5KUKA

Crystal structure of inward rectifier kir2.2 k62w mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
total genus 97
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kukA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kukA01
1U4FA 3SPHA 4JTCB 4J9ZB 2YEVA 4R7CA 3K6NA 2QKSA 4PA9A 4ZBMA 4MVUA 3FB7C 4PA3A 3SYCA 1R3KC 3UKMA 3ATBA 2EIJC 2EIKC 3K0DA 5CBHA 2ZD9A 4GX1A 3ABLC 3SYPA 3FB6C 4F4LA 1R3JC 4PA7A 2X6BA 3RBZA 3K06A 4QE9A 2H8PC 1OCZC 3F7VC 3K03A 4HZ3A 2HJFC 3AT8A 2DYRC 2WLJA 3K08A 4PDVA 3WG7C 4RAIA 5CBFA 2WLIA 4PDMA 4LP8A 1OCCC 4R50A 3SPCA 1V55C 1N9PA 4MVZA 2HFEC 3ATEA 3AUWB 3ATDA 2Q67A 3AG2C 4RO2A 3T2MA 2WLLA 3PJSK 5J9PC 2HVJC 4UUJC 2A0LA 2ITDC 4MTGA 4OXSA 4JTAB 4MVOA 4MTOA 4XDJA 4EKWA 2ITCC 3LDCA 1J95A 3KG2A 1S5HC 2DWDC 2BOCC 2EINC 2A79B 4PA4A 4WFGA 4X88A 4P30A 4X89A 5IY5C 4BW5A 3T1CA 3OUFA 4WFFA 3SYAA 2WLKA 3T4DA 4R6ZA 3ABMC 3AG1C 4MW8A 4PA6A 3IFXA 1LNQA 4P2ZA 3SPIA 3ABKC 2EIMC 3AG3C 3SJQC 3ZRSA 5BZBA 3E83A 4QNHB 5EC1C 2E4FA 2EILC 1ZWIC 3E86A 3BEHA 2WLIB 3E8BA 3E8HA 2DYSC 4G28B 3K0GA 1OCOC 3GB7C 4PDLA 2OCCC 3STZC 5B3SC 1G4YB 3ATAA 3K04A 4MTFA 3LNMB 4DXWA 4MSWC 3E89A 5B1BC 3ASOC 2Q6AA 4P9PA 5EBWC 5EBLC 2KB1A 2HVKC 4MW3A 1JVMA 2W0FC 4I9WA 2X6CA 3SYOA 2WLHA 5B1AC 4LBEC 1V54C 2BOBC 3IGAC 2NLJC 3LDEA 3E8FA 4MVQA 3UM7A 3AGWA 1R3IC 3ASNC 5EC2C 2K1EA 4P9OA 3F5WC 2IH1C 2P7TC 4CBCA 1R3LC 2X6AA 5EK0A 3LDDA 3TCUA 4HYOA 3OR7C 2Q68A 4GX0A 4XDLA 4G27B 5CBGA 3E8GA 1QLEC 3EFFK 3FB8C 4XDKA 2QTOA 3F7YC 3RVYA 5E1AC 4KFMA 4R8CA 1M57C 4PDRA 4MS2A 4RUEA 2Y69C 2DWEC 1K4DC 1M56C 5KUMA 3TETA 3OUSA 3VSQA 2WLNA 4RUFA 3AT9A 4GX2A 1U4EA 2WLLB 2ZXWC 4H33A 4WFHA 4MVSA 1BL8A 4LCUC 2Q69A 2IH3C 3JYCA 3X2QC 3STLC 4X8AA 4H37A 4MVMA 4GX5A 3OR6C 2A9HA 3SYQA 3ZJZA 3VOUA 3AG4C 3HPLC 3SPJA 3T4ZA 5KUKA 3LUTB 2GIXA 3ATFA 1XL6A 3RVZA 1ORQC 4WFEA 3OGCC 3R65A 1OCRC 5EBMC 4J9YB 3RW0A 2JK5C 4QE7A 1K4CC 1XL4A 2R9RB 2WLMA 4MVRA 2HG5C 4JTDB 2AHZA 3SPGA 2AHYA 2ATKC 3FB5C 1P7BA 4TWKA 1KKDA
chains in the Genus database with same CATH superfamily
4NCC2 2V5TA 1NLDL 3CCUV 2UY6A 5GSRA 5IZ7A 4DR2B 2WXJA 3CHOA 3NCJL 4U3SA 4KKAD 4A6YH 4JFVA 4HSCX 2DI9A 1WC7B 5CEYA 1UXWB 3ECUA 5K69A 3O6KL 5EUOA 4P2OD 1G7MA 2ZE6A 1BYOA 4LL1A 2KSDA 1CL7H 2H2SC 1R5IB 1T2JA 1N32O 2R23B 3GMRB 1XB3A 3MYZA 4I89A 2BLFA 4G5AA 5FL7G 2KZBA 3EYOB 3S8WA 1A3ZA 5DHDA 1SDAB 4MZRA 2O6CA 4HIPA 3KM2A 3BSHA 4TUYB 3DUSB 4HS3B 4LBEA 1LUWA 4XAKE 4AYGA 5E8EA 4WFEE 2ZSWB 2HFFA 2YKLH 3MLRL 1BS3A 3B7TA 5HHVH 4RESB 3DXAB 3JVGC 4JTAB 5F97E 2MEJB 1INEH 2ZDIC 2BZDA 1WPCA 4U1MA 5E6ID 1KPUA 3UCQA 2PW1B 4HBCL 1EEUA 4AC4A 3OUFA 2VDQB 2GITA 3BKMH 3ZEDA 1S7SA 3DK2A 1OPOA 1P84J 1ZDSA 3QA3A 2WA4A 4NO0D 4B3EA 4FQJL 4QTIL 4NUMA 4RMVA 4XVOA 4DP1X 5AD0A 4NBXB 3DX7B 2XTAA 1FVCA 4GAJH 4OB5L 4PWEA 5H94A 5T1DH 2DH2A 1N4XH 4LEOB 3SODB 2Y7QA 1IC7L 2X89D 3S34H 5IB4B 4JYYA 2ZUYA 1SJHB 2GY7B 2W8CA 3G7TA 4RWYH 2AXWA 1UD2A 3QUZA 3EDDA 4X1IB 2MNWA 3O3AB 4YDIL 2NY6C 4NT6A 4LLVA 2K4WA 3P2DA 1Z0NA 3VXPA 3HFMH 4LF7B 4N6RB 2VH5L 2BE3A 3O3DB 2Z0UA 3DX8B 3B5TA 3C5JA 3F00A 3CX2A 3UABA 2DF3A 4O51B 2FGWL 3GMQB 1CD9B 5PAZA 3R66A 2YAQA 4QOKD 4CMMA 1YEFL 2UUAB 4K9JA 4UF7C 4Y5YC 3EYVA 5EBWB 4CUCA 4NHUA 4GRWB 3VW3H 4B96A 3DV6B 3B2UC 1OF0A 2OI9B 3N43F 4XR8C 1BZOA 1U8MB 4P46A 4TSBH 2HMID 1DBML 2GJ6D 4JFZL 3FAVA 4OLWL 4JPWH 4DP0X 3L4YA 4H0LB 3PHOB 1H9VA 2AEQL 4FD0A 4WJG3 3GDBA 1U0QA 2XXFA 4HS6B 4NKDB 4R2GD 3QQXA 1QVOA 2XQBL 4MYWB 3RVZA 3KCPA 4X9FA 3VI3E 5BRZB 1HAWA 2F54D 2GHYA 4WHDA 2R0KH 2IXQA 1QBML 2D7QA 2J57A 2J5LB 1GR7A 2VDNB 4R84A 5E7FA 5IHHA 4NX0A 1YJNV 2KC0A 5DHYB 4IYHA 1I82A 1MUJB 2L7JA 3G5YA 5DLML 3QNZB 3QXVA 2VT0A 3EBAA 5EZJB 2YEVA 4E5XA 3OAUH 5EF3A 3ZHFA 4RX4D 1PTZA 3P3TA 5F6IB 4OZHF 4FXTA 2YIBA 2RCSL 4I2XE 4RBPH 5A7BA 3F7YA 3FQTB 1T1ZA 4E9SA 5E4IA 1BHAA 1WUNT 1FZMA 4IRJB 3GIZH 5F96L 3QUKB 4XB7A 3MJ9A 4M7LT 3GNML 1JN6B 1XSKA 4Z1VA 1S77D 3HHSA 4G9FD 3ZSSA 3QEUA 5FOBB 1RUPH 2I69A 4TLTA 2WLJA 1OB0A 1QBZA 3SGEI 3RDTD 2Y0PA 3ZDZB 2OTUA 3B2PA 4ZQKB 4YY3B 1F4WL 5IB1B 2HTLC 4Y5VB 1S5HB 5D1ZA 2RBLA 1CLOH 2PYFA 1CPUA 1NZ6A 3PJLA 3QDGB 1FL6A 1FH5H 5BVJB 3MVSA 2YPLE 4ELDA 1SHXA 2D7NA 3Q01A 1Z5LA 3E9TA 4MBOA 2Y24A 3ROLB 1BXXA 3Q2VA 4Z7QE 1RSYA 4U7MA 5DMGC 3TVMD 4QJ5B 2VWKA 3DRQB 3VQVA 3NJKA 5E6SB 1VKXB 1AI1L 5IJCC 2F19L 5CD5C 4OZ4A 1V7NH 2Q76B 1R17A 3QZWG 1S5IL 4JGSA 5DJ0A 1N2RB 3M6DA 3V4LA 2DQJL 