA 2HEWF 1XEQA 1RUI3 3LWCA 3RYFA 5CNAA 4AGVA 3TGUH 1LOFA 3N9MA 4QGNA 1OUSA 2EICA 4YJ3A 4KWUA 1S0CA 3I3EA 1J5EO 5IT9N 1HB4A
chains in the Genus database with same CATH topology
4H14A 1PGL2 1RUJ1 1EV12 1RVF1 1VBC1 2EA7A 4L97A 4UBHA 5GZCA 1ZZ7A 3ETQA 4LUMA 2BGCA 3LAGA 1VBA3 4P9IA 3TNQA 2CAUA 2XJQA 5J98B 3ZYJB 4CDWC 5C9AA 1AJOA 2ZACA 3ZFFA 4QPGB 4FP2A 1RC6A 4AFDA 5AVAA 1WMEA 4JGZA 4MGYE 1J59A 3VUOA 2UURA 2GC1A 4XXAA 3WHUA 5JSOA 4C90A 2XLAA 3SH5A 1RIRA 5EFUA 2GU9A 4PBOA 3BALA 3D6EA 4YG6A 1RMU2 2ZHMA 2P3KA 2WZR2 1PZ8A 1LKNA 4G9SB 4EN9B 1GBGA 1H30A 3WD5A 3ZVXA 1A78A 3AZXA 1BBT1 2XJVA 1BKZA 2XUMA 2ZKLA 3O5SA 4W65A 2D43A 4LBNA 4ONUA 1AR93 2DV9A 3M70A 1D0GA 3C2UA 3AMHA 5H9RA 3BB6A 4C0BA 3OPZA 1O3TA 4KQ7A 3OCPA 5GZFA 1WBFA 4K20A 1OIJB 4YVWC 3OTFA 4K21A 1S55A 2WA4A 2NMNA 2DCYA 1XRUA 1F2NA 4Q0PA 4LBQD 1QWRA 4CVYA 3M3OA 4WVZA 4F83A 1NLSA 4LBJA 4QM9A 5K8SA 3N35A 1YFXA 5HCFA 1DQ0A 1BZWA 1UU6A 1PO11 1O5UA 2HEVF 2JICA 1Z7S1 1H9PA 2DUQA 2RS32 1ENXA 1CJPA 1EY2A 3ZSKA 5DG1A 1PO23 2FHRA 3NWKA 1FMD1 2NM1A 1QDCA 2DF7A 1ULEA 3HD8B 4QPIA 3VZLA 1UIJA 5C9AB 4FPKA 1F8VA 3KS7A 5E8AA 4ES8A 5BY5A 3MPBA 1Q8VA 2YDEA 1OKQA 1DRTA 4YVSC 1LEDA 3V65A 4JGZB 4MLOA 4MXVA 1FX5A 2JE9A 1OMIA 2B46X 2PHFA 2DCZA 3V0AA 2Z2SB 1IZ3A 5K0UC 4UXAA 4N7IA 4L11A 2OIIA 5FREA 3D4KA 2XJPA 1H8TC 2BUKA 3TRSB 5CG8A 5K0UA 1LU1A 2GH8A 2IWGB 4LULA 4Q27A 4YM3A 5C33A 2GNTA 4OHWA 4W6YA 3KM5A 2VECA 3AYDA 1VBA1 3H0OA 4JDOA 2P3IA 2O1QA 5J96B 3ZMNA 2Q4AA 5JWPA 2B7YA 1YIFA 2WZPP 5GLUA 2CYFA 3ZIWA 4QPYA 1C8M2 4YW2A 2EXJA 5KXBA 4MH0E 1DU3D 1PGW1 2BVBA 2D98A 1VBE2 5FOBB 3IT8A 2VNOA 1RHI3 4JCKA 3VBUC 4WBBA 3S7EA 2B9UA 4I30A 1VALA 1ENRA 2PHLA 3NV1A 4HKWA 3D0SA 2VW1A 2RS13 1OHFA 3LZZA 4XFBA 2ARBA 5L73A 4E4ZA 4FVVA 2TUNA 3MIFA 2ZMLA 3TN92 4XW3A 4MXWA 2VOWA 2D6LX 2QUOA 5T52A 1NX4A 1FYUA 1UN1A 4M3CE 1AR91 2ZGNA 1OFSA 3ILFA 5JR7B 4W6XA 5FLHA 4D7SA 4QQLA 1AVBA 4LO7A 3VBFC 3ZXGA 1V6OA 2DVBA 3OBTA 3WHTA 4LTAA 4N53A 4XJ9A 1HKDA 1JW6A 5JOXA 2D6OX 3NSTA 1QJX2 1QJU3 2R062 3JD73 4GULA 4AQSA 3V0AB 4QM8A 4X8NA 3WQ1A 1DF0A 4XFCA 5BNOA 2QFEA 1GLHA 3J8F3 3MGUA 2W52A 2E6VA 4FP3A 2A3XA 4AI0A 5AFEA 2D3RA 4H7MA 5K0UB 1UPIA 3MIEA 1RUC3 1PO21 2XVKA 1DQ6A 4K1ZA 4YW5A 3CO2A 3T1MA 2PHRA 3AZVA 4JQRA 1ZX5A 4Q4W3 1H8TB 1N47A 3D5OA 5FO9B 1J58A 3NJZA 4LBQA 5EV7A 2R32A 2RR12 5FLIA 1EYBA 5IUQA 3AXEA 4GB31 5L7OC 3VBRC 3MICA 3THTA 2X5IC 1RUH3 2ZKNA 3ZFEA 4P9XA 4L99A 1NQJA 2B45X 2WBQA 1OQEA 3AYAA 3VBRA 4Q2FA 4ASMB 3KGZA 5FFOC 3VHOA 3FFZA 2WKKA 5AC93 2HWE3 4IEVA 1S0GA 1FXZA 1DDLA 4MSVA 4IQPA