5KUKA

Crystal structure of inward rectifier kir2.2 k62w mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords ATP-sensitive inward rectifier potassium channel 12
total genus 97
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kukA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kukA01
1U4EA 3LDDA 1XL6A 2HJFC 3ATAA 1OCRC 3OUSA 2EIJC 3SYPA 1OCZC 2BOCC 4RUFA 2K1EA 4LP8A 5CBFA 2W0FC 2DWDC 4PA6A 3RVZA 4KFMA 3T2MA 4PA7A 4MTFA 1M57C 4WFFA 3GB7C 1QLEC 2WLJA 1M56C 3E89A 2QKSA 4MW3A 4XDKA 3ATDA 2ATKC 2EILC 2ITCC 4MVRA 3HPLC 2EIMC 5B1BC 2WLIA 3K08A 4BW5A 4PA3A 4DXWA 3LDEA 3BEHA 3SYOA 3WG7C 4PDLA 3AUWB 4TWKA 4OXSA 3E8FA 5B3SC 4MVSA 1V55C 3OR6C 1ZWIC 4GX0A 4J9YB 4P9OA 4MS2A 4WFHA 2EIKC 4H33A 5BZBA 3ATEA 1V54C 3LNMB 3E86A 2EINC 4PA9A 4MTGA 1JVMA 4R50A 4MW8A 2AHYA 2IH1C 1R3KC 3ASOC 2ZXWC 3OUFA 2WLHA 4PA4A 4QE7A 3IFXA 1K4DC 3K0DA 3UM7A 2QTOA 1R3JC 2A79B 2WLIB 2NLJC 3LDCA 4J9ZB 5E1AC 1U4FA 2IH3C 3TETA 5EC1C 2P7TC 2Q68A 4R7CA 5KUKA 1N9PA 3F5WC 2WLLA 3SPJA 2KB1A 3STLC 2HG5C 4QE9A 4F4LA 4PDVA 3F7VC 3KG2A 2DYSC 3E8GA 4WFEA 3SPHA 3STZC 4XDLA 1J95A 2HVKC 4HZ3A 4MVOA 4RUEA 2X6CA 4JTDB 3AG3C 3AGWA 4MTOA 2HVJC 2OCCC 4PDRA 2WLNA 3E8BA 3FB6C 5CBGA 4GX1A 4LCUC 3SPIA 3ZJZA 5J9PC 4G27B 2YEVA 4MVMA 3SYAA 3UKMA 2HFEC 4X89A 4ZBMA 3JYCA 2JK5C 4I9WA 4P2ZA 3T4DA 3ABKC 1K4CC 3SYQA 4MVUA 4WFGA 1P7BA 3K03A 3K04A 3R65A 1G4YB 3SJQC 3SYCA 4MVQA 3T4ZA 5IY5C 4MVZA 5KUMA 4P30A 1R3IC 4RO2A 3T1CA 3FB8C 3TCUA 4CBCA 2WLMA 3LUTB 3OGCC 3RVYA 4X8AA 2R9RB 2H8PC 3FB5C 5B1AC 3E83A 3K6NA 1BL8A 2A0LA 3ATBA 2WLLB 1XL4A 3AG4C 3EFFK 2ITDC 5EBMC 1S5HC 3SPGA 4MSWC 5EBWC 2BOBC 4X88A 2X6AA 3PJSK 4QNHB 3E8HA 5CBHA 3F7YC 2E4FA 3IGAC 2DWEC 3AT9A 3ABLC 1OCCC 3ATFA 4RAIA 2X6BA 4JTAB 3OR7C 4GX5A 2WLKA 2DYRC 4R6ZA 4R8CA 4XDJA 1LNQA 3K06A 5EK0A 4H37A 3VSQA 1ORQC 1OCOC 4UUJC 3SPCA 2A9HA 3AG2C 5EC2C 4HYOA 3AT8A 2Q67A 4EKWA 2AHZA 3K0GA 3RW0A 3ZRSA 4PDMA 3ABMC 2ZD9A 3AG1C 1KKDA 2GIXA 2Q69A 4LBEC 4P9PA 5EBLC 3RBZA 3VOUA 3ASNC 2Q6AA 3X2QC 1R3LC 2Y69C 4GX2A 3FB7C 4JTCB 4G28B
chains in the Genus database with same CATH superfamily
3STBA 4ZSOE 4IRJA 3SDAD 1M2OA 3HMXA 2D0GA 3ECQA 4HWBL 2AK1H 4KV5F 1GSMA 3GBMH 4L37A 4XAKE 4NERA 2XN0A 4XR8C 1BLNB 4Z7NB 5H37H 4GLXA 1YEJH 5A2CA 4OU3A 4X5WB 4B97A 3AK3A 5GGSA 2AHIA 4KVPA 1BWWA 1WFTA 1W0WB 4HJTA 4CKQA 2Y6TE 2BNRD 4HWZB 4ZRGA 3TEYA 1C7TA 3C90A 3F5WA 4P4KC 3A8TA 3WG7C 3F6JA 4N2CA 4Z95H 2C7FA 3QI9D 3VG9B 4L5FL 3EH4B 3CIQA 3NR7A 5AW6B 2ORBH 1HAUA 4DT2A 2B77A 1ZK9A 4OZHE 3T0EA 1HYSD 3KLHD 1L6XA 4G9FB 1TTRA 4N0UB 4PW9A 1FWXA 3BWUF 3GMPA 3T0ED 1ZLVH 1MI5D 2LVEA 4Z7NE 4IRJB 1BQRA 4BDVB 3HE7C 5IE9A 2Y3AA 3DA0A 3T3ME 2RCVA 5H4YA 3FUNA 3S0PA 4WUUD 2WQXA 1MAKA 1URZA 4LESA 2ZOTA 1DJIA 2JDIG 1WG3A 2K9FB 5JIKA 2P7TC 1G7IB 2YO3A 2YRZA 5L0QC 2WBKA 4ZK8A 1K7DA 2GHZA 2H7WA 4E36A 2XJKA 4R4FL 4GCZA 2VLLA 3IBEA 4HWZA 5D7KE 1WQVT 3WO3B 1U8NA 3KYMA 3Q2WA 4AYBA 2WQ8A 4LCUB 2H9GB 4OH2A 3FONA 4JY4A 3MV8A 2XTSA 5DZ9A 3GB7A 2IAND 1SZXA 3UJJH 1P5UC 5IBUB 4UZSA 4PLOB 1KT2B 4BCYA 5CBGA 5EOCJ 4I18C 1Y4MA 4MSWB 5H35A 4MNGB 5E2UL 3K0YA 1SA0B 4E5XA 4JI3B 3GWJA 3G80A 5EYPB 1HSAB 4H0GA 4JFTA 1OPGH 4QI3A 5CFAA 2F7RA 4UAOB 4RGOH 4ZX3A 3HJEA 1XGQB 1QPXA 3STLA 2QEXV 2D31A 3W7WA 2J6EL 3E2HB 5KVFL 4ICGA 3VFMA 2IGLA 4UDTA 1ZX3A 2GJJA 2EIKB 2EP6A 2MPAL 5CILH 2VLLB 4NP4L 3GPEA 5FDWB 4JVWA 3BRCA 2NY2C 4K3DH 1XBDA 1INDH 3HG4A 2J88L 3DV6A 1RVFH 4QHNB 5F96H 3KDMA 2CJSA 4HMDA 5B1JA 4FQHB 5B21A 3LN4A 2AMUA 4JKPL 4V2BA 2ENSA 2H6UA 2QFPA 3RN4A 2WXQA 2A9CA 2CZNA 2E27L 4FNPA 4KNUA 4YHLH 1KT2A 4PH8A 3GHPA 2QELA 5H35B 1AKJD 2WQAA 2X2UA 3W81A 3QNXA 4XNZC 3UAJC 1SA0A 1CLOL 3F7KA 5BRZB 4DPBX 3TNMB 4Y5VC 4F3FA 2Q7YA 4NQDE 1N4XL 3IK2A 3KE0A 4NQTA 5AAMA 2VQFB 3H9VA 2G3MA 4H88H 1RZ8A 4JDTL 2DIBA 3MLUH 4X5LA 2VLRA 5ESAA 2C3WA 5DRZB 2CO3A 4H5SA 1NTKH 1XL6A 3FO0H 4UDTB 4OV5B 3FAWA 3ZX6A 1P7QD 2X1QA 2ZTBA 3VI4E 2FJUB 2VGLM 1A3RL 4RAUA 2OMUA 4W6WB 3MNVB 1UJTA 3BSGA 1NTMH 5CBFA 2X2IA 3LKNA 4Y16B 1VQ5V 4UT6H 4AE0A 5CA1B 3MZTA 3QIUA 4G9DA 2X70A 1DBAL 3E89A 3KH3A 2DMKA 3DXAE 2CSPA 2ATKC 4OGQC 4K3JH 2K4AA 3SDXE 5ICYB 4X9HA 4PS4H 5B3SB 4KKNA 4GRWB 4GYBA 1AKJB 1H6EA 4TM9A 3IWVA 2PO6B 4FG6C 3SQOH 3F83A 4AGQA 4XX1G 5T3XL 4H20L 5T1KD 3ZO0A 4R26H 3OR6C 1LEKB 2VN6A 2JB6B 4B3TO 4PJIA 2PPCA 1I5YA 3LEYL 3UEQA 1DL7H 1M05B 3HKBA 1KN4L 4FLYA 1M53A 4OLVL 2EINC 1H6UA 3CH8A 3O3UN 3TWCL 3ZU8A 5L3FA 4JFYA 5DQDL 2C4XA 1E6JH 4HJGA 4QO1A 4RZCA 4NKIH 4OI7A 3N0AA 1CPYA 4U1JB 1RZJC 2XYCA 1TVKB 1QLEH 2X70B 1ES0A 4R7CA 3NZHH 5LWYL 1JSYA 1JS4A 1MW1A 2F58L 1OLLA 1SBSL 4X99B 1ZVNA 3KR3H 5TF1L 3FB6B 1E3ZA 2ZG3A 2EDQA 1QBBA 3IC7A 2X4NB 4NQVB 4W93A 1B4JH 3NPZB 3JV4B 3PWNA 4DUYO 2Z3FA 1HWWA 3Q8EA 1AI6A 3P30A 4OD2A 3TYFB 3EJZC 5CFHA 3X3FH 3M46A 4LBAA 2DBJA 5E2TL 1MHHB 1O9HA 1QLNA 2FGZA 1E8XA 1OE2A 1ZXKA 2MK3A 3CZNA 5T1KB 1BXVA 2ZR2A 3HKBB 3JD1A 1YYCA 3JSLA 1P7BA 4M5SA 4HPHA 2P26A 5IVZB 4KKBD 4R4ND 3U4KA 2DW5A 1E3FA 5IESH 4UXNA 1BD2A 3BVDB 1R24A 1WFJA 3E1ZA 5FHBL 1TVKA 1D5ZA 1ES0B 5A9GA 4WKXA 5SWSA 4PVMA 2VNCA 5CBEB 2YGQA 4MSWC 