5E8NA 4CJ1A 1KEGH 5CR1A 3A4DA 4QIRA 4PUBL 4Y4KB 1K8AW 1F0LA 2FYYB 3BAXA 3ULVD 1UKQA 5CILL 3KW7A 4PQXA 3WHE1 5AQ0A 3WYRA 3RAJL 2FX7L 3JAWB 5DEFB 4A7QA 5E2WH 4CRPA 4U33A 3WV0A 4PLOB 4R5XA 3BWUC 4NQXA 2XAJA 5C0EB 1YNTA 1JV5A 1DFBH 1KB9F 1X3DA 2D4FA 3PGDA 3N2GA 4X62B 3G4SV 3WI9A 1MF2L 1T20A 1CD1A 2VDKL 3GINA 1QLEC 4TSFG 2F53D 3TIDB 1M71A 4NO0B 3TV3H 5I1JL 4IL6Z 2N0KA 4BZ1A 3RVYA 3K3QA 2P06A 1QA9A 1PQZB 4L4TA 4P59H 4PDRA 4FEIA 4X8JA 3CD4A 2CUHA 4GKKO 2GI0A 5F3FA 4DW2L 2BINA 2P5WE 2XVBA 3ZKND 1YA5A 5F3BB 2IAMD 3VH8G 2OMZB 2VZSA 5KYUB 4AYEC 1GY1A 3JV6A 3IVKB 2FD6H 3N85H 2RQ6A 4ANKA 1VADA 3DX6A 2IH3C 1JZ2A 1GJUA 2X12A 1W6WA 1D5IH 5D2NE 1NCAH 5E2VL 3NAAL 1KLFB 4PJCE 1CF1A 2WCPA 5D9SA 4Z95L 3VFWB 3C6LD 2YUZA 4GQQA 4L8DB 4UILL 3TC9A 4HJJL 3UTQB 5AZEL 3V0FA 3EO1A 2MK3A 2G3XA 2BP0A 4DJMA 1BHGA 2WXMA 4QOKB 4GUQA 2HLDG 3ZE0B 5KBLA 2OXHA 2VC2L 4YDLB 1DLBA 5JW4R 2ATKC 1WP7A 2YGQA 3QQ9D 2V2XA 4JVPA 4O58H 4QRUB 3N42B 3CDZB 2GJ6B 3IFPA 1MRDL 4B3MO 2XWJB 1MZFA 2LABA 5I19H 2BNUB 3UKMA 3HNTH 1T0MA 5LXGL 2YI8A 1FP5A 1MWAB 6CGTA 1OW0A 2ZD9A 1HINL 1ZPLA 3SHSA 3ZX1A 3SYPA 1KPRB 3HC0A 4PJ8C 3OKYA 4Z78A 4IEFB 4JZNA 2AC0A 2ZP0T 1N6UA 2ZX7A 3G08A 3REVA 3NH7L 2R1XA 1U2YA 3AXIA 2ZNJA 2F54B 4N2GA 1RHFA 3CXHK 3U1SL 1R3HA 2MWCA 1H19A 1G9MH 2ITDB 1X5FA 3S2CA 1RP3B 1CJYA 1ACYH 1H8HG 1CK0H 2BZ7A 4JKPH 5DQ9A 4CMHC 1A3LL 2VXVH 3UZQB 3KXFB 4AMXA 5FGBA 4FMKA 4W9LC 4KO6A 4XXWA 2EXYC 2GYSA 2RD0A 3P9LA 5FW8A 5H2FZ 1I8LA 4LLMA 4PIRF 2CJUL 4RGNB 4KMTL 4PJFA 3RX9A 4DGVH 4I55A 3OHMB 1HCVA 5KAQF 3SGDI 3II3A 1ACCA 5FA4B 4JQXA 2GABA 5C0CA 2IGFH 2E4FA 4JGMA 1NGZB 1PLAA 3CFEB 3FUEA 1UXSA 4EMZA 4J3OC 3MUGB 3UERA 1OT4A 4XN4A 4FGMA 3GO1L 1B88A 2J72A 4OLUH 4TN9A 4LVEA 3AABA 3VXSD 2D2OA 3WD5H 1CU4H 3L5IA 4G8GE 5F1KC 5IVXF 1WZAA 1BAFL 4TOIA 2D0FA 3MAQA 4YBLC 3TZVB 2FEEL 4ANXA 3H3PH 3FQNA 3FUFA 5IW3A 4WW2B 4Y16D 2UXFA 2DJMA 3PWLB 2AV7A 2VQ4A 5IBUG 4ZFFB 7FABH 2EDLA 2KI6A 5E1QA 3TVMB 3H1HH 5AKVA 2H9GA 4UBDC 1MPAL 2VAAB 4BGDA 4JK0D 2YK1H 5LDSA 5JIDA 3FTXA 4ANVA 4G6JL 1MJUH 3RIAF 1GIGH 2J44A 4JI4O 1GAFL 4M02A 4X9HA 1IFHL 4WI6A 5LWYL 1NUGA 4GB9A 1A7OL 3EFDH 1JP5A 3QHZH 4LQ1A 2CLVA 3DHMA 5B38A 2C1PA 4NRYA 5DU7A 5I0DA 4RDQF 4X9GA 5CGTA 3U30B 5DK2A 3UFIA 1ECYA 1JF6A 4IOSA 2ADIA 4YDKL 2H6UA 3CDGA 4GQZA 5CCKL 3SYQA 3VOUA 5B66Z 2ZUVA 4RFOH 1I4FB 1MZEA 3D3VE 4M6NL 4N90E 5E08L 2WVUA 3T65A 3L6FA 1BREA 4GSQA 2KDGA 5I30H 5IIEB 2OCFD 3K9AA 1P6FA 2F7RA 3OSVA 4UIMA 1N5AB 4M8RA 4YC2B 1T21B 2AHYA 1O7SA 3ZE1F 1P7BA 3PWVA 1QSFD 4Y5XA 1RL1A 2Z65C 5IHZA 1QSVA 3TO4C 4EQ2A 3MKKA 4G59C 3CJJA 3U9UB 3HE7A 3RTQA 4IHOA 3PE9A 4HLEA 2YAEA 2WNKA 4R26L 5CINL 4F8TA 1H2GA 3WMQA 1LO2L 2IDUA 5DZVA 2KQNA 3BEVB 2NXZC 3FCUB 2YQBA 1H0DB 1LLAA 1OTUC 5B39A 3LPWA 3ARXA 3BDXA 4NZRH 2Z8SA 2PWDA 5E9DA 3WSQL 1J10A 4IIQB 1KV3A 2JJUA 5E51A 3TBYA 3V5KA 2JS5A 4PG2A 4ECNA 4HGWB 3RGHA 4HFUH 4XPHL 1IGYB 1HCZA 3MV8D 4YBQD 1I8IB 1AGEB 1RZKC 3M8OH 4A7VA 3IGAA 4JRYD 3MPCA 4W6WB 1Q1JL 4TULH 4U6VH 1ONQA 3P3PA 4MLSA 4TUKH 3NRFA 4Z1PA 3KLSA 2Q7YA 4NBYB 5E1IA 1Q3EA 1AANA 2XT1B 4UDUB 1LMKA 1J18A 3GSNA 3D2UA 4RZCA 3MLXL 3HTLX 4IRSD 5JQGA 3BAJA 5DEGA 3O41B 4LMQE 4M5TA 4WFFA 4AKQA 4G7YL 3UGUA 1Q38A 3BP5B 4OX9O 2CMRH 2V5SA 3SEPA 1BZ7A 3SJQC 5HI4D 4LL9A 4ZJ9A 4MXWH 5A9GA 2IQAA 4H0IA 1I5YA 2GHZA 1V7MH 5IMMA 5BQ7A 5LGJA 1J12A 1EVTC 3V4PA 3E8HA 2BSTA 4XNYH 3IJEB 2CXKA 1ASQA 1TZOA 3KPSB 1H8OA 3MR9B 1A7PH 4OM0L 2BDNL 1WFMA 4YSOA 3V4VL 3ZN1A 4J39A 1J11A 3B6SB 1E5ZA 3C8DA 1ZDQA 4S1RL 4NTXA 2WTPA 5HHOB 4MMXC 1A14L 4NUQA 3NABL 5BJTA 1GGUA 1IBMO 4YAQA 3AU0A 4JI1O 1E2ZA 5C71A 3QJRB 3WOVA 1JHKL 1EPFA 4M7LH 4EPSA 2P1YA 2QFRA 1OP9A 3DO7B 1MQKL 1SQMA 4DQOH 1G7JA 2AK4A 1X5ZA 3F05A 3ZL1A 3QDMA 3WMPA 2KUTA 4FJYA 3NFSH 1IGFH 3QEQA 1JFFB 2KKQA 1OGSA 3CHQA 5D2NC 4L8SA 5J2TB 4PW9A 5JOFB 2I24N 1OAUL 3MRNB 3DMMC 4PJ7B 2XAHA 2QV2A 4D94A 1BYPA 4Y16B 3GPSA 2CO2A 1B9ZA 4NM8H 4I9WE 2CH7B 3VRLE 1P5UC 4GKOA 3JSLA 2EDOA 3BX7C 5LG1A 1ZGLB 1WD8A 3TV8A 2LLGA 2ZQKA 3UH8A 5T33L 3EXAA 1ZXQA 4OIBA 2YRLA 1KXTB 5DD6A 2XC8A 5TE4L 1MLBA 2R29A 4HUMB 1K2DA 1XTMA 4LIQH 2EDTA 1R3LA 1E6OL 4N87A 2R1WA 4PBWD 4U1HA 1SDYA 1YYMH 1FYTB 4X6DB 4DN4L 1A1OB 5J4MA 1NANI 3LKQA 5CBHA 1UHVA 3APOA 4WEBL 2B16A 5H6RA 5ACZA 2ZSVA 2XWZA 1YEHL 3MXWH 3TBSA 1KYOJ 3RP1A 2XWBA 4MJ6B 3MRLB 1T03H 2PN5A 1HNYA 1FZKB 1PG7X 3REWA 4L2YA 3N0PB 1YECH 4OLZH 4BFGA 2X4TB 4Q0XH 2NUPA 