5KUKA

Crystal structure of inward rectifier kir2.2 k62w mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 97
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kukA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kukA01
3TCUA 3E89A 2ZD9A 4PDRA 4QE7A 3K6NA 2BOCC 4R50A 3ATEA 1ORQC 3LUTB 4EKWA 2ITCC 4X89A 1J95A 5EC2C 2HVKC 3OR6C 4F4LA 4JTCB 4PDLA 5CBGA 3SPCA 1N9PA 2HG5C 3ASNC 1KKDA 2BOBC 2ATKC 2HVJC 1OCOC 4WFEA 4MVZA 2R9RB 4QE9A 4HZ3A 2Y69C 1LNQA 2QKSA 2HJFC 2A9HA 4MVSA 4GX1A 3IFXA 5KUKA 1OCZC 2EILC 4XDLA 3ATFA 4GX5A 4LP8A 4MVOA 4MSWC 1OCRC 3ASOC 4MTFA 3SYQA 5B1AC 3AGWA 1QLEC 3T1CA 2ITDC 3OGCC 3AUWB 2WLIA 3T4ZA 3SJQC 5EBLC 1ZWIC 2WLIB 5B3SC 3ZJZA 2QTOA 3E83A 3BEHA 2H8PC 3GB7C 4HYOA 1M57C 3STZC 3SYPA 2WLMA 3E8GA 3F5WC 4G28B 2WLHA 1R3KC 3ABLC 2Q68A 5B1BC 5E1AC 3RBZA 4GX0A 3AT8A 3JYCA 3EFFK 3SPIA 2EINC 4J9YB 1R3JC 3FB5C 4P2ZA 3LDEA 4GX2A 2Q69A 4PDMA 2JK5C 2GIXA 4MW8A 4WFGA 2E4FA 3F7VC 4P9PA 3IGAC 2Q6AA 1U4FA 3UKMA 4P30A 2P7TC 4MVMA 4WFFA 2IH3C 4MTGA 3VOUA 3VSQA 4H33A 4R6ZA 4PA4A 3KG2A 2DWDC 3HPLC 4R8CA 1K4DC 3OUSA 4KFMA 1R3IC 4LCUC 4ZBMA 3AG4C 3SYAA 2X6BA 4LBEC 2WLLA 4RUEA 4CBCA 3FB8C 3LDDA 2A0LA 2WLLB 3AG3C 1S5HC 3K0GA 4JTDB 4MS2A 5EBMC 4PDVA 4RUFA 4DXWA 2ZXWC 3E8HA 1XL4A 3K06A 1G4YB 2OCCC 5EK0A 3RW0A 2HFEC 2WLNA 4QNHB 4BW5A 2EIJC 3SYCA 3ATBA 3AG1C 2IH1C 2NLJC 5IY5C 1P7BA 3OUFA 3E86A 4UUJC 3K0DA 3K08A 2WLJA 3FB6C 4PA7A 5EC1C 3RVZA 1M56C 4P9OA 3SPGA 1JVMA 3LNMB 4WFHA 2KB1A 1V55C 1BL8A 4RO2A 3TETA 5CBFA 4MW3A 3AG2C 2DYRC 2X6AA 1R3LC 5CBHA 2EIKC 4I9WA 2DWEC 3K03A 3E8BA 4PA9A 4TWKA 3WG7C 3STLC 4XDJA 2A79B 3K04A 3AT9A 2EIMC 1V54C 4JTAB 5J9PC 2DYSC 2W0FC 4X88A 3OR7C 4H37A 3ABMC 1OCCC 3R65A 3T2MA 3ZRSA 4PA3A 2YEVA 4MVRA 4MVUA 3T4DA 3UM7A 1U4EA 3PJSK 4OXSA 5KUMA 3X2QC 4J9ZB 1K4CC 5EBWC 4XDKA 3SPHA 2K1EA 3LDCA 4MTOA 4G27B 3RVYA 4MVQA 3ATAA 2AHZA 3E8FA 3FB7C 4X8AA 3SPJA 2WLKA 3ATDA 3ABKC 3SYOA 4R7CA 2Q67A 5BZBA 2AHYA 4PA6A 4RAIA 3F7YC 2X6CA 1XL6A
chains in the Genus database with same CATH superfamily
1CLCA 5F7NC 4KVNL 3QDGE 4QRQB 2ZSVA 4YHLH 4Q4EA 3INOA 3O3EB 3N41B 4LGSB 4GP4B 4DAGH 5MP6L 3NCXA 5GS1A 1RPUA 3SB3A 1KIRB 3BQUA 4OZIF 3SDDA 4PDLA 3WFHA 2QM8A 3A0OA 4G1MA 1RZPA 1WUZA 2P4VA 2QHRH 2R70A 2YMXH 4RMQA 2ATKC 1PZDA 2IAMD 3ARGD 3EYFA 1N0LA 3KNBB 4MJ2A 4NRXB 3BFOA 2V7NB 3STLA 4JAMA 3CN3A 4DERA 5J06A 3CMEV 3RY6A 1EXGA 3V5KA 5KBMA 2H32H 1E3XA 5ANMB 2VC2L 5E8PB 4BZ1L 2NTFB 4HNAA 1ZKAA 3AGWA 1QLEC 3CVHB 2JXMA 1RVFL 3T6WA 2F1MA 2V17H 1KOAA 2ADGB 3LKQB 1XWVA 1DUYB 4HW6A 2YS8A 3T0EE 4C59B 3STZC 5KTEH 2B1GA 2DI8A 1RXLA 2J25A 5F9JB 4WCEV 4RZCB 2YIAA 1TYRA 4DV6O 1JNHA 3QUKB 3B2MA 1BMFG 4EDWH 1IVTA 2NQCA 3HNSL 2UX7A 3ETGA 4PD4F 3MRRA 5FYJL 2FYYA 4XCEA 4JRYD 1KP2A 4O2FA 1DFBL 5LA6A 5I71C 4Y89A 4JY6A 1N7MH 2W60B 1RSFA 2SEBB 4MHHI 1A7OH 1DO6A 2F4VO 1FNHA 1KJ2H 1NCDL 1NOLA 2XA3A 2Y7MA 4FYRA 3S5LB 2ZE5A 2R59A 3A4FA 3I6KB 4HWUA 4IGBC 1D9KA 2EAEA 5BMFL 5JHDB 2OK0H 3S35H 3NJXA 1O7SA 1YMME 3T4AB 4B08A 4BZYA 5DRWB 1KJMA 1UM6H 5FYKD 1BGYH 4HMCA 2W9EL 1U96A 4RNRA 5EK0A 3D9AL 3BRCA 3O8XB 2KPWA 4CC5A 4LSVH 1NCIA 3JD3A 1WFUA 1GK9A 4IHOB 4XBPA 1UPGA 4HIXL 4NNYA 4HOMA 2UVFA 2JH2A 3FK3A 3OTTA 4AX3A 5BOJA 1JXFA 2AJXL 2VDOB 4A55A 2UUAO 5B3SB 1J0ZA 2DWYA 4LNUB 3NFNB 3IBEA 4JI8O 1SXSA 4IIZA 2MCAA 3RZCA 1BL8A 4QD2E 1TIUA 3NTCH 4ZFFA 4LLMA 4CVZB 4JG1H 5ESQA 3MODH 5CSGA 4AKPA 4L4TD 3R18A 1ND0B 4OY9A 4H44B 1OGPA 1P7KA 1XTLA 2IBZX 5HGAA 4BDVB 3D25B 3CPUA 1I8KB 3QW9A 4POZD 1FYTD 2VDLH 4P0DA 5EB9A 3TJTA 4LOFA 3R65A 3T2MA 2VZVA 4X4MA 2XKSA 4AJYV 4JDVB 3UJTH 2QADB 4X5QA 4Y9BA 2JB5L 4JJHA 2LTQC 4POUB 4OXSA 1Q0EA 4YNYB 1N26A 4TV3A 5HHVL 3DHJA 4KZCA 3T1HB 4AYSA 4DCQA 1NMBL 1GZQB 1SXNA 43CAA 2R27A 3PHOB 5F1IA 2ZOLA 4LVNB 4U7SA 3B2PA 5F96H 4XBFA 1G7JA 2OZ4L 2Y2YA 3CZNA 3LKNA 3BYYA 4LSPH 3OZLA 1F6AA 4B3EA 2WNWA 1FDLH 3CD4A 1XFPA 3B3IB 3CHOA 3IRZA 3U6RA 3GSVA 5DSCA 4U3CA 3IT8D 2CJUL 4O9HH 5E70A 4BFGA 5DVMA 1RJLA 3E8UL 2IALB 3EF4A 5JCOA 1OAXL 2D3VA 3T0VA 3GPEA 3PAZA 1HE7A 3ZQXA 4Q9CA 2V2XB 2QVKA 2B4CH 4IRSC 1YA5A 5DYOA 4HZ3A 1YECL 4NKIL 4KQ3H 1C5BH 3AXIA 4AK2A 2CDGB 1LE5A 1M4KA 4Y19A 4B97A 2WQXA 3MNMA 3L2MA 3L3JA 3FT3A 1ZDQA 3RGVD 3I02A 1RZ8A 4MAUL 5D7IE 1AKJB 1P84F 4GG6B 3DX7A 4QF1B 2YXWA 4G6AD 3WS3A 1I3VA 2Z8RA 3D50A 4Y1AE 1HNZO 3PJLA 2JCCA 3MHZA 4WEEA 1Q0XH 5I28A 4L3CB 1IE5A 5IUCA 1HEJC 4NXNO 2FWLB 3BAXA 3RI5K 3HNVH 3QQ3A 4OT1L 1ZHKB 3SDCB 3FB5C 4OIIH 2OMYA 2FYUH 2X0UA 5IJBC 4QTFA 3CIAA 4HPYL 5K59E 4JFEE 3WLBB 1AJ7L 4JI7O 4X4ZA 4HLJA 5E1QA 4DPCX 4OZFB 1NC2B 3N6YA 4O4JA 5D1ZI 1S7RA 3WOVA 1R3IC 3OC5A 3RWRD 3ARDA 1MCOH 3KPTA 4CVXB 4UFZA 1AD9B 1OM3L 4IKIA 4L1TA 3VB9A 5E08L 1ZGLP 3FOMA 4NENB 3JCZA 3WD5L 4F8PA 3GVMA 5JVDA 2L3BA 5IVXB 3IEAA 4ONGL 2X53A 1F4YL 3UTQA 3SKOA 1K34A 5FL7G 3IU3B 5GISL 5J1SC 4QY8B 1RZJL 1JGUL 1RUAL 1H5BC 5JQGB 4NZRL 3UYPB 2J1WA 3MV11 3U4EA 3SPGA 1AHKA 1OJHA 1IV8A 3VFTB 3LNMB 4KJPC 4LHUD 2LFEA 2KZKA 5K9QI 4CW1A 3DV4B 3KPLB 1ETZA 3KZIZ 1IGIH 4P4KB 3HR5B 5EZPA 4IBZA 3IGFA 1BQHA 2NLJB 1KNOA 1JMZA 3JV0A 3B5TA 4XVUD 3FSZA 