1H2LA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
total genus 106
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2lA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2lA01
2CGOA 2CGNA 4B7EA 3KCYA 3D8CA 3OD4A 3P3NA 2ILMA 1H2MA 1H2NA 2XUMA 4NR1A 4BIOA 5JWPA 2WA3A 2YC0A 4AI8A 1YCIA 2WA4A 3KCXA 2W0XA 2Y0IA 1IZ3A 1MZEA 4QU2A 4Z1VA 1MZFA 4Z2WA 3P3PA 1H2KA 1H2LA 2YDEA 4JAAA 4B7KA
chains in the Genus database with same CATH superfamily
5J96B 1IBLO 5LMNO 4CU8A 2DCKA 2GC2A 3K5NA 3H01A 2J1AA 3JXSA 3OSDA 1NXD1 4IYHA 3T1HO 1QIQA 4UW3A 4A6OA 5TISZ 2XAQA 4I30A 3RYCA 3PUIA 1UXXX 3MLLA 2OUHA 3JD72 1PNMA 5T50A 3FJSA 4UB6Z 2DTYA 4L97A 4GH4B 3ACLA 1HV0A 4R4XA 4TN7A 4N9HA 4NHXA 1C5HA 1XEQA 5FOBB 4COWA 1UPGA 5SV8A 2NP0A 5DZFA 4AHZA 1WCUA 3STZC 1VBD1 4EFBA 1JHNA 5FYZA 4KWLA 1V9U2 4PIXA 4X65O 1XOYA 1Q56A 3NVCA 1G8MA 3T1LA 1TUEB 4LPLA 4D6SA 1B09A 5F3EA 4IUGA 1S55A 1RVF1 1LOGA 1JW6A 2VOKA 1RUG3 3AM2A 1R083 3CJXA 2JDKA 4MADA 3JASA 4A42A 4UXAA 3ZMZA 1K3EA 3LSSA 2FKXA 2OCHA 4FPPA 3ZYJB 1OF3A 3ZLIA 1F15A 2AEZA 2WABA 3ZDSA 4XFBA 2C5DA 5T52A 1F7YA 1J84A 1WLEA 5E1AC 3THCA 4PA7A 1MZ5A 3NV3A 4BQ1A 1POQA 2BVBA 1QOOA 3DF0A 2LW7A 1S0EA 4RR3B 2ZHNA 5BYNA 4LBLA 3DYPA 2FL4A 1QQP1 2BWCA 5FK8A 2NLRA 5BNPA 1SLIA 2DURA 4WM8C 4Z2AA 4YVSA 2X8KA 4DV1B 2VQUA 4YLZA 3SDLA 4Y5TA 2QKCA 1LR5A 4AVBA 1W6NB 1C57A 3JZVA 4DQAA 1MS4A 1C8M2 1JR9A 1RUE2 4A7ZA 1DYPA 4BISA 1BHAA 1ZRCA 5LBQA 4FMTA 3IFXA 3CCMV 3JAMN 1OCOC 4UCSA 1LRHA 1UX7A 5C3QA 1MR5A 1VRH1 1PIV2 1KXGA 2A3WA 2WLIB 2X7RB 3EXUA 1FV3A 4QKNA 4HPKA 4BB3A 3K51A 3IAPA 1F35A 2UXNA 2GN7A 5JVVA 2F17A 2ZXQA 3H8UA 4HZ3A 1VBD3 1I6XA 3N27A 2R16A 4JI3B 4DRVA 5LGTA 4JF3A 2CTQA 1DK1A 1HDKA 3JB8A 1BYHA 2J22A 2XLFA 5JXIA 3FKSG 1RVF3 2WL1A 3FC0A 4JKKA 4CDXC 5BXXA 5KBFA 1NQJA 1THZA 3SJQC 3CZJA 4CEYA 4AZZA 4CDUA 3ZFFA 3THDA 2ZEZA 1CGPA 4JYYA 3GGLA 4MVOA 3VQXA 2HVKC 1BGYH 1JJ2U 3NNFA 4MTFA 3CRCA 1AX2A 2J1VA 5D5QA 3AP9A 4QPIC 4NB5A 1JOPA 1A8DA 1CPNA 3MW2A 2IUWA 5CG9A 3WB1A 2CSGA 1QQP3 5FYYA 2QNKA 5CISA 2DUQA 1I0HA 2E53A 1GV9A 1UYXA 3F5TA 3POFA 1JZ5A 2UXBO 2BP6A 4NRPA 1SERA 2RG4A 3RYPA 4RGGA 1XPWA 3TEWA 4CH6A 1ZA7A 1H1MA 2WSVA 4NPMA 2VOWA 2OZJA 5LBCA 3H1HH 5FQ0A 1RXGA 5EXOA 3OEEG 2XGXA 1JFFB 2FDJA 2VNVA 3GCWA 4Y4YA 2AR6A 4IEXA 3UKNA 2ZR2A 5CA1A 4JQTA 1KD7A 4MGTA 1I1EA 5CFDC 1HB2A 1VRH3 3LSDA 1RM1B 3MI8A 4UOJA 4XPVA 4N23A 4YJ2B 2E3CA 3IDAA 5FKBA 1QJY1 5E6HA 5JVDB 1WP8A 1VQ4V 3KHCA 2XBO2 1UO9A 5C9AB 5DM6V 3C3VA 3TCUA 3ME2A 5KXCA 3GZUC 4A7KA 4PV1B 4NXNO 2MK3A 3S6PA 5C8CB 1RUH1 5ABJB 3QLQA 4TZDA 4XFFA 2D3RA 3B2EE 4WCEV 1SHWB 1UL9A 2VBBA 3IDBB 3WDUA 4BPZA 2X05A 3FB8C 1QU7A 1BCCH 4UCVA 1X8MA 4O4HB 4JI4O 1FATA 4K3AA 5LL6Y 2GC1A 2IJIA 4B3SO 4RS5C 1BSMA 1WLWA 3ASOC 3C3SA 4B3NA 1G1XB 1UU5A 3EVKA 4RGAA 4XF4A 4ZS2A 4YGCA 2CNAA 5IJ0B 1R3JC 3FL7A 4ICGA 2Q30A 1OKOA 3AXEA 4L87A 4M4RA 3I2OA 4R9DA 4E2LA 4FPOB 1W99A 2ETNA 1V6LA 1W9YA 4ATEA 2E33A 5FZDA 3JARA 1GO3F 3K03A 3LA3A 3A4UA 4I0BA 1DP0A 3CYOA 4P9WA 1FXKC 1WMEA 4LF9B 1WD3A 3WY6A 2XOMA 2EULA 3W20A 4CP1A 4F6RB 4LBQD 3VBHB 2TBVA 3JD1A 1GN2A 1YF2A 3VOUA 1EY2A 1P84F 3ABTA 2E63A 2EX3A 3WR0A 5IHRA 2LW1A 3O1OA 5JZGB 5LMUO 4LBNA 1PGSA 1H2MA 2D6NA 1AX0A 5H9QA 1LOFA 1ULCA 1XYNA 4MT8A 5GTHZ 1FNYA 4FFBB 3TWIA 1QJY3 1WJZA 1GN3A 2DUOA 1LAJA 3IIAA 4CCMA 3WDYA 5FTTC 3ILFA 1IDSA 1OUXA 4FVVA 1CQ9A 2ZD9A 3VQVA 1PVC1 4Y22A 4FK5C 2UUAB 1HRV3 2WNOA 1TGOA 2WA4A 1KD1W 5A3NA 1M5IA 4KHPB 3LAGA 1AYM2 1NY71 3NL1A 1MPXA 1TME2 3O1VA 2WFPA 4O61A 1M1KW 3WQ0A 3E97A 2P06A 2ZR3A 1SZTA 5KMGA 1AR82 4O7XA 4QT6A 2EAKA 4UCRA 3MFAA 5TSWA 3OG2A 5C33A 2DF7A 3Q8AA 4Z1VA 2AHYA 1FT9A 3EB7A 5LOVA 1AROP 2BERA 1VQ8V 1KJRA 2BGCA 3M3OA 3WVJA 3WB0A 1K12A 4I55A 1S5HC 4MZUA 5JIUA 4H55A 1V6MA 3EO6A 5CBFA 4IEPA 4OI4A 4BE3A 4WM7A 4JHZA 1ZSPA 4DINB 2P67A 1LB2A 3O1PA 1CVNA 4LF7B 3K04A 2KM2A 5I8SA 4CXYA 3UKTA 4GKKB 1DHKB 4D3WA 3J80N 5AG2A 1Y76B 2Y48A 4PD4F 1AR1B 5FPRA 4NIGA 3N7JA 2Q1MA 3JATB 1CAWA 3OBRA 3QD6A 2QWOB 1FYJA 4ZIBA 1LECA 1GWLA 1HNXB 3ITQA 3GHMA 3CEIA 5FZ0A 1DFQA 1QLEB 2WLLA 1RUJ2 4PDWA 3T2PA 4AFCA 2QJVA 2R071 4LFCO 1X33A 3I3MA 1DU3D 4KUMA 1V00A 1J59A 4XAEA 3HNBM 3WLUA 3ABZA 1LU2A 2UY9A 4YJ3A 2WQZC 2OX0A 1ZBA2 4LWSA 1IGOA 1WCQA 5FXWA 2Y6GA 3LCPA 4XOGA 3BY6A 3ZFGC 4CZZA 2W68A 3VHOA 1W6PB 4OI1A 2E74B 3A8TA 1BK0A 1PVC3 1WCDJ 4FPCA 4QPGB 4AQYO 5FPBA 3BCWA 1OBNA 1MS5A 4UCOA 4HVOA 3SISA 4NRMA 1NI8A 4JI1O 4JZGA 3UT5B 4YM0A 2Q7HA 4FXGB 2VTXA 4RA0A 2CGOA 3VZMA 4LFBB 4MTGA 3T4ZA 2R9RB 5DMYA 1NTMH 3NAPC 3H7YA 3GBGA 5I0RA 2YPDA 1POV1 5GZEA 4I3GA 4D7YA 4O4LA 4N9IA 4V1PA 1Q8QA 4I0XB 3ZXJA 2LUWA 3TN91 3CU7A 1K45A 3DCQA 4QB6A 3Q4HB 1YEWA 1VBC2 4IV3A 1KFXL 4JGZB 3CEWA 4K8RB 3C7FA 5FZFA 5CA0A 4AG4A 1NTKH 3GZTB 3AFKA 2LJ2A 4LF5O 2XKPA 3MIGA 4UVCA 3T4VA 5JH7B 3USSA 1DGLA 1RPOA 1IVSA 3TETA 4XFCA 3E5QA 1W6MA 2WLPA 1AYN2 1U96A 5C3OA 5DUVA 2RS31 4ARYA 3L74H 1HNZB 5FZGA 4B4RA 4ZZ5A 2DU1A 1PGL1 1CX1A 3IWZA 1NCQC 1UYYA 2R073 3WQ1A 1SZXA 2PHDA 4HYOA 4PLMA 4JI5O 3N2GB 3VBFC 2ID4A 4B4QA 1QNMA 1W28A 1YTFD 2BBVA 4D7SA 4YGEA 1RINA 2ZGPA 