1H2LA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 106
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2lA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2lA01
2CGNA 4Z1VA 3P3NA 2XUMA 2WA3A 5JWPA 2ILMA 3OD4A 3KCXA 4B7KA 4Z2WA 4QU2A 1H2LA 3P3PA 4B7EA 2CGOA 3KCYA 1H2NA 1MZFA 2Y0IA 4NR1A 2W0XA 1H2MA 2YC0A 4AI8A 1YCIA 2YDEA 1H2KA 1IZ3A 4JAAA 1MZEA 2WA4A 4BIOA 3D8CA
chains in the Genus database with same CATH superfamily
1WB7A 1CVNA 5DUUA 3TN93 1F51A 3APOA 1OF4A 2W6JG 2JKBA 2Y8KA 3A0BZ 1OMIA 4M4PA 3W20A 3KVBA 3RYFA 3WOGA 3STZC 3DXRB 1SCSA 2OIGA 3LEMA 2B1GA 1UN1A 1AYM2 4Q0UA 1HB2A 2EA7A 1V55B 5L3EA 1W90A 4CYDA 4XCAA 2AC1A 4JKKA 5FYUA 1CPMA 5A3TA 4I0WB 2X5IC 4IHJA 1TGOA 4B3RO 4IE0A 4K40A 2V1DA 3HNYM 3I3BA 1JFFB 5HV4A 1LHVA 4DV2B 2EIMC 1G1XB 1XHXA 4A4AA 2C26A 3C7HA 4RFRB 1N36B 1UCXA 4QU2A 5LEKA 3FFZA 4YJ3B 4CCEA 1QJEA 4CPBA 4P9OA 2Y38A 4FZ1A 5F3GA 2PAEA 4EROA 3FKSG 4O4HA 2GTAA 2Q7HA 1SBDA 3DXTA 1RUC3 1FT9A 2ETEA 1CAUB 1JYIA 3CC7V 2WKKA 2W08A 2B1IA 4RUFA 1P7GA 2LW1A 5CG9A 2WLKA 4XFCA 4BJ0A 2FZ1A 2WYFA 3KT7A 1GICA 2RG4A 1JYNA 3DKWA 2ES3A 1RYYA 2Y6JA 1XE7A 2I07B 4LHSA 3F95A 4AYUA 1FXVA 1NTKH 4JI4B 4GIQA 1TVKA 5CFDA 4URAA 1YFXA 5FYVA 2R7EB 4PQQA 3GGLA 2P90A 1ODNA 5EFUA 4RR3C 5A33A 4OYUA 4P5HA 3SKVA 4JGYB 1ULPA 3BY6A 5JMOA 1Q8VA 2VH9A 5FBZA 3TEZA 1JZ8A 2XJSA 2O0OA 1S76D 3BPZA 4CH5A 1O9GA 2P2KA 3CC4V 3PIJA 4IGOA 4OZXA 2Q1ZB 5M0TA 3GZTB 4EN7B 4GALA 1QJU2 4X6QB 2E5LB 5KHJA 2AR6A 4E2QA 3MDSA 1BEV1 2R073 2D6KA 4QKBA 5J98B 1QDOA 5LY1A 1DFQA 2OUJA 3NXSA 4UF0B 3U78A 4CP9A 5A3LA 4DB5A 4OX9B 3JATA 1QXPA 4CDUA 3L2YA 4KBZA 3AMHA 3ZS8C 2YU1A 3VDDA 2F4VB 1PK6C 1TA8A 2BPA2 1UOBA 1DHKB 3OTOB 2IJHA 1GN4A 4DK1A 3BHPA 3P32A 4MVTA 2LGQA 2BP6A 3MBWA 3CU7A 2P37A 3GZEA 5J2UB 2EF6A 2B4KA 2FBEA 2H94A 2HBTA 2DN9A 3LD8A 3H42B 3BI3A 2QDOA 4DR4B 1Z7S3 2O8OA 2OZJA 4QGLA 2WO1A 1U5IA 2QNKA 3CJIB 3O65A 4EN6B 1RJ7A 1NQDA 5C9AA 4TYSA 2VZ3A 4IERA 2H8PC 2R063 3F7YC 2UXCB 4FZ0A 1OOPC 2A3WA 5KC6A 2DFCA 2ZGNA 5BZBA 4R9DA 4K7JA 1VQNV 4HZ3A 4TUYA 3WG2A 3DPRA 5FZ6A 4ES9A 2A9HA 3OFNG 5ACA1 5J36A 1V9PA 1JOJA 1RUC2 3ASIA 3T2PA 5BNPA 5LL6Y 1AF9A 1EZVH 1XNCA 2F95B 2CU5A 2IFWA 3ORJA 1JOYA 4GX2A 4XILA 2RM23 4UAPA 4L8QA 2J1RA 1LOGA 4NHYA 1VBB2 1V6KA 4QWNA 2VZVA 1PGL2 3SPJA 3NRUA 1LHUA 3MYXA 5LK7B 5B1BC 3KT1A 3WR0A 1RTVA 2ZOEB 5FZ4A 2P3YA 5FP4A 5B1AC 2VQFO 1O8SA 4AQSA 2BOJA 2VWKA 4Q4Y1 1SLBA 4CCNA 2Q67A 5H5NA 4HPKA 1XNQO 2XGXA 5J9PC 1NQJA 4LNUB 1MEC3 4LNUA 2ZX3A 3OGIB 1UZYA 3WNXA 5I0TA 3QCWA 1HX6A 2DYRB 4YZ5A 1CIWA 4GQ7A 2QQWA 3AG7A 2BNNA 1SLAA 3N9NA 3H9AA 3ASOB 4MZUA 5F3IA 3PJSK 1C1LA 1K5JA 2PHRA 4JV4A 3OPZA 4XDKA 2R072 2KXLA 3A0NA 3AK0A 4XJZA 3ZYJB 2JDPA 4QX5A 4EKWA 2WN3A 4J7ZA 4IEVA 2WLMA 1PPJH 2ODMA 2FB5A 1WNSA 2GSYA 3VBSB 4CDQC 5E88A 1H2LA 4OQ9A 1ENXA 1LODA 3W9AA 1HB1A 2PN5A 2HWD2 1DBNA 2A3XA 1COV2 5GKAC 4K21A 1N1VA 4KQ7A 3MIFA 4ORFA 2LO1A 1NVPB 3POFA 4EWDA 3SYAA 3M3CA 4KHPB 5JSOA 1GK9A 4QDQA 4KNCA 3VDCA 2P4EA 2IJKA 1GMMA 4DIQA 5IDJA 3HAGA 2FDJA 4GX1A 3I5DA 2ZGMA 2PMWB 3O12A 1ZBA2 3FUOA 3KQRA 2QKCA 3C3TA 5C3OA 1OUXA 2OTJV 1PVC2 1UMIA 2F4LA 3M99B 1KJRA 2VNGA 1NCRC 1W9SA 2VQ0A 1CZVA 1EUTA 1PIV2 1WW7A 1IKQA 4AVCA 3L73H 3CLPA 3UM7A 3JAWB 5FUNA 5CKMA 4LOSA 3ZXDA 1AHSA 2BCCH 3ZM8A 4A7ZA 3ZFFA 4GXLA 3LIGA 1L1FA 2K0GA 1VMGA 4K3AA 3H3UA 5EBLC 3SISA 5D21A 3A4UA 4UI9L 2XR4A 1YIFA 4R9BA 2E7AA 4WM8C 1MQTB 1WWYA 3ECQA 3AC0A 4XOGA 5HCHA 5LGNA 5JMCA 5L7OB 2MHFA 4NWVA 1ZZ6A 3CCJV 3WD5A 3VN4A 2BV4A 4DINB 5BY5A 1XXNA 3LDEA 1BVVA 2FDHA 2V4DA 4OHZA 2ARBA 1VQPV 3WU2Z 3O1SA 2RVAA 2D44A 5FYCA 2PI4A 5T50A 4QPWA 1HNWO 4RQPA 5C4WC 5FXZA 1M4WA 5KR7A 5B2GB 1E57A 5K4LA 1HB4A 2F4VO 1OA4A 2IXLA 3ETQA 4L97A 4FM0A 1N3PA 4LF5B 1R081 2AEYA 1E1RG 1PNLA 4JTNA 3FHQA 2ET7A 4YGDA 5BNNB 3A21A 4B7EA 1SS3A 1K73W 1PIV1 3ZHSA 3WG7B 1WA6X 4FFHA 1W06A 4DRXA 2Z79A 3VDDC 2VBPA 3MIGA 4E4SA 5CFCC 5IW0A 1TZOA 1Z5VA 1M57C 1FOD1 2OCHA 4IV1A 3K5MA 4JI5O 4QX1A 1BSMA 2W47A 1HJGA 5F1RA 1POV0 1N32O 4ONUA 4PT6A 2L6LA 1BE3H 1PK6B 2DCKA 1MR5A 2WO3A 1FXHA 1K3IA 3CE2A 2XHBA 2BGPA 4HT1T 5JR2A 1PMHX 4YWAA 3HWJA 2ARHA 1KD7A 4XBFA 4XFGA 2VMDA 3OF1A 2W52A 2G9ZA 1UWWA 3GXUA 3U07A 3ZN5A 1QJX1 4XDPA 4ZHQA 4LFBO 3H1MA 2Q9LA 1ZZCA 4LXLA 4X66O 3RZGA 4B3TB 1ZRDA 5FLJA 3ZYBA 5CFDC 4IE4A 3I3MA 3K58A 1ALYA 4X20B 1GKFA 4MVZA 1N47A 5LP6B 2ZR3A 2WZR3 1W6NB 1PZ8A 3WV6A 2Q6AA 3NV1A 4LORA 5ACA3 4IE7A 4AZZA 4I2OA 3WNOA 3UCSC 2GC1A 1NE6A 2XJQA 4NHMA 2QFEA 4WVMB 4MTGA 1FFXA 5KA5A 3B00A 3HIFA 5JIAA 1B04A 1TVGA 4AHXA 3ZN4A 2WS93 1FPOA 5IAXA 1IX9A 1XNRO 1RHI3 3GZUC 2NZ9A 4O4LA 1QVFU 2PA7A 2XL7A 4AQYB 5ABJA 2R32A 4BLIA 1UIKA 3E5QA 1HR0O 2QJ1A 3ZSJA 5JVDB 4IGQA 1W2OA 4RS5C 3U4XA 3HQRA 5A7WA 1S4CA 2QA4V 1IXMA 5C3PA 2VZRA 1NLRA 4QNHB 3ZR5A 4LLOA 1XEQA 3M3IA 1LOBA 2IXJA 1ND2C 5FY0A 1IOAA 3IM0A 4OGQB 3KLSA 1TNRA 1RUG1 3WDVA 2BVVA 1LULA 4DY5A 2VZ1A 4COVA 1XNTA 2IWGB 3R4UA 5J48A 1GM7A 2ZQMA 1YQ6A 4EJRA 1UMZA 2EAKA 1NH2D 4LBKA 3J4UH 5LBQA 2R1BA 3CXHF 1XMQB 4DR3B 3K3NA 4NHKA 1Y9GA 5DN2A 4DO2A 3D36A 3M7MX 1R092 2JX9A 1DQ2A 4XBNA 