2KPNA 1N26A 3WSQH 2WZPD 5KVGH 3HE6C 1X4XA 1NLDH 3QJXA 4M4RA 3K2UH 4MDJA 4XPTH 4L1SA 2X4NA 4TF4A 1MG2C 4DP1X 4YN3A 5FO9A 1Z9PA 5GSRB 1J11A 2Y1AA 1BBDH 3TH2T 1FVCB 2EDYA 3ALWA 2B5UA 1IGCH 5ILTH 1EMTH 2H32A 4JJ5A 3V0WH 4AEEA 1ADQH 3IBOA 2VXVH 3POHA 5I6MA 1DBBL 5LKNA 1JFFA 4LSSH 2VDLH 5KOVC 2F66C 3VGHA 3QJVB 3WV0A 4DN4L 4PJCF 5IMKB 5L88L 1YECH 1Z9SB 4FXGC 3WMSA 2F53A 3EH3B 3X12A 2VXUL 4C83A 3DX7A 2BHZA 5DC0A 5JQIB 1G7PB 4HJJH 1PZ5B 3O2DA 3WS6A 3OGOE 5DJ2A 2ICEC 2OTUB 2WSPA 2YC1A 1X5XA 3PDOA 3IDXH 4JN2A 3CLWA 3EZJB 3NJJA 3P54A 2GQHA 3NXSA 4U6XA 3BT2H 3LSQA 1CF8H 5F89A 3P4MA 4YO0B 1UWGH 5F97E 3VX1A 3SDXA 2X0WA 4FK5C 4KOCA 4HGMA 4LFHG 4JJ5B 3AWEA 4J3SA 4M6ML 5E4EB 5KMGB 1QLRB 5CN2A 5DQJA 5E00B 2X0VA 1BVZA 4WW1B 3U6RA 1I82A 4QCIA 4B9FA 4KJWD 4ZFFA 4DKEL 5I1KL 4PREB 4L4JA 4NWTL 2LTQC 2CIKB 3HC2A 2R1XA 4QXVA 4DGYH 3AK2A 3O9WC 4JLRA 4ZQKB 5I71B 1Q4NX 1QRND 2QQQA 1M1XA 2WUCL 1CR9L 5D7JD 1QSFE 2LJ2A 1UB6A 3M17A 4HUVA 1QRNA 2YC1B 3MI6A 3PDOB 2DMGA 4YVNA 3VMPA 2D3NA 2Y6SD 1HE7A 2F8VA 4QYAA 2B2XH 2NR6D 4AYEC 2XWJB 1KLUA 2Z7UA 3OV6A 3V9FA 4CN4A 3F5WC 5ID1A 1FBIH 4QE9A 4LSPH 2BWQA 3ZEDA 3K0WA 4ZODA 3RUGA 4ZKIA 1CXIA 3HB3D 3L3OA 3PG2A 4KKLC 4KMLB 5DD1H 3S4SA 5HBBA 1H19A 1PL0A 5B1OA 5FYJH 4NRYA 2DI9A 4DW1A 2DYSB 1JL8A 3N91A 5AL0A 3ESOA 1EPFA 3GJEA 2VLJA 5J56B 1SDAB 2IO5A 1VF6C 5ITZB 3G6BA 5C8YA 2HVKA 3HC3H 5BQDA 3MRMB 2ZUXA 4WFGE 1QRNB 1A1OA 1OWWA 4A2GA 4X8JA 3O0LA 4A68A 4AVHA 4BJLA 3VXRB 3A3YB 4NWUH 5JQ6L 4Z2WA 4JZ2A 1HS6A 2TSBA 2X4PA 2JEUA 3WI9A 5FO8B 3AG4C 5CLXA 2IBZY 2A6KB 1KPRA 1AR1B 2Y4SA 3C5ZC 2QM8A 3GXDA 1XB6A 1CIUA 1NPJA 4AH2A 3WNMA 2F74A 1KB9K 3LH2L 4OPAA 1DEEA 2W9EL 3CHQA 3TBSA 2CUAA 3UG3A 4HXBL 3HR5A 4Z3IA 1L4IA 3ARDD 3C60A 3V0AC 2LVCA 1M56B 1H3XA 4TYUA 3FTGB 5HI5D 5ITZA 1CICC 2VL5B 3O6FC 3UEZA 3ARDA 3VXRE 4A7QA 1OGTA 2HVKB 2NYYC 4ZNEA 3MRMA 3S5YA 2A9DA 3II2A 4X9BA 5AB2A 1JK9A 1PP9H 1FHNA 2R0LH 3BGFB 1XREA 3BAAA 1K92A 4FQLH 4G43A 4MXVE 5EBMA 2OX5A 1EN6A 1SYVA 4DV3B 2IIJA 5I30H 1HHGA 1ZKAA 4DR2O 1AG0A 5FO8A 1OSZA 5GRYA 3GXMA 2IAMA 2A6KA 3NCYS 1NBVH 4UAHA 2BFVH 2UZIH 3BZFA 3RYCA 1YC7A 2IAMD 5F9AC 1WP8A 4EN3C 2VO5A 2YK1H 1WN7A 2FO4B 1MXGA 1BXAA 3PAUA 4QRTA 5AOKA 2V17H 1S8DA 4YFEA 3AQDA 4NJAL 3CVHH 1WJ3A 4X6EB 3HR5B 3BQUC 4PSPA 3NH7L 5C3IA 4PWKA 1NR7A 1THZA 1LWJA 2X4UB 2ODIA 2P45B 3FTGA 2VL5A 4K23L 5T1DL 4K07A 1GPOL 3FX7A 1OSPH 1SVZA 3RKPA 2RJZA 2YICA 5EIIG 2J6EA 3DBXB 1U95B 2ICCA 1B88A 4XN5A 3MXWL 4Q14A 4QOKD 4PJAE 1I1AC 3B3IB 3S96A 3WIHH 2DM3A 1G43A 4MTGA 1OSZB 5CD5D 2FB4L 4N2HA 1E6OH 1BVOA 2DKUA 5FUZL 3H8NA 3WUWA 1N67A 4B5ZA 4GS7B 4KUCF 1CGTA 3EYQD 3H1JH 3FT9A 4HIJA 1RUMH 2CRZA 3QT2A 2DN9A 2NNXA 4WTQA 1XGPA 2Y5TA 3MBEB 1AH1A 1ZT1A 3BP7B 2Q8BL 4OCWH 4AQ8C 2J8UE 1F1DA 4FQIH 2QL1A 3UTTD 1PTZA 1FIGL 1N34B 3QZWB 4TV8A 4GLRI 4JQIL 5TFSL 4W4OC 3LKOB 2APVA 4TN9A 4GMTH 4ZO7A 5KSAC 3RX8A 2CO7A 3JTSB 2OP4H 4KY2A 4BFOA 1GYCA 1KXQA 1KIUA 3VI3E 1IAOB 1U3HB 4PI0A 1T0OA 4GW5A 4WWKD 2UXBB 1LK2A 2B15A 2QMJA 3BP5B 2VLJE 2YEVA 3OXRA 3RYFA 1JZ4A 1T0MA 5KSVA 3QNYB 3B3IA 3QPQD 2DQHH 3TV3H 4PJCB 1G1OA 3ZXAC 4UQAA 1CO1A 4UM9D 1G6RH 2DM2A 4APXA 4YHYB 1Z3GL 1AC6A 3ZE2E 5C7XL 2EBOA 3AG7A 2JVUA 2NQ3A 4U2YA 1QVOA 1HXMB 3S3BB 5D6DC 1IBMO 3BH9A 5ANMA 5HYQB 4AIOA 2JJ1G 1OTUC 3UBXG 5G4NA 5D9SB 5C09E 2QPEB 5K1NA 3D0AA 2ZUYA 3QXUA 4DUZB 4ZO6A 4PW3A 4EE2A 2BIOA 2E8YA 1MCLA 3P3TA 1AXSA 4WQOA 2O6DA 1G7MA 3PL6B 1X59A 4GUOA 2Z7YA 2F4VO 1IILE 2WA4A 2BOCB 4L4TB 2UVFA 3Q9QA 4J3BA 3QG5A 1KN2L 3VXSE 4ZMWA 2Y7MA 5CCKL 6FABH 1A9VA 3IDJB 1BAFH 5TDOA 4Y9EA 5EZIL 1N0LB 3O4LB 5JLZB 1G9HA 2E7DA 1A6UH 2L0DA 4FG0A 4DR5B 4R97B 3G6JA 3FB7C 5F44A 2Z35A 4DP9X 1CZ8H 2J44A 1QVOB 3S34H 4BZ2H 2AABL 3SKNB 3ZKXC 5FYKL 3EGSB 2A2QT 3MRLA 4HWNA 4QPEA 3BQUD 1ZDSA 3ZHFA 3D08A 4GIAA 5ADOL 5TE6H 3FT3B 3ATDA 1UOWA 4WI8A 4NXMB 4EN3A 3WAJA 1FH2A 3TIDA 1VP7A 4G11A 1PD1A 6PAZA 3E22A 4H1LB 4JE4B 2BOBB 3TA4D 4EN3D 5EEWA 4UT9A 3AG4B 3KXFA 4F7MB 5TDOB 4JPRA 3MTRA 3KXFD 4MD0B 5DR5H 1E4JA 1SXCA 1T6WA 5KHKA 3OMIB 2CLRB 2NTFA 4G8IB 1Q9WB 4GXUN 4P04A 4YHNA 3CXDH 2EDFA 3FH7A 1A9EB 1RZ7L 3SB3A 4CDHA 1A6VL 4X6CA 3I02B 3CPLB 1TJGL 5AW9B 2APTA 2V5YA 1QKZL 4JDTH 4PA4A 1TO4A 4OVUA 1MPAH 4YLQT 4OAWB 3BKML 2IH1A 4OZIF 5GTHZ 3D3QA 4DV1B 3EFDL 1X9RA 2AI0L 4KI5D 3L4WA 2LAGB 3CX5J 5GISH 1FPTL 5C09B 1UQSA 1EQWA 3C5ZD 3IJHB 2FHFA 1BZEA 2YIBA 1BMFG 1U8OB 4H8WC 4KDVA 3BVNA 3U4EB 4DCQB 2IBZX 4ZUSA 4BWTA 4YBLB 2OR9L 3WL9A 1PJ9A 1SXNA 2EUVA 2YIBD 3EOTL 4QIWF 5FL7G 1T6BX 4BKSC 1NCDH 4UTAH 4YHNB 1NAML 1MWAA 2DQEH 1AP2B 2F19H 3NCMA 4JYYA 2MIZA 1QHPA 3JTTA 4R26L 2J8HA 1MMMA 4HUXA 4IIZA 2R69L 1RHHB 1CXZB 4JFZH 1NMCC 4JM2F 3OG4B 2HPOA 4NAJA 2DYPD 4MXWL 1DVTA 4DUZO 1VGKA 1ZOXA 3BO8A 4HIHB 2LE9A 3MGTB 3R18A 3V52H 5J6GB 5C09A 4LK4A 3L7EB 1J8HD 2J71A 2A6IB 2Y22A 1QLEL 1AZNA 3PWLA 2HVJB 1BCIA 3MBWB 4M7KL 3TONA 1UM5H 2AEPL 4OJYA 3BVNB 3QS3A 1VQPV 1T04B 3MLXL 3MXVL 1XXDC 5AVTB 5FYJE 3B3BA 1IC7L 2Y6SC 1CFBA 3P3YA 5KVDL 3PGCB 1H15B 5I17A 2R23B 2AVGA 3MODH 4MYPA 5FKAB 1HR0O 4G7QB 2R29A 3MRFB 4H8VA 1J0HA 1R3JB 3Q05A 2Q6AA 