1XXFC 4ZO7A 4K0KO 5FEBA 4NN7C 4YDKH 5F89A 3QQ4A 2AXHA 3BPOB 1MNNA 2Q0OC 4LIQL 2HUHA 1CDCA 1V55B 2A74C 1EJ8A 1ZLSH 3WY3A 3IAGC 2P24B 1OB0A 1RUQL 2NY6C 1BJMA 1JFQL 4IEFB 3SE9L 1X59A 2BSTA 1Q9KA 3REWB 1PFOA 1MIEL 2K6YA 4PR5B 3FO2A 2LLGA 4MNQD 5D7JA 2RB8A 5DI8A 5DHMC 1Z9NA 2R23B 2J88H 1RUMH 4NJAL 4WFAV 3SJVE 2NY4D 3GINA 2ADIA 2R56H 4FA6A 3VFOA 3VVVA 3BESR 2J43A 4NVPA 3QUMH 3QEGH 4FNUA 3WNNA 3ETDA 4P05A 1F42A 5MEOA 4WAFA 2DE0X 3ZMUA 1R73A 1KJVB 1SA0B 1VEOA 2F53D 2HN7B 2Z7UA 3MRLB 3MRPA 2FIRT 4PWEA 2OMNA 5FYKU 4HLZG 2COQA 3OR6C 4PBDA 3UOAB 3UBGA 2CE6A 2JRIA 1FV1B 4TSCL 2EYSB 1RZFH 1FIGH 3QI9D 4N2EA 4OD3H 5DZJA 5I1IH 4FJYA 1FLRH 4JHZA 2NRDA 4ODTL 1D7BA 5C08B 4JL1A 4B53A 2MPAL 2YUXA 2J5LC 3FT9A 5HPOA 4PGBA 5AKVA 2VLJA 1W8EA 2W0KA 3GMMA 4F2MB 2MJWA 2Q2LA 3HI5H 4HSQA 4C56E 2XWBA 2W88A 1KCVH 2FRGP 3CX5K 4LDLB 4M00A 3FUHA 4G6FB 4P5MA 4LF4B 3BWZA 2B59B 2Z8SA 2XWRA 1VQ5V 1KFGA 2EYRA 2KPNA 3MBEB 1NEPA 1KBWA 1QSEE 3ZTJG 4AGMA 3F7YA 1G7MB 4MDJA 2WBJC 3HE7B 2PCPA 2AXGB 4MNHA 4P9PA 3IPEA 3IGAC 3GC3A 3B43A 4HKZA 3QIWD 4TL5A 5F71A 3RWGB 4P23C 1WWAX 3VSQA 5EIQA 4AIZB 1NCCH 2YC0A 3EYSH 1DBKH 3UAJA 1YNTF 2VLME 1KKCA 4NO0A 3QTCA 4YSUA 5KSAD 2BVPA 1V10A 4N2FA 1YEKL 1N4XH 1T0OA 3QDMA 1BX2B 4YXKH 4J23A 3B34A 1HYSC 1MZEA 3E2HB 5IW1B 4MYPA 1KIUA 2P90A 4Q2ZB 1VQKV 4C4KT 3LJ3A 4I0XA 1NFDF 1KEML 2OSLA 3ATBA 3JWOL 5SWSB 3SKMA 4HFUH 1NTMH 4KXDA 3VYOA 4ADGA 1CURA 3FQTA 4LVHC 1JPXA 1JTPA 1UUSA 2XQYA 4XNMA 4ZAKD 3ZKXC 4PA7A 5I5JA 4E9QA 3LKRB 5LVEA 2GUZA 1HILB 4DP1X 3N0AA 3PWVA 2Q8AL 4AEHL 5D8JH 4PB0L 2YFNA 3K9SA 1LGVA 1JJOA 3BXNB 4GMSH 4B9GA 4GSQA 2EKSB 4Z78A 3CX2A 2NNRA 3OAUH 1JNJA 2Z7ZA 3K04A 3MXVH 3MGAA 2ICWB 1AP6A 1S46A 4PYHA 1U8MB 2JI2A 5FLVA 5ABAA 4KUCF 2FSEB 1E5UI 1R4XA 4X64O 4OI8A 4NBYB 1KYOJ 5JW3H 3N04A 1K4DA 1AP2B 3GEWB 3OMIB 1PLGH 1AD0A 5ES4B 4HUMB 1EZVY 1UB6B 1I3RB 1Z9MA 5H2BA 4YR6A 4R84A 2AVGA 3CFIC 3IWUA 2R2BB 2DDQL 2D03H 3LQMA 3QUZD 4Y4FD 4WHTB 3OKOB 3MJ9A 4DO2A 3BH8A 3FKUS 4P2QE 1E3FA 1BSMA 3SQOL 3DURA 4GAFB 3BT2L 4ASUG 3HG1D 3D2UD 3HUJF 4GS7C 3O9WB 3NABH 3KG5A 3BP7A 4WW1A 1JZ7A 4PJBB 3T4AC 5JPNC 1W80A 1AZZC 2XJLA 4UNIA 3SJBC 4F7CB 1WD8A 1AI6A 3FONB 5AB1A 3HFFA 4O5LL 2ZT9B 4NNPH 1JZGA 5DJAA 5EU3A 4TULL 3WN5C 5IMLB 1FZJB 1TR7A 2WUBH 2Y6SD 2MFNA 4DIXA 4NB7A 5I2IA 4NKDB 3MDSA 1GXEA 2HG5A 3OEEG 2BX5A 3KPRA 5B3SC 4F3FA 1EFQA 3DRQB 4NRYA 5ALCH 3GZOA 4JRXD 3RL1B 2IQAA 4UV4H 5I5MA 3O3AA 2C4XA 5K1NA 1ZSDB 4M3KB 1WLHA 2M6YA 2NY1C 3H2WA 4KGLA 5DJCB 3RYFB 1YNLH 4I87A 4G8FB 2YN5A 5F3BB 4KMLB 5T1KD 3FT4B 2C9UA 1SOSA 3C8KB 4X6FA 4OQ1A 4ORGB 2Y1AA 4RQQB 2VUOA 3OM3B 1ZT4A 2PWHA 4GFTB 4I48A 5FUOH 1DLFH 1PKQE 1A3ZA 2O5NA 1GM8A 2NSQA 5KZCB 1U91B 3GYRA 4EI5C 3L3OB 4KK6D 5I30H 1N0XH 1WAAA 5GONA 3GHBL 5E6YA 4J4PC 1R3JA 2O1AA 4R5TA 1X5LA 3ZE1E 1JERA 4XGZA 4J3OH 2KMWA 3HKEA 4JUTA 2GHYA 3PLYA 3LNNA 2HWZL 5DJYA 4YY3B 5CJQL 5DECA 4ABVA 1NEZA 4X20A 1B4JL 3H01A 4PRIB 3KPSD 3LN4A 5JQHC 3FO1B 3L95A 2XDHA 3NGBB 1INQA 1P53A 3OUFA 1JWUB 1W2KT 2ITDA 5JOPE 4Q9RH 1R6VA 4KHPO 1RURL 2AERT 3GSWA 4G6KL 3RVZA 43C9B 3MRJB 2NT0A 4NR1A 4HGWB 3QPQC 1G6RB 3MV01 2HFEB 1S9WB 2NUPA 4LHJB 3ARFC 1A5FL 3QDAA 1CD1A 3BE1H 5EZYB 4KZEL 3QNXA 3L4UA 3VGDA 1UOLA 5C9JA 5FB8B 1VACB 1FPTL 1HN1A 3K2KA 4Z7WA 5KAQG 4EUPA 1M42A 1KG0A 5JPMC 1P1VA 3L9RA 4KV5E 2H47C 3GO1L 1E9QB 3L7FA 4UQ3B 2BJMH 3BP6A 3DWTA 5HDBB 4I89A 4EZKA 5BZZA 1QHTA 1CZ8H 1H0DB 4TSBL 4B5ZA 5CINL 1O6SB 1ZSPA 2R0WL 2X44D 3GXDA 3LRGA 4JN1L 1WZKA 3DV6A 4KKCD 5J0BA 1BYPA 1JVOA 4PA6A 3NCJL 2YGNA 2UZPA 3G71V 3X2QB 3KPOB 1N59A 4W4OC 4XP6H 3TWYA 2QQLL 4S2SA 1GJWA 4GYBA 3PWJA 1WTGT 2NDGA 3C5ZC 3VQYA 3JD0A 3IKKA 3O2VH 3FULA 4KHTL 5H6QA 1PNKA 5D1XD 5E1GA 3DTDA 1TXKA 3SE4A 4QO1B 3UTTD 1GS8A 4NQED 4PJFE 3D09A 1MSPA 1JZ5A 1MQKH 3O2DH 3RIFK 4FFZA 4U3HA 2XAFA 3T0WA 5I1DA 3IETB 4P5KA 1WZLA 5AEAA 1P4IH 3KR3L 2VZOA 4J3OD 3WUWB 1PVHA 1VFBA 3EH2A 4YO0B 4YHPA 4QHNB 5EC2A 2DZEA 1PM9A 1BXXA 4JRYB 4ODVL 3L45A 3N85L 2YJQA 4L4VA 1QOKA 5KMGB 1DDHB 3MQIA 3DX4A 5BR8B 3V6ZA 1WRFA 1YMHB 5L2KB 5JW4R 4MYWB 2H8PC 2WB7A 1NS1A 4H13B 2UZYB 4HWZB 3BP4A 1JXKA 4GIOA 4HWEH 4LAQL 2UU9B 2EDLA 1MVYA 3II2A 3PWNB 4LRIA 5CEXA 2CGYA 1SJHB 2OL3H 4I55B 4U7NA 3CFUA 3CXHK 3U0WH 4H88H 1ZTXE 4PJDF 1EQWA 3CH8A 3CMOL 4DV4O 4ABMA 2KQMA 2P5WD 3V9EA 4BWUA 3VOUA 4AQYO 1W16A 3KZ8A 5F7EH 1KELL 1NU1H 1EHNA 4Z1VA 4M7ZB 2OTPA 4XO5A 4FZ1A 1LNUB 1WBXA 5LQBH 1SQPH 1YYLL 5I5IA 4EN2A 1VMGA 3ZDYE 2XTJE 1TLMA 4CBZA 5CFAA 5CBHA 5FUCC 2C9VA 5FECA 5F7WC 1UZ6E 4OJYA 4WUUE 4V11A 1F18A 3CC4V 3OQ3B 3VA6A 3WL9A 5I0WA 4L4TB 4HOZA 1XGTA 1MUJB 5C0FA 1CLYL 4MGXA 3L1EA 4XBGA 4FFBB 2AEPH 1KN4H 4DGWC 1A7QH 1OSZA 2NR5A 1BD2E 1MVUB 3GNMH 5A1AA 5D5ME 4GKZB 3MLPA 2LGWA 3W5NA 3KYNB 1XHZA 1NBZB 3H1LH 2UXCB 2RACA 3Q9QA 2ZNWA 5SX4I 3UYOD 2L7UA 4MFHA 5FO8A 1UG9A 2DQIH 2H32B 4RRPG 4E0RB 4G3YH 5HD8D 2XV2A 4EN3D 5IT2L 4JZGA 3VMPA 3UT5B 4J3UA 2Z0AA 4FFKA 5EFIA 2EJRA 3SGEI 4F33A 3MAWA 4BQCA 3DK2A 4YXLL 1MWAL 2YAFA 3DGCR 2JKXA 2XWTA 4IKLA 1MJJA 1TVKA 1J8SA 5DQJB 5JHLA 5JIHA 3I2CL 3NZ8A 1XBRA 2Q0AA 2FR4B 1G4MA 