3GBGA 3VBOA 4CS3A 3ZHQA 4YXWG 4EFEA 4F6EA 3N9LA 5FPOA 3BOPA 4OULA 1HNZB 4CU9A 2J1UA 1S0EA 3J7NA 4META 1UPGA 3L75H 4HBNA 5KXDA 3GJAA 4DW1A 5FPLA 4FPJA 1NS1A 3M4FA 2HBUA 4ZXEA 3ILRA 2Q8DA 2P4KA 2ZX0A 1WBFA 4FQ4A 3SPGA 1LOFA 1D4M2 4DFSA 2JE9A 5IUQA 2V7QG 2CV6A 4IETA 4LBMA 3AK3A 5FJHA 2JECA 3OUSA 4O2AB 4C7UA 2J1EA 3DYOA 3N3HA 2WT0A 3WQ0A 4HVQA 2QKSA 1REDA 2JIZG 3IGAC 3CBNA 4CCMA 3CRMA 3IPVB 1QJX2 1ROPA 5A1LA 4JVAA 2QVSB 4GD4A 5FPBA 3K5OA 3L71H 1XYOA 1SQQH 1RL3A 3CJIC 5J7MA 4Q1PA 2ZJCA 5KMGA 3N7MA 4ZI7A 4NIIA 2ZAHA 5I0DA 1QH7A 3WNLA 1DIWA 4CCOA 3DSQA 1YYNA 4L87A 1OCOB 1VBD2 5B4XA 3B9IA 2JENA 4PQ9A 1G8MA 3DKQA 1VP7A 1G6UA 3E97A 2DDUA 3P1IA 1WJZA 1RGSA 3HN3A 4BLJA 3RJ2X 2GV9A 4FFBB 1I7FA 1PV0A 1THZA 1DG6A 2YXSA 3D0JA 1LGBA 3RYRA 4BISA 1STMA 3CD6V 2E7QA 3T0AA 1H30A 4Q0PA 5FPXA 1AR91 2AZ0A 1VQLV 1G6NA 1DQ6A 4I50B 4X62O 3E35A 1OFSA 4I50A 1MPXA 4NRQA 1HRV2 1ZNPA 3UETA 3RI9A 4GCZA 4BE3A 3E89A 3K0DA 2MEV1 2P6HA 3RMXA 2VQUA 5FZMA 2R043 2X29A 1AR83 3EO6A 4XURA 5A32B 3JU9A 3P3PA 2ZDIC 3KZIZ 4UB6Z 2Y6KA 2CL2A 3AG2C 3R05A 2GU9A 1RXFA 2OPKA 3RNSA 3BRCA 4NUBA 4Y1XA 3UO2A 1U96A 4W6YA 4KMQA 5CA6A 2K1EA 3ASNC 4NTXA 4JAUA 1UZ0A 2GMEA 1NCRA 4HNAB 2WLLB 2Y64A 5EJ3A 5IK8A 2YU2A 4LKFA 1O3QA 3ABKB 5JCOC 4LOTA 5E16A 2OW4A 4LE4A 4JQRA 4PLOA 2V5YA 1JX9A 3F2ZA 1J5EO 3VD5A 1PGSA 5CVRA 4M0NA 2R061 5JWPA 4ARYA 1TMF2 4DXSA 4AVTA 5I8TA 3KKYA 1F2NA 3JZVA 1W0NA 5F8PA 4DV7O 4WBNB 1U5XA 3OEAA 2L35A 1PX4A 1LU2A 3KVAA 4F8AA 3K4AA 4A3ZA 4X65B 1UD1A 3J8F3 4LF8O 4X64O 1HQWA 1X82A 5FWEA 3BOWA 2GNTA 3MGUA 3JALB 5H9QA 1EUUA 4AEDA 1NT2B 3LE0A 2QZ2A 1F5FA 1QJY3 2DVDA 3G80A 5FOJB 4J25A 3ZMVA 5HXMA 4GULA 1CP9A 2ZHKA 3I2JA 1IDSA 3LSUA 4W6XA 1FV3A 3MICA 4BM8A 1PO12 3UJOA 3T2TA 2VCCA 4UT5A 3AVRA 3S7IA 2X6BA 2VQEO 4QPGB 1LOAA 4PCRA 1XSRA 5IVVA 3ZDSA 3O1OA 1VBA2 4UCVA 2V72A 2VD7A 1KJLA 4RGGA 4OUEA 4HPKB 4FT8A 2JG8B 4WM8A 3ZFEA 5FZEA 1IVSA 1NLQA 1NZIA 5FZ8A 1HXS3 2B42B 2XAJA 1OV9A 5L73A 5SV8A 4IV3B 1SF9A 1DF5A 3ME2A 2JJ2G 3PVOA 4JI0B 4K0KO 3DTUB 2VMCA 3CJIA 3T4DA 1VMFA 2YPJA 3CEWA 3RYIB 4GX0A 4E8DA 2FTKA 5T55A 4BW5A 1H2GA 4P14A 4AHWA 1F4NA 3VDBA 1H2NA 3W58A 5CNAA 4P9WA 1SZTA 2PY5A 4QB1A 2EZPA 2GP3A 4PELA 4JI0O 4B4PA 1OPOA 4KXRA 3O1MA 4OZOA 3C7FA 2XUEA 5J1XA 1RSOB 3OR7C 3FLPA 2XPJA 2BYVE 4NXMB 1KUQA 1S2KA 1OOPA 5GZGA 2DWDC 3LSSA 2WAOA 1AR63 2ZT9B 1DLCA 4DV4O 5ANQA 4H55A 4PLNA 5F9TA 1E5SA 4J1WA 5IYZA 5IY5B 2Q73A 4B3NA 4JGZC 5CYYA 3W21A 4OLLA 1J95A 1NVPD 1C5IA 1HJFA 1LB2A 4RGAA 2OCCC 2WO7A 3HEIA 4CDQA 1H8EG 3VBRB 1VQOV 2A0LA 5B1NA 2E31A 1QIQA 5IT9N 4COYA 1MZEA 1UOFA 4I0XA 1SACA 2N7GA 5A6ZA 4QT6A 3TN92 3WSOA 4WFAV 4A42A 3VHOA 1ZL8B 2DVFA 1MSDA 4DS0A 2ZX4A 2D3PA 5CA0B 2AGAA 5CBGA 5FMBA 4JZRA 1ZBA1 2IBZH 3PU8A 2YV8A 4IV3C 2YGMA 2AEZA 1Y74B 3PDQA 4MGQA 1BT8A 1NKDA 1O9HA 3TB0A 1B6QA 5FP7A 5IWAO 3H8OA 2HVKC 1RIRA 3T1HB 4YVWA 1S55A 5L19A 2WNVB 3MPPG 3AMNA 1X4TA 4E2GA 1S3JA 2LFSA 3JD71 1GN6A 2D7FA 4EN8B 4M3CF 1IBLO 4XTMA 2WFF3 5H6RA 3A0RA 2JDAA 1WCQA 4GB32 3WY6A 4RL7A 4Q27A 2ZNIA 1XMOB 2TUNA 4YM2A 2A3QA 2PF4E 2Q5ZA 3SJQC 5I0UA 3ZIAG 1Q90D 5H9PA 2CDPA 5T5LA 4AG4A 5EBWC 2QTSA 4RS5A 1UXXX 4ZOLA 3BTAA 4Z1MG 3ETGA 2KKWA 2HEYF 3JCUZ 4IYHA 5C70A 5JPMB 2LFRA 1RUG3 1QHTA 2ZTNA 3ABUA 1QLNA 3WB1A 4XXPA 5FCCA 3ZMNA 1K4CC 4Z2AA 4Y24A 4RAIA 5H2FZ 1EYBA 3VKLA 2VOWA 5IATA 4QD2A 4YG0A 2WDBA 3AYEA 3U14A 1BL8A 1M93A 2IJIA 4XF9A 4HKLA 4NJ4A 4CXXA 1Q8IA 1R091 3POIA 4XIKA 1BLZA 1WA4A 4JYYA 1CAXA 4QXHA 4FLTA 2GBOA 3JALA 3Q8AA 4XBQA 5IYYA 3H0OA 1VIBA 3MUY1 3M3QA 1M56B 2WBKA 3I2FA 1I6XA 1ACCA 2VZSA 1NCQC 3H1YA 2Q7EA 5T5JA 5L7OA 5SV5A 2RMKB 1P49A 1VR3A 1WLWA 1F4MA 3T1CA 3LAGA 3ELNA 3UKTA 1UPSA 3VQWA 4NKGB 4AVBA 3OD4A 4I02A 5DAWA 2N74A 5FZ9A 4YZ1A 3H3ZA 3ZFGA 4M3CA 3ZFGB 4DV0B 3V0AB 2A79B 2LUWA 2YUEA 5C8WA 2ZE6A 4FXGB 2PFWA 1UW8A 4QQ2A 1SQFA 5JAXA 1OUSA 4DRVA 3N2GA 4CXWA 3ZFEB 1YDXA 3IMMA 2PLV1 2VZTA 1IGOA 1PHMA 4IV1C 1EZJA 3FYIB 3SJBC 2R6QA 5KXBA 1HN0A 3PUSA 1BBT3 2P06A 1BHGA 5KX5A 3R65A 2IXHA 2NLJC 1EN6A 1KS4A 4DUYO 4AI9A 5IY5C 5B66Z 5KHKA 2DYSC 5FPRA 2JB4A 1NZCA 3SPHA 1AR4A 3A22A 1W2TA 5DN6G 2Z42A 1UYXA 3BTZA 4XUTA 4PA6A 1IHMA 2HWC2 3UT5A 5I91A 3UT5B 5EZWA 2A6WA 2QQLA 3MD0A 2ZX1A 4Y5Z0 3IDEA 3AG3B 1U97A 1XMOO 1ODMA 1W05A 2XKPA 4GB33 3UGHA 2QTWB 2DURA 4GMP3 4LH6A 1NCQB 4JV5B 2JDMA 2C6SA 4RFT0 4BIFA 4L11A 4I3PA 1UY4A 5J37A 2BBAA 1ZRCA 2PLV3 2ZGLA 3RJRA 4AK3A 2PYJA 4XFIA 2AZ5A 2XJPA 3SQOA 5A3OA 1VBB3 3E5UA 2QBXA 1EM1A 2JD4A 3Q8CA 3TETA 3NAPA 5IJ0A 3ZHTA 3B40A 4JCKA 2HWE2 5C93A 2WZPP 3FFQA 4KWKA 3VBSA 2UWCA 4I0XB 4DR3O 4PF5A 4QPYA 3HKDB 4HN1A 3ZPYA 4GWJA 1XOYA 1CXZB 5EIBC 1GP6A 3N2KB 1KITA 1DLBA 2Q68A 3D8CA 3LB9A 3ZXLA 4AL9A 3FYEB 4MW8A 1K33A 3KV5A 5A7QA 4YARA 4TT3G 1PO23 5LBEA 3AYAA 1M9NA 3WW4A 4FVVA 4R7CA 4R8HA 4BQ2A 4MGZE 2VNOA 1SLTA 2JG8C 1NE4A 2X6AA 5F2WA 2RMU3 2WLPA 1JZ7A 5AVPA 2OT7A 2RN9A 3WDUA 1H8TC 5AC93 2A7WA 1KQSU 4ABMA 1A3KA 2OKXA 2EJ7A 1ZZ9A 3SCGA 3VV1A 3GYDA 3RZHA 1B06A 3JBG2 1S0GA 1RUF1 2B9UA 5FY4A 5IVEA 3VBFA 3RG0A 4D6RA 3ZXEA 1AXZA 3UESA 2ZPXA 3MFAA 1QXRA 1GM9A 4RS5B 