3X2QB 4DV5O 3ARED 3F7LA 3FULA 3I3BA 4GUCA 1PZDA 1U8QB 3GUFA 3WKYA 3QARA 4QNPE 3KDPB 4OQTL 3GS0A 2K0RA 4ASUG 3FUIA 3ARGB 1O7DE 2EDTA 2PCFB 5FYJU 2A6IA 5DUPL 4RUFA 2H2SD 4AUUA 4K8RH 1ETZA 4AVIA 3FOMB 2OZ4A 3QUMB 3APDA 5TPWH 4PRIE 2ADIB 1WS8A 3L95B 4MW3A 3VFPB 4KXRA 1T04A 5FW7A 1NLDL 1AE6L 4BIOA 2QVKA 3Q44A 5IZ7A 4U3XA 1ILUA 3VO0A 3L6FA 3WFEH 2ED8A 3FSZA 3LDEA 1UA3A 5ITFB 2W95A 2N0MA 5EC2A 4H44C 2P8LA 1ZLSH 3T77A 4PWJA 3MRFA 4UYQA 1HQRA 1SRDA 4W70A 2WBWB 3ZMRA 4YHHO 1SJEB 4NCC1 5HHVH 3ECBB 5I0YA 4AIZB 3LZNA 5I9QB 5JNYA 3ARGA 3MOBH 2WLHA 2YI9A 1P4LB 3OWEA 2D7OA 2WKOA 2CO1A 1B4RA 1OSYA 1UD4A 1N7ML 4ZD3H 5IEKB 1T7XA 5I5JA 4KKAD 4Y2NA 5DYOB 5DD0H 3VFPA 4RRPG 5FYJD 4ABUA 3QORA 3QWQB 4ODWA 1KTLA 4WUKH 1A0QH 1MI5E 4UOZA 3ZHRA 3L6FB 4HK3J 4GKZB 4S1QL 1WZ1H 1M6UA 3O4OC 2CDGB 5ITFA 1KOAA 5F7EL 4AGOA 3L3IB 4DERA 1F4WH 1XF1A 1BZDA 1HC1A 1TTCA 4PTUB 3HG2A 3TO4A 1H3WM 1T89A 1OY3B 3GTVA 5IQLA 2HLFC 2FK9A 2P4AB 3VQLA 3VQWA 3GT6A 2NN4A 5HGBB 1TLMA 4M61B 5JNYB 4H0LC 3EJYC 2UZXB 3GBNL 4MVQA 3STZA 3GMLA 3DETD 4I4TB 4F8TA 4F7TA 2FWOA 2IJIA 1R47A 1QMUA 1YZBA 2WUCH 4XO5A 5BVPH 5DYOA 5I8OH 5MENA 4CBPA 5J11C 4XWGL 1G6RA 5C0JB 5FKPB 2WNKA 3QFDA 5JDJA 5B1NA 2WUBH 3DKHA 3ZDXF 1KCRL 3QORB 3TS8A 3JALA 3BEVB 2VM9A 2C8NA 3AITA 3PJSK 2MHAB 3KCPB 1BAWA 2OCCB 1V7ML 4JFFB 4N6QA 4XNYL 1ZEAH 3QO1A 4Y16C 5F7DA 1NC2B 2H1PL 3ZOAA 3RB5A 4Z7OB 1ICTA 2XXGA 3EOYG 4G1EB 2J20A 1S3RA 1IQWL 3JWDL 5BXZA 4NHCL 1I4FB 4YMPA 1PZAA 5DGRA 7PCYA 3D07A 1S9XB 2OSLB 3BSHA 2Z4QA 2C1PA 2F8XC 1YSOA 4Y4FC 3GI8H 5LUMA 1RUQH 4GT1A 1G6RB 3MRBA 1JVOA 5C0JA 4Y9GA 4M7JH 2WC7A 3CH1B 1U97A 3KCPA 4KGLA 4AZUA 1BJ1J 2B1AH 1EHAA 5ICUA 1T03H 2NYKA 1CD0A 2W6JG 2BXYA 2BIPA 1J9TA 4AJYV 5E9DB 2BWIA 5F7DB 4EDWL 1NC2A 1PNKA 1RPOA 1G7LA 2XXFA 1FVDA 3EJCA 2QWRB 1RZKH 2YMTA 3BD4A 5HGAB 1B9ZA 5JOFB 3ZTJG 5KBPA 5C3LD 3ULUE 3L8QA 2IH8A 4HPYL 1I4FA 1YMME 5C0DA 1XV8A 1FCCA 1DYZA 1E50A 1MRFL 3KPNB 4UT9H 3RIFK 4C56D 4CSSA 2Z4QB 1IX2A 3N04A 2GTZB 4WFHA 4UAOC 5AB0A 3RILA 3QO5A 4GKNA 1LO3L 2Z34A 4Y5VA 2VXQA 4CC0A 4Z0BL 4I13B 2A6JB 2XICA 1V7NH 2L4OA 1SJMA 4X20A 2M7WA 5K93A 4HKZB 4P2OA 2V5SA 3T1WA 4JFUA 4F15B 5AWNL 4F2ME 2BS9A 3MGOA 2CUIA 2WZPA 2X7LA 1KACB 1RKRA 1Q7YW 1YEHH 3GRWL 3NSXA 5D7SL 2Q86B 1YMMB 8CGTA 5IIEB 4KVNH 3HRZA 2FJHB 1T21A 4M8UA 1M9WA 5JOFA 3L3JB 3J81N 2AK1L 3G04B 1JYWA 3ABLB 3U79A 4L18A 4F6RB 5E79Z 1JHLL 4FFWC 4O02L 5L2KD 1O9WA 1YEJL 4U0RC 5KYUB 2BRRL 1QEWB 3SY0A 3WFBH 5HD8D 3BQVA 2BVPB 1ZTXE 5EU4B 3T1YB 3CFCL 4WSGA 4YSRA 4PJ9B 5H94A 4APQD 1GC1L 4LIQE 1IEHA 2GSIA 3OZ9L 5D5ME 5GZND 4IYIA 4APQA 1OK0A 2NXZC 1ET5A 4GIOA 5AG9A 5BRZE 5I0ZA 4JFDB 2HKOA 1M7IB 2GABA 3OB8A 2V37A 5IB3A 1NMAH 1YEFL 1Q3EA 1OGPA 2WMPA 3T4AC 5DU7A 4G82A 1N0XL 3BP6B 4JL1A 3RHWF 1E3XA 1LO0L 1OO2A 1YMMA 5IIEA 4XCYA 1P69B 5I1DB 5IMMA 3BJLA 1YMMD 1TUBB 4TQFA 1N34O 1UFIA 1I1YB 1XBLA 1D5RA 1DTUA 1U3NA 4PLJD 4AJ0A 4DP7X 1SJVA 1ETA1 3EVKA 5AB9A 2X6BA 2G75A 1UXSA 3N85L 3NZ8B 1FIGH 3O2VH 2FIRT 1MZZA 3OX8B 4JQIH 3ABTA 5KYUA 4JI8B 5HDQL 3U30B 4O2BB 4DR1O 1FE8L 3U9UB 2Z91A 2GSIB 3K57A 2P5WE 4APQB 2XUMA 4GRWE 2UZYB 3C2AL 2L6LA 4W4KA 1OB0A 2GSGA 3SDCC 1SY6L 1Q72H 2NY7H 1SOSA 2SEBA 2XFGB 3DVNA 3CCMV 1QWUA 4NQXB 3KLHC 5E5UB 2HJFC 4OCXH 3OSVA 5ERWA 3BP6A 3SBWA 2NR6A 5JHMA 4FM1A 4XCYB 3UQ8A 3FT4B 3EJSA 4AVKA 4XC1H 5I1DA 3ZE2F 5IMMB 2MNJB 1JGLH 1VQ7V 3E3QC 1LL1A 4PA6A 3GZPA 4FI7A 4LGPB 3WFHA 4RGOL 1SOKA 5B38A 5JPNB 2G75B 4TVPD 2H2PC 3OX8A 3C09C 3BDYH 1TG8A 5F6IC 3GXTA 1KGXA 1NBZB 2MPAH 3FCSB 2JI1A 4JQVC 1H5BB 3WS3A 5FGRA 3UTOA 2OKMA 3Q1EA 2L3BA 1I3UA 2Z91B 4JI5B 5DJCA 4YDJA 1WK0A 3SDAC 1W9XA 4JKPH 4LVOB 3O4LE 5CCKH 5DEFA 6FABL 3EHBD 5F1OB 1F4YL 4GH7B 3I6GB 2IM9A 1P84J 5ERWB 1A6UL 2XBDA 4M7LH 2RNBA 2HFEB 4LSDA 2FSDA 4HEMA 1KYOK 1NGWB 3UTSA 2WIMA 3S34L 5B38B 3MLUL 1BGXH 2YZ1A 2K3TA 1SZTA 1NCNA 1C16B 4YHMH 3DUHA 3TJPA 3RYMA 4LXFA 4W9GC 2X6CA 1GGIL 1EDHA 2BCKA 3VU2A 5E8DH 3WHE1 5F70A 1AGFA 1VB9A 4PDRA 2DWSA 3B4NA 2ZKHL 3H7BB 3C60D 4L1DA 5DJCB 5AW8B 1ZV2A 4Z7AA 5BRQA 5CD3A 5BVJA 5FM5M 1PZBA 5HVFB 3HNTL 3P32A 1TCRA 4JG9A 3ZMEA 3DX0A 1WEJH 3G5XB 3VWKA 2WYTA 3U36B 4WWID 3FB8B 5F1KC 4PJXB 5FUCE 2HFEA 4R0LB 1W16A 1QU7A 2OWOA 5I1GH 4JO2L 3L3GA 1NEPA 2IPUG 5KBLA 1IGFL 3BVXA 2VDNH 4OCMC 3Q4HB 4FNTA 4JRFA 4AIEA 4ZUTB 1TZGL 3ZKNC 1FFPB 3VTTA 2DLGA 2DWXA 3E8UL 2BCKB 4R2GB 4ZDHA 2Q20A 4YHZH 1AGFB 3PWVA 4FZ8H 3I2CH 4YHIA 5IT2H 5BVJB 5IHWA 1TAEA 1WBZA 3NZHL 1IXMA 1INQA 3QJQB 5EUOA 2HUEA 5IB1B 1ZLWH 5A3ID 3VDCA 3ZDWA 5F9WB 3U36A 1BQHA 1A7OL 5DS8A 4ZO9A 1CLZH 3ILQD 3OKEB 4K8XA 3OQRA 4K7FA 4GKSB 2FJGA 2PP8A 4OUUA 5I74B 4J7JA 1MH5B 3DIDA 2UUCO 4RMRA 2E7MA 3KM1A 4LCCA 2J1YA 2R69H 1KC5H 3Q4HA 2W0FA 2XN9B 3MJ9L 3WB2A 3MMEB 3ULVD 3U2IA 4ZUTA 5HJ3A 2UUAB 2XTJB 4N5ED 3VXME 1FL6B 4LBEB 1RZFH 1AGEB 2J2ZA 2P8PA 4NEHB 4PA7A 5DGQA 5IESL 1FS0G 5ELIA 3WB0A 1KQSU 4KRNA 2B4CH 4YHIB 2WN2A 3N43F 3NSYA 4KK9C 1TVHB 5AW2B 4OIIL 5IP4A 1INQB 2M83A 4BHUI 4E9RA 2YEQA 4ODUB 3DXRB 1MCPL 2ZNIA 1YNKH 1ROWA 1WBYA 5GHWL 4EB6B 4PIBA 4O4YH 2CH8A 1XMQB 1CN4A 3SQBB 2ZKOA 5DECA 3GXIA 4K7FB 