4HETA 4IOIB 5D2LF 4CU7A 1ASQA 2E75B 2LQTA 4LF8O 4F27A 5GGRY 5LWYH 4IIJA 3O41B 3ABGA 4KK5C 4G27B 2VLRD 4BYHA 5GGTA 1IURA 4XC3H 5E6RB 3QO5A 1I1AC 2JTYA 3PUUA 1DJIA 1KJ2B 4RGMC 5E0QA 1EHAA 1KP3A 4N0RA 3MBEC 4P59L 1F1AA 4JGUA 4PJ5D 1MA1A 2GPZA 2Q87A 2ZX6A 3DXAE 2DQ0A 1P7QD 1W91A 1G9NC 3PL6B 4CADB 5IYCO 4NQUA 5GIRA 5FA3B 4V2BA 2K9PA 2DJMA 3RVUD 1KTRL 3VH8G 1HNXB 3RGVB 5KJRH 2E74C 1RPRA 2VLKB 3GLZA 5HDQH 2HVKC 3QZMA 4I18A 3VD9A 4A6YA 2EDXA 2XNAB 4LT7A 4NNXA 1P69B 4YSOA 5MEQA 2DYPB 4OCMC 4FQHA 2V6HA 4Z3HA 1WCQA 3S4SB 3TEWA 2AABL 3W9DA 4Z6AT 4IJTA 3CFDA 4OF8A 5C09B 4XXWC 1UD5A 3KDMA 5CSZB 5AOIA 4AC2A 3QWRA 1KQSU 1B9KA 1Q8IA 2VIRA 4PJCF 4M7LH 1NGXA 2PP7A 2ZG1A 4M1GL 3WBDA 1MLCA 3WNKA 2VKWA 2EILB 3H9HA 4UB0L 3T2PA 3FUMA 2HJLB 2Z65C 4XMLH 3D5OF 3MLWH 3WNIA 1K3EA 2D4FA 4X0KA 1UD3A 1N32B 8FABA 1T03H 3FTXA 1Z7JA 4HEME 5CCGE 3K6DA 4L3ED 5GTHZ 4DWHA 3B6SA 1URFA 1FAIH 4X6CF 4EI6A 3HHMA 1NFAA 2V9UA 1R3KA 1SHXA 3F5WB 3WKQA 2D7MA 5HYEA 1SN2A 3S7GA 3HZYB 1KSRA 4GNKB 3DIFB 1BJ1J 5E7FA 4B6ZA 3GJEA 3ZO9A 1QHOA 4DP2X 4PI0A 4YZWA 2AQSA 4LHUB 3F7VA 1SLWA 2EDHA 1CIDA 4Y4HC 3TWCH 1JYVA 3WDJA 4Z3FA 3PPSA 2C9AA 2ZUTA 3ARSA 4D9QE 1MJUL 5ENWB 1RHHA 2WN3A 2ROYA 5FKPA 2R51A 4QRUA 5LDUA 2GY7B 3OSVA 2QA4V 4KVPA 3JVGA 5IJ9A 4JR9L 4PRAB 4LCWE 4LPVA 4Q74A 1C1EH 2X2IA 1IDSA 3GXPA 5EG6C 4N5UA 4Z2WA 4TXVB 3ARWA 4O02B 5B7EA 5DD6B 4AYMC 4ODWB 5IG7A 4OLYL 1F6LL 4YDIH 1L0XA 1G6UA 2CHDA 3NIFF 4QRPD 4MNQB 3RGBA 1KCRL 1FP5A 1QLFA 2IOMA 3LSOA 4FQQA 3CFTA 1T5WB 5DJZB 1FO0B 3I55V 2ICEB 3EFFA 2ESVD 4JY4B 4P46D 2ZUXA 4YC2B 1NUGA 3G5YB 3II3A 3JWNE 3K8MA 3QJUB 3FRUB 3EXLA 1I31A 4GT0A 1ZS8A 3GSUB 2F53B 1CTNA 1XF2B 4FJCC 4I9WD 1S5HA 1LE9B 4JI6O 5DS8A 5KVDE 5B8CB 3N55A 4FP8H 3HZKB 1GKFA 3SGDH 2EXWC 3EH3B 4K94L 5CEYB 4QHKJ 4JRFA 3BPCB 3FO9A 1HL8A 3QI9B 2QPEB 5TF1L 3MOBH 4U1HA 1F4NA 3VWKC 3WNJA 2HJDA 2EIEA 4S1QL 3IS0X 3K6IA 1U42A 2J4WH 3I3BA 5GGRB 1JI1A 3CUPB 3NZUA 1H2MA 5C0GB 2BXZA 4UQIM 3QUYA 4Y2OB 2CBOA 2NW3A 3MGOB 2ZM6O 5J2UA 3WSQH 4I2XA 1X44A 4YEFA 4ZMVA 1T7XA 3SO3C 4OLEA 4PJXF 3B56A 4Y5VB 3KPPA 1N5AB 4N8CL 2Y72A 3AW5A 3O4LA 3PN1A 4M3JA 3ATFA 1GHFL 3ML8A 3NGBC 5J56B 3HFML 3WXWH 5LAXA 1TJIH 3CE2A 3ZYZA 4DVBB 5JHLL 4A2MA 12E8L 5E7BA 5D72L 4WO4C 2OX5A 1DTOA 1TOXA 2AEIT 3KGSA 4JFFA 4YUEL 5HDOA 3BQVA 3UTSA 3GUFA 2OP4L 1I9RL 1BJ1H 5BMVB 5GGTL 4EFBA 4K3JH 5KSAB 1S6NA 1OP3H 3ECVA 4V33A 1TSHA 1L0QA 1LEIB 3JV6A 4WI7A 1K6QH 4YXHL 2JKSA 3RWEB 5E4OA 1DJYA 1M2VA 1URLA 3OGCB 1FQ9C 1H6UA 5DD1L 3MNWB 4I3SH 4YHMH 1IFGA 2N56A 4KDTA 5GGVY 4GKJO 3MLSL 2TRHA 2Q9OA 3QULA 1M71B 1MCPL 1AJNA 4TRPL 2BNQD 2BY2A 5C07A 3U0TB 5HDLA 3VMOA 2G60H 3O9OA 1PDKA 1ZANL 25C8H 3LZPA 4QHPA 4ZYKB 4A6YL 3QUMB 4RWYL 5BXFA 1IAIL 4KXBA 1ZGLB 1RJYB 1MAMH 3A0BZ 4JYAB 2DH3A 2JKJA 3TS8A 1SLUA 2F74A 3VUAA 1GKOA 3RB7A 5AVUB 4KK9C 2DWDA 1NJIW 2Y7NA 4GLRI 1CDBA 1M3IA 2ZTBA 2H2PD 1M93A 1REIA 3Q2VA 5FWQA 3BKMH 4PJIB 3DVNA 4UILH 2CK0L 3AG4B 4E5XB 3FPXA 1DBML 2FLBT 2WLZA 3WIAA 3HS0A 2X0WA 1MHEB 4YK4C 1SJEB 1ZHNA 1JE6A 4TWKA 4LHQB 5CCHE 5CN0A 4LXFA 4LFBO 2WD0A 2ODMA 3QZWB 3QUZB 4LCYB 2KERA 3MUJA 1MNUL 4LMQI 4PHXA 5T33H 3HIZA 3NQIA 5GZOD 5HHNB 3Q44A 3U30B 4UNVA 2X4NA 2EUZA 3DX2A 2XCMC 5CCKL 4KHXL 3HG1B 5TDNA 1IQWL 4M4RA 3D2UB 3BGFB 2K1EA 1I3GL 1YUHB 4RA3A 4B0MM 5I1GH 3CN4A 4YHKH 1RMFH 1ZVYA 2X09A 3VGHA 4XP4L 3GIZH 4OD2B 4PJGA 3MV7B 3D4GA 5JDSB 4OVUA 1X4YA 3EGDB 1VQ6V 3HBPA 1Y66A 1U6AL 2ICWI 3TOPA 4EVNA 1MI5E 4PY8I 2ZKYA 2ETWA 5T1MB 3ZRFC 3INUL 1AXTL 4JKMA 1HQ4B 4WFED 2VNCA 5EC1A 2WYTA 3AG7A 1NGYB 5JA8B 4M7ZC 4LNRA 1ONQB 4PY7A 3VJ6B 1TO4A 2GDSA 4U4BA 4Z1MG 3ZXAC 5JXAL 4IS6B 4C8XA 2JJUA 4JRXB 3U4KA 4HUVB 4MVZA 4PVNA 1EAQA 1XGRB 1Q7YW 1D5IL 3GSOB 3CRAA 1NGQL 5T1KB 3BYTA 3TIDA 3H1IH 4QUOA 2PETA 4W4KA 4G59C 4N0YL 5KVFH 1EUTA 4TM9A 3SJQC 2GSIB 5ABDE 4RRPM 3KBPA 3VXTB 2GYSA 3K5RA 1BF2A 5FOJA 2QWQB 2B9BA 4LKCB 5ANME 3QB7C 2CAKA 2APTA 1LEKA 3RVXC 2F43G 1SETA 1ED3B 2VSDA 3HLKA 1Q43A 2DW4A 5TK4A 2PMZA 4K73A 5I18H 3S97C 2ZNXA 3FRPB 3GBEA 4I0PC 1LMKA 4DR7O 4JGMA 1Z9SA 4NXMO 3US9A 2B5UA 4AEFA 1VQPV 1WQVT 1AIFA 3CQQA 3TJEL 2AQ2A 4I7ZC 5B3NA 5DD3H 4PW9A 5FKAA 2RJMA 1CFBA 3ZHKA 2VOTA 4WO0A 4ZUSB 2HMID 4UCRA 4UQCA 1KT2A 3H6JA 3CC2V 5JHDE 2A6DA 3DHUA 2XWEA 5CEZL 3ZIAG 3A23A 3TA3A 5HYQA 2OIGA 2R1XB 2QBWA 2BIQA 4U6HB 1IXBA 3PL6C 4PV9B 2XBDA 3L5XH 4IU3B 1RU9H 3VW3L 1S9VA 3WHXB 3LKOB 4O2CA 3IC9A 4N3TA 2H45A 4GRMA 4K9EL 1DJHA 5CJ8A 1ZLVK 3ECBA 4DPAX 2CR0A 1WS8A 3GLEA 4LWSB 5DRZA 1H3TA 3W3BA 2FJGB 1IBHA 1MVFA 1XD0A 1N34B 4MXQD 1YPZA 4XXDA 5I23A 1L9RA 2B5IC 3OJVC 1TJGH 1R5WA 3MN8A 3MRDA 4JRWA 3SDYL 1F3JB 2H26B 3P30A 4GH7B 5TQ2H 1MFEL 1PMYA 1E50A 3C6LD 2APSA 6CGTA 4MQ7B 4LKXB 1KGXA 3JARB 4P57B 5EBWC 5IBTL 4OCRH 2X3CA 4WDIA 5HGDA 5D1XB 3AU1B 3EJCA 1R5IA 3LN9A 5C0IA 4LCIH 3QCTL 4IYKA 1M7XA 3UTTB 1T2QL 4NQEB 3CZJA 3JALB 1NCAH 2B16A 4FXTA 4KVCH 4UQ9A 4QRAA 1OAKH 3JD2A 3EFOA 4EKWA 3NJVA 3T08A 4O58L 4UT6L 4ZTOH 2QGCA 2R1WA 4HKBA 5EDXA 5LCVL 4NDMA 3WIFB 4N0CD 4N4YB 3L3KB 1EFXD 3OXSA 5D9SB 4KVNH 1W15A 1ML0A 3Q2NA 3TEZA 4I5SA 4LQFL 3JTBA 