5JH7A 4MVRA 4LF9B 1WMDA 2HWB3 1UF2C 1UZVA 4X1KA 4H7MA 1WA8B 1LR1A 5LRSA 4K6BA 4K8RB 3JD4A 2WAMA 3VOUA 3H8UA 4A6SA 1OH4A 1GRJA 5DDJ3 2SLIA 3O0XA 2MEV2 4DR6O 1PL0A 5L9BA 5LHHA 1VMHA 1BMV1 1XNDA 3M2MA 5JZGC 2C5DA 4AEJA 4COZA 1HN1A 3MLKA 2VQEB 4BR6A 3ZMTA 3SYCA 4JGZB 3EMRA 3CWBH 4Y26A 4Z82A 4CP1A 1OA3A 1OURA 4SLIA 3MV01 3NJXA 1W8HA 4WVWA 1WPBA 3ZRSA 1N32B 4LO8A 1SZBA 1VBD3 1HXS1 2XHKA 1AJOA 5BMVA 4YG6A 2JG9B 4XETA 1PGW2 2P17A 3J81N 3T4ZA 2FMLA 4DV7B 4HYOA 2RNBA 5DDJ1 1H6YA 2E3CA 1QNYA 5FPUA 3DPRC 4UV9A 1HDJA 1R1A2 4B1LA 5GALA 3G6BA 3BIWE 3GDBA 3IPVA 4LF5O 4HONA 1SQXH 2P3KA 1M57B 2BERA 4Y20B 3KD4A 3RFRA 2C9KA 1OQDA 3ABMB 1W8WA 2K2SA 3KMHA 2RS52 2NYYA 3O14A 1W6MA 2ZNJA 1SFPA 3MEPA 4RO2A 4FPPA 5IE9A 1QQCA 1RUF2 4LKDA 2GAUA 2VCBA 3AFKA 4X8AA 2YGLA 5LMNB 1MS4A 2WL1A 2CYFA 4HVRA 2MW2B 2LROA 1MZFA 3IIAA 3LNNA 2RJZA 3B5LB 3JBG3 5HCAA 2QQOA 2Y0OA 3ETDA 4LWSA 2XJUA 1W9YA 3RYHB 1N8RW 2YSUB 1R3LC 1R1A1 2BBVA 3UK9A 3PJYA 4LEJA 3BUCA 1VQ9V 1UU4A 1W2UA 4O65A 3GB7C 4NTYA 1IS6A 4MGIE 1GMGA 1WW6A 1WPXA 1QOSA 1V54C 5FNVA 3ABKC 1MQTC 5C7GA 2G38A 2H0BA 1FX5A 2CGOA 3IWZA 4W4KA 3OBTA 5FAXA 2MEV3 2EBOA 2OS2A 1RUI1 2YY1A 3BN6A 5JSPA 3JXSA 1ZWIC 4EQVA 3ZMUA 4DXZA 4XDLA 2HWE1 1Q6IA 5CBLA 1QNMA 4ZONA 2QSAA 1LAJA 1HV1A 1W6PA 3AK1A 2JD9A 3WDTA 5HBAA 4LHLA 1GN3A 5LMUO 3BABA 4YY3B 5K0UB 4DR7O 2JJ1G 4IEWA 4IESA 2OYZA 3CP1A 4Q6GA 1EP0A 3UKNA 4O2BA 5EBMC 4GH4A 5A9GA 3VBOB 2CNAA 5EJZB 3SJAC 4XQ4A 2UUBO 4FPYA 1H8TA 2ZZQA 5A7NA 3RDIA 5GONB 1WCKA 4Q5OA 3X2QC 5C5TA 1X8EA 3NR7A 2HFEC 1W2AX 5LHIA 4FFIA 5BR8B 4NXNO 3OOXA 1OCOC 4R6ZA 3HBKA 3APQA 1JUIA 3G71V 2WAAA 4LBEC 4N90A 5D1IA 5JXHA 5FZCA 1Q82W 4TV8A 2PHDA 4B4RA 3LSEA 3B8NA 5LBBA 3H1LH 4OXSA 1YC61 4X1YB 3V0BA 2QGNA 3VBRA 1S2BA 1W3VA 3LSDA 1NI8A 1KEXA 5CADA 3NAPC 1RP3B 4UVBA 4QPGA 4UXAA 4W8JA 1QJFA 5FV3A 2VPVA 3HT2A 1XBFA 1E5HA 2IU3A 1H1IA 2YYOA 2QDNA 4CCKA 1H2SB 3AYCA 3MUZ1 2KR2A 2CTPA 4XHXA 2RS13 2WWWA 4GKKB 3AMMA 3MIDA 2Y4TA 1U12A 1LU1A 3EHKA 1PM9A 2GMMA 1N0JA 1NAEA 2YPDA 3MHHC 2XWJB 1HLCA 2HWD1 4PBOA 4DV4B 4FVMA 3IN9A 5IFPA 4DXTA 3C3VA 3P5BA 5D8AC 1QQP2 1VJ2A 4J9YB 4H14A 1MS5A 4B3SO 4Q26A 3VLBB 2D97A 3IC9A 5DABA 2PQSA 2E7TA 2PELA 3I59B 3I59A 2P7TC 4XZUG 3RWRD 3I4IA 4E2LA 4BYYA 4XJWA 5FY5A 5IVFA 4N7IA 1C1FA 4YM1A 1UPIA 1BK0A 1N1SA 3CCRV 2Q4SA 4I09A 5J96B 1ULEA 4XFHA 5BV6A 2I74A 4U7OA 4FPOB 3DGTA 2YEVB 2ZEXA 4YSFA 4UW6A 4MVOA 1EAH1 1KDMA 4ZS2A 1S0DA 1XREA 1ONAA 4Z07A 2JE7A 1FMD3 3EHBB 2SBAA 5FO7B 1SQVH 4B3TO 2Y69C 2CTRA 2EIKB 3RGBA 1AX1A 5FMOS 5C4WB 3W59A 3GALA 4AQTA 4J11A 4PA4A 1JHJA 1LUWA 3NNLA 3RYCA 5IJ9B 4C91A 4E4HA 2ZGRA 3WFVA 4FFKA 2RM22 5ERLA 5H9CA 3EXAA 3RZLA 5C8YA 1IPJA 4AAXA 4CUAA 2EXIA 1AYN1 5BPXA 4P9PA 1D2QA 4E9KA 5C8CA 2FDKA 4QPJA 4QIWF 1WLCA 2XBO2 1KU9A 4P9LA 1MABG 5A6QA 3UO3A 5KHHA 1JOBA 4I30A 5J3UA 1BMFG 4YW1A 5JXJA 1SBFA 3SYQA 3SEPA 1ZM1A 4COWA 5JJJB 5LOVB 1RUH1 1CAWA 3FAVA 3WQ7A 3GNEA 3RYPA 5LHGA 5FLIA 1AR82 1FXKA 1GTOA 5LW9A 4DW0A 1UO9A 3WP6A 3LOIA 5ANNA 2DU1A 5DAXA 5K8SA 1YJLA 2E33A 2UURA 1LNQA 1O59A 2WFPA 1COWG 4CCJA 3THPA 1RC6A 1ZA7A 4CDXA 5JIUA 2EXKA 4CDXB 3F7VC 5KXEA 3ZN6B 2F6BA 3ZN6A 1H8HG 4P2ZA 1V6NA 1I3HA 5IVYA 4W65A 2BUKA 4GWMA 2RS12 2YBSA 4D7SA 2XXZA 5JQGB 1SESA 1PD3A 1HNWB 2QQIA 3HKBA 3I2GA 1UL9A 4X8PA 3ACHA 1D7PM 1Z0HA 3B8MA 5B3SB 4WCEV 4AFAA 2WNOA 2FDGA 4QX2A 4KWJA 4QB2A 1K12A 3T2QA 1YQCA 1TAEA 1PMJX 3CCQV 1W0JG 5BUVA 1QY4A 3H1WA 5C6CA 3S57A 2NQYA 2EIJB 3ACFA 3OMNB 1H38A 5EP9A 1BEV2 2VTFA 1RUE1 3HVDA 4KG8A 1QQP1 2Y26A 3RVZA 3CPWU 3DF0A 5FYSA 1I5PA 1XJAA 3PLQA 4Y5SA 2EIMB 1V54B 4HANA 1VP6A 5K1XA 2HLDG 4QU1A 1PIV3 4F6RA 4F6RB 1FJGB 4XF3A 3PIGA 3C3SA 3V64A 3FD9A 4AGGA 4GKYA 4IUGA 1O4ZA 4BHPA 4F3JA 3APBA 3JCZA 1HNXO 2VXRA 2HJIA 3WDWA 4KHPO 4LBQA 1WAZA 4M4RA 1HXS2 3TNQA 3NNGA 4DV5B 1AX2A 2ZMNA 3H50A 4PDWA 3JD2A 3J80N 4E8CA 3OMAB 4EE2A 4H7LA 1XQNA 1I1EA 2BRTA 3IDAA 1VEWA 4RQEA 2ADEA 1REFA 5A3NA 4JI8O 1OCCC 5ITZB 2XG3A 4CEWC 1HP8A 2YC4A 1AJNA 2WJSA 1D0HA 4ZY9A 3ZXAC 4TWTA 1W9TA 2OT5A 1W6NA 5DECA 4XE9A 1L7RA 3OD0A 2JXAA 2WLHA 4HAMA 4GWNA 3SYOA 3NV4A 3FB7C 3LEKA 5FZAA 1IBKO 1S77D 2WLIA 2RS32 2VCAA 3USUA 4JYAB 4O61A 3GHNA 3BCCH 4PLMA 2HHHO 2W92A 3B2EE 5FJKA 2CY6A 1I08A 4HFSA 3NNFA 4IW3A 5AC92 4JKMA 4NPLA 1EV12 2RV9A 3S5AA 1DYKA 2ZGOA 2B8MA 4BA6A 5ISLA 3NAPB 1OVSA 5IJ0B 4PDWC 4CP9B 2ORXA 2Y6FA 2GC0A 1YFUA 2WT1A 4FPKA 2ZKOA 4V1PA 4J7JA 1ZRFA 4A45A 4DYLA 3QOPA 1N1TA 1ZAUA 2IXKA 4LIVA 3PJQA 1NY72 2JRIA 3SNMA 4FPEA 1AR92 2VECA 2PYTA 3AKSA 1M06G 2O1QA 1GFF2 3IZOA 4TXWA 2UUAO 4D8MA 4XFBA 2HEVF 2QCSB 3R4DB 1Y76B 1U0AA 4DXRA 1XMQO 3ABTA 3ZYFA 4XTPA 4FO9A 3POBA 1FOD3 5EYYA 4CZZA 2B39A 3BODA 3FN9A 4OHXA 4CBCA 4FK5C 1JHNA 5GLZA 3M3OA 4YFZA 1OH3A 3OJBA 2DJVA 3TXSA 3FBYA 1EAH3 5FBJA 4JYBA 4AEKA 2R16A 4CDUC 3JSNA 4DO0A 3IJ4A 2UXCO 3UGFA 3VL8A 2RJLA 2EINB 1BQPA 3AX4A 3ZFFB 3TWIA 4FM1A 3BB6A 2KSDA 1E5IA 1IQDC 1J3QA 2BTVC 1COV1 1US2A 2RE9A 2AXTZ 3T0DA 1MG1A 1SC5B 4LITA 3VHRA 2A7AA 4LBQB 3SJCC 2QKAA 3ZN0A 2DW4A 4AQYO 4QQLA 4X88A 2QTOA 1O4TA 3HKCA 5BXXA 3FJSA 3VKOA 4Z92B 4RHV2 