2GC3A 1B35B 3PVOA 4MH0E 1TQ5A 1UD1A 3A2FA 2W95A 3NV2A 2FDKA 4YW2A 1P8JA 3KG2A 5BNQA 3ZEDA 5CZKA 3BVCA 5GZCA 1CD3G 3L70H 4CYDA 3U11A 5J2TA 4GKJO 4MS2A 3MV11 1JYTA 2UYBA 2D2CB 3I5DA 1W03A 4W8JA 1N36O 2OCCB 3HBZA 2VTFA 3SH4A 3T0DA 1WB7A 4HN1A 5CKQA 4OI0A 5FJHA 1GZWB 1SS3A 5A3TA 4LMFA 5KUMA 5B1OA 2VGDA 2FDIA 2MEV2 2WQ4A 1ODMA 3RWNA 1ASJ2 2JB8A 1G9BA 1NZCA 3WD5A 1POV3 4EB6A 4BIZA 4P2ZA 5JI7A 4CUAA 3KCCA 1RTVA 3ZRXA 5FO8B 3IGAC 4LF4O 1UMHA 3FFQA 5CKNA 3TN93 4IDZA 1S0VA 2LALA 1EAH1 4DFSA 1VJ2A 3WG2A 2P7TC 1YLLA 3QG5A 4H0LB 2HWE2 5FY4A 1S2EA 2WN2A 3GYDA 1K42A 3O1MA 4C0BA 4Y1VA 3L2HA 1JA8A 2WZ8A 2VS0A 1S3JA 4WVMA 5ANQA 3K3OA 4YARA 2RS33 1LUVA 5IY5C 2Z79A 3MZHA 1V55B 1UW8A 2JDZA 1SFPA 2VOTA 3RJ2X 1RFYA 2KQXA 1UAIA 5JSRA 4IE4A 3OPZA 5L3DA 1TA8A 1REFA 2OT5A 4J41A 4XFGA 4DV3O 3PJSK 2ZTNA 5BNPC 3OUHA 3K4ZA 4YVSC 1MZEA 4GUNA 2V5YA 2VC9A 4OYUA 2OIIA 4X1YA 4Q8LA 4H33A 3B5LB 1W2OA 3RBZA 4PF5A 2GNBA 3ORJA 1KYOF 5IK4A 5KX5B 4XUTA 2PAEA 1VBB2 3JQXA 4B3TB 3KGZA 4ZBMA 3PURA 2X0LA 3ZN1A 4IYIA 2UXCB 3SKJE 4J7JA 1YQ8A 4Q1PA 3VHNA 1XRUA 3V0AA 2K2SA 5LA1A 2ZCEA 3L2YA 4S2FA 2ZGKA 4I0AA 4U3FH 1BEV1 3E5UA 2OPKA 5LEJA 3LSUA 4CRQA 5BNNA 4OHVA 1AJQA 4B3RB 2C9AA 5AC91 2YHJA 3OYWB 3L9DA 2PI4A 1H2NA 1WPXA 1YSCA 2PHLA 5A7SA 4XJUA 1D4M1 3MFCA 4Y5Z0 4I0WB 4JI0O 5F32A 2PHWA 4P02B 4I50B 3AEIA 3WW4A 1EAH3 3R4DB 2OT7A 4LBOA 5EC1C 2VZQA 1LHNA 3O14A 1NA1A 3JAKB 4CEYC 4CDUC 1LOEA 1OA2A 1CIYA 2WLQA 3ZFFC 2ZEYA 1NE6A 1DYOA 5C3SA 4M00A 4RO2A 1WMDA 2Y33A 4DUXA 4PA4A 3WDWA 1ZRRA 3GBFA 5KLVH 1MSDA 5JOXA 3RS6A 2FDHA 5DUWA 3SMHA 1YI2V 3SPGA 4DR5O 3LZZA 3BTYA 1Q8PA 2F93B 4ZHNA 5A6QA 2PLV1 4CS2A 5C6CA 2LO1A 1AR72 2ZXWB 3QVNA 3LEIA 2UURA 3SYCA 1LOCA 2WWSA 4K35A 4IV1B 4LR4A 1N33B 2JDNA 4SBVA 3TK1A 3OUIA 2YICA 2C26A 2ERFA 3KS7A 5GLTA 3PNAA 2WLMA 5FO7B 2JB4A 3M99B 4P9PA 4LBMA 2JECA 5DAVA 2QVSB 4C8DA 2QWRB 4ES9A 2RMU1 4QQPA 2LQTA 1RUC2 4UB8Z 3ZSMA 3QH7A 5KA6A 5FZOB 2HWF2 1TVKB 2W6IG 1BEV3 1CAVA 2YC0A 4LNVA 4DR7B 1N1YA 2RM22 4E9KA 4K8XA 5AC93 2BTQB 2F95B 1SRYA 1YFUA 1XU2A 4TXWA 1AUYA 3DGTA 2JXAA 2WNUA 4OMCA 4X1KB 1D4M3 4NIIA 3PTYA 1UOGA 5LA6A 4UF0B 2OQ6A 4DB5A 4DR1O 2ADEA 1WW4A 5IFTA 4UI9L 5FLHA 3WW2A 1EV12 5L73A 4RQPB 2DYSB 1OT5A 2Q5ZA 4E27A 5EK0A 2NNUA 3KSCA 3S3WA 1XSQA 2Q8OA 4FQZA 1PMJX 2DVFA 1RB8G 3VDBA 4ABMA 5A7QA 2GAUA 3QOPA 3ZFEA 1OLRA 4FPEA 2VCCA 4QB1A 4LK7A 3A0NA 2PLV3 2ZQMA 1F51A 5CFCB 1Q8IA 3OBTA 3OY8A 2BTOA 1IHMA 1O91A 4MVRA 3PVNA 1FJGB 3VD7A 5IK8A 2GMEA 1MS9A 3BB6A 5LYJB 1M06G 3UL2A 1CN1A 1AR91 4K7JA 1NR1A 1XUQA 3CB2A 5E88A 4YRDA 1RUF2 2JDAA 3RVHA 1MA1A 1VF7A 1XL6A 1IBKO 5F6KA 2JS5A 2J1SA 4GWMA 3POEA 1DZTA 4YGDA 4ZZ8A 2YIAA 5A80A 2RMU3 2VBDA 1GR3A 3ASNC 5H9CA 3SJBC 5F1RA 3F2ZA 2ZE8A 4DV4B 5FMOL 1H9PA 2PHFA 1LOFC 1FPN2 1JZ6A 2CTRA 4NWWA 3KD4A 2GZWA 3GZAA 3CJHB 5B5EZ 1OHHG 5A3WA 3WFVA 1IG3A 2F4VB 5JUVA 2WZEA 1CPYA 3AYAA 5FY7A 1QJZA 1HN1A 4EROA 1ACCA 1W04A 1I5YA 1LR1A 3PMSA 3K5OA 2Y34A 3RYFB 3OBZA 3M1HA 4JAAA 3AK1A 3LUTB 5IDJA 2Z42A 4EN6B 5IJ9B 3U4SA 4LO6B 1WUVA 3DYOA 4M3CB 3KZIZ 4WM8B 3SPIA 2Z4FA 5JSOA 4META 2ZHKA 4QGNA 2W1UA 2ZKOA 4WM7C 4MSWC 2Y8KA 1RSOA 5EIBD 1AR62 5LY2A 1XI1A 1VQ5V 4K1ZA 4E2QA 1GFF2 1GOFA 4CEWA 2X10A 3FAVB 3G6EV 4R6ZA 5DAXA 2RMKB 1AR93 2WAOA 1OCOB 1REEA 3U10A 1YIJV 3VN4A 1ENQA 1UF2C 4ZXEA 3ZPYA 5IATA 1OURA 3W9AA 3HKBB 1GZCA 5FRAA 1WN7A 4PDWC 5F3IA 4X1IB 2GNDA 2QM4A 4JI8B 3CMGA 3C7GA 3T09A 2BSKB 5C4WA 3MW3A 2WQ8A 3I56V 3K4DA 4RAIA 3HN3A 3TRSB 1RGSA 3ZHSA 1JVMA 4QPKA 4B7KA 5FOJB 1ULOA 1UXZA 2VQFO 1K92A 1WP7A 2CYFA 4CC6A 1TUBA 4GX2A 4CTEA 1MEC1 4AI1A 4CDXB 1KU9A 2WPDG 2GTSA 4FPLA 4DK1A 1FX5A 1O4YA 4JPRA 2GHYA 2ATKC 4QU1A 3HKEA 2HJFC 4DS0A 3Q8FA 5F6LB 2ZJCA 3SEPA 5EBLC 4YGBA 4PBOA 4EN0A 4CA9A 3PJQA 4J42A 4DK0A 4XMAA 1TVGA 2WT1A 2XJTA 1HB3A 4M0HA 2QTOA 4MHRA 5JDBA 2JKXA 1ZBE3 3VKFC 4QDRA 4TSVA 5A3MA 3RT3C 4AGGA 2XVGA 3WP4A 3I2HA 3H3LA 4QPIB 5ERLA 3N9NA 2HWD1 1WD4A 5EBMC 3QBQA 2QKSA 3H1MA 2GU9A 4JI2O 2VMDA 4LOTA 2JIJA 3B09A 2VO5A 2ZX3A 1FFTB 5IYZA 1XOUA 1LEMA 4GX1A 1FAFA 4Z92B 4DV0B 3SYAA 1ZX3A 2ILMA 3WNXA 4IV3C 1EN6A 2P2KA 4Q4X1 1K4DC 5EFUA 2V5DA 1ZX5A 5ANNA 1RUG2 2JGDA 3O65A 1R082 2A73B 4AI0A 1QY4A 4Y26A 2BGOA 4WZCA 5CFDB 3UGGA 3CC4V 2D44A 1F4NA 1X7NA 3B94A 3UJQA 3AC0A 2LFSA 1OPOA 1Y3TA 4X8NA 4FI9A 2XQRA 3O0WA 4W50A 1CEZA 3B8MA 1BQ0A 3FFZA 2HG5C 2JE9A 2ZT9B 1NS1A 2DN9A 3M3EA 2UWBA 1PGW1 1WBFA 4W4ZA 2A6ZA 3LGRA 1G9DA 5CBGA 1D0GA 1OCRC 3PHMA 3WXPA 3GALA 1MEC3 1S4CA 3GBWA 3EFFK 4P5YA 4KU7A 1J5EB 1ZREA 4JYBA 2GSYA 4BIOA 2E5LB 1AJNA 2P3KA 4RS5B 4CS4A 2WJSA 2B45X 5FPOA 1S72V 1C1LA 2VCBA 3ASOB 4BLIA 2ZHMA 1YC61 1RUD1 1M57C 3WV6A 3BN6A 4YZ1A 4EZ4A 2PQSA 2Y26A 1SQVH 2VMHA 2Q4SA 4AE2A 4FZ1A 1H9WA 2LM3A 2HWD3 2JE7A 3RZZA 4XQDA 5EZYA 1UZ0A 2V7QG 1RMU1 4BQWA 4XCAA 3IDEA 4CCNA 4X62B 3ZRSA 2P5BA 2YPJA 5I8TA 3N2KA 4P00B 2ORXA 2JDUA 1POV0 2P34A 3WHUA 1S5LZ 3MIBA 5IWAO 5EYPB 3HD8B 1VBD2 3GHNA 3CP1A 1O7FA 4JX0A 1FXKB 2VPVA 1K5JA 2XL7A 4Q4X3 3P30A 4ZKTB 3H3ZA 4FVMA 1GM8A 1OPMA 1RVF2 4EN8B 2H6BA 3FLRA 2XJVA 4ZOLA 2WBKA 3SCGA 2CE4A 1G9AA 1V0AA 