1R6TA 5CO1A 2N59A 1SUJA 5D7IF 5FO9B 4D8PA 2O5XH 5CIPB 4AW7A 4XOAA 1FFTB 5J6GA 1QSFB 2XIDA 3O0RH 4LLYB 3WE6A 1IC4H 2C4FU 4G8AC 1AHWC 5KVEH 1AQ8A 2R0LL 4PJHF 4MTOA 1DVQA 1DO5A 3ULUL 3VRIA 4F9LC 1XF2B 2CUGA 2WWMC 3K5RA 3OXRA 5KVDE 4CBPA 1TJIL 2ZCLH 2NX5D 2XAGA 1FG2B 1YO4A 3CN4A 3C6EA 3V52L 2JVDA 1E27A 1OARH 1UZGA 1X4YA 3JBG7 4JI6B 5EFIB 5I0YA 4J4PA 3TF4A 1RY7B 2AEWA 4OFDA 5LCVA 3MYJB 3ZHVA 5I1AA 2BVYA 5CSGA 1L0XA 4KO9A 3GMNA 3IWVA 4NQCA 1CVRA 4MJIA 3SGKC 4JRYB 4UXNA 1IAOA 3ZDYB 4AYDC 1HSBB 4MA3B 4MVBC 1ZVNA 3PV6B 4OLYH 4QHMB 1M93A 1DDTA 2N3JA 5AL8A 5CLXA 1CTOA 1MEXL 2EKSA 4I0PD 3TEYA 2O93L 3BGMB 2G3MA 4YDNA 3LD8B 5KHGA 4E2LA 3V4UL 3O2WL 1Q9KA 4KQ4L 2ZM6O 1BD2D 2YOCA 4LGSB 3A8TA 4IRSB 3LEYH 1ZHLA 1WP6A 4ALAL 5GS1A 3S3WA 4IKKA 2R7EB 3K4DA 1GGYA 3HZ3A 2LU7A 3EH2A 4XDKA 4DQAA 4MX7B 2DQEH 2FJHA 5D5ME 1WYJA 1G7IA 2CBMA 3GRWA 1JDDA 2DTSA 2H32B 2EXYD 2APWA 4HJUA 4LFHG 3V79C 3RWGB 1Q0EA 4LF6B 3PL6B 3GSNL 1SQVH 4F91B 4JL2A 3U1PA 4YHOH 3C08H 5G5DA 4WFHA 4JVWA 4GRLB 1RK1B 4LEBA 5D5QA 2DH3A 3JATB 1TETH 4R5TA 1UADC 4K3EH 1FIGH 4J3OD 4A6YB 4TKWA 4J6IA 1FNHA 2YD6A 1BGYH 1KGYE 4JI5B 2Z3FA 1KWGA 3THMH 4D9QD 1U8PA 4JN1H 1RFYA 5ECGA 1NZRA 4EQ3A 3QNXA 4DV5O 2K3TA 3Q6GL 3RX7A 3LVTA 4JPSA 3P4MA 2Y1VA 3SPHA 1GN4A 3P77B 3ARBC 3QJTB 4KKQA 4ZOLA 3VD1A 1A2YB 3VWKC 1OAKL 3X11B 5SV4A 3BSZA 1F13A 1OD7A 1YEDB 3B5HA 2VXQH 1B4RA 2BRQA 4JI8B 1QHTA 3FUIA 4N22A 3C87A 5BV7C 2ZX9A 2QLVB 2OXGA 1TPXC 4N0UE 4L9LC 4AT6B 4LDOB 4EXKA 3RBZA 2X4RA 3FKSG 4QE9A 4KI5C 2OYPA 2H8PC 3RFRA 5B21A 3V7AG 4EOWH 1RZGB 3RZWA 2YIDA 5F6HJ 4PY8I 3H9ZA 3CNKA 5EUOF 1IAIH 2N7SA 5SX5K 4X1KB 4OGQC 2ICEA 2H4EA 3MRCB 4UM9D 1C5CL 2M1KA 3CIAA 4YXKL 2BOBA 2IANB 2EINB 3EJQA 4OFIA 3KR3H 5I8OL 4Z0XA 3NJMA 3I55V 3HKCA 5HHQB 4EKWA 2WSDA 4MNQB 2FECL 4N24A 2VZOA 2XDHA 5B1JA 4JCWA 2IPKB 2A74B 3QISA 1MCHA 3JT2A 5KBPA 1JCVA 1RLBA 3CXDH 1QHOA 1DVYA 4Q9BA 3TO4D 3WLBA 1R24A 2EILC 1QPPA 2R29L 1CDJA 1GGCH 3H7LA 4N25A 2XPGB 4O2BB 3CSPA 3L3GA 4MQTB 3QEGL 1TUBA 4HGKC 4HSQA 4HWBA 3AS3A 2Q86A 4H88L 4UCRA 3MLSL 3QB7C 3PWUB 4B3TB 2NY5L 1JVMA 2BNRD 4C4KO 3CPUA 1S9VB 4Z7UB 1UM5L 2NR5A 1CFVH 2PUQT 4BFEA 2JK5A 4WTWA 1AD9B 4GEJA 3ZL4H 2UXXA 3RURA 1FSKB 3S37L 1E9QB 1K4DB 3O2VH 5F7WC 4R7NA 4OF7A 1MSDA 4Y2DA 5I18H 2N7BA 1YEEL 3LS5H 3IGLA 3CBRA 3MRBB 4F7KA 2IBZX 3F8UB 4NJAH 4CU8A 4MS2A 5ADOH 2OZ4A 4F33A 5LOVA 1KOAA 4NM4L 3T8XB 5F7EL 5D7LA 1VF6C 1NM4A 1NIBA 1EEZB 4MD0B 4LASH 2YPKB 5TK2A 5CN0A 4NQDB 5D70L 3T4AB 1MW2A 2XXCB 2Y48A 1AGFA 4B9KC 4APQB 4Z9KB 1TVKB 2W59A 3SBPA 3TA3D 4I0PB 1D6EB 3QUHA 2CDEA 3ZT7A 5EBMB 5JHDD 2Z92A 1SQQH 5DK3A 4Z1MG 1NGWA 1K4CB 5GGRY 4GAYA 1WBYB 1BD2B 1UWGL 4K0KB 1E4XH 3BLKA 1F1GA 1W0WA 1XDCA 2E7MA 2QADB 2BSKA 2R69H 2VLJD 1JCHA 2WLZA 3K1DA 5DXWA 3ZHRA 3S4SG 1BQRA 1BM3L 4WI3A 1JPXA 2P8PA 3UDWC 1CXEA 1SJEA 3X13B 5KS9E 3LZNA 3QE5A 1YN6A 3F04A 3K2UL 2AABH 1KJ2A 1T1XB 1HXYA 1OLLA 2EZ0D 4PB0L 2WQXA 5C97A 4JRXD 5IW6A 1VQ6V 4JFFE 5FB8A 2GK0B 3L3OB 4ODVH 3LN5A 1P53A 4R7CA 2CBTA 1I3GH 2LTQB 2OJZL 2QWQB 4DO2A 3K6NA 3LRGA 4P5KA 5FCUL 1IKFL 2R56H 1G7QA 5D7JB 5DQJB 4ZAKA 1UT1A 4NBZB 3GRWL 1I1FB 1SXSA 2ZWLT 4TSCL 3OX8B 5EU4B 3AS0A 3LRMA 2APXA 3MRDA 4J3BA 5JW3L 3CLEL 2O72A 2EDHA 1V55B 2BCCH 1X9UA 2CK2A 2JDIG 5KA6A 3SJBC 2EC9U 2RDCA 2WBWB 2A83B 2ENSA 4H8WC 1CE1L 4YIQA 3UTSA 4AQ8A 2NY2B 2NW2A 2YFNA 1UOKA 1JGLH 3HZYB 3CV5A 1UCBH 5C0BE 2ZCHH 4NGHL 2NLJA 3ATEA 3IDJA 2CJTA 4HFWB 1G5AA 5JR1H 1YC8A 1F45A 4GOSA 4ORZC 4ELMA 2LHAA 1E4WH 2W92A 4IOFC 1KELH 3O8XC 5EEWA 3L9RB 4JY6B 2W6IG 3I6KB 4HMEA 3CCEV 3UX9B 2B3IA 1Q1PA 3V9EA 1XVSA 5GZND 4ZMWA 1N6VA 1AC6A 4TVUA 3FHEA 4LVHC 4NNXA 1LD9B 1ETZA 3QJHA 5J56B 2LE9A 3BW9A 5DF0A 5J6HB 4B7IA 4OLXH 3LDBB 4YHHB 5K9JL 3CEIA 2X2YA 4FQPA 4Z3EA 4DP6X 3QFDB 3QRBA 4LPTA 1PYWB 3ZLQC 1SETA 4EDWH 1WFUA 2EVIA 3BPOC 3IRPX 4F7CA 5KSBF 3DSFL 1WD9A 5I75C 4PRPE 3WIIL 3E8FA 4I50B 4GSDH 4JYBA 1P84K 2OLDA 2DAVA 2V4LA 5FO8A 4WW1B 2OL3B 2CK0L 1L6ZA 1BP3B 4YSDA 3H2WA 2XAQA 5IF0A 4UIKH 1T7YA 3NIFF 1O9GA 4B08A 1YNTF 4WJKB 4UTAL 4TV9A 5E1AC 3K5LA 1OB1B 2CHWA 5EIIG 3UG4A 4FZEL 2R4SH 4YLCA 4PYHA 2PWHA 5D6DA 1HKFA 5CA3A 2FK9A 2WLNA 4JPVH 3P4NA 3BFWA 5JPMA 3CFDA 3TJPA 2IPUK 4JO2H 5ALBL 1I8AA 2NY4D 4DZ8A 5IM7A 4J3VA 2O61A 3ZIAG 4H37A 3OR6C 2OW6A 3LZFL 3RGBA 4LHUG 3P0YH 5DJAA 3I2CH 5T3ZH 1G0DA 1F4YH 4HHAB 1YZBA 1HFUA 1QUNA 2E7DA 2OYLA 3FB5B 2Z4QB 3OVUB 2YPVH 3MRQA 