5KUKA

Crystal structure of inward rectifier kir2.2 k62w mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 97
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kukA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kukA01
1R3IC 4KFMA 3K08A 3PJSK 4WFHA 3RVZA 3E8HA 3KG2A 4GX5A 4PA9A 3TETA 4PA3A 4J9YB 2Y69C 2WLIB 5EK0A 2X6BA 4MVUA 4MW8A 3STZC 5CBFA 3SPGA 2DWDC 1BL8A 2EIMC 4RO2A 2DYRC 2HFEC 5E1AC 2H8PC 4EKWA 3AG1C 3K04A 4JTDB 1J95A 5BZBA 3LUTB 3SYPA 3RW0A 2ITCC 1QLEC 2OCCC 3ABLC 2E4FA 3HPLC 2NLJC 3AT8A 3SPIA 1U4FA 3ATDA 1R3KC 4PDVA 3EFFK 2W0FC 1OCRC 2DYSC 3FB6C 4MVMA 4DXWA 3AT9A 3E8GA 2AHZA 4P2ZA 2R9RB 2A0LA 4PDMA 3ATBA 4MSWC 2ATKC 2ZXWC 2A9HA 3F7VC 4J9ZB 4LCUC 3UKMA 3ZJZA 1M56C 2WLHA 2X6CA 2JK5C 3T4DA 5EBWC 5EBMC 4RUEA 5EBLC 4PA6A 3E89A 4G28B 1R3LC 3K6NA 1KKDA 2WLIA 2X6AA 4G27B 3F5WC 4PA7A 3TCUA 5CBHA 3VOUA 4R50A 4GX0A 4PDLA 3OUFA 5KUKA 3F7YC 3FB7C 2HVKC 3ASOC 2YEVA 4GX2A 3AG2C 2EIJC 2HG5C 4R7CA 4ZBMA 3E8FA 5B1BC 5B1AC 4X8AA 3ABKC 1JVMA 1OCZC 4MS2A 4XDLA 4WFFA 3OGCC 3SYQA 4R8CA 2WLLB 3AG3C 1V55C 2WLKA 2QKSA 4HYOA 4JTCB 2ITDC 1G4YB 4MVOA 4LBEC 2A79B 4MW3A 3E86A 4F4LA 4I9WA 4QNHB 5CBGA 4PA4A 3SYAA 2HJFC 4JTAB 3OR7C 4BW5A 1V54C 3SPHA 1OCOC 3ATEA 3K0GA 3LDEA 5KUMA 4MTGA 3AUWB 4WFEA 1S5HC 2ZD9A 3SYOA 3BEHA 4PDRA 1K4DC 3ASNC 4MVRA 3WG7C 4LP8A 3FB5C 3LNMB 3R65A 4UUJC 3FB8C 1ORQC 2BOBC 2EINC 4RUFA 2WLNA 3T4ZA 1LNQA 3K06A 4H37A 4H33A 4MVSA 3VSQA 3ZRSA 3AGWA 3STLC 2IH1C 5J9PC 3LDCA 3OUSA 2Q69A 2EIKC 4MTOA 3T1CA 2AHYA 2WLLA 3K0DA 4GX1A 4R6ZA 4XDJA 4QE7A 4MTFA 4MVZA 3ATAA 2WLJA 4XDKA 1K4CC 4P30A 4RAIA 2P7TC 5IY5C 3LDDA 5EC1C 3GB7C 3SYCA 2HVJC 4OXSA 1M57C 1ZWIC 3ABMC 2QTOA 2Q68A 2IH3C 3JYCA 4P9OA 2EILC 4P9PA 4TWKA 4X88A 3RVYA 1P7BA 3SJQC 2WLMA 3IFXA 3E8BA 3UM7A 3X2QC 3ATFA 2Q6AA 4HZ3A 1XL4A 4X89A 3E83A 2K1EA 2DWEC 1U4EA 3IGAC 2Q67A 3RBZA 1N9PA 3T2MA 1XL6A 3SPCA 4CBCA 3AG4C 2KB1A 4MVQA 1OCCC 2BOCC 3SPJA 2GIXA 5EC2C 5B3SC 1R3JC 4QE9A 4WFGA 3K03A 3OR6C
chains in the Genus database with same CATH superfamily
5KVDE 4LK4A 2JJSA 4UV4L 3PG2A 3X1GA 4CBPA 1J5EB 1U2YA 3S35H 1KCLA 1HHHA 2WWMD 2QKIC 3GSVB 3L3JA 3QUZB 4YHPA 2EIMB 3U4AA 4LKCA 2OXGA 4H25B 4FN0A 3UC2A 4O5LL 1IAOA 1MCQA 3FSAA 5E1AC 1R3HA 5CJQL 2EDYA 4JM4H 1VF7A 4Y4KA 3W9DA 5LMNO 1O7SA 2I32A 4FDWA 5JIMA 3GJFK 4N6RB 5D8JH 4CN6A 4OFVA 3MCLH 4PJ5B 1RHHB 4ODVL 2BOCA 5JYLA 1GJWA 4QXWA 1NZRA 2ETNA 3F7RA 5E0QA 2EDMA 4YHHO 4L29B 1MSDA 2R0ZH 1NOFA 3OPUA 4OCWL 5E56A 5GONB 3DIVA 4WHCA 5HI3C 3X3GH 5AL0A 4B3VA 1AVMA 1SBSH 1KCWA 1CTNA 1JV2B 3E89A 1FVCB 3K3QA 3FQTB 3RAJL 1J9RA 4EBQL 4P4KB 1JZ6A 5I15L 1IU1A 3N41B 5F71A 3BGFB 3LSOB 5JHDD 3O8XD 2ZP9A 1J1PH 1WE5A 5F7LB 4A6YH 1DK1A 4GX0A 1BAFL 1E9QB 4OBRA 4G11A 3FB7C 1PD1A 1PZAA 1TVBA 1VQNV 3APCA 3WN5C 3ABKC 1NI8A 1KBVA 1KCKA 1OY3B 2IG2L 3IS1X 2BVOA 1KCUL 2EYSB 2J5WA 3GTNA 1ZA6A 5FB8B 3QFDA 5F9AC 1MCNA 5TH2A 2NNRA 2HTKD 4RZCA 3C6LC 4DVBB 3HE7A 3D7PA 2PXYD 3BRCA 2XVKA 2OSWA 5EBLA 1ACYH 2VDOL 2Y6TE 5LBSH 4HHAA 2HLFD 5D5ME 4LNRB 5C09B 3ULVF 2J6EA 3EG9B 3VQMA 4JFYB 3MCG1 5LG6A 1HZLA 1FFOB 1TQCB 3PQYD 1BXAA 5A6MA 2DQJL 3L3OB 2EDTA 3FXIC 3NCBB 4GAGL 4BWTA 4HWEH 4C55A 4FNSA 4JFOA 4CC1A 4JANA 4MJIE 2HT3D 4HMCA 3MRJB 4J27A 4B3MO 4YXLL 2XPYA 3EYSL 3QQ3B 2DIBA 3B2MA 4WTXA 3KWTA 1DL7L 3HOGA 1KCSH 3NZ8B 4KROD 4M7ZC 4Z7QE 1IZKA 2DI8A 2E6QA 4JDVB 1L7TH 3DO3A 1FL5B 1JFFB 5SX5K 5HD8D 1N68A 4V33A 2N74A 2CRIA 4PVMA 4EN3C 2A3QA 5K5YA 1KBGH 4L2YA 1AVAA 2GDSA 4EFBA 2DWEA 4NB7A 5FM8A 5BS0D 5KTEH 4OFQA 3SDLA 1YEHH 1M1XA 1Q3EA 3CSYB 2DW5A 3MUHL 5I6NA 3SJAC 3GWKC 4DGYH 4JVWA 3WY3A 3BUDA 1V10A 4BFIB 5BMVA 1QACA 1JGIA 1ET8A 5F7DB 2QR4A 4ATTA 3DUSB 1UT1A 4C56E 2HRGA 2XZZA 3WMSA 4WJ5A 2VKXA 5D7KD 5HI4C 1MJ7H 3IMWA 4DESA 2RTTA 1KCVL 3NAAH 1HL5A 4DFIA 3X3FH 4U3SB 4OLXL 2YUZA 3G6JF 5IG7B 4OKVB 4JI1B 4DEPB 1WFJA 4FTVD 4IKJA 4U1LA 3L9YA 4UM9D 3RG1C 3H6JA 4F27A 4I9XA 4J1UA 5D93C 1KENH 3PXLA 5E9DB 4G8GD 3KLAB 4QRBA 4XN4A 3RNQB 2XWJB 4ZFOL 3T77B 4PJ0Z 1KV7A 1TR7A 3BSZA 5IOPB 1IBMO 3ZYJA 5C3LD 2LOEA 2HRPL 5EBMB 4WF7A 2HA1A 3NDZE 1IGYB 1S7TB 4RNRA 4NO2B 1IBLO 3OAUL 3RI5K 4JHVA 2CU9A 2Q0AA 2QFPA 1XREA 1TJHH 4HS6B 3RGBA 3TS8A 1E9OA 4Z95H 2DWYA 4MZIA 1VEMA 3C8DA 3RWIB 3B40A 3AT0A 5JXEA 2E7DA 3EXLA 4LSPL 3T8XA 3ASOC 4DTGH 3F01A 4KHXH 5B66Z 3IF1A 4W4OC 2X4QA 3PE9A 5PCYA 3BKCH 2NZ1A 2DQEH 3HJEA 2JJWA 1MG3C 2FGZA 2E7HA 4HJJL 5ESVB 4AYFA 1J86A 3D4YA 5C0ND 4EUPG 4W4LA 4LFAO 1GRJA 4FXKB 3CD6V 2AI0H 2XNAA 2CD0A 5F7NC 3D0AA 3WD5H 1VFAB 3INUL 4F7PB 3QIBC 1XXFC 5B1JC 3K0GA 4RFEB 3WS6A 5DQJB 5JUEH 2IDCA 3G6JB 3L3DA 1NCGA 2FYUH 1MJUL 1RP8A 3CZFA 3JUZA 3TBTA 1VRSA 4BFGA 5BV7L 4NQVA 4ONGL 5F7AA 2NY2B 3D06A 1QQCA 2CJUH 4IOSD 3S97C 2DQFA 2OTWA 1IFGA 5JYMA 4UINL 2R2HA 2YBRA 5TQ2L 5B4MD 4F2ME 4E5XB 2AEQL 4P48A 1J48A 1FP5A 4DUYO 1GGCL 1QYGL 3SGJC 3S8WA 2C1PA 3MRFB 1GOGA 5E95B 3OHXC 2WXHA 3GRWH 4GSQA 4PRAB 4CL7A 43CAB 1X5GA 4YIOA 1LD9A 3MA7A 4EI5C 1QU7A 3GNML 3NA9L 3B2VL 3P4MB 1JNNH 4GRMB 4FQQB 4PRNA 1A6VL 2V37A 2ZP8A 3FPXA 3HG4A 4P5TA 3NIFF 3BOVA 3QP3A 2B0SH 5EN2B 4LF5B 5LQBL 