1EYBA 4Y3OA 5DN2A 4KBBA 1K33A 3ZRWA 4LBQA 2ZX0A 2G9GA 2X09A 2IU0A 2ZMLA 3QO5A 3CCLV 2QKDA 1SEFA 1SPPB 3RI8A 1YQ5A 5LHHA 1ND2A 1FOD1 2OYZA 2P6JA 5FNVB 1W2BU 3SH5A 4D69A 1WA8B 4UBGA 3NKGA 2VQEO 4TTGA 1QQP2 1W90A 3OMIB 2W08A 2CTVA 2UYAA 5FDBA 1QR8A 3KHBA 3MW4A 4AVTA 4QX2A 4YPJA 1F4HA 3VDCA 2O1QA 1H6XA 1RUD3 1W8HA 4X64B 4LLFA 1SMVA 1Q5OA 4LC1A 3AZZA 2UUCB 4LK6A 5JSPA 5H9SA 3BYWA 4OVEA 2VAUA 3KF3A 1GWMA 4AI9A 1VRH2 3OMAB 1RMU3 5K1XA 5BNNC 3KCXA 4NXMO 2QSAA 2ZEXA 1PNKA 2F4LA 3DV8A 5HCAA 1M90W 4NROA 1ZL8B 3KT1A 3BFRA 2N04A 4I3PA 1XMOB 5K4LA 3MIDA 1JU3A 1GRJA 4AF9A 2AREA 5BPXA 5T5OA 4UFMA 3H1JH 4DR4O 3MPBA 2A7WA 4D0QA 3VD5A 4DV2B 3OEBA 2HEWF 1NA1C 4TWTA 3PVBB 3RYIB 1NJIW 1XHZA 1SQBH 2KB1A 1QJEA 4K8FA 4WVZA 4AQTA 5ITZB 4LH7A 1PZ7A 4LEJA 4BXSV 4MXWB 1S76D 4Y4RA 4AEKA 4P30A 2ITDC 4DV7B 2D98A 1NOVA 4YHHB 1MABG 2M7WA 2A3XA 3UT0A 2DUPA 3ZFGB 2P4KA 3CCVV 4QX0A 2H8PC 4FPHA 3OBAA 1FOD3 5H2FZ 3M2MA 3UNPA 3W7TA 2E75B 1SLLA 5JPMB 3T4DA 2VWJA 4FIPC 4CP0A 1V6OA 3IDCB 1PD3A 4AI8A 1XMQB 3PL0A 4BK5A 2C0ZA 2LGQA 2Y69C 2HWB1 1YXWA 1MNGA 1QXPA 5FZCA 3RNSA 4ZU7A 4YFZA 1HW7A 3NAPB 2C2AA 4OHWA 3P32A 5B4XA 4GH4A 3EXAA 4LFAB 1K5MA 4X6RB 4Q0VA 1OMIA 5LHGA 5FZEA 2HBTA 3DPRA 1H2LA 4L8JA 4FLZA 3AG4C 2PN5A 4X66B 4XQ4A 3AVRA 2DE0X 3TNPB 2CL2A 5IE9A 1MACA 4HSJA 4OZOA 5FP4A 1H1IA 2DWDC 1QJY2 3KZ4C 1R6KA 4XJ8A 4KI5M 2WNUC 4UFLA 1I5PA 4E4DX 3QO8A 2PYLA 4K3UA 2JDHA 4LP8A 2JDMA 1VRBA 3MYXA 4J25A 2ZNIA 1HRV2 2RDCA 2R6QA 1GNZA 4GXLA 4I02A 4Z8BA 1U5XA 1C3HA 4TLFA 3WF3A 4HN0A 3RDIA 1YYNA 1T6GC 1QJX1 2OWOA 1KJLA 2DQ3A 4HKOA 4LUMA 1GNHA 3MDPA 3WG4A 3LOBA 1PMHX 3N9QA 1NCQB 1W9SA 3DECA 3K79A 1R093 1WW7A 2F66C 3ZFEC 4XBNA 3VBFB 1M56C 1CJPA 1ENXA 4MGKE 4AI3A 4OI2A 2H0BA 2EAAA 1XL4A 1HR0O 2WR9A 4QGMA 4BQYA 5CN0A 3L9JT 3A23A 3OMNB 4JRLA 2W1SA 4JCKA 3GWOA 5FXZA 3ABMC 3CCSV 2OS2A 2BV4A 5JCTA 1UFIA 3RYCB 3FYIB 4XDJA 2HVJC 2AENA 3K3NA 4AEDA 4N7UA 2IVIB 5F5IA 3A0HZ 2JEUA 4XZUG 4JV4A 2HWB3 2WO7A 3ENRA 4UFKA 1SQPH 1A78A 2HWE1 2QQNA 4O4IA 3R0RA 2TNFA 3W59A 1SF9A 3HPLC 4K1YA 1W0JG 5EQUA 4EWDA 2VW1A 4M3CE 3KLSA 3MUZ1 3ZCCA 2W47A 1VMGA 4N53A 2RDSA 1EZVH 4GJZA 1EBOA 3JQWA 2RCVA 4GCZA 2ZBJA 2RS11 2PZSA 1MMMA 4IEUA 1B3QA 1L7QA 5F3GA 1RXFA 5CNAA 3WNMA 3N9MA 4OUEA 4NR1A 4TV9A 4DXRA 3JD4A 5EYYA 3JASB 2VG9A 3AZWA 1GOGA 5BZBA 2IJKA 4AAXA 4QXHA 5CA3A 1PVC2 3D3QA 4BQ4A 4OQ9A 4XC9A 4H14A 1RUI1 5IY5B 5BR8B 3D3AA 4F6EA 1FI2A 1V6IA 1UX6A 1NY72 3UKVA 2X5IA 3LDCA 1QJX3 3ROUA 4IESA 5F37A 2ZDIA 1OI6A 4CE8A 3CC2V 1LGBA 1YFYA 5BNPB 2Z2SB 1HRI1 1YRZA 3RZLA 1M93A 3OJBA 4YVSB 4JI6B 3TNQA 1XILA 1W8ZA 1WW5A 4YVWA 3J7NA 2QWQB 1W8WA 4YY3O 1YDXA 2ARXA 1XC6A 3LQCA 2G1MA 3PUQA 3ACGA 5J37A 4WBBA 3DXTA 2VNRA 4CEWC 3N7MA 5FZ7A 4I9QA 5DG1A 3WDXA 2XVLA 4EEQA 2BOIA 1AJKA 1W8TA 3CPWU 4RYDA 5IJRA 4YW3A 3OAAG 3BODA 1OVPA 1J3QA 3ETGA 4HPKB 3ABLC 1GOHA 2HWE3 2QGNA 3AKQA 2ORZA 2QWNB 1UY4A 4OX9O 5C4WC 4PDVA 4YZ4A 1A8MA 1UMIA 3A0RA 1IBLB 5LMNB 4WV8A 2B8MA 2XPJA 1OLME 3BI3A 3G4SV 1R1A1 3T1HB 5AFBA 2R061 5LZ6A 2R072 1BMV1 1HP8A 1L8DA 2RS13 3T30A 5IVEA 3AKPA 3LIGA 5IT9N 3HQRA 1TEIA 1IS4A 4JDOA 1BT8A 1SQXH 5IYCO 4LF7O 4BQ5A 4CXWA 4MHUA 4CEYB 4CDUB 3I4IA 2DVDA 3CBNA 3CIHA 3ZFFB 4GKKO 1XE7A 1XHXA 1W8OA 5FZ1A 3H42B 3LFMA 2ZACA 2XDVA 4LHSA 2DDUA 1RUI3 3RRDA 2VUDA 4BCUA 4MVUA 1XNQB 4LT5A 4X65B 5DAWA 2EJRA 1DIWA 5T54A 4Y20A 2DVBA 5C3RA 5LEKA 5A2QN 1HRI3 3TXSA 1SLCA 2WFF1 5F3CA 2OZ6A 4I9WA 3VBUA 5HCBA 4IE6A 4FLUA 1XBFA 2NMOA 2DWRA 1N3OA 5C8YB 1F23A 3M3IA 3WNNA 2BFUS 5B3SC 3LPGA 1SBEA 2GV9A 3JUUA 2IXHA 1L7RA 5FQ0B 5K7PA 1VBA1 5GALA 3JCUZ 4Q4W1 2JG8A 5K9YA 3TN92 3ZYGA 5DAQA 3OTFA 1BS3A 1YQ2A 5CA1B 5L3EA 1W9FA 4LO8A 2A79B 3IB3A 4AR2A 1VP6A 1QCEA 3ZX6A 3ON7A 1ZLZA 5KHKA 5FP9A 1IQAA 2LGWA 3S0MA 1ZVFA 3M7AA 2R72A 3OTOB 3PU8A 3IC7A 2RS32 2UXDB 3IT8A 3RWRD 2YBKA 1PGL2 1R1A3 3O1UA 2YYOA 2R063 4XF0A 2WLJA 1AI7A 4QD2A 4H3WA 3CRQA 5IVJA 5CB4A 1RHI1 3W5MA 2YY1A 2Y60A 1QF3A 1C1FA 4F7ZA 1DQ1A 3AMHA 1VQOV 2NQYA 4YW1A 4CDWA 5JOZA 4KXRA 1GZTA 2Q73A 1AB3A 1BZWA 1BXHA 5FMCA 4IETA 3GVMA 3BTXA 5A7NA 2X6AA 2EIEA 3CWBH 4XJWA 3CXHF 4W6XA 4B8EA 2VMGA 4QPWA 1Q6UA 1SBFA 1IPJA 3AMNA 1W06A 2CGNA 2EVXA 4Y33A 2ZGSA 3VQYA 4PF1A 5KR7A 2EXJA 1VQMV 3RZHA 3OD0A 2WFF3 5FZIA 1DQ2A 2KXLA 4OMDA 2WNVA 4CP9A 1B6QA 2Q8DA 1XNDA 2JEXA 4CH4A 3RVYA 3JARB 1O8SA 4XDKA 4PHZA 4HZFA 4FP2A 5DABA 5GJ6A 3IAYA 4PI2A 2DYCA 2QQWA 1SBDA 3ZMUA 4BK4A 3K0GA 1SFNA 2FMYA 1VBA3 4MX3A 4AILC 5F2WA 2VMEA 4Q4W3 4BIUA 3KF5A 4FBFA 4WVVA 3VZJA 4GIQA 1XNCA 5J9PC 1EAH2 3B3QE 5B1NA 4YZ5A 4OQ8A 1AXYA 2JD4A 3KGLA 2QDRA 3AP7A 3ASNB 4EV0A 1GN6A 3EJKA 2I45A 4R9BA 4PDMA 3ZS8C 1GQGA 3WG3A 1AXZA 5KA5A 1N3PA 3OEHG 2BBAA 2QQPA 1IXBA 2EZPA 3CRAA 3OR7C 2UXBB 4ZXKA 5C7GA 1ZRFA 4CC5A 1NLRA 1ND2C 2YXYA 5JCOA 4Y22B 4YW5A 3S3XA 1WBLA 4HVRA 5LXTB 3WF2A 4O2AB 4E4HA 1ZA4A 4QPGA 3J81N 1R73A 2YGLA 1RHI3 3SXWA 1SQFA 1V6JA 2QQJA 2W46A 5KMGB 4U2AA 2XTAA 4CS3A 2BZDA 5DPNA 4A45A 3TEYA 1XNTA 5LOVB 5FL7G 1WLCA 2BOJA 2UY8A 2RE9A 3OGIB 4O4JA 4I55B 4F4LA 5B4NA 3S30A 1H4GA 4WM7B 4XVHA 3UKMA 2V1DA 1UMZA 5B1BC 1DGSA 