5EN2A 3A6BL 3C09B 4MZ2A 2V9QA 3BWAA 1HHKA 3W7UA 1EDHA 4HOMA 5LXVA 1YUHB 2WJ7A 3S5YA 2G9HB 2X4UA 3H1LH 3FT9A 2EIJB 2ZOLA 3L7FB 1IGIL 4RMBA 4GCZA 3PJNA 2BWDA 5CGMA 2GEEA 2X2JA 4KHTH 4U1JA 4UCFA 3KVPA 5B3JF 3L2LA 4HJIA 2OR9L 3OQRA 1T5KA 5FX3A 3ES6A 1NAMH 2J1XA 4JFDE 2HJFB 2GI7A 4IBQA 1IQDA 2ESVA 1JL8A 2DW5A 3FQXB 2OZ4L 4GMSH 2ZWNA 3WN5B 5HVGB 5GGRB 3PPEA 1YDXA 2DQIH 2J8UE 1QU7A 4DR4O 3MNVB 4PJ9C 3WEXA 3DVIA 4AE1A 1JA8A 4F5CE 3E2HC 5CCJA 1JWSB 3VD9A 1HCFX 2ITEA 3EGDB 3UZEA 3FT1A 4OF6A 4PWJA 2V1DA 3QWRA 3SBRA 3BXNA 3RFZB 2GTQA 3MOBH 3BLPX 4QKXB 1J1OH 4AJ0A 2QSCH 1JWMB 1IIKA 2N04A 3U82B 5SWQB 3TEZA 4IU3A 1A6VL 3LKOA 3ARZA 4R4NC 2K6YA 1UUNA 1K85A 3L1OL 2ZKOA 25C8L 2N05A 3AG3C 1QHQA 1TTFA 1I31A 3N0AA 4NZUL 1FJGO 4PJFF 1L3WA 3E6FB 4LLAA 1VLXA 1MREH 4M5YH 2NXYB 4FFZH 3ZMEA 2W6JG 3VXME 5BZWB 3D8MA 4P9HC 2PGGA 1DN0B 3MV9E 1MN4A 2P47B 2XV6B 4UANA 5ICXB 4BV1A 5KSUB 3W1ZA 4XBGB 2NY3B 2UXGA 4TL4A 4FQHA 1JNLL 4JF3A 3E1F1 4CH3A 5MHSE 4D9RD 3FBQA 4HJGA 3VQ2C 3WEOA 1XCTA 4F27A 4PJHE 3HBGA 3KCWA 1NVPD 1KCRL 1XH1A 3T6XA 5IP4A 4KO5A 1R4XA 4YSAA 3LXUX 5IFAH 2WUCL 5EOCH 3QDAA 4ZXBB 2KH2B 5C08E 6PAZA 3FSVA 3MA7B 4N0YH 2VZTA 4RWHA 1NBZA 2NY0B 2M83A 3MJ7B 1JGEA 2YS8A 3CE2A 4JDTH 1WBZB 4DCQA 3FT4A 4N0FA 4MAYA 1T2QH 2R0ZH 1HL5A 5IWLA 4H33A 4WY7H 4P99A 5EA0H 3J27A 4PRBB 4YZWA 4QYOB 4V1DE 4PI2A 5CP3H 3CMOL 2FO8A 4I3SH 1UGNA 3T2NL 4PMFA 4K23H 3ENEA 3H54A 2ATPA 4R8WH 3ATFA 2BNQB 4UB8Z 3WIFB 2CSPA 5GTHZ 4HCRH 1BQHA 4MDJB 1G7HA 3Q05A 1FV1B 4XVUC 2J73A 2V7HB 4JAMB 5J1AB 5EYPA 1SF9A 4JCMA 4WDIB 2O5ZL 4X80L 1PZ5B 3ZZLA 1I7FA 1DYZA 3D69B 1HNWO 2GUYA 1AP6A 4NQVA 5SWSA 2IG2L 2L3BA 4EI5A 4MDRA 2NR6A 3K3WA 4LLQB 2CO1A 4OKVB 4KTDH 2ED9A 4NB5A 3GSUA 4NQUA 2XFXB 1A32A 1XB8A 2C3VA 1QPXA 1ENVA 5J13B 1ZHNB 4HX1B 3LRLA 5LUMA 1URIA 3WTTA 2XKNB 2X6BA 4S10A 4U1LB 1QI5A 3VU2A 1MJJB 1PZDA 1ZLVH 3IFNH 1AP2B 4K3GA 1RK7A 1UYWH 4HZ3A 3DURA 5T5FA 4P5TB 1OTSD 3UTTD 5J3HC 3JT0A 2A6IB 4LCUA 2DS4A 4UV4L 4ZMYA 4UFZA 3FTYA 1YY8A 3MBED 1DBBL 3T2PA 3PWPB 4JPQA 5AYQA 1J5OL 1AP5A 5HJ3B 1T80A 4K5PA 5FKPA 1LO0H 3LPOA 1SRYA 3TK1A 4Y88A 1RFDL 5ERWA 3MRGB 1Q9WA 4ZW7A 4LK4A 2J43A 5F9AC 3TBTB 2NTFB 3UO2A 4KV5F 1I9EA 1FFXB 3V0IA 3RNKB 1YC7A 3FFDB 3J2PA 3GSXB 4XWOC 5LP6B 5C8YB 2OPCA 1GS6X 2XZCL 3MFFB 3NZSA 4NKQB 5AOLA 4GFTB 3R1GH 5HVHC 2W0FB 1OE2A 1TTCA 1T7WA 4NERA 1HCYA 3FF7A 5EUOE 1IGJA 3QUYD 1IFRA 1XZ0A 1DQDL 1NU1H 4NUJA 1MQ8A 4I77L 4DVRH 4LFBB 1H3PL 2P7TB 3OZLA 4P5MB 3DC6A 3HG1B 4YZFE 1UPGA 1Q72H 4FFYH 3AGWA 3R0MA 5HY9A 1TOXA 1O9VA 3TT1L 3VMNA 4P9OA 4OQ1A 5EU6B 1M05B 2IFFL 1KN2H 4QNPE 1W91A 1XR8A 3JD3A 4K9EH 4OD2A 4UQIM 4Z77B 1YMHA 2ZUUA 4G71B 3LMJH 3CRAA 2WIIB 5B4MD 4B3SB 3IXTA 3S7GA 5FYJH 5CB4B 4U6YA 5KVFE 5I8EA 4A1RA 4OZFA 2DQDL 4TTDC 5IBUB 3IPBA 4L8BA 5ILTL 2WVVA 3KPNB 2APBA 2YMXL 3GM8A 1VQKV 3LQZA 4OCYH 4YHIB 1VQ8V 3NSFA 4C47A 4MJ2A 3FB6A 4K0OA 2ZAGA 4D7SA 4N9OB 1RZ8A 4PP2B 1P7KB 4NNPL 5DHVA 1JF1B 4HKJB 3FCTA 5J1TC 2B4CL 4FA7B 3R65A 4X98B 1J9SA 4KY1H 3RWCB 3ISWA 3FZUC 1PY0A 1T89A 5FDWA 4PJGB 5EBLA 5D1XB 1S8DB 2GUZB 4N8CH 5I2IB 4BDVA 2H47C 5CZVH 2B77A 1MHHB 1D5XB 1YDPB 1ZE3C 2AZ0A 2Q6WA 1BE3H 1A6PA 3GEWB 1JZDC 3U2SA 3TPUB 1AXSA 3QZMA 4L48A 3SYCA 4OF8A 4CZZA 1A8ZA 3EYUH 3RI5K 5BXFA 4EUPG 2KERA 5LMUB 5EZLB 2BMKA 4B9PA 1JK9B 3S96A 2ETWA 1QRNB 2WV3A 2QVFB 4AZ8B 2B0SL 3CZKA 2MQ3A 5DEZA 3CVHH 4J27A 4EVNB 2VABB 4L8CB 1MFAL 4IBVA 2EC8A 2VR9A 2Y6SC 2WM0A 2C9PA 4S1QH 2H1LM 2WXQA 3N3EA 4WTQA 1U33A 1EMTH 3MMEB 4PCYA 3T08A 4K3JH 3UYRH 5I76B 2G5BB 4OI9A 4BWTA 1LDSA 4PY7B 4LRNL 5DVMA 5CSBA 3CZEA 3DGCR 2WQVA 5JZ7C 4ZUWA 4UTBH 5DUJA 3C6SB 4GRMB 2RNBA 4WO0A 4P04A 1O7VA 1NEZA 1U8CA 4KPHL 2B9AA 3GXMA 3HRZB 4M6OL 4MCMA 2VRQA 1DQIA 2X7LA 4LNRA 1U96A 4Z5RA 3HN3A 5F9OH 4YK4B 1HNZO 3ABMC 3ARRA 1CBJA 4FLHA 3BE1H 3ZOAA 3ABKC 4PRAB 1U3NA 3MBWA 3Q44A 4F15C 1KXVA 3RGVA 1HEZB 1GKFA 1KENL 1U8JA 5TF1H 2YHGA 2F8OA 2HR3A 4AQYB 4J42A 2CM5A 1IV8A 2HT3D 3CDCA 1WITA 1CVSC 3BD4A 2Y07L 1S7XA 5LA6A 2Y5TB 1N0LB 3MBEB 5TDPA 2QLYA 5EU5B 4J80A 2QL1A 1HE8A 3DV4B 5FAAA 5GRUH 2XQYA 4I5BA 3T0EB 4U6HA 5JIMA 4LFHD 5FCSH 2JLLA 3A4FA 5T5FL 4R97C 4W70A 5J12C 4RRPA 3HKEB 3ZHUA 1A1MA 3T6ZA 1S7RA 4RQQA 2ISDA 2IPTH 3FN3A 4PJDA 3U6XS 1T5XA 5CCGE 5GGVL 4LWSB 4KKBD 3OEEG 2CBPA 2JMRA 2YD4A 4FQCH 1HHJA 5C2UB 1HXKA 1S9YB 4D0CB 5F6HI 3QXWA 4XVTH 1B2WL 5C93A 1I3UA 2W95A 2OYMA 1P4IH 5C0GA 4KQ0A 3CCJV 2HG0A 