2OCJA 1GM9A 4N8UA 5KVDH 4IBUA 1DO5A 2IPUK 2NY3D 2XWTB 1FNEA 4J3OC 4DR7O 2IQAA 3S3DB 3T09A 2WD0A 4UM9A 4CDGC 1ND0B 5I26A 2QSCL 4RRPA 5CP3A 3OUFA 4YHKH 3ARFA 3L4TA 5LGHL 3W82A 2LQRA 8FABB 4LSQH 3VACA 3QPKA 1LEIA 1U4FA 4POZD 2F7OA 1TMCB 4TLUA 1CURA 2B1OA 4XPHH 4LLAA 2J43A 2OL3L 3V6FB 4AQEB 2EEFA 4FQPA 5GGTL 5FPRA 5DLLA 4XPAH 5KHHA 4B60A 3RTQB 2YD6A 4PR5A 1DANT 4KNQA 4UV7L 3O81A 1FN4B 3UZEA 2ICWI 4EB6A 1ZANL 2F53E 3MDSA 3COOA 3CZUB 3IGUA 3V5DA 4ANXA 5GTIZ 1DVQA 4GQ9H 3ZTCC 3VH8B 1VEMA 4RQFA 3BT2L 4WFFD 1R3IH 4PRHE 5DK3A 2FYUH 1JGEA 4FG4A 5AVRB 4UM9B 5A2JH 1MFMA 3PWPE 1ND0A 2PYFB 4LLWB 4LFAO 1BBJB 5EZPA 1O9VA 4A7VA 1KNOA 2YIHA 1X5YA 1T66D 2VN4A 4N5UA 1CDHA 1EEYA 4X8CA 4POZC 4ODXB 2FLBT 1WISA 4KRPD 4EUPG 3C6SA 1OAYH 5B7EA 3GKWL 3V5HB 1AACA 2Y7LA 2ZXAA 1OAUL 3JTBA 3RTQA 3QQ3B 4MS8D 1YQVH 3V6OC 4CC6A 4PJBB 2X3BA 4FLSA 1NDTA 3DOSA 5FNVA 3FQRB 4MQ7A 4PUBH 2APSA 4IJTA 4RISL 1M57B 3V5DB 1EZVY 3CBRA 4BH8B 4U1KA 3IDNA 2DYRC 1IIIA 4WI9A 4XMTA 2EJ1A 4CW1A 1BOGA 3TZVC 4HK3N 3KBPA 2VXQL 4WCYL 2Q8AL 2CLZA 4TUJA 4BIKA 2JJUA 1MFBH 2CBMA 3X13A 5DFWH 2G9KA 2Z5UA 4KHXL 1S7VB 4IDJL 1BQ5A 3G6JE 4MHHI 4XP6H 1DDHA 3V5HA 3GJFK 3U6XA 1VKXA 1NPUA 2EH8H 1ZAGA 4PJBA 4MDIA 1FSKC 1ZLZA 2W0FC 2B9BA 3B7RL 4YDMA 5F21B 5FGSA 3VRLE 2EVGA 3D18A 1EZVH 1FXKB 1P4BL 5I1IH 3G5VA 1FNFA 2DQ0A 1NVPB 3VRJA 3PXLA 4MQSB 3ETQA 2E6JA 5A3IC 3GI9H 4X4XB 3ZE0B 2ARJB 1MLBB 3PJSB 3HG1D 1J87A 5T1MB 4CMHB 4TVPL 1CBVH 3E9UA 2V0AA 2HYMA 2GI7A 4OQ1A 3HG1A 4GAYB 4H25A 3VXUE 1XI1A 2YMXL 1AO7D 3SGKA 3JVGC 4MMYA 5LOVB 2GJ6A 3A24A 1AO7A 4NIYE 4HXBH 2AQTA 2OMVB 1TGOA 3ROOB 1VKXB 2OR7A 1IAKB 4QTHA 3N2KA 3E35A 2FVNA 3H0TB 4MDIB 2HH0H 3L9RB 1HX0A 4J9ZB 5JH7A 3QJZA 4TNVK 5C09D 1E4HA 2JKJA 3KPRD 1UYWL 4NFBA 2R0LL 4JM2B 43C9A 3NIDF 4X7FC 5I24A 5BXFB 4NTYA 3ASNB 3RVVD 3VRJB 3BCCH 5DJAB 3U48A 4A37A 1ACCA 1QYGL 1CGYA 1TVDA 3KCYA 5K9KB 5F9WC 4CVUA 5H9CA 4JTDB 2TSAA 1CTMA 2IANE 4E41A 1S7UB 4PJAB 4AZ8B 4GAYA 3P73A 1IBGL 1MG1A 1M2VA 3QR0A 4LH6A 1H3GA 3FT0A 1UUNA 2QJDA 4LGSB 5D1ZI 4A7GF 3TIEA 4Q9RH 3AREA 3HHRB 3NH7H 3ROOA 1K34A 5C6TH 1GSKA 3ZKMC 1JNHB 1XB3A 5IM7A 1JTOA 4LASH 1AQHA 1J9QA 1D5MB 4OLZL 3GMMA 1V54B 4JI4B 3DUUA 1GGYA 3OC5A 3OKOA 2WBJC 3T0EE 43C9B 3B8YA 5D71H 4OFIA 3PDDA 5DJAA 1BZOA 3CVHB 4ONFH 2WNXA 1ZLUK 2JJ2G 2ZWZA 2H3NA 3P0YL 4JCWA 2NZ1A 4N2BA 5FUZH 3T2LA 1YY8A 5HSFA 3VTMA 4LO9A 4PJAA 1X5JA 3S36H 2CK0H 5IROC 2DWYA 3OFNG 3FQTB 3H1ZA 3KVPA 2J8UF 2AZ2A 4B3RB 4WI2A 4OLXL 3AREB 2BC4B 2I9TA 2PUQT 2FZ3A 2QPDB 3PP3K 3ZQ9A 5IQ9B 2PCPB 2RFXB 4LHUG 5CU9A 4WY7L 1V27A 4N23A 3DUUB 3N41B 2MKLC 2WWKO 2ADYA 2VDPL 3WIFB 3QI9A 4GUPB 1GZQB 3ARUA 3GD1C 1F41A 1A7RL 4DHLA 4YGVB 5JORA 1G6RL 2ICWJ 3JQOB 3PGFH 3S3SA 2VZVA 3F01A 1ORSA 5IEHB 4MVRA 4U1HA 1LDPL 2H41A 3B9DA 1AGBB 3FT1A 3J7HA 4LPVA 3RI5F 3ULSA 3ISRA 4EI5A 4G3YH 1PX3A 2A4CA 3C5JA 2EDKA 4WUUA 4C55A 3DMMD 3CJHB 1THAA 2FZ3B 3CFNA 4JGJA 2XLLA 4UM8A 4FGMA 4PLJC 3CDFA 2Y0IA 2AJXL 4A7UA 2HLDG 2FT7A 3MNDA 4PELA 1EEUA 2VUOA 3C2AH 1R0AL 5I18L 3TXSA 1X5LA 3QI9B 1M1SA 2MH4A 1RZIA 1F11A 2XV0A 4WTZA 1GN2A 1J8HE 2YAMA 4KTDL 5DZVA 5KVEE 3LEVH 1US6A 2NXZD 3F58H 4HUNB 5KUKA 4G7SB 3DECA 3B9VA 2I7SA 5GZNC 4I8DA 1IEBB 2XPYA 3H9HB 3WGUB 1JDAA 2XZQH 4APQC 2Q8VA 3LZQA 5GGTA 3WDIA 1CB4A 1JF6A 5KZCD 5HD8C 2UXBO 4HBCH 3K7UA 4NZDA 3BESR 2NW3B 2BNRE 2GDSA 3W56A 4FFWD 4FFYA 1SOXA 2XETA 4FM0A 2DEXX 3DHUA 5ADOH 4IOIA 4TKWA 5IW6B 1MNUH 4ODTL 4X89A 2CQVA 4U7NA 4JJHA 1JPSH 2A74A 4PGDA 5ICZB 4LEOB 4ZW3A 3V9EA 1IBKB 3GMRA 3HRZC 4B6ZA 1EJFA 1W0VA 3QUYA 2EEXA 3ASOB 4FQ1L 4PJFE 3RPBA 4HMEA 3LUTB 1F4XL 4BUGA 3T3PE 3SZKC 1CDCA 3E83A 4GW1A 5GGRB 1IEBA 3H9HA 1FVEA 2IFFL 4BSVA 4DO5A 5EBWC 1SUHA 3N3EA 3DYMA 4O4IA 1QX1A 1BPVA 1YJWV 5D96C 4MRCA 4KK8D 4AEIH 1P7KA 2DJSA 1RSYA 2OMTA 2B1HH 3B9KD 3PJNA 2ZOLA 3GJFA 2X41A 3M1BA 1P7QA 2NY0D 1MVUA 2GITA 3ZMNA 4PGDB 5ICZA 4HC1A 2Z0UA 4IU3A 3WKPA 4GAFB 5E1AB 4YSEA 4WFHD 4DFHA 1KKDA 2XWCA 3CFJB 4BGLA 3HNTH 2IGTA 3QIUD 1Q6HA 3EJQA 2F5BH 3NSCA 1EAQA 3LSOA 4KQ4L 2GTWB 3HFFA 3FW6A 3PWJA 2IMMA 4FI8A 4MVBC 5A16A 2D3OW 5CEZE 5GGRA 4XX1E 4HXAL 1ET7A 5HYSB 3I9GH 2X4TA 1M93A 3LKSA 5BQ7B 4TQDA 1EDYA 4JFZL 5C2UB 2A74C 5EWIL 4FMVA 1G6VK 3D85D 2VWEC 1XIWC 2XIBA 1MCOH 1YDPA 2PPFA 4PB9H 2HRPH 2ZOLB 4QXGL 3D85A 5L4JA 4J4PD 3B40A 1P7QB 3L4UA 2LW1A 2WZ5A 3FQWA 4M5TA 5EPMA 5D4IA 1CK0H 1NIBA 2WCGA 2O6EA 3RWEB 2GV9A 3FCGA 4XWOC 5E1AA 1ZLUH 4OXSA 1PNDA 2J55A 4Y16D 4Q6GA 1UM5L 5IUSA 4J9YB 1YUHB 2Z31C 4NO5A 4OLWH 5L6YH 4DAGL 1HZKA 1PG7W 4F1ZA 4M62H 1CTOA 3PWJB 3ETEA 4OLYL 3VH8G 1PY9A 1E4WH 4BWAA 1E5ZA 3AJ7A 3QIWB 4ZZKA 5JQHC 4JHWH 5BQ7A 4Y89A 2NLJC 1VRSA 1BVNP 4O00A 1CFSB 4QTFA 4RGMB 1XMWA 3ZUNC 2DL9A 3DETC 1CXKA 5ESQB 4EIZC 3SOTA 4AM0B 4XBGA 1JNLL 3STZC 1TEYA 5JW5A 5L2KB 2HLAB 1X7TA 3QZWG 2DQ3A 1XCQA 1M7UA 2YFOA 4X7SH 4LNUB 3DXAD 4O02B 1EERB 2HKHL 4EZKA 5TPWL 3K72B 1NLBH 4I4WB 3FTYA 4PW4A 4PM1A 5SWSD 2QVMA 4XMLH 4WWPA 3PWPA 3QCUH 2JK5C 5KS9A 3GXUB 3MRPB 3GZKA 4Q6IB 4Y1AB 3SDDB 3H1IH 2C3VB 4NNYA 3SJQC 4UF7C 3R06B 5F72S 5AAPA 1KLFB 4KKAC 4X66B 3U1PA 3N1QC 3ZRVA 