4XC1L 4H25B 2ARJB 4OJCA 5MP6H 1UA6L 3V4PB 4HUNB 4TNWK 1K2DB 5E1HB 5AQ0A 5SWZD 2R0LL 3AT0A 3RFZC 5B1AC 1OW0C 5EU7E 2WBWB 1AR4A 2P8MA 2P5WB 4FQCL 4KJWD 1BQKA 1GMGA 2WC7A 3D34A 3MREA 5KJ7E 1H3XA 2IMNA 1WG3A 3O65A 3PNRB 2D7TH 1I9EA 1OGAD 3FT2B 4ZW8A 1ZLUK 2WLHA 3SQRA 2Q8BL 2VC2H 2X4UA 2YRBA 4BZ1H 4GG6E 1AQDA 1KC5H 1ADQA 1QVFU 5DC2A 1RVFH 2BTOA 4K5MA 1FJ1A 1DL7L 4MAYA 3Q06A 4I0KA 3AM8C 2ZR3A 4RAVB 3D0AA 5D93B 1JF1B 4M6OL 2ICEC 1NANH 1W0JG 4O4LA 2A83B 3D05A 4MCNA 5BCAA 4W9ZA 4YOKA 5MHSD 1DVXA 4YFLF 5FYJH 5CLYA 1VF6A 2OI9C 3UAEA 4JI5B 1M3JA 1DFBH 2XSKA 2V2WA 4X0NA 5H35A 5D2NA 4QXTA 3LDDA 4BRVA 5GS2H 2CBQA 4N86A 5B8CC 1MRFH 1WBYA 3VQLA 5B38A 2GI7A 1NCDH 5IW3A 4DZ8A 2K78A 5BMFH 1FCCA 5I8OH 2J8UF 5JMOC 4TTGA 5IB5B 4EN3B 2IU3A 5HYIA 4NM4L 2NSMA 1I8UA 1J1PH 1HAUA 3J81N 2XIIA 2YUWA 3KAAA 3N1GC 3ZO0A 2KKQA 3FC8A 2QLVB 4AT6A 3RL2A 2ZOKB 4LLUA 1TVHB 5IVXE 2W9EH 3VI3F 2WIIA 3D9AH 5CMAA 1GOHA 2APFA 3VFRA 2A0LD 4N6QA 1DVFC 5A2IH 1ZL8A 2BHYA 4Y5VC 2JS5A 2VAAB 1L7IH 4HIXH 2CBPA 3VG0L 2VLRB 2AJXH 1JZEA 4IQHA 1V7NH 2EDTA 5CU9A 4HA1A 1VF5B 3ABMC 3UPCA 4PJ5B 1AILA 4X4KA 1GGUA 2YEVB 3JAKB 4I9QA 1P7QB 3NK3A 1TJMA 5DRNB 4AM0Q 1JGVL 2OL3B 2GJZA 2GIYA 1AGFB 4PRPA 3UQ8A 5GZNA 2F7RA 3ZYJA 3KWWB 4C83A 4YHNA 2X6MA 2W0FA 5HYSB 1D3CA 4BH7B 2QFRA 3JTSA 2K8MA 4QNPE 5EN3A 3JATA 1M7DB 3ZLQC 1KCSL 1TTGA 2XZQL 2JB5H 2QPUA 3A6CL 1S9XB 3FW6A 4FS0A 3PHAA 5J6HA 1A02N 5HHVH 2PWDA 2CD0A 1Q1PA 1NMBH 5A6LA 4I4TB 1T83A 3MLRL 1H3PL 3Q4HB 1WPBA 2OM5A 2ZXCA 3MZTA 5FUCE 1KMGA 5AVVB 3C3TA 4UQAA 1T3FB 2ZAGA 4UB6Z 2OZ4H 2YSSA 2A5UA 1JV5A 3CZSA 3F8UB 4FFTA 3UZVB 1KB5A 1S9YA 1N9PA 2FBOJ 4JO4L 2K7QA 1D2OA 2CJUH 1UUNA 2XN9D 5FYJD 3WDIA 3QNZB 2VDPH 1GC1L 3WG7B 4HFWB 4KO5A 2B3RA 3IMRA 1DLHA 5CP7A 3E8UH 1S2EA 4DUYO 3CSYA 1PZ2A 5GS2D 1OT2A 1OAXH 1UACH 1WO2A 4UOW0 3LHPL 4R4FL 3IDYB 2PPEA 3F58L 3W39B 2AC0A 4FCAA 3VX1A 4IDJL 5HSFA 2HKFL 1CT8B 2P5ED 1QNMA 4J7KA 2UXBO 4L3EB 4PJ8D 4N28A 4NKIH 1P4UA 5IB4B 2F58L 4XXCA 5C08E 5AVSB 4DN3L 5AZUA 4Z18A 2PW2B 1EEYA 2N1TE 3NR7A 4MAUH 2XFGB 4BCXA 4F2ME 1FSKB 1ES0B 2DKSA 1X5FA 4OM1L 1LWRA 4TUUA 1E3ZA 1T04A 5EBLB 2EDEA 5DUBA 2GTWB 1U4FA 3ILDA 1FL6B 5DJ6B 3TONA 1N8ZA 4ATTA 5BRZA 3QH3A 3L1FA 3GQFA 2ZUSA 3GMNA 4OT1H 1KTDB 3CCHB 2RQ6A 5H37A 1KLFA 4HPYH 1JHTA 2DS4A 3H3BC 1G7QA 1AJ7H 1U97A 3CFEA 3P02A 1YHPA 4PAZA 3FNKA 3W11D 1HXYB 3A6OA 4WV1B 4ZMOA 1GN2A 4QRPB 4K3AA 3KMDA 4Z8FL 1ADWA 4D0CB 4N20A 1I8LC 1VIBA 2QPDB 1CL7I 5MI0B 1OM3H 5C6TL 1IGYB 4JZJC 3EZJB 5E08H 1N5YL 3WD5H 2WWOA 1HK6A 4ZBJA 2ESVB 5SWSE 1MAJA 2Q3ZA 3PDDA 4P46B 5JIKA 4ONGH 1OB1A 4U49A 1U2HA 1F4YH 1J5EO 2EE9A 1IEAA 5A3IC 4W70A 1U8NB 5GISH 1QSVA 4J28A 4G7SB 1RZJH 1RUAH 3WB1A 1LQBC 4GRLA 4HXBL 1BQSA 3FTSA 2F68X 5I15L 2IDQA 3DC6A 3VQMA 4JK0D 2GAZA 5J6GA 1JGLL 2C3VA 2NZ9D 3HI6L 4ZODA 5MENA 4NZ8A 2O5YL 5KHGA 4MQSB 3NYKA 5B39G 1N36O 4MXVF 3ZDZF 5KYUA 2Z7WA 1NGWB 1AGBB 4PS4L 5EU6B 5CUSL 1KBHA 4JANA 4LIQH 1AOHA 3BSZL 5L0QC 4PP2A 4LSTL 2PKDA 1RUQH 2VABB 5IVZA 1BAWA 4IM8A 1JFQH 3R4DA 1WYJA 1K8IA 5D1ZA 3TBYA 3BMVA 1V3JA 1OSPL 1MIEH 3MOAL 1T1ZB 1IAIM 1T5XA 4PJ7A 2EIZA 2O30A 2IH8A 4JDEB 1XCTB 4F24A 2FWUA 2BSEA 4P2OA 2FO8A 2Z34A 3F2LA 4PLKD 4UV7L 4GFXA 4QXWA 4UU9B 3RBSA 1BYOA 4NJAH 3W0WD 4DP4X 4F91B 4I1PA 1E28A 5F3FA 3VDAA 1PL3A 5C0EB 4JZNA 4LBAA 3DGDA 1D5AA 2XZAL 2NCMA 1VZIA 3HHSA 1W2BU 2XFXB 3BH9A 2GT9A 4PJBE 2E3VA 2W07A 1ZT1B 4KAQH 4TSCH 4DUZB 2ATKA 3CXFA 3BO8A 2VDNH 4L1BA 5I16B 4ERSH 2FK9A 4MZ3A 2Q76B 2BSKA 4N2OA 5D6DC 2MPAH 3DMMD 1VEWA 4FABL 3C5JB 4K7PX 4AXWB 3LPFA 4U3SB 4KKLC 1U8KA 4UYQA 1C12B 3RJDA 1NZRA 1DVTA 3IWVA 3UCSC 1ORSA 4WBNA 3STZA 4B9YA 4W9KC 3RTQB 5JW5B 2ZR2A 5KHKA 4N90D 4RGNE 1VPOL 1G7LA 3HS8A 4K8XA 1S3RA 2NT1A 2Z4QB 3U25A 3TZVA 1H3UA 4AENA 5FNVA 1PD0A 1RZKL 4KTGA 1U92A 4BA8A 2ZX5A 3VXRA 3FBQA 5DJZA 2ZNJA 1JOIA 1CB4A 1G94A 3A24A 3JV5A 1HINL 4HVBA 3K59A 4GCZA 4ZSOA 4FLZA 3QNYA 4TLTA 1PYWB 2GC4C 2CO1A 3X3GL 1CDJA 1LM8V 1YEKH 1Z32X 1BLNB 1QBBA 1D9KD 3GSQA 1S5LZ 1KXQA 4L2LA 3K2MC 4ALAL 1TNNA 5J2TB 1CFMA 4U1GB 1KEMH 3U36B 1HWGB 4HC1A 2FECI 3CVDA 2R2EA 2EE6A 3QJXA 2BDNL 5F1SA 1BA9A 1YY9C 5E23A 1KXTA 2K8QA 1IUZA 4O2AB 1B2WL 3JWDC 1P49A 3T0AA 4DEPB 1IGML 2FZ3B 4LF3B 2O5ZL 4XO9A 5ETUB 1G4RA 4MJ4A 4XH2B 2B1AL 4UQBA 1F2XK 2Q8AH 3RYIA 4ZXBB 3H6AA 4PB0H 3PF2A 2IFGA 4XHJC 2X4TA 3W9EB 1H3WM 2G75A 3LOWA 1KCBA 4WJKB 4JI3O 4AZ8A 1P6WA 2QSAA 3G6BA 2I27N 3SDXB 4WLCA 4DO6A 4B3VA 2EEFA 5BRQA 1GRWA 4BK8A 5E2UL 1S72V 1MCRA 1M6OB 2XQ0A 3BGMA 4ZQKB 3LTVA 1X5MA 3MFGB 5HDBE 3UBXB 2WXRA 3X12B 3IDGB 3LQAL 1KBVA 4J7RA 3FTUA 5E2VL 3JV4B 3MA7B 3RPKA 1CVSC 5CBEB 3MTXA 1AHMA 1GYUA 2UWEF 4OPAA 4LP4A 4CVUA 2DDQH 2ZWNA 3U48A 4BEIA 2HP4A 5DMGC 2DQFA 4KX8A 3HC0B 1NA8A 1KKDA 2V8LA 3K5LA 2AQNA 4DW1A 3SQOH 5KSBF 3BT2H 1UH4A 4H0HB 4UCVA 5J3HC 3DX9A 4AE0A 1U8JB 3EYOA 3FD9A 2X1PA 4GRWH 1OE2A 1QWHA 2MPVA 3DNKA 3HRPA 2F23A 3OD3A 3FU0A 1HT6A 3BZEB 1C8QA 3BVVA 2PPDA 4AV0A 4JFHE 2JJTC 5IBUG 1FZMB 1WT5A 2QTOA 4O5LH 3PG2A 4TULH 5TH2B 3VGEA 1ZPLA 4QT5B 5BS0B 4F80A 4JRYE 2ATPA 4QRRB 5GGQH 4QYOA 3IJ7A 3GI9L 3H9VA 