4ZDHA 1KCRL 2A0LC 2B4CH 3K5MA 4JO4H 4RX4A 3CS5A 3CCMV 2GHWB 4NZUH 4DO2A 2DRUA 5I73C 3FTZA 5FEBA 3RZCA 4MJ6B 5JMRA 5KAQF 2GT9B 2DWDC 3H4FA 3QQ4A 2EE6A 2JH2A 5DTFB 3V4UL 4ZI8A 1QRNB 4DVRH 1Y76A 1WAZA 3SDCA 4YHLL 4PRHA 3DHPA 1HDMB 2VDMB 1PEWA 2DYSC 3U25A 3WHXB 1EHLH 2K7QA 3TV3H 3UC0H 4QJ5B 4HLEA 4A2GA 4PJFA 3GJFH 4DGIH 1VIWA 4KDTA 3KVPA 1DF4A 2QM7A 1M05A 1QSED 3UYPB 5DMKA 2IBZX 2XIBA 2V4DA 4ASUG 3ZKXC 3QW9A 1OCOB 4XNBA 2ZUQB 4PJEA 4JFHE 1DEDA 4KRPD 2X70A 2EULA 2R2CA 4DHLA 1J1XH 4PSRA 2Q8BH 2GVYA 4ALAL 1F90L 1B9KA 2PWDA 4GI6A 4E41D 4Q97A 2XT1B 5L3EA 2DY2A 3PL6B 4P2AA 5LKNA 3QQ9C 1CFBA 5T1KD 1A5FH 2X41A 3H42L 4HAMA 1MI5B 2XN9A 5HHXL 3ZE2F 4DV1O 3NIFB 4NPYB 4X7EC 4B3RB 5HPMA 1PL0A 4XXWC 4FMKA 1FO0B 3QEQE 2YC1B 5B3JE 3PHOA 4JTCB 5C07A 5DZOA 3PFUA 2FEDC 3OJDB 2JK5A 1AJ7L 2FEJA 1A7OH 3TIEA 4LL9A 3GXTA 4WCYH 2VJXA 3HZYB 5LXGH 2ZJSL 1N3NA 3CK0H 2OSXA 4BQ9A 2R4RH 2JIXB 2WKOF 4L8DB 2PCYA 5HYJD 2BWDA 1X59A 1U3HB 4UT9A 4W9GC 2OMWA 4OLZH 5F93C 5FUOH 4KKRA 2KHAA 4POUB 4PDRA 3D0LA 4W9HC 2GI0A 2AQPA 3BIKA 1RULL 1ORQA 3WIHH 5ISZE 3NRFA 1W6WA 1I1FB 1NGZB 2IH1C 3LDCA 1XCQB 1AGCB 25C8L 2VDKB 1URLA 2DQDH 5TFSL 2EUZA 5KYXA 5BV7C 1HOCA 3TZVC 1J18A 4FNUA 3QRLA 1ZTXE 5KSBE 1XD0A 3QPQC 4ORGB 3U0PB 3LNDA 3HAEA 5EU7C 1T7VA 5EYPA 3H3BC 5SX5H 3TASA 2XWZA 4HD9A 3WY2A 4AC4A 1GAFL 4M03A 3UIYA 4K5LA 2VLJA 2CE4A 2E9GA 5K39A 2ZKHL 1SQPH 1E65A 1UM5L 4RGNC 3PV6A 4YHOL 1MCOH 4LWSB 1AY1L 3CXDL 2WBJB 3REVB 4KFMA 3HZVB 1L9NA 3KPRE 3MLYH 5I75C 1I8MA 3L4UA 8FABA 1UEMA 1WP7A 1MQ8A 4XBPA 1Z3GL 1U8NA 2ENJA 1WWBX 3IJHB 2XSKA 3GS4A 5KYYA 1E5YA 1N6QL 3OTOO 3MXWH 3CFKA 1NFDA 3V9CA 4QYOB 5IWAB 2DYRC 1BBDH 3CPLB 4EKWA 5D55A 3B9KB 5IVXE 4P2RB 4ZAKB 4RBPK 1E6OL 1CYWA 1N0XH 4Z7VA 3JAKB 1MELA 2BY2A 2VXSH 3OPZH 3VXME 4Z7OE 5A2BA 4CMMA 3WYRA 5JW4M 4HUKB 4XOAA 3TP4A 3VWJA 1P5UA 3BLPX 4X99B 1A4CA 1NCAL 5IMOB 4HIPA 1BQHG 1I4FA 3HKZA 3LKSB 2X2YA 1M71B 1EMTH 3VH8A 5DK0A 4JZ2A 4X83A 1U33A 5KSAA 3CFBA 4IGBB 1NDTA 1S4IA 2A6DB 2OL3B 1TZGL 1GN6A 3B1TA 1B2YA 3U0ZA 3ARFC 1MWAL 1VEPA 5AVVB 2VSDA 2WN3A 1BZ9B 3N3EA 1BVKA 4ETQB 1F13A 4FG0A 2HUEA 1KTDA 1NS1A 4WSJA 3DK2A 4PWHA 4RETB 3HE7D 4QWWC 2BCKB 3KXFA 3EJTA 3O0RH 4KAQL 4ALAC 1PDKA 3CU7A 1FBIL 3LB6D 3P3TA 5CB4B 5IW3A 1IKOP 1D3CA 1UENA 2CLZA 5IHBA 2V2WA 1BX2B 3NRPA 1IVTA 1X5FA 3UTPD 3QYNA 2EYTA 2F8XC 1OF2B 4G8EB 4Y4HA 1PLAA 3V6BR 1CGSL 1GC1H 3VXSD 4ZXBB 3CDCA 1F8TL 2XPZA 2HFFA 1EGJH 1Z6JT 3RIFK 4BIZA 1IEAA 1DDHA 5GGRA 3MHHC 4R83A 4BZ1A 2YPVH 2J8OA 4IHBA 1ZDSA 3BI9X 1F7YA 3ZHLA 5ACLA 1Q1JL 4K9EL 5DD5H 3FFCB 1OTUD 4PJ8C 2Q69A 4QXGH 5D7KE 2XKSA 4TLSA 2AHYA 5FO8B 3VVVA 4H8QA 2IBGA 3CLEH 3N43F 4FQCH 3PGDB 4AY0A 3T1HO 2GFBB 4PV1B 4RGMB 2CO6B 5I0VA 1J11A 4MNQA 3WS3B 3CMOL 4DV7O 4LU5H 4YHMH 1AR1D 1L9TA 2Q68A 3FU8A 1IBZA 4P3DB 3RFZA 1P7GA 3VNYA 1ZHKA 3M1BB 5AKTA 1KKCA 1C16A 4QDGA 4O2BA 4AK1A 4OI9A 4WJG3 1U8IB 4PRPA 3P3SA 1N32O 5K59F 2N0KA 1I3UA 3FB5A 4JPVH 4FMVA 1QHQA 3SGEH 4Y5YB 5BZWB 4UCVA 5B3SC 3MLXH 4LF6B 1GR7A 5J9PA 2QGDA 1JZ5A 2FECL 5EO0A 4R7NA 5JW4Q 1XILA 1HC1A 2WUBH 5LBSA 3X1EA 1VDGA 1QLEL 1IX2A 4LLWB 4B7EA 4WDIB 5ICXA 4H26A 1ASPA 1PNDA 2DMGA 3DPDA 2WY3B 4HCIA 3HG5A 1B4JL 4Q14A 1MW2A 2AJ3A 3KYOB 4BCZA 2B5IB 5IJKA 4YDJA 2MNWA 2RN9A 4FM1A 4ODSL 3RTQC 1R3KA 1IVSA 2G9HB 2GG1A 4B96A 5KBPA 1SA0A 1W9XA 3HG2A 3NFNB 3QZMA 3HNTL 1FFQA 3DLQR 1I8UA 3DDFA 2VDNH 1IJNA 2P48B 5AW5B 2ZKMX 5ANMB 1P1ZA 1AG6A 5AOLA 2J1WA 1M4KA 5DQ9A 1F86A 1H3XA 5DC4B 5BVJA 2UXNA 3C08H 4MXVF 3N43B 3GO1H 4G1MA 2ZT9B 3CN0A 3UAJC 5JXED 1R5WB 4DK6A 2VXVH 1LM8V 3K58A 3HKEB 1NQBA 2BIIA 2FO8A 4AYDC 5DJ2A 1CFMA 3ORJA 4JPWL 4AKOA 1EEZB 1VQPV 1PY4A 2CDGB 3DMMA 1B90A 1JF1A 3HI5H 1R5IA 3BAEH 2DQMA 4Z9KB 2H2PC 2AERT 1EJOL 4OFPA 1VZGA 2J1ZA 1YDPA 4WI0B 4G9DB 3MRDB 4EI6A 1ILSA 4PGEA 3VA2C 4JB9H 5KVMC 3ZMVA 1FL3A 4WW2C 4PJGA 4YXWG 4QLWA 2Y24A 1NC2A 4X6FB 3B9EA 4ZKIA 2C1OB 5IB2B 4FYRA 2ITDC 4LPWA 1H6TA 1KIRB 3GGWA 3GFUA 1XOUA 2AS5M 3L4XA 5KVGE 4LGPB 1LDSA 4Q6IB 3M86A 4ELMA 3AQYA 4CNIA 1NJ9A 2E75B 4WVRA 3HBZA 2B5UA 2Q0ZX 3ICXA 3LNMB 1G0XA 2ENSA 3RBSA 1ZVSB 3TA3C 5C0JB 2YXYA 4KWUA 4S0HA 4ELKA 4NHCL 4LDCA 1SHSA 4LPCA 3LKOB 1LE5A 3F7PC 1K6QL 1S9WA 4MTOA 2XXFA 4G6JL 3BDBA 1XH1A 4APQB 3KZ8A 1JHKH 1XAUA 3ZL1A 1SHMA 3ERXA 5CFAA 4P2QB 3U9UA 5DMGC 3PJSA 1OGTA 4K9EC 3DUUA 4QKXB 4NXKA 2QTOA 5JLZB 2LE9A 1XI1A 3LRGA 4FKHA 1HWHB 3UTQB 3AJ7A 2BY1A 4QRRD 4QY8A 1YN6B 1KP2A 5J3HD 2EADA 3MFFB 3HNSH 2MEJB 5E00B 4TNWK 4XP4L 3ASWA 2QPSA 3EBAA 1BMZA 3X1FA 3GWJA 3HUJE 3LV3B 1QSEE 4RX4D 2JB5L 4IT5A 1EXUB 3L75H 3RGVB 4QXUL 1WAPA 4Z18A 1JZGA 3RZCD 1LO2H 4FG2A 2BTOA 1RMFH 5HGGS 5T5FL 1KBWA 1UKQA 3WFHB 5IB3A 1BCCH 1FN4B 2R72A 1IAIM 2XA8L 4JVPA 4AYGA 5IV2B 4Y16B 1G1KA 4TVPL 1KTLA 1WF5A 1JV5B 4E41E 4GIPD 4U6YB 2VIRA 4PCYA 3SDCD 4PRHD 5D70H 3GDCA 1CDCA 3U36B 2EVJA 4H20L 3QJTB 2ARWA 4K8ZA 5CSZB 2J21A 4WWKA 1QLEC 4RWHA 2QWQB 5EIBC 5I1DB 3SPVA 2I7SA 1WLEA 3K71B 4ZMZA 2X53A 1RURH 3T71A 5DA4A 2UXXA 2DMHA 1IMHC 5D2NB 2KDGA 3ZDYF 1UXLA 5EO1B 3P3PA 4F37F 5J2UB 1S9XB 4RBPH 3KLLA 1NPJA 1U6AL 3EJRA 2HRHA 1A1OA 