1MCSA 3MRDA 1GHFH 2QSCH 1NCWH 4EO5A 1G94A 1RM1C 4LSUH 1T0NA 4JGSA 3W3BA 5JOEA 3DSNB 3EFFK 4P48A 3R8QA 1RL1A 5GGUB 5EO0B 3V4UH 1K4CB 2Y0PA 4FABH 3LPWA 4NN6C 3DX4A 2V7QG 3MLVH 5DUBB 3BAIA 4EXKA 3SCMA 1N70A 3HBQA 1ORQA 1ZT7B 2BY3A 3C2SA 2IPTH 4TUKL 5EK0A 4XDJA 2OTWB 1A32A 4HALA 4J28A 4PWFA 4U6HB 5ICXB 3B5HA 4AMXA 4ZMOA 1LE5A 2HT3D 2YD5A 1M6OB 2AEQH 4EQ2A 1F4HA 3FU0A 2GT9B 4Q6IA 4Y4HC 3SDDA 2CJUL 3SZ6A 4S1QH 4O9HL 1W8NA 2JNZA 4YXLL 4HIIA 4NR1A 1U8LA 4U7MA 5CLYA 2X09A 2APBA 1XDCA 4FFBB 5BZBA 5T3ZD 2XHBA 3FMGL 4J6IA 1J5HA 2H2SC 3FKSG 2KC0A 3Q9PA 4XCEB 2VXTL 3LRSA 3DSNA 5CWSB 1QWNA 2BH0A 2LLGA 3IDYC 2AK4B 4JN1L 4NN5C 3UTSD 1IXBA 3P2TA 2X40A 5C0CD 5AENA 1PV0A 4FFTA 4QWWC 5D4QA 1KB5A 4P57B 2EUXA 3ZMSA 4JKLA 3TF7C 4UV9A 5C0CA 3FUKA 2EJRA 2ZE0A 4QRAA 3TBWA 3KPSB 1OXYA 3AS1A 4RBPK 1F23A 2P4KA 1A7BA 4YX2L 2Z65C 4KDTC 3ZDXE 5IYDO 4HWEH 1XR8B 3QQ9C 5TGBA 5TDNA 2BNUA 2IMNA 2GT9A 5F7MC 1ACXA 1E2VA 3JVFC 5LJYH 4XNYH 5IB4A 3IN2A 1ZEAL 4GMSH 4HIIB 4I1PA 3N50A 3JYBA 3N2GA 1I9RL 2V2XB 3JWNG 4XMPL 4K5PA 4W9CC 4XCEA 3MCYA 3TLRA 5IDJA 3LRSB 4ZUWA 1K4DC 1JFQL 1WFMA 1ASPA 5K59F 4YHPB 4D8OA 5FR3A 3PIQB 4CGUB 3DTUB 1EHXA 5BS0D 3ZTNL 4XRCB 1J5CA 4EEQA 1WJZA 5J4MA 3KPSA 3GRGA 4PGZA 2C3GA 3HKEB 2A9ML 2BP8B 5FECA 2ZUQB 3A23A 3KPSD 1YPZB 4Z1MG 2QGBA 5F93C 4DRXA 3U10A 1F45A 2YUWA 4NQUA 2BNUB 1KXQE 3BZDA 3T2OA 1HU8A 1XF3A 5HPOA 5AOJA 5FGBA 4BQBA 2N05A 2NY5C 1CJYA 1RK0B 2NLJB 4G9FA 4UIMA 4J8QA 3UPRA 3K6IA 5DMIL 4PJ7A 1UKSA 1RXLA 1LP9A 1PAMA 5D1XD 4ZS6D 5IK3B 2PN5A 2B9AA 3K04A 3SGDI 4CSPA 5E4IA 3NCWA 2LGWA 1IJNA 1ZPLA 3DC5A 2O4EA 1DE4A 3BVOA 3RFRA 3RURA 3O6KH 3LZRA 4YHPA 4O51A 1KXVA 1MRFH 1HOCA 2R9RB 4BV1A 1ODUA 1KULA 4CH3A 5BS0B 2QVTA 4Z7NF 1HWGB 5IFAH 2NW2A 5EF3A 3KYMB 4GG6A 1LUVA 4I50A 2GJPA 3EOAB 1UYWH 1INDL 3EFFB 4LIQH 4UFZA 4HFWA 3QHZH 5C0AE 5ADPL 4PBXA 1WB7A 1FO0L 4QRUB 5HI3C 5IHUL 4X9FA 1KCLA 4AQYO 2AQ2A 3MNZA 3CFDA 1MIEL 3ZJAA 2ROXA 4RQQA 1JYNA 2DDQH 1LP9B 4UNUA 3ARPA 3TTSA 5FFOA 2GK2A 2FX7H 1JZ7A 3OEEG 3SJBC 1U30A 3UTZB 2QHRH 4IOFD 4LT7A 3H01A 2Y36H 4JFWA 2BMKA 4YH6A 2D31B 1U92B 4JW3A 1ZIBA 1U4EA 2NY1C 2VDRH 3TWYA 5IV2B 3ARFD 5F9OL 3FO0L 4ZPTB 2CHXA 3I50L 3W7UA 5E99H 5FGCB 1UWEH 2AF2A 1K3EA 5CN0A 2EE0A 2IDTA 3FN0L 4JVUA 3WNIA 3L7FB 3PAYA 2XQYK 4IQHA 4UT6L 5C0CE 4MNHB 2W91A 3ZRWB 1SM3H 4NBZB 3WTVA 2D03H 4KAQL 2EACA 2ZOOA 4QRUA 1PQZA 4QOKA 4E5XG 5SX4I 2DICA 1N0XH 4KVCH 3DWTA 4WTZG 1N8ZA 4LF6O 4YJ2A 3TNMA 1AKPA 4TNGA 5CZVH 4HWBH 5DMGC 5AB1A 4JPKH 5BRZD 2Q7YB 5IOPB 4NXSA 3UTZA 3WMPA 1F2QA 5LMNB 4YIQA 5T3XH 3UZQA 4G6JL 3TV8A 4JV5B 1LNUB 2D3LA 1WV7T 2ITDB 2WY3B 2ZQKA 3V0FA 5IVXB 1MHEB 5I8KH 2ERJC 3B2PA 1JPEA 1BFSA 2WO3B 3S36X 2F1BA 2WXFA 2QM7A 2J25A 3MV7E 3QIBD 1WRFA 1OAXH 4RAUB 1NOLA 4JO4H 3MNVA 4UCTA 1O6SB 3BN3B 2LQTA 4IIQC 4LOUC 3NGBC 3RTQD 4WWKA 3ILEA 5BS0E 5FOBB 3SGEH 1MIML 3PNWA 1USQA 4IKIA 4JB9H 5GONB 3QPQC 4OZGA 4WFEA 3I6KA 3V0DA 4WFED 2NPLX 2CRMA 2PO6A 4H8UA 4TNVF 2KT6A 2OCFD 3DJ9A 5IBUG 3QEUA 1RZPA 5IOPA 4TLTA 1MHCB 3S5LB 3UO2A 4YIQB 3UZQB 3IE4A 3UC0H 5JVDB 2Q9OA 1LNUA 1KPVA 4LQFL 3TBYA 5GGRY 4OFQA 3AEIA 4DR6O 1I9EA 2F18A 4H8WH 1RI8A 4S0HA 3TN0B 3SYCA 4LCVA 5LBQA 5IREA 1AI4A 1U8IA 4IHOA 3CZEA 3NFSL 4GSDH 4NP9A 1NFIB 4Q56A 3KXFE 2VO8A 4HD5A 4UIKL 4HWUA 1BM3H 1VF5C 3EYQC 3IFOA 4NPYA 4WWKB 5D72L 5I18H 5HHOD 2ROYA 3S37X 4BZYA 1L6ZA 5FOBA 3ZN0A 3MYJB 1NBMG 1KPUB 2P5PA 2YPLB 1QA9B 3HAEH 1PGRB 1VFAB 2Y24A 2YXVA 2CGOA 1NEZA 1HNFA 2TRYA 3QJOA 4D9QD 1CE6A 3U1SL 4UT7H 3DX9A 1XCXA 3JV4A 3PWNB 1GCFA 1OCCC 4HKBB 3TYFA 4OD2B 5F1NA 4LWSA 4ZI7B 2WHVA 5KSBA 3PLYA 4U3JB 1XNRB 5L3GA 3CCEV 2RCSL 2IU3A 4I5BA 2VR9A 4L8SC 3C5SA 1N6QL 4GLRH 5CILL 2KKWA 1KY6A 3TN0A 5HTSA 3BQUA 1YN7A 5E2WH 3GBDA 1U8IB 5EIQA 4DN4H 1DZBA 4U7OA 3TN0D 2Z93A 1Y6NR 3GXPA 3HN3A 1L0NH 2O72A 3IDMA 1A5FH 2G0KA 4F27A 5CBEA 1NL0L 1H6TA 4WI0B 2HWZL 2QM4A 2K1EA 2JELH 1NEZB 3A6OA 3NOIA 4FXKB 3MA9L 3QCTH 1QABA 1YEWA 3DX9B 5JUEL 1QFUH 4IK7A 1NGXA 4HKBA 2J4WL 4G7RB 4J27A 3BMVA 3WJLA 3BRGC 1FVCA 2NYYD 3EO1A 3ZW3A 5D7IB 3LCYA 4D9QE 5L2KE 1CICD 1MJJA 2C9PA 2ITCB 3WE6B 2ZE8A 3ETBJ 4KKCC 4NXMO 5KSBB 1FFXB 2PMZA 1CICA 3M7FB 3PHSA 4ANWA 2EXTA 2XFXA 5CN1A 2YPKA 1M71A 5IMKA 3GXFA 3LZOA 1XFPA 2JF1A 3OKKA 3IXAB 3UTTE 3LSUA 1DBAH 3HS0C 4RCAA 1LD9B 3Q3GA 1ZMYA 3QUGA 5MEQB 2HA1A 5DJ2B 2DE0X 2OTUA 1CR9H 2AQ3A 2Z1KA 3KPRB 3OPUA 4KXBA 2VCOA 2C5DC 3VFRB 4Q4IA 4LRNL 2XKUA 3H9YA 3B2UD 4IKKA 4UTBL 2EYTB 4TSCH 3P4MB 4YO0A 2AJYL 4XX5A 3CFKB 4W9DC 5I6NA 3K4DA 4CC1A 1Q9KB 3N6YA 3LRMA 2DMBA 1QOKA 3CCHA 3VJ6B 3AGVA 2HVKC 4IU2B 5KMGA 5E00A 5DD6B 4JI7O 2B7DT 2W81C 2XFXB 4IRSB 1MZEA 5DQDH 4UB6Z 3VYOA 5E4OA 4A38A 4KKLD 3FO1A 3SE6A 2X4SB 3VXMA 1FLTX 3HB3C 3ZMVA 3EYOB 1NKOA 3VVWA 4JLRB 5LWYH 1TTGA 2Z7WA 2OIEA 3Q3GB 3UXFA 1M1XB 3KR3L 4WRLA 4TRPH 1AR4A 4NB5A 1K9MW 1B6QA 1HP8A 1X5HA 2NY5H 2O6PA 2WKLA 5D7JB 4ELKA 4Z5RB 2NR6C 3A0BZ 2FR4B 1GGBH 2VIRA 4C59B 1EM1A 1E4WL 2CLVA 4PJDE 2EYTA 4CMHC 3X14B 1F1AA 3RRQA 2EADA 3CFKA 1ZE3C 2CALA 1RP9A 2E8ZA 3WTUA 2K9UA 4Q9QH 1AJNA 1OW0A 5D1ZA 2AXFA 3O9WD 4FCAA 5LMUB 4HCRH 3V7MA 5GZOD 