3SLIA 4I0XA 3SKVA 5EIYB 1BEV2 1FKAO 1US6A 2ZX1A 3NXSA 5FUIA 4MTXA 2VZSA 4JI4B 2W2IA 4OFGA 2M6YA 3BTAA 3K46A 4INDA 1YJLA 5AC92 1HNWO 4B3SB 1CAWB 4EZHA 2XB6C 5FFOC 2FB5A 1LU1A 4KQ7A 1GUIA 1D4M2 1EN4A 1HN0A 1O5LA 3I2FA 2DQ0A 4GT1A 3RMXA 2QE3A 2J1TA 1VBE1 4JASA 4QQOA 2WLLB 1C8NA 1ZZ7A 3OFNG 2HLDG 4PDWB 4C1XA 5J2UA 4IE5A 1GM9A 4BLJA 1J95A 1GMMA 3E6CC 1WNSA 1E5IA 1XNRO 1R3LC 2QBXA 4RGKA 3QO7A 1JYIA 4GQ7A 4YJ3B 3ZN5A 1VB4A 1Q8SA 2ATFA 4LWSB 3W7XA 4J1WA 3ST7A 1ORQC 1T5EA 4OUMA 1L3JA 4G28B 2D5FA 4UW5A 2WO2A 4IGGA 2PLV2 3HMYA 1VARA 1W6OA 1I5ZA 2BU9A 2EIMC 2Z3YA 3UETA 5A1AA 4PDLA 5F5QA 3OGGA 4ZS3A 5LMUB 3LIHA 3PN1A 3GM8A 2L35A 1ZTEA 4MSVA 1W9TA 1XJAA 4IW3A 5JQGB 1KP2A 5FY1A 1Y9QA 1K5MC 2PF4E 1DTOA 2Q1ZB 2Y6LA 3DPRC 4HK8A 2RMU2 4O4LB 4LIUA 2ZGNA 4NTWA 4XJZA 4JAUA 2P6HA 3G71V 5IYBO 3LEMA 4IV3B 2QCSB 5FPXA 3AZYA 4U7NA 5FMDA 1PZ8A 3K0DA 2NN8A 2BQPA 3UGHA 3MAQA 3IPVA 3N7LA 2QKAA 4JTNA 3ETDA 2XJSA 4MVQA 1W6QA 3O0XA 4KNCA 2CDYA 2C24A 1N33O 4J11A 1EUTA 2YI8A 2VTXJ 3GDBA 1VBE3 2P3JA 2UXXA 1AILA 4JGYA 3B9IA 4DOUA 5FLJA 5FUNA 4MW3A 1SFYA 1KKCA 2JWPA 4MVZA 4K6BA 2E7TA 3L71H 4X88A 3AG7A 3R6SA 2WINB 3R4SA 4MVTA 1N8RW 2RS51 5FY9A 2EIBA 3OT7A 1GQHA 3BU7A 5LBEA 1E79G 2PYTA 3VZNA 1ND3A 4ARXA 5GZGA 1O3SA 1OCRB 2EILB 4P9XA 4DR7O 3IMNA 3OPTA 1KQRA 3WG7C 1YQCA 4IHJA 5A33A 3O9OA 1W8FA 3NNMA 4GALA 1UQXA 1W3XA 2D7FA 1OLQA 2JG9A 3WINE 1E5SA 4JC1A 5J2TB 5CG8A 2Q5TA 1W8NA 4AEDC 5HFLA 1M57B 1ZNPA 1V54B 1EUUA 3IKWA 1IQDC 3N36A 3K9AA 2WWUA 2YV8A 1OH3A 4DRXA 1AR92 1O3QA 2W3JA 1B06A 5D8AA 1VP7A 1S2BA 3DXUA 2WLKA 3E8HA 3ZMVA 1E57A 3FZ3A 4MXVA 1G6NA 1MOFA 4XW3A 5JMOA 2WUHA 2WZPP 4N53C 4EB6B 2D6PA 1OQ1A 2EIKC 2YMZA 1NQTA 1L1FA 4AEJA 4ISRA 4XFHA 4AVSA 4JI1B 2CAUA 2VCAA 3ZXAC 1H1AA 4KH9A 5A7WA 4I50A 4LE4A 3ZSEA 4YG0A 2HH9A 3O7OA 1UU4A 4DIQA 5A70A 1HJGA 1S0GA 2Y38A 2W6JG 3E8FA 4PT6A 2WO1A 3KB5A 1HB4A 3N3HA 4IGQA 3MBWA 4WVMB 4DR3B 3UK9A 4JZ2A 2OXBA 4BM8A 1WKYA 3DKWA 4WFEA 4K21A 1WLTA 2AZ0A 5L9VA 4JV5O 4CPBD 2X5IC 1MS8A 1TNRA 4O65A 3CHXA 1DLCA 3I49A 5C8WA 2ZDIC 2AZ2A 4QKBA 1ZBE2 2ZX4A 2R1BA 2RR11 4LBKA 4NHKA 4QU2A 5FP8A 4RHV1 1UN1A 4HK9A 1OFNA 4ZKIA 5FZLA 1I3HA 1LEDA 4UXNA 2B5UA 3DUIA 3MPPG 3H1KH 4R8CA 4YVWC 3ZYPA 5F2SA 5KC6A 5GONA 2RS53 4X1YB 4AQSA 3RW0A 4DUVA 1DGWX 4RQFA 4FLTA 4DXSA 3JD0A 4LF5B 2B7YA 1SESA 1D2DA 1MS3A 1VLNA 3POJA 5A3UA 2TUNA 1SQ4A 2GMPA 4CVUA 1XBLA 5BNOA 3CS5A 1CP9A 2DV9A 4A6SA 4RL7A 4F8AA 2VXJA 5A3OA 1FFXA 2ZPXA 3V0AB 1PM4A 1BHGA 3OM3B 3AZVA 2DYRC 4HKLA 1WAZA 5F2VO 5GM0A 3AMMA 4LO4B 4A7YA 5E16A 1PZ9A 3M3QA 4JI5B 1W0OA 3LOIA 1PVXA 2XAGA 2VQTA 2YG0A 2CAVA 1TVKA 5FREA 5FYIA 2IBZH 4HXCA 3BIWE 3NW4A 5BNNB 1YJWV 2OTLV 3M3CA 2JDIG 5CU1A 1N0JA 4BYYA 1VF6A 4S2HA 4COYA 5FYUA 2B42B 2OPWA 4Q4V1 4RUEA 4Q6GA 2ADQB 3ZRVA 1URFA 3AG1C 1RIRA 1URXA 4GKJB 3KV6A 2IW5A 1BK1A 1NA1B 4LBJA 2VUJA 3FX7A 1OKQA 3HJRA 2FMLA 2KD7A 2BNNA 4NN0A 2E9QA 4YM2A 1MEC2 2V73A 2A9HA 2IH3C 1U0AA 2PTMA 4PLOA 2DTWA 4GWNA 1NLQA 4PIYA 4FPGA 5FZ6A 1GTOA 3WZ1A 3I2GA 5DG2A 1O3TA 4MO3M 3RI9A 2CAZC 3D5OA 4G4FA 2PELA 5A32A 4LF4B 4DXZA 2RR13 1QVFU 2KG7A 3C7HA 1K34A 4FPYA 2JDYA 4JI8O 2DBNA 1Y9MA 3SGIA 5JAXA 1ZZ8A 4RHV3 5FAXA 3HT2A 1S1AA 3ZMTA 2IWGB 2HWD2 4XBFA 3VBUC 1WB8A 1GWKA 3RMYA 4BMEA 4S2DA 3M8LA 4XJ9A 3N9OA 1SLAA 2ZABA 1I7FA 4CUGA 2CK3G 4P9IA 3I55V 4E2GA 3GNEA 2Y69B 4E8DA 2JG8C 3NSTA 1S0DA 4QXCA 2ZE7A 2VVEA 3M70A 5FXVA 4LULA 4FTEA 2DVAA 4M4PA 3CL1A 2YSUB 2C4XA 4Q4X2 1GICA 3E6BA 3KV9A 5FUPA 4DV3B 1JYXA 2ES3A 2VZUA 3FLPA 1HRV1 2AGAA 2QEXV 2X29A 3AG4B 3BEHA 3HPNA 2HEYF 4NOTA 1A3KA 4NMIA 1SDWA 4GULA 1W0KG 2P3IA 1QR9A 3ZXEA 2K46A 1N0NA 1SKVA 2WNUB 2ZHLA 1BVVA 3D6EA 5DEDA 1MS0A 2YB7A 4Q4V3 3AK0A 3LFIA 5LA6B 2YUAA 1U5IA 3B9CA 5L7OA 2XH6A 4AQ6A 4WFAV 3VBOA 5J1XA 4EE2A 3MO4A 4DV0O 1QBZA 4AI2A 2ZINA 1PGW2 4COZA 2XL9A 3T0AA 1YHQV 3RZGA 4CDWC 4GB31 3CF6E 2DOSA 1V6KA 3JU9A 4PA6A 2QFEA 4XUNA 3IN9A 5F5AA 1KBHA 2P5OA 2K0GA 4LQRA 2YEVA 3ZFEB 4B3MO 1M56B 3K59A 4JTDB 1RUD2 1YZBA 4AAPA 4XF1A 3OY8B 4N21A 3JBG1 4ASUG 2Z0AA 2A06H 1JS9A 5DZGA 2HP8A 1NXMA 4XF3A 3EQEA 3VKNA 2WNVC 2GALA 2RJKA 1RMU2 3ABMB 4LA3A 2Y0PA 2QUOA 1NCRA 1RL3A 1OOPA 3N7KA 3OEAA 3AG2C 3WDVA 4XURA 5DDJ1 1WWYA 2PY5A 1F2NA 5IAXA 3CX5F 1PK6A 2ARAA 2W5FA 1JYCA 3X29B 4J1XA 4DR5B 4ZPIA 2YIDA 2IVJA 4GWJA 2DW4A 3VD9A 4DNYA 4G9SB 3STLC 4MGSA 4WFGA 2N05A 1CZTA 1GLHA 4X1IA 1H6YA 4KG8A 2VRZA 1CAXB 2G19A 1XREA 4FOQA 2V4DA 3NV4A 4J80A 5F9TA 5T5LA 2A7AA 3ZIWA 3OUFA 4CP2A 2WZR1 1FV2A 5JCOC 3RJRA 2CH7A 4X62O 3USUA 2IXCA 4FFFA 3A22A 4R8HA 5BV6A 3QNEA 3T2TA 1YCIA 1HJFA 3ZMSA 1FOD2 4JTAB 3GF6A 1LTEA 2BNMA 1UPSA 2G4IA 4QHOA 3W58A 2VBPA 3D4KA 4LJHA 1UY3A 4GB33 3W7UA 2PAMA 4ZU5A 1DLLA 4JYAO 4LNUA 3U78A 2WAMA 3AJYA 4QPIA 2QDOA 1NH2D 4QIWF 2VOXA 5L9BA 2QZ3A 4QNHB 1OLMA 4CCJA 1S0JA 3UM7A 1RSOB 2WDBA 2BOCC 4LA2A 2N74A 5EBWC 3CC7V 1XQNA 2DFBA 1O8PA 3JBG3 1FMD1 3MD0A 3HT1A 4M01A 3S5QA 3OE7G 5B66Z 3LWCA 2NM1A 4L0PA 5EIBC 4CEWB 1VR3A 3LA7A 4UW4A 2BVVA 2VL4A 3L75H 3DXRB 3V0BA 4XZPA 1JH5A 2YIBD 2GP3A 4CDQA 5T3NA 5FBZA 5BMVB 4P5HA 2E7AA 5DDJ3 1N4CA 1JMKC 