1T22B 3LS4H 3FQRA 1DLFL 2IEPA 3G5YB 5EBWA 1NGYB 4LKXA 1UZ6F 4ZS6D 4A7QA 5GGVY 2MH4A 1JPSL 4IM8A 1M1SA 3TH3T 2VQEB 3QQNA 1ZGLA 3T3ME 2XN9D 2ZOOA 2I60L 4RFNC 3T4YB 3C5JA 4FA6A 1I8AA 3CLFH 3MLWH 3WU2Z 2HVKC 1OL0A 3HG1E 3NCJH 3NIGE 3S5ZA 4MD5A 1IC4H 2DEXX 5C07D 3C60A 5E4IA 3WTYA 3B3IB 1YLBB 2YS8A 3IPEA 1FZOB 3EOBA 5IQMA 3DYPA 2J72A 2ZWKA 2CK2A 3FZUD 3OG6B 4FQPA 4I50B 5T1JA 4X0KA 5IUCA 2A1WH 1HCVA 5CD3B 3OKDB 4YDKL 2XTJE 5GJTL 3M8OH 3FYIB 4CKVX 2BFGA 1KLFB 2R1WA 3ATEA 3VXUE 4X64B 1W72A 15C8L 5I8CA 4DP0X 4UV4H 4JBSA 1G7HA 1QHTA 1QR4A 2B14A 4LCWB 3UTSA 4NBZB 2NR6A 2YXFA 1NLBH 3WJMB 4U0QB 4IBVA 3DETC 3ZT6A 2QWNB 3BX7C 5CZXC 2H3NB 4AXWB 1XBDA 4IRJC 4RFOL 4O5LH 3DO7B 3ZDYB 3MRLA 4J4PC 3QHZL 5CJQH 3O2DA 1BG1A 3LPOA 1MLBA 2LLGA 3KPNB 2C2AA 4HCFA 3RYMA 3THML 4LCYA 5HI5C 3O6FA 2UXFA 2E7LC 2ZSVB 1DO5A 1G43A 1XGQA 2XTSA 2D03L 2YIAA 2Y1AA 1B4RA 4J3UA 4CN4A 2ZQMA 3VMOA 1S3KL 2FLMA 4L1SA 1PD0A 4MFHA 5DRXB 5JIQA 5CO1A 5I9QB 1RJZB 3QDMD 4NRZA 4OCWH 5IJ9A 3SBQA 3V7MA 1GZQB 2ESVB 4HZLA 1SOXA 2DICA 2YA1A 3BKYL 4RMBA 5J6GA 1W8OA 4KJYB 4E9SA 1UWEL 3RAJH 4EBQH 4X1IA 3MCYA 1XZ0A 3TCTA 4F9LC 5I15H 1I8LA 3DRQB 4UANA 3AREC 4I87A 1KJVB 5DS1A 1UQSA 4O9HL 1BAFH 3EIFA 1S7RB 5FR3A 3RWGA 1JGDB 2AV7B 1LMKA 3WLWD 1GY1A 3RVWC 4F58L 2VYRE 4ANWA 2IG2H 2HT4C 3LRLA 4HKBA 3PS6A 1KCUH 4JFTA 4HT1L 5JIPA 2VMDA 3H01A 3B7UX 2P1YA 4J8QA 3WDHA 2G3XA 5ERWA 3ZGHA 3KPOB 3AWFA 4J3VA 5JORA 3AT8A 1KB5B 4URTB 2VDOH 5C8YB 3PPEA 4DKDC 4MA8L 5CMUA 5EC2A 3UTPE 3K9AA 1RSFA 1QHOA 2Y7OA 5IB5A 2A9HA 3VXSE 1GMEA 1MVYA 2WCPA 3CZGA 4GAGH 1KACB 4YFLF 3BFWA 3U2JA 2EZ0D 4GFXA 2QM8A 3HC4L 4ANKA 5CU5A 1PYWB 3D52A 3PUCA 5GSVA 2OLDA 2FT6A 2JTDA 5FM5O 4YXLH 3EYSH 3OLGA 1DL7H 1WT5C 3JVGA 2XAHA 2MPAL 1CLVA 1P7QB 2A9BA 2AXJA 3KXFD 4RRPM 3KJ6L 2J8UA 1MCSA 4F8LA 1HINL 4F33A 1CGVA 4M61A 2PO6A 5TK2A 1Z66A 3ABGA 5HHMD 5TF0A 2EZOA 5IIEA 4JS7A 4Y4HD 4XNDA 3ZTDC 5K9KB 1WPBA 3AS0A 1NCBH 4KXDA 5HHQA 4MD0A 1G87A 2XVGA 2E74B 2VL5B 3GMPA 4LHJB 3DBSA 2I24N 3VWKA 1L9OA 3SDXA 1YYML 2JSFA 2BVUA 3N42F 4O4HB 1FXKC 1QPXA 2LU5A 4KVPA 1RZFH 4HJTA 5E1HB 3BIAX 2V17H 5TDPA 2EQDA 1HJCA 4Z77A 1SKVA 4IRSB 4OJFL 3SBRA 3ULUL 2DIEA 5FX3A 4EEQA 2ZYRA 2AXGA 2BW5A 1KCVH 2KBGA 1AZNA 4F24A 4XO5A 4L3EB 2CIKA 5LHHA 1EUUA 2EKSA 4OLXH 1XB6A 2DIJA 3AC0A 3BYYA 4LCCC 2EIBA 4MNQD 5D5QA 3TPUA 4Y2DB 5AVUB 3ARDB 1MAJA 1WD9A 4BXSV 3L4VA 2AQSA 4L2LA 5AD0B 2Y7NA 5IY5C 3ZR6A 3CWGA 3AS2A 3DTUB 4I5BB 1MCPL 4QRUA 4YY3O 1E1RG 4WWOA 1TO5A 1U0QA 5DK2A 2HRPH 4CDHA 2VMCA 2YQGA 3N55A 1XL4A 3IGAA 3G9VA 1KZQA 1U4EA 2QQKL 3RDTA 4ZZFA 4LEXL 1K3EA 3S8FB 2AKRB 3LVTA 1MDAA 1WUZA 5D1QC 3SKUD 1R3JA 5H37H 4D94A 1W0KG 2ZOWA 2PUSA 1HSAA 2YRPA 3HE6C 4LVOC 1DEEA 1XNQB 2L7JA 1VF5B 4R97B 1M7XA 5I1KH 5LNDA 2B2XL 4UMGA 2WXIA 1YUHB 1U8JB 3NPSC 3VU1A 1EGJA 5EOCJ 3QUMA 3CRCA 4NAJA 4Z76A 3N42B 1KZYA 2UYLA 4WLCA 5DZVA 1E3FA 5MP6L 5DJXA 2BSKA 4HJJH 2N7BA 2J12B 2JB6B 1XF2A 2NLJA 1WA1X 1X5IA 4FI7A 3A67L 3K72A 3W57A 3FB6A 2X4UB 3N0AA 1ZSHA 3INUH 2GJ6A 1XGYL 1QUNB 2IQ9H 3KPSD 4RRPA 4E9YA 5J1TC 2TSBA 5TE4L 4DZBB 1N10A 1F4WL 3JATB 4P2OA 1GXEA 2VL4A 1I94O 2ILMA 4KFZC 1AHMA 1MJUH 2B7DT 4ZHQB 5T3ZD 2R9IA 4U1IB 2YI8A 1O6SA 5BV7H 4OF3A 4ONGH 3KLKA 1KLUB 4UCRA 2PCPA 3O3DA 4AK2A 4NXSA 4UINH 3EOAB 4OIAA 2WV3A 5G4NA 3WNJA 2K8QA 2YGNA 1EN4A 4JRFA 2QMKA 4Y19D 2AEQH 1Y6XA 1GGCH 3LZRA 2E7BA 3GZPA 3NA4A 5GS1B 1UKSA 4EZJA 3L9RB 4Q74A 5TISZ 3MRHB 4YJZL 5I19L 2IGTA 3RVTC 5BY1A 1L0PA 1JOYA 1HWWA 4P07A 1PG7L 1VZHA 2D7PA 4LBAA 4K94L 3JBG7 3GNMH 3EBIA 3B2VH 3NA9H 3L70H 3TO4A 4QHLB 3FT3B 5CLWA 1A02N 1A6VH 4QRRE 4YS4A 4LHQB 4X6EB 3RUGF 5LQBH 3QJFB 2ZYHA 4KXZI 5CGBA 4RDQG 3TNNB 1A1MB 2UWEA 1AI6A 2WMPA 2PTMA 1S7SB 4ATWA 5HYFA 4PJBF 2RMNA 3P9LA 4UCSA 1NGWA 2JXMA 2JJ2G 1JK8A 3BWSA 2AXTZ 3FONB 2A74C 1L6XA 3NFSL 1FVDB 3MV01 1TQWA 2VE6A 4NHUB 1YJDC 3IDXL 4RIRB 4HK3N 1E5ZA 3FFOA 2JKIS 4OAWB 1HN1A 4R4NC 4XP5H 2NY6C 3IXTA 3R8BB 4YSTA 1BVNT 3FSZA 1BQKA 4WI9A 3V4UH 3ULUC 5FGBA 2OMXB 4F8NA 3RKDC 3LD8C 2UY6B 1QR1B 5JTWA 2JKTM 4YHLH 2P4KA 5K1NA 2NOYA 1U8PA 4S2SA 1MCIA 4L4VA 5BZDA 2VERA 4G7VH 3NJVA 3VD9A 1FVEA 5H94A 4MHHG 2Q3AA 1NCCL 3KYAA 3CSBA 1OD7A 4JFEB 3MUGA 1ZHBA 1BM7A 1JXDA 2P46B 2F6AA 4OPHA 2YUXA 2UXCB 4YXHL 2YZ1A 4ENED 1F45A 1LL1A 4KVCL 4QD2E 4AVKA 4ALAH 1F90H 4UU9A 1NFIB 1LO0L 3LXCA 5AB1A 1FNFA 3BAIA 2JNZA 4GRLB 1DVFA 4JG0L 4GX5A 3TF4A 5CWSA 3UQ8A 3H42H 4JE0A 2LGWA 1TSHA 2YHGA 4LH7A 2BP3A 4WWKD 5HHXH 3RUGB 1WGVA 3DSQA 3MRMB 4GUPB 5DD6B 4B50A 4PCKA 1P7HL 5KOVC 2RNBA 1AQKL 3DHUA 1ZL8B 4FQ1L 4HFUL 3AITA 4JI2B 4PJBB 3SGDH 3Q01A 3ESVF 3HPLC 1AJ7H 1U8QB 3DROB 4BW9A 2N0MA 3JT2A 2UZYA 2XASA 5IJCC 2ZM6B 2ZJSH 3QJUB 1CO1A 2B39A 3AU1A 2ZOLB 4ZBJA 1JPEA 3DIFA 1DJYA 4I1NB 3MV11 5KJ4A 2BNQA 2D8KA 1G6UA 3L2NA 4KKBD 2D0HA 4GQRA 5TF1L 4KKLD 4NO5B 1ECYA 5I6XB 3SE3C 1JCHA 3CC7V 3LNFA 1LXMA 4OLEA 4AYBA 1EAPB 2PYEB 4OGQC 2DQIL 5CLTA 4OM1L 2QGNA 2UXGA 4P5RA 25C8H 5TFSH 4UOJA 4X4YB 3F7YB 3C60D 1IBKB 2OYLA 2CBPA 2HFTA 3VSVA 1B2WL 1SDDA 4YGVB 3ZRXA 3GXIA 2VRQA 2O93L 1N59A 3MJ7B 4U33A 4UCFA 2XQYA 1VQ4V 1S9KC 