1WFOA 2ZONA 3WKPA 1BPLB 4AIEA 1W16A 1DBJH 3US1A 3RVWD 1E9OA 4J23A 2MCMA 3RVUC 2NMSA 4MVMA 1A7RH 1AH1A 5MEND 5AOKA 3BQUC 1DVFA 2N74A 4OLVH 4AQ1C 4EIUA 3IJYB 1XL6A 3QZOA 1ORSA 2ICWA 4G43A 4XX1G 3DJZA 3U2JA 3U7AA 1F3RB 1OM9A 3U36A 1A6ZA 1M53A 1NAKL 2JCCA 2VN4A 1QLRB 1PSKH 4IHJA 1MSWD 3FQWB 1ECZA 1UJ3B 4HWZA 3GMLB 4PLKC 4XP5L 3NIFE 4Y9BA 4S1SH 1X5JA 5D2LF 3V2AR 2D9CA 1BX2B 3VGAB 2FTKA 1BAGA 1GSKA 3VE0A 2H1PL 3CFKB 4UQ2A 1UTDA 4ODBD 2UWEA 1F6LL 3RNQA 3DOSB 3Q2WA 3L9BA 4I1RA 5BZZA 1NCOA 5HGBA 5LGKA 4KJPD 2VQFO 4L4TE 4F57L 1TIUA 2APVA 2FEEI 4KK5C 1ZLUH 1UJTA 5DQDL 3TJHC 2OJEA 2OSWA 2E9WA 3ROOB 4NYKA 3SKOB 3EJYD 3SQRA 4HPOL 5E2UH 3NIGF 1UXMA 2PTTB 4RFEB 1NBVL 3AWFA 5D1ZI 1JUFA 3VI4A 4Y7MA 3OKEA 2J6EA 2I26N 1M1KW 3QJQB 2IEPA 5E79Z 1RQ5A 3V0AC 5JA9A 2JB5H 4M56A 5ISZD 2BY2A 3KDPB 4H2CA 5K39B 1HNFA 3MFGB 4ZI8A 1K6QH 2NDGA 1KY7A 4ODXA 3T2MA 2YUVA 4A7SA 2GJZA 1EGJH 2DMKA 1Y76A 1T1WA 1T3FA 1D9KA 1AJ7H 2OR7A 3FTUA 4GKZA 1KYOK 4FVMA 1IIIA 2LW7A 3PN1A 1FC1A 3GXUB 2DWDC 4I18A 1EFXA 2VR3A 2Y22A 5B3JE 3CD6V 1R6VA 4P30A 4K15A 3ZHSA 4ZUSB 5MERA 2NNXA 4XRCB 1BW8A 5J6SA 5CSZA 2YXVA 2G75A 3DKHA 2V4DA 1BFVH 3O9OA 4M3JA 1Q6UA 1D5MB 1ZVYA 4MJ5A 1FJ1B 3PUUA 3KPTA 3QYMA 3KEHA 3CCLV 5HGDB 5CJOL 1PKQA 2YSSB 5DCCA 1PD1A 1MSPA 1FYJA 3CVIL 1MLCB 4M00A 5JUEH 1N5YL 3P3UA 2M6YA 3NCXA 5I24A 5E24E 2G2NA 3D52A 2JQMA 1FO0H 4LBEC 5DRZA 3TPKA 2FT6A 3L4ZA 4X4XA 5ES4B 1VFBB 3PF2A 4PIBA 1LXMA 2PWEA 3RPBA 2LU3A 4WU7A 1ZMYA 4K55A 3S3DB 1JRHL 4K73A 5CGBA 4RMSA 5CEZD 3F5TA 4PS3A 4QGPA 5F89A 1EAPB 4WWKD 5GIRB 1HNXO 3GUTA 5B1BB 1H3TA 3RWJB 1TO4A 2R2HA 4PJFE 4L18A 1C9SA 1UZ6F 4LSPH 2QSAA 5JW5B 2ICES 1KTLA 3TETA 1M56C 5C07D 2IWGA 2DMGA 1KN4L 2AEPH 2QVIA 2YAOA 3EUUA 5EC2B 4AGQA 1SM3H 4TV3A 5C0CE 3TA4D 3O2DA 5ESQB 4KQ3H 1EA9C 5BS0D 5T1MA 4XWOD 1A0QH 1YJDL 4WHTA 4KAQH 4XMPH 4DVBA 4CC6A 3TYFB 3QUZC 2XKUA 4G6KL 5EWIL 3MRRB 3WFDL 4ODWA 3QVAA 4DR6B 1RULH 2COVD 3AREB 3B8NA 1KGCE 5KYXA 4JFOB 2F58L 3ABTA 1QSEA 1CFTB 3UC0H 3ULSB 4PGJA 2I9LB 1RUKH 1U8OB 2OFQA 1RK0A 2GTAA 1IBZA 1WE5A 5D8JH 3PABA 3HG0A 2XN9A 2C9QA 1RVFL 1HJCA 4HWUA 2NY7H 2ITCA 2WZ5A 5DD1L 4M1CC 4MASA 4C56B 4KTYA 1BF8A 5KHJA 4LESA 3L3IB 3ML9A 4HDIB 4CH6A 4QHUB 1S9XA 4QF1A 2DQMA 1QLEH 2B14A 2BY0A 4FXKA 3BUQA 1JPST 3X1FA 1SJVA 1W8NA 2MHAA 4CC0A 4TQEL 1C08B 3I5DA 3U7YH 3OAAG 4F8PA 5EO0A 2XA8H 1NCWL 3L13A 5MENB 3Q48A 2XG5A 4LFAO 3VMOA 2PWFA 4A55A 2OKMA 5T3XH 3LKNA 3WE1A 1U58B 5EZYB 4PRDA 2PUSA 3ETTA 1I7UB 4WNQB 5EOTB 2P5ED 2ZKHL 1TFHA 3BN3B 4JDZB 5C1MB 2YZ8A 5B1NA 3W7WA 4M4RB 4EZLA 4X99B 4X7TA 2BY1A 3LPPA 4FF9A 3EYQC 2FWOB 1R34A 4EFBA 3ULUE 5LN8A 5AYUH 1I8MA 1XAUA 3EJRA 1XSOA 2EYSB 1MRCL 3V7MA 2O5YL 4PTUA 3TOPA 3S37X 2HAZA 3H56A 5GPRA 2VERN 3NK4A 2WXGA 4YDZA 4WTXA 4ELMF 5EC1B 2VDLB 2GBUA 3A6OA 4XCYB 4XMXA 3SZKC 3HJEA 4PGZA 3SJVB 2F7IA 2VLKA 4IIZA 1U2HA 3EDEA 4PWIA 2UZXB 3FW6A 1S9WB 3IRCA 4YSUA 1XMOO 3RYCB 2YQ2A 1IT9L 4XMWA 4YHKL 5GRVL 2OP4H 1NCCL 3GI8H 3BVWA 3MGTB 4WO4A 3IBEA 1DQLL 5ISZB 2E4TA 3O9WC 3ILDA 4IKLA 4U3JB 4DN3H 3DGEA 2IH8A 1HXMB 3BI9X 5GGUB 5E9DE 3H1IH 2ZXQA 3MNMA 3OHXB 2YSUB 1GN3A 1EJOH 4JO4L 3ARFB 3WJMB 5K59F 1I9RL 1I1YB 1SEBB 2J1KA 5D1ZC 2J6EL 4Z3IA 1DJWA 2Y6SD 2Z6FA 4R4BA 1AZVA 4ODTL 3UBFA 4EDXA 3TNNA 4QAMB 4IRZH 4Z7WB 4Y1AB 5IK3A 2YN3A 2I85A 4NO2B 1RXLA 3U4BL 3FO0L 4HYOA 3WL9A 1TKWB 2J4WL 1RIHH 3QIWA 3RYIA 3GJEB 4W9IC 1XGPB 5GRXG 4DAGH 1O75A 3JV4B 4NRXA 3UP1A 3HCVB 4UOJA 5AUMB 1GMEA 3H53A 5C0FB 2V2TB 4KK6D 4ZMVA 2C9XA 4LHUD 4WFFE 1UXLA 3W0WA 3ZW3A 1AR5A 3F64A 1EZLA 1G1KA 5B8CB 4YFLF 1B6QA 4AJWA 1QNMA 1TJGL 2QWRB 2X4SB 3B3BA 3KVDD 4N2IA 1ADQH 4HKBA 5ITFA 3K2IA 2QEJA 5H9CA 1NFDA 2ORBL 3LTVA 4JL1A 4HK3J 4J3OH 4ODUA 3AXLB 5LGHL 4PJXF 1PAMA 4X6BA 3EFFA 2VDRH 3EOBA 5I66A 2GIYA 4LDLB 4KX7A 4ZI7B 1WO2A 3P30H 4PJ5B 5BOJA 1NAMB 3CPLB 5JHLL 1Y4MA 1JPTH 4OU3A 2R70A 4URKA 2PPEA 3MHSC 2OZNA 3KLKA 4TNVK 3TBCA 1I94B 4ZFOB 3UJTH 4HT1H 4XZUB 4H1LA 2ARHA 3SGEH 4FQIL 4MA7H 4HQQH 5C07B 5DMKB 1QR9A 2Y7LA 3N41F 1DCLA 5BS0B 4JHUA 4ZFGH 4HA1A 4XC1H 1MNGA 1M3JA 1NL0L 1UOVA 1B4LA 2AK4E 3ARGA 4KI1A 3T0VA 5HYJB 5L8JB 4A2MA 3QDME 3QUXC 3H42H 2W9EH 4FQ1L 1OAZL 1XGTA 3QEQE 2BVPB 1IBGL 1GMGA 1FFPB 5E2JA 1FL5A 2NSQA 4LEEA 2X3AA 3O2DL 2FL5A 1MELA 3RY4A 1GRJA 1MI5B 3LV3A 1H8EG 4GIAA 4TXVB 2QTVA 3V55A 1IB5A 2HLFD 3FRPG 1QNZH 5KJ7E 1RIVL 1WA2X 3VA6A 3L08A 4AQAB 4N21A 4KU1A 1FYHB 3JYBA 3GMPB 