2E32A 1LNQA 2ENRA 4LKEA 1GH6A 4D6QA 3RQ0A 2YC2A 3FHAA 4DPNA 4JI7B 3DSQA 3J7MA 1YJNV 2ZM6O 4C7UA 5L3BA 5C4WB 1K97A 5FP7A 2AZ5A 2RHPA 1OCCC 3C90A 4BAYA 2CDOA 3AFGA 1LHVA 3H1YA 4BR6A 1AI5A 1R092 2ETEA 2GH8A 1NE4A 5I0TA 1TUBB 4QQLA 2WZR3 4DUZB 2D43A 1EPWA 3SPCA 3B7MA 4I4TA 4CXXA 3GJAA 4UUJC 4NHMA 1IBKB 2C9KA 2QQLA 2WWWA 3HKEB 3I3DA 4M0NA 2H6CA 2Z5UA 4QKFA 2J7MA 1COV1 1YO8A 3K3WA 3ZBHA 4YXWG 4J9ZB 2CTWA 2UWCA 2B1IA 1H8TA 4XFIA 3F5WC 3MHHC 3K5MA 1QJFA 2UUBO 4DV2O 3NWKA 2PHXA 2J1EA 3SH3A 1Q90D 4MTOA 1AP6A 1W39A 3AMQA 1I94O 4BW5A 3KV4A 2HWB2 1XE0A 2D3PA 2KR2A 3UGFA 3DYMA 4A5UB 1Q8VA 4W6WA 3ZR5A 1QOSA 1Q8OA 5D21A 5IYZB 5IVVA 3SR2C 1DQ5A 3DC5A 1QWRA 5B3SB 3OD4A 3I59B 1AP5A 1FMD3 2XQXA 5EYPA 5C5TA 4R50A 4X8AA 3E89A 1H2SB 1DF0A 1G8WA 1DG6A 3T08A 2JEMA 5LA9A 4RSUA 5A7PA 1GANA 5EJZB 1HXS1 2Z5WA 2JGDB 3RGBA 3T1YO 2WS91 3J8F1 3P5BA 3HB3B 1CZVA 1LKNA 4D6RA 2ARBA 2OIEA 4URAA 5ACA1 2ET7A 1GQPA 3LKJA 1LNSA 1VQ7V 4Q20A 1Z5WA 4NHYA 1CAUA 3GJBA 4JGYC 2BW8A 4CCOA 2XWJB 4JRAA 1S77D 2O14A 1W8UA 2KA3A 1WCKA 1ULPA 2YFZA 4K9SA 4K0KB 3I3QA 5HV4A 3OOXA 4LFAO 2A0LA 3RSJA 1QJX2 3HBKA 1DGRA 3RZKA 1WGPA 2AEYA 3VLBB 3KVBA 4QM9A 2GTAA 1YQ6A 3AX4A 4MG2A 4Y5SA 1ND3C 1TG7A 3QF7A 4X66O 3CZUA 5L36A 1VIWB 2WKKA 2SLIA 1ZYBA 4OUSA 4ES8A 2B9VA 3CLPA 1QH7A 1W9WA 3E5XA 4UCUA 2LFRA 4XF9A 2JG9C 4E4SA 5JJNB 1COV3 1JOYA 4ZONA 1UY0A 3R05A 4LR3A 3ABUA 2XHBA 1JHJA 1VPHA 3E22A 4N43A 2W1WA 3K9SA 4FSJA 3ZM8A 1MZFA 3FB6C 5D8AC 3HN1A 2PA7A 5EZYB 4RUFA 4DYLA 3ELNA 1S5JA 4P9OA 2VQFB 2RQ6A 1G9CA 4L2NA 1BL8A 5LW9A 5LP6A 5FYMA 3N2KB 3ZHTA 3AP5A 2E7QA 1F8VA 1NVPD 1QH6A 4NIAA 4IE7A 3CDZB 3RG0A 3A0KA 1VAVA 4QDSA 5BUVA 1GKFA 5A3LA 5FPZA 1PM7A 1UNBA 4Y1YA 2XVKA 3J7HA 1ALYA 2FCUA 5LHIA 2PI5A 2DMXA 2RS12 4XEZA 2EIGA 1HXS3 5DZEA 4QXBA 1SA0A 4B1LA 2WS93 4DV6B 3J8F3 4H13B 3BUCA 3UJOA 3JAWB 3AXDA 5ACA3 3JALB 3ZRWB 5IW0A 4LBQB 4NWVA 3WP5A 3ZVXA 4KWJA 4ASLA 2YU2A 2UU9O 5FLXN 2QE7G 1PO13 1FAYA 1RUI2 4WFBV 1UWWA 5HFMA 4AFAA 1GMGA 2HHHO 1UZVA 1ND2B 2VH9A 3RN4A 2VMCA 2PXJA 4LF8B 1HRI2 1KDMA 1XNKA 1JQ0A 2K9PA 4A44A 4V2WA 4QHZA 4BH9A 3AYDA 3WNOA 1DQ0A 2RDRA 4L92A 4IERA 1OCZC 5BNOC 3BCCH 1K3IA 4FJCC 1H30A 1OH4A 4AVCA 2ZGTA 3KVAA 3NJVA 1UPIA 1DLBA 4KGGA 2VJXA 4XIKA 1XXNA 1LOAA 4ET7A 3N9PA 3HQUA 1LUWA 4TQFA 4KP4A 2EIJC 5B1BB 3OUSA 2MPFA 2VXRA 3TXQA 4YW7A 1KDKA 4FO9A 1F9KA 4XXAA 4QGPA 1PNFA 2GUZA 3RYHB 4IE0A 5FYSA 1VF6C 1LJ7A 1PX4A 4QPJA 2R49A 5CB7A 3AKSA 2XG3A 2FTKA 1JOBA 4H7LA 1R1A2 2R062 3UQ8A 4UFZA 1BMV2 2IC1A 4XTPA 2XUMA 2GC0A 1M9NA 1JPXA 1X9PA 3WG1A 1YI9A 2PUSA 5IVBA 4BZ4A 4Q4Y1 3SC7X 1RUOA 1GSLA 3J4UH 4G27B 3ZIXA 4HG6B 4QXKA 1NCQA 1PL0A 5A6ZA 2PQQA 2D93A 3LDEA 1KQSU 2W9XA 3ZR6A 3VDAA 3AVSA 2QM8A 5IWAB 1AI6A 1HLCA 5BY1A 5AVPA 1YFWA 5I93A 4YIPA 2E31A 3APQA 4XTMA 3W21A 4FM1A 2ZGLA 4A3ZA 2XAHA 4RD7A 2EIMB 4P9YA 3I2IA 2WFF2 5A3PA 2XLAA 3NRUA 3ZOIA 4XYXA 4AW7A 2PYJA 1GK9A 4W4LA 5M0TA 4A4AA 4ZI7B 3CMAV 1D4VB 2UWAA 4WBNA 3AG3C 1YJKA 1E1RG 1U5ZA 3MUY1 5JWPA 3DC6A 3WDTA 3WW3A 1VBA2 3MDSA 1K5MB 2FHRA 1OD3A 4Q4W2 3BOPA 3O1TA 2QM7A 4G3YC 2XNDG 2XAJA 3DPRB 4O2BA 3SYOA 2VQEB 4MVMA 2BGPA 1XNQO 2XHNA 2IXKA 1RJ7A 3PTRB 4J7ZA 4DXTA 2HFEC 4I7ZB 3E8BA 1ONAA 2Q0OC 1QVGU 1OHFA 4TV8A 1AR5A 5I8YA 3D8CA 4ZY9A 1IKPA 3EBRA 4UT5A 1T2XA 2AXTZ 5L7OC 4HBNA 4QKDA 3VBOC 2YGMA 4PELA 3UESA 3D0SA 4QQ2A 2JJ1G 1RHI2 1X9TA 4Q4Y3 5E1RA 5E89A 4NXMB 2LW8A 2SBAA 1ZZ6A 2ITCC 1R64A 2KSDA 1YNAA 3HKDB 1MQTA 1IURA 2NR5A 1OSGA 4IGPA 3OTOO 5LCWL 4YSFA 4DR4B 4J7KA 2UXDO 1JYNA 1Y9GA 3EMRA 3FMGA 3WG7B 3AB0A 1YTFB 1EP0A 1PO21 5H6RA 4AFBA 1NZ6A 4D6TH 4AVAA 4PJ0Z 3ZN4A 1NCRC 4QJFB 1OQEA 5J7MA 1OOPC 2WC2A 4AEDB 4UWDA 4NPLA 1Y7BA 2EXKA 4B4PA 3ZSJA 3ACIA 1RJ8A 5EC2C 1PK6C 1AI4A 2IXLA 4LKSA 1DQ4A 2VNOA 5GZDA 4O4IB 1ZRIA 3HIFA 4QM8A 1BVP1 4TUYA 4UBHA 1PHMA 3CD6V 4DR2O 1CR7A 3PU3A 1ZM1A 2ZZJA 1MVEA 4OXSA 4HFSA 4N53B 3KMHA 2H94A 2EXHA 3ALQA 1ULDA 3TAYA 4B7EA 3ZMOA 1IPSA 5DN6G 2EIKB 5KAFZ 1YIFA 3NNGA 1JYWA 3HR0A 5HBAA 5A9GA 4TV9B 3ATGA 1ZBE1 3KV5A 5EPAA 1IBMB 1QDOA 4FXKB 3MLKA 1Y74B 3M4FA 2B9UA 2OIGA 3ZN0A 4UVAA 1K73W 1UOFA 3WEZA 4C90A 5KUKA 2QTSA 3LEGA 1NVPB 1O3RA 4J9YB 1AL21 2RN9A 3ECQA 4D8MA 3VZLA 2X5IB 3EHBB 3NO8A 3OPWA 4L9BA 1U12A 1IX9A 2XAFA 2WNEA 2J1RA 2JIGA 5FPUA 3I2JA 1ZWIC 4U3JB 3CKHA 1N1SA 4CPBA 3H0OA 4YVWB 4LITA 5LGUA 3ZO0B 1VQPV 2V72A 1OA4A 1CIWA 5C8YA 1KECA 1VQKV 2VUAA 4XFAA 1PO23 1JMUB 4NO4A 3ACHA 4Q29A 3POYA 1OXCA 3GXUA 3WT3A 4CDQC 1G6UA 3RFRA 2RJ2A 5JPNB 2DYRB 5FV3A 5G05L 5J09A 2EINC 1FNZA 4X20B 1AXKA 5FYTA 4EWAA 2WSSG 2JENA 3LDBA 1HDJA 4QX7A 3GB7C 1NTZH 3PUSA 4FLVA 1HR0B 1VBE2 1DDLA 4R4ZA 4TYSA 4GMP1 2RVAA 4XDPA 4IEQA 1FS0G 5J48A 2Y64A 5FO9B 4MGQA 3I54A 1SG3A 3V64A 2W0FC 5LA0A 5IWFA 2WT2A 3HEIA 2VCMA 3AG1B 1A32A 3CJIA 2CU5A 2B1GA 2VVFA 2JD9A 2QA4V 2IXIA 3K06A 1UOBA 1VALA 4FPFA 5CIRA 1P7GA 3R65A 4LE3A 1NAEA 1ZZ9A 5AFEA 1F4AA 3MEPA 5FIXA 3IC9A 5FWJA 5KWRA 1H8TC 3WCRA 2IU3A 2FCVA 2G9ZA 3POSA 4P9JA 1JYVA 1VQNV 1AL23 1K8AW 1FYUA 3B69A 5ISLA 5JIAA 2ZMNA 2FDFA 5JMCA 1K4CC 1OQDA 4GD4A 4LO7A 4QPYA 5GKAC 2A5ZA 2W91A 3KQ4B 