2D7NA 1JBJA 1TZIB 3IJ8A 4ANVA 5GGSY 1ZXKA 1E8XA 4U1LA 4Y19D 5L2KE 4OZIA 2D7QA 1D5XB 3ISYA 2NY2D 2XT1B 5HHPB 3WGUB 1BOGA 1VF5C 3LB6D 4G6JL 1ZTXL 2AJ3A 4Z7VF 2EH7L 3VDCA 4YQXL 1AVAA 3NFSL 5FYKE 1XF5A 3OHMB 1QI3A 1QRNA 1XI1A 1RFYA 4D9RD 1HNFA 2OAAA 5HI3D 3FB5A 2VXSL 2GUOA 3GJFK 3VG9C 4JHAL 4NFBA 4DV3B 2R2HA 3MV8A 3FJTA 3QO1A 5AW1B 3B9AA 4FIPC 1YYCA 1BQLH 1ZJAA 1WEJL 3GHBH 3RWJB 1IBFA 4ISVA 5F7MC 2VL5B 2GFBA 4H8WH 4GAJL 4GAYB 2W92A 3EOBA 2HWZH 3HW7A 1HU8A 5CJQH 5ICUA 3VU1A 3CC7V 4L4TE 4OCYL 3ARDD 1B4JH 2IWEA 3RKDD 3QPXL 5IW6A 5ESAB 4UCOA 3AWGA 1I85C 3DROB 4HCRL 3WG7C 1UXSA 2WOYA 1FNSL 3QRGL 1Z9PA 4G6KH 4X5WB 4BINA 1H5BA 3VXOB 1QPXA 2ERJB 5CA0A 1MY7A 4R5XA 1S5IL 3OAZH 4FK5C 4LSDA 1TQVA 2CHZA 3PWUB 4JFYA 4XCNA 1GZHC 2DOSA 1XGPB 5I8CA 1YITV 3BVUA 1A5FH 3HN3A 2Y7QA 3UGXA 4KZEH 3UO3A 4IIQC 3ULUF 1S7XB 1JTTA 4MMZC 1FPTH 1TJHL 2B2XL 2EUXA 4FTVD 2YUAA 4YN3A 3CZFB 1O75A 3GO1H 5EYPA 4OFQA 1EFXB 5AYUL 3HC3L 1J12A 4HKXB 3ZRVA 3M8AA 1ACXA 1XB3A 4J1UB 4DV6B 1CCZA 4QOKA 2R9HD 1ITBB 4TSBH 3VXSB 2P5PA 3GFUA 5SWZB 2R0WH 4JN1H 4YDJA 4XPBL 4U3JB 2BCKA 2WQVA 3A47A 3FB7B 2XTAA 4OZHB 4QGYA 5KEZA 5D7JD 5JIIA 2VZSA 2WV3A 3NCJH 4R3SA 5GPRA 4APXB 1OGAB 3ZKQD 4DFHA 4Y5XB 2MW2B 2CUAA 1ROPA 5I26A 5D5PA 5KUKA 2HLFC 2O5XL 4LL1A 2VDML 4KHTH 4ODXB 1IEBB 4WV1C 3MRNB 4XVSL 4OFVA 3OR6A 4D6TH 5K1VA 4XX1E 5C8JB 2DAVA 4NN5C 2CR6A 3DIVA 3C8HA 1VIWA 3FU3A 2C2AA 4AEIL 1ZWIC 2X2UA 5KYWA 1UZ8B 1E4KC 1KIQB 4H8VA 4F5CA 2AQ1A 3QXDA 1PLBA 3KR3H 3QUXC 3GDBA 1HHJB 2JVUA 2KZWA 5C09E 3L75H 1WICA 4KKBC 3AACA 1LEGA 4ODVH 3ZKMC 3N85H 3D0VB 3DC0A 3UABA 1N0JA 3IJSA 2GIXA 4HOWA 3H7BB 5CKGA 1KPUA 1LDSA 3IFLL 4XP1L 2VLJD 5AKSA 1UM4L 1I53A 1GL4B 4LLWA 1OWRM 5LXGL 4KROD 4LAQH 4RFNB 1VZHA 1T7WA 4Z7OF 1WA1X 3VD1A 1M9SA 1L0YA 2V9TA 3CCJV 3MJ9H 1QWNA 3GSNB 2J5WA 2XAHA 5LMUO 3CMOH 4XI5D 2WBJA 4N8VG 4P49A 4XB8A 4RSVA 3IGAA 1I9IL 1R6TA 3K8KA 1AGCA 5HHOB 3NSCA 1KELH 5CP3A 1J9SA 4KFZC 2HX7A 3VD5A 2CK2A 2MIZA 2P43B 1RI8A 1SJVA 3N2KA 3UAJD 1D5NA 1WJZA 2AAAA 1NKOA 4PREA 5B7MA 1IILE 4NO0D 1VGKA 4GUPB 5DTFB 1A6ZA 1LD9A 3AG3B 3TF4A 3QDMD 4TF4A 3D85B 5IJ0B 3GB7B 1CLYH 1F4HA 3DTXB 3OF6A 4WWKB 3QEQB 4EXPX 1T5EA 4BFBD 4XAKD 4ATWA 4HCFA 1CLVA 1U21A 4NO5B 1S7UB 2O6CA 3OJDB 4Q6IC 3GXTA 3KGRA 1A6PA 5BUAA 3WNLA 5D96C 3LHAA 5C0CA 1AZUA 4CH4A 2XOTA 3QCVL 1VGEL 1D5ZB 2IPKB 3MKGA 2B9ZA 3MR9B 3FQNB 3K46A 4X7SL 4J7ZA 5IT2H 4N23A 4YIOA 1FLTX 4MNQE 1HL9A 2K6ZA 3TN0D 2F0CA 3CFKB 4YXLH 3PHSA 3ARQA 2E5LO 2DYSB 2M2DA 4KTDL 2BERA 3UO8B 1XB8A 4M62L 1W0YT 3QZPA 3VRJB 3I2CH 5FLUA 1QFHA 1HNZB 1QI4A 4X4XA 2F53E 3QHFL 4FQPA 1YZZA 4JDTL 3RHWF 3BUPA 2FL4A 1R3IL 1WFNA 3O45B 1OGTB 4KK8C 1KWKA 1E4XL 3RTQC 1WAZA 4UAHA 1SEBA 3CVIL 3ZUCA 4JKNA 3ULUC 2F1BA 1IIIA 1ZEAL 1E6OL 4F8NA 2IIJA 4P59H 4MAZA 2Y0IA 4DKEL 4JI7B 2KG7A 4M29A 2NXYC 3LZOA 3ZTCC 2JJSC 5FHBL 5EH1A 4O4HA 4YHHB 4AL8H 3S2AA 3IAYA 5JJNB 3BHBB 3CSXA 5LAPA 4GX5A 5FIEA 1L9NA 2WSKA 3H53A 4ACTA 3ARZA 4LCCB 3VH8A 3B2XA 5L3GA 1A8JH 5DD0H 4AJ0A 5JPNA 3NCEB 3QZOA 2UUBB 1SDAB 2AXTZ 3ULVF 5CA3A 4X6DF 5FR3A 3U2JA 3MD0A 3VA2C 4PSPA 1DCEA 4G8GD 3IDIA 1P4LA 3VXNB 2AABH 4JQXA 3WN5A 4EUPH 2CSPA 2C7UA 3IFOB 2M1KA 4PWFA 1MLBA 4H1LH 3E0GA 3SPIA 2IBBA 4RVBA 4Y2DC 1E27B 1M5IA 4J9YB 3SDLA 2HRGA 3DHPA 3PJSB 3PV7A 4HS3B 3EHBC 2DIAA 3TX4A 1J11A 4M1GH 2CHNA 2A6IB 2XC8A 3KPRD 2OTLV 1CD9B 4UB0H 1RJZA 4DV0O 2XI9A 5ICXA 3TBCA 4YHYB 1N64L 3CPLB 3LSQA 1DTUA 1MHPL 2X7LA 3M86A 2O61B 3QBTB 4NB5A 4JRLA 1WH0A 2LGNA 3MLUL 4JQVC 4ODSL 4LF7B 3GUTB 1CE1L 5H94A 4A68A 5JIDA 5IV2A 4FLQA 5AG2A 3M17A 4LEOB 4EI5A 2F8VA 4I4WA 1UJWB 3HPLB 1WS7A 1R33A 3RNQA 2CGOA 2D3OW 2FQGA 4R2GB 3L3IB 4DR1B 4XWOD 4DP0X 3ZE2B 3ZBHA 2IBZH 2VDPB 3TJHC 3PIQB 5ISZD 4H8PA 4P99A 1JFFA 5J1AB 1MJUH 4PJIE 5CHNA 3OBAA 1XNQB 3NIGB 1YNTA 3FH7A 4JFZL 5AW5B 1QFOA 2K0RA 1OE1A 1U95B 3CDZA 5HJGA 1MOFA 4F57L 3C90A 4JR9H 1A3LL 2DJ4A 1U8IB 1KB9F 4WJ5A 3JWNG 4HAKA 1R0AH 3QUGA 2CDFA 3P4MA 4OLYH 4Z0XB 1GTFA 4F7TA 1NFDA 3ARFA 5TQ0L 3N42B 3V0WH 1KCRH 1Q9LB 3TVMA 1WAEA 3N40F 3TTYA 2WQAA 4MD0A 4HAGA 4BSWB 1O5PA 3NN8A 3VQ2C 5L3CA 1SZNA 2BNRB 4HKJB 5JPMA 1IQDB 4HUXA 2M83A 3HG1E 1A21A 2MHAA 3DJRA 4FG6D 4ZHQA 3SODB 5AAPA 3G6EV 2FUTA 1J7VR 1JGDA 4CKQA 4MTMA 4PJEB 2ZSVB 1JDDA 2EE0A 3CTTA 3K1DA 5C97A 5IHHA 1ILSA 1J95A 4K94H 3L70H 1HC1A 5GS1B 4JTCB 4BZ2A 3BQUB 1TGOA 2CBMA 4I13B 5TF1H 3SDDB 3WFHB 1TCMA 3FQUA 4FI8A 4G1MB 4ZX3A 3VD4A 4I8DA 3QR2A 3EYFB 1N0LB 4S1QH 4TYUA 4PWHA 3STLB 4JAMB 2KS0A 1WFIA 1D6EA 2GK0A 3AXLA 1QZNA 4KKZA 1FJGB 1HSBA 3C5ZA 4LOEA 3V5KB 4J6RL 4XNYL 3WJMA 4JRXE 5BZDA 4HNAB 5DF0A 3VD7A 3RX7A 2P26A 2X05A 4XAWL 2GSGA 2JXMB 2RBLA 5EN2A 1O0VA 2A4CA 3O3DA 3VXMA 2VO8A 3F00A 3PGCA 3E8GA 1GHFH 4QRSA 5GRYA 4G8IA 1PJ9A 1JNHB 3MCYA 2I69A 3S35X 3HUJA 5JHLH 12E8H 1UT2A 3GMOA 3ASOB 4MJJA 1OAYL 5F3HA 3VMNA 2FWOA 4MB1A 5C0JA 3MRRB 4YUEH 2FYYB 4XCEB 2E76C 1WFMA 2VN4A 1SZXA 5TISZ 5LA6B 4L4VD 4O2FB 1R5VA 1I9RH 2H8PA 2OP4H 3A6BL 4JY6B 3ULVC 2K1MA 4RIRA 2IH3C 5F7LB 5GGTH 5ACZA 3ABUA 3BZ4A 2G2PA 4OLVL 2EDBA 2PP8A 3WE1A 5I6OA 1EZSA 1D9KB 4YXHH 1H2LA 