1XNRB 4RA0A 1D4M1 3IIIA 4HOOA 4QHZA 4XF1A 3FX7A 4DUZB 4Q4V2 4X89A 4KL1A 1SQ4A 4O4HB 4LULA 2QWOB 1R1A3 1CR7A 4J10A 4ISQA 3CMGA 4C0HA 1RM1C 3S5QA 2YIBA 4BIZA 2Q8VA 2QWNB 2VOTA 5L3GA 3IBMA 2DVAA 4OX9O 4X66B 4DV6B 4LC1A 5C9AC 4HG6B 4NIDA 2CHHA 1W2NA 4P9XA 1IURA 1XL4A 2GN3A 2Y69B 3N9PA 2X5IB 1SPPA 4NOTA 4AW7A 4XUQA 4JI6O 3JASB 4NROA 2WLQA 3BU7A 1H0BA 4JC1A 4WBNA 3PMEA 4B3MB 4JASA 4JI4O 4OVEA 4WFHA 2HWD3 4UB8Z 5G04L 2FL4A 1PK6A 4Y22B 3CSXA 2GNMA 1IQAA 5BNNC 3DGEA 1W9FA 3L74H 3FB5C 1W39A 3OPWA 1BZWA 4PDLA 2ID4A 3DEMA 1Q86W 4ZU7A 2BFUL 4Y20A 5FO9B 1V55C 3SYPA 1BMV2 4HN0A 2A6XA 3E8HA 1RUE3 5D8AB 1KGYA 3WB2A 5B3SC 1JS9A 1QKQA 4LBJA 3AKRA 5A70A 1AP6A 3VZNA 2EIDA 1L8DA 1EY2A 4D7TA 3RVHA 2ERFA 2E51A 3ON7A 4I4TB 1AI4A 1QU0A 3G67A 3LIHA 4DV2O 1US3A 2GH8A 4AGRA 1AI6A 2CH7B 1JH5A 1KDKA 4CH3A 3CEIA 4CZSA 3OEBA 1I5ZA 4AILC 4CTEA 1X7NA 4CS4A 2GN7A 1X9PA 5JXIA 4JQTA 4H3WA 1AYN3 3SCHA 4UFJA 1RHI1 5JI9A 4Q4Y3 1V6IA 4ZHQB 3HR0A 3C7GA 3VKMA 4YZ2A 2EX3A 2VOVA 3S6PA 3O9OA 3RSJA 3VBFB 3ZRXA 4BPZA 4IEQA 3AKPA 4K9SA 2D43A 4MYEA 4MSWC 2G4IA 1UXZA 2UYBA 4KI5M 1DTOA 1DU3D 3EBRA 2A71A 5C8CC 2C0ZA 4DK0A 3A8TA 1ZA4A 4QM8A 1B09A 1S5HC 3JD3A 1GQHA 2ARAA 5IVBA 5FZ3A 1YUDA 5D5QA 4RUEA 2J22A 2R042 1AYM3 4OPHA 4EB6A 3H1JH 5LA0A 3LSQA 1LOEA 5K0UA 3THTA 1EFRG 5IAVA 4LH7A 3KSCA 1XOUA 3N7LA 3N36A 1OHFA 2GSMB 3CRAA 3K75B 2DCYA 4MW3A 5CKNA 4PV1B 4LF6B 2GH2A 3OEHG 4JGYA 4D6TH 4B08A 4JRLA 5HV0A 5GONA 4FLYA 3M1HA 1NBMG 4D0QA 3GM8A 3QBQA 3THCA 3WW1A 5DAQA 1RXGA 1IZ3A 1AL22 4IV3A 2ARCA 2RDNA 1NX9A 1Z2GA 2J1AA 2CE4A 3CCSV 1R082 4IEXA 1JMUB 4ZKIA 4UOJA 3OTFA 2HKXA 1J1LA 3LDRA 1H1AA 1UKGA 4IDZA 3T09A 2WWUA 2JVDA 1I94O 1BYHA 3T4HB 1EV11 1GOHA 3ZMSA 3W7SA 1LHWA 1DGRA 3ZXKA 3J8F2 2QM4A 4DR7B 3AB0A 3TAYA 4YY3O 1N0NA 1OOPB 1XNQB 1T6BX 2E53A 5FO8B 1GZWA 2WINB 5IK5A 4JI8B 3E83A 2XVLA 4Q4W3 3ZLIA 3K06A 4BQYA 5KMGB 2ZEYA 3WF0A 5K7PA 2WO2A 3FBMA 1HDKA 4E2SA 5F39A 2JIGA 3Q8FA 5KHGA 4NRMA 5ABJB 2Q30A 3BTYA 3D3QA 3V56A 2QQMA 4XHBA 1JPXA 1VBA3 3JAWA 4BK5A 3OGJA 4NN0A 1BJQA 4QKDA 2JDNA 3JB8A 4I55A 2OIEA 1DLLA 2TEPA 1K4DC 3KCCA 4IEYA 3KWVA 2IU0A 5CKQA 3GWOA 2GDSA 4YM0A 4XW3A 4TTGA 2M6YA 1N3QA 2VL4A 1VAMA 3ZFEC 5A3UA 1TUBA 3KHCA 5BNQA 2HVJC 1Q8QA 4YIPA 5F7UA 3D3AA 4ZI7B 4C0BA 3WNNA 3RZMA 1GR3A 3W5MA 1PM4A 2OQ6A 3S30A 1W8TA 3AFGA 3V0AA 4R4XA 1GAXA 4TQDA 4R4ZA 2YI8A 2Z0AA 1YSCA 4KG0A 3VD7A 3RPQA 2AH2A 4G3YC 2HWF3 5C5UA 2DUQA 4U3FH 1TMF1 4CVUA 2V73A 5FL7G 5F5AA 1WUVA 3SLIA 5FMOL 3EB7A 2WYSA 4WFGA 3RZKA 4YVSC 4FPLA 1CPNA 1QEXA 1ZBE2 4X1IA 5FUPA 4X1IB 2VW1A 5DUVA 4ZU4A 3HPLC 2P3IA 1CZSA 3ZRVA 4N9IA 5FXWA 2XVKA 4YW2A 4DXWA 2X0LA 1JODA 3WG7C 1LTEA 4CDWC 1R6KA 4CCLA 2E9QA 2R9AA 4UFLA 3FUQA 4AWDA 4GKJO 1FS0G 1AB3A 3N35A 4DR5B 2C24A 3AG4C 5FPZA 1VRH2 1SEFA 3GF6A 4MHUA 4PI0A 5FFOC 2OX0A 4P5YA 1ZVFA 1OBNA 4H37A 4IT5A 4CH6A 4QMAA 5EC2C 1VQ6V 1PGL1 2OZ6A 2WS91 4YW6A 3L9DA 1AJKA 1SKVA 4P00B 2LS6A 1K7DA 2XAFA 1SQBH 2HYKA 4JHZA 1XNAA 3CMEV 3B69A 2JDIG 3U1XA 3ZHUA 3VD9A 1IPKA 4DR6B 5D5PA 1F15A 5FLHA 4XJ8A 4YZ3A 1SLCA 4V2WA 1OXCA 1G9CA 2ZHLA 5DG2A 5J2TB 3MIBA 1JQ0A 5DM6V 1XYPA 1RITA 3ML0A 1F31A 1OD5A 2DU0A 3VBHB 3VBHA 3STLC 2UXNA 4A7KA 4L99A 1IPSA 4LR3A 1X50A 3J7MA 2ITCC 1LEMA 2WNVC 1CGPA 1E1QG 1C4RA 4FFGA 3ZYGA 3JARA 2ADPA 3KG2A 1DQ1A 3O1RA 1H1MA 1Y4MA 1DGRN 5L9VA 4FQZA 4Q1RA 3JATB 1XUQA 2YMZA 5A1AA 2E6VA 1V00A 2PYLA 1S0CA 1O3RA 4D94A 2OCCB 4X6RB 1MNGA 1AVMA 4ZIBA 3OEEG 4NAMA 5GLUA 5LY2A 2RS51 1ZUQA 5GTHZ 2IH3C 2G9GA 4GMP1 1ND3B 5IYZB 1POV1 4DQAA 4K8ZA 4LK6A 2DF7A 3K03A 3ZVXA 2BSKA 1F4HA 4AR2A 4GKKO 3VUOA 3BEHA 4YIOA 3MLJA 1DGWX 1BHAA 1OKOA 2LW7A 5JZGB 3IDBB 3SPIA 1YJ9V 5JZGA 1KD1W 1R3IC 4UUJC 4XQWA 4QE9A 4EYUA 4YHHO 4N53A 1VLNA 4PBPA 3R4SA 2VOKA 2PHTA 2OYQA 4H2AA 4HK9A 1L0NH 4W4LA 4KU8A 1COV3 1K97A 2DFBA 1HWYA 4TQFA 2ILMA 2AHZA 2R9IA 5FREA 2PI5A 4F7ZA 1RUOA 3CRQA 3NVCA 1O5UA 2LTNA 3N9OA 4YM3A 1Z5WA 4FPHA 5BNPB 5FYYA 3IB3A 1ZBA3 1LCLA 5AFEA 2W1WA 4HKOA 4A7YA 2CTVA 3ZOIA 1QBZA 1NH2B 3JAMN 1TE1B 1AJQA 5FP3A 4YVWB 4LBQD 4Y1UA 3M7AA 5B1OA 1PNMA 2AREA 4DEVA 4NXNB 4J80A 1YF2A 4DR2O 3RZJA 1MS9A 4LKSA 2FMDA 4M3CB 5C71A 1Q6HA 5A6XA 3FZ3A 1W28A 4DOUA 4E27A 1VBE1 1AP5A 1OCCB 2DQ0A 1ZL8A 4QPGC 2P6CA 1EN5A 3BA9A 2VUAA 1PZ9A 2VZQA 3UYJA 1HV0A 1D5NA 1TQ5A 2ZM6O 3QVNA 4QAWA 4LF7B 3ZSKA 1SMVA 2RJ2A 3KT4A 3MF9A 3MPBA 1ND2A 2ZGKA 4Y1ZA 1XI1A 3ZYRA 4I0BA 4XIOA 3WINE 2YXHA 1JN2P 1GQPA 1JJOA 1H9WA 4XF0A 4DRXB 4LBOA 2ATFA 2A6YA 3FE5A 3JARB 1J3RA 4Q4V3 4UYBA 2XQRA 5BY1A 3KB5A 4Q2FA 3JBG1 1SDWA 1SBEA 1RM1B 2GZWA 4B1MA 3WW3A 5CISA 4DUWA 3SPCA 1VPHA 1GLHA 2GC2A 1RSOA 4NMIA 3BYWA 2OWOA 1S0BA 3URFA 3NWKA 1G9FA 1R1BA 4ZS3A 1YRZA 1QJU3 3OBRA 2BU9A 2VBBA 4Y3OA 2QQVA 5DUWA 1YIPA 3H1HH 4IYIA 1RUI2 4B7KA 4QJFB 4U2AA 3S3XA 3WDXA 3ES4A 2GALA 1W0OA 2UUCO 1ULDA 2UU9B 1VBD1 1X36A 3VBUC 4ATEA 2ZMKA 3NKTA 2DWEC 1HRI3 2WIIB 1FAFA 1JU4A 3K59A 3JQXA 4UBGA 3ZFFC 2GHYA 5LP6A 5A6YA 5LMNO 3VZLA 4QPIA 3JB4C 3LF7A 1CAXB 5A7SA 4D3WA 1NCRB 4WVMA 3V65A 4OI0A 2CH7A 1OSGA 5T5PA 1RUE2 5C3SA 1Z7S2 4NE9A 4EN0A 4BIOA 4LJHA 2QM7A 3ABLC 