5DD6A 2KDGA 3L3OB 2L7QA 4X50A 3T71A 3O9WA 1HXKA 1Q9LB 3QUML 5IW1A 5JDSA 4EI5D 4XPHL 1BF5A 2YS8A 1EZSA 1AB3A 3IS1X 1R4XA 1HH6B 3AT8A 2VLJB 1AHKA 1UT9A 2VSDA 1I9IL 3RIKA 3JSNA 1YYLL 1DP0A 5PCYA 3HG5A 2WXHA 3WB1A 4NKMB 1FFTB 2GIXA 5IB2B 2OA9A 3PY9A 4J3OH 2MFNA 2C9SA 4K8RC 1P4IH 2YIAA 2JI2A 5DCCA 2MNWA 3N9GL 4GQ9L 2ZUTA 5HJDA 4MD4B 2X4PB 1JWMB 2ZIOA 1QSFB 2X9XA 2ZCKH 5CJBA 3QULB 3AAZB 2J1WA 1JI2A 3GSNH 4W4NA 4X7CC 1AXIB 3RZCC 3OHMB 2W0LA 3HR6A 1QO3A 1ZLWK 3CVDA 5AAWA 2CR0A 3ESNA 5KBKA 2YK1L 5HJBA 3R4RA 5TK2A 3QZOA 1QLEC 2WLJA 4JO8A 1KTBA 3H2PA 1DEEB 4FXGA 4NPKA 1V55B 4DVRH 5JDSB 3U46B 4WI7A 2LFSA 1JD7A 3FQNB 1OAUH 1PG7L 4Z7WF 3CPUA 1BVKA 5CSZA 1WZLA 2NSXA 3EG9B 3LQAH 1G7IA 3H4FA 3BKJL 3ARDB 4EXPX 1OGTB 4YHOL 3ZPDA 1EEQA 1FAFA 3E8FA 1B0IA 1L9OA 5IB2A 5LDUA 1K3IA 2MCPH 2H9GA 1JNJA 5I66B 1YEGH 1SYVB 5I1CL 2Y7SA 3WIAA 2YXHA 3H2QA 4JY6A 1JWMA 3QUYD 4UQEA 4YXLH 1IBMB 4KJPC 4XP5H 5FYLL 2FB4H 2Y69B 2HX7A 4NM8H 3QVNA 2Z64C 3WNLA 3FTVA 1QO3B 1K5QA 4MSWA 4FD0A 3R19A 4CNIB 3V2AR 2VXTH 4E5XB 1WT5C 3MLWH 3TO4D 5EUOF 3GDCA 3MNWA 3PF2A 1SDDB 4MXQD 4QRTB 4E9VA 4J12A 1JPGB 3G6JF 2AANA 3L5XH 4MA3B 4LH7A 2W0PA 5K9QG 3RJQB 5C0AB 4ABMA 2GAZB 2IQ9L 3PL6C 3VFMB 3ARBB 4GMTL 4NN7C 1W0JG 2DIJA 2QSTA 2K4WA 2OW7A 3BRDA 4TUYA 4GUNA 3R1GL 3VGEA 1A7QH 1P4BH 1ID5I 2BY0A 3BIBX 3DV6B 4Q52A 4MJ4A 3KDMB 4FQHA 2J5WA 5KJRH 1QW9A 4QXUH 1FBIL 3E3QE 3RPIB 4PJ7F 1G4YB 1QACA 5F3BB 4GKJB 4B3EA 1BQHG 1FNGA 2XY1A 1RH8A 3QNXB 4FFYL 3MTXA 1JZEA 2UUDH 5DHVA 1PS3A 2H0JA 4PGBA 3MNWB 1BMGA 5EG6C 1VGEH 2WZ6A 1O0VA 4EIGB 5JHLL 1IE5A 1LP9F 1KFAL 1E2WA 2VR3A 1CLVA 1AGDA 1IC5L 1S9WA 1KCKA 2ED7A 1SKVA 4POUB 4UCFA 5DURD 5AVVB 4DK0A 4R84A 1J8SA 5GSVB 3HI1A 2QQNH 3CLEL 4YSOA 5KSAB 1BQLL 1OV8A 1J5OH 2YDEA 2K6ZA 1TNNA 3ARBD 4MB5A 3D2UA 4A39A 2OMUB 1DLHA 3ZE0E 1RPKA 2OYLA 1N0JA 4F2MA 1DVFC 4M4PA 4Y16A 4XBPB 4KHTH 3UO1L 1W2BU 3DPBB 3QNYA 3MFFA 1SESA 3M8AA 3RPIA 4HLJA 5F3BA 1AAJA 3CZGA 1PM9A 4K9EH 3D39B 2Y69C 5CJXA 5DHVB 4L3CA 3ULUH 1NC2D 1E9PA 1K8DA 4OZ4A 3OJDB 3ZHDA 2GTAA 1CE1H 3S9DB 4PGBB 3ATAA 3VD9A 2WTPA 1CZ8L 1X7QB 2DJUA 2CH7A 4DR2B 4ZW5A 5FO7A 4K7PL 1MCDA 1N2RB 4JPVH 4AMKH 4LP8A 2E5EA 2OS7A 3GM0A 1UADC 3QZMA 1CIDA 2VKWA 3ZVVA 4F2EA 2ITEA 4BQCA 4C56A 4DK3A 4X98B 2G9HB 5KAIZ 1G7MB 3PL6A 2DI7A 2EILC 1T89C 2BDNH 2GKIA 3DXAA 3NJMA 4LF9O 2BOCA 2FX8L 3IMWA 3H7LA 4QO1B 1NZRA 4RZCB 4F2MB 5BV7C 4FLOA 1LO2H 4P2RB 2M6YA 4GQRA 4HJ0C 3TFKC 3MFFB 2GIYA 4NYKA 3ETGA 1TVBB 3FB5B 3SDLA 2OYMA 1TZHA 1I1FB 3WTTA 5B3SC 2BFVL 3O4LA 1GM8A 4Z9KB 5GPRA 2DDQL 2VQ4A 3D39A 2X88A 5AKVA 2FUQA 3QORC 1Q43A 5GS3A 5LCVH 1NFDF 3LQMA 1WB8A 4ZPVA 4AT6B 2NY2D 1BYOA 2XPGA 2DJVA 2JEXA 2Y36L 1QKZH 2K8MA 3ELQA 1CVSC 4HC1L 3CDZB 3UM7A 3K5LA 1BZ9A 1I8KA 1N2RA 1UM6H 2Y7NA 4XCFL 3HBZA 4LOVA 1U2YA 4KUCD 4X4KA 4YS4A 4H0LB 4A66A 1DQLH 1NCCH 3I50H 3KD4A 2G9HA 2A9AA 1FLRL 4RMBA 5C0EB 2Z0BA 3QYMA 3ESPA 3OXSA 5JHDB 2FEDC 3Q0HA 1AQKH 1S78D 2V5RA 5DEZA 2YD7A 1D5ZB 1UWXH 1N33B 3ARYA 1ZLDA 1I1FA 3AM8C 1PIFA 2ZIDA 3CFQA 3ZMZA 2ZP8A 1MCFA 5SWQB 3T2NH 3PGFL 3T65B 1NGQH 4NRZB 3UP6A 3RZCA 3A6BH 2QKIC 4M4RB 4MDJB 3FF8A 4HUWB 5I6XC 2JGDB 1SFDA 3B6SA 1HKLL 4G6JH 5J1SC 2X6UA 5L7XH 3CDZA 5CSBA 3LHPL 3MV9B 2H32B 3SKMB 3WO4B 3QJSB 2ZCZA 4NZUL 3SE4C 1N12A 3JXAA 4HG4J 1S77D 3DJZA 5K1JA 3WFDL 2WLMA 3ALXA 4JFEE 3ZYJA 5HHOE 2Q3ZA 3CCLV 2YKKA 1MCHA 1Y74B 4MAYA 2R51A 1Z9SA 4GRLA 4PJ5E 4JRXE 3VDAA 4QT5A 1DVUA 5JHDD 4GRLD 2BSRA 4ENED 5D4HA 1PZ5A 5D1ZC 1JPTH 4P9HH 1UD5A 2ENQA 3K1DA 1TENA 2BSSA 1GZHC 4JN2B 3KBEA 4PQXA 1MFCL 2ZX9A 4HUWA 4WNSA 4UQ9A 2X89A 5EORL 2W65B 5F89B 4D7TA 3JTTB 4U1MA 2OMWB 3P0GB 4HUXB 3EYSH 3SKMA 1IQDA 3KL3A 1NM4A 1R3LC 2ZXEB 3IKCB 4KKQA 2ZDIC 5TQ0L 4DEUA 3QEGH 2JKWA 1G1KA 4DV0O 4IW4C 1OAZH 1T83C 4QD2E 5CAYB 3U6RB 3EGDA 4HIHA 5G5DB 3HKDA 4AGPA 5M94B 4XC3L 1Y74A 3L7EA 2EIZA 5FC9A 3JV6B 3DHPA 2DWDC 4QXTB 1BAFL 1KMIZ 1NUGA 4H2CA 5I0VA 1RUPL 4ANVA 4NX0A 1EUUA 2GTSA 5LNGA 2YARA 1XGRB 4XZUA 3HZVA 5JIDA 4NZ8A 1HVXA 2FATL 2H5UA 2ZKYA 3DDFA 4OB5H 1UG9A 1YI2V 4ODVH 2WXIA 2XWJA 2EXYC 4FEIA 4G8EA 4HLEA 2R23A 3F8UB 4G9FD 4XHJC 4Z7OE 4BZ2L 1A14H 3L2NA 3O8XC 2OMWA 1A21A 5EU3A 3TJHD 2YLKA 1R3JA 3NA9L 5IJ9A 1ID2A 3GHBL 4JG0L 1SXAA 4RDQG 1NI8A 1I8AA 5JOPD 3RUGB 1ZRUA 5DQ9A 4DO6A 3ZL1A 1X5ZA 2BNQE 1FXVA 2LU5A 3ATEA 3DROA 3G3LA 3N1FC 1C5BH 2IH9A 4XO8A 4Z0XA 4KITB 3ZE1B 3P77A 2PCFA 4NRYB 3UABA 2ZCEA 1E4XI 2EIZB 4GFXA 3VA6A 4KOBA 1W72B 4DTGH 5BO0D 2Q73A 5LXTA 1KYOJ 1ACYH 4Z18A 5B7MA 3JBG7 5KTEL 2EVIA 1XF5B 3CSYA 2B1GA 4FCHA 1G9ML 2VZ1A 1QNMA 4NKQB 2L7JA 1G9NL 3UJTH 3VWKD 2KI6A 1H8NA 1IAII 4WUKL 3Q1SH 3WJLC 4JGNA 1N8OE 2CU9A 3L81A 1RIHH 4KBPA 5AUMA 3OEHG 1IBBA 2QTEA 3ZX1A 1BFOB 5EC2B 1KB5L 2NNFA 2P8LB 5HHME 1JVLA 5EU3B 4GFTB 5DO8A 2COVD 3U1QA 4WV1A 5EWIH 4OZIE 4L29B 4MVMA 2F5AH 3QDJE 3NTCL 2G2NA 5FPOA 3Q8FA 5AYQA 4Z0XB 3WBDA 1ROPA 4Q58C 1K4CC 4AH2B 4KK6C 5GISL 4IBVA 1YA5A 4YAQB 3NDZE 3TO2A 2HZHA 3RPKA 4CN1A 5ID0A 3RIAF 1JZHA 1CFVL 3ZUCA 1Z5LB 3QDME 3DNKA 2E76C 3CSYB 5BVPL 4U1IA 5I8OL 5L6YL 3L1EA 4XAWL 2LLNA 2ZP9A 4AMWA 4MA8H 2UXNA 4XP9L 