4M7JH 1BSMA 3RUGB 3VXOA 3OJDA 4PLKD 5L9DL 2IV8A 5HYQB 2E3VA 5JQ6L 5FPRA 3MJGX 2ZYRA 4U3FH 4XXCA 2NCEA 3SJCC 3R4DA 4BZ2H 1IEAB 4DPRA 1OW0C 2YXWA 1XF4B 2QQLH 3MV7A 1ZHKB 4JRWA 4WF7A 2CWRA 3D39B 5DVPA 3IAYA 4KK5D 1Z7JA 3X14B 3TJHD 1YVWA 1KZYA 3KYNA 3ARDA 1JXJA 1S78C 3HMWH 4P5RA 4WJ5A 2DLFL 4DKFH 4X20B 3CSBA 3LRHA 4AK2A 3D36A 1DSWA 2XCMC 4PJIA 4E41B 2MNJB 3PU7A 1I3RB 1RZKH 2X1WL 3QXTA 2SODB 4X65B 3GSRA 4XP1L 2DQ0A 3RLSA 4XXWC 4OQTH 2WTOA 3DHUA 1HILB 1KTKE 3BO8A 1I8LC 2ZXDA 3KYMB 1OZTG 4Y4HD 2PTMA 3T1FA 4YSRA 3CZSA 4XMLH 1TQCC 1MCFA 4YN3A 3O3BB 2Z8VC 1NS1A 3VG9B 3NUKA 5JORA 3DVNA 2B1AH 1WICA 1ICTA 4F20A 4MVSA 4XVSL 2OMBA 1KGUA 1VFOA 5EIIB 2G5RA 4H25A 1WC7A 5BZDB 4NQCE 3VXUB 1U95A 2HRHA 4MJIE 3WELA 5ETUB 4FYQA 1PY9A 4TOYH 1TQTA 5HFLA 4XC3H 4F2MB 2JS3A 1R5IA 3OKKB 1IBKO 4QRRD 3JTSA 3P54A 1KNOB 1IEHA 1LP9B 2Y7SA 3HN8A 4NI3A 1ZV9A 4RZKA 2X2IA 5TQ0H 4JR9H 1PL0A 4TUYA 3QG7H 5DM6V 4LHUB 4X6EA 1BMFG 1J1PH 3JV0A 2ZSWA 3SDDC 4I3RH 4L1LA 2Z64C 1EBPA 1G0XA 1UA7A 2GUOA 1XGQB 1AIFB 4XCNB 1RUMH 1CR9H 3TM6A 3W2DH 2PW1A 1PNDA 4IDJL 1D6VH 1N0JA 2WINA 2A4EA 4H2AA 1NMCC 2HH0L 4LLWB 1PZUB 2QPUA 4ZBJA 3MV11 1ULVA 3GB7A 5FV2A 1LK3L 2R27A 4WFHE 1MHCB 4IJ3C 3R7QA 2WAQA 1RPQA 2Q0ZX 3P40A 5L6YL 4FNUA 3HA0A 3HAEH 1HDMB 2FZ3B 3H01A 1ITBB 4L5FE 2AGAA 4F1ZA 1FGVL 1I9IH 4P2RD 4FXLA 4LEOA 4XH2B 3S36H 3FB7B 4XGZA 3WTUA 1TVHB 4L3EB 3ULUC 5D2LE 2Z31A 5IDJA 3O3AA 3DXRA 5KHHA 4GXUN 2QV4A 4U1SA 3B9KB 3LN9A 4YH6A 3L95B 1R3JB 3OGCA 4JZJB 5JPNA 5I1LB 5D96C 3QQ4A 5KG9B 3QI9B 3CX5F 1K9MW 1SLXA 4PSRA 3Q06A 1EHLH 3FQUB 4NJ9L 43C9B 3O3DA 1MCLA 2JKSA 5A43C 3DX8A 2PYLA 3WNNA 5CLYA 2DM3A 4J3WA 4UT7L 1OCOB 2ZICA 3FHQA 4QRPD 4O51A 4QT5A 1L9SA 3GMQA 3NIGE 4BFJA 1H3UA 4XP4H 3GXFA 2QVKA 3FT2B 3QCTL 4WQOA 3QIBC 1BXVA 3T3MF 1UD6A 3QQDB 1U8MA 4PLJC 4K35A 4NOFA 1FBIL 4LQFH 4JV5O 1XCQA 3ISRA 2JGUA 4PJ0Z 2DICA 1JPSH 4ALAC 2YGOA 3IGAC 1YCIA 4WHCA 5FGRA 3MCYA 2EE6A 5FLXN 1LWHA 4RMQA 3FFOA 6FABL 2FO4B 3W37A 1RIUL 3L17A 5FO7B 1QAWA 3VGGA 3L3KB 4AEFA 2OMXB 4AW4A 1HOCA 4TQHA 2D8KA 2ZUQC 1SFDA 3I3BA 2Y69C 1QFWL 1U2CA 3D12B 5DHYA 4D0BA 1Z9NA 1TVDA 1IBDA 3QNZA 4EZMA 5EZJA 2JJVA 2P8MA 2YAMA 2WLLB 4J3XA 4NOBA 4JG1L 2EUXA 5IGXH 3LXCA 3LPGA 2CHDA 3KPQA 4P23B 5GISH 4HZLB 1Z9SA 2WZPD 4MJJA 2ODIA 3O9WD 1AGDB 3S5LA 2WC7A 2A73A 3KBFA 3T0WA 3QUKA 3ELAT 4TNWK 3SKUD 1MJ7H 5DJXB 1GYWA 2AXHA 2KQXA 3DROB 3D51A 5FOBA 3RA7L 1UD3A 5IQOA 3S3CB 1A3QA 4K8RD 3FONA 3SOBH 4FTDA 4ZQKA 3MOAL 1ZEAH 4ZUVB 2FLRT 2Q3XA 5IB1A 4AJVA 1U4FA 4I9QA 2C1OB 2WGXA 3QDGA 4FG2A 1C1EH 2E76C 3VB9A 3I6LD 2GTZA 1HQRA 4ONFL 3HB3B 1LO4L 5D7LE 1MFDL 2VJ0A 2I25N 5JOPE 5INCA 3DRQA 2VRZA 6PCYA 4DUYB 4Y2OB 2WP3O 4DUXA 3IGFA 1R6NA 4P2OA 1EN5A 2CBOA 1F02I 2Q76A 1SVCP 1PNLA 3KVQA 5F2FA 4DKEL 4L05A 2KS0A 1XBLA 3H9YA 3WB1A 3KH3A 3AC0A 1RMFH 1CFMA 1QO3B 4JZOB 4WCYH 7CGTA 1YQ2A 3U0PB 5EO1B 5FIEA 1HR0O 4W81A 4I4TA 2FYYA 2ICWJ 3P2TA 4FCHA 1IM9D 1K3EA 1KCKA 1AQKL 2OR8A 3NJXA 5FK9A 1D2OA 3FTZA 4LKCB 1U8IA 5DUPH 4JI0O 2NRDA 4K5NA 4LF8O 5HDRA 4K7FB 2FX9H 2EBOA 5E6IA 1CWVA 2YD0A 4G2AA 4X6CB 2QKIA 3HVDA 5SX5H 5C0EA 2PETA 4JFHD 1QZNA 4AGPA 4DR2O 2GJPA 4FTVD 1XT5A 2HJLA 1AGBB 1Y18B 2WSSG 5EEYA 4A5UB 3EH1A 4E42A 5I1EL 4CMMB 4NO0A 1OSZB 1WSST 1XGYL 3OL2A 5BV7H 5JWPA 2NY5C 4IKJA 4X7SL 1O0VA 2VDPH 2J7LA 3IMWA 2BC4A 4P2RB 3COOA 3QUXD 2Q0OC 2X89A 4UAHA 1JWUA 3RVVC 2JVUA 2BTOA 5KYUA 2VDQL 3UTSE 1TJXA 2JB6B 1PZCA 1UENA 2L8AA 3NCWA 2VITA 1KLFA 3IJSB 4DV1B 3P73B 2X70A 1LR1A 3LXBA 4CBCA 2Q1EA 3GXDA 3T9WA 2DLIA 3C9NB 3BYYA 1MCCA 3ZGIA 4ELME 2HFEA 4HKXA 3WB2A 5E95B 5C09D 1KBGH 5KANI 4WHYH 1UH4A 3CFNA 4OCSH 1QABA 3BJ91 4QOKA 3UMTA 1YI2V 2A4ZA 4TQIA 3OUSA 4J4PC 3IDMB 1K3ZA 4R0LA 3CDZA 1TQBC 2GJ6A 2CJ3A 2ZD0A 1R9FA 1I85A 2LGWA 5LXTA 1E90A 4HV8B 4P2QB 5BO1L 3RWIB 3ZUNC 4XODA 4FIPC 1EO8H 3RN4A 5JXAH 5K59E 1ED3A 3NCCB 1QFUL 4TNFA 1NANH 3B3IB 3OF6D 3T1YB 4KH9A 4Y5YB 4IEFA 4JG0L 3EF4A 1ORQC 1S78D 2HWZL 2F1EA 1XNQB 2BSED 4LF7O 1GGIH 1XSJA 2FYUH 2R9RB 2F54A 3G6AA 1DL7L 3DYOA 1J5DA 1AI6A 3CJHA 4OCRL 3FQYA 5GS1C 5ICZB 4Q6IA 5J06A 1UQSA 4GG6B 1M7DA 3CVDA 1Z3GH 3KBPA 4AEIH 2EUWA 2R2CA 3CSFA 5IMOA 2JLPA 2ZYHA 1TMQA 4O4JB 2AXTZ 2UUAO 3QG6B 2EX3A 2F68X 1IU1A 4P0DA 5E94B 3NN8B 4H13B 4Y1SA 3SDXF 2VKXA 1Q94B 4OM1L 4RX4A 4BA8A 4UDTB 5E8DL 5CNHA 1Q0YH 3QWNA 1MJ8H 5GSVB 1CG9B 3MJ8A 4OZGB 2VDNL 3OM3B 5HYEA 5JXED 3MLZL 5AW7B 4D0DB 3EJUA 4G9FA 