3TJTA 2FDIA 2ZGTA 3FB6C 3FLRA 3LDCA 1GUIA 2R062 2BGOA 2EIEA 2JJ6A 3QACA 2LQTA 1YHQV 2YIBD 3MZHA 4MGTA 3CO2A 2WZR2 5JDBA 4JI2B 3T1HO 3WF1A 2PTMA 5FRAA 4JZGA 1AROP 2J7MA 1MA1A 5L9RA 1GNYA 2YXYA 1Q5OA 1NXMA 1AYM1 4B8EA 3K04A 5JXGA 2A6VA 3DCQA 4ZBMA 2W46A 4N23A 4AEDB 2EJRA 3RMYA 2BNMA 4NYKA 2FKXA 3CCVV 5B5EZ 1XHZA 3MIHA 5E6HA 4W50A 1ZZ7A 2YUAA 4P9YA 4C1WA 3ZSEA 3T08A 4BZ4A 5FZOA 1VF6C 4JDMA 3B93A 1JYWA 4ZKTB 3NW4A 2RR13 1QLEB 4P9IA 3UQ8A 2BVBA 3K77A 4AF9A 3H9VA 5EIYB 2NPIA 1NOVA 2D6OX 3AYDA 1K9MW 3VQVA 1K5SA 3AXDA 4P9JA 4YLZA 1WCUA 2NMNA 3PUQA 4NVPA 5DEDA 1VF7A 3NV3A 2PHWA 4QHOA 4MG2A 2WNUB 3HB3B 2RS53 1NA1B 4DV3O 2B45X 4P08A 3F5WC 1JZ2A 1M5IA 3O7OA 3WQ1A 2BNOA 4O4JA 2E63A 4CE8A 3IKWA 1EV13 2RJKA 1ZX3A 4BAYA 5FXXA 2VBDA 3DN7A 4UFZA 3WP5A 1BQ0A 1TME1 3QNEA 2Q8EA 1ASJ3 3VZOA 2B5UA 4ZZ5A 5LGUA 4U36A 2DTYA 1LUVA 2IJJA 4HLTA 5LA6B 1JXNA 5BNPC 2VULA 5FZ1A 1AILA 3POGA 2EINC 5LA9A 4N43A 1LECA 3UJQA 2YIAA 4UCRA 1FFXB 3CZUA 3OUFA 5L3DA 3AL5A 2VR4A 4TN7A 2A75A 4CU8A 3AKTA 3V0BB 4QKNA 4BQ3A 2EILC 1UNBA 1VBA1 1JJ2U 5F2VO 4FLWA 1TG7A 2WNEA 4AEDC 4MTFA 4MXWB 1D2DA 1ASJ1 4LHKA 5FR3A 1QJX3 2A70A 2JDYA 4XFAA 4LUMA 4BK4A 4XDQA 1FPN1 1KYOF 3CJHB 3CJHA 2VGDA 4I55B 3F5TA 5C8CB 4N43C 3KM5A 3RS6A 3I2HA 3OBZA 3CDZB 5FOBB 4KWLA 2W2IA 1LNSA 3OR6C 1VRBA 1KKDA 1C8NA 5LOVA 4AI0A 3MV11 5CG8A 4DV3B 1NU1H 2P34A 1BQZA 4JV5O 2W94A 4U3JA 1FXKB 3C2UA 1CD3G 1SG3A 2Q7GA 3OT7A 4JYCA 3WHTA 3FMGA 2KG7B 2PQQA 3KV4A 3B77A 1J5EB 4I7ZB 4EFBA 1TMF3 3OGRA 4LF4B 5LP6C 5AVAA 3CHXA 4UWDA 2CTQA 2EZOA 3J7LA 2VVDA 1EPWA 2DMXA 3VHPA 4RR3B 3O5SA 1GNHA 1ULGA 3B4SA 4S2GA 4CEWB 4CEWA 2UY9A 4MS2A 2ZXQA 2Y6LA 1WCSA 1XU1A 1GV9A 3A7QA 4UF0A 3E6CC 4BXSV 1NYWA 1ULOA 1S5LZ 2IVIB 1RMU3 4EZHA 4L8JA 2D3SA 3VDAA 1G8WA 1BGYH 2JG9A 2ET1A 2C4XA 1PVC3 2WNUC 3PHMA 2Y4UA 1FMD1 3A2FA 5AC91 4GKJB 2WC2A 2XOKG 5KC5A 2NP0A 4NTWA 3EYPA 3T1YB 2JDKA 4O2AA 4BIUA 2E26A 2Q0OC 5FY7A 4UXNA 1ZBE3 1NUKA 4RD7A 4XFFA 1VB4A 2HWB2 1XYNA 5IYBO 5FYBA 3AG4B 1AL0G 4UFMA 2HJDA 4J7KA 5IVCA 4X1KB 2XWBB 2V5DA 5E1RA 5LEJA 4ARXA 2E75B 3AXEA 1AL21 4WM7A 1A8MA 1SRYA 3AVSA 3MF6A 1T2XA 2YICA 3A0HZ 5IJRA 3ZMZA 3WG3A 5JI7A 5JSRA 1V70A 3AJYA 1OI6A 1RVF2 3MFCA 4ZU5A 5JLVA 3POSA 5CBFA 1FAYA 4FAHA 1ST8A 1O4YA 2GUZB 2ZGPA 1PO11 2IW5A 1Y6XA 1OKQA 5FZGA 1NR1A 1CWPA 1JCHA 1V6LA 2VRZA 3DL3A 2Y60A 2ORZA 3BIEA 4MVUA 3DC6A 1K8AW 2HEPA 3L72H 4FMTA 1N34B 1OC1A 5EZYA 4XC9A 4K8XA 4N8MA 2EXHA 3K48A 1XSQA 3JYCA 2ZDIA 3CJXA 3H8RA 5EWSA 3LA7A 4IQPA 4XAAA 1OLME 4NR1A 1RUD1 1K5MA 1OJHA 4AFBA 3VBUA 5GZEA 3D6EA 5CB4B 5LA6A 4CEYB 2IUWA 1FNYA 4F4LA 4FLXA 1WP8A 1R3JC 1R3KC 1WD4A 1YEWA 3BAAA 3DUIA 4DZGA 1O91A 4OCTA 1HKDA 1FXKC 3USUB 1UYPA 2WZ8A 3OAAG 1HNZO 3CQOA 1DGLA 3VL9A 3EJKA 4FI9A 1K34A 1C57A 3GWKC 3KHBA 2LM3A 2ZXWB 2RDCA 4N21A 2DCTA 4A3XA 4TZDA 1CAVB 2X8KA 2DV9A 1UZZA 1UKRA 3ETPA 1UMHA 2C2AA 4CDUB 3VBRC 3N7JA 1QR8A 4KBBA 4N53B 2X05A 5C3QA 3ZKYA 1D0GA 4WFEA 1DP0A 3CXCU 1J1TA 2ZACA 4SBVA 4UV8A 4CUGA 2WFF2 4JI7O 4CRQA 5JJEB 4IL6Z 5FDBA 5ACA2 4MGKE 5DQ0A 4NO4A 4J42A 1W6OA 1GKBA 4OHYA 4K20A 2WS92 1VIWB 2Y0PA 1VBE3 2QQUA 4JRAA 3AZYA 1W3XA 2WNVA 2NN8A 1SQGA 1L7QA 5A33B 1VQ4V 2ZZJA 2DVGA 2D98A 3CCEV 2ZABA 4HSJA 2DVBA 2Y6HA 1D4VB 2VE1A 2WA3A 5AG2A 3CNAA 2ATKC 3ITQA 1HQLA 2WLJA 3TBDA 1UOGA 4NWWA 2VCMA 1MS1A 1H2MA 2F43G 3UKVA 3GCXA 2RDQA 2VTXA 4J41A 4BQWA 5EK0A 3KV9A 1K5MC 4UVCA 2ZAAA 4PJ0Z 1DQ4A 2WSVA 4PIXA 1E79G 3G7DA 3OSDA 1JYXA 4FP3A 2D6NA 1KB9F 4AAPA 1C8M1 1VQ8V 1YJNV 3PNAA 3D36C 2VAUA 3E8FA 5EIBD 3I55V 1QJY1 4IEOA 2VTXJ 2A6ZA 3W5NA 3VDDB 4AFDA 5KWRA 4AQ2A 1SLLA 1UU6A 2J1VA 5LWBA 4Y4YA 3TYJA 2W5FA 4EZ4A 4BCUA 1QJU1 2DUOA 4Q20A 5IJ9A 2XH6A 5A2QN 3W7UA 2QZ3A 4Y5TA 1C3HA 3PURA 4BQ5A 2EICA 3RWKX 2A06H 5L3FA 1I5XA 4Z2WA 4OPAA 2VJXA 1GO3F 3IAYA 4DV1O 2JWPA 4CDWA 4CDWB 5EC1C 4QGPA 3ABMC 2Z5WA 2YFZA 2HR3A 4WM7B 2ZD9A 1UOJA 4W6WA 5EHDA 4CC5A 3NNMA 2Z4FA 1OCZB 3ZRWA 4COUA 4Y33A 4MTOA 3H01A 2XQXA 3OBAA 3RYKA 1W8ZA 4LF8B 4WZCA 3E22B 1VARA 1H9PA 1OQ1A 2DOSA 5F3EA 4GZ9A 2BGCA 3VBBA 5LK5A 5C4WA 4Q4X3 3LCPA 2CWSA 2WQZC 1NTMH 3IC7A 4UW4A 1X9TA 2P5OA 4OQ8A 3FC0A 1ZYBA 3QO5A 1PM7A 2B7YA 4MSVA 4M3CE 1O6UA 2JG9C 1B35A 3K51A 1B35B 2YI9A 3HN1A 4ISRA 4XUNA 1S1AA 4NRPA 4TV9B 3JD1A 1IG3A 2CGPA 3I97A 1WW5A 3AM2A 3S3WA 2CWMA 4X9QA 3E8GA 5EV7A 2W0FC 3LEIA 2P5BA 3MO4A 3FAVB 5FY9A 1YHFA 4L9BA 1OA2A 4JI6B 1SA0B 1IXBA 1R6TA 3K0GA 4GZRB 4EEQA 2HWE3 1R64A 2HWC1 2QWPB 3U0ZA 2W1UA 1SDDB 1BBT2 3K2OA 3RN4A 4HL0A 4MLOA 1QGLA 4DV6O 4A2UA 3LQCA 3J9SA 4DR5O 1AVBA 1U5YA 3J7AU 3S7EA 3FLTA 4IE6A 3GHMA 3WNMA 4ZOLB 2PXJA 1IBMO 1HRV3 4L92A 2QQJA 1GWLA 4X62B 1WBLA 4A41A 2UXBB 4OUMA 3AL6A 1OT5A 2WQ4A 2UXDB 5FWJA 1K42A 1XU2A 4GJZA 2AACA 1A32A 2LJ2A 3SDLA 1JZ3A 2XB6C 1K92A 1YXWA 3H1KH 1JBCA 5L3BA 2ADDA 2O57A 3K5NA 5FZIA 3LWCA 2VY0A 3NO8A 1DZTA 1JMKC 1G9BA 1ZRIA 1HIXA 5I0RA 1M4UA 1Y9QA 4RHV3 1KFXL 4QXBA 4AHYA 5J09A 4JI1O 1H4GA 2UXXA 1YI2V 1VMJA 1WMFA 4WVZA 4AFCA 4F83A 2AHYA 3TEYA 5LYJA 3QD6A 3LUTB 5A7OA 3HD8B 4FXKB 1Q43A 4XEZA 2PAKA 3ETEA 3FB8C 1UX6A 1CZTA 4IE5A 2GTSA 4AI1A 2HJFC 