5KUKA

Crystal structure of inward rectifier kir2.2 k62w mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
326
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 97
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kukA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kukA01
2EILC 4GX2A 2Q67A 4PA3A 3FB7C 3SYPA 2X6BA 3BEHA 2BOCC 3F5WC 4MTFA 3RVYA 1S5HC 3AG1C 3F7VC 3ATEA 3AT8A 3X2QC 3RVZA 3LUTB 4EKWA 3T4ZA 3AUWB 4ZBMA 4QE7A 4XDJA 4XDLA 3T1CA 1M57C 3K0GA 4JTAB 4P9PA 4PA7A 1G4YB 3WG7C 3AT9A 2ITDC 1BL8A 3STZC 2EIKC 1J95A 2H8PC 2HFEC 4G28B 2KB1A 3IGAC 4H33A 5EC1C 3SJQC 5B1BC 3VOUA 3ATFA 4R7CA 4MW8A 5EC2C 1V54C 4MW3A 4MS2A 1K4DC 4G27B 3FB8C 4HZ3A 4PA4A 3SPIA 3TETA 4JTDB 2GIXA 3R65A 2W0FC 4GX0A 3OR6C 2WLLA 4WFFA 3SPHA 1OCOC 3OGCC 3LNMB 1V55C 4MVQA 2EIMC 5EK0A 4P2ZA 1U4FA 4KFMA 4QE9A 4MTGA 4R6ZA 4OXSA 1P7BA 3E83A 4J9ZB 3OUSA 3ABMC 3RW0A 5CBHA 3EFFK 4MSWC 2AHYA 4R50A 4H37A 5EBWC 3ZJZA 3IFXA 1ORQC 4QNHB 1KKDA 1R3IC 1M56C 4F4LA 3E89A 2OCCC 2ZD9A 2WLIB 3AGWA 4X88A 4PA9A 3SPJA 3K06A 3SYOA 1XL6A 2A9HA 3ABLC 3LDEA 2DWDC 2E4FA 4MVZA 4MVRA 5EBLC 3T2MA 4BW5A 4PDLA 1K4CC 3K6NA 3AG2C 3E8FA 4WFEA 1ZWIC 5BZBA 2HVKC 2IH1C 3ASOC 4DXWA 2A0LA 3GB7C 2Q6AA 2IH3C 3JYCA 2HG5C 2WLJA 2HJFC 3OUFA 3SPCA 1XL4A 4MVSA 4RUEA 4GX5A 4MVOA 4HYOA 1R3KC 4LCUC 3K03A 2WLNA 3SYQA 3UKMA 2A79B 3ZRSA 5E1AC 4P30A 4RUFA 2ZXWC 2QTOA 3UM7A 2Q68A 4P9OA 4R8CA 2WLKA 1OCCC 2Y69C 2EINC 3HPLC 3KG2A 2AHZA 3ASNC 1QLEC 5CBFA 1N9PA 1OCRC 3F7YC 4TWKA 3E8HA 3SYAA 3TCUA 4UUJC 4MVMA 2ITCC 2JK5C 3ATBA 3LDCA 3ATDA 4RO2A 3T4DA 4LP8A 2DYSC 3LDDA 2X6CA 2WLHA 2P7TC 2QKSA 4PA6A 3AG4C 3OR7C 4JTCB 4I9WA 4PDRA 2BOBC 4MTOA 4CBCA 2EIJC 4MVUA 5KUKA 5IY5C 3K0DA 4RAIA 3E86A 2WLIA 5J9PC 1U4EA 3FB6C 3FB5C 4WFGA 2ATKC 3E8BA 3STLC 1LNQA 3ATAA 5CBGA 3SYCA 2X6AA 4PDMA 1JVMA 2Q69A 4XDKA 3VSQA 2HVJC 4LBEC 4X89A 1R3LC 4WFHA 3RBZA 5KUMA 3K04A 2YEVA 3AG3C 2DYRC 5B3SC 2WLLB 1OCZC 4X8AA 3SPGA 5B1AC 3PJSK 2DWEC 3K08A 1R3JC 2K1EA 3E8GA 5EBMC 3ABKC 2R9RB 4GX1A 2NLJC 4J9YB 4PDVA 2WLMA
chains in the Genus database with same CATH superfamily
4TV9A 1BFOB 1IVLA 1NGWB 2VR6A 4JYAB 1WAZA 3I02B 4WY7L 2BY0A 3VVWA 4M93C 4URTB 3NEXA 1PFCA 3GRWA 5FCUH 1H2GA 3OKYA 3D39D 2EIZA 4MHHI 4A39A 3O45B 1BDYA 5LHDA 3C8HA 2BNUB 2Q8BH 3S5LA 5KW9L 1DBKL 4Z0BH 3VTMA 1TPXB 2OKMA 5AW2B 1CPYA 3DGGA 3O8XD 1W2KT 3EJRA 2DBLL 4MQXD 3L5WA 2JLPA 1P2CB 3L6FA 1JMXA 5HGAB 3SCMA 3FCSA 1Q5OA 1AOHA 3GT6A 3O6KL 3QHZL 2E8ZA 5E4AA 4NZRH 1HIMH 4FADA 2C3WA 3LB6D 1QQDB 3H54A 2CTWA 4EI5D 4FDWA 4HWEL 4I89A 3NJXA 3TX4A 3SPHA 5BR8B 3K79A 4HIJB 4WU7B 3W3BA 4NENB 2P5EE 2BP8A 1BQLL 1OT2A 1XF3B 3IF1A 4ZW8A 2WTRB 5HGHB 4J5VA 1K85A 3SY0B 2DLHA 4DPCX 3N2GA 1BFOA 2YIBA 3BKJL 4EAEA 3FQNB 3QUYD 3PABB 4OCWL 1MZFA 5KYXB 4BUQA 4UT7H 4JYCA 1RJLB 4DO4A 1QG3A 3F58L 2ZNIA 4PA9A 1ZLSH 4XCEB 3AMLA 1UPGA 1FDLL 1BJ1J 3L1GA 2Y72A 3O45A 2BY1A 2BNUA 1IKOP 4HC1A 2CH7B 1UWGL 4C47A 2R23B 4YZWA 4JW3A 4KKRA 4H1LB 3RU8H 4LEBA 5FPRA 1FN4B 1P2CA 5HGAA 4WF7A 2ZM6B 1JVKA 4UQEA 2DLEA 2DLFH 2W81C 3MXVH 1K5SA 1ZE3H 2XV2A 3FTZA 5D93B 4WKXA 1SRYA 1H3XA 1QQDA 2FUTA 3QXAB 4PJFE 4DCQB 3EHBB 3FB5B 4NYKA 1Q0YL 3H8NA 3MQIA 4HIJA 4LEOB 1G9HA 1GHFL 4WU7A 4Y2DD 4NENA 3UROR 5IQMA 1XF3A 2WTRA 5HGHA 5DK0B 1NOFA 3IGUA 5E95B 4M8VA 4CNIB 3SY0A 3GHEL 5EF2A 4I13B 3KLHC 4LDEB 1KEMH 4MX7B 5LGNA 1EMTL 3FQNA 4IIZA 3PABA 5KYXA 4XO8A 1ZTMA 1EA9C 4HBQA 4NM8L 5FHAH 5J2UB 4XCEA 4B9JA 4KZEH 2BZCA 1FLRL 2QPSA 1VIWA 1J1OL 3LHPL 2XZCH 2CH7A 2R23A 4GNKB 4ZTOH 5B3SC 4XP5H 4H1LA 2VN3A 4M1CC 3L1EA 4ABUA 1KXQE 4OKDA 3QJFB 1WJ3A 1D3CA 1FN4A 1HCZA 1J5IA 3B40A 4OI7A 3FFCE 4XVJH 1NFKA 4CGTA 1RHFA 1S7QB 4S2SA 5T3XE 1NCBL 2AK1L 3NCYS 4OTXH 3L08A 1XXDC 3VWJC 2NRDA 4DN4H 2E7MA 3QXAA 1HVXA 1YEEL 2WZ0A 1M1XB 2E7DA 4DCQA 3FB5A 2F8OA 4LEOA 5EEWA 1XNRO 1I94O 4ODVL 3TH4T 4XVTH 2VDKL 3LEYH 4AEIL 1WP8A 3JWOH 4KK6D 5DK0A 5E7FA 1AE6L 4CNIA 5CF3A 2AQTA 4WAFA 1KCVH 4XBMA 5TK4A 1T66C 4MX7A 1WBYB 3OGCB 4RESB 4F93B 1KYAA 3ULUF 3OBAA 1SJVA 2J44A 2BVQB 1C1EL 1KJ3L 5KBLA 1DLFL 4LASL 5J2UA 4MW3A 5JUEL 1W0YT 3B9KB 5DJ6B 5JMRA 2F1AA 1BVZA 3D0VB 1XGTB 3RNKB 3MLVH 5HHMD 3FTVA 4LF7B 4P46B 1BEYH 2WBJB 4WO4B 4L8SB 3RGVB 2FWUA 1JVOA 3EO1B 3QJFA 2FT7A 4QHKI 4BUHA 3K5RA 5I18L 3E83A 1OO2A 2DMXA 5HFMA 4DR1O 1BQSA 4NGHH 4UM9D 2OYKA 1M3JA 3ASOB 4UNIA 1F42A 4B9PA 5IT2H 4LCVA 1S7QA 4HKZA 4MNQB 1QABA 4FQ2H 4KU1A 2NY5H 1F8TL 4G6FD 2YRPA 2DWTA 1M1XA 3TOPA 4M8QB 4Z7QF 3J7HA 4NP9A 4TQIA 1TUEB 4OZGF 1E30A 5D4IA 3HR0A 1DN0B 4XGZB 4LNRA 4Y4FD 2RMKB 4OF5A 3JD1A 2Z35B 2IDFA 3C8KB 4IBQA 5TQ0L 4WWPA 1WBYA 1DEDA 3OGCA 4D9LH 2Q7NA 3GWKC 4X5WB 2BVQA 2MTPA 5D6DA 4Y7MA 5TPWH 1NFAA 4K3EL 1A9VA 1SQGA 3NDYE 4NJAL 3LPWA 4LSVL 3B9KA 5DJ6A 4JM0A 2UZIL 3IE9A 3D0VA 5JO5B 1XGTA 4NQEE 3RNKA 3SB3A 3LV3A 5GS1B 1XNQO 2CE6A 4Y5VC 4YSPA 3TVMB 3TS8A 4P46A 2WBJA 4ZO9A 2CALA 2AXFB 2NY0B 3ECQA 2N05A 3L71H 2Z8VC 4KVNH 4L8SA 4WFGD 4WO4A 3RGVA 2Q7AA 4KZDH 5F0PB 4FLTA 3EO1A 1RJZB 1J1XH 3V0WH 5KVFL 1L0YA 5SX5H 4NCC1 4N2OA 3K4AA 1IC4L 1YUKB 1P69B 1M53A 2DZEA 3RL2B 3QUXB 3HRZB 2YSSB 1VEWA 