4L8BA 5DD1H 1PZSA 4MS2A 1I1FA 2CJ3A 3KPSE 4X65B 3SE3C 1KJMB 3MLSH 1R19A 3O0LA 1KFAL 4RNRB 1G7HA 1MCPH 1XF3A 2XTLA 4TRPH 5F44A 2CXKA 3EADA 3SKJL 1ZANH 4RWYH 4A6YH 4A04A 4Y4KC 3HR6A 1IAIH 4NNYB 5LKNA 4TTDD 3APNA 1YEIL 3OMZA 3AS2A 4XNAA 3RZCB 4ZFFB 3AG2C 4MJ5A 4LLMB 2EIJB 3QFDA 5ESQB 3T1FA 1K9MW 3CS5A 2O6FA 4Y5XC 2OV0A 2CK0H 4ECNA 4LESA 2FH8A 4XVOA 1JL8A 2VDOL 2VDNB 1JPGA 1P7KB 5HGAB 5HYJA 4QHUA 1DBMH 3DHMA 1CIUA 2HT4D 4R96A 1ZVSA 3VD3A 1QBAA 4XP5L 4Z7NB 4J3TA 4XMKL 1TETL 3J7AU 3F6LA 1YI2V 2D73A 1EM1A 4DCQB 5CD3B 2BRQA 4BXSV 3CD6V 4B3MO 5I0XA 3LRKA 43CAB 3ZU8A 1MNUH 5F1IB 1NPUA 2ZOLB 5JOFA 3BWSA 4U0RC 2WQWA 1LUWA 2HT2C 2MOVA 1G7JB 1OCWL 2V37A 2WXLA 1PQZA 3LKNB 3P3TA 4KHXH 5CCKH 1F6AB 4TVUA 1DQLL 2JB6A 4IBYA 1IQWH 1W6LA 5D1XE 5I19L 3U6RB 3GSVB 1I3GH 5JDJA 5AOJA 4DZBA 3ALPA 2X40A 1ZVNA 4RFNC 3UTTE 4NQEE 2NY0D 2OULB 2WHVA 1I1AA 1UKTA 1RJLB 4XP4H 1F41A 1E67A 1Q4NX 3LKSA 4AGLA 3ETBJ 2Y4TA 1IT9L 1U6AH 4HXAL 2VR6A 2VT0A 4K7PL 4TKWA 3T8VA 4B7EA 1JVKA 3INUH 4MZ2A 4BFRA 2ORBH 5IGXL 3QDJA 1AOZA 3UBXI 5DYOB 4UTBL 1OP5H 1IZ3A 1ET5A 2XN1A 3MRKA 4JFVA 1LE5B 1B3IA 3UERA 4LP8A 4Y19B 4PCYA 2HVKA 4N85A 2IV9A 1FUNA 3FT3B 3L3JB 5JXAH 3DPDA 2NY2B 1IARB 1RZ8B 3I02B 2WLIA 3MLYL 4PWGA 2B0SL 1H8LA 3DX7B 5F9DC 2BXYA 5E2JA 3G80A 3WS3B 1SDYA 3ILQC 4LF9B 3GB7C 1D5IH 2Q6WA 4F7EA 1B90A 3NQKA 1NGQH 2A1WL 2A6JA 4WWKC 1YAZA 2JCCB 5CIPA 4CS3A 3V0IA 4AQ1C 3OLIA 1CDHA 3IDXL 2P5WE 1TF4A 4XXWA 1DSYA 2AGJL 3QQ3B 1TO5A 2XG4A 2OMYB 2IFFH 4H2CA 4MS8D 3UC0L 1MCKA 1BZQK 4PRNA 3LSUA 3BSHA 2W6JG 2ZE7A 3QWRD 3I85A 4ZUTA 1NUDA 2EEAA 1R3HA 4RMWA 4XOAA 5B3JF 2EJ7A 3BY6A 4AILC 2EP6A 5F7UA 1IBMB 4O4JB 4LH7A 4RWHA 1S7RB 2XPYA 4KKAC 3S5LG 1E40A 3ARDB 5L8LB 4QHKI 3LKPA 4M03A 4IRJC 5T5FL 3E22A 2ZUYA 3FOMB 2R0KH 4OQTL 3BW9A 3LD8B 3RW0A 4GXUM 2FEEL 1BZOA 5JVDB 1I08A 3B9VA 1X5XA 2IH1C 2HUEA 3CIQA 4M9PA 3TJEH 1UWEL 4NC1C 4QCIA 2N04A 3UTQB 2O72A 1UYWL 3SKOB 4BKLA 4ZX4A 4JO3L 3JUZA 3FN9A 3BAKA 5D5QA 4X42A 4PGZA 4RMVA 4Y4HA 5E9DA 4KRNA 4Q58C 5E51A 2AV1A 1CXZB 3U4EB 4PJDA 4K3GA 4GRWB 3NH7L 5CEZH 2WWMD 5DDHA 3L3GA 4CW1B 5L7XH 1ETZB 2NYZA 2RALA 2WXNA 3OHXC 5IY5B 2V9QA 4X7DC 1BQHB 4UCUA 5K33A 1KNOB 1DANU 3VW3H 4HH9A 5JIQA 5F2VO 1KGCD 5JO5A 3IE4A 4K9EH 1U2CA 3QQ4B 5F89B 3EBIA 4F93B 2R9IA 4XMXA 2YJLA 3QDGD 5BVJA 4X6BA 2VLRE 1OXYA 2QGBA 1F4XL 4F9PC 2BSTB 1Q9KB 4PJ5E 1QBLL 1BV8A 3FO2B 3SDYH 5KWYC 4QR7A 1MFEH 3DETC 5D7JB 5JW4M 5DI8B 1BAFL 5DO2D 1DQDL 3ZRXA 2ADIB 5IBTH 3VFOB 1E1QG 2AZAA 1S3KL 1VEMA 2P9RA 2H6UA 4KI5F 3CEIA 5MEOB 3QIUC 5IMOA 1YDXA 2AW9A 3ATEA 4LSUL 2ADYA 4X5PA 2V3EA 3QRLA 5E56A 3MRPB 4JI0B 3KWVA 1DQTA 1JPST 4NQDA 2UVEA 1H8NA 2F5AL 1KV7A 3B7SA 4GBXD 1DVUA 4Q52A 1E0OB 5JW4Q 2OCHA 3UADA 2AK4A 2IANA 1WBZA 3VWKA 1MG3C 3FQ4A 1AKPA 1K5NA 5D2LA 2APWA 3Q6GH 3OJ2C 4JREC 4O58H 4OLUL 2ID5A 3L74H 3TXSA 2FH6A 2WTOA 3L1GA 4R2GC 4YAQA 2FAUA 2P67A 5LCVH 4TOIA 2D2OA 4PGBB 3QUYD 2DMCA 2VLJB 4BSVA 1AACA 3MMEA 3GMMB 3WY1A 4LQFH 4XC1H 4KROB 1A1MA 1UA6H 3GTVA 4FNSA 2XWBB 1YMMD 4P9ML 2R0LH 4LH6A 1BMZA 3R0NA 4P5MB 4L3EE 5K69A 5CEZD 5HYFA 1CLZL 4IK6A 2EYRB 4FQCH 4MDRA 5HVHB 1DE4A 2PO6C 4QDGA 1J05A 2Y24A 4WO4A 4Q7DA 4A2LA 3F7YB 1BPVA 4MDJB 1LK2A 3LNDA 2PCPB 2FJSA 4MNHB 4HKZB 4ZPTA 1WIUA 3A21A 4PBVC 2BOCA 4JFFD 2Q8BH 1LXMA 2J7LA 3I9IA 2GTSA 1CXHA 2IJKA 3TYGH 4ADIA 4ELKA 4NO0B 4AQEA 3E1ZA 1DL7H 3V6FA 2BVPB 3KLHD 4OZFG 3CN2A 3QDMB 1OAZL 2ZUQB 4M6OH 4FXLA 4J41A 1A65A 3G6DL 1G9NL 2OIEA 5CLTA 1UTDA 2OCCC 1KIUB 4LF8B 3REVA 4HJ1A 4PJCA 4I0XB 2OSLB 3H56A 1TTBA 2PYJA 3GRWA 3SKMB 5DVOA 3D52A 4X1YA 3FQTB 3UZEC 4J10A 2WXJA 4OGQC 3FB6C 3SY0A 4XNMB 5FOBA 1L0LH 1AFVL 1NKRA 2LLNA 2OJEA 4UT7L 4IHJA 1EGJA 3FCBA 2GUZB 4ODBD 1UOWA 3BQUC 4RO2A 3Q5TA 2OPCA 3QYCA 4QRPE 4NM4H 3PWVB 3OKLA 5CSBA 4X6CA 3IJYA 3WO4C 4H0GA 5I0DA 3TN0B 4X8GA 3V6OC 4Z78B 3STLC 3F64A 3UYRL 4BFEA 2ESVE 4FNLL 4JV5B 4HJ0C 5IB3A 3DX0A 2BIIA 3GTNA 2JIZG 3B9EA 1N2RA 2AZ0A 5C92A 4XNQA 4ODUA 5I0VA 1F3DJ 4I9WE 4QWWD 3HOGA 4E9SA 1GCYA 5FPIA 4JFDA 3VG0H 4UM8A 1K4DB 5GSRB 4OX9B 4CRPA 4Q6GA 1WITA 1AD0B 2DMGA 2GBVA 4FFWD 4WY7L 3Q5YA 4TUKL 5H2BB 2PCFA 3P4NA 4OZGF 4YR6B 3SSGA 3ATAA 2L7EA 3EBAA 4TSAL 2WLKA 3C2AL 3LZQA 1H15A 3SBRA 5DO2C 2F7PA 3FU9A 5EUOF 1BEXA 1JGVH 3UMNA 1G8MA 4DGUA 1SF9A 1NLDL 5EU6E 1QEWA 1XL6A 3BH8B 2CTWA 3FPYA 3BFRA 2ZCLL 3D69A 1AZCA 4ZOCA 1VFAA 4JPQA 1FFXA 3WFCL 2PYEA 5A2BA 1KCSH 2XZQH 1PZBA 3A6CH 3L17A 4LQ1A 2CIKA 3KCPA 1M90W 4DR3B 1MCFA 3BP7B 1AANA 2OQJA 3GK8L 4DK6A 4ZFOA 5IJKA 4GUCA 4N0UA 1DLBA 1J0JA 1H3PH 3FFCA 1RZGA 4UBDD 2P45B 4I50A 5DJAB 5EU3B 5HI4D 3COOA 1SY6A 2QM7A 1YJ9V 4G8EA 2NYYD 4URTB 1ODUA 3F7LA 4KI5C 4UDTA 4JO4H 5I2IB 1NDTA 2HG5B 1F11A 1OPGL 4ZX5A 1KV3A 1FGNL 1GC1H 2IBGA 2ZUVA 1W0WA 3KPRB 4NRYB 3UROR 4F3FB 3RZCC 4ZMXA 2NQ3A 2IQAB 3O3AB 1RERA 2WWWA 2LFGA 4R4FH 5F7HA 2D0HA 4IDJH 2HKFH 3U7AA 1N3NA 4D8OA 1G7IA 3NACL 4PBWD 1SQFA 4WFGA 2F58H 4LF4O 2JELL 4NIYE 4X6FB 4XBMA 4DN3H 4PV1B 5I1AA 4WWPA 4I48B 1ZT4B 1JGEA 4PJXA 3RJOA 3U6XA 3NCBB 5IESL 4WF9V 2X4OA 2QDWA 3I5DA 2OS7A 5BQ7A 3MLXH 4OM1H 3RWEA 5GONB 1CE6A 3DLQR 