2YBPA 3ICXA 4WV8A 3MIEA 2Y34A 5FLXN 3H7JA 2YC0A 2WA4A 3WT3A 5JOYA 3AKQA 1Y9MA 3AG1C 4U7NA 4FTEA 1D5AA 1S0IA 1Y67A 1PP9H 2K9PA 1VF5B 3PVNA 3OE7G 5A3PA 1V6JA 2VZPA 1XDCA 4XUPA 2UUAB 1OVPA 1J59A 3WXPA 4DR1B 5EYPA 4AFMA 1GWMA 4IL7A 2ZGSA 4XACA 2WABA 1ZRRA 1QJY2 4TV9A 3OCPA 4CS2A 2JICA 1YQ2A 3WB0A 3ZIXA 1BVP1 5FMCA 1OCRC 3LDBA 3RWNA 3LA2A 1UZWA 4ASLA 3AZXA 5FMDA 2LP7A 5ITZA 3G4SV 2XDVA 1NG0A 5CA1A 4I9QA 1ZZ8A 1FPN3 3WZ1A 2KB1A 1A78A 3HPNA 3ZKUA 4ASUG 4DR1O 4Y1VA 4IGGA 4QX7A 5JOZA 4FOQA 2RS31 1I9RA 1VAKA 2HKOA 2VM9A 4LKEA 2EULA 1PZ7A 4LFAB 3D5OA 4PF1A 2EAAA 5IT6A 1JVMA 2A1XA 1ENRA 1MSWD 1CX1A 3T2OA 1F5JA 4JYAO 5DZGA 3R66A 3LEGA 4P9GA 4EB6B 3OUHA 1LOFC 5L36A 1ULCA 5DDJ2 4ES8A 2I2SA 4GAZA 1AR81 3SCFA 3B02A 1BK1A 5DPNA 1H6XA 1GWKA 2ZX2A 4C1XA 2Q8OA 1AR1B 2IM9A 4QB6A 4MHRA 2WZEA 5F32A 1UJWB 3JASA 2RQ6A 1WD3A 2A3YA 4K1YA 1YIJV 2CDYA 5FUIA 5CIRA 4S2HA 4QPKA 1W9WA 1QCEA 3TN91 4XUOA 1SFYA 5IYDO 5BYNA 3HKDA 4JTOA 3VBOC 3QO7A 1FI2A 2VZOA 1LJ7A 3HQUA 1W8FA 3CF6E 3CKHA 3M70A 4IHJB 2F1MA 2OIIA 1LR5A 3HMYA 4IEZA 3WLUA 1TEIA 5A3WA 5KUKA 1ZLZA 2O14A 3OMIB 1WMEA 3OTOO 2LW8A 4KH9A 5DG1A 3ZX7A 3NSTA 4FLUA 1S0FA 4FPGA 4N7UA 2VG9A 4PA9A 2WPDG 4QGMA 4UVAA 3H3LA 2D2CB 3OUJA 4H33A 1C28A 2IXIA 4QPIC 5FY1A 5JOWA 2UXBO 1W03A 1FJGO 5FYMA 4Z8BA 1PKXA 1ZBE1 3LFIA 5K0UC 4I4TA 4K35A 5JVVA 1H8TB 1F4AA 1GU3A 4HSLA 4LLFA 3MW2A 1CQ9A 5DMYA 2E5LO 1BS3A 4CCCA 1GZCA 3CCMV 4YW4A 4C8DA 4FOVA 4LFBB 1P8JA 1O5LA 4OHVA 1RB8G 3B09A 3THOA 4O4LB 3JD0A 3JD72 1S0VA 5K9YA 3NJZA 3O0WA 5FNVB 2VUDA 2E32A 1QLEC 4AQ6A 5C9AB 3MHSC 1YCIA 2XVGA 4LIUA 3K46A 2XT9A 2P1BA 3TRSB 2WLNA 4OI1A 1BHBA 2KG7A 4WFFA 1YXBA 2XLAA 4XVHA 4OI4A 4XDOA 4QDSA 3UNPA 2XOMA 1KMIZ 4FBFA 1U5ZA 1CPYA 3TXQA 3O1PA 3GVMA 3BGAA 2ZBJA 3IT8A 3PMSA 4KWUA 1CX4A 5T52A 1W6PB 3ZYHA 3ZYPA 1CONA 1FOD2 5EZYB 4YGCA 1RUG2 4PDMA 2OTLV 1RUH2 5I8YA 3SH3A 3K3OA 4D6QA 4ZPIA 1J58A 4FAGA 2X5IA 5BMVB 1RVF3 4XMIA 4YVSB 1MEC1 2V4VA 1VB2A 1J84A 4P02B 2QQPA 1N36O 3OM3B 3N9MA 1YFYA 4D7YA 4AI8A 4YVWC 5F2SA 5FPAA 2YBKA 3AP5A 2ZHMA 2CUGA 2H0VA 1WCDJ 4CP0A 5FZDA 2RCVA 1GQGA 2CTWA 3LGRA 2FCTA 4B3RB 2DCZA 5GZCA 5J2UA 3OPTA 2HWF1 1MMMA 4CSWA 4XYXA 2F93B 2EIBA 2RDRA 3L2HA 4O4JB 1W59A 4JPRA 2B46X 2K46A 3AP6A 3ALQA 3PVBB 1CJDA 3AZWA 3JUUA 3N9QA 3ZHVA 4WM7C 1KECA 5H9RA 5I0SA 3OGGA 2VMFA 3IFXA 5D8AA 2YFUA 2BDRA 5LCWL 2VOXA 1DF0A 4YFWA 4JZ2A 3I3EA 2R0HA 1MS0A 1LKNA 4ICGA 3WNPA 2BTOA 1DGSA 3BU0A 5IYCO 5CA1B 2WUHA 3NKGA 2CAVA 4UW5A 5TSWA 4MT8A 1POV3 4Q4W1 3JCIA 4N43B 3EQEA 3WNKA 3KQ4B 5KUMA 3ILNA 3PUHA 2B5HA 4JAAA 4LCUC 4FLVA 4MVSA 1GYKA 3SHRA 1PX3A 3B3QE 4GUNA 4DUVA 4PDWB 4QGNA 2VW2A 5LGTA 1Q8SA 2VW0A 4CDQB 1BCCH 4X8NA 3GCWA 1NKGA 1MACA 1WGPA 1M1KW 1T5EA 4JX0A 3MW3A 1Y66A 1SPPB 4K8FA 1KFUL 1KC8W 4G27B 2QUOA 3I2KA 4UCSA 1K5MB 2VS0A 4MGYE 3I56V 1QOOA 2VNRA 4C90A 4LBLA 3B7MA 3THDA 1DF4A 2R49A 1SERA 4J6GA 1WLEA 1GZ9A 4LO4B 1SCRA 5FPVA 5FKBA 2P4VA 4YGEA 4FPCA 4LK7A 2QDRA 3N7KA 2ZCEA 3ZPOA 3MHZA 5DZEA 3VZJA 3WUDA 2WSUA 3SKJE 1UU5A 4RYDA 1JYVA 1P84F 1UY3A 2FCUA 2XAQA 3ABZA 2XBO3 2TBVA 2CDOA 3WW2A 2R071 1QJZA 5BNOB 4GH4C 1NY71 1DGWA 4LFAO 1V6MA 1Y43B 3NQHA 2ZIMA 4O2BB 2JIJA 3I2IA 4NPMA 4R50A 2DQ3A 3ZR6A 2YHJA 3FX3A 5FP9A 3P6BA 4A6OA 2JEXA 1O7FA 1R1ZA 2QWRB 5DXDA 4I9WA 1UAIA 1N1YA 4UCTA 4INDA 3Q4HB 1K3EA 3RI8A 1AI5A 5BR8O 5DZFA 3G6EV 3VB9A 1QWRA 1QHDA 4XDJA 1FMD2 4CUCA 3N4MA 2AUYA 4PIYA 4AVVA 4LNVA 3LPFA 4MV2A 3FHIB 4Z1VA 3ASNB 1W04A 4URTA 4OFGA 4O4IA 5GLVA 2E74B 4QXKA 1W6QA 3MI8A 4JTCB 4Q8KA 3ZMOA 2I45A 2W0XA 4Q0SA 4TUYB 2ZE7A 3LDKA 2E76B 4EN9B 2GP5A 4QQHA 3IAPA 4CEYC 3LFMA 1URFA 5IK4A 5C33A 5LMUB 1HB3A 2JS5A 2BE3A 5F6KA 4FTBA 3E1F1 4OMDA 1XE8A 4DR4O 2WQ8A 4CUBA 3HKCB 3K79A 1RUJ1 1WZXA 2RM21 1AX0A 4CDXC 4LA3A 4AXOA 1IS4A 1KS5A 3KZ4C 1FYUA 4H13B 4YVSA 4DV5O 1TVKB 5CFDB 3ABLB 4QKFA 3U4SA 2ZMLA 5GZDA 2YXLA 3WP3A 1RPRA 2VXJA 1VE0A 1HNXB 1L0LH 4JTDB 1US6A 3SR2C 5FQ0B 1I5YA 2BEOA 4QQPA 3I2DA 4LPLA 1IBMB 1N33O 2HP8A 3NMBA 3LKJA 2F23A 5LASA 3T1MA 3POYA 4ATFA 1OLRA 1KQRA 2ZA9A 4FCAA 1FATA 1CESA 1JFFA 3U37A 1R083 1QNWA 2VZUA 1FFTB 1TUBB 5CEHA 3EVKA 1O3TA 3ZSMA 3VBUB 2YB7A 3BFRA 2QEXV 4LO7A 5FXVA 4R9CA 1W99A 3HJRA 4I01A 2PHLA 5A32A 1ENVA 1N4CA 5KHIA 2HH9A 4E4EA 4PDVA 2JE8A 3PU3A 3SITA 3G6JB 1HW5A 2HEWF 4RQPB 4ASMB 4QHBA 3LNMB 2VQTA 1RINA 3RT3C 3WCRA 3WQBA 5F6LB 4NHXA 3AP4A 3D0SA 5A7PA 3RW0A 2BW8A 4MTXA 1UIJA 2QWQB 1Y76A 4G2KA 3NJYA 3DYPA 5A80A 2UWAA 1KKCA 2GNBA 3I3QA 3OYWB 4XBLA 1WB8A 2ZKNA 2DWRA 1RUF3 1W8OA 1URXA 5LYJB 3DC5A 2VQAA 4O4IB 1QU7A 4BW9A 2CGNA 3WG1A 1Y3TA 3FL7A 2ZEWA 1VBC2 5CBHA 3AG2B 4Y1YA 4QPIB 4PA3A 3TEXA 3ACLA 3U11A 3DPRB 1JW6A 4IGPA 1XBLA 1Y7BA 4CH4A 4DV1B 4PD4F 2XMLA 4KUMA 3ZCCA 2G1MA 4AVAA 3DYMA 1S5JA 3FWEA 5GW7A 3TGUH 4JAVA 1FKAO 4GJYA 4RGKA 3HQXA 1BCXA 5JQGA 3TEWA 2ZCWA 2CSGA 1L7LA 4TLGA 2VWJA 1UFIA 4FTSA 1Q8PA 3H1IH 2MK3A 4KP4A 3HKBB 3AJZA 1VRH1 3NL1A 5J2TA 4QX0A 2RS33 2WZR1 2ZGQA 2AENA 5LZ6A 2FYUH 1KP3A 3SGIA 2HWF2 1DZRA 4DEQA 3ZO0B 1D2SA 5HFMA 1RUI3 3ROUA 3A23A 1JTZX 3PUIA 4FLZA 3I54A 4LF9O 3LA3A 1JA8A 2BSKB 2XNDG 