4MNQA 3L5HA 1KBKA 1WT5C 2VGLM 2QTSA 4PRDB 4XPAH 2D9CA 2VXSL 3HMWL 1OTTD 3OKLB 4B9ZA 1YY9D 2QADC 4M8QA 4XMLL 4E42B 3U6XS 2VSMB 4MYPA 5I5JA 3CX5F 1DN0A 4XGZA 2GUOB 4PRIE 4DQOL 5MHSE 4YBHA 5F7WC 2V37A 2HVJC 3LPOA 3SDDD 2Z35A 1F02I 3MODL 1B0RB 1WG3A 2GK0B 3C8KA 3GBNH 3NZ8B 4KAQH 4UB0L 1C5CH 3NCYP 3F05A 4TL4A 4X5WA 3LOWA 3RIFK 3NCJL 1T0PB 4R7VA 4WCEV 1PZ5B 1A7QL 3ARDD 2FD6H 4X5PA 1CS6A 4CSZA 2JDIG 3WJLC 4NQDE 1EEQA 3UAAA 1OZTG 5GS1A 4TM9A 5DHVH 5BW7C 3IDXH 4FNLH 1QUPA 3TVMA 5JPNC 1A4CA 3IK2A 4MDJB 2AXFA 5CEZE 1E65A 1CURA 3TJTA 2LV4A 2OJEB 1TEFA 4GINA 4X4ME 5L3DA 3L3GB 3X1BA 4K2UH 3FYIB 4MKTA 1RJZA 3V95A 5K5YA 1SVBA 2EDMA 4OJDH 3EYVB 1NCCL 3AACA 2HT3D 5DVOA 3K9SA 4YHHB 4IYIA 3RL2A 3QUXA 3HRZA 3E8UL 2YSSA 3LZRA 5TE4H 1UM5H 8CGTA 1U2YA 4PRDA 1A3LH 3OKLA 1NPNA 4V1DE 4E42A 3QCTL 1NH2B 1A8ZA 2GUOA 4JZNB 3AFLA 1B4LA 3P2DA 4PWGA 4BD4A 1Y74B 1CF1A 2IANB 5E5RB 1E50A 1MCPH 3NZ8A 1B0RA 2GK0A 4NUGH 3FDWA 3QO5A 3BUQA 5ADPH 5TF0A 4NDMB 4DESA 2X12A 5BXFB 5IEKA 4JV5O 4LC1A 2XC8A 3MGOB 1PZ5A 2VDOL 4ZYKB 4FNQA 2A0LD 3QS2A 3RKDC 3TO4C 3VGFA 3L70H 4IGGA 2FJFB 4JFDE 1R33A 1IBBA 4MDJA 1RKRA 4IIJB 2UZPA 4Z3JA 2OJEA 3L3GA 3LKPB 3GXTA 2DDQH 4JO3L 4KRNA 1Y1DA 1URFA 2MFNA 2WZ6A 3EYVA 1WDAA 3HG1D 5I8KL 3UC0L 3ZE0E 3CK0L 2YS8A 1NOLA 2RB8A 3GNMH 4QR7A 2W95A 4JKWA 4N0UE 3PL6B 1HILB 2DJ4A 4UTAH 4QGPA 3V7MA 5BCAA 4F9PA 4B9FA 4U05A 2YKLH 4YXLH 1EZVH 4OJCA 4JZNA 5HJ3B 4IJTA 4EDWH 4Y2NA 3IJ4A 3QJVB 1Y74A 2IANA 1EIBA 4GMTL 1AP6A 3AREC 2TRYA 3KM2A 4QCIB 2NY2C 5FX3A 1IX9A 1IVSA 5HJBA 4F1SA 4GLRH 2CKNA 3GEFA 4HLZG 4JI0B 1IGJB 1MZZA 1GZPB 2F54B 4JFHE 1YDPB 3ZE2F 2WBXA 1U8LB 4NDMA 2A5UA 3ZDWA 4Z7QB 4OZGB 1XMQB 5BXFA 4HS8H 5AWNL 3MGOA 4ZYKA 1YYLH 4JJ5B 1GTOA 5AKRA 3B8MA 2FJFA 2DQHL 3OLGA 5D7IF 4IIJA 3OAYK 1PYWB 5BOPA 3LKPA 3QUZB 3IFLH 4JHAL 1E5ZA 2XKUA 2WNXA 4KKAD 4ZS7H 4APQB 1R3LC 1KFAL 3RI5F 2E76C 4FHBD 4HCGA 1YHPA 1R4XA 2Y25A 1WFNA 2OK0L 3ENEA 3RZCB 5E5LA 3PL6A 1FXKB 1HILA 4YJ3B 2YPLB 3HB3B 3ABGA 3L4UA 4HZAA 2LOEA 4AUJA 3A6OA 5EBGA 5I15H 4YL4A 4Z0XB 4N8VB 1AYRA 5HJ3A 5I23A 2OJ1A 3FQYA 2VXTL 3CNKA 3CEIA 4QCIA 2B5UA 1NCGA 1CCZA 1IKNC 3S6CA 5FW8A 4MMZB 1LE9B 1BD2E 5I0WA 2F0CA 4AVHA 1Q9KB 2Y5QA 2F54A 1IGJA 1PL4A 1GZPA 2VDNL 1YDPA 3N9GH 3PWUB 1U8LA 2BDNH 2Q73A 4WEBL 5FM4A 2OYPA 4OZGA 1A6ZB 2Y48A 3L9YA 4K8RC 3DC6A 3MJ9A 3NIGE 5IMMB 4N9GB 1MCLA 2B39A 3KPRE 4JJ5A 5AZUA 3EYOB 3CXHK 4BELD 4S1QH 5E8DH 1COBA 2Z34A 5CLZA 5I82A 4JI1B 3SIKA 1PYWA 2WYHA 2EUZA 3QUZA 4UTBH 1O5DT 1XGRB 1YCSA 2WA4A 4M5YL 5ALCL 5L88L 4NTWA 1AZBA 2IFFH 4APQA 2B5IC 4U7KA 4JQIL 3ELQA 1Z5VA 2P3YA 2VO8A 1HR0B 3RZCA 4I4WB 4PJAE 4AMXA 1FXKA 1IBKO 4JPRA 1K9TA 2IWEA 5MP6H 4NS0A 4YJ3A 2YPLA 3DX4A 2WTPA 5IQ9B 2G60H 4J3BA 4AK1A 1YNKL 4Z0XA 4IHBA 4N8VA 3C5XA 4LHJB 4YHMH 3OPZH 1NSNL 2WAMA 2NY4B 5F7HA 2IAMC 1YJWV 5ACLA 4QHNB 5FFLA 5J56B 1ID2A 3N44F 5DT1L 4EXKA 2LLLA 4MMZA 4BWWA 5I0XA 1LE9A 1Q9KA 4N9OB 5DJ0B 4MJ2A 4YDVA 3PWUA 5EBLC 1WGVA 2DTMH 1A6ZA 4L4VD 4HG4J 5J12B 5MEOB 5IMMA 1I4FB 4N9GA 4HEPG 4DVRL 4YDKH 1SEQL 3EYOA 2YIAA 4JO4L 4PBXA 4YXKL 1KCLA 3BUBA 4U0RB 1EO8L 4HF5H 4LOUC 2DQFB 3IDUA 1PTZA 4PBDA 3KDMB 3MLZH 2WINB 4RISH 1QTSA 1XGRA 3L2NA 5EF3A 2H2SC 3DX1A 3AM8A 2EXYC 5H94B 4CC4A 4JJOA 2O5ZL 4E41E 2UUDH 4I4WA 1MG2C 4ZMOA 1BAFL 1TVDA 4JY4B 2UXBB 4LOVA 3D4YA 2W91A 4W9DC 5IQ9A 1DSFL 3DYMA 3QAZC 1P1ZB 1KFGA 3BUYB 1YYCA 4GO6B 1AHWC 4AIEA 1NEZB 2EE6A 3BT0A 4LOFA 4QHNA 4RWYH 4GQRA 2RFXB 4EN3B 1JPEA 4Y0GA 5AB0A 1IT9H 1U4EA 2RCVA 2R56L 4PJGE 4ZW5A 5DJ0A 4FLYA 5FFOA 1UJ3C 3V2AR 4UINH 1PX4A 3P1VA 4FLUA 2X53A 4LLDB 3KKYA 2H45A 4TULL 2IOOA 2W9EL 4X8AA 2JKTM 1I4FA 3B3IB 1ZLDA 3SD2A 3VNYA 3EJYD 4DV1B 1A5FL 2V5RA 5C2UB 3Q48A 3MBEC 5JOPD 2ARHA 1D9KC 3BP7B 2QQQA 2DQFA 4NLAA 4POZC 4QGYA 5H2BB 3ZE2B 5IFHL 4MZ2A 5BVPL 3KDMA 5EF1A 2IOMA 2WINA 3QK0A 2E3VA 2PF6A 2ODMA 3L13A 2O30A 4K0KB 1NCDL 1CXHA 5H94A 3C5SB 1IGFL 3N85L 1GJIA 2GABA 4XN7A 2EECA 4EKWA 4FNRA 1ID5I 1TA8A 2D4FA 4ZBMA 1T6BX 2DYPB 3MLXH 5D7IB 2QJDA 4JY4A 5T5NF 3RPIB 4BM7A 4YSCA 2H1XA 1H2LA 4FA8A 1AACA 1P1ZA 3UO3A 3BUYA 1ECZA 5T5FL 3MLSL 2RAMA 1NEZA 2VR3A 4EN3A 2CWRA 2RFXA 3F6LA 3CVDA 4LQFL 4X7TA 1BQUA 3TEXA 3SHSA 1F2XK 1CE1L 5C7XH 1GOFA 2QKCA 2WLYA 4KQ4H 4LLDA 3U7WL 1BAGA 2GBVA 3U30C 3CAFA 1Y07A 3B3IA 4GRLD 4QYAA 5KVDL 1RJCA 5C0RL 4K7FB 1QEXA 4Y1AB 3BP7A 5H2BA 3IDGB 3ZRXA 5F0JB 2AHYA 1A1OB 5L6YH 2WCSA 1I75A 5J3HD 3OW2U 3MRHB 4NTYA 3EJPA 2ZOUA 4TSCH 3RUGB 3C5SA 3EF7A 1MJ8H 2HX7A 5I6OA 1KBGL 1Q1JH 5DLML 2Y1AA 3WUWG 5EUOB 4PJIF 3RPIA 2DYPA 5D7IA 1MJUH 1TTCA 2OL3H 2HX9A 4PJDF 4AYFB 4AKQA 1ILUA 4DV7B 5LBVA 2WLJA 2BWQA 3VMNA 4F15C 3WENA 3CFKB 5BS0B 1AXTH 4WHTB 2ZYHA 2EQDA 1JNLL 3S5ZA 1QLRB 4KNQA 5LHIA 3X3GL 4BZ1H 2FX9L 1S46A 3RX8A 4JHWH 1RPKA 3CTTA 1GC1C 2YXMA 1XIWB 1QRND 2BSCA 4PP1C 3US0A 5KHIA 4TWKA 1VAHA 4O58H 2DJUA 3W5MA 3SYAA 3ZHLA 3NSYA 4K7FA 1OAQH 4Y1AA 1NGPL 3ZKMD 1CFVL 4WFHD 3NIFE 2BHUA 3IDGA 4FJCC 3LXCA 2X6CA 4LF9B 1A1OA 2CLZB 5FECB 3ZU8A 4GT1A 4BSVB 2F93B 1M5IA 3MRHA 3UEZA 4A6YB 3QUHA 4O02L 1JGIA 5F9OH 5C0JB 4M56A 3O2DL 2D0HA 3FTUA 2WK2A 5EUOA 