3C2SA 3B8MA 3OD4A 1JP5A 2CJ3A 4AWJC 1I08A 1K7DA 3C6LA 2GHZA 1X44A 4MQXD 2WQSA 5KS9A 1BMWA 4TT3G 1GAFH 3MGOB 1NTMH 1RK7A 1VENA 3W0WB 2IGFL 1MH5B 3NCFB 4NUQA 4DEWA 1BPLB 3QDME 4AENA 1UM5H 4K94C 3UTSD 2NR6D 4YHOH 1AY1H 1T5EA 3CXDH 4JM0A 1SVCP 5AVZB 4DV3B 3FO9A 3QQXA 4JG5A 1AYOA 3G08A 1U2HA 4LDLB 4GKSB 5AW7B 1Z3GH 4X7CC 2Q6WB 1G7IA 3O6FD 1CLYL 2CGZA 2C9PA 3LNHA 4KXAA 2BFVL 4R3SB 1I82A 1UUNA 4JPWH 4PRIE 4D8PB 3PNWB 1CXZB 1YY8A 1RIHL 1Y18B 2BSCA 2E86A 2YO3A 5A1AA 4QE7A 3ZKSD 1I85A 1E6OH 3UT5A 3FFDB 4J3TA 3DURB 1CD1B 4ZMAT 1UGNA 1BGYH 1MLCB 2P8LA 3FTXA 5CXPA 4Z7UE 5FYKU 3AWEA 2CALA 1WAEA 3SKNB 4OZFG 3Q2WA 4GSDL 1DVUA 2EDXA 2ICWA 1PZ2A 4AQ1A 2X1PA 3LRSA 5DO2D 1ACXA 4QGYA 4BQ6A 1LEGB 2VSCA 1TDQA 2WZ0A 1TZGH 3VACA 5E5RB 2B9BA 4AEFA 1MWAH 2A73A 1M42A 4PR5A 1RJYB 3P69A 1INDL 1INEL 4GW4B 2EC9T 5EO9B 4J9YB 4FTDA 1D5ZA 3HNVL 3V5KA 1AC6A 4E9TA 5JR1L 1TFPA 2XRAL 3EHBC 3I9GL 3SODB 4KAQH 4JQVA 2W65A 1FBIH 5CN3A 3HS0B 5DUBB 2VRZA 4WUKL 1FG2B 1AZRA 2R27A 5GGRY 4BZ2L 1PCSA 3RW0A 3HLKA 3U1QA 5F9DC 5C0DB 1X6LA 2P5ED 4R2GC 3T0WA 1ZLUK 1XGTB 1CGSH 4YPGB 1F8TH 1I1AC 1RUAL 1HHJA 3CVCA 5CIPH 3EYVB 3R0NA 2A9DA 1TT6A 3BH4A 2O6FA 3RILA 1DDTA 1ETA1 1DTUA 3LX9A 4KZ0A 1J1OL 2WINA 2V2TA 1D2DA 5ITZB 3OKLA 2X4RA 4F92B 5F9WB 4AYEC 1T0NA 1Q1JH 3T0EB 4K9EH 2OSYA 5C0CA 1JNJA 1CS6A 2BOLA 3KWXA 5LG1A 2ZKXA 5FLXN 1IRAY 1URIA 2PO6D 3DV4B 1H8OA 5BOJA 2EIJC 3UTTA 3CMOH 5I18L 3D3IA 3I02A 1KB9K 4TVUA 2XV2A 5EDXA 5E5UB 5HYSA 1PKQE 4IU2A 2Y5EA 1F4YH 5LL6Y 2BNRA 2VDQB 3BVDB 3L3GB 5C0IB 4PRDA 3CCHB 3CN3A 1V54B 4JDTL 1JN6B 2C5DC 4EUPH 4J3OD 1G6RB 4JREB 4WENB 1WB7A 1G8MA 4NUPA 2NY4C 4NN6B 3V5DB 1ONQB 1GIGL 5L2KD 4Z1PA 1YSCA 2EINB 1QLEH 2IBZY 5EPMA 2QQQA 4L0ZA 4HCGA 1U8HB 2RR3A 5EOTA 4H33A 1A6ZB 4G6FD 3W2DL 4UQ3A 2V5MA 2UZXB 4EE2A 4Q56A 1KJ3L 1F3RB 1CE6B 3DXRA 4WI4A 3KKYA 4ODSH 4JCMA 1U3ZA 1GAXA 4U1KA 1IIIA 1NIAA 4JDZB 1SQMA 3VU2A 3HNTH 2BTQA 4JI1O 4Y2NA 2FSEB 4HGWB 1M57C 3OKNB 2A6JB 5ITFB 3RDTD 2XAGA 5D72L 4NKIL 4OSUL 3A8TA 3IFXA 3KPSE 5ABDE 1X3DA 1JL8A 2F5AL 3MRBB 1OAUH 3TVMC 1OAZL 2MKLC 2OMTA 3EF7A 4HH9B 1NCIA 4FZ8L 4Y5XB 1IAKA 2CDEA 2O57A 3FAVA 1EERB 1NGXA 1CL7L 1NIFA 1BE3H 2Y2WA 3BVNA 4LLMA 5JOPD 2HZHA 3RWCB 4H7VA 1X4YA 4CSPA 4WTWA 4Y1TA 4UQ9A 3ZHNA 3EJSA 4XZUA 5DZ9A 1EJOH 3AABA 5E8OA 2JDIG 3JWNG 2XZAL 4Y19E 2HP4A 1A9BB 3HMXL 4BRVA 1CWVA 3PABB 4KK9D 3D50A 3AG1B 2YJQA 4O02L 3WKNA 4AGQA 3J7HA 5ETUB 3IDJB 2GJ6D 4ICXA 2V7QG 2WYZA 4X8CA 1CN4A 2XKNB 1MHHA 4P2OD 3VFSB 4TUYA 3QO0A 1W0VB 5FYKL 3J7AU 2D0GA 3LAFA 2WXKA 2CGNA 2WUCL 4K5NA 1S76D 3T6ZA 2XUMA 2J56A 2KQMA 2IU0A 3AAZB 2UXBB 1SZNA 2HN7B 2VISB 3B7YA 2AV1A 3FN0L 3P4OA 3SE8H 2JRIA 5FPIA 1KPUB 1WO2A 5HHNA 2Y5TB 4H4NA 2EEXA 1BAGA 3CDGB 1A6AA 4HUMB 4NHCH 3VCLB 3SBWA 5FW7A 3FCTA 4YBLB 4HK3J 3QFJB 4YWGL 3UACA 4PJCA 1K6QH 3WFCL 3KS0H 5JQGA 2BSBA 4G6JH 3M8AA 4HIXL 4BH8B 1ZSDA 1JZ4A 3EGSA 2Y0PA 4BFFA 3FQUA 5B1AB 1CYGA 2CE6A 1OCZB 2E9WA 3MKKA 4KK8C 1PPIA 5DRNB 3T4AB 5H37A 3TO4D 4F5CA 5D5MF 4ZQTA 5JPMA 1ZGLP 4MVBD 1Q0YL 2F7QA 2ODMA 1WISA 1J9SA 2OYMA 4XXWA 1U8KB 4XE0A 3OFNG 5EBGA 1P2CA 5C0BD 2ZNJA 3GQFA 3FT2A 3RRQA 3B9VA 5CJ5A 4XP4H 5I8EB 5F1OB 4BFEA 2CNZA 1A7QL 3CH1A 4OGZA 2ICEB 3V7AE 1FORL 2JB5H 4Y2OB 2ADIB 4KKZA 4QXUH 3Q7JA 1NCNA 4YK4B 1KDJA 3CFNA 4W9EC 5T5FH 5ES4B 4K23L 4PVBA 4XNMB 4DUWA 2Q7NA 4CC4C 4TVPH 7PCYA 4IS6A 5KHKA 4HIJA 4S1QL 1IAII 1EFRG 3S5LG 3K06A 1Q1PA 1M6OB 2X87A 3FT1A 3B1UA 2IH1A 2NY5L 1FNGA 3MC0A 3O2WL 4H20H 4L4VD 4ZFFB 2QGBA 1RM1B 2WXOA 3TZVA 3MV9A 5F1KC 5MENE 2FE0A 5IUSA 3GKWL 3V4PB 1A9EB 1DVQA 5DC9B 4N6QA 2PW2B 3IS0X 4JFDB 5LB1A 1RZIA 4GW1B 2EILB 2NUPA 1D9KA 5B38G 5IW1A 3BUTA 4U1NB 2YAEA 2XU9A 1U6AH 4XO8A 4X98A 4FGMA 2MFNA 3OEHG 3N27A 2JGDB 4GT1A 1DLFH 1WBZB 3GDBA 1M9NA 1OVZA 3T2QA 4PGBA 4XNAA 1ND0A 2JF1A 2BOBA 4U1SA 3A0HZ 1JPSH 3D85D 3H3PL 3L3HB 1EDQA 4X5WB 5D5MB 3UAFA 3SQRA 4YDLB 2Q4PA 3CSGA 3IT8D 3MRRA 1SYSB 2VTFA 2FJGA 2VLMD 1G84A 2I60H 2DMCA 2O30A 4QUOA 3X12A 3RPBA 5E6SB 4JCLA 3VI4E 2Y72A 2DYPA 3VFOB 4DGVL 4MQ7B 1E5UI 4Y1AA 1VGKA 3VFRB 4HYTB 1MSWD 2MRYA 3K2IA 4I5SA 5K1PA 2H8PC 3G71V 4L8BB 3H6AA 4FQHA 4ZMYA 4I55B 4PD4F 5B7FA 1UJTA 3R7QA 3EAKA 3QXDA 2BNQD 3KPLA 4YDKH 2I9LB 1AHWA 5GJTH 3CFJB 3BH8A 5DYFA 5HI3D 4AH2A 4BH7B 2XWRA 2P3YA 5KX5A 2Z91B 3QEHA 4PBVC 2ZXWC 15C8H 4WWPA 3X13B 5MHSE 1M56B 3IDIA 4IHOB 1ZLUH 5K9OB 1TEGA 4FYQA 2EVGA 4FJ6A 3J81N 1T6BX 2KLSA 2ZP0T 1AROP 4B9GA 4RFOH 4ODXB 4K5MA 1TFHA 4RGOL 2BY0A 1GM8A 1R73A 1QI5A 3F05A 3QHZH 3WENA 3BPZA 3F2LA 3UBXI 1DBKL 5ICZB 4L3CA 1ID5I 3V0FA 2QJDA 3IGFA 3NESA 3O65A 3X1BA 2KMWA 3F6IA 4KBPA 4C56B 2D03H 1MG2C 3C6LD 3D18B 3H9SE 3FD9A 1PGRB 1BD2E 3K6SB 3V6ZA 4NXNB 1UD3A 5H35B 1S3KH 4NC2B 4QHKI 4F3FB 1RAMA 4PWFA 4JUSA 3EXAA 1RH8A 1AYRA 3V55A 2ALAA 3JAWA 3BKYH 4JZNB 4A67A 12E8L 3VJ6B 1V8HA 1S78C 1UWEH 5AVRB 2HLAA 1CTOA 3FTYA 1VEWA 4LPYA 5I0XA 3ZMUA 1IGFL 1TTCA 3BDXA 1E4XL 7FABL 1U8MB 4GFTB 4O9HH 1X5KA 4GAAA 1GMGA 5EUOE 2DLIA 1BBJA 1VFUA 2X2IA 4XCEA 1WPCA 4DR2B 2JKSA 2E76C 2UX7A 4N8VA 4F58H 1C7TA 2G38A 2BW4A 4DERA 4HT1H 4NI6A 4P06A 1B06A 