4Y20B 2RJZA 5DQ0A 1M4WA 4LXLA 1JUHA 3KT7A 2NMNA 3VBUB 2A3QA 1HW5A 2JGUA 4MLOA 1Y4MA 5FZ8A 2F4PA 4HNAA 1AJPA 4LKFA 4DXWA 3BHPA 4Q0SA 4OHZA 3WU2Z 2JG8B 3ASIA 1J83A 3VBSA 5CEHA 3BOWA 4QE9A 1QLNA 2Q7GA 5F7UA 4AGRA 3APOA 5FYHA 3K2OA 5FY0A 1JU4A 2CUGA 3RPQA 2IXJA 2CGPA 3H8RA 4LF6O 3BIEA 2R7EB 4HSLA 4YY3B 4R7CA 1O59A 3CXCU 2JDPA 4LO5B 5GZFA 1Z7S1 1OFSA 1RITA 4GMP3 3VHRA 1STMA 1W2TA 1AX1A 3RZMA 3KCYA 1Q43A 2FBEA 3N9LA 3OF1A 4I09A 3VBRA 5EJ3A 3VKMA 3POBA 2JICA 1RUH3 5LXTA 4O2AA 3PIGA 5CB4B 1SZBA 1X50A 1Z2GA 2R32A 2A70A 2RS52 3T1CA 3ZYIB 4FM0A 4BJ0A 1NT0A 1YHFA 1NQDA 4UYBA 2ADPA 4CDWB 3S5AA 2CDPA 1YWKA 1TMF1 1IOAA 4FPKA 3ABKC 4OX9B 3CMEV 5LK7B 1TE1B 4N43C 2CHHA 4JDNA 5JLVA 1F5FA 1SDDB 5KHIA 2B39A 2Q67A 1O9HA 5CA6A 4BIFA 3WNPA 1PKXA 1AL0G 1J1LA 4WZFA 3E2EA 3BALA 4A2UA 1K7DA 5LP6C 4OLLA 5EWSA 2R041 5IVYA 2F1MA 1CESA 4H2AA 2WNVB 4CP9B 3AL6A 5IK5A 3POWA 4Q27A 2HKOA 4NUBA 1IZ3A 1DZQA 2HWC1 3AG2B 5EHDA 3LE0A 4KU8A 4JTCB 1PNLA 2YZ4A 5JXHA 2XLGA 4YW4A 4RFT0 3VDDA 5H9RA 2CWSA 2Y4UA 1MVQA 3AKTA 5K0UA 2W1QA 2V4AA 1VMHA 3T2MA 1B04A 4AK3A 3ES1A 2ARCA 2FDGA 3I2KA 1L7LA 4A3XA 3H8OA 1H8EG 3K48A 4IEOA 4NYKA 4COUA 1QU0A 4ZHQA 4EJRA 4E8CA 3HKCA 3DL3A 1Z7S3 3BKZA 5HPOA 2CTPA 2RR12 2VWKA 2XONA 5I0SA 3WB2A 3ETEA 4RHV2 2Q6AA 4X9QA 4WFFA 2YI9A 4CH3A 3A21A 4KWKA 3CSXA 1AVBA 5FYBA 3AYCA 5D1IA 1EFRG 2A3YA 2W94A 3SPJA 5FCCA 1QNYA 2GNTA 2HYXA 3G6JB 1TMF3 1GP4A 4O4JB 4DR3O 2QWPB 1N34B 2NYYA 5JQGA 1YUDA 4HETA 3ZN6A 1CPMA 4DV1O 3J26N 4NIHA 2IJJA 3NJYA 4XHBA 1R6TA 4J10A 2L9LA 2BRTA 5JOWA 2R043 4DW1A 2GSMB 4HONA 3JSNA 2VZTA 4XUQA 1G86A 3DTUB 2EBOA 1BZKA 1W0NA 4IIJA 1ZAUA 5T55A 4OHYA 4TOIA 4V2VA 2HWC3 1Y43B 3NJZA 1R091 4PQ9A 4Q4V2 3VL9A 1EZJA 1GAXA 1VB2A 1AHSA 4NIDA 2YIBA 3ZHUA 5J2UB 5APAA 4DV5B 4IL7A 3TB0A 1XB9A 3B02A 1DF4A 4AHCA 5C70A 3QCWA 2ZEWA 1OCCB 3M8AA 1SCRA 2VOVA 1N32B 4X89A 1UIKA 3H9VA 2WN3A 2D5HA 4JI3O 2ET1A 1RPRA 1J3RA 4Q0UA 3URFA 4Q8KA 1GP5A 4ASMB 1QKQA 2VZPA 3FUOA 3SEEA 1VQLV 4JKLA 1W6OB 1OF4A 3UO3A 3E35A 1Q6IA 2VD7A 2BFUL 4ASKA 1ZZBA 5J3UA 1NKGA 3WF1A 2Y6JA 4ISQA 1HX6A 3K08A 2XASA 2HEVF 3F7VC 3U37A 3T1MA 3ZSKA 2QQMA 1OUSA 3WHTA 1I08A 4EWEA 1QJU1 4DO0A 3Q8CA 1EPZA 3VZKA 3ICXA 3NR7A 2Y0IA 5J36A 2NZ9A 2WIIB 3VL8A 2L6LA 1R1BA 3GCXA 4UVBA 5G04L 2QQIA 3U0ZA 5FJKA 1Y66A 1QHTA 3ILRA 2JKBA 3B40A 4BXFA 3LDDA 3HQXA 4KWUA 5FYCA 3WNLA 3IPVB 1UYZA 2XJPA 3K77A 3FB5C 1J3PA 1SACA 1W6QB 1KUQA 1NG0A 3HR9A 1BQZA 3K75B 4B1MA 3R4UA 2YXSA 5J98B 3T3YA 3SJCC 4RR3A 1VMFA 2AH2A 1GBGA 4JGYB 3S7IA 5FMBA 1C4RA 5FYVA 1W2UA 3JB4C 2Q1FA 3ML0A 1LCLA 4MVSA 4NTXA 2EA7A 1RUNA 1GZ9A 3BU0A 4GB32 1Z5VA 1W6NA 5H6QA 1JZ7A 4MYEA 1MQTC 3PIJA 1AZDA 4DMIA 1IPKA 1HNWB 5IFPA 2EJ7A 1ND3B 1QMJA 3MF9A 4BQ3A 4XACA 2P37A 1Z78A 2FYUH 3BRCA 2AUYA 4QWNA 4IHJB 5A33B 1G7YA 1NZIA 1C28A 1GNYA 2R70A 3JBG2 1Y67A 2JG9B 1CXZB 4XILA 4PA9A 2WLIA 3WNKA 3X2QC 4UV9A 1UU6A 2BTVC 2FMDA 3OGRA 4AHXA 3H1IH 1O5UA 3BPZA 4DRXB 1XNRB 3SYQA 5LK5A 3WP6A 3AJZA 3MGUA 1BE3H 5D8AB 3UV9A 4JAVA 5FP3A 2WAAA 1COWG 5DDJ2 1KGYA 2Y6FA 3ZPOA 5KXEA 4ATFA 1CJDA 3WCSA 1QJU3 4AQ2A 3NNJA 1BQPA 5LBFA 5DAPA 1KS4A 5CADA 2XUEA 4Y1XA 3LPFA 1Y4WA 5IUQA 2JE8A 1LOBA 2ODMA 3JCZA 1QQCA 3ZSLA 4DUYB 4DR6B 1FXZA 2BUKA 2YUEA 3P6BA 3KWVA 3ZHRA 1S2KA 3MIFA 2MNGA 5A7WB 1D7PM 4NAMA 4B08A 2BE3A 4LF9O 1JOJA 5LASA 3J7LA 2WZR2 3I2DA 4HT1T 3ETPA 3WX5A 1X4TA 3VD3A 4NJ4A 4I01A 1HV1A 2OQ7A 1QHDA 1KITA 1SETA 4XABA 2B9ZA 1BBT1 4EYUA 5LRRA 4AFDA 5GONB 5FZBA 2Q9LA 2UUAO 3D82A 4XE9A 4UFHA 4Y1ZA 4C91A 3D3IA 3FLTA 4XXPA 3SHRA 4C0HA 4CH5A 1JFFA 4KHPO 4I2OA 3ZXGA 3ZYFA 1OCZB 5DXDA 5BNOB 3PVEA 2BWAA 4NE9A 1W0PA 3WUDA 3LNMB 1FMD2 4YJ2A 1FFXB 3C8XA 1K5QA 1O9GA 4BHPA 1FXVA 3E86A 4YW6A 4R9AA 5JVDA 3WF0A 1HWYA 4A41A 3JCIA 2A6YA 3VQWA 5LGNA 5C9AA 4QX3A 5H5NA 4PIZA 2EIJB 2K9ZA 1XE8A 1Q7YW 2HBUA 1YI7A 2GMMA 2B5HA 3ES4A 4GZ9A 5C8CA 1Q6HA 5ABJA 2J42A 4GKXA 2CV6A 1JZ4A 4HKWA 3NMBA 2EF6A 2YBPA 4IEZA 2F43G 1L0LH 4O4HA 3CJIC 5CBLA 4RFRB 1YXBA 1RYYA 3UYJA 3VKOA 5K1PA 1N3QA 1GYKA 4DZGA 2G38A 1UKGA 2AYHA 2DFCA 4KL1A 4BQXA 1HNXO 3QH6A 1REDA 3I8TA 4BWAA 2IH1C 3U07A 1LHUA 5IJ0A 5HCHA 1KS5A 4DUWA 2OUJA 1UY1A 1COV2 4WFHA 3DEMA 1DGWA 3VGIA 2K1EA 5A32B 4FFHA 3RVZA 4QHBA 3CCUV 4JI7O 3JD71 2KG7B 3C7OA 4OHXA 5FR3A 1ENRA 1BBT3 2Q4PA 4JTOA 3QACA 2A6XA 5IVCA 1LULA 1D5AA 3BABA 2XJRA 4FFKA 4F6RA 3B8NA 3VBHA 4CCLA 3ZHQA 4GX5A 4HAMA 4GAZA 1JZ3A 4DUZO 1V9U1 3IAQA 1X36A 5F5CA 1IS3A 5JZGA 3VBSC 2DU0A 3IZOA 1CX4A 3AG3B 3BGAA 4JV5B 4LFBO 4FFIA 4W6YA 1MSWD 2KKWA 1BLZA 2ZGRA 4FFBA 3IIIA 1S0IA 4R52A 1HXS2 1H38A 4MOAA 3UCSC 2ZGQA 3B4SA 4L99A 2WS92 3J8F2 3SNMA 1HQLA 1CAXA 1MG1A 5ACA2 4YIOA 2Q69A 3K58A 2E6VA 1BKZA 1G9FA 4FOWA 4AEMA 4GMP0 1ULGA 1PO12 1OC1A 1TZOA 1IS6A 2FQPA 3VBRC 2XT9A 2VNGA 4NAOA 5JOYA 3ACFA 5L7OB 5GLZA 3VBOB 4EFEA 3L72H 4EN7B 3H50A 3A0BZ 3NQHA 5JJEB 4QMAA 2BPA2 4IQPA 1XU1A 1HNZO 1A34A 2JRIA 1C8M1 2DCTA 1RUE1 1VQ6V 4AHYA 4FLWA 2YEVB 4IT5A 3C3TA 1WMXA 2AW9A 1QXRA 2BEOA 5A7OA 4MUVA 5F39A 5B1AC 3WQBA 4LKDA 3FE5A 2O8QA 4LHLA 1WA6X 2D6LX 2WYFA 2YDEA 1IXMA 2XKOA 1PIV1 3FYEB 3JD73 