5HD8D 4FMKA 2Y4SA 3EZJB 3G08B 4M7JH 4TOIA 5T3ZH 1OSYA 4DEWA 4AYFA 3TV8A 5FUZH 5JTWA 2XZAH 3CFKA 2DEXX 5BS0A 4WHTA 4NJ9L 3QIUB 4UVCA 1ZV9A 1QLRA 5DD6B 3U9UB 4XP9H 1U42A 4ZXBD 4AQ1C 1AR1D 2SEBB 2XYBA 3PQYD 5IB3B 3G04B 1NAML 2DLIA 2E46A 1XIWA 2WWMC 4XCFL 3SJBC 3S3CB 1MCFA 2WOYA 3BHBB 5DVNA 1BXAA 3V7AE 1G9NL 2IADB 2XHNA 3W0WE 4GH7B 1RK0B 2R0LH 4D9RD 4XAWH 2CLZA 2FLRT 3LKRB 5FECA 4BDVB 5ADOH 4DUXA 3RAJH 4YSUA 1V55B 2DKSA 4DRXB 4DR2B 4BSVA 4OLWL 4KKBC 4A6YA 1WIUA 4QTFA 1RUKL 3NP3A 1CFNB 4JI3B 1RPQA 4HQQH 5DA0B 4JFQB 5TFSL 1NCOA 5C0JA 3AQXA 1WC7B 3F84A 1K3EA 1HX0A 4PRHE 3BMWA 1J5OL 3G08A 2BH0A 3QWOB 2W94A 1LDPL 2NXZB 1T5EA 1NIEA 4J39A 1O9GA 4JREC 3T8VA 3A0HZ 4DGIL 2VL5B 1W72B 5DRNB 3BFOA 3M8OH 1G8MA 3J27A 1A47A 3CDFA 3QIUA 5DHMC 5DD6A 5IHZB 2J20A 4HWUA 5DZAA 3U9UA 1KTCA 3S34L 2SEBA 3EH5B 1ESOA 3NJMA 4UT6L 2DIAA 5IB3A 3G04A 2A7BA 2AJXH 3M86A 1XGUB 3HE7C 3I3DA 4R4FH 3QSKB 3BHBA 2E4FA 2DH2A 3Q2CA 2IADA 5FYKE 4PDLA 1RK0A 5ABAA 4WWNA 1ZWIC 4MNHB 5LBSL 3GINA 5KYNA 3LKRA 5FDWB 3BPZA 2XZQL 3FTWA 4HHGA 5GISH 5IEHB 5E2VH 3KGSA 5E2UL 1N6VA 1KYFA 1CFNA 1V7NH 3CCMV 2QVFB 4JFQA 1WC7A 2PO6B 2GSMB 3SJVB 5EF0A 4GI6A 5DHVA 1Y6KR 2OXGB 3GXNA 1EUTA 3QWOA 4J2QA 3WUZA 3MBXL 3ZMZA 4PLJC 2B59B 1N36O 4JRWA 2XA3A 3EGSB 2LW3A 3S8GB 4YHNB 3E2HC 3LTVA 2VL5A 1RZFH 1W72A 3MX0B 1VF5C 3FSWA 1UATA 4HWNA 4PJ7F 5DRNA 2BNQB 4PBVC 4PJIB 5IHZA 2ENPA 3QORB 4NEHB 3QUMH 2WQSA 3GHBH 3D36C 1BBDH 5DSCB 5DXWA 4RAIA 3STBA 1MAJA 1GO3F 2Y6SC 1XGUA 4LSTH 3GUTA 1X4TA 5TJWK 3ZO9A 3BVWA 1HCFX 4LSPH 2I26N 4MNHA 5C7ZA 4E9LA 3AG3C 5LQBL 3MV7B 5FDWA 3GXPA 3QNZB 3UOAB 5IEHA 3AWFA 5ANHA 3MLWH 4ZW6A 2ERJC 3BP5B 2R9RB 4UQIM 7FABH 3FRPG 4NXMO 3O4LB 5ILTL 1GS7A 4HWBL 2PO6A 2UZYB 4HSCX 4YAQB 1MLBB 1JD9A 3NCCB 3S35H 3SJVA 1A3RL 2OXGA 1QAWA 1DFXA 4YHIB 3AG1C 1U96A 2B59A 3CE1A 5IJDC 5DWUL 3EGSA 1E5YA 5GJTL 1PY0A 4K3GA 3WSQL 2H4EA 5IVNA 4J3SA 2X6UA 2CJUL 4RVBA 3MX0A 1DEEB 2HH0L 1RP8A 2V4DA 1XBDA 3BGAA 4PJIA 1MREH 1VACB 1JHKH 1CG9B 3QORA 1FPTL 4QRPD 2XOKG 2B0SL 1YI2V 2WV3A 3SE6A 5CEZL 1E9QB 1KPRB 5DSCA 3U2JA 2ZIOA 5CJXC 4A63A 2HWZL 1GR7A 3S8FB 2CDGB 3DX3A 4JI6B 3T6QC 4L1DA 5TF1H 5A2JH 4JF3A 2DW4A 1LNUB 2AK4D 4OCXL 5TH2B 3K58A 3MV7A 2KI6A 4L87A 3QNZA 1OAUL 4GEJA 1WWAX 1XD1A 4N86A 1IAOB 3MZTA 3BP5A 1N0XH 4O2EB 5A2IH 3WV0A 2GBOA 3PPSA 1EO5A 3O4LA 2DE0X 1MI5D 2UZYA 4YAQA 1MLBA 3V8CA 3OWEA 1KJ2L 4GBXC 3Q8AA 1YECH 4YHIA 1CLZH 3NGBB 4LF4O 1FZMB 2VJ8A 1S3KH 2R1WB 2GIMA 3VRLE 4JI7O 2CJTA 2XAJA 2MIZA 2DQIL 4G83A 2VXQH 1DEEA 2ZE5A 2XACC 5FXCH 4AJVA 2NY3C 2FR4B 1J8HE 4J3OG 1CG9A 1U6AL 1XSJA 3D5OF 3GB7C 3Q8FA 3K1DA 4KI5C 4WNSA 1E9QA 1KPRA 3EOTL 1I8MA 3N0AA 4KKLD 1E5UI 3MRRB 1J9CT 4BINA 2CDGA 1NJIW 1M90W 2JB5L 4LCUC 1NICA 3H1LH 4HSAC 1SA0B 3LY6A 4ZOBA 2JQMA 1S7TB 5TE7L 2YIDA 3TA3C 5KJRL 4C56E 2C2AA 4K8XA 1LNUA 2HZHA 3RTQC 4A7GA 2XWBB 3U11A 2ID5A 4OJYA 2ZX6A 3STLB 2MHAB 4A68A 3WTVA 3ILDA 3WTWA 1IAOA 4XPHL 2IDCA 1VQNV 4TQEL 1Z9LA 1FL6B 4HGWA 4MMXB 4KX7A 3OD4A 3QEQE 3UTSD 1UGNA 1XH1A 3OLIA 3US1A 1ZV5A 4CH5A 2EP6A 1RZIA 4HUWB 4PG2A 4AV4A 3L74H 4PWKA 1ED3B 1FZMA 1XGYH 2ROYA 3IWUA 2PUQT 2F53E 1QVOB 4UCRA 2R1WA 5E0FA 1PAZA 4PGDB 4YO0B 4X99B 3MRPB 4TTGA 3GRBA 4LHQB 4NXNB 1ZHNB 3UO1H 2Y4TA 4WHCA 2FR4A 1SQFA 2XVKA 4WUUE 2ZKYA 3LPFA 3BJLA 4NO0B 4P2QE 1X5AA 1KECA 1UM6H 3HC4L 2Q7YB 3MRRA 4A7VA 3SJCC 5D2NA 1NCUA 5FGSA 1SA0A 4CVZA 3RA7L 1CBVH 4QF1B 1S7TA 3QEHB 3GI8H 5T3XH 4YUEL 5IWAB 3UZEA 5EEZA 3ETGA 5F8QC 3SCMD 1CYXA 2XWBA 4U33A 5CN3A 2R0ZL 4U1JB 3STLA 5DJCB 2FATL 2MHAA 3CLEH 4MJIB 4NZ8A 1SQPH 1JX9A 5DD1H 1LWHA 5DMIH 3HFML 5FF6B 3MKKA 5EORL 3SE8H 4BBWA 2GFBB 4LRNH 3TFKC 1AMXA 1FL6A 1H2SB 1FO0L 1WA8B 2BIIA 2QSCL 4MMXA 4NRYB 3FL7A 3QG7H 2Z65C 5B1BC 4HUWA 1OAXH 2JEUA 2W6JG 2IPUG 2WNWA 1ED3A 2FGWH 2K1MA 3P30H 5E8EB 3RWJB 3C5ZC 2E75B 4HPYH 4NNPL 3TNMA 1QVOA 4BGDA 3CC4V 1Z5LB 3FU0A 2YIBD 4P2YA 2EIDA 4PGDA 4X99A 4YO0A 4B3MO 3V5DB 4G6KL 4NWUH 1QR9A 1ZHNA 1C9SA 3CJHB 4ZPVA 5EU6E 1TJIH 2HA1A 1HE7A 4X80L 4EXPX 3HS9A 4OCNC 4NO0A 2Y6TE 2UVEA 4I9QA 1BS3A 3FH7A 5K1NA 2Q7YA 5DQDL 2VOTA 5JQIB 4BKLB 5B3JE 5ELIA 4C7UA 4QF1A 3QEHA 2ZCHH 4M1DH 2WXLA 3ZHUA 2GJ6E 4KK9D 3PRZA 2H32H 4ODSL 3L3KB 4U1JA 5SWZE 5DJCA 1XHXA 3UBHA 2I5YL 4MJIA 5FF6A 4HLJA 3RPBA 3GVMA 1PCXA 5J6HB 2ZXWB 4K8RH 1GGIH 3WE6B 2Q8AH 5IJVB 1GVIA 4W4KA 2BJMH 2GFBA 2CM5A 4HJEA 1WA8A 1IZKA 3UAJA 4NRYA 4PEEA 4F9LC 2UYLB 3BUIA 1QW9A 1FF5A 5E8EA 3RWJA 4PJCF 4AYSA 1AFVL 4NKMB 1Z5LA 5CJ8A 3UBXA 2HT2D 3UKMA 1WV7T 4N2FA 5C3IA 5GS0C 3GTVA 1MFVA 3H1KH 5F7NC 3V5DA 5JHBA 5ICZB 4DEUA 3CJHA 1QW8A 1BJMA 2Q4PA 2C9QA 3SGKA 3MAQA 5AAMC 5DVMA 1CDCA 3TCUA 4UUJC 2XTJC 4M5SA 2OL3B 4IU2B 4O4YL 4C4KO 2WXHA 5K9OB 4BKLA 2AANA 3QFJA 1XMEB 3QCUH 2ZE6A 4PDRA 1Z9NA 4Z3IA 4PD4F 3KL0A 3LRLA 1UURA 4JJHA 5KLVH 1VPOL 3L3KA 4YHZH 3QP3A 4G11A 4B3SB 5I1GH 2B2XL 4CL7A 4ODTH 1QZ1A 4IDJL 5J6HA 3CZUB 3WE6A 5IJVA 4R90H 4PBWD 5G5DB 1MIMH 2ZYRA 3BGFC 3EHBD 1GY2A 1P9MC 1GGCL 4LAQL 5I28A 4KHXH 2ZX7A 2UXGA 3INUH 1GL4B 2A4CA 4NKMA 3UO2A 5KJ4A 3BP4B 1BMWA 3EH2A 1CGWA 1EHXA 1YQVL 3SGDI 4KPHH 5E1GA 3E9TA 