3ZXFA 1DYPA 1FYJA 1ND2B 4Q4V1 4YJ2B 2R9RB 5FP8A 5FK7A 4BXFA 4QXCA 2PLV2 1HRI2 1LOCA 4FP2A 3WG4A 4EWAA 3RYIA 1YVWA 4RHV1 1NZ6A 1V9U3 1AI7A 1QXJA 2W1QA 3IMNA 4K3UA 4D6SA 1Z7S1 3RRDA 4XF4A 1Q6UA 4NPRA 1W6QB 5ABJC 1YZBA 1OCZC 2P6JA 4NAOA 2EILB 2PZSA 2UYAA 3ATGA 3RBZA 1ND3C 5EJ1B 4B3SB 1GSLA 1QF3A 3C8XA 3O1UA 4FOYA 4Y22A 1VQ7V 4NIHA 2JKXA 2JDZA 3ASOC 1H4HA 2LALA 2R041 5FYTA 1GZTA 1YO8A 3INAA 1B3QA 4O7XA 1G9DA 4M01A 1N3OA 5BNOC 4XZPA 1AR5A 4M0HA 2NMOA 2YC2A 2XKOA 3LZZA 1O3SA 2VUJA 2L9LA 1YTFD 1GANA 1GNZA 1OD3A 2RMU2 4XCBA 3E22A 2OUHA 4U3JB 4NHLA 3SC7X 1VALA 2Q1FA 4NIAA 1EBOA 1MZ6A 4CA9A 3QG5A 1NJIW 3VZMA 3OGCC 3AK2A 2NR5A 1AUYA 4QQOA 5JPNB 1VBC3 2EXJA 1IKPA 3CZJA 4PDRA 2OPWA 4E4ZA 5CU1A 2Q69A 4HNAA 2JEMA 2RDSA 4Q0VA 2WLIB 2RHPA 1AJPA 3AG1B 1PL4A 1R73A 4MX3A 3M8AA 2KM2A 3TNPB 1GM8A 2X6CA 4QX8A 1I0HA 4CC6A 4G28B 3J7HA 1R6NA 3LPGA 2ZEZA 1G9AA 1KP2A 3R0RA 1C8M2 1IS5A 2VC9A 4N9HA 2H6BA 5FZKA 5G05L 5LATA 2RS11 4MUVA 3AP7A 3J8F1 5CFCA 2LGWA 5DUXA 1WKYA 1YLLA 2ADQB 3WF2A 4GT1A 2R70A 3POEA 4XJ9A 3I8TA 2UUBB 3QO8A 1GBGA 2XJVA 4BWOA 1V0AA 5EQUA 3W7TA 3TCUA 3ZDVA 1DCSA 3WF3A 3O0VA 3VGIA 1JR9A 1WA8A 3CL1A 5BXZA 2VUCA 1VQKV 3T0BA 5F5IA 4WBBA 4JI1B 1N34O 4JI3B 2DYSB 3H8XA 3OG2A 1T6GC 3NV2A 2BJSA 3GZAA 1PO13 2EIGA 3BA8A 1JZ6A 2MPFA 4DV0O 3HT1A 1YJWV 4I3GA 1QVGU 3QLQA 4MH0E 4IV1B 2Q0AA 2XBO1 4KGQA 2P3JA 4FPFA 1ORQC 2JGDB 1ZTEA 4WM8B 2ZXWC 2FD8A 3JAKA 4YW3A 1E5RA 2ZR2A 5D2AA 4E4DX 4YNIA 3C7OA 3KV6A 2BOCC 4TSFG 4XJUA 1GOFA 3T1LA 1X59A 2OA2A 3KCXA 2UXDO 3HKEB 1GH6A 4WZFA 4D69A 3HKEA 1FV2A 4ZXKA 2LRPA 3T1YO 4FIPC 5JCTA 4CXYA 2G9FA 1LRHA 3CB2A 4A5UB 3OY8A 5T54A 3ZYIB 4BQXA 1M56C 3Q8EA 1MOFA 5LA1A 1X8MA 5CB4A 4CEYA 2Y0IA 2MNGA 4Y4RA 1TNFA 2YS8A 3AMQA 1AR71 2OQ7A 1FXZA 1YNAA 1AR61 5KAIZ 4LO6B 1YI7A 3X29B 2M7WA 1R093 4X20A 3JQWA 5CMUA 1AXKA 5APAA 1CAUA 2YIDA 2Y33A 4GA9A 1XNKA 1AR62 1ZZBA 2QJVA 4OHWA 3LDDA 1GZWB 3WP4A 1YQ8A 4BMEA 5BNNA 4Q4Y2 3CC2V 4CP2A 4CPBD 1CAVA 4LFCB 4AE2A 1EN4A 5FZBA 2ZINA 2HLEA 1AL23 3SXWA 1DDLA 4IEUA 2FMYA 2X53S 3WX5A 4MVMA 2ENRA 5FZ7A 1F35A 1D4M3 4HMZA 4OI2A 5A7WB 5CFCB 1QH6A 2RR11 1XILA 4LF4O 3BVOA 3KF3A 4RQPC 5IWAB 1GN2A 4H0LB 2D6MA 3UV9A 4AI2A 5KA6A 1UYZA 2WNUA 2X7RB 2V09A 5IK7A 2VMEA 1W0KG 2D93A 4PHZA 5LBFA 3ACGA 3U10A 2PGGA 2R72A 2Z5UA 4HVOA 4BH9A 1ENSA 2CK3G 2VO5A 2YZ4A 2BQPA 1GP5A 2WFF1 2W95A 3MDPA 4A44A 2QE3A 5FZHA 3E5XA 5B4NA 2Y48A 3QTCA 1POQA 3ZJZA 3KGZA 5GZFA 2J1SA 4QDRA 5HXVA 4YZ4A 3HBZA 2DCJA 1PNGA 1NQTA 2R30A 2F4PA 1NA1C 1MVEA 3VKFC 3O1TA 2J1TA 4BQ1A 2PAMA 1P7BA 3UGGA 3WHUA 3Q4HA 4AGVA 4LHNA 1UY1A 2B9ZA 1TME3 4GKXA 5EYXA 4DY3A 4OUSA 2WSSG 2ZE5A 1EAH2 2B9VA 1IG0A 1YFWA 2PUSA 3L70H 2JB8A 1PVXA 4RWUA 3K57A 1SQPH 4CU6A 2W91A 1W8NA 4JKLA 1J83A 3ZXJA 5H9SA 2GDFA 5CA0A 1MEC2 4K0KB 1UX7A 1OFNA 3W7WA 5LA2A 3WEZA 3AG3C 4GWIA 3CRRA 3SMHA 4AEMA 2YDEA 1WW4A 4HXCA 2UWBA 3DECA 1VBC1 3K4ZA 2D40A 1Z78A 1W6OB 1O8PA 3CCLV 1XL6A 1RUJ3 3ZX6A 2JEUA 2ZHNA 3VBFC 4UFKA 4UBHA 2D6PA 4ET7A 1LEDA 1OF3A 2QKDA 3GBWA 1CAWB 2QQNA 2RMU1 3WF4A 3ZN1A 1H2KA 5E8AA 4WFBV 4Q0QA 3BALA 3ENRA 2ZKLA 4YPJA 2RR12 1SFNA 5EXOA 2FZ2A 4QE7A 4YW5A 4JI7B 4MVQA 5HCBA 4LFCO 3BCWA 1YTFB 3CIHA 2WN2A 4G4FA 4CCDA 3E2EA 4JGYC 5DAPA 2PHXA 1XRUA 2JDHA 5FYZA 4FM2A 2XJTA 1AR93 2JGDA 2JG8A 1QQP3 5T5OA 3MAQA 4BMBA 3JAKB 1VRH3 3POWA 4TWKA 1GP4A 5LBCA 3ZFGC 3OGSA 2IFRA 1NA1A 4Q29A 1SZXA 3TK1A 4AVSA 1F8VA 1RUD3 2HWB1 1A34A 4P30A 3BTXA 2IVJA 3JD73 3DXUA 3KS7A 3HOBA 2W87A 1TUEB 1HRI1 1MZ5A 1XQ8A 1RMU1 2HWC3 3B01A 2N05A 1WLTA 5JOXA 2CAUA 2AGSA 5LXTA 1KRIA 1IS3A 2XASA 2IH1C 4B4QA 1WN7A 2VNVA 3BVCA 1NTZH 5B1AB 2UY8A 1V9U1 2H6CA 3KF5A 1M90W 5B1BB 4TOIA 5LRRA 4HKWA 5E1AC 4JI2O 3S0MA 3CYOA 1CIYA 1QDCA 2OVUA 5CAZA 2F17A 4WVVA 3B9CA 1VF6A 2IZWA 5H6QA 2XAHA 1VAVA 1VBE2 2QM8A 4FFFA 2XJRA 1MVQA 3NNJA 4DUYB 1S0JA 1TME2 1RJ8A 4UCOA 2Y6GA 5E79Z 4HZFA 5F37A 2C9AA 4KU7A 1NLSA 1X33A 4OMCA 1JU3A 5HI0A 4BOWA 2XL9A 4XPVA 3MLLA 3GBFA 5FYHA 4JI3O 4K1ZA 2UU9O 1RPOA 1PO21 3RYCB 3PUAA 1S2EA 2KA3A 1F7YA 1ULFA 1LHOA 4IIJB 4ZZ8A 1F9KA 4FJCC 2D5HA 3PTRB 3ZXGA 4I0AA 2EIJC 2VMGA 1ZREA 1PO22 4CU7A 3SH5A 5KX5B 2ARXA 2EALA 1J3PA 2AW9A 1WLDA 3NJVA 1AYN2 3BPSA 2WR9A 1BKZA 2P67A 4S2FA 1PNKA 1JYCA 4UFIA 3BKZA 5I8SA 2XLFA 3SEEA 2BZDA 3WUCA 3K9AA 2QR4A 4LO5B 3HR9A 4RQFA 5L7OC 4GX5A 3DV8A 1NCQA 2KD7A 3JSLA 4LBNA 3PL0A 2DBIA 4RR3A 5CN0A 4JTAB 3GJBA 4LF7O 1QR9A 3UL2A 5K1PA 3CRCA 5C3RA 3WCSA 2ZS6B 1DQ0A 2Q8CA 1RMU2 1RUD2 1OQEA 2XLGA 1BEV3 1XE0A 3ST7A 3W7XA 1I94B 5HFLA 2BWAA 2ZM6B 2FQPA 3OB8A 3T4VA 5GJ6A 1UQXA 4R9AA 1JZ5A 2PHUA 2Q4PA 3UT0A 4JHTA 4Q4X2 5LXTB 2AYHA 3RVYA 1YJKA 4DR2B 2G19A 4DPNA 2W9XA 4HETA 4ASKA 5C8YB 4M00A 5KLVH 3K9SA 1AXYA 1IBLB 3M3EA 3TOJA 1MS8A 4DUXA 1XC6A 3CS5A 2XTAA 1OHHG 4B29A 4UW3A 2ITDC 1PMIA 1VQ5V 1SETA 2EIKC 2JK5C 3L9JT 4EV0A 4RN5A 1PGW1 4GLXA 4LA2A 1RUC1 2PHFA 5AFBA 3ZSLA 3KGLA 1A8DA 3D4KA 1DK1A 1P4RA 4JF3A 3AP9A 2R1DA 2OXBA 1JYTA 4BDVB 2AZ2A 1CJPA 3ZBHA 5CA3A 3Q9OA 1OZ0A 2DUPA 5JUVA 5JH7B 1UYYA 4Q4W2 2Q5TA 4YHHB 2X09A 5GTIZ 1S72V 2VMIA 5EYPB 1Y74A 1RUNA 2DBNA 1XB9A 