1Y76A 2YXHA 3VUOA 4RN5A 2DCJA 5IAVA 5T5PA 1YVWA 4LCUC 4K0KO 1F5JA 3JATA 1OD5A 3LB9A 4XUPA 3LD8A 3AYEA 3J7AU 4FTBA 5FXXA 1ULEA 3LDKA 4DY5A 1SC5B 1NCRB 2BNOA 1OOPB 3DXRA 1V9U3 3U75A 4GLXA 2DCZA 2H0VA 2ZMKA 5BMVA 1PK6B 4QQHA 3VDDC 5K0UC 4U7OA 5EZWA 1HB1A 1E5RA 5SV5A 4XIOA 2XJUA 2WA3A 1U5YA 3ZHVA 3ZYBA 5HXMA 3M7MX 5FZ4A 3HNYM 1W6PA 3LDRA 1WCSA 3RWKX 1SLTA 3Q8EA 4ORFA 4MW8A 2CH7B 2VUCA 1QNWA 3USUB 4DW0A 1M4UA 2VZ1A 1WW6A 3UT5A 2P3YA 2BCCH 3BPSA 3TBDA 3H8XA 3H9AA 2R30A 4Z07A 1H2KA 3G6BA 4BOWA 3Q9OA 4L11A 4HOOA 2AGSA 4TWKA 4NXNB 2OKXA 3HAGA 4LNUB 1C8M3 4P08A 5EV7A 1NYWA 1RUE3 4H37A 2HJIA 4DV6O 2LROA 1UZWA 1DYKA 1D2QA 1DGRN 2P1BA 4JZRA 3CO2A 3Q4HA 2VVDA 4M3CF 4PQQA 1UCXA 2WLNA 4JGZA 1PIV3 1KB9F 2YS8A 4Q26A 1ODNA 4CCDA 3I59A 5JH7A 1IKQA 2D97A 3PMEA 3VKLA 1YFXA 1JI6A 4B3TO 4Z1MG 2A6VA 4KG0A 3V0BB 4U36A 2XBO1 3U1XA 4QB2A 2Q8CA 2UXCO 4CDQB 3DN7A 4LF8O 4QGLA 4LUKA 2Q0AA 4B3MB 2EINB 3EYPA 4TSFG 2ZIMA 3JD2A 1VMJA 3WP3A 2JJ6A 5IK7A 3N2GA 2JK5C 3S7EA 4IGOA 1CONA 2W52A 1PNGA 3MHZA 3G7DA 4RQEA 4C1WA 1AVMA 1OA3A 4B3RO 1B35A 4HVQA 4Q4Y2 1Y6XA 2I07B 3JD3A 2A1XA 4ONUA 2X6CA 2A75A 4NPRA 2G9FA 3PJYA 3FD9A 3HVDA 5HCFA 3TEXA 2ZAHA 2EILC 4I4TB 3T4HB 4OULA 2Q8EA 1SLBA 1U97A 2VZRA 2H3OA 4R9CA 5KC5A 4GH4C 1H8TB 1ZUQA 1GZWA 2QQUA 5B2GB 2PAKA 2Y4TA 1V54C 3E1F1 2BDRA 4HLTA 2PFWA 1HQNA 3KT4A 2ZIOA 2IM9A 2RJLA 4JGSA 5FK7A 2XHKA 2ZGMA 5LA2A 4Z2WA 5EJ1B 3WSOA 2ZX2A 1JTZX 3AMPA 2AHZA 2VR4A 1ENSA 4FT8A 5KAIZ 2R1DA 2YBSA 5CA0B 3APBA 3CE2A 3ZKYA 4JVAA 3BAAA 3INAA 3RYKA 3VZOA 1N47A 4X6QB 1W6MB 4PJYA 4B29A 2DCYA 2QQKA 4CU7A 3ZXKA 5FMOS 5T5JA 3TOJA 2YFUA 1DQ6A 2V4VA 1QGLA 2XBO3 2LRPA 2VW2A 3NNLA 2XOKG 4JYAB 1IS5A 2E76B 3UO2A 3THTA 4PLNA 3AL5A 4RR3C 3D36A 3FHQA 1CAUB 3JAWA 4MGZE 5K8SA 3JALA 1AYM1 5H9PA 1ST8A 1TME1 2LTNA 4LORA 3OB8A 2ZAAA 1R3KC 2VE1A 2RNBA 1AR81 2GH2A 3VV1A 3LEKA 2O57A 4YYOA 2QTWB 3LF7A 5KX5A 2OVUA 4BDVB 2FD8A 3OGCC 4NTYA 2WRAA 4Q2FA 3V65A 1XQ8A 5A1LA 4LFCB 3CCJV 3VD4A 3K4AA 4COVA 3FBYA 1NUKA 1LGNA 2GDSA 2MHFA 1N1VA 1O6UA 4OGQB 2P4EA 1FD9A 1PO22 3ABKB 2ZM6B 3CNAA 2W0XA 3E22B 4N43B 3B00A 1DZRA 5A6YA 2EALA 4AOCA 4RWUA 2JS3A 4GA9A 3OYWA 5CKMA 5LATA 4FM2A 2PHRA 4AQYB 2IZWA 1GU3A 4CCCA 3O1RA 2HEPA 2C1FA 2O0OA 4NHLA 3VHPA 5LP6B 5A1FA 4UFIA 3O5SA 1YIPA 4LIVA 4FAGA 1FJGO 1UJWB 1WMFA 4LBEC 1RUJ1 2GNMA 2PHTA 3RYHA 4N8MA 3JAKA 2QR4A 1DF5A 3WOGA 3N35A 3ZYHA 4FFGA 3B01A 2D40A 2P22C 1ZBA1 5CYYA 2UUBB 4XDOA 4BQ2A 5LB6A 1SA0B 3PUHA 1PMIA 5L3CA 1I94B 2D6OX 3TYJA 4UW6A 4XHXA 4FTSA 1H8VA 2PMWB 1BCXA 3J9SA 3CRRA 1UY2A 4DV4O 4QX1A 4IEWA 3W5NA 4GZRB 1AYM3 3SCHA 4NRQA 1TME3 3HWJA 2R0FA 1AL22 4JHTA 2ZA9A 1AR83 5HV0A 4IV1A 1AF9A 1YJ9V 2F4VO 3RZJA 4PBPA 4DO2A 4BU2A 2JJ2G 4XAAA 1KMIZ 5KHJA 3T1YB 3Q8BA 1D5NA 2QQVA 4K8ZA 3H7JA 4LHKA 5D2AA 4ZU4A 3I7DA 3AK3A 3JSLA 2HYKA 2VZ3A 5LRSA 3IBMA 1IBMO 1RM1C 3ZJZA 1JODA 4ZI7A 4OZXA 5FZOA 5IYYA 1VBC1 2NN4A 4YZ3A 5C3PA 4CBCA 4AWDA 4URTA 2VQAA 2DWEC 1V9PA 3ZXDA 1MS1A 5C9AC 2EZOA 2BTQA 3MHSC 1JN2P 1AYN1 5C8CC 1X82A 5ABJC 1VEWA 2BYVE 3WW1A 4X1KA 4AL9A 4IEVA 2MW2B 3W7WA 2GUZB 4UF0A 1WZXA 2D3OW 1RUJ3 3CCRV 4RQPA 1N36B 2VULA 5F8PA 3GZEA 3P3PA 1TNFA 3MV01 4YWAA 4CCKA 1Q3EA 4CZSA 4YFWA 3I97A 3KKYA 4QE7A 2OA2A 5CVRA 3B77A 3LA2A 5FPAA 2ZGOA 4CSWA 2XWBB 1LHOA 5IVFA 3K57A 4XDLA 1ZBA3 1APNA 5HXVA 1RUH2 2BOBC 4O9EA 3HOBA 4CUCA 5I0UA 1XYOA 3SPHA 4Z82A 1PV0A 1XNAA 5CFCA 4UV8A 3DKQA 3SJAC 3VB9A 3S57A 1R6NA 4BWOA 4W4KA 2R9IA 4P14A 2AC1A 1QDCA 1EM1A 4L8QA 1I5XA 1L0NH 3HKDA 3FWEA 4TQDA 5LYJA 1QXJA 1H0BA 1RC6A 2Z69A 3BA9A 5KXBA 1KRIA 3E6DA 3FB7C 4HMZA 1O4TA 5LBBA 1S0CA 3RYRA 1JZ8A 3NV1A 1Q81W 3QTCA 1JX9A 2MEV1 3VBHC 4CUBA 1ASJ1 4F3JA 3THPA 5GTIZ 1XNBA 2RV9A 5JJJB 1ROPA 3SITA 5JZGC 4S2GA 5C5UA 1VAKA 4WBNB 4AHWA 5FBJA 1UIJA 1SCSA 2UU9B 1CAVB 5FZAA 4YM3A 1P49A 1VBC3 1K5SA 2RDNA 4Q1RA 4XDQA 2HHHB 4G2KA 4Q5OA 5FZMA 1J1TA 3CJHA 4O2BB 1H8HG 1WA4A 1KC8W 3O1SA 1AYN3 2WYSA 5JR7B 3BTZA 4TT3G 2C6SA 4YNIA 3OW2U 1VIBA 2CWMA 2F6BA 2EICA 2RDQA 5DUXA 4TV8B 2DBIA 1OVSA 3RYFA 3THOA 1W05A 2GP5A 2ARHA 4N90A 1Z7S2 3U4XA 1Y74A 4FZ0A 1X59A 5FY5A 4IEYA 5C71A 3ZXLA 4FPJA 2Q7EA 5IJ9A 5FZHA 4P9LA 3WUCA 3P3NA 4M3CA 5EP9A 3FUQA 1YITV 2HLEA 4IXLA 3GWKC 4WM8A 4PCRA 1VBB1 4AGVA 4JI0B 2PGGA 4GYCB 1WPBA 1NBMG 1JCHA 1OJHA 4SLIA 4GJYA 4PDRA 1TMF2 1LESA 1MQTB 2Y6HA 4U3JA 2R0HA 1BJQA 4E2SA 2ZS6B 4YG3A 2ZE6A 1PL4A 3FAVA 1HIXA 4WVWA 3TJTA 5GLVA 4AYUA 1PX3A 4FOYA 2W39A 3FBMA 3ILNA 1J5EO 1JJOA 1PM9A 5KXDA 3X2QB 3HKBA 4EKWA 2MEV3 2R042 2OTJV 2E5LO 1ASJ3 1QLEC 2D6MA 5JI9A 4XJAA 3LSQA 1KFUL 1NX9A 2BSKA 3IMMA 2WO3A 1J58A 4D94A 4LLOA 5L3GA 1N1TA 1LENA 2HWC2 1UYPA 4TUYB 4DEVA 4X20A 2JIZG 5I0DA 4OPAA 2JX9A 2AACA 5LY1A 5FKCA 3VBBA 4N7IA 4DEQA 2XMLA 2XXZA 1G4YB 3U14A 4MGYE 4MGIE 5FLIA 1F31A 2QQOA 4CDXA 1GM7A 1JBCA 4QPGC 4E4EA 3PDQA 4LTAA 5DUUA 3CCEV 2OYQA 5IYDO 2EIDA 2Y0OA 2HKXA 4XBQA 4XMIA 2R9AA 2W92A 1AR71 5GW7A 4PA3A 4K20A 1GP6A 1FPOA 4HANA 3TEZA 3CRMA 3T2QA 4JYCA 1DCSA 5DECA 1VBB3 5L3FA 2FZ1A 2X53S 4DR1B 3G80A 1AJOA 2E51A 1LGCA 5FZKA 1OZ0A 3F7YC 5LWBA 2VMFA 4JGZC 2Y6KA 3I3EA 1RUC1 