5ICZA 4TOYH 3ZKNC 3S3DB 4X4YB 3G80A 1NJ9B 3VQWA 2UU9B 3R06B 3DX2A 4AL8C 5HI5C 1CLYH 2OL3A 4IU2A 35C8L 5CGBA 5K9OA 4PWJA 2Y7MA 5FOBB 3EBAA 1HYRC 1I08A 4U7NA 1YYML 2G3XA 5MENB 1OK0A 2OSXA 2HLFC 1NMBH 1WFOA 4IKKA 1G1KA 4LF8B 1TTBA 2JJUA 2VKXA 4OCYH 1URZA 1K72A 2EXSA 2ZPKH 3QARA 4YX2H 1LO2H 4CJ0A 1JGLH 5G5DA 2OMWB 4PRAB 3ILQC 2GW5A 3DJRA 1T2JA 2RCSH 4Z9KB 1OCOC 1Z9PA 2ZKWA 3EJTA 4WTQA 4XC1H 3UH8A 1YZZA 5CMUA 4PG9B 3TV3H 1U58B 4W6WB 3WKYA 1N70A 4DR4O 5KVMC 3BP4A 4I55B 4P48A 1UD5A 3F7QA 3H4HA 4ZPTB 1D7FA 3OG6B 4JY6B 3VI4B 2QPDB 4Y1SA 4X4YA 1NJ9A 2Y1YA 3OJ2C 3R06A 3WFEL 1ETB1 3B9KD 5IKCB 4FM0A 1Z9SB 1NCJA 1WRFA 3CV5A 1FP5A 3FUKA 3IETB 3AS1A 2I69A 5E6IC 3MCYA 4XN8A 1JFQL 5FOBA 4P46D 2WBJD 3RGVD 1EEZB 3D6GA 5MENA 5DM6V 2FZ3B 3PP4L 5K1JA 4FMVA 2AEIT 3EJUA 3P40A 4WI3A 4KDVA 4OF0A 3MOAL 4ZJ9A 5K1XA 3VXUB 3ULVE 4U3HA 4OLYL 2WA3A 4JPWL 4CSSA 1G6RH 4LL9A 4M7LT 4OVVA 3JV6B 4MNQD 3WIIH 5J0BA 4J3XA 4LCWE 4DGYH 1N9PA 2OMWA 4PRAA 5KBNC 1JV2B 2ZNXA 4ZSOE 4S1SL 1B3JA 4MCMA 1VFMA 2WQVA 1ZIBA 2HRPL 4M4PA 5IBTL 1FG9C 1UEYA 4PG9A 3WO4C 1U58A 3NAAL 3ECWA 4G42B 1QPXA 1YC7A 4DP5X 4DV4O 4I55A 4G5ZH 1MCHA 2ZXDA 4M61B 5E6YA 4J6IA 2IFGA 4BHUA 4CMHB 4NZTL 4ZPTA 4JY6A 3VI4A 3ZQWA 4Y7OC 5IKCA 3KVQA 1Z9SA 4DH2A 3IETA 3QZLA 2YD0A 4L9LB 1R6TA 3PAYA 4XPBL 2B1AH 3TVMD 3ZDYE 3WY3A 2NY0D 4OPHA 5CCKL 1EEZA 4WI0B 3BESR 4MD4B 4WK2B 3M17B 4FFWC 1RFDL 2BP5M 2FZ3A 2F19H 1OW0C 4R7DB 1WHOA 2GVYA 2AJSH 3UMTA 3VXUA 1OL0A 2X40A 1SZXA 3PWPB 3Q8CA 2A7WA 1JS4A 3QUXD 4AM0Q 3JV6A 3E35A 1PLBA 1GC1H 2WVSA 1RMFH 4Z7VF 4FJYA 1C16B 1JV2A 5C6TH 3LUTB 1F58H 5BZWB 4NRZB 2EVGA 3AVEA 3FT4B 5C8JB 1QTPA 4BHUI 4XPGL 2YWZA 3TZVC 5EIBC 1FE8H 4MXVE 4G42A 3QI9B 5KX5B 3STZC 1JGUL 1IGTB 1PG7L 3HBZA 4M61A 1JAEA 3CFJB 3ATFA 4FQCL 4PSRA 2EDHA 1G7MB 4RGOH 4OD1L 4DVBB 1FNAA 3NEOA 3K71B 4GKLA 4WVRA 1Z5YD 4F7TB 1FFQA 4L9LA 4FQXB 1KMIZ 1NFIB 5ERWB 4MA1C 3RLSA 3CXFA 4WI0A 1F6AB 4MD4A 2D9QB 3M17A 3F7KA 1F45A 3HZYB 2XJKA 4R7DA 3RY4A 3GPEA 1YJDC 2FB5A 1D5MB 1YUHB 1U41A 3QUMA 3PWPA 1SRDA 5EO0B 4AGQA 2Y2YA 2D3JA 2GT9B 3GMMB 2QDVA 2X9ZA 1C16A 4XHJD 2GKIA 4JX0A 5BZWA 4NRZA 4AYDC 4JFWA 1NH2D 3FT4A 4RGNE 5C8JA 1OLZA 3NPZB 3Q5OA 3PS6A 4MB4A 1ACZA 3AG2C 2IAND 3QNFA 4HT1H 4WGKA 5C0GB 3SE3A 1CI5A 4G7VL 5CEYB 3SOBH 3HLKA 3QI9A 5KX5A 5CUSH 3K5OA 1IGTA 3BKYH 1UWXH 4KOCA 1I7UB 3CFJA 4BFJA 4NKGB 1G7MA 3IDMB 2WUCH 1AMYA 1XL4A 1ASPA 4DVBA 4R0LC 5FYKL 4FPPA 4O2AB 4BCXA 2FLBT 3K71A 4UDTB 1LR1A 1NCTA 3CXCU 2IQAB 5JPNB 4L5FH 3BKMH 2B20A 4F7TA 3BRDA 3L72H 3H55A 1SHWA 4PJ9B 1JDDA 2ZXBA 4FQXA 3VU1A 1NFIA 3H3PL 5ERWA 1NANH 3ULUD 1QSZA 3DBSA 4LDOB 1WZAA 4C54A 1CD8A 4AMWA 1F6AA 3B5TA 5DYOB 2WPDG 3HZYA 4GXVL 5EZLB 3WELA 2E27L 5EN2B 5KHKA 3L2MA 3PF2A 4EPSA 3BE1L 1YUHA 5EO0A 1H15B 3RY6A 1KENH 3D12B 3PL6D 1B9KA 2YEQA 1DGSA 2GT9A 2Y7OA 4DUYB 3GMMA 4R3SB 3HUJE 4M6OH 1YEKL 1ZA6B 1GN2A 2HVJA 2HMID 3A6CL 2FUQA 5KSBF 4JI4B 1TNMA 5C0GA 2ZR3A 1FH2A 2UUCO 5CEYA 3GLDA 1OCZC 4M48H 2J5LB 3MI6A 1I7UA 2R27A 2UWEF 1M7DB 2F54D 3IDMA 1NKRA 2Q20A 4PJEE 3EYQC 1GSMA 1LK3H 4O2AA 5GRXG 4ZUVB 1QA9B 4UDTA 3M45A 4OM1L 2IQAA 1UEMA 4Q74A 5JPNA 5GGVL 1RP3B 1O9VA 4JDZB 4PJ9A 3SY6A 1KTDB 1LVEA 4ONFL 2DJMA 1I3RB 3DPDA 3JD0A 4XE5B 3ECBB 2VXQA 3QUZD 5DYOA 4GUCA 3VO0A 5EZLA 3PWLB 4XDLA 4APQD 1M57C 5EN2A 3U9PL 5HHVH 3POHA 4ABVA 1H15A 2JVUA 2KHAA 3RZCD 1BV8A 4R3SA 3ZT7A 2EJ7A 2YPLD 2A77L 3HB3D 4JM2C 4JYYA 1ZA6A 5CZRA 4UOZA 4YBQC 3ULVC 4IDLA 5E9DE 1N7MH 4GAJL 3P0YH 4UV7L 1M7DA 5C0CB 4XP4L 2ZUTA 2RD0A 3BEWB 2NZ9C 2XV6B 1PSKH 3D39E 4J3WA 4ZUVA 1QA9A 5C71A 1VFBB 2BP3A 2Y07H 2XY1A 1PX8A 4JDZA 3MOBL 1KTDA 4FP8H 4GKKO 2CO4A 4AGNA 1I3RA 4L05A 4DR5B 5TQ2L 3UDWC 4NN7B 3ECBA 1R3LB 2FT8A 2YQ3A 1F90L 3VI3F 1LILA 1QACA 3PWLA 5E6UB 2YEVB 5ITBH 4Z7WF 1N0JA 2QHLA 3VA6A 1WN7A 3LNDA 1U8OB 4WO0A 3JALB 1CU4L 5CA0B 5D7HA 4HEPA 1LEKB 4P5RA 3VD1A 5AW6B 1KSRA 4FK5C 2VSCA 4ETYA 3AREA 5E1IA 4JDTH 1MEXH 4OGXH 1DBMH 4K23H 3OVUB 4QAMB 4TUKL 2GITB 5GPRA 3ZHFA 3W7XA 2GTZB 3KG2A 3BZ4B 1QLEC 3I56V 4MA7H 4Q6IB 5C0CA 3PDGA 3EYUH 3ATDA 3BEWA 3PIQB 1QKZL 3B2UD 1VFBA 3HG3A 3ZCCA 2BSBA 5CJQH 3J80N 1IAMA 2ZX9A 5I2IB 1Q8IA 1WAPA 3OZKA 1P4IH 4N68A 1CLOL 2FVNA 4XMPL 5DHYB 2YUZA 1R3LA 2B5IB 5JLZB 1IXMA 2EUWA 3FFDB 4NM4H 2CHZA 4K5PA 1OLLA 1R17A 4AIOA 4Z3HA 4NI3A 4GS7B 5F96H 1RULL 1SJEB 4PWEA 2YEVA 4Z7UB 4CBPA 5KA5A 1QYGL 1H5BC 1OWWA 5GRWA 4RLDA 4R26H 3N2KB 4F2ME 1U8OA 2Z7ZA 3JALA 5CA0A 3G6JE 4PGEB 4UBDC 1SLWA 2NDFA 2QELA 1LEKA 4G6AC 3G5WA 3Q5YA 2WLMA 4QLRA 5HYSG 2K4WA 2HFGH 3KZ8A 2QDWA 1XNRB 5FHBH 1I94B 1UZGA 3CCLV 4TV8B 1CXIA 2HTKC 2H32A 4HH9B 3WNMA 3RVYA 4U1GB 1BSMA 4EN3D 2EICA 2GITA 3GMOB 2GTZA 3AU0A 3BZ4A 4M5ZL 4P2RB 4Q6IA 3WS6C 4HHWA 4IRZL 4XX1E 3WUWB 1RU9H 3L48A 3PIQA 1IFHL 1BVKB 1LXMA 3CVHH 3KJ6L 4RGNC 3NRPA 3QDJB 4UT9L 3TU6A 1UACH 4U7SA 3G3LA 1NVPB 4DP4X 3BPOC 3NA9L 4IK6A 3LVTA 2XWJB 5I2IA 2XXFA 3K5MA 5DHYA 4CAGA 3ZYZA 3D3VE 2UWEB 1PLAA 4D8OA 1RVFL 3IDJB 5JLZA 1ET8A 3FFDA 2WKOF 5C0AB 4Q97A 3RP1A 2G5RA 1UXSB 1S9YB 2PWEA 2VZVA 1MW3A 1SJEA 3FTGB 3RG1C 5KYUB 4Z7UA 5DD3L 1MRCH 4G6MH 5HI4C 