3GT6A 1R3JB 1KBBA 5F7BA 4LK4A 4XGZB 5E6IA 3HKEB 1OV8A 1U3ZA 1GIGL 3O81A 4I0PA 5FHAL 5DJYB 5KJ4A 1DJZA 2N7AA 2E46A 1NEZB 2HT3D 3H3PL 4X20B 3BWUF 4JFEA 5CMUA 3LN4B 3L95B 4NJ9H 3V4UL 1INQB 4DGVL 1AQKL 4H0LC 1XQ4A 2OFQA 3K0DA 2ITDB 2DL9A 3E6HA 3OWEA 5ERWA 3GSWB 2XICA 1XR8A 3I3EA 3LDBC 5JCOC 4NHCL 4ZFZA 2YZ8A 2NUPB 2E7HA 4FZ0A 1BMGA 5C6TH 4ZW5A 1M7IA 1XT5A 3NIDB 1CD1B 2IDSA 3TA3D 1N5YH 4OUUA 3SJVD 3QNXB 3T5WA 4P8QA 5C9JB 2CUIA 5LBQA 5IKCA 4GI6A 4NWTL 4Z7WB 1G43A 4HEPA 4PS7A 3PY9A 4EUPB 2XXGA 1S7SA 3KPQA 1KG0B 1ZA6A 5INCA 2X9XA 3L9RB 4JZ2A 3APDA 2EXYC 4H1LB 4U6YA 5J11C 3KEDA 2UY6A 3L7FB 1SOKA 4MCYA 1NUFA 3BP6B 3C60D 4HXBH 1VQ8V 3CFNA 2AJVL 1JGLH 3BUYA 3ZDXF 3HI6H 5AVWB 2KHAA 3L08A 3IXAA 3L71H 1GZPA 4WFEE 3SDXE 3DV6B 1JFHA 5D71L 5DMKA 1RUKL 3ZBMA 1RL1A 2EO7A 5EBWA 1N0NA 1QABA 2ZX8A 4PS4H 5CUSH 4NKOA 1N59B 3BSZH 1MXGA 5B39A 1EGJL 2JQAA 4S2SB 5IIEA 4RGOH 3W57A 3PWJB 2J8HA 1AR1D 5C0DB 2F54A 1AXSA 3L6FA 3VSTA 1ZLEA 2J56A 4ZPVA 1HDMA 2DYRB 1OSPH 3MOAH 3VDBA 1MCCA 3T0XA 1OQXA 3LH2H 1XDTT 2F1EA 2EABA 3CB2A 4FGMA 1VQMV 2JE8A 3FXIC 3ETEA 5I1DB 3EVKA 4P5KB 1UATA 2PF6A 1BXAA 3QNEA 1VFBB 1RZQA 4P5RA 4YHPB 4MTFA 3OLEA 4QHMA 4FM1A 5EC2B 2W91A 2CDEA 5INDA 4K35A 3VXPA 4L4VB 3WEOA 3WU1A 5BQDA 2VLMD 2XZAH 3V6ZB 1N12A 3WB2A 2CPUA 3M07A 2L4OA 2Q7HA 2QEJA 1OARL 3NAAL 3MJ6A 1M2OA 3BP4B 2H9GA 2Q3AA 3PXHA 4DK1A 3RFZA 4BE6A 2G0KA 2K3TA 5CEXB 1FRGH 4PJ9C 1KCWA 2Y5EA 4BFIA 5BS0E 1BYNA 3EDEA 4QRRE 2W0PA 2R39A 3GZKA 4FABH 3GMLA 4C56A 4LAJH 4LFBB 1BQZA 3CAFA 5DFVD 2YSTA 4LSRL 3BHPA 3UJIH 1WBXB 5TPWH 5GJTH 3O3BA 5L8KB 3AM8A 2DOCA 4JPKL 3QIBC 1QSEA 5FECB 5C0RL 3OB0K 1SY6L 4FAAB 5DZAA 3RWFA 3KJ4C 1VPOH 3WL9B 3KL5A 3HJEA 5KOVC 1CVRA 1KB5H 4YY3O 1XGTB 3TFKD 5C0FB 2FCBA 2K9UA 1RZKH 3K5MA 4XBGB 3NPSB 1OSZB 3MA9H 4E36A 4YHLL 1QPKA 1HINH 2ZKMX 2QQKL 1QHQA 2H0FA 4FLSA 3X3GH 5FO8B 2DJVA 2VXQA 2FX8L 1AO7A 2QHRL 2YMXL 4HV8A 1DBJL 3BWUC 1UQSA 3BT0A 5DS2A 3ARXA 5EFIB 5J9PC 3P3UA 1N67A 4ALAH 5LOVA 3E3QC 4F33B 4H7VA 2LU4A 3WEAA 1MXDA 1ZTEA 1GS7A 3AABA 3BPLC 4TNGA 3APQA 1IE4A 5KVFE 2XWTB 1MJJB 1TVKB 1DVFA 2BDNH 4EIUA 3EJPA 1YEWA 3HKBA 3NZ8B 3L4CA 3CCUV 1B2WH 2FJFA 5GS0C 2HTLD 2VSKB 2O5ZH 2NY0B 4OW6A 2WWKT 3LDCA 2B1AH 1VERA 4IIJB 4JFOA 4AYID 3QORA 5KTEL 1HYRC 4G43A 4HYTB 2CHXA 1K5WA 3L4WA 2AHZA 3N9GL 2NY4C 1WDAA 1CQYA 2LE9A 1MIML 4YZFE 4R7CA 4G82A 5BRPA 1Z0MA 3F7YC 5H37H 4WTXA 2VN5A 3GI8L 2D3JA 2GJ6A 1SERA 4Y16A 1QA9A 1A7OL 4LL9A 5GIRB 4PRPD 3ZK0A 3CWGA 5GZND 3ARTA 4P5TC 4XN1A 4OJAA 4DR7B 4I18B 5E2VH 1CXLA 2HVJC 2YEZA 3VXSE 3QDHA 2I07A 1EIBA 2P4AB 3D0LA 3BEWA 4KOCA 4QKTA 5SWZE 1UM6L 4NNXB 3GHEL 4DP5X 3CCLV 5CBAA 5ALBH 5JQIB 4OZHE 3PABA 5H2FZ 4FQHB 4CU8A 1GYVA 3DSQA 2AMGA 3B83A 4U7MA 1MRCL 4HIEA 2DTSA 3W9DB 2KDYA 3CFDB 3UP1A 2BPBA 2PXYC 3QXAA 1JWMA 1OGAE 5DZVA 3ASNB 1N18A 1XH1A 3KDMB 3HPJA 1Z3GL 5L7XL 4XPGH 1D7CA 3E9UA 3VXUA 4B7IA 4DW0A 5I1JH 2VIRB 3VD2A 4G7VL 5I6LA 1NGXB 4M02A 4WU7A 1HHHA 1ASPA 1MLCB 5BR8O 1V9PA 4PTUA 4U2YA 5EOQL 5DFWH 3H9HB 2NZ1A 4JCWA 4N2DA 1NC4D 4UOJA 4P2ZA 3D39A 4TV9A 4RZKA 2OKMA 4X0KB 5MHSE 3VX0A 2UU9O 3CDCA 3AB0B 3RB5A 8FABB 2YPLA 3B6SB 2WGXA 4EI6B 5ILTL 2IVFC 2NR6C 3GI9H 1GJUA 1R3KB 4Q14A 1K4DC 1TTUA 1OSEA 1I9JL 2F8OA 3AS0A 3ARRA 3GJEB 2ITEA 2WLLA 3M1BA 1A7RL 3FB8C 2YR3A 2VWEC 4G6JH 1YSOA 1X9RA 1ZTXH 4YQXH 2EH7H 2XPGA 3G4SV 1URIA 2DRUA 1CL7L 3F7VB 2FQEA 1E90A 4G1EA 4YDLB 3AY2A 3RN4A 3ZUNC 2P7TB 3ASWA 2TSBA 3NFSH 3VBBA 1P9MC 3QEHA 4JN2A 5JORA 2Y25A 1QFWI 4NAQA 5BRZD 2VXSH 1MWOA 4JHAH 1RHHB 1XGUA 1XSOA 2AEOA 5FKPB 1CF8L 1KBPA 1S4IA 2ZICA 5HHOE 4QRUB 3OL2A 2BP0A 3M6DA 5IJ9B 1J1XL 1WEJH 2MOQA 3LXBA 1Z5VA 1NFIA 1SESA 5KBLA 5F1OB 2LAAA 5IG7B 4DP9X 5JZ7C 4GAJH 3D07A 2DMXA 2VH5L 2LVCA 3IDUA 4JZJA 2LLLA 4NBXB 3ZT7A 4OCYH 2YA0A 5BUPA 1T6BX 1KTLA 4LZKA 1RP8A 1QLFB 3LSOB 3QEQE 4FQQB 4J2XA 4O02L 3GGWA 1J5OL 3EFFB 4PYGA 1O6TA 2J57A 4BH8A 4XRCA 2QJ1A 4HCRH 2J8UA 3NXSA 3S98A 5I9QB 2HZHA 1FNSH 3QRGH 4DQAA 2ADPA 1ZS8B 2EXSA 5LBSA 1K73W 1E2ZA 1S5IH 1R34A 4ZKIA 4F58L 1FO0L 2ZINA 1S5HB 1Q0XL 2DY2A 1MG2C 2ZYHA 3NJKA 4LE8A 4GBXB 5DS8B 1QPPA 3TYFA 1PEWA 2NXZC 3VI3A 4CH3A 2WMPA 4AC4A 3FO9B 1VZGA 3HB3D 2E4TA 3V95A 5MEND 1Y1UA 2B2XH 1TJHH 4U1HB 2BCMA 4ZTEA 4HJUA 3ZMNA 1BPLB 5KAIZ 4X5XA 5EZJA 1F3RB 4M61A 1ORQC 1KBGL 1NIDA 4K7FA 4GB9A 5FYJE 5E6SB 5AYUH 2NW3B 3QUYB 3FAWA 1K9TA 2IPUG 2VXQL 5J2UB 1HNXO 3PHQA 4I2XB 3IN2A 1OCOC 1MCOL 1H3VA 1JQ0A 4BUGA 2Q7GA 5IYBO 2D31A 3KPPB 5D1ZD 4GI9A 1IMHC 3KM2A 3O4LB 3QAQA 4XPBH 4S0TD 1OHZA 4QXUL 1OP4A 2ZWLT 1JXDA 5DQ9A 4NBZB 2BSED 4P2OD 3WNMA 2C3HA 5LAXB 3CCVV 2ITDC 3S4SG 3U1SH 3OVUB 1FFOA 5TFSL 4D9LL 4S11A 2HJKA 3E83A 2OX5B 2R4SL 4JFFB 4PJFA 5G2NA 4KKPA 2O5XH 2VDMH 3UTSB 1OTSD 3WKNA 1DUZA 2D7PA 3QJOA 4XVSH 3Q2LA 1O9GA 4HIQA 4PD4J 2L04A 3S3BB 5H6RA 1IVSA 1IGIL 3DVIA 1L3NA 3QYMA 4WUUD 4AEIH 3JV6B 5JUEL 1P5UC 3ZSTA 3S3PA 4NSKA 1HW7A 1M2VB 3ZQ9A 4K8ZA 3K81A 4XO4A 4TUOA 3T2LA 3MCLH 3EH5B 5D6DA 1N32O 1BD2D 1KTBA 1SQ2N 1E5AA 3NSYA 3QULB 2PUQT 3MX0A 5C07B 2QVTA 1PDKB 3LS4L 3IFLH 4XP1H 1UM4H 1ECZA 5BXFB 5LXGH 2ZXWC 2RH0A 