4YFLI 1ERNA 1QBML 2AMGA 4UTBH 5JYMA 3TJTA 1WUZA 2VC2L 2G3XA 3QDJB 4G80A 4OX9O 1GOHA 2C7UB 4JHWL 5JZ7C 1KIRB 4LPXA 4X1YB 3GS4A 5HVWA 3AS2A 1BCCH 1EH9A 4PCSA 4L9LA 4R3SA 2X9WA 3BZFB 1AQDB 2WWWA 3VYPA 4NM4L 4MNGE 2Q67A 5HGBA 4O2CA 2AJ3B 4OT1L 4YPJA 3VFOA 4YAQA 5JMRA 2ZCLH 5LG6A 2JGUA 4DUYB 2X4UA 5C0RL 2G2PA 2V5TA 2PCYA 3VRIA 3B2MA 4WO4D 5LG1A 5MENB 3US0A 1TMQA 1RUQL 1HL5A 2ZAGA 3IJEA 5FKPA 5B4MD 5SX5K 1GAFH 4FHBD 12E8L 4WO4A 5AD0A 3JALB 1IC7H 3BEVA 1U95A 5CJQH 4O5LL 4Q89A 5FHAL 5C07A 5CP7A 2PO6C 3QDJA 2QV2A 4G80B 4PP1D 3RVTC 2NXYB 4X9QA 1NGYA 4X1YA 2GUYA 5C07D 4DSYA 4EZLA 4L9LB 4FA8A 4Z76A 3RVTD 3WUWB 2PI4A 5IKCA 5IYZB 1WAAE 2DRUA 5L3CA 2PO6D 4HIJB 1N5AB 1GKOA 9PCYA 4HT1L 2WYZA 4F80A 1DQML 5AQ0A 5B4MC 1OV9A 2QPSA 3ET9F 4PTTA 3VFOB 1H2MA 1VZIA 1RP3B 2P5WB 3BAXA 1ITCA 1UXWB 2P47B 4IRZA 3QZWA 4TV8B 4Y4KC 3E6HB 3O9OA 4G2AA 2Q0AA 4LPCA 4GO8A 1MHPH 2GHYA 1ETJA 3D12B 2FQFA 3IJEB 1I0HA 3MRBB 4JKKA 2VDQB 4Z0BH 1HEHC 4ELMA 5LHDA 3CN3A 3QUKB 3CH1A 4GW5B 3G9AB 3U4AA 3WUZA 1KP3A 3RYFB 3MROB 1HK6A 1OHZA 3WENA 2ZCKL 1UD6A 5CXPA 3IGLA 4PJCA 3O4OB 1ZSHA 2A4EA 1A22B 1BSIA 1G7LB 3AB0B 4QY8B 1FVDB 4JFDE 4TQHA 4Z76B 1KYAA 3NEEA 5GXBB 5F9JA 3KEDA 1N5AA 2VDOL 4BKLA 4J3TA 4JN1H 3OKNB 4CC4C 4D0DA 4LVNC 4Q9BA 1VFBB 3WFCH 4AEHH 4ZAKC 4ZJ9A 3OTFA 1ZCRA 4PTTB 4X1IA 4IKJA 2HRHA 5J5EA 1D5IL 1R5IA 2ARHA 3B34A 4EEEA 2VDOB 3PGDB 4IKNA 2F54E 4UB0H 1HCVA 2R9HD 3ICXA 1ZD6A 4BK8A 4ZBMA 2HJKB 2PW2B 3CCUV 3MRIA 2A6JA 1KDIA 2XHNA 2YA2A 3OZ9H 2IPKA 3OTTA 5KUMA 4CVWA 3SE8L 4UDUB 1RPQA 1HHKA 4LKCB 4TNEA 4XN7A 3VXUD 3RVYA 4D0BA 4TULL 1YEFH 1NMAL 1YCIA 3V0EA 2AK4E 2X7LB 1H2LA 5DJ0A 3VXUA 1KWGA 4FLHA 5EUKA 3IVKB 2Q86A 4YLBA 2PLTA 1Z1WA 2LLLA 3NJLA 4XE5B 3HRZB 3G6JB 4JPIA 2K6WA 4QNHB 5C0ND 4D0DB 4G7YL 1IEAB 4KY1H 3DO7A 4YDLB 3AQZA 5HJGA 5FGCE 4X1IB 4S1SL 3CSXA 1NCBH 3A6CH 1FNAA 1LNQA 2GC7C 3O6LH 1OAQL 3VFUA 1XO8A 3LNEA 1S7XA 3UAAA 1L1FA 2OJEA 3X17A 2HJKA 1XH1A 2WUBL 4ABQA 1KXVC 4IHJA 4PJCE 4GAAA 3I55V 4XBEH 4NLAA 2XPZA 1RSOB 2A73A 2ZSVA 2BOBA 1MDAA 4UDUA 1ZAUA 2AJUL 2BZDA 4F7MA 2WMPB 4OCXL 4QKTA 4OM0H 5DJ0B 3VXUB 4AQAB 5B39B 3ZHQA 1KTCA 3BAYA 1LVEA 4MBRA 4F33B 1OP3K 4GQZA 1X5KA 4JPIB 4JCLA 4V1DD 5J6HB 1A9EA 5JO5A 1I8MA 4R90H 3JWDH 1FJ1A 4NHCH 4KX9A 3TVMB 3DO7B 2CHWA 4AUJA 4XDKA 1M56C 3SKUD 3OKLB 1UXSB 3NZ8A 1IKNA 1GZPB 4YWGL 1GGUA 1JV2B 1K3ZA 1VIBA 4JHZA 3ZDZE 4UOW0 4L2LA 2OJEB 2VWKA 2ZYHA 2VABA 1XHZA 2JTYA 3LH9A 4M7JL 1FDLL 4ZS7H 5DRXB 4DWHA 4IHJB 15C8H 4TLSA 5TD4A 3VXMD 4EZMA 5IJDC 1KCWA 2EIDA 1K4DA 4YXKL 2ZSVB 4OF5A 3CBJB 2HG0A 1R73A 3IJHA 5C6PB 1OT1A 3Q2NA 2A83A 4FYRA 1VENA 2VERN 4NQXA 5IHUH 1VHPA 3CQQA 3ULAB 5A7BA 1NFDA 1F0LA 4BK4A 4J3OG 2OJZH 4AI8A 4M7LL 3RJDA 2BS8A 5L3BA 3L3KB 1ZIAA 4XOCA 5B39A 3FKUS 4HSAC 3CNKA 1P9MC 4E41D 2V8LA 2IH3C 4Y4HB 2Q7AA 1U6AH 4GW4B 1VCAA 3MLTB 3QCVH 4ZTOH 5D1ZD 5CGMA 5GZOA 1GZPA 1Z5VA 1WIUA 1GGCH 4Y2OB 4XNXH 4H0IA 3H56A 4N6RA 3TA3D 1LO3H 3KVDD 2CTQA 1DVYA 1JJ2U 1WCBB 2YXLA 3QG6B 4JDZB 3TA3A 1EZLA 5IVXE 5DRXA 2W60B 1SQQH 1L9RA 4M43H 4GX1A 4HUUA 2UWEE 4OJAA 1SM3L 3F05A 3LPPA 3KWWB 3CXCU 3LS4H 1NKDA 1VSCA 4NJ9L 1NGPL 2A4ZA 4JO3L 3J27A 1NFDB 1DJHA 1YAIA 4P46D 3Q8AA 4Z8FL 2KG7A 4RMVA 4Y5XA 1AMXA 3B4SA 2JKXA 3APNA 1PSKL 2ZINA 1TLKA 2HRLA 4K71B 4LF3A 4BA8A 4NBYB 3HCVA 4AYGA 1H15A 4AQ1C 4X8AA 4RLDA 1AR1D 2G60L 1BS3A 1VQKV 5I17B 1UM6L 5F6HJ 4AWJC 2DM7A 3MV01 4G6KH 2B59B 3GSUA 4O4HB 1A3ZA 1DQLL 5EBLA 4NUJB 4AJWA 4QYOA 1S78C 5L4IA 4WHTA 1VJSA 1OAXL 1WCBA 2NTSP 2QFRA 3ARGD 2E56A 4OJDH 5F3HB 4JDZA 2EDNA 2FMLA 3GLDA 3ZHUA 1F42A 2PWGA 3H7BA 4Z7OF 4HHWA 2HP8A 1WTGT 3GIVB 1B06A 3FPXA 1K73W 4HHGA 2GBUA 3FJTA 3QZPA 4MRBA 4CMMB 2X05A 1BREA 3S3JA 4DR3O 3FB8A 1NGQL 3JD2A 3LXBA 1QLFA 3ASNC 2FB5A 1XQ8A 3TT3H 5IYBO 2ZX7A 5F9DC 4YJZL 3ECWA 5L7XL 1H8LA 3PQYB 4OSUH 3BAEL 4FQ2L 4LRIC 4UQIM 4HAMA 1WUNT 1DVFB 3C8HA 2OK0L 4MNQB 1FFPA 4EUPB 1RZFL 4MCZA 1A8ZA 5A2QN 3EKCA 4MZ2A 3VB9A 5F3HA 1S7WB 1KJ3L 4UQDA 4QJ4B 5B3JE 1MREH 3NPSC 4RVBA 5B7FA 2WSDA 3KPPB 3W7SA 4J10A 1JDDA 4G5ZH 2DLFL 3GIVA 3IU4L 1SY6H 4WO0A 1JAEA 2YUAA 4PRDA 4BWWA 2GCYA 1T20B 3RWHB 4GNKB 3MLYL 1YJNV 1JNNL 5DS8B 1Z2GA 1Q0XH 4N9GA 5CJXC 3U1SH 3ZTDC 3JT2A 4GKSA 3KPTA 3VWJD 4ZMPA 4MZRA 1QLFB 4LPUA 2C4FT 2EIJB 3S3CB 3WJMB 4BAYA 3ABKB 4OTXH 3E86A 3NRPA 3PQYA 4OF7A 1VF5B 5DT1L 1L6PA 2W0FB 2XN9A 3K4ZA 4A7TA 3MMEA 1FFOB 1WWBX 1DVFA 1DN0A 4LVHB 3PQYD 4PTUA 2CKBH 2DOSA 1MF2L 1XSIA 2ZZUT 4L5FE 5E1AC 2EYSB 4XVJH 5E2WL 3U4BL 1ULVA 2PF4E 2Q68A 3ARBC 3KJ6H 3PV7A 1FZJA 2DBLL 1E1QG 2HRGA 3KPPA 1L7IL 4KNTA 3SO3B 2F15A 1Q8IA 4CJ0A 3H4HA 3VXPA 1UT1A 3WN5B 5MHSE 1XIWA 1BV8A 1F4YH 1T20A 1NL0H 1T5KA 3QJHA 1LK3L 1A4BA 3CK0H 1MJ8L 3D2UD 2ZXGA 3DI3B 1LHZA 2P22C 3D9AH 1CL7H 2DYRB 3P3UA 4JFFD 3P9LA 3KEHA 3QQXA 4Y2DB 2VL4A 5DHMC 4JFFA 4NT6B 1FO0B 3WJMA 1BGXL 2NY3B 1VFOA 1CS6A 2Q7HA 1FFOA 3DBSA 2AQSA 4F37F 3SDYH 1KLGB 3R0NA 2QWNB 4LFAB 2EULA 1RZQA 3BAKA 5E8DL 3WOVA 1D3CA 1S0VA 1AZRA 2B5IB 3AUVA 1OAYL 2IU0A 3GKWH 1FZJB 2G3NA 3CP1A 1QPKA 2ITDC 4YSTA 1AD0B 3K6FA 3PL6D 4LDOB 5DRWB 2X6AA 3QUHA 3D51A 1SPDA 2FSEA 