3O9WC 5I5RA 7TAAA 5D1QB 3N2KA 3EW3B 3VGAC 3CX2A 3B37A 2VL4A 4PGEA 2DYPD 5E08H 3S3BB 3CMAV 4I1RA 5B1OA 4NQVB 1V5JA 3QRGH 3SKJL 3MUUA 1KDIA 4G8AC 4Z7NB 3DI3B 4UQCA 4TV8A 4HH9A 5IVXE 1SHSA 4W9IC 3OLEA 1E4XL 2ZT9C 3GMOA 3RVWD 4K3AA 4N4YB 2M1KA 4P2RA 2X4NB 5GHWL 1ZEAL 5D5QA 2EAEA 2JSFA 1PZSA 4LEXH 5GGTH 3WUWA 3BRCA 3HJ0A 2VW7A 1SQXH 1BVKA 3QDJA 2E5LO 1I9EA 1OVZA 2IH1C 1FVCB 5I1CL 3L4XA 1A0QL 1TTFA 5HHME 2BOLA 3SBWC 2X4RB 3ARWA 5CKAA 2XWJA 2IAAC 4OCRL 2ZDIA 4WW2C 4Y1AD 4EI0A 2B3RA 1XNQB 1ZRUA 1YEJH 1F4MA 2UWEA 3IDJA 4D2NA 1DQDH 2BSRB 5DZNA 5I76B 4FTDA 1DJWA 1YZBA 3ERXA 1JBJA 5C0AA 2TRHA 3LZOA 5GGQL 2R4SL 4BXVA 5IGXL 5KYUA 1UXSA 1S9YA 1J48A 3FTGA 2R1YB 1IKFL 5D1QA 3AABA 2CRYA 2E6PA 2WXOA 1AQMA 5I75B 3N41F 4DP6X 1XGQB 2N59A 4NQVA 1TITA 4PJ6A 3VI3B 2FL4A 2OJZL 3F6JA 1I85A 3SE4C 2OYLA 3T3PE 1PKQE 5CNHA 4EQ3A 4GLXA 2VJ0A 4L1SA 2LLNA 4TQDA 2VMFA 1JF1B 4Z7IA 2ICEC 5BS0D 5EDXA 4OFIA 2BNRB 2XAGA 2X4NA 1AI6A 2HPTA 5DK3A 1OQOA 1PEWA 3MJ6A 5HDQL 2YD8A 4HG4K 1S8DB 3N91A 1E43A 3SGJA 2V4LA 2YGOA 1FVCA 1XIWD 5DVKA 3TM6A 2YFOA 4DK6A 4EBQH 2NQCA 2X4RA 1FNLA 4FYQA 2KZBA 5LG1A 4WFGE 4AI8A 1A32A 2QWNB 4X98B 4XNXH 5I76A 1E4JA 2BSRA 2DQGL 1SBSH 5F21B 1G9ML 5GS0H 1WD9A 5IJKA 2YPVH 2PI4A 2K3HA 3B2VH 2R1YA 3O2VH 1OE3A 2ADFL 3NJKA 2ROXA 3JVGC 3T1FB 2A9ML 4MQXC 3NCWA 1J0YA 3GBDA 3NZHH 2ZXQA 3BSHA 3MN8A 2WB7A 1XGQA 4FERA 5D7SL 2VDRL 4OLXL 2E7BA 3VI3A 2OMUB 2Q3XA 3JSLA 3HR5A 1J0ZA 3LB6C 1NBQA 1BA9A 3TN0B 1HCVA 4EI5C 1RIVL 1P5UC 3BD4A 2BNRA 4UNVA 1NFDB 3QIUD 4LL4A 3LZFL 4XP1H 4GXFA 5FV2A 4HEME 4KKPA 4PJ5E 4KUMA 4FG2A 4M6AA 4U3SB 4IEFB 1OT1A 1S8DA 4S0HA 2CRIA 3THMH 4JRXB 4JV5B 3QUYC 3QPXH 4B7EA 1G5GA 5A16B 4BQ6A 3QYNA 1KGIA 1TETL 1P7BA 5CB4B 2GBAA 2UZXA 5CBHA 1NCHA 4X98A 4F6EA 2PPEA 4TRPL 5E0QA 4NKQB 1MCCA 1CDBA 4ZFZB 3KCYA 4NZJA 25C8L 5LJYH 3ZMRA 4J12A 5DHEA 3N42B 2AJUH 4AL8H 1Y18B 3T1FA 3MNDA 4M29A 4WY7H 4WZ9A 2I07B 1H6EA 4CMMB 3GS0A 4FYSA 1Z0MA 1NWPA 4IKJA 2NXZD 5DEGB 2W0LA 2OMUA 1E3FA 3CZGA 3IAPA 3SDYH 2FB4H 2R69L 2ITCB 4JEGB 1XB3A 5GRJL 3PGDB 4JRYB 3TN0A 2MEJB 1P53A 5LO7A 4AQ1B 1NFDA 4Y2DC 2ZUUA 2X05A 4IOFD 4U3SA 4UAOB 4IEFA 3K5LA 3O6KH 5JHDB 1FD9A 3OGIB 4DV0O 2AHZA 3FB6B 4JRXA 3Q4HB 3F7YC 4R5TA 3UCQA 2OR7A 1MPAH 5A16A 1LGVA 3L16A 4Q0XL 1V9PA 2DQUL 1A14H 4OD2B 5CB4A 3CVBA 3BLPX 3BHPA 3CC2V 3HG1E 5IHUL 1BQLH 1OB1B 5IBUG 2DD8H 4CBCA 3E22B 4KL1A 4ZFZA 4B3EA 3HKBB 2V7HB 1HTYA 4OCWH 1Y18A 4KI5F 4LCIH 2PO6D 2DWSA 3SJVD 3C6LB 3FPXA 2G0LA 3HVDA 3VXNB 2I07A 4CMMA 5ES4B 1PAMA 3MACH 3BPCB 3QEGL 5DEGA 1BE3H 1D6EB 1FDLH 2FX7L 4IRSB 2WKOA 4N20A 4ZOLA 2C9PA 2C26A 1D5AA 1KNOB 3DBXB 2ITCA 1NL0L 4K0OA 1HL9A 3PGDA 4JRYA 4XWGH 3EADA 4AQ1A 3HG2A 3HI6H 4PWHA 5AZEL 3ZTNL 3QORD 4B7LA 3N41B 4LT7A 4KK6C 3U83A 2RJZA 2Z92B 1N5AB 3FO0H 5JHDA 2GBTA 2DH3A 3FB6A 5I0YA 4GO9A 4HNAB 3Q4HA 5F88B 1ZWIB 3AUWB 5D96C 4U2ZA 2AXGB 4OD2A 1U2CA 3CC5B 1BQ0A 1KELH 1QFWH 2WXRA 1NC2B 3MV7D 1XFPA 1NBCA 4L8CB 3E22A 1G9NC 3CFBB 5KSVB 3HKBA 2V7HA 1E7VA 5DFAA 1ZJBA 3DUUB 1EMTH 3NQKA 2XG4B 3QJRB 2WY3B 2PW1B 3O4LD 3K6DA 4YZFF 4QJFB 3C6LA 3B6SB 2QMKA 5F93C 3TYFB 2L35A 1CGTA 1J8SA 3VXNA 3E2HB 1MRDL 3BPCA 5ANME 4ZQTA 1D6EA 4IRSA 3SD5A 1FLRH 3TT1L 1VF5B 5DD0H 2DL2A 1KNOA 3DBXA 3LHPH 4FD0A 1JGDB 5GJSL 1HWYA 5HDWA 2ZWKA 3KEDA 5KMGB 4L18A 4C4UA 1DL7H 3WFDL 4PJXF 4N6RB 4Y4FC 4JM4L 2F68X 3WY4A 2Z92A 1N5AA 4BSJA 1ZT1B 2R29H 4HNAA 1NCBH 4MJHA 2DWDC 5F88A 1ZWIA 4MVZA 2YSUB 2JRIA 2AXGA 2BXYA 2KZWA 4Z3TA 1PD1A 3CC5A 3HBQA 2P46B 3NPSC 4ODVH 1NC2A 4IOIB 3U9WA 3BKCL 2QWOB 3BA8A 4L8CA 3CFBA 1AE6H 2CAZC 5KSVA 2DQMA 2D8KA 3DUUA 1NGZB 2WBKA 2XG4A 4X6BB 2QWQB 1V7ML 2PW1A 3CHXA 3OR7B 5I19L 3TYFA 1IAIH 3B6SA 4IW4C 5JIIA 1HSBB 3ZRSA 4LASH 1K92A 4JRFA 5JUEH 1OQXA 2AQQA 1RD6A 1K8DB 3A23A 3I9AA 5LP6B 1GXEA 3LH2H 5IB5B 3S9DB 1VFAB 3DX0A 3Q6GH 1T5KA 5KMGA 1OTTC 1YJDH 1WHPA 5DYFA 5JNYB 3P9LB 4P23B 1XF4B 1PNLA 4ABQA 4L4VE 3NRFA 4FFKA 4N6RA 2W65B 4XAKD 2WN3A 3SDDC 1ZT1A 4YBLB 1IC0A 2EILB 3ECVA 3FT9A 2AVFA 1X4YA 5DVLA 3V8OA 3CSBA 4K15A 2F58L 2A2QT 1XCXA 2ZKHL 4PRNB 5FC9A 1HKLL 3ARDC 4IOIA 4Z6AT 3CN2A 4J7JA 3D9AL 5EBMC 1MHHB 4LCYB 3R19A 3MV8E 1NGZA 3DC5A 3CH1B 4X6BA 3HMXH 3OR7A 4IS6B 4IHOB 4OJEH 1INEL 1HSBA 2Y2WA 3QC6X 3QRLA 3S37X 4MAYB 1Z66A 4NJAH 1K8DA 1E8YA 2HT3C 2WCGA 4X6DF 5LP6A 3C90A 3AT8A 2YD1A 4J3VA 5IB5A 2A9NH 3T2NL 2C1PB 1VFAA 3V6OA 1IV8A 2WO2B 5GW7A 3IDNB 5B22A 2D03L 3M07A 5JNYA 1G4YB 1SDYA 3P9LA 1XF4A 4P23A 2ITDC 4KKZA 2DLTA 2W65A 4NO0D 2O6DA 3TT3L 3MRMB 1ET7A 1A6UH 3HHRB 5E1HB 5FNVB 4MS2A 5JOPE 3BN9D 3N43F 3V55A 1PKOA 1WWBX 1XCWA 4AM0B 2OYMA 4KXZH 4I5SA 1WE5A 2QKIB 4M8UA 3ARXA 4NX0A 4PRNA 4FZEL 2A0LC 4PLNC 4QXUH 3GJFK 4MJID 4TNWF 4R8WH 3MODH 1XD0A 1MHHA 2LR4A 2O26U 2YK1L 3AS2A 3BSGA 4LCYA 3ZKXC 4UB0H 4AYEC 3CH1A 3WNPA 4YS4A 1IEAB 4H37A 2QE7G 4IS6A 4IHOA 3QBTB 3UAJD 5K59E 1AI7A 3NCJH 4MAYA 1UWYA 2FAUA 2IDTA 3ZTCC 4XBFA 2JELH 4HIXL 3CRCA 1A7QH 2R2EB 1ZJAA 2YOCA 2PPCA 3BUDA 2C1PA 1TDQA 4ZX4A 2Z0AA 4KJPD 5CP3H 3IDNA 2C3HA 1I9IL 5FDYA 1I9RL 3RVTC 2PYFB 1PD0A 4YDJB 2CMRL 4X9HA 3MRNB 3V4VB 1CL7L 1C08B 4L4TE 