3BD5A 5CGTA 2BW5A 5F88A 4GQZA 2F74B 3QWQB 4AGQA 4LHUG 3GLDA 4NQVA 2DWDB 2FECL 4PRBA 4JFPA 3D08A 4L23A 3V0VA 3WI9A 2ZE6A 3DVNB 1I9IH 3JTTA 1YTFD 3P69A 4HU2A 4N2GA 4ZK8A 3VXRD 5DGQA 2YD7A 3HS0B 1KGIA 2DYRC 2ODIA 3CU7A 1KGWA 1PY4A 5D1QA 1YN6A 3GPSA 1ZHNB 3ZE2E 4IGBD 4YDZA 1LK3L 4PRDA 4X99A 4G9FA 4WF7A 2EIMC 1RSYA 2AQ3A 1BGXL 2VJXA 1P7GA 1QSFA 1U8QA 4I3RH 5EBGA 5F9WB 5IOPA 3UIZA 3GZPA 3NIGE 2X4NB 1X3DA 3OD4A 1F8TL 2ODHA 2X41A 3VU2A 4KDVA 3S3CB 4ZZFA 2WINA 3ZHDA 1NI8A 5TDNB 1TQCB 3HKCA 4M4RB 4ZW3A 3P0VH 4PVBA 4FLHA 1C7SA 3QCVH 1VGEH 4N87A 4X7SH 2R1YA 1A9BA 5HDWA 3QJSB 3EDFA 4PJGB 2LU7A 3VD0A 4EVNB 5K9OA 15C8L 3WTSA 1LILA 3ZMRA 1MELA 2BNRE 1FXKC 1LO5A 1NM4A 2AW2A 4KTDH 5EC1B 1KULA 4M62H 1NCCL 2WJ7A 2MNWA 3DX6B 3CH1A 4LNRB 3L72H 3QHFH 4WI5A 2K4WA 2YAMA 4JDTH 4PY7B 2XIBA 1R3IH 1PIGA 1TITA 4RDQG 4KZ0A 4PJEE 4TLUA 3TH3T 4AUUA 1CXKA 1E4XH 1S3JA 3CVIH 1MCNA 4M93B 1MSDA 1E6OH 1ZEAH 1VQ4V 1PD3A 1P84J 2XAGA 1EDHA 3TIDB 4OGAD 4FERA 4DKEH 3QG7L 5DVNA 4KH9A 1JHLH 1JX9A 2VR3A 5FHBH 1OAJA 3CLEL 1H19A 1FZKA 3OB0H 4JO2L 4CNIA 4P2AA 3NZHL 5LBSL 3EJQA 5ELIA 3FTZA 4WNJA 3ABLC 1OCZB 1YIJV 1Y0LA 4BQ6A 5AW7B 3CZKA 1KLGA 1LEKB 1S78D 4MJIA 1BAGA 1OCRB 4QJ4B 3QR1A 4PDMA 4N90E 1MKFA 4U1JA 4MX7A 3MXVL 5K39A 3DUSA 2VJ8A 1Q9WA 4IRSD 4HG4J 3ZHUA 1Z9SB 3K6SA 2X1WL 2ZQKA 4HPOL 4WZ9A 5FXCH 2HB0A 3NJJA 2BLFA 1AIFB 1MJ7L 4K8RL 1A4KA 5FKAB 5IFJA 2HP8A 3MRQA 4LIQE 3FTGA 1NT2B 3WENA 1N36B 3U46A 1UADC 1KT2B 2D03L 1N64H 2A6DB 2IG2H 3LZLA 3LPOA 2QDOA 2HFGL 2EO9A 4TUYA 1MHPH 4JYAO 3TA3B 5HYQB 1MH5A 1CI3M 4R0LA 2R7EA 4TVPH 4CSPA 2ZSWA 2EQDA 1EEQA 1Y74A 4G2KA 3MLUH 5C0AA 1QR1A 4ODSH 1CK0L 1CE1H 1S9VB 2XU9A 5GGVL 2WP3O 1A8ZA 5LBGA 5HD8C 4O2CB 5IMKA 3CSBA 5I24A 4GRMB 4PHZA 2R29A 4UXNA 3O0RL 4I18C 4X7TA 3BMWA 5LN4A 5DRZB 4A7SA 1GVIA 2TRYA 5DEFA 2DLGA 3F84A 4XXDB 1YPZB 1VQOV 1L6XA 4RH4A 4FYQA 5HFLA 2JNZA 3GSXA 1QTPA 4W9FC 5I6MA 5IFHL 3FF8A 2BWDA 1R5WB 3MOQA 3MRDB 3E35A 4LL4A 3QZWG 4QJFB 3ZVVA 2ZUUA 1I85A 4JFZH 3T6VA 3L5IA 1NSNL 2GCYA 3V7AE 4F57H 4AQAA 4K5OA 2AXWA 2WSPA 4P06A 4WDIB 1A3LH 4Z7NE 4X4ME 1AR1B 5HGDB 5C0IB 2V3FA 1R5IB 1K92A 5IEKA 3D18A 4O4IA 2XG5A 3GBML 4E41A 1NCGA 5BV7C 4KJPD 5TQ0H 4RMTA 3H1KH 4YGAB 4IIQA 4MMZA 3TFBA 1GPOL 1B6UA 2RCSL 1BG1A 3TPUA 4MASA 1U33A 1U2YA 3EFOB 2ZDIC 2VM3A 4BIZA 4NQTA 5CP3H 4HKBB 2R1WB 1N0XL 5I30L 3N1MC 1BM3L 1BVNT 3I9AA 4NDMB 5FO9A 2E9IA 1I7RA 3F65A 3OXSB 4HGKC 4OBSA 2Z6FA 4YDLC 4FQXA 2EX3A 2NY6D 4XBEH 5D7KD 4F7PA 2A3QA 4QOKD 4X9YA 4H40A 3BIKA 2VMJA 1XXDC 2N59A 5FPOA 2FT7A 1UA7A 2P8MB 2WNGA 3P11L 4IOSA 1H9VA 3JWDL 4GIPD 4X1KA 4ZFGL 2DEXX 4W9JC 3MREB 4TVPD 4UVCA 3V4PL 3R19A 3EOTL 3F7QA 4L37A 4Y19E 1RPOA 1GYWA 1QTYT 4FFYA 4YFDB 5DK2A 2Q68A 4OF0A 2X2YA 4JGJA 4J6RH 4M7LT 4XNYH 2UWEA 2X4UB 1TENA 2ADQB 1AQDB 3PE9A 4LDCA 4XAWH 2MCPL 1JRHI 2APXA 2FMLA 1FJ1B 1E4KA 1MFCL 1R46A 4MAYB 1WK0A 1HCVA 4S1DC 2JCCE 4QRBA 3QUXA 5KSBA 4O4LB 2XTSA 3FRPG 5C0DA 5EIIA 2P80A 3BWAA 1D6VL 5I9QC 2XUWA 3DYOA 5A7EA 2WO4A 1JYWA 2KLTA 2V2WB 4EIBA 1S5HC 5D2NB 4QXTB 3A6BH 5H35B 2NUTA 4J5VA 4HDIA 3BFWA 4QMEA 4XNBA 1WBYB 4GSUA 5GRUL 1S7VA 3VSVA 5B38B 4E9XA 3GWOA 5CM1A 3CJJA 1CTMA 3H42L 4OLVH 4DZ8B 2A9ML 3ZIMA 2B14A 1UEYA 4YBLB 2YIBD 3TGUH 4K15A 5AVZB 5FDWA 3HE6A 4AT6B 5T1LA 3RL2B 2XWCA 2N0MA 3DARA 3AK2A 4GJTB 1KFAH 3M7MX 2WIIB 5CMAB 3OT7A 2VDKB 2WBJD 3VFRB 4Z7VA 5SX4H 5E1AA 3SKJH 4P23D 4Z7QB 5HGHA 3D87B 1ZL8B 4YWGL 2XVGA 2FJHA 1P0SE 1OAUL 3UAFA 4GRWE 3SGEH 1YEIH 3BVXA 4L05A 4R7LA 5E5UB 1XEDA 4PG9A 1MI5D 1N34O 3Q1SL 3EGSA 4J27A 3CQFA 3GKWH 2QSQA 2NOYA 3WTVA 3MBXL 1HYSD 1IX2A 2ED9A 3IF1A 3MVSA 4OGYH 3UFIA 2HRHA 4ODHL 4UCFA 2CMRL 4LPTA 3Q7JA 4KPHL 2VDOH 4DT2A 1TAEA 2BVOA 2GJZB 1KZQA 4Q6IA 4P9HC 2IF7A 4PRPB 4JYBA 4PLJC 4C83B 4YHNB 4ZT1A 3OXRA 2W0FB 2UZIL 4XP5H 3JTSB 4XMKH 3JATB 5JJJB 1A4CA 3B77A 2WXOA 4G11A 1TETH 4P3DA 5C0CD 5M7QA 5BZBA 5J6HB 1H8OA 2MNUA 2XKUA 1VENA 4BUQA 3VRLF 2YD5A 3HMXA 4L0ZA 2JEXA 2VXTL 2YGOA 4KDTC 1YJNV 2EBOA 1QI5A 4XN4A 2PUSA 3CRCA 2WVSA 4QE7A 3RYCA 1SXAA 2UXGA 3U6XS 1FFTB 1EBAA 2WM0A 2A7WA 2YDEA 3WNOA 4LCVA 2FWSA 2IDFA 1UB5A 4GYCB 1A22B 4J3OG 4CN1A 3FSAA 1OCWH 2IDCA 3S9DB 4UAOB 1JV5B 1CICC 1DQLH 1KB5B 1S9YB 2VMDA 4HS6A 5I19H 2KH2B 2LU3A 3SCMA 3TA4D 3QXTA 5I6XC 2RTTA 4TT3G 1YJDC 2NY5C 5CP7B 2NPLX 4Y9CA 5KBDA 1DLHB 1BVOA 4APQA 4X98A 5J13B 3CSYB 1IT9H 3FT1A 3U4AA 4HXAH 3RKPA 4K7PH 3V2AR 2C9RA 1A7QL 1DZ0A 4Y8AA 4BHUI 4FXKC 5KLVH 1BVKA 2JJSA 4FLRA 5TF0A 4MT8A 2I60L 1M57C 4FLTA 1NGPL 3S8FB 2VM9A 2LO1A 1THCA 2X7RB 2JV6A 1OT4A 4R7DA 1NTKH 2DQIL 3RIFF 1EEYB 2UV3A 2VLJE 1WE5A 3MLYH 1LWJA 1PX8A 4EPSA 5BO1L 1KECA 5JHDD 2ZOUA 1CFQA 4LLDA 1J5DA 1LYQA 4HIJA 1QBZA 5DUBB 2A1WH 4JPIA 4LLYA 5AVYB 3QJRB 3UCQA 1N8ZB 4FNTA 5BRZB 3IDXH 1V3MA 3QH3B 3F7PC 3B8NA 4Y2DA 3VWJC 1E6JL 3LSSA 2AGJH 3GMNB 2GHZA 2F9BT 4DN4L 3UC0H 4HZ1A 4R83A 1JHTB 3BN3B 3VQVA 1HNYA 3CXHF 4JI5O 1G7QB 1NMAL 3N91A 4HF5L 4X80L 4DKFL 3CFEB 3KHQA 5EO9A 2P46B 1XGQA 2P5OA 1EJOL 2NY1D 3QDME 5F7DA 2WYIA 2Z0BA 1QEXA 5T5FH 3DI3B 5EC1C 4L8SC 4GSRA 4JQVA 4O4YL 4AV4A 4XAKE 4PGEA 4OQTH