4WBNA 3UCQA 4Z3EA 1DZ0A 2ZF9A 4IOSA 3K2KA 4I0KA 4WEMB 3GUTB 1HEZB 4HS6A 4MXQC 3VFWB 3P4NA 2WLKA 5I1GL 5E2JA 5F7HA 1KU9A 1CXHA 1Q82W 5I6KA 3RIFF 2NR5A 1E4KC 3NUKA 3O4LD 3CG8A 2AHZA 1GIGL 3BVWA 1K5WA 4LLWA 4I0XB 5B1JC 4HCIA 3U0PB 3H1KH 2RMKB 1BBJA 3NTCH 1KNOB 4UOQA 1MAML 5IQNA 1VF7A 1OAKH 1EEYB 4ODXA 2LFGA 4J42A 3ZSTA 4KK5C 1FL5B 4WU7A 3DGGB 4HDIA 4XAKD 2F95B 1O7DC 3CSFA 3KPNA 2I60L 1F86A 3GSQA 5GRXG 1HNGA 4U6VH 1X4ZA 2GTZA 2AQNA 1KYUA 4DK1A 2PR4L 3MRCB 2FBOJ 4GKNB 3VRLF 3OB0H 2YHGA 3BPNB 2D7MA 1HEZA 1JX9A 4HG4K 1MZYA 3VFWA 3P4NB 1M7XA 4OW6A 5B1BC 3KW7A 3RDTB 1UKTA 4CW1B 4HKZA 4FYSA 3GSWB 4HKXB 3MUGB 1U3ZA 4LL1A 5DHDA 4ZG1A 3MACH 3OPZL 1OTTC 4FX5A 5FM5O 2YEZB 3U9PL 4TWKA 5AW3B 3RZCD 1Q0YL 1KEML 4I0XA 2K45A 2ZUVA 4LDEB 3U0PA 3SO5A 3ZS8C 3JT0A 2NY2B 1MCWM 1GMEA 1IBDA 2JIXB 3F2LA 4DKDC 3JCZA 3V6BR 1SYSA 4PJXF 4ELME 5D6CA 1FL5A 1Q6UA 1W0YT 3FCUB 4HMCA 4C8XA 4FADA 5BR8O 1E4XL 2JB5H 1NA8A 5ETUA 2QTOA 3FYIB 1EVTC 3SY0B 3L4YA 4IBQA 1MCPH 1YNKL 2AV7A 2DH2A 1XMEB 3ES6B 4G6AC 4WDIB 2E5LO 1S9YA 3O6ML 4DH2A 5CEZD 4EI5C 1FXKA 4TUOB 3G5VB 2WLLA 3RWFB 2CMRH 2WTOA 4I0PB 1GYUA 3PWPD 4N22A 4JI1O 2HX9A 2XZAH 5DHYB 4DZBB 3NJIA 3GSWA 4HKXA 1IFRA 4RFNB 3ZL4L 1JMZA 2IALB 2IDFA 4G8FB 2HLEB 1AZCA 1EBAA 3HG1B 4H25B 4XTRC 1JZIA 1AROP 4OJFL 5LGHH 4LCUC 1EXUA 3A0RA 2Q1EA 2JIXA 3BZ5A 4E42B 3FN3A 2F54D 4JMNA 3GSXB 1AO7B 1PYWB 3MV9D 3RT3C 1DFBH 1IAKA 4QTHB 4FQQA 2MOGA 4A6YA 5IGXL 1QTPA 3IFNH 4IDLA 1NC4B 1P1ZA 4OCRH 3SCMD 3B43A 4YUEL 4IRJC 3M7MX 3CAFA 3U9UA 3II1A 1TETL 3LJ3A 3O45A 2I7OA 5J2TA 3ZYOA 4FDWA 5IFHL 1PZ2A 4JV5O 4JZJA 2E0PA 4R0LC 2JJWA 3R7QA 4X6CE 1ZUQA 2EXWC 1MQKL 4NM8L 3CMEV 2P5ED 3FFQA 3QUZD 1YQ2A 4KZDL 1IGML 2JV6A 4WHDA 1N36O 4AZ8A 5DMYA 1EAJA 1RJYB 2VDOH 2P5EA 1F4MA 2EZ0D 3MLWL 5FWQA 4BSWA 1YNTF 1MCKA 3GBML 1WNSA 5CCJA 1OZTG 2IOMA 4PJHE 2A9HA 2VC2B 5DK0A 5GRJH 3FQYA 1YYMH 5EA0L 5BRPA 1GYVA 3FN9A 4XBMA 3ZE2B 4B9ZA 1XZWA 4FQQB 4JPWH 4G42A 4P9PA 4PHZA 4K0KO 3UGUA 3UX9B 3SE9L 5D7LD 1UWXK 1XMOB 1NBZA 3L3DA 4CADA 1A1NA 3WS3B 1IURA 3T1HB 1A7QL 1KZQA 1UFGA 3O45B 3OKOB 5D7LA 4L8SB 5J2TB 5KSBF 2MOVA 3VI4A 4MQTB 2VDKH 1UCBH 2ESVD 1T1ZB 2CO6A 4WCEV 1A7RH 3CVBA 2ESVA 3FU9A 3BSZA 4AW7A 5EZYA 2KERA 1JRHH 2OXHA 3I9IA 4HBQA 4F7KA 1T1XA 3QS2A 1LDPH 1VGEL 1TJMA 4PSRA 5GGQH 1JWSA 3KWTA 3UTSB 4FFVD 4NQQA 3K9AA 4CS4A 1H5BC 2ETNA 4P9ML 4L23A 2DWTA 2BHYA 2ENPA 2OMNA 1Y07A 1I75A 1EZJA 4G42B 4NYLA 2BIIA 1YITV 4PRBB 4W4LA 2PETA 4FNQA 5FYLE 3K71A 4ERSH 4R7VA 4XXDB 3H55A 5I19L 2W0XA 2BNRB 1IRAY 1RY7B 1YHQV 3DVIA 3IGAA 4M48L 5GGSY 1OSEA 3VNYA 4ALAL 1L0PA 4CH5A 1WA2X 5DVKA 3GSVB 1ZL8A 1RP8A 1NWOA 4WAFA 3JWOC 5C0IB 1F7YA 1JVKA 4XOBA 4OM0L 5I5IA 2F1AA 5CBAB 2ESVB 2JK5B 4ZOBA 2Z1PA 3O65A 3FFCE 4MJIB 4WENB 1K6QL 4JFSA 5IEHA 2EDDA 4DN3L 3F7VC 3IAPA 1T1XB 2N1TE 1WAZA 3WEOA 4DUVA 2UX6A 3KZ8A 4FNLH 4N26A 4L3EE 3HNSL 3BPOC 4WUUB 4Y9BA 3AQXA 1GXEA 4ONOA 2IXQB 3QC5X 3U0TB 5F0JB 1P84K 2BCMA 4M8VA 4R6UA 5AW5B 1LMKA 5ITBL 3OKYA 5DJXB 1VQOV 3ZE1E 2GEEA 1S5HB 2RA1A 2B20A 3K8MA 3KLAB 3OR6B 2WINB 2VRZA 4BK5A 3OGCC 1O5DT 3WTYA 1G5AA 1I3RA 1L9NA 3F04A 1FYTB 1DUYB 4HUMB 4JI0O 2K6YA 4BFFA 2BVUA 2V1DA 4NXNO 4QHMB 3DHJA 1SMDA 2CDYA 1RUKH 4LCCB 2BINA 1ZLVK 2P5EE 1RJZB 2ZWSA 3OAAG 2XASA 2VR7A 3IDGA 4N8VB 4GX5A 2IXQA 2XWEA 5HJ3B 4AV5A 3TGXA 3RTQC 4N2AA 2CXKA 2PWDA 3IAYA 2XTAA 2VDNB 3NT0A 5I1AA 1E2ZA 4B3SO 3SGJA 1Z5HA 2P8PB 3ZY7A 5BR8B 1S7TA 3O3BB 4AKQA 4D8PB 4DUXA 2DW4A 3QIBC 4F58L 1SMAA 2B16A 2P52A 1JJUA 2MTAA 2NY1B 4GY4A 4LEOA 3GMRB 3BGMA 4N2KA 5EU6E 3LXCA 3VFTA 1TVHA 4EMZA 4D0CB 3VG0H 3WKQA 2AZAA 2ALAA 3APOA 3SDXF 4PS4L 1SLWA 3BGAA 3T2NL 1VESA 1SLVA 2W9LA 1FYTA 3A2FA 1T2QL 2Y07H 1B04A 1OZ0A 4KV5E 4LPYA 1VFUA 5EN3A 4BSVB 4PV1B 4Z7WB 5MI0C 5GS2H 4H20H 2OMBA 1C12A 4LLDA 2XWTA 5FFGA 3MNMA 4FMFA 2OMYA 2VW6A 3B2EE 5I82A 2DMXA 4PJFF 4XCCL 3UZEC 1JPFB 2OMTB 1RJZA 5E6RB 5I6LA 3JV0A 1YEIH 2EE2A 1Y67A 2WLIA 1LQSR 2EO9A 2XBZA 3ARZA 2FX9H 1MSPA 1LEIB 4OI8A 3QIBA 5EEZA 3O3BA 2HHHB 2BVYA 1EBPA 4AQEA 3W5NA 2H45A 2VDPH 4IU3B 3SGJC 3T0XA 5D96B 3OSKA 5KANI 3BUYB 1BA9A 3ARFC 3PWUA 3BIKB 3DGEA 2NY1D 1TYRA 3HLKA 4MX7A 4RZKA 1PLAA 1U8CB 3BLBA 4JRXA 1GY2A 1PAZA 5A16B 3CFMA 4R50A 1EGJH 1MNGA 4Z7WA 5DJZB 1TUPA 1IC1A 1PIGA 3GO1H 4UVBA 4YNYB 2BERA 4PJDB 5D5PA 4NHUB 4OSUL 3BAEH 3BMWA 3MFGB 4FQ2H 4YY3O 3GLEA 3TH3T 1JK8A 3LHAA 3K5RA 3ARXA 5AVXB 1JPFA 2MKWA 2LR4A 3AXLB 3ARRA 3HBGA 1Z0MA 2W59A 4M1GH 3SHSA 1E30A 1KCSH 2IAAC 1ET8A 1JNLH 4X9IA 4ZW7A 1HHJB 4KTEL 1X4TA 4I3RH 1URLA 4DYLA 2NNUA 1GW6A 3CZKA 2O1AA 3GZQA 5AW0B 3TEUA 4LF4B 3BIKA 4R8WL 3DOSB 4HJEA 2Y1ZA 1AVMA 1J0ZA 5KHIA 1RIVL 4LCCC 2J5LC 4MQ7B 3FNKA 3DIVA 4M93C 3SPVA 2GK0A 4OB5L 4ODVL 1DVSA 5EU5A 3Q7JA 4XPFL 5K39B 4FZ1A 1G4MA 1L5GA 4A1RA 1BOGB 1I7RB 4HBCL 4L8BB 1AI7A 3H3BC 3NA9H 1A64A 3PNRB 5FGBC 3V0WL 4H26A 1RFDH 2IDCA 4V1DA 4IBSA 5ESQA 1JXGA 4KRMB 3EF4A 4RWYL 2E75B 3HPJA 1TZ8A 2NNRA 1X6NA 3JAWB 2GJ6D 2WLZA 4MJHA 3OD4A 1RJLA 1JPSL 4XB8A 2Q3AA 4AL8C 5LNDA 1UM4L 3IGAC 4P23C 4Q0XH 1PNLA 2N7BA 1JZJA 1L3NA 3FSOA 2IGFL 1TPXC 3BI9X 4UWQB 1ODAA 3OTOB 4FFVC