4PJ8A 4JY6B 4ZW6A 1V27A 3TT3L 3CC1A 3LH2L 3BWUF 3ZZLA 3SD2A 3E22A 4R6ZA 5E24E 3C75A 4OCLC 5IK3A 4QCIB 4U7SA 5DS8A 4AGLA 1E2VA 3ARQA 1WZAA 1R0AH 3E2EA 4X2UA 5IWAO 3N6YA 1H8NA 3B6SB 3BWZA 4NTYA 2H0PA 2NY5C 4MA8H 3K5RA 4S1RH 2I9TB 1CLOL 2P5EE 1IT9L 3HI1B 3O11A 2XHNA 4XCCL 4AQOA 2EXWC 2A9ML 2GJRA 2DTSA 3VAEA 2OWOA 5BXFB 3CFIC 1SXBA 1KTBA 3HC4H 2XT9A 1SXAA 3B2PA 5AWNL 3M17A 3CSPA 2WPGA 4J8RB 4XN2A 2OMVB 2WTPA 4MCZA 5I16B 1SJHB 3IAQA 3CCUV 5HI4D 3TN0A 1T0MB 2MPAH 3VGGA 1ZANL 3WKQA 3MBEA 3VRLE 1AI1L 3KJ6H 5D9SB 4ZD3L 1KWKA 1DQVA 2F54E 2HX7A 3BT0A 5GRJH 5TDNB 2WK2A 2JJVA 3APNA 1HINH 2R7EA 2QDOA 4BUGA 2ILLA 4M93C 1FNAA 1RPKA 3PWVB 5JCOC 5JH7A 4Y9FA 4TNGA 4DH2A 4WK2B 1T21B 3GSRB 4F2MB 4O2EA 4NJAL 3RTQA 1N5AA 1L0NH 2YJLA 3W7WA 2ARHA 5EZYB 5EOQL 1D5NA 4PDVA 1YYMH 1AXSB 4MA3A 5DEGB 4HEME 4ZUUA 1I7UA 1DLHA 5FF6A 2IMMA 4OJFH 3ULUH 1OQXA 3ZJZA 2P8MA 3MRNA 5C0CD 2NNAA 1VARA 4JZJC 1TJXA 4M6OH 2A6KB 3UAJA 2X1XR 1SN2A 5L2KE 2H41A 5HVHB 3D25A 3I3BA 3QAZB 1PFCA 4OZIA 5EZPA 1PW3A 5FYJU 1WHOA 3ULAB 1BZ7B 3PFQA 2BNRD 3KM2A 3L71H 1MCPH 2ADJB 4NSKA 3QJSB 1MWAA 4WW2A 3O3BB 2O6CA 4WEEA 4ADGA 1DTOA 4U31A 3QIBD 1KJ2A 5GGSA 2CBMA 4WNJA 2QQKH 4LEXH 1N0JA 3QG6B 1U8OB 2BJML 2WYIA 5ID0A 3FU6A 3QUKA 5E8NB 3S5YA 4OH2A 1IGTA 2X6UA 4PH8A 3KYMB 4LF7B 1YJWV 2PMZA 4L3AA 2GTZB 3P0YL 1WTLA 2B2XH 3PYCA 4MVRA 2W0XA 5JOPE 3TBYA 2FHBA 5KSBF 3E1ZA 1PS3A 1Y6NR 2VAJA 2WZPD 3WSQL 4U49A 1L9PA 1EWHA 2O1AA 3QWRA 5EZIL 4U7OA 2NY7L 3GSQA 4JRXE 5CIPA 1EK3A 3Q44A 5MP6H 3V6OA 3BZEB 5I66B 3I74A 4MAUL 5FA4B 2UZIL 5MI0C 3NXSA 1KGYE 3VG9C 4EI5D 5I0DA 2GUZA 1NC4B 3A67H 5A3ID 4YAQA 1RUML 5B1CA 1TITA 1RUKL 1XGYH 5FUCC 2FZ3A 4OGYL 5EWIL 5TE4H 3ZK0A 1F4WH 3AS1A 1TQSA 4AMWA 1QPKA 3GMRA 4ZW5A 1KMGA 4BCXA 1WA8B 3QEQB 4Q58C 3ATFA 2EEFA 3GSUB 3MGAA 4JZOB 4ZPTA 2ERJC 4JHBA 4NZRL 4H2AA 3PDDA 3F7VB 3WDIA 3RYFA 3SPJA 4P5MB 4EI0A 2XBDA 5DWPA 1F58L 2O6DA 1UB6A 4FLYA 2OR7A 4IJ3B 5IVXF 1B6UA 3WEAA 1RFDL 4M43L 3KEHA 2OYQA 4QRQB 4TUKL 1NWPA 1HDJA 2VDLB 4EUPA 5I19H 1AILA 3DI2B 4X7DC 4Z7OF 3R19A 4MMXB 5FCSH 5I23A 1PG7H 3D3VA 3TF7C 1F3DJ 3MGTB 1PD3A 4LHUG 1I1YA 3I50L 4K94H 4BHUA 2R0WL 3SCMC 1G7QA 3DX4A 4JFQB 1K8IB 1G9ML 2ZXDA 3J8F7 4NUJA 5HGAB 3BZDA 5C0BE 4LCVA 2EEAA 1GYVA 2AQNA 3DX6B 5KSBB 6PCYA 2IADA 4CW1A 3PWLA 5FGRA 4PJIA 4A2HA 4XCYA 4HFWB 3NFSH 3GSXB 5BRZA 2G5RA 3VGEA 4QHNA 5FCUL 1NFKA 3IDXH 1AQDA 1IB5A 1D5BB 1YMHB 4FLZA 2W9EH 4XXDB 1GTOA 4CS3A 4WFHE 1RHFA 3E6FB 1U8LB 2FVNA 1ML0A 4IDJL 4UTBA 5LDSA 2PUQT 5E8PB 2OT5A 3JVFC 3KPRB 5B1BB 2HR3A 1BXUA 3KLQA 5ICYA 3ZHTA 4H1LB 2HG5C 4X4MA 4YL4A 5D7IA 1Z32X 3MROA 1ZPLA 4OUUA 1IGML 1IEBB 1S3RA 3O41A 1NCCH 4N0CC 1ZHNB 1ZVHA 3FSWA 2OCHA 4O4IB 2IPKB 4Q8BA 2RA1A 2IVFC 4OF5A 3ZRWA 4YXHH 3JWNC 4CRPA 2QZ5A 3VXMB 5I0WA 4Z7OB 2Q7HA 3CRRA 2PXYB 4NI3A 3SE6A 4ZMQA 3PF2A 1U8CB 4KVCH 3KWUA 4MJ5A 3DOHA 4K7FB 1F02I 3BFRA 1LO0H 4X4XA 1J8HA 4L0PB 1PZ3A 4LVNC 1OP4A 3VFGL 3OKOB 2XXCB 2VC2B 1PNCA 3PQYB 1HH6B 2VLME 3LPFA 4KOCA 4IRJA 2GBUA 4W9LC 5DVNA 3TZVD 1RK1A 4UQ2B 4O2AB 3ZMSA 2D3OW 1D7DA 2SEBA 2B1IA 3GRGA 1F42A 4U6XA 1AQKH 4FQ1H 5I24A 3S3WA 2G30A 4HFUH 2PCXA 3UXFA 2ICWI 2CUIA 1OE3A 2LO1A 1JWSA 4TM9A 3N06B 4KROB 3CFEA 4O00A 4ZSOE 3OHMB 2NXZD 4N8PA 3SZ6A 3CCSV 5SWSE 3P3YA 4AM0Q 2YFOA 5DHYB 5JHLL 4LSUH 1FAIL 2C7FA 1TF4A 1HILB 1PY9A 4RGND 5TF1H 2ATPA 1CFSB 4HJSA 1MFUA 5LHGA 3AG4B 1OSYA 1AGDA 3L3OC 4Y5VB 4O4LA 2F19L 3A24A 1SZXA 4F9LA 4ANVA 2IDTA 2AJYL 1B3QA 2P9RA 4OM1H 2DYPD 3AREA 5CA1B 3I85A 1TEFA 3AS3A 4Y1AD 5BPPA 4R7CA 1U97A 1JHTA 4IOIB 2BSEA 3VXTB 4U1JB 4PWIA 3O9OA 2ZOKB 2GTQA 3QUYC 3FQWA 4N1CA 4JPRA 3CN2A 2VQEO 4UT6A 4NN5C 2Y0IA 1KIPA 5KJ7E 4PP2A 2ZAHA 3UPAA 3JWOL 2AAAA 1RSOB 3KHOA 4HAFA 2X42A 1UJ3C 3MR9A 3NN8B 2HHHO 1NICA 2EXYC 4H40A 1YXBA 4YLCA 4FFTA 5DEFA 1G4MA 4N2CA 5G4MA 4UM9B 2W0FC 3DC0A 4HSCX 3MTRA 1YCSA 4FLVA 3N9GL 3D69A 4NP4L 4NNYB 5C9JA 1JNHA 1CT8B 4G8GB 3MV7A 5AUMA 3ECQA 1G9MC 1D6VL 3KDPB 3D2UA 4HIIA 4NEHB 3BP5A 1MKFA 2ZIMA 3T65B 1ZK5A 4X64O 3ARFD 5KHJA 1AGFA 1H8SA 1A6WL 1A6TB 2XC8A 3STZA 2E3CA 1CLYH 3BQVA 1HEHC 3JTTA 1J10A 1WT5A 1XGPB 4GLRI 3APOA 5HP5A 1P4UA 1RIHH 1RVFL 1MCRA 1WZLA 4JRYA 1NH2D 3L5HA 1VQ6V 3DX8A 2Q7AA 3S4SB 4ONFH 3UIZA 4ABUA 1RQ5A 2YARA 1NAMB 2O61A 3NP3A 3PDGA 4HUXA 5GZNC 4PJ9B 4HWZB 1QLFA 2FQEA 1HE8A 2ED9A 3OKKA 1XH0A 2P5WD 2CO7A 2X7LA 1EANA 4FQIL 2EUWA 4Y4FC 4GSDH 1AZZC 3DVGB 1YEDA 1TJGL 4I9WA 1OXYA 2C3HA 3OZ9L 4KK6C 3EW3B 2R29L 1FXKA 1F6LL 3V0HA 2AVFA 3UGEA 4F7TB 3D2TA 4JI3B 5HJ3A 2VQUA 1SMOA 4YSEA 1KP3A 4ONHA 5J6HB 3EDJA 3SJVA 1UZ8B 1XDTT 1INEH 3EUDA 4PJ8D 5EIIG 1UC6A 4HC1L 3HNVH 1E6JL 1EAJA 3EFOA 2BP0B 3BUBA 5CMAA 2XRAH 5HY9B 5JR1H 3I9GH 2EUXA 4IIQC 3O6KL 3MHSC 4LCCA 1HHGB 4L9LC 1ACCA 4WUKH 1OCWL 4P46C 4YIPA 3IDUA 4BXVA 4BZ2H 1NVPD 3HUJF 2TRHA 2XIIA 5I76A 1I7ZB 1IEHA 2PPFA 1GYAA 4POYA 4Q20A 1K4CC 1CQKA 4GKKB 2X4SB 4F7CA 4RQEA 1OAKL 1TVHB 2E7MA 2J5LC 4FXKC 1RUAH 1A1NA 1RZ8A 4DKFL 3IAYA 8PAZA 3SJQC 3S8GB 4LLQB 4QIRA 2AK4E 4AV0A 3DXAA 3ZJAA 3HKBB 3ARTA 5SWQB 1RPQA 1J1OH 3RBZA 3TN0D 1J0IA 1M53A 1C8QA 3FB8A 2G5BA 4FQXB 