1YNLL 2MQCA 5E79Z 3MRMA 5EU5B 2ESVB 4RMQA 3V0FA 4D3CH 4Z8FL 5FNVA 4XXDB 3QFJD 4HZ1A 3ULVH 4AM0A 4WWKB 3I50H 1OZ0A 5JIDA 1X9RA 2K8MA 4G1MB 4PJXB 3RIAK 5AAPA 2VLMD 1D2PA 3CMEV 3KH4A 5AW7B 1N59B 1VP7A 4U3CA 4JN2B 1IEAA 2XPZA 4G2AA 1KACB 1DQTA 4DNLA 5ABZA 1MCEA 4KKAC 2G2PA 1EAJA 1BGXL 2R2EA 4AWJC 2QQKL 5C08E 4CW1B 5JDSB 5DJYB 4LBEC 2PYFA 4WUKL 4YDJA 3O3UN 4JO3H 3MRNA 3VYNA 1OP3H 3V4VA 1UVQB 1C08A 4YK4B 3ZT6A 2BRQA 1P7GA 1QRNE 2V9RA 2WMPB 5EU5A 2ESVA 1BYNA 1QOKA 2L7UA 4XXDA 2AGAA 4WFHE 4WWKA 4ZOCA 2Y7NA 2VISB 4BZ2H 1XILA 3F7VC 2XN0A 2ETWA 4G1MA 1QLEH 4PJXA 3IBEA 1IEHA 1UUSA 4FNSA 2W92A 2OMBA 1WUZA 1N59A 3GTTA 3KBFA 4GMTH 4JVPA 1Q3EA 4P4KB 3DXAB 4U6HB 5KVGE 4AEHL 1O7SA 4JN2A 4HKJB 5AOJA 6CGTA 2VLRB 4FL4C 2V2TB 4BK5C 3QXVA 1MFCH 4K7PX 4OF8A 1KYOJ 4XBGB 4PJ0Z 4DEPB 4AY0A 4BR6A 4FI8A 2DQTH 4GQ9L 2PNDA 4JFEB 4J28A 4LKXB 3ME0B 4CW1A 1PMYA 1LP9E 4G2KA 4LCCB 1ORQB 1TMCB 3BT2L 5JDSA 5DJYA 3ZHNA 2DQHH 3H01A 1I31A 1PF3A 1EZJA 2A3QA 5D70L 3VYPA 2GIXA 4LSRL 1W0KG 4XT1C 1Z2KA 4YHOL 1UVQA 3NCMA 1V3KA 3F5TA 1FRGH 2WMPA 3EYFB 1L7IL 1M1SA 5IESH 1T2QH 4ODHL 1WAAF 5DUJA 2D2CC 2VISA 3BAWA 3NVQA 2RIKA 5MEND 3VGGA 2ED8A 2DICA 5D1ZB 4F8TA 5LGHL 4Q20A 1MFBL 4LLUB 3QCVL 4QHKJ 2GB2A 3SBPA 4P4KA 4PCKA 1T04B 3F7RA 4FFYH 4U6HA 1X9UA 3DXAA 2CGRH 4RMSA 5FA4B 4AIXA 4HKJA 1EUUA 3U10A 1QLNA 2P22C 2VLRA 2W59A 3N43B 3NACL 2HVKC 4JG0L 2LFEA 5CN2A 2V2TA 4UIKH 4WEBH 4XBGA 3VXRB 4MTXA 1UWEL 4JKLA 5EDSA 1QFUH 2VQFO 3MA9L 4YSOA 4JFEA 3GM8A 2DYSB 5HHOE 4LKXA 1R3IL 3ME0A 1N36B 4LCCA 3OEEG 1ORQA 4HFUH 4NTXA 3I6LD 3ZEDA 4LSSL 3Q06A 5AAMA 4YEFA 4N8UA 1W9XA 4N87A 5ALCH 4UM8B 2V3FA 2EJ1A 2FSDA 1D2DA 5HHXL 3EYFA 1JYNA 3JUYA 3MXWL 4XH2B 3ARQA 1D5IL 2A74B 4M1CD 1ZL8B 1NDMB 2YAMA 2WSSG 4NOFA 1SOSA 3T4AC 4M6NL 1ENVA 4LLUA 1GMGA 4NT6B 3O4OC 4MDRA 4MRBA 3WB0A 3EJYC 3VXUD 1ZD6A 3VFRB 1T04A 2XIIA 4K4KA 5FA4A 3KLAB 1ZHLB 3DMMB 2FTKA 2E6JA 4OF6A 3SPGA 3B2MA 4NXMB 4IQHA 1VEOA 3VXRA 3O41B 3DROB 3KWTA 2OR8A 1KCRL 4J11A 5HGBB 3KYKH 3AS0A 1W8EA 3SYPA 4P04A 3IKKA 4F7CB 4ZMQA 2BOCC 2CKBL 4QWWD 3GBML 5KS9B 4BWAA 4QNPE 4GFTB 4UM8A 3CSXA 3D25B 5E6IB 4TLKA 1DQLL 2K8QA 3CD6V 2IPTH 1O9HA 5F7YC 2XUMA 4XH2A 2O5ZH 2A74A 5D4JA 3KM1A 1ZL8A 1PPIA 1NDMA 3AT9A 4PB9L 4Y2LA 3ZN0A 3KD4A 2ZNJA 3ARBC 2IQ9L 1EBOA 1PEZA 3AU1B 1X44A 1U8JB 3QQDB 5GIRB 1YJ9V 3QZMA 2CK3G 1YC8A 4TVUA 5C0IA 4JFPB 4NT6A 1J9QA 5LYJA 2MKWA 4GRLC 3VFRA 3PWPD 1ZOXA 1E67A 2EABA 1WEJH 2VQEB 5CKGA 4YQXH 1KXHA 1ZHLA 3DMMA 4KTEH 3WO4B 5J3HC 1AZCA 2VH5L 3O41A 3DROA 4ZTPL 3GC3A 5ESQB 2DN9A 2WSDA 2W9EH 3S5YA 5HVFB 3CG8A 4KV5E 3LKQB 2CGNA 2FJHB 3I9GL 2VXUL 3QI9D 3GTNA 2L0DA 1M71B 4F7CA 4JI7B 1RAMA 5BVPH 5KS9A 3F00A 2XA8L 5F72S 5E6IA 3D25A 4JPKL 4ZG1A 3RJOA 1X5GA 1FFRA 2IH8A 3V9CA 3QNXA 5CFAA 4JM2F 4FQXD 5BUPA 5E9AA 1KTJA 1H19A 3AU1A 3QQDA 1G1OA 1MF2L 1U8JA 5GIRA 3OUFA 1U97A 4XNZB 5EU7E 3H6JA 2PR4L 4F2EA 4JFPA 2QHRH 2WC7A 3UJJH 1M2VB 2Y5TB 1I8MB 4I2XE 4CUCA 5BV7C 3CSTA 1HW7A 3ZKMC 4NFCA 2X44D 2ZOLB 4JFOB 1SOQA 3NSXA 5IREA 3WFBL 1DQMH 2ATKB 2PP9A 2VR8A 4UMSA 1KBHA 2MCG1 4CA4A 3FUMA 4AW7A 5ESQA 2J1YA 3ORJA 3R1GH 5JQGB 2VDKB 5IYBO 2PTMA 4B95C 3LKQA 2I32A 3E6HB 1CIUA 2FJHA 1ACXA 5KVDH 5HD8C 4OSUH 1M71A 2B1HL 5ITZB 5BZDB 4FKHA 3PV6B 4BFEA 1K3ZA 1FVEB 1SBBA 2AERT 1I7RB 3BVDB 4PGBB 1HNXO 1IC5H 2HHHB 1U8KB 4ZIBA 3D30A 3FHEA 1NH6A 1H3TA 4GAGH 4KY1H 4MA1B 4PJ9D 3VJ6B 1KBGH 5DLMH 4ZXBC 3B5GA 4MMYB 2G3NA 4KC3B 1UM4H 4OZ4B 3NH7L 5EEVA 2AEWA 4GUQA 1M2VA 2Y5TA 2DQJL 3IAGC 3BVXA 2E9BA 2E86A 1NUDA 1JNLH 2C1OB 3UTSE 3CFUA 2ZOLA 4JFOA 3GKWL 4K5OA 2ATKA 5CLXA 3AG2B 1CI3M 4YE4H 3FB8B 3B34A 1L3NA 2FX9H 1UB5B 1Y0LB 2L7EA 5JQGA 3E1F1 1EVUA 1ZUQA 3E6HA 3JWDL 4JY5L 3IVKB 1WA0X 2N0MA 2LFGA 4M6ML 4R0LB 5BZDA 1ADQH 3KGRA 1CFVH 2XY2A 3O81A 2DM4A 3PV6A 3S88H 1FVEA 1HZHH 5AW5B 4B3MB 1NAKH 4XC3L 1I7RA 4G72B 4PGBA 1H8NA 1U8KA 1Z3GH 1MWAL 4W9CC 3VD9A 1BMGA 1KT2B 3VJ6A 2J1ZA 4PJBE 3ZGIA 2A6DB 2EZOA 2H94A 2ZSWB 4FI6A 1XCQB 3GSNL 3OKEB 4MMYA 5LCVH 5F7BA 1YIJV 1A7RL 3LRSB 4OZ4A 2ZWLT 1DANT 3AT0A 2NCMA 3D2UA 3P3YA 2HG5B 3BW9B 3RVVD 3LEVL 5KOVC 2V7NB 3N1GC 4HUNB 2VQ1B 1QZNA 1DBBH 5JXEC 2C1OA 3OZ9H 4LU5L 4Z1PA 2Z0BA 4FFTA 3GUTB 3ARED 5E1AB 1UB5A 1Y0LA 3P11L 2AHIA 1UZ6F 1RZPA 3U0WL 3DUSB 4HIQA 3RWHB 4IKNA 3IVKA 1N12A 4Y89A 1G9NH 3X17A 1QSEB 4R0LA 4HLEA 1L9TA 4QRUB 5C0CD 1IQWL 4I1PA 3JV5A 4YDVB 1G5AA 2H2PD 3WOVA 1CIDA 1O6VA 4OLWH 3BVTA 3HS0C 4HGMA 1BREA 1RUKH 4P07A 5A2BA 3ETDA 2NQDA 2IPKB 5HYSB 1KT2A 3T0EB 1HEZB 1NIFA 3JT0A 3VG9B 2A6DA 4W4OA 4ODXB 2KPNA 1J5OH 1UYWL 2ZSWA 4FNUA 1XCQA 1LDPH 3OKEA 1NMCB 4DV2O 2EJRA 4FIPC 3LRSA 2ZOOA 2ADGB 3PREA 4TV3A 2JV6A 2DJVA 1B6UA 4FCHA 2WWKO 4DGIH 2HG5A 3BW9A 4LSDA 4CC0A 4OZHE 1KIPB 2V7NA 5INCB 4NQXB 2VMDA 1I3GH 2VQ1A 3OMNB 2Y23A 4Y9FA 1Y6XA 2LGQA 3D05A 3DO3A 2GJZB 3J2PA 3V5KB 3VQXA 1DJHA 5L4IA 3VFTB 3ZUNC 4F24A 5E1AA 5EOTB 5AG8A 1TYEB 2BSED 4IHJB 3DUSA 5T1DL 5TGBA 4PJEF 3RWHA 4GJTB 2LJ2A 4A2LA 5ACZB 4Z3GA 1QSEA 1Q9WB 4M1GH 4QRUA 1V3LA 3CX5J 3RVXD 3UABA 1JZGA 2XZQH 5EOCH 2ZQKA 4MB5A 2P44B 4RA3A 4CH3A 5E2UH 3B56A 3S98A 3X14B 3IGAB 