3WF4A 3N4MA 2FZ2A 1K9MW 5GLUA 1KP3A 2HWF1 1XYPA 2ADDA 4UCTA 3BA8A 1UOJA 3PLQA 3OGVA 4LHNA 1NU1H 5CFDA 2B46X 2IJHA 2RM21 3ABLB 3ZKUA 4CCEA 1SQGA 5FZ3A 2J1UA 4H7MA 2ZNJA 4GWIA 4UAPA 3PUAA 2IFRA 3SYPA 1PPJH 2XR4A 4X64O 2UUCO 4HL0A 2FCTA 1EV11 3SCFA 1ENVA 1E5HA 2A71A 3AP6A 3C7EA 4FCAA 1N34O 1B35C 4FAHA 4AVVA 4BMBA 4Y24A 3ZMNA 1XMOO 2NPIA 4Y1UA 2JVDA 3CJIB 3MICA 4RS5A 1NLSA 2B4KA 1H2GA 3LSEA 2HJDA 1HKDA 5L9RA 3E83A 4XETA 1NR7A 1AR73 2VQ0A 2OCCC 2D3SA 4FOVA 5BY5A 4DR2B 2ZZQA 3E8GA 1W2AX 4JKMA 4YM1A 3F95A 4XCBA 1UKRA 1LHWA 4D7TA 3T0BA 3SQOA 1RUF1 2WSUA 1FXHA 1AR4A 1X8EA 4DV5O 3P1IA 4DV7O 1VF5B 4YHHO 1S0BA 3DGEA 4LOSA 2TEPA 1WLDA 1QEXA 2UU8A 4XBLA 5JR2A 1FXKA 1N32O 3W7SA 1QJU2 1W2NA 1RUC3 3AP4A 4HNAB 2I2SA 1OV9A 1CZSA 3H3UA 4GKYA 3G67A 2EXIA 2HWF3 1FPN1 2ZE5A 1D2SA 1JUIA 2HR3A 4KFMA 1XMQO 5L19A 3VBSB 2P90A 4O9GA 3KQRA 1GKBA 1V55C 2F23A 2RM23 3KM5A 3POIA 1PO11 4FLXA 1XSRA 5FZ9A 4E4ZA 1HQWA 4MV2A 5FY8A 3D36C 1SPPA 5JXJA 5AVAA 4BW9A 2YROA 4ITCA 5CBHA 4QAWA 5I91A 3EHKA 1V70A 4XUOA 2ZGUA 5FNVA 3MF6A 1EV13 2ZKLA 3OGSA 1WA8A 1Q86W 1BMFG 4EN9B 2VZVA 3OR6C 2YXLA 1LODA 5BXZA 3VBRB 3OGJA 1JXNA 4K40A 4KMQA 3ZX7A 1QOTA 5JXGA 1VQ9V 1SQQH 2LS6A 2GBOA 1KKDA 3BVOA 3C2UA 2VW0A 4NKGB 2A6WA 3FX3A 4AXOA 2D6KA 3O0VA 3FHIB 1AR61 2OW4A 1CWPA 1O4ZA 4DRRA 3ZYRA 5KHGA 3MLJA 2W87A 1P7BA 4W65A 3AK2A 2WWJA 3OCPA 3L73H 1EN5A 3ZDVA 4QDQA 3CCQV 3K5LA 5B1AB 1RUF3 2YC4A 1ZL8A 4NVPA 5KHHA 3CQOA 5FPLA 4KGQA 1NT2B 2PHUA 3AZXA 4FQ4A 4YZ2A 3D0JA 1T6BX 1PP9H 4H44B 2QDNA 4JDMA 1GN4A 1NKDA 3HNMA 2CY6A 1VAMA 3RYIA 4ZOLB 4KBZA 4BA6A 1FPN3 4Q0PA 2IFWA 2VMIA 5ITZA 4QX8A 2LP7A 4JI2B 3VDDB 1D0HA 3JYCA 5D5PA 4P9GA 4MXWA 1ULFA 5K0UB 3H1WA 2WLHA 2VZOA 1MZ6A 2VY0A 1IG0A 5A6XA 1UZYA 4XQWA 2XJQA 5E79Z 3ZFGA 2ZXWC 5C93A 5CMUA 2QJ1A 1Z0HA 1E1QG 4EQVA 2GN3A 2BJSA 4F83A 5IT6A 3POGA 2I74A 4ZHQB 3T2OA 1W59A 3HKCB 2VM9A 5HI0A 4AFMA 1V6NA 4IV1C 2E26A 1A6CA 4WF9V 4YG6A 3I3BA 1XDCA 4FP3A 5E8AA 1UZZA 1R3IC 3NJXA 5FPVA 1BBT2 4FLYA 1Q82W 1TAEA 1US2A 4DUYO 4DR6O 2O8OA 3AKRA 2X6BA 3NAPA 2ZKNA 1R1ZA 1ZZCA 3IJ4A 5BR8O 1AR63 1F4MA 3FN9A 3R66A 2WT0A 1I9RA 3O12A 2DVGA 4LF6B 4GX0A 4UFJA 4DY3A 1S0FA 3LNNA 1US3A 3MIHA 3H1LH 4JQRA 5CAZA 2NLJC 1RP3B 4LH6A 3ZN6B 4TLGA 1W3VA 4CU6A 4Q0QA 2GDFA 1RUG1 1H4HA 4JI6O 1R081 2VU9A 4CU9A 3IM0A 4I5SA 4PI0A 4OCTA 1NH2B 4QX5A 1C5IA 4J6GA 1VE0A 4OPHA 3ZIAG 4IIJB 4RQPC 2DYSC 3TGUH 1ZRDA 2V09A 3OUJA 1BHBA 2Q68A 3ZXFA 5EYXA 1KEXA 2DJVA 3WQ7A 3B93A 2ZOEB 1P4RA 2N7GA 3V56A 2P17A 4X8PA 2P6CA 1JZ2A 2QZ2A 3VBFA 3MIEA 2Q8VA 5FWEA 1DBNA 5GLWA 3ETQA 2P4VA 2YU1A 2VECA 5CFCC 3A7QA 4IL6Z 2ZCWA 3NKTA
chains in the Genus database with same CATH topology
2VPVA 2G4IA 5J96B 3JCIA 2A6YA 2DCKA 2GC2A 2XL7A 4Q4X3 4C8RA 5C9AA 3W58A 1NXD1 3D4KA 4PIZA 4ZKTB 2K9ZA 3H3ZA 4GB33 4UW3A 1XE8A 2PAMA 4ZU5A 1YI7A 2GMMA 1DLLA 1OPMA 1RVF2 2B5HA 3ES4A 4I30A 4EN8B 5C8CA 2H6BA 5ABJA 3AJYA 3FLRA 4QPIA 2XJVA 3SCGA 1G9AA 2VOXA 4GKXA 2CV6A 1EYBA 3MLLA 2OUHA 4HKWA 4KBBA 4LBQA 2QZ3A 2EF6A 3JD72 2ZX0A 4IEZA 2G9GA 1S0JA 5T50A 3FJSA 4LA2A 2DTYA 4L97A 2ZMLA 3CJIC 2QKDA 4GH4B 1SEFA 5CBLA 3ACLA 1XQNA 2DFBA 3JBG3 1HV0A 1FMD1 3RI8A 4R4XA 4N9HA 3VKOA 1C5HA 3HT1A 5FOBB 1N3QA 1GYKA 4FFAA 1ND2A 5SV8A 4COWA 4DZGA 2NP0A 1FOD1 4M01A 5DZFA 4AHZA 1UKGA 2OYZA 1VBD1 2AYHA 2DFCA 4KL1A 3LWCA 3SH5A 3QH6A 2NM1A 4D69A 4CEWB 1REDA 1JHNA 1VR3A 3LA7A 3NKGA 4UBGA 4UW4A 4KWLA 1V9U2 3I8TA 2BVVA 3V0BA 4PIXA 4XZPA 3U07A 1LHUA 1JH5A 1Q56A 1QQP2 4M27A 3NVCA 1KS5A 4CDQA 5T3NA 3T1LA 5FBZA 4P5HA 1B09A 2E7AA 5DDJ3 2OUJA 1S55A 1RVF1 2W08A 1LOGA 2CTVA 1JW6A 1COV2 2VOKA 1RUG3 2ENRA 3AM2A 1DGWA 1R083 3VGIA 3CJXA 3RQ0A 2UYAA 5FDBA 4DPNA 5A32B 3MW4A 4AVTA 4UXAA 4QHBA 3JD71 4OHXA 5C4WB 2O1QA 1RUD3 1ENRA 1BBT3 3ZYJB 4LLFA 1SMVA 2AZ5A 1Q5OA 2RHPA 3QACA 4JTOA 3AZZA 3ZDSA 4XFBA 2A6XA 2C5DA 5JSPA 5T52A 5H9SA 1LULA 1MZ5A 3AFGA 3NV3A 2XJRA 4BQ1A 1LHVA 4OVEA 3H1YA 2BVBA 2ETEA 1R092 2GH8A 3VBHA 1QOOA 3DF0A 1VRH2 1NE4A 1S0EA 5I0TA 4QQLA 1RMU3 2D43A 2WZR3 5BNNC 1NX8A 3KCXA 1OIJC 1EPWA 1V9U1 4RR3B 2ZHNA 5BYNA 4LBLA 1X36A 3DV8A 1QQP1 1IS3A 3B7MA 5HCAA 5JZGA 2BWCA 3VBSC 2DU0A 2NLRA 5BNPA 1NX4A 1SLIA 4NHMA 3KT1A 1CX4A 2DURA 4I3PA 4WM8C 4YVSA 2X8KA 3MIDA 4M0NA 4YLZA 2H6CA 4W6YA 1COV1 1YO8A 1LR5A 4AF9A 4AVBA 2ZGRA 2AREA 5BPXA 1S0IA 5T5OA 1W6NB 2UWCA 1C57A 3MPBA 3JZVA 1H8TA 4R52A 1HXS2 4XFIA 4DQAA 1MS4A 1C8M2 2HEWF 1NA1C 3NWKA 2PHXA 2ZGQA 4L99A 3PVBB 1RUE2 4TWTA 4A7ZA 2WS92 3J8F2 1DYPA 3SNMA 3SH3A 1HQLA 1CAXA 1W39A 1ZRCA 5ACA2 3AMQA 4K8FA 2E6VA 4WVZA 4AQTA 2HWB2 2D3PA 1BKZA 1G9FA 4FOWA 1LRHA 4AEMA 4GMP0 1ULGA 1Q8VA 4W6WA 1MR5A 1PO12 1PZ7A 1VRH1 1PIV2 4LEJA 1IS6A 2FQPA 4MXWB 1QOSA 3VBRC 1KXGA 2VNGA 2A3WA 1Q8OA 5JOYA 3EXUA 4AEKA 1FV3A 1DQ5A 4HPKA 1QWRA 3K51A 5L7OB 3OD4A 3I59B 2D98A 1NOVA 5GLZA 3VBOB 2A3XA 1FMD3 4EN7B 3H50A 2DUPA 3ZFGB 2GN7A 5JVVA 1DF0A 1G8WA 1DG6A 4QMAA 3H8UA 2JEMA 4FPHA 1FOD3 4RSUA 2BPA2 1VBD3 4IQPA 1I6XA 1GANA 1XU1A 2R16A 3M2MA 4DRVA 1SLLA 1HXS1 5JPMB 2Z5WA 1C8M1 1HDKA 2DCTA 3JB8A 1BYHA 1RUE1 1OIIA 2WS91 2XLFA 3J8F1 4AHYA 4CP0A