2WWJA 2XHNA 1FNZA 4XXAA 1Q56A 1W2BU 2W39A 1W6MB 3SH4A 5DAVA 1BZKA 1BBT1 5FY8A 1BXHA 4WF9V 4ITCA 3OGVA 3I7DA 4LT5A 5F5CA 1LGNA 1SA0A 3HNBM 5FQ0A 1HR0B 4NXMO 3AMPA 4LTAA 5F5QA 1Q8OA 2W6IG 5HCFA 3I3DA 2K9ZA 3CCUV 4JGZA 3VD4A 2BTQA 3RZZA 2BTQB 4NB5A 2ETNA 3VKNA 4YW7A 3PTYA 3K4DA 3RYHA 5CB7A 2D3OW 3HNMA 1VQMV 4L2NA 5HPOA 4N53C 3ZEDA 1MQTA 2FHRA 1F23A 3A0KA 3ES1A 1UY0A 2NM1A 4JDNA 4FOWA 1ND3A 1C8M3 4R8CA 1L3JA 4J9ZB 2BWCA 3ZRWB 2F66C 1JZ4A 1PVC1 1FD9A 3C90A 3UKMA 3D3IA 3PN1A 2D3RA 2HYXA 3OUIA 1Q7YW 1JOPA 3RQ0A 4MGSA 2BOIA 4XMAA 2D6LX 3I49A 2XAGA 5FK8A 4O9EA 3K08A 4IIJA 1GOGA 4DRRA 2QE7G 3KCYA 4AHCA 3Q8BA 4BB3A 2VVEA 2WWSA 2O8QA 5KBFA 1RVF1 1OCRB 3OYWA 1LESA 2NLRA 5IVJA 4YRDA 5KXCA 3ZHRA 4B3MO 1REEA 4XABA 5FZFA 2JGUA 2V4AA 1B35C 1FPN2 3AZZA 1NR7A 3VQXA 3ILFA 4JI5B 4YG3A 2N04A 1AR73 4XAEA 1W8UA 3J26N 1CN1A 2YG0A 5I93A 4MOAA 3QH6A 3E86A 4LP8A 1C5HA 3OY8B 4ZHNA 2R0FA 3VBHC 4Q4X1 4X64B 3AEIA 4X65O 3RYFB 5FZLA 1QMJA 3T30A 1SHWB 5A1FA 1YWKA 1OPMA 2DE0X 1QOTA 1KXGA 4V2VA 1KBHA 5IWFA 1NXD1 3VQYA 4IEPA 1LENA 2W3JA 4PI2A 1N33B 2Z69A 4TSVA 3N27A 1DYOA 5E89A 1APNA 3ZIWA 1WMXA 3I2OA 4DUZO 2TNFA 4UCUA 4BWAA 5T3NA 2A5ZA 2VMHA 4S2DA 2GNDA 5FKCA 2HG5C 3CX5F 3E6DA 4AI3A 1OLQA 3VD3A 2W68A 3VZKA 3ACIA 3M8LA 1JUHA 5CZKA 2GUZA 5LB6A 1DQ5A 2Z3YA 4PIZA 4IXLA 3P3NA 4GMP0 4KGGA 1LGCA 3POJA 4FFBA 5JCOA 2H3OA 1Q3EA 1V6OA 1K5QA 4PA7A 2YROA 2XONA 2IC1A 2GC3A 3H7YA 1MS3A 4XJAA 1PNFA 4YJ2A 3E8BA 1VBB1 1HRV1 1XNBA 5F3CA 1W0PA 1Y4WA 4YGBA 1EPZA 4XQDA 2UUCB 4JGSA 2Q1MA 1HQNA 2JS3A 2J42A 2BFUS 1SLIA 4GH4B 3EFFK 2VVFA 4FSJA 1NT0A 4BU2A 3E6BA 2BOBC 2A73B 3T2MA 1ZX5A 3C7EA 1YQ5A 4AOCA 3DXRA 3IAQA 5GM0A 2P22C 1UY2A 3VHNA 4KFMA 4AHZA 2NN4A 5FYIA 3N2GB 3N2KA 4YYOA 3K5LA 4PJYA 3R6SA 4O9GA 2NNUA 3CMAV 1ASJ2 1G7YA 2WLLA 3PVEA 2ZGUA 4LQRA 2YEVA 4MO3M 3WDYA 3LOBA 2EVXA 2Z2SB 4I5SA 4YJ3A 5TISZ 4X1YA 3O1VA 1YI9A 4QX3A 4GYCB 2ZIOA 1RHI2 1AZDA 4LUKA 4MXVA 5JR7B 5IHRA 3IDCB 1V9U2 1A6CA 4MXWA 1HW7A 1JI6A 5GLWA 1Q81W 2DYCA 1AR72 3FHAA 2QQKA 5FTTC 2C1FA 4R52A 4RSUA 1RFYA 4BQ4A 4J1XA 2CAZC 1XPWA 3USSA 4L0PA 4EWEA 4UFHA 4MADA 2IXCA 3EXUA 2D5FA 4DMIA 5A3MA 4LWSB 4QM9A 2HHHB 1H8VA 3P30A 3OW2U 1ZSPA 2WRAA 4LR4A 3VBSC 1IBKB 3T3YA 1K45A 4GB31 4TLFA 2JDUA 5KAFZ 1RUH3 2WT2A 1ENQA 5EPAA 3K3WA 4G9SB 2VU9A 5JVDA 2X10A 4LF6O 4TV8B 5GLTA 2FCVA 4W4ZA 3WVJA 3D82A 5FZOB 2GMPA 1G4YB 2VQFB 1WP7A 2FDFA 2DYRC 2KQXA 4H44B 5L3CA 4HK8A 4LE3A 1CEZA 3QH7A 5FIXA 1YITV 5JJNB 4LMFA 3X2QB 5FZ0A 3U75A 1RUJ2 1LHNA 2XUMA 2DTWA 4DNYA 3QF7A 4NIGA 1OLMA 2W1SA 3MW4A 2ZE8A 4Q8LA 3AZVA 5IFTA 1DZQA 1G86A 2UU8A 5BNOA 3B94A 4JDOA
chains in the Genus database with same CATH topology
4Z1VA 4URTA 3O0XA 4OFGA 2MEV2 2FMDA 4M3CB 1CVNA 5DUUA 3TN93 3FZ3A 5GLVA 4QXKA 1W6QA 3MI8A 4DOUA 4E27A 1XNDA 1VBE1 3M2MA 2JKBA 4Q8KA 1BMV1 3ZMOA 5JZGC 2I45A 1OMIA 2C5DA 4AEJA 2W0XA 4Q0SA 4COZA 3MLKA 4QPGC 3WOGA 4EN9B 1SCSA 2VUAA 1UN1A 4QQHA 1AYM2 1PZ9A 4Q0UA 4CEYC 2EA7A 4JGZB 1HV0A 5IK4A 4CYDA 1TQ5A 5C33A 4Y26A 3ZSKA 1SMVA 4Z82A 1CPMA 4I0WB 4CP1A 1OA3A 2WBPA 2X5IC 4SLIA 3KT4A 4K40A 5F6KA 4WVWA 3MF9A 4FTBA 3MPBA 1ND2A 1XE8A 2ZGKA 4LO8A 4Y1ZA 1LHVA 3ZYRA 1VBD3 1HXS1 2XHKA 4I0BA 4XIOA 1RUJ1 3WINE 1JN2P 1AJOA 4YG6A 1H9WA 2JG9B 1UCXA 4XF0A 4LBOA 4XETA 2ATFA 1PGW2 2A6YA 4QU2A 5LEKA 2RM21 2P17A 3FFZA 3FE5A 1AX0A 4CDXC 4LA3A 4AXOA 1IS4A 1J3RA 1KS5A 4Q4V3 3KZ4C 2Y38A 1FYUA 3KB5A 4YVSA 4Q2FA 3JBG1 1SDWA 5CFDB 5DDJ1 2PAEA 1SBEA 4EROA 2GZWA 2ZMLA 5GZDA 3WP3A 3WW3A 1QNYA 1SBDA 1GLHA 1RUC3 2GC2A 1FT9A 2ETEA 1CAUB 1JYIA 3DPRC 5FQ0B 2BEOA 1R1A2 4QQPA 3I2DA 2OG7A 2WKKA 2W08A 1S0BA 3LKJA 5GALA 3BIWE 5CG9A 3URFA 3IPVA 3NWKA 1G9FA 4XFCA 3T1MA 2P3KA 1YRZA 1QJU3 3OBRA 3POYA 4ATFA 2FZ1A 3KT7A 1OLRA 5DUWA 4Y20B 1KQRA 1YIPA 2ZA9A 1GICA 3KD4A 1RUI2 4FCAA 1FATA 1CESA 4B7KA 3DKWA 2ES3A 4U2AA 3WDXA 1OQDA 3ES4A 1R083 2GALA 4M2EA 1QNWA 1XE7A 2I07B 2K2SA 3KMHA 1W0OA 2RS52 4AYUA 2NYYA 3O14A 1W6MA 1O3TA 1ULDA 1VBD1 1X36A 3MEPA 4GIQA 3ZSMA 5CFDA 3VBUC 4ATEA 2ZMKA 1RUF2 3VBUB 4LO7A 2GAUA 1YFXA 3NKTA 4R9CA 5A33A 5EFUA 4RR3C 1HRI3 3AFKA 4I01A 2PHLA 2WIIB 5A32A 2YGLA 4P5HA 5KHIA 1MS4A 2WL1A 4JGYB 2CYFA 1DS1A 3JQXA 4HVRA 4UBGA 1Q8VA 3SITA 1MZFA 2VH9A 3G6JB 3IIAA 5FBZA 3ZFFC 2XJSA 1HW5A 2O0OA 3BPZA 2HEWF 4RQPB 4ASMB 3B5LB 3JBG3 4QHBA 5HCAA 2P2KA 2Y0OA 3VZLA 2XJUA 1RINA 4OZXA 4QPIA 1R1A1 3JB4C 2BBVA 1CAXB 3WCRA 4D3WA 3UK9A 1NCRB 2Q1ZB 5F6LB 3PJYA 4LEJA 3GZTB 4WVMA 3AP4A 3V65A 3D0SA 4EN7B 1UU4A 4GALA 1QJU2 2BW8A 4X6QB 4OI0A 1UIJA 1OSGA 5T5PA 1W2UA 5KHJA 1RUE2 2AR6A 4E2QA 1IS6A 1DRTA 4MGIE 1BEV1 1Z7S2 2R073 2D6KA 1WW6A 4EN0A 4BIOA 1QOSA 5J98B 1QDOA 1DFQA 2OUJA 2UWAA 4BG1A 2GNBA 3OYWB 4BGMA 2ZGTA 4XBLA 1OIIA 3FLRA 1MQTC 2ZKNA 5A3LA 2DWRA 2R062 4DB5A 4J5IA 1QXPA 1FX5A 2H0BA 2CGOA 2JJ6A 3IWZA 3L2YA 3QACA 4CDUA 1RUF3 3MZHA 5KEUA 3OBTA 1URXA 3CO2A 5FAXA 2MEV3 2WZR2 3AMHA 5JDBA 1OS7A 2VQAA 1RUI1 2YY1A 3VDDA 2PTMA 5FRAA 2CGNA 1PK6C 3WG1A 1Y3TA 5JSPA 1VBC2 2BPA2 1DHKB 4Y1YA 1Q5OA 4QPIB 4DXZA 3ACLA 2HWE1 3DPRB 3U11A 1JW6A 5CBLA 1NXMA 1AYM1 4B8EA 1Y7BA 4MVTA 2A6V<