1XUQA 1ZS8B 2IPKA 2VDOB 3GDBA 5HYSA 3T0EA 3OJDB 5DZLA 1HEZA 3CVIL 3P69A 3IT8D 4ODXA 4HCRL 2R59A 4OI9A 4FQIH 5CP3A 5JW4M 4ANVA 2AEOA 4Q89A 5TISZ 1NIAA 1YMMB 2ADGA 3FF7A 3L1OH 1FSKC 3RVUD 5MERB 1DVTA 1DQIA 4ZOEA 3UXFA 3WKML 4G28B 3TBSB 1KIPA 1OXYA 5INCA 1T83A 4NQXA 4MW8A 4JPQA 1LM8V 3V7AG 1TJHH 1VSCA 2GJZA 3LKOB 3V5KA 5LWYL 3VFTA 2F5BL 2Z4TA 5EOTA 1ZVHA 4JTDB 3L95B 3BPLB 4IHJA 2RA1A 1FZJB 4EKJA 3L2LA 5ACZA 1BHBA 1VFOA 1ZLUK 3EXAA 2PABA 1Q9WA 2O93L 2FX8H 1JDCA 4XNUL 5AL0A 5HYEA 3ABUA 2YD7A 3G5YB 4I0XB 4GIPD 5A1AA 4OY9A 5F8RC 3VFNB 2VMCA 3QDJD 1IMHC 3QRBA 3X14A 1NVPD 3IGAA 4LFCO 5EWIL 2PUSA 4KDTA 1ZS8A 3HR6A 1H8SA 1VQ9V 3OJDA 4U1HB 4X4XB 3SYOA 5DHXB 5C9JB 1A3RH 4DN3L 3CCEV 4ZS6C 3B77A 2EXYD 5I1EL 5C0AD 1XI1A 2AEQL 4W81A 1K4CC 5C07B 4KKLC 1YMMA 1FFNB 2XHBA 1OCWH 5MERA 5E99H 4P9HC 1P4BL 1PV0A 1CXFA 3IM1A 3TBSA 5D1QD 4R5XA 2IM9A 1BZ7B 1XZ0B 5LLIC 3FSVA 3H2WA 1F4WH 2DQ3A 4WEMB 2HJLB 2X9WA 5DEDA 2ZNWA 3APFA 5F9AC 2XETA 3LKOA 1ADWA 1TQCB 4OFQA 2HWZH 1RZKL 3ZE1F 3L95A 1FZJA 3A4AA 4K3HA 3MLTB 3JD2A 1KLFB 1OPGL 1SMOA 1FAIL 1ODUA 1SY6L 4HXAL 3FH8A 4YSEA 2R2HB 4DR6O 4NQQA 1QHTA 5KHHA 2C3VB 3G5YA 4I0XA 1S76D 3VFNA 2VDNB 3BPNC 2CJ3A 3GLAA 5B1AB 2DMHA 4NCDA 3QDHA 5CA1B 4I3SH 3AQDA 4U1HA 3ILPB 4FI7A 4X4XA 1HZLA 3A6BL 5C9JA 1KJ2H 3JBG7 4OFVA 5HGGS 3IJ9A 3GYRA 2EACA 3CN4A 3EJZC 3U36B 2Y5EA 5C07A 5CCJA 2GV9A 1FFNA 2VZTA 4K5MA 4MNQE 4OU3A 3OJVC 1AQKH 5EIQA 5E7BA 1IZ3A 4YHHO 1S72V 2COVD 1BZ7A 1XZ0A 2Y7QB 2PF4E 1IBZA 3MV11 5I74B 4CN4A 2HJDA 2HJLA 2DQ6A 1PX3A 3MUZ1 3PXLA 3CXDL 1YNTB 1HXMA 2PTVA 3V0GA 5EC2B 5EFIB 3GZPA 3VX0A 3WS6A 3EO9L 3C09B 4XO5A 2HAZA 2Z31C 3WFVA 1KLFA 1NGYB 2BNRD 2D7TL 2IALA 3MLTA 3A5VA 2W88A 2R2HA 3ZTJH 4P5TB 2IH1B 1NUNB 2C3VA 4I3RL 3D2TA 2OQJB 3BQVA 5T33H 5GGSY 4DW2L 4M3JA 3GSVB 4GIAA 1ZPUA 2A1WL 4PSPA 4Y4KB 5IW6B 4NIYE 4CS2A 5EB9A 2N1KA 5CA1A 3DVNB 1SHXA 5CGYD 4JNXA 3ILPA 2XLLA 1AKJB 4KZ0A 4FYRA 5TDNA 2HG0A 1KWGA 4NHCL 2R4RH 4LBAA 3SEPA 3U36A 4MDIB 4AILC 1NOAA 4UCOA 1SOXA 5EA0H 5JHMA 3Q0HA 3IS1X 3NOIA 2XG5B 4JQIA 1TPXC 2ZE7A 2AJ3B 2CU9A 1QBML 2K45A 3FU8A 1RZ7L 1QI5A 2W8CA 2Y7QA 4UILL 5AW8B 3B7YA 1X5MA 1T5WB 4KK9C 1DHKA 3DHJA 2IO5A 2MPVA 1BMFG 4GSQA 4OB5L 4L1HA 3BRFA 3HG5A 4Q14A 15C8L 4BCYA 3HC4H 5CXPA 5EC2A 5EFIA 3CRQA 2EDBA 3WBDA 4ZD3L 4LARL 1X9LA 1KTLB 5E2WL 3TN0D 4PS4H 1OSZB 5FUCE 3RA7H 3ZGHA 1XL6A 1NGYA 1PFOA 1P7KB 4P5TA 5A2AA 2IH1A 4G9FB 4JI0O 2OQJA 5ISZE 4M62H 6PAZA 5HP5A 3GSVA 3O2WL 3WLBB 1XHHA 1THAA 4JRXD 4Y4KA 5HBBA 5IW6A 3WU1A 4JHZA 5FGBA 5C1MB 3DVNA 4RQFA 1H38A 1S3JA 1U8CB 2IV8A 2NMSA 43C9B 1AKJA 2QSCH 4YXHL 3FMGH 4HWZB 2HYMA 3DJSA 2EIJB 2Z4QB 3DURB 1ZTEA 1U33A 4MDIA 1L6PA 2YMXH 4AOFA 2COQA 2XG5A 3QHTC 2AJ3A 2JIXB 1S7WB 3O3DB 2VIRB 4TUJB 5L3GA 2O61B 4XXWA 1WCBB 3A4FA 5I5IA 3PY9A 4YXWG 4MS8D 5D93C 5EOQL 1EFXB 1A65A 3QVAA 3ABKB 4YSRA 2CJSA 1KTLA 4JRYD 2OZ4H 1R73A 1OSZA 3FB5C 2UUCB 2YI8A 1P7KA 5B8CC 2FNBA 2OI9B 4G9FA 4YEEA 1EX0A 1GKFA 2QQNL 1RUAL 5JHDD 2EVHA 3HNSL 3WLBA 3C2SA 3QTCA 5E70A 4YE0A 3ZE1B 3ULUE 5ICXB 2WQXA 1U8CA 2XN9B 3MLRL 43C9A 1A7PL 3TK1A 2DKMA 4PJ8B 4HWZA 1Q94B 2Z4QA 3DURA 3GRGA 3K2IA 4P06A 4W9FC 2X09A 2NSXA 3JVGA 2Z3FA 1N4CA 1AR4A 1QR4A 4HX1B 4RMTA 1G9MC 5FIEA 4GUPB 2JIXA 2HUEA 4FZ0A 1HR0O 1FORH 1S7WA 3C6LD 3CFNA 2VIRA 3NJHA 3VXOB 3WJMA 3B7TA 3B7RL 4F8PA 2O61A 2VRQA 2O5YL 1I1CA 1AZNA 1WCBA 4IRSD 5F70A 4I0PC 1EFXA 2WGNB 4O4YH 3MJ8B 3P54A 4GQPH 1ZT7B 1FPOA 5T5FA 4WTZG 3K0YA 1UGKA 2F54E 2W1NA 4MRCA 3V4PH 1RIUH 2DIJA 2WYIA 2XU9A 3WDJA 4Z7QE 4OZGE 4KHTL 1L9MA 3IDYB 1E5CA 1H3GA 3WGUB 3MTRA 1HL4A 1ZIAA 1S9XB 4GG6F 2Q6WB 3OGCC 3CBRA 4IDJH 4XNMB 1E40A 1KB5H 3T1HB 2ICWB 4MA8H 4OM0L 5D6DC 5ICXA 4G82A 2XN9A 3WIFB 4H8HA 4JKPL 3KR3L 3W82A 2ENJA 2NTFB 2YBGA 3FCUB 4GKKB 5IZ7A 1NC2D 3B9KC 4PJ8A 4LAQH 4N24A 1Q94A 4E2LA 4CSTA 4J3OD 2VSKB 3JTTB 2WBJC 4HX1A 4P46C 2F1BA 4L8SC 4O02B 4WO4C 5GSRB 1LTXA 4W9GC 3RGVC 2YPLE 3W81A 4GUPA 4OIAA 1NKDA 4NBZB 1OGAB 2DQCH 1JHLH 2CHWA 4K71B 3VXOA 2UXBO 4B7KA 3KXFB 3GJEA 3ASOC 1WF5A 3SQOL 3ZMNA 3VCLB 2YQ2A 3CGTA 3MJ8A 1ZT7A 3VXTB 4B9KC 1I53A 1PLGH 5H6RA 3WXWL 2RALA 1DBAH 2VYRE 5A2KH 2PPFA 3OC5A 4X7SH 4E9VA 3MCLL 1S9XA 2YWYA 3ZW3A 3W38A 2Q6WA 4XNMA 3QQNA 1NAMB 2ICWA 3CRRA 4ZI8A 3UP6A 4DV1O 3HC3H 2WLZA 3WIFA 2KZ1B 3GLZA 1BWMA 1B3IA 1M42A 2NTFA 4FAAB 4GPVA 1CD9B 3AY4C 3ILEA 1US6A 5KN5B 5AVQB 2GC7C 1R3JB 5BRZB 1HESA 4JVUA 1EHLH 3VB9A 1E6JH 1J0JA 5GS1C 1IFRA 3Q6FB 4UYPA 3TVMC 1VQKV 3JTTA 2NY0C 3D87B 5GSRA 4O02A 3O2DA 4LGSB 3WNIA 4HVBA 2XPGB 5AAWA 3S36L 1OGAA 2OR9H 1ZLWK 4X8GA 1JE6A 3KXFA 5D5MF 4U1KB 4NXSA 3VCLA 3QUXC 3HRZC 4U6VL 2K7QA 3VXTA 4UZSA 2FJSA 1ZXQA 1FGNH 3LYRA 1A6PA 4BQ9A 1CZ8L 5B1NA 1WK0A 4GRMB 3LKNB 3PP4H 2B4CL 4P23D 3K5NA 2ICWI 1VLXA 1DQKA 2H0EA 2ZG3A 3HAEG 3DSNB 1GN3A 3ISYA 1MCKA 3LNEA 4KH2A 4JPWH 4PV8B 1KXQA 1NAMA 1BZOA 3INOA 5FUCC 4KKCD 1E1RG 4NUMA 1XSKA 2VC2L 1JRHL 2X3CA 2XTSA 1G9EA 5KN5A 5IBTH 1R3JA 5BRZA 1X3DA 1WFJA 5F2VO 2KT6A 4TSAH 5A40E 1RURH 3NAAH 1BBJB 3Q7JA 4PGCB 5ETUB 4WW1B 3Q6FA 5I1KH 1YITV 3AB0B 3QW9A 4NB7A 3VA2C 4TL5A 2XPGA 1OM3H 1L8DA 2VDML 