4G6FB 4HU8A 2VXUL 4DKTA 4ENEC 2ZOTA 4LARL 4LLUB 3UEQA 2A6KA 5HYSB 3DI3B 3RDTA 2Q73A 3OW2U 3E35A 5MEPA 4U3CA 3GSQB 1WLHA 2XASA 2Q67A 1ROCA 3CC5B 4K3DH 1E67A 1RLWA 4WV1B 3OKNA 4XVJL 1FFRA 1A6AA 2YUWA 3H7BA 3OJVC 4WFGD 3UGXA 5FWRA 1MCDA 3IDIA 2VXTH 4HC1H 4GW1A 3PWLA 2JKRM 1FO0B 2OMVB 4GKLA 4M7KH 3TVMA 5FYLL 2M2DA 2QDVA 3VYNA 1K33A 1GTOA 4ZUTB 3SDDD 2Y6TE 4XCEB 2R8SL 3HI6H 1XMQB 1AZRA 4QXUL 5HGHB 2WK2A 3GSVB 4FI8A 1K8IB 1PZBA 4G28B 1F8TL 1U8NA 2ESVE 1F4NA 3LQAL 4MAUL 4XWGL 3SE8L 2W60B 5I71C 2PY5A 1B9KA 4H8WH 1RUAL 2DZEA 12E8L 5IFHL 1KQSU 2X10A 1IAIM 2FMLA 2BOBC 4YY3O 3N04A 3WDJA 5KTEL 3EAKA 5AVTB 1WB8A 4RAHA 2ZZUT 4JRFA 3QFJD 1ASOA 2N0MA 5LNGA 2HG5A 2VL5B 4X6FA 3JD2A 2IQ9L 2Q8BL 2F95B 4LSUH 2IWEA 2XWCA 5KVDH 3TYGH 1YEKL 5F21B 4M7ZC 5I1GH 5IQ7H 5KAQG 4JGNA 2DQGH 2F53A 3MLWH 5B1JC 5IIEA 3P3NA 4YHMH 1SA0A 1HHGB 2VMFA 4RUEA 3WXWL 2KHAA 1N5AA 3DGDA 1T21A 1JE6A 4UM8A 3VA2C 3NJNA 1E9PB 1OV8A 2IAMA 5C9JB 1MCRA 1NCBL 3N27A 4FFBB 3L54A 1QLEB 4H26B 4OGYL 5AOJA 3UPRB 1CF8H 3O0LA 3QIBD 5TH2B 3H0TB 5C0AD 1EZSA 1FFQA 1S3JA 3C6LA 3OB8A 3N9GL 3LAFA 4JPKH 4LHJB 4UINH 5KSVA 2JK5C 4IBZA 3GHPA 3QAZB 1J8HD 2XVKA 1PS3A 4HLZG 1IGYA 2LW1A 4X62O 32C2B 3GBDA 1I8IA 1AGEA 3CWBH 1DQVA 5INDB 3HR0A 4Y2DC 3IDGB 4XI5D 3GLEA 3I6GA 2CDGB 4PR5A 3UO3A 1CDUA 3RL2B 3NRPA 3ARYA 5CZXC 4UDUA 2MQ0A 5D93C 4YWGH 1FQ9C 2OQJB 1WA8B 4RDQG 4F8NA 1JMKC 2DYRB 1LNUB 1WDAA 2CHZA 2W07B 5DJ2A 3UBXA 1ODUA 4AYSA 3BP5A 5DD3L 3WNIA 4EN3D 3K03A 4NKOA 5IQLA 1CFSB 2UZPA 4FA6A 2XVLA 1K5NA 3A6CL 4IGBB 4KX9A 4KK8C 2KPWA 4MAZA 4MB4A 3KPOB 3TGXA 3MDSA 1C5DA 1IBLB 4A37A 3C3SA 1QBLH 2PCFB 5ANMA 5JYLA 2ZF9A 3HHMA 3IJEA 4FNSA 2P24B 2GSMB 1KIQA 4AGNA 1M9NA 2BTQA 1CLYH 1LTXA 1BQKA 1A1NB 4NRZA 3KKYA 1KYFA 4OXSA 3B6SA 3D30A 4I0CC 4PJ8B 4PGEB 1DJHA 1BQSA 2RHEA 4LLDB 4M8VA 4NZDA 1BMGA 1NGPH 3CXCU 4N68A 5SWSE 3TBWA 3OZ9H 2CO6B 4JDVB 1GRWA 1AE6H 2OWOA 1Y66A 2LVEA 4ZAKC 2EULA 2QJ1A 1FRGH 5FUZH 5MEOA 2DL2A 3DO7A 1JNHB 4NQED 4A68A 1KLUB 3GSOB 2DQCL 3CVBA 4AQ8C 5L2KD 1NBQA 1ZK9A 1TZHA 4JI3B 1Y1DA 3VXSA 4G8EB 3MC0A 4F24A 1C5BL 3MRHA 3NA9H 1T7VA 4XNXL 5I0WA 5DJ8B 3L72H 2QZQA 2NLJC 5J2TA 2HYMA 3MRNA 4DETA 4XCFH 4PJ7A 5J11C 4H20H 3KLHD 1IZKA 1P7HL 2F5BL 1R5WA 4Y16A 4HHWA 2C3GA 1HU8A 2DWYA 4BIZA 2WXIA 4KXRA 5G4NA 2CPCA 2E9GA 4O4HB 2CH7A 3O45A 1MCIA 2PP8A 2QTOA 2ATAA 4LGRB 3U0TB 4RGMB 3FCGA 1ZGLA 1BHBA 3DGGB 1SJXA 4UQ9A 2ZT9B 3FU3A 4G7VH 1HHHB 2TRHA 5FA3B 3MA9H 5JIPA 2KPNA 4F6RB 4IMKA 3PNRB 1VFAA 3N1QC 1FZJB 4G80B 1ZVSB 2H3NB 1A1OA 4UWQB 2HLAB 5AL0A 5FHAL 4DK1A 2NY1B 3BKJL 3PHSA 1X7QA 4Z8FL 4XO3A 5F8RC 4P9HH 5IJVA 1UEYA 2E9JA 4OCXH 3QFJB 4MCYA 4P8QA 2DIJA 3FTWA 2ZE7A 2ERJB 3MUUA 3MRLA 1SJMA 4Y4FD 2A06H 3L2MA 3NJJA 1EZVX 5DVLA 2Q87A 2W38A 3QBTB 4ONHA 2EO1A 3U79A 2ID5A 5K9OB 2WQRA 5HDQH 3E3QE 1PD6A 1QSFA 5KVGL 5I6MA 1CLCA 4UMGA 3VI3B 2WD0A 1GKEA 2N56A 5EHFA 5D6DC 4ERSH 4ELKB 5E99H 3BGAA 5LKNA 1XF2A 3DK0A 1MW3A 4RCAA 4XPGH 4EEQA 1EWHA 1RJYB 1A7NL 2H0PA 1F11A 1FG2A 3K74B 5GS2H 6TAAA 1CZ8L 4U0RB 4JI7B 1KFGA 5ID1A 3QH3A 4S1DD 3QORD 1IARB 3RE0A 2HKFL 5IB3B 1Q0XL 4ETQA 1AS8A 4I2XB 2OTJV 2K3HA 3U6RB 2HRPL 1CTNA 3DVGB 3MV8A 4FNQA 3ZUCA 1F1AA 4JRYA 4WEUD 4MA3A 1MFNA 2XWXA 4S2SA 3PV6A 1W0VB 4MD5A 5A16B 2NXZB 3SDAC 3CAFA 2X87A 3IDXH 3KD4A 2VS0A 3C60B 4Q2ZA 2BOCC 4IT5A 3UXFA 4D7BA 3QCUH 4X89A 2WXNA 3QR2A 2VXSH 4DGYH 4IRSA 4XPAL 1IGCH 4BSJA 4MBRA 3CMEV 1NDTA 2Z1KA 2KBGA 2R7EA 9PCYA 4AIXA 2ED8A 4MX7A 2H6PA 1XF5A 4D9LH 3SE3A 3JWNE 1TF4A 2H32A 2YPLB 4DSYA 3MO1B 3RWGA 4Z7QB 1MCKA 5DJCA 3BZFA 4NPKA 5LBSA 5T1KB 4F9PA 4N2MA 1BCCH 1C8QA 5EZOL 3Q8AA 3O6LL 3I50L 3SCMD 3GSWA 5EOQL 2AJSL 4LF4B 4WI7A 1RK1A 1K72A 1BVKB 3UZEC 2EIEA 4ENED 2CLZB 3QIUD 1E4JA 1BWMA 3SN6N 4X8CA 1AJPA 3SOTA 3WTXA 1GW6A 3NIDF 3MLVH 4PJIF 2R4RL 4ESKA 1GOHA 5TE6L 2VW4A 3VSUA 5ALCL 3RRQA 4P3CH 2OCHA 4RWUA 1CXHA 3GPEA 2Y9RT 3LRSB 4ORGB 3ARWA 5FECA 3FUDA 3QUMH 5BMVB 3LB6C 5L2KB 4GXUM 3F12B 4AHCA 1A2YA 4KUMA 4BD4A 3V6OA 3A21A 1UG9A 3X11A 1I7ZB 4KGLA 2B4CC 1OP5K 2NSMA 3X2QC 5IMLB 2FT8A 2H1XA 5DSCA 3IDYB 3Q2LA 2EEAA 2GDSA 3T4ZA 3INUL 5DK0B 4AT6A 2P5WB 1Y6MR 2ZUTA 1QBBA 4JM2D 1YSOA 3RU8H 4HMCA 1PBYA 4C83A 5CA0B 2FBOJ 3GK8L 5ESVA 5AVRB 1F58H 1GZHA 3UJJL 1NGYA 3X12B 4MVRA 4A66A 2GIMA 2I32A 5J9PA 4MQXD 4BE5A 1P2CA 5D2NB 4PJDE 2MTAA 4AYBA 1LK2B 3K46A 1LHZA 3HAEB 1F90L 2YD2A 3HIZA 1QKZH 4PB9H 5HYFA 2WANA 2WCGA 3CN1A 2KMWA 3K0DA 