4I8DA 1SYVB 4EDXB 4M7KL 1JZ3A 4S11A 1XIWB 4OCYL 2V7HA 4N0UA 4YHIB 4D8OA 5E8EA 2EO1A 1L6PA 4OGXL 1N67A 3KPMB 5DD0L 1QNIA 1UKTA 4UYPA 2PETA 5EZLA 5CCJA 1TNNA 3NH7L 1NKDA 3SDAC 1Q9OB 1JFQL 3D4CA 1DN0A 1I9EA 4E9WA 3RTQD 3MRIB 1Q9WA 1XGRB 3IDNB 3W11C 1OPGL 4NQCA 3APMA 1WWWX 3T0VA 4MB1A 4N20A 2BLFA 3VFNB 1S7QA 4HSAC 4O4JB 3R4RA 3PP4L 3SPIA 2E27L 3DSNA 4KV5E 4JDTH 1J05A 4YIQB 5FGCB 5B39G 4MVMA 3EDEA 4ANXA 2LABA 2HXAA 4O4YL 1I7RB 3JWOC 1M1KW 3BZ4B 3BO8B 1WQVT 1L3NA 4KUCD 3T3MF 3UAJD 3OR6A 4XO9A 3NIGF 4HNAB 1GIGH 4FHKA 4JO3L 5FKPA 1QI3A 4XGZA 3FTSA 4WIQA 4PWGA 3HUJB 1QSEB 1OGAA 3NJFA 2VDPL 3O4OB 2ZWZA 4JI7B 5DI8A 1NEZA 3W2DH 1T2QL 2WIIA 5DJ0B 3T6XA 4OZ4B 3LDBB 2Y7QB 2FWOB 4HUUB 1KJ3H 4TUOA 4JL2A 3AG2B 1FD9A 2MW2B 5CA0B 1E42A 5IWLC 3O4LA 2W60A 1XMEB 4MX7A 2CA4A 4J80A 1L6ZA 2LTQB 3ET9F 2JS5A 4E41B 3MREB 4AEIL 2HLDG 2QSQA 1AOHA 5D72H 4NKIH 4OSUH 3CFDA 3FSVA 4PHZA 3HMWL 3OAZK 1NBCA 2F5AH 3KPTA 3WNPA 2H0FA 1OAJA 1GKFA 3GXFA 1OAZH 4FZ8H 1BAWA 3VO0A 3L16A 1NCDH 1OCOC 4Q2ZA 3RWFA 2RH0A 3EGXA 1PZCA 3I6GA 1N8ZA 2A74A 1DBAL 1XSKA 2X0UA 2BIHA 3DRTB 3QUHA 3QWRD 1GH6A 1L3WA 3U82B 4NJ9L 5A2JH 1RU9L 4AIZA 5L4IA 2XZAH 1XBRA 2ETWA 4Z0XA 2IJKA 3ZEDA 3HMXH 5E9NA 1XNQO 1FFNB 2DLFL 2WSKA 3HC3L 1GZPA 4O02H 2BSSA 5DMGD 1JWMA 3ZSSA 4LPVA 2C9XA 2NQ3A 3T3MB 2Y7SA 4UCOA 2VLRA 2C7UA 3ESUF 3PWPA 3H1IH 4NQEA 4AW4A 3NIGB 5E4OA 3H85A 3NCCB 5KHHA 4M8RA 5FYKH 2PPAA 1SPDA 1ZIBA 3GHPA 3BPOB 2WUCH 3QG7L 1Y66A 4GP5B 3A4AA 4OKDA 1H0DA 2X38A 4X62B 3IYLW 2WTOA 3FN0H 3L7FA 5D7JA 3EADA 3LEVL 2WWMC 2WLMA 4GKZB 1QLRA 1THZA 1DVSA 1PL3A 1Q9KB 2CDFA 2ITFA 2JI2A 4X6CE 5IR1A 5LA6B 4CADA 4X8JA 1Q72L 3EVKA 2W94A 3RU8L 4RMWA 3FF7A 2XTJB 5AFAA 1QSFA 1MSPA 1EZVH 3VXUB 4HIXH 3G5XA 1HCZA 3KWWA 2YA2A 4TLTA 5DEZA 2UY7A 2D3NA 3D3VD 3HB3D 3X14A 2QA4V 2OX5A 1XGUA 2CLRB 1S7WB 4JQIH 1HHHB 5I6PA 3UADA 1RLBA 5A2FA 4XWOC 1YVLA 4BIKA 1FYHB 5DHMC 2OXGB 1TG8A 1Q0YH 3HR5A 2DMKA 1BFOA 2LQTA 1A4KB 3WUWG 3QVNA 1LNUB 2XG5A 1BVOA 2FWLB 4NWTL 5I1JL 3JARB 1OIOA 1WFIA 3HPLA 1KY6A 1PZUB 3AK1A 1A7QH 1H5BC 1JS4A 1KXHA 4JHUA 3B8SA 5EUKB 3O8XC 1M4UA 1M9SA 1U9KA 2VN4A 3MBXH 3QJZA 2ZUVA 3L2LA 4JJ5B 3IFNH 4M48L 2AJUL 5KAIZ 4AZ8A 3K4ZA 4MNHB 4MXWH 4K23H 4WEMB 2WPDG 2J6WA 5DRWA 1TCRA 2X4OB 1YEGL 3C6EA 4YHKL 5EULV 4ISVA 2EO7A 1P5VA 4S1QH 4OJDH 3IDMB 2ZD0A 2Y36H 1XR9A 4G6KL 4LLYA 1MIEL 3UZVA 4AJ0A 2DE0X 2NY5H 3BLBA 3JSSA 3O2WH 3DDGA 5SWZA 1ITBB 1S6NA 1FXVA 5JW4N 2FYYB 4GQQA 4MCNA 3KDMB 3TXSA 1A4JA 4MMZC 3BUPA 4PGDB 1ORSA 4OGAC 5J13C 1UH2A 5DDHA 1YMMA 5EU7E 4BFBD 1MW0A 4S1DD 3GXPA 2H9GB 4RZCB 3HE7B 2AP2A 3QO1A 5E2VL 2BHUA 2OMYB 3M6DA 2WWOA 4TOIA 5CZRA 1WV7T 1MNUL 3NTCL 2EECA 4F4LA 1J8HD 4PJ5E 4AE1A 4XX5A 3H3PH 4TF4A 2LHAA 4JRWA 4I48A 3FH8A 3IRZA 5CZXD 1RJLB 3QIUB 4IRJD 2UXCO 3VXSB 2YD0A 1IL1A 4IMKA 4WW1B 4DGVH 3GMQA 5C0AA 4R26L 5HI5D 1ZT4A 3N40P 3AGWA 4X5RA 3L95A 5CILL 3STLC 2YAFA 3MX0A 1B0IA 5CHNA 2Z64C 4WFAV 2W07A 3CDZB 5KYNA 4IBWA 2IAMA 4PLNC 4GKNA 4X9BA 5CBEB 4N0RA 4RAIA 2P7TC 4JI2O 3H7BA 4V2BA 5IROA 3RWJB 1ZWIC 5FFLA 2IH3C 1NPUA 1U95A 1JNLL 1CC3A 1SDYA 2FL5B 2G5UA 3OQRA 4RAHA 3BQUA 4WHDA 2CKBB 2KZKA 2ZM6O 1AR1B 1GS6X 3X2QC 2DWEB 2PCFA 3LS5L 3Q8BA 4XVOA 1HWGB 5BRQA 3ARED 1T2XA 3FQ2A 3CFCL 4KHTL 4TN9A 4X9YA 3RTLA 3VXQA 1VQ8V 1F6AB 4OZFH 4HK0B 4MMYB 5F88B 4RGOH 2VM9A 3RVWD 1CURA 1XF5B 5IMLA 2DW4A 3MLZL 2HT4D 3T5WA 1SFDA 1W0WA 4XB7A 5I1HL 1BZ8A 3MSPA 1KGXA 5DC0A 4DPRA 4HUWB 2W38A 3V4VA 3OVUB 4TVPD 1IBKO 2HVJA 4R5XA 1KULA 3OWEA 2EE2A 1MJ8L 3FQXA 4U1LB 3BFOA 3KBFA 4OFIA 4HJ1A 2P5WE 12E8H 2G0KA 5BW7C 4NKMA 5B1OA 1BSIA 1YEIH 2FYVA 2OKMA 3G9AB 4L18A 3EFFK 4Z78B 1I1AA 3DTDA 5A6IA 2AHZA 1E4XH 1MZYA 3QNFA 4GNKB 3S96A 1FNEA 3GMLA 1S72V 1UXMA 3DPBB 3CBKB 3FK3A 4RNRB 2G4GA 4NZDA 2L7QA 1KYAA 2VR6A 4JRYD 4DV3O 4NTXA 4M1GH 1R3LC 3K6NA 3KCPB 2BWQA 4XPFL 3U4KA 3TT3H 4ZMWA 1GA2A 5C0NC 3LH2H 2QADC 5BUAA 2ZX5A 1N34B 2WAQA 5ESAB 5I1AB 1IC5L 1WFOA 5CF3A 2YEVA 3O45A 5DZLA 4OFYD 5LCVL 1J5DA 1QFUL 2ADQB 2X2HA 4XPHL 4FA8A 5HGDA 5I5MA 1Z0NA 2ED7A 1CLOH 2IAND 3KH4A 1IT9H 4DF9A 3M1OA 4C83B 4I9WD 3ULVE 5E6UB 1UD4A 3QDJA 2I69A 1HW7A 4XCCH 5GGVL 1PP9H 3OEEG 1IZJA 3J07A 2A9MH 4V11A 3WNLA 3JV5A 5HHOE 4AYFB 2XG4A 3FT4A 2OR9L 3OAZH 4NCDA 2X88A 3SJVD 2OW6A 4R4BB 3PWUB 5AWNH 2Q87A 1QMUA 5K9QI 1YEWA 3IWUA 2LW1A 3U6RB 4TKWA 2IJHA 1B6DA 2Z8RA 1ZANH 3O9WA 1KTCA 4JCWA 2DL2A 3DYMA 3TBTB 4ZD3H 2NX5A 5TE7L 5IF0A 1LUWA 2XVLA 2A4CA 2DQFB 4FL4B 4JK0D 4DO4A 2R2HB 4KJWC 2V8LA 1DCLA 3BFQG 1AIFA 3RWDB 4L48A 1U92A 2J1KA 4PVLA 5BJTB 3GKZA 4NJAH 3TESA 3SJBC 1YF2A 2I07A 4LLVA 4PJEF 4UOZA 2HJKB 4L05A 4K71B 5AAWC 3A6CL 5EOQH 1XAKA 2Z65C 5MERB 4HD5A 2QQLL 2XWCA 1NCJA 1Z5LB 3DXAD 4UDTA 3IJYA 5INCB 3SYCA 4OXSA 3MA7B 3EOTL 3CC4V 1YHQV 1SQ2N 2FB4L 4YJ2B 5D1QD 3NJNA 4ZT1A 3TVMA 4Q6IC 3RB7A 1OF0A 2P5PA 2L0DA 4PRNB 3AXLA 1ZS8B 4PN6A 3LTVA 4QRPD 3HE6D 4O58L 2E75C 5FO9A 4QRRB 3U6XS 4BFNA 4ELDA 3B09A 3CVHB 2KB1A 2CZNA 4X5QA 3BN3B 4BHUI 4EF3A 1J5IA 4ZO7A 1Z5VA 2EZPA 4XMZA 5J2TB 3BVVA 1F1AA 4U3CA 5J7CC 4AMKL 5GGSY 1WFMA 2B08A 1MWOA 3QI9A 1S77D 1FYTA 4X8XA 