3KEHA 3VXME 5EH1A 1VJSA 2KSDA 4MAYD 5BZXA 4U1KA 1ROPA 1G0DA 4CS3A 5EK0A 2OZNA 5DR5L 3G7TA 2ADJB 4KFMA 1FJGB 2NY3D 3D69B 4LFHD 4XPBH 2OSLB 3VNZA 4RQEA 1LO3L 3NCXA 3IRPX 4U4IA 2M83A 4F9PC 1UXMA 5CCKH 4XHJC 1MRFL 2C4FU 3BYTA 1BXUA 4GRMA 3LKNA 1QBLL 2CO2A 2IMMA 1GM7A 3BABA 2A4ZA 3DSNA 1UT1A 4XO9A 4J8QA 5DQJB 5F7DB 2CRZA 4PV8A 4Y19B 4UT6A 2RHEA 5ESVB 2QQLH 1AIZA 4JPVH 5J1SC 3PUUA 3ZE2E 2F61A 2YSTA 4WFAV 4NWTL 3O11B 3GGWB 5K9JL 1OAZH 5CCHE 5LBSA 4GQQA 4XPGH 1WB7A 4DP8X 1BBJA 2P5WB 4PGCA 5ETUA 4WW1A 4AEFA 4LL1A 4GG6B 3ULUC 1AGEB 1II4E 1PG7H 1SYVB 3IJEB 4OV6F 4PTTB 5C97A 5D7IE 4PRIB 3PGFL 3K03A 4U1LB 2J88L 1H8EG 4AQYO 1L4IA 4OD1H 1HNWO 1VQ6V 4NPKA 1ES0B 2WOBA 1OCCC 1LO5B 3GQFA 2MCPH 4G6JL 4XMKL 4YL9A 5EO1B 1A9BB 5E4EB 4HYTB 4F7KA 5L2KB 2VUYA 2ADJA 2EDTA 3PL6C 2YD6A 4HZLB 3D69A 5K9QG 2EH7L 2OSLA 4ZO8A 3CLFL 1TT6A 2XFGB 3K4ZA 3TWCL 3WXVH 4AXWA 5KSAC 2HMIC 1S5LZ 2QLYA 3NFSH 4NQDB 1C8PA 1JGVL 2PTUA 2QGBA 1OARL 1H3PL 2YC1B 2ESVD 4NQCE 5DQJA 5F7DA 4Y19A 5ESVA 3VFPA 1GS6X 4G7YL 5D7JB 4WWKD 1WIPA 1EK3A 2BHYA 5SV3A 5A2CA 4H8WL 2ZIMA 3O11A 3GGWA 1FHNA 3QWNA 1HI6B 3ZKXB 3SSGA 1JF5A 4G7RB 2IU3A 3DGDA 1C7SA 2P5WA 3MGTB 4V1DB 3UYRH 3KVPA 4GG6A 2F8IA 2UX7A 1AGEA 1SYVA 3IJEA 3OF6A 4PTTA 4PRIA 4U1LA 2GIYA 4GXUN 5AKTA 3QUZC 1RERA 4ZMZA 5L8LB 2XAHA 1X5YA 3C5ZD 3JQOB 4HWBA 4APQC 5FUOL 1ES0A 1KJ2B 1LO5A 2Y3AA 5EO1A 5CILL 1A21A 1W80A 1A9BA 1E3XA 1T4WA 9PCYA 2BWIA 4ZMLA 1EDYA 5L2KA 4HZLA 1FXKC 5BS0E 5H2FZ 2D3OW 4JB9L 4ELDA 2ENYA 3ESVF 3HB3C 4S11A 4JFFB 4EMZA 2VM3A 4EUPH 1AP2B 7CGTA 4NQDA 1MCWW 5I1AB 4EF3A 2H1PL 5L3EA 4LNUB 1AXIB 2E27H 4JFDB 4M7KH 3NUKA 5HPMB 1DUZB 2YC1A 5D5MB 4OLEA 2NSQA 1CR9L 3FUDA 4GI8A 2OTJV 2M6YA 5D7JA 5AOLA 3ZE0B 1GGYA 1BVNP 2R8SL 4N0UB 1HI6A 1T0NB 4NPYB 3PHQB 4J23A 2O4EA 1Q72L 4P4KD 4OVUA 3MGTA 3DXAD 1E2WA 2GTAA 1NCWL 4N0RA 3KYAA 4MWFB 2VLRD 1JNJA 1NPJA 3LIZL 1QI3A 4N2MA 3TNMB 3ZDXF 4RH4A 3E89A 3GMRB 1BHGA 2XNDG 1KJ2A 3AM8C 4ANKA 4JFED 1YEIL 1NM9A 3HNTH 5GS0D 2A9HA 3TBTB 3BI9X 4LR3A 2FCBA 5FYKU 1QNZL 2ZJSH 1KCSH 1L9NA 1JZFA 2EEBA 2N7AA 2OP4H 1ET5A 2EXWD 3FUFA 4JFFA 4H13B 1SN2A 1AP2A 5I1AA 3WB2A 4LNUA 2NY4C 4FG6D 4JFDA 3U9PH 4YHKL 5HPMA 1DUZA 4MXQC 4OIIL 5D5MA 1HH6B 3QQ4B 4HUMB 2ZQMA 3ARUA 4LESA 3WFCL 3AG4B 4DV0B 4XR8C 1DJIA 5CA3A 3H2PA 2IH9A 2WVVB 4DKTA 1H0DB 3B2UC 4RFEB 4N0UA 1T0NA 5J12C 3UBGA 5I0DA 4N28A 1E4WH 2C5DC 4NPYA 3PHQA 4FABL 1NIBA 4FL4B 4DIXA 4U0RC 3PWVB 1J18A 1XH3B 2BIMA 4XN1A 5A6IA 2WGXA 2CUMA 4MWFA 3WNNA 3Q2LA 1EXUB 1XT5A 1GIGL 2CO7B 3VXRD 3ZZLA 4GAAA 1FO0B 3GMRA 2AS5M 2IIJA 4PB0L 4LSQL 4XCCH 5JXAH 1BD2B 3ZHVA 4LFAB 1KGYE 2GTWB 1G4MA 4FM1A 1P1VA 2IV9A 2H6PB 3TBTA 3PXJA 3MOBH 4NUJB 3CZKA 4KJQD 4GKJO 4LVEA 5BRQA 2A73B 3RBZA 3MHHC 1IBGH 4UDUB 2KH2B 3QO1B 4P9HH 5HI5D 2JCCF 4M43H 4IBLT 3K2KA 2IBZX 3ZMEA 1YEHH 1MFMA 1KU9A 4EN3C 3L1FA 4WJG3 1S5IL 1HH6A 1JIBA 3QQ4A 4LXFA 3OQRA 4QGTA 4QDGA 4LSUH 1KCUL 1GAFH 1NBVL 4JI6O 1QMUA 2BRRH 4JK0D 2CTRA 2WVVA 3HE6C 1H0DA 3OAZK 4RFEA 5A7BA 2F4VO 4PJAB 3LD8B 3PJNA 4TUKH 4QE7A 4XDJA 3PWVA 5LL6Y 3SJVE 3GK8H 3BZ5A 2SODB 1EXUA 2CO7A 1TYJA 2DQEH 1WZKA 3LS4H 1FO0A 4N0YH 2NNUA 1BD2A 4MVBD 2R0WH 2GTWA 2R9AA 2H6PA 4NUJA 5K39B 3Q01A 2JJTC 4GRWH 4PJIE 2A73A 5F7KC 4KDWA 1EJOL 4N2NA 4UDUA 4YIQB 3RQ3A 3QO1A 4UV4H 5DS2A 1F56A 4EOWL 5DECA 1NMAH 3CE2A 4PJDE 4CVXB 3B9DA 4WSGA 5E6ID 4NC2B 1RULH 1RZ8B 2QLVB 4UQAA 4A7SA 5IYCO 3SOTA 3RVWC 1QYGH 2DIBA 3UJTL 5H9CA 3MV9B 5I6XB 1TIUA 4FEIA 3FD9A 2ZCZA 4HA1A 1QWNA 1V10A 1CYGA 1F4YL 2QZ5A 2W38A 3MV7E 5E1QA 3RWGB 2N01B 3E80A 4E41B 1X7TA 2Y7LA 4PJAA 2YMTA 4X9FA 1RIHH 5IQOA 4UVAA 1Z9OA 4HDIB 3O4LE 1BQHA 2VLJB 3NT0A 4ABWA 2UY6B 1F3RB 3JCZA 4DXWA 1NLBL 2LQRA 1IFHH 5F3FA 4UT9H 2V3DA 2VB5A 5IG7B 3QR0A 4X4ZA 2DQDL 3FO1B 2P7TB 3RE0A 1NLDH 5K39A 1QBZA 2FLMA 1LO0L 3QQ9D 4M02A 4HC1H 4YIQA 2I9TB 3RIKA 1RVFH 2NCEA 4I48B 4NAQA 4OPAA 3B83A 4LVOB 3VFUB 4NXNO 3ZDXB 4CVXA 2JKJA 2EUVA 4L3AA 4GFXA 1AD0B 4JO1L 1RZ8A 2QKAA 1MAML 3ML8A 5MI0B 5DD3H 3ARBB 5F2FA 5F3BB 4HMEA 3M7OA 4XOAA 4NZDA 4KHPB 2WLHA 3MV9A 3FBQA 2GUYA 4K9EL 5ALBL 5AZ2H 5FYJL 2KKWA 3S37L 3RWGA 4E41A 1ZLEA 1D5NA 1G7HB 3K3QA 2R83A 2EDEA 3CHQA 1XIWC 3FUNA 3GZOA 3U7YH 5HJDA 1KEGH 12E8L 4XDKA 3M1OA 2ORBH 4HDIA 4JKMA 2VLJA 2HKFL 5L3CA 2UY6A 2ZE8A 3L8QA 1ZEAH 2AQ2A 4G8EB 4PD4J 4PW4A 2EXTA 2WKLA 1VQ8V 3CMGA 2J71A 4FG4A 4MXWL 5TTRA 4W9HC 4ES8A 4FA6A 4BE5A 3QJHB 3REWB 2YQBA 1J8KA 2B9ZA 5IG7A 1ZTXL 3FO1A 2OLDA 1A0QH 3UTPD 4ASUG 1IM9B 2P7TA 1TGOA 4GX2A 2WAQA 2JQZA 4OCRH 1AGDB 3BMVA 3NIDF 3SE9H 2X6MA 1ZDQA 2I9TA 2V9UA 1R0AL 4I48A 5GRZA 1JN6B 1T1ZB 4XAKE 4DV5O 3VFUA 3KLQA 2HKAA 5IGXH 2R4SH 2VW6A 3D0LB 3O6FB 4X7EC 2DOSA 1AD0A 4HUKB 4A2GA 2VCOA 4HJTA 5F3BA 5D2NE 3ARBA 4Z76B 3REVB 1XR9B 1MIEH 1GJUA 1HOCB 5LN4A 2QM8A 4YY3O 2JCCB 3EOBB 4YSAA 4LZKA 5KBDA 1G7HA 4KROB 4DWHA 1V3MA 3CMOH 3DKHA 4ORZC 3D2UD 5CZVH 4JZOB 5J6SA 4ZT1A 1FIEA 1M93A 1IQDB 4Y16B 4G8EA 5HDQH 5CAYB 2AKRB 1V55C 1XZWA 3MSPA 3GS4A 3O6LL 5KOMC 1TOXA 3QJHA 4MTGA 3REWA 1KB9F 1IM9A 2AITA 4TUYB 1MFEL 2VTFA 2NXZC 3APNA 1JN6A 1G9MH 1T1ZA 5A2FA 3D0LA 4WENB