3SKJH 1XDTT 4O2EA 1P5UB 5IWLC 3IRZA 3LSOB 4JANB 5HHXL 3F7QA 4PA7A 3HPJB 4RIRB 3WTWA 3F7VC 3KW8A 5DUBA 4QO1B 1PPJH 2D7TL 2DTMH 3WBDA 1T04A 1IQWH 4Y4FB 5DR5L 1K9TA 2XPGA 3QXUA 2HA1A 2E6QA 2IH3A 4HKZB 1AI4A 4CA4A 5F7FA 1CICC 4HWEH 1HS6A 4AUYA 1NICA 4F58L 3T77B 2JCCE 2AJ3A 2YGPA 5DFVC 1WFTA 3AQXA 3B2EE 1CGWA 1UASA 4CS2A 4PG9A 3NCJH 4XPTH 4EI5C 4PHZA 4LF3A 1N59A 2NR6C 2VB5A 1AD9A 2YI9A 4BW5A 2UWEE 1ZE3H 3QWOB 3SO3B 3TT3H 4KJWC 2NX5A 4HUUB 5LN4A 3AQDA 2XETA 3FRPB 5F7UA 3L5WB 4Q4EA 2Y72A 2QVMA 5EORL 3IF1B 2WQAA 1U8KB 4XN7A 4APXA 3VFNA 1VF5B 1AHWB 3L9EA 4I0KA 3T8XA 4AOFA 1QVFU 4M1DH 4MMYA 1EEZA 4MD0A 4N8VB 3E89A 2YPKA 2IH1B 3BPZA 1VQMV 1AR1C 2NTSP 1VQ4V 3MLRH 3N1FC 4I0PA 1D6EA 2JI2A 2Q8VA 4P57A 3QQ3B 4J3TA 4OCWL 2HFTA 1T5WA 3ERXA 2J25A 1BQLL 1VPOL 1BD2A 4ZUUA 2ADFH 4HBCH 1XO8A 4WNJA 1BYNA 5I9QB 1ZANL 4FLXA 1EHAA 3LSQA 2CBQA 2DD8L 4FQJH 4QTIH 3IFLH 3TWCL 1FFNA 1IX9A 3B8MA 4JLRB 4OB5H 4QGTA 4X4YB 2FT7A 4JI6O 2H3OA 2GK0A 3L3OA 3ZT6A 1D7BA 1GZQA 4CGTA 5D7KE 4FA8A 2ICWI 1ZLWK 4AZUA 5ENWA 4O2FB 4X5LA 4JFTA 3VWJD 4LCCC 3VYPA 1NKGA 3BH4A 5DQJA 5I15L 4NC1E 5K9KA 1R73A 3FO2A 4CVWA 1PKQE 3FQRB 1DDHB 5EU4A 3VFSA 3LUTB 3OX8A 4I13B 1V3MA 2O57A 2J1ZA 2MQGA 2WQSA 3MNDA 2QQKL 1QZ1A 1E28B 1P5VB 3QJSB 4XNMB 2O1AA 1NWPA 3P30A 4LPXA 4PS4L 3BUTA 4R7DB 5F72S 2C8NA 2HJKB 5K9QG 2FGWH 2CPUA 4FMTA 1DUZA 3HZYA 3E3QC 4JAVA 4WBNB 4XBMA 2WOBA 3HVNA 5B3NA 4JTCB 3D3VB 2EJRA 4DP8X 5EZIL 4A6YL 1DBMH 4JFZH 4LF6O 2E7CA 2VLRD 1WLEA 3OTOB 1UB5A 5J2UB 1OSYA 2VSMB 2EZOA 3ECWA 1A5FL 3KNBB 4ABWA 3KMDA 2AEQH 1NEPA 3JUYA 3FB6C 3K06A 1R1BA 4H0GA 4Z7IA 2XQBH 4G6ML 1E2VA 4I7ZB 1NC4D 5J6HA 4DEPB 2OK0L 2IMMA 3VWKB 1BAWA 1TCMA 5FEBA 2XRAL 2E75C 1QBMH 3QFDA 4JI5O 1KY6A 5GGTH 2YKLL 1LUVA 4ZHQB 1T89C 3FO1A 5CGYC 2YLKA 4DEUA 1DANT 4O4LA 1QSEE 2XTJE 1INEL 4L9LB 3OJMB 5AW4B 4I50A 2RCVA 1G6VK 1SN0A 1U41A 2CRZA 2XN9E 4PRHD 5DJ6B 4AGMA 5SWZD 3BKML 2ZUWA 3BCFA 1C16B 3PCYA 1EN6A 2BWQA 4HVBA 4JI8O 4QXTA 1FXHA 3JWNC 5F96H 1Z0MA 4J10A 4A2HA 2UVEA 3TO4A 1N4XL 4UAOB 3GNMH 2QM7A 4U1GB 2WLIB 3S34L 5D7HA 4U7KA 5TF0A 4RWYL 1JGDA 1OVZA 3ASWA 3IDUA 3SPVA 4JZ2A 4AYFA 5KAIZ 1MH5B 4KHXL 5IB5A 4KMLB 4ENZA 1GPOL 2LLLA 1HL4A 3UYOD 2X1XR 5H37H 4F8QA 1DGSA 3IETB 2E56A 3PNWA 2BNRA 4CVXB 3S0PA 3KPMB 3BGFC 3S35L 4W9EC 4HHAA 4K2UL 3FB5A 2IDQA 1AI1H 1TTAA 2Z4QA 3SDAD 4ATWA 5AB1A 5ELIA 1S5IH 2D2CC 1YUHA 4ZW5A 1N8OE 2FR4B 2DQJH 1TVBA 1YJDC 2EE0A 2KLSA 3GT6A 2VLKE 1KXVC 4PUBH 3RGVC 1A22B 3M86A 4IK6A 5C0DB 4Z76A 3WJLA 4XBFA 5CILH 3JALB 3T1HB 3FO9B 4DV0B 2GCYB 2R1YB 4E9YA 3BIKB 3TA3A 4JJ5B 2PPDA 3RAJH 2FX7H 5JHDA 4LCWD 1U8HA 4B3TO 3FQXA 1XGUB 3MKGA 4WGWB 3WN5A 2XV0A 2VLJA 5LLIC 1BF2A 2FSEB 3BUIA 2BIHA 2C4FT 2VDKH 2X6MA 3BRFA 3MNVA 5DS8A 4JY4B 1MFBH 2X9ZA 1TYJA 3B37A 4DP9X 2WN2A 1JWSA 3D08A 3NFPB 3EGDA 3E9UA 3RBGA 4JRXA 1KKDA 3RYHA 4F2FA 1ODAA 4DW2H 2SEBB 5KVFH 4Q14A 3RFZA 5TFSL 3V5HB 1AZZC 3P2BA 4FLTA 3VQ1C 4OZIF 2XQYK 1JWMA 2VWEE 1T4KB 2G30A 1KGXA 3HS0C 3W0WE 4Q4IA 5SWQA 5E2VH 1JZ7A 3NAAH 5HGGS 3JWOL 1SESA 2JKLA 3LB6D 4Z95H 1IXMA 3UPAA 2PNDA 4O02A 4F3FB 4ADIA 1RUPL 3E7JA 1A6UH 2YRPA 3N43B 4UILH 1G87A 4HJJH 2FJSA 5AZEH 1DVFC 1FXKB 1NFDE 3E6FA 3KJ6H 3C2SA 4K0KO 1N12A 3QGVA 2N7AA 1UD5A 5BZWA 4MMZB 5I28A 3JARB 2GTWA 2WXRA 2X4QB 3EYSL 3ZZ1A 1PDKB 1C7SA 4PGBB 1DN0A 1X5GA 2VC2H 3VD7A 3KWWB 1RPRA 4AVHA 4FZ0A 1J5EB 1KIPA 5ICXA 2XWTB 3QZWA 1P7QD 1UVQA 5F0MB 1MRDH 3V0JA 4HUVB 2BSSA 2YR3A 4IJTA 3G6JA 1DVTA 4JJOA 5KX5A 5LXGH 3UCRA 1L9TA 1YAZA 4TS6A 3QPQD 4U4IA 1HINH 4QHPA 5EU3A 1TZIB 3VGDA 3VXNA 1SZXA 5GZNA 2P22C 3E2EA 3DJ9A 4M9PA 4BELD 2L7QA 4L3CA 1NC4B 2A9NL 5LQBL 5BVPL 2HVKB 2R9HC 3MJ7A 3C5ZD 5FF6B 3C75A 4AH2B 3O8XB 2ZR2A 3S2AA 4OZHB 5DVKA 3T71A 3SYOA 1II4E 4GAFB 5E2WL 4IQHA 2BVQB 2RMNA 5AG2A 5GRVK 3OMIB 1A3LH 3EO0A 1PZSA 4QYOA 5C6TH 4Z3FA 4JB9L 4F37F 1J5HA 3G6EV 4QTFA 1DFBL 3ULVF 4B5ZA 2WZAA 5SWZB 4F7EB 3BVTA 3EOAA 4WWPA 1SOXA 2CJUH 2VISB 5IMKB 1D9KC 2Q20A 2QWPB 1Y07A 4EE2A 3WIFA 4DW0A 1CICD 2NW3B 4JFXB 4I18C 3VH8A 3VXQA 2ZXBA 3H9SD 3TH2T 4MDJA 4K71C 2I07A 3MLYL 1HH6B 1FV1A 4BJLA 5DFVD 4JAMA 5J1AA 3OKDB 4J3UA 4GKNA 4WDIA 2GT9A 4O2AB 4FLUA 1PZ5A 3D25B 4LEXL 2N4IA 2K70A 4LPCA 1QFHA 4W4LA 2UXBB 4H44B 1PX3A 2OL3L 4U49A 2C4XA 3GO1H 4YHHO 3HE6C 1KJVB 1T0NA 3MV7E 4IBYA 4ZMXA 3HUJA 1PKXA 1M6OB 4NC1C 3L48A 3SDCC 1BAFH 3ZGHA 4PJAF 1ANUA 4N2BA 3F7KA 1IGTA 4P4KB 2Y2YA 5E1AB 1S46A 3