4E9RA 4NQCD 4XBGA 5K9JL 3N1PC 2X4PB 3JWNH 2K4WA 2XX1A 5IJVB 1BL8A 5FM5M 2DI7A 3KCYA 3HAEG 3D39A 2W9DL 4NQQA 1WD8A 3C5SB 3VQ1C 4KRPC 2APSA 4QPKA 2IOOA 4K7PL 5FYLL 5EFIA 2BJMH 1XH3A 1AD0A 5LMNB 1TZOA 4ES9A 4KI5C 4W6XB 2A5UA 4KDWA 3W3BA 5MEOA 5AYUL 4BZ2A 2I5YH 1WITA 3P0YH 2J6EL 3QORC 4N1EA 2V6HA 4JPQA 4YLBA 1THAA 1BM3L 2XKUA 3AK2A 3S3JA 4YHHB 1E4WL 4PJEB 4LEOA 3V0VA 3WSQH 2X70B 3KW8A 4MT8A 4FFYL 5EZIH 1KKDA 1UVQB 2PF6A 3O4LD 1SJXA 3RVTD 5H2FZ 1KB5L 4RAVA 3TCUA 4MAUH 2HKHL 2RQ8A 2UZIH 3UYOD 3OXSA 4TSCL 3QCTL 4X6BB 4JFFE 2HKOA 5LGTA 3WJJA 1EDYA 1RUMH 4M9OA 5CEXA 2ZWLT 4POZC 1RUKH 1FUNA 4L1LA 2XN9B 4NYLA 4OGYH 4CU7A 5EWIH 3GVMA 3OGCC 1NCOA 2FL4A 1BYOA 1KXVA 3TNMB 3FOMA 5CZVL 2QHRL 5D7SL 5D2NC 3L5WA 5T5NG 5C07B 2HKFL 4HYOA 4FXGC 4EIUA 1A2YA 5SV4A 1OQOA 4ICGA 2EH7H 4CVXA 3JD1A 2P24B 3D8MA 4LBEC 3VH8G 2E9IA 4DK3A 3CJJA 4NZRH 4IKKA 2WAHA 1S9VA 3KLDA 4AQEB 1F58H 3UPRB 3F5WA 1S5HB 3P1VA 4LSVH 1I7FA 1RFDH 4R4ND 3W9EB 1TUPA 2NY6D 4M43H 4P04A 1DQML 4TUKH 1YSOA 1REIA 1KC5L 1ORQB 2OXHB 5SV3A 2COQA 4NQED 5IESL 3DUHA 1DJGA 2O5YL 2R83A 3PWPD 4Z7UF 5BRPA 1HNZO 2D3JA 2HSIA 3QZLA 5I74C 3RJQB 3K7UA 5B39B 4F91B 3R0MA 5KYXB 3L6FA 1HOCB 2JJSC 4B3MB 1G9MH 1T5XA 3HG3A 5D7JD 2RJMA 1AKPA 2NXYC 4I4TB 5IGXL 3V9FA 4DV5B 4DAGH 3NIFE 4YO0B 1H2GA 3ABMC 3ZE1F 4PJAA 5F7BA 4NNXA 1L9RA 3W7XA 2YQ2A 1OJHA 4NN7C 3BSZL 2R1XB 1QSFD 5DHVB 4Y4KC 4WU7B 2ISDA 5FCUH 4GUQA 1JSYA 2FX9L 2UXBO 3QDMB 1NDMA 2BOCC 3OV6A 4IDJH 2CSPA 3NP4A 1P69B 3ESMA 3KYNA 5FDWB 4ZUTB 1SMDA 2AXWA 2ADFL 1TQBB 2QVKA 3CLWA 3I6LE 4HIEB 3WV0A 3KG2A 3B34A 4P99A 3GXDA 1KFAL 3L1FA 3QA3A 1IGMH 1KN4L 1EM1A 5BZXA 4GP8B 4P9MH 2ZXBA 3K8LA 1G7LB 3PHQA 1BLNA 3DTXA 2H8PA 4WFFD 3TIDA 1FJ1B 2NSXA 5AZ2L 5GRYA 1PZ5B 2FJSA 3HMXA 1JDAA 5KYWB 5D4QA 3WFDL 5C0FA 5JVDA 1FI8C 1I1RA 4D7BA 4JO2L 4O02A 3VM5A 1XMOB 2MIZA 4Z7UB 4PJXE 4F6RB 1MCEA 2RBLA 3ZYOA 2RHEA 1P5UB 1P4IL 3BN9C 4WI3A 4ZW8A 3VFGH 3U79A 3RZWA 4ZPVB 4FIPC 4FYSA 1JPTH 3SE9L 5SWZD 5EBLC 3QZWB 4AM0B 5L3GA 5HVFB 3GBNL 2FR4B 3BPNC 3CFBB 1GOHA 4PYGA 1FJGO 5F7KC 5B3NA 2R4SL 1MCKA 3IJEA 3ZE1B 2F58L 2Y23A 3U0TB 2RCVA 5IHZA 4L4TE 4Z6AT 5KUKA 1BVKB 5FW6A 3DX7B 1JZ7A 2XXGA 3C2AL 3M88A 2PYJA 4NAMA 3QWNA 1S7UA 3QIWC 1BOGA 4JKMA 5D1XA 4MNGA 1PDKB 4E2OA 5JHLH 1BQ5A 4B3TO 2G4EA 2YAHA 2HKAA 3GK8L 3KG5A 4P2RE 5FHAH 4AVHA 4U4IA 2BZ7A 2OQJB 4Y4HB 4ECNA 4QR7A 3LVEA 4UMSA 2AJYH 2AZ2A 2E46A 4LFAB 5E6IC 1HEZA 1AR5A 4MJ2A 2APVA 4UQCA 5C0AD 1LP9E 1DDHB 3D0VA 1R4XA 1UOWA 2IOIA 4WUUA 2RALA 3ASNC 1E4HA 3QNEA 3ZKMC 4BYHA 2AK1L 2CGRH 1NUGA 4HPOL 4JLRA 4DYLA 1IKNA 3U1SH 2Q76B 3L1OL 1ZT7B 4BFRA 1TTRA 3MNMA 3ZZ1A 2IAMD 1KPVB 2RDCA 1NGQL 3JWOH 3TJPA 1N8OE 1UADC 2ZUWA 3A4DA 2WTRA 1O0VA 1XBLA 2Q2EB 4TVPE 5IROD 1YNKL 3LQZA 1HNXB 2XJLA 4MNQB 3BQUD 4CVZA 1N19A 3CSTA 4OQTA 1SQQH 4DUYB 4OY9A 3II3A 3BA9A 3E3QC 3N9GH 1SRDA 4MAYB 4NP4H 2C9AA 4A6YB 4AQAB 3RFZB 2V5YA 4QTHA 3MNDA 3VE0B 2AW2A 3CVBA 5T3XL 4O2BB 1D6VH 4C4KO 1B3IA 1D5XA 2FUTA 4F15B 1HZHL 4HCRA 4HULB 5MEPB 4ZQKB 3U46B 1TEYA 5FO7B 1A6WH 2CUHA 4JV5B 1BZQK 4HJUA 1RV6X 2B1AL 5L4FA 2LJ2A 3NJLA 3EHBD 1RVFH 2YGQA 3LQAL 2NSQA 4G6MH 5IREA 3EJJX 3VFPB 2VLKA 3C9NA 2AXHA 4LLUA 4Q89A 2QSAA 4H26B 3IXAA 4RA3A 4ELMF 2YD2A 4Q4IA 2X6BA 2BHFA 1CEZA 5EC1A 4R2GD 3TO2A 5JCOA 2EDQA 2DQ3A 5BR8B 1T89C 5DHEA 4PU2A 3FN3A 1VESA 3DARA 4FQIH 4XOEA 4WAFA 2GSGA 1I1AD 2IANE 3SKOA 1JHLL 2XPGB 4NXNO 1R3KB 3BYTA 1TJGH 1SA0B 2VERN 4NQDD 5T1DL 3GC3A 2R29H 1WICA 3DOSB 3N85L 1OCRC 4GAFB 2VUYA 1CFNA 1O9GA 4FAAB 2AJZA 3E7JA 2QVMA 3KPSB 4UT9L 5ESQA 4GW5A 4OCXL 5BVJB 1IAMA 3UJJL 3VG0L 4G1MB 2JCCA 1DGSA 4HC1H 4PLJD 1E6JH 1Q94A 4I2XA 1OSZB 1IFHL 2W1NA 4QTFA 3O6KH 4XH2A 4JPIB 5DYOB 1DUYA 3JD3A 4HHWA 3CC5B 1OCWH 3WS6C 3UO1L 4DR2O 1QFPA 4A55A 2HFEA 3DJTA 3VQ2C 3FCSA 3HKDA 3BHBB 3HBPA 2WNWA 3QDJD 1CF8L 4Y19B 1OAKH 3ZOAA 5LBQA 4DKFH 4R96A 2ID5A 2I25N 4DV1B 3ZZSA 5I17A 1H8EG 2NY4D 4TVSa 4G9FA 4ENZA 3E86A 3O9WD 1FV1B 1TJIL 2PI4A 4HDIA 3FC8A 4PA4A 3OKMA 3FCUB 1KGCE 3O3AB 4M7KH 4N24A 4QNPE 4ODWA 4CU8A 4ELMB 4M6ML 2ZCKL 4QRPE 4OCYH 3I6SA 3MUJA 4X1YA 4N3UA 4OGXH 2GIYA 3ZHUA 5JA9A 5DD0H 1MCWW 4XHQA 4L8CB 4MTXA 3NH7H 4YSAA 3V95A 1NKOA 1K5QA 1JFQH 4P5TC 5CLYA 1VMGA 1ZHLB 3G80A 4KMLB 2LVCA 2WO4A 5AB2A 4WCEV 3E6HB 1M2VA 1OPGH 3AEIA 1HXYB 1AKJA 2OMZA 1Y4MA 3H7LA 2E27H 3PP4H 1OGTB 3RZCC 1QQDB 3TVMD 3ZX1A 4IOFD 3FQNB 3NYKA 5IVNA 4UVCA 1MY5A 2D31B 2EX3A 3IETB 3VI4F 4JO3H 4OIBA 3O6LL 3FOLA 5AB9A 1C5DA 1PZBA 4LLAA 1CPYA 1JBJA 2VDPH 1E67A 2VAAB 2JKRM 1BOYA 1JTOA 4X7TA 4Z3TA 3VXPB 3QI9D 4S0SD 2WVUA 1FYTD 5E94A 5IB3B 2G2RB 4G43B 3CCQV 3RVZA 5EU6A 3EBHA 3MXVL 1IGCL 1VHPA 4ZW7A 3T0AA 3E8HA 3UJTL 1NCHA 2ZNWA 1BQUA 5C3TA 3UP6A 3D39D 1RY7B 3PREA 2AEIT 1BJ8A 4ZUSB 4AEIH 1CI3M 3DGCR 4N68A 2VN3A 2R56L 3SCMA 3LQAC 3HMWH 3TEUA 2H32H 3BEVA 3OTOB 3AB0B 1DZBA 1K85A 2VQ1A 1M7DA 1OTSC 4WKZA 3LUTB 5C0RL 3SPVB 5MENB 4D9LL 1ZAGA 4P2QE 4BAYA 3NGBC 4OZHA 1SQBH 4MSWC 1OLZA 1UWGL 2VQ4A 3G04A 3V8CA 3FQRB 1DBAH 3POCA 5EBWB 4BSVA 5JHAA 2JK5C 4LH6A 1RU9H 2DIAA 2HJFB 2WLYA 1VA9A 4NJ9H 4OCRL 3VI3E 4BZ1L 4LF7O 4DO6A 2DLFH 2F18A 5L0QC 3FZUC 3IPFA 1F3DH 2AZ0A 3HC3H 3ULUE 3ZMEA 4KK8D 3GSVA 3QUZA 4U3JB 5IOKA 3CVIL 1RXLA 1ZGLB 1Q86W 4WZ9A 4H25A 4UQIM 2JIZG 4FFWC 3VI4B 2EDBA 4MD5B 4FZ0A 2XXMB 4LEBA 1BF2A 3D4ZA 1U91A 3ZHFA 2WIMA 5E5MB 1PM9A 4N6RA 3QG7H 4AUUA 1E79G 1LILA 4D0DB 4ZUVA 1KF9B 3HRPA 1LEKA 3LEVH 4GXUM 1RHHA 2X1WL 5D6CB 1KXQE 1V55C 5EUOF 1HAWA 2YOAA 4OLWL 1K9MW 4K8XA 5GZOC 1ZLWK 2EABA 1G4YB 1Q72H 1YN7A 4L29A 1E7VA 3K74B 4P59L 3RU8H 5GONA 1I8IB 3NG5A 2GB2A 3ETGA 1JV2A 2H0EA 1FVCA 2DL9A 4ZMXA 3IK2A 2WSPA 4KO6A 4P4KA 3ZHSA 2YKLL 3SDDB 3LSOA 1UD5A 2WZ6A 3G7TA 1ZDQA 4QHKJ 5GRZA 3C3TA 1CXEA 1IARB 4I88A 4RUFA 4OQ1A 1BVNP 2EVHA 2CPUA 1ED3A 5TJWK 2IJJA 3AQXA 5F2FA 5J12C 2EYSA 1B88A 4NWTH 5I1JH 5FB8A 4LF4O 3W37A 4TQ8A 3B5GA 4HJ0C 4NM8L 4F1SA 4B9ZA 4DVBA 3WNNA 1OWRM 4WFFE 2R8SH 4CKQA 4H5SA 1BD2B 4M48H 2AJUH 3CPUA 1K5NB 3IDYB 4DV7B 3VRLF 2J8UF 5G5DB 4LNRA 4NRZB 4JAVA 5C09A 4JFYA 1YEGH 1FFOA 1WFTA 4J3OG 4JZGA 2C9SA 4YHKH 4AV4A 1OOAA 1SVBA 3L3OA 4OJCA 3T2MA 1MCHA 1OAXL 5CP7B 3PP3K 2VW6A 5FNVB 1MIEH 4G6KH 4XXCA 1N32B 1ZOXA 3CCRV 4HLJA 3GS7A 1X5HA 4M5ZL 1L0XA 5T3ZL 1QO3B 3VWJC 3MRJA 4G7RB 4EB6B 3BKML 4L9DA 5PAZA 3RWGB 3X11B 3QQ3A 3JD2A 4XNZB 1VF6C 5EUOB 4LMQE 1ACZA 4LRIC 4G8FA 2Z7UA 4JDVA 3WGUB 4MW8A 4LLDB 3D30A 5KSAC 1EXGA 1JFFA 1E3ZA 1FL5A 1SN0A 4DN3L 4OR1A 5ERWB 1MHEB 3ROOB 5IFJA 3ABLB 4U6TA 2OCCB 1SHXA 2Z6FA 4AG4L 5E2VH 3HZKB 4KI1A 1AO7D 2OTLV 1MNUH 3NTCH 2HT2D 1EEYB 2OP4L 3KGSA 1MRDH 2W0FA 1XEQA 4CA4A 3H9VA 4O51B 4GSRA 1OO2A 4PGJA 1UZ6E 3F12B 1XMQO 2X4NB 2P5EB 3WDJA 3AU0A 2IM9A 3D5OF 2D2CB 3O81A 2OBGA 4RMRA 5FECB 1KEGL 1DF5A 1BGXL 2ESVE 3H4HA 3VRJB 2OMNA 3DX3A 1MY7A 4NC0B 4UB0L 5KVFL 2ZE0A 4BFIA 4DJMA 4R26H 3CWBH 3RI5F 4FLXA 1Y0LA 3DUSA 4PW3A 2ZX8A 5CILH 1OTTC 4LQ1A 3L7EA 5KZCB 4XTRC 1A65A 4RESB 1KXTB 3PHAA 4U3SA 2J8UB 4R50A 4I0KA 5D1XD 5IG7A 2F54B 3HS0C 4OKVA 4XNQB 4F33B 2ZUUA 1CG9B 1S46A 4M61B 4RRPG 4Q6KA 1WLHA 4IBUA 5E9DA 2BNUA 4QAMB 1NKRA 1S78D 3KLAA 1JNLH 3QNXB 4KXBA 5EU5B 2GIMA 2XWJA 1K72A 3RNQA 2XDHA 1NTDA 4HJIA 3T77A 5HHQB 5LMUB 3L17A 4MD0B 5DCCA 5IOPA 1SGKA 4X5XB 1ECZA 2XLLA 3CFCH 4KHTH 1USZA 5EBMA 5SX4I 1SETA 4N0FB 1IGYA 3FAWA 4NO2A 4WUUD 3LKQB 2KERA 3BVWA 4JO5A 5TDPB 3MLZH 4HS6A 2V5RA 2RFXB 1V7ML 1P0SE 4TSBL 4XAWH 2Z1KA 3RWIA 1X7TA 2JEXA 5I1HH 3FB5C 1G5AA 4X66B 4GKJB 4MVSA 5L2KB 5JHMA 1KBBA 1MJ8H 5J9PC 3TPUB 1ZRUA 1SUJA 1KJMB 1PQZB 2HAZA 2YOCA 4XMUA 2KI6A 2W95A 3ZXAC 4E9VA 3ECBB 2EXWD 5ESVA 2Z4TA 4FXKA 4QRUB 4GS7B 5E2TH 4NQDE 2OJ1A 1VFAA 4F7PA 3ZO9A 2R69A 7PAZA 5DN6G 3MODL 2BMKB 4RFEA 4TUJB 5DQJA 2J88L 3G6JA 3OGOE 2ORBL 1BLIA 2GBTA 2IWKA 4M7LT 1R3JB 4WGKA 4J7ZA 2VLKD 4CS2A 4XPFH 2ZCHL 4UV8A 1VZIA 4XBEH 3QISA 1CPUA 2OIEA 4J3WA 1IC5H 5DHDA 4E5XA 1N4CA 2RGSA 4UNTA 3FCBA 5LCVH 1QFUH 4XPHH 3WL9B 4JKNA 4IEFB 4Z76B 1XNRB 2UYLB 4JFVA 3DVIA 2DF3A 5HYQB 2Z35B 5GGVH 2YD8A 43CAA 3DMMC 1XF2B 5KN5B 2CNYA 3WIIL 4OD3L 1MRCL 2OR9H 2V0AA 3P4MA 3FB6B 4CH5A 5IQ9B 3K6OA 4LOVA 4PG2A 1JYNA 4GRMA 5EEYA 4FQQA 4JI6B 3AY4A 3CHPA 5FFOA 3HC0B 3MNWB 4LSDA 5EN2A 3GBLA 1NOAA 1XXDC 1SQXH 3BJ91 1O6SB 1TO4A 4FERA 5TE7H 2WLHA 3BGMB 4OZGE 5IBUG 2PCPB 4OB5L 4N23A 4JI3O 1H3PL 2F61A 2VZSA 3R8QA 1J5OL 5AW6B 3KPQB 4OTXH 2B15A 2J55A 2TSAA 4MJ6A 3SHSA 4X6DE 2GT9A 1GYUA 4WU5B 1E2WA 3QZPA 1ZKAA 3H9HB 3DWTA 2YAQA 4YEEA 5DJ8B 3O2DL 1BECA 3A6CH 1QRNA 1VACB 4L8SB 4MGXA 2AMUA 4N5ED 2QQLH 1YYCA 4PLOB 1EO5A 3SKJL 1HDMA 4HXBL 3SYQA 3EOTH 4R7XA 4KK5C 3VRIB 2FB4H 4FRWA 4YPJA 5LP6C 1IAIL 4GKKO 1Y1UA 2DAVA 2ZINA 4MB4A 5E08L 3UYPA 4O58H 5C0BB 4BA8A 3SYAA 1MMMA 5FA3A 4C4KT 1ZLWH 3MOAL 2QVFB 4AMKH 1JK8B 1F97A 4HWUA 4IJTA 1XF3B 1UB5B 2VE6B 3K8MA 2VDNB 4ZO6A 1FF5A 5AKSA 5K9JH 3SE4A 3PL6A 4PY8I 2XQYG 5E99L 4QOKA 2XN2A 1MI5A 3MJGX 3L08A 2W9DH 4NPYA 2MKWA 2IFFH 5GQBA 3B5TA 5I2IB 1MCFA 3S37L 1NBQA 3HLAB 4MTFA 4S2SB 5FYLH 2XAFA 2H26B 4LASH 5CP3A 1Z2KA 2IALB 5JIIA 3UEQA 3OJDA 2F53A 1P4BL 1HI6B 4QJ4B 5AYUH 1T1YB 1HCYA 5H94B 3HZYA 1HHIB 2ICEC 2P28B 4UZSA 4DP4X 3RVYA 2JIXA 2J6EH 3WAKA 2BM3A 1AGBB 1M2OA 1U3HA 3BAYA 1ZHBB 3RWEB 4AUJA 4WWKC 4YC2C 1CU4L 1CL7I 4YSCA 1BM3H 2AJSL 1DJZA 1E4WH 2DJSA 3N2GB 5LLIC 5HHPB 4YDMA 3QZNA 2ICWJ 4FFYH 1OCCC 2RACA 2D9QB 1J9CT 3FRPB 2IV9A 1NDGB 4WFEE 4BE5A 2HKHH 4M62L 4TSCH 1I1FA 3QCTH 3PP3H 3D85B 1XCQA 3DV6B 3FU7B 1AGCA 1GM7A 3SCMD 5DVOA 2QKIB 1ES0A 2Y69C 1A14L 3N5AA 2UXDO 4GIAA 2YXMA 1TZAA 5FOJA 5E1AB 2X3CA 5LGKA 5CZVH 2QHRH 2PPEA 2HKFH 1A0QL 2NYKA 4Q0XL 3VSUA 1YEEL 1AZUA 3EJUA 2PNDA 4ZSOB 2M6YA 5KHIA 1J8RA 2BNQB 1EBOA 4DGWC 4E9LA 2UZPA 1R1CA 1DQMH 1B4LA 4LWSA 2D7TL 1A7NL 1KC5H 3REVA 3HZVA 1MW3A 4GG8B 5AOIA 5IESH 2NY0C 5F7MC 2O5YH 3WIAA 4NKQB 3LYRA 4MQXC 3C12A 1BMFG 5A9GA 1XVSA 3FB7B 2EKJA 2WKOA 1FC1A 4QYOA 3GIZL 3HPJB 1SEQL 1SM3L 3WN5B 5IGXH 3ABKB 3B9KA 5CJOL 1TUBB 3RUGE 5KA5A 2UUBO 4NRXB 3JAKA 4HWBA 4FF9A 1WZKA 3C6LB 1T4KB 3BSZH 2C34A 3MJ9A 4KTEL 4A2MA 4HOZA 4JN1L 2MNJB 2OZ4L 3TA4D 1QTSA 3O2VL 4PTTB 4R84A 4X62O 2Z7WA 4P4KD 4KJQC 4X99A 3UO3A 5IMOA 3F3HA 4AENB 5B7MA 1NPNA 4CH4A 3LKSA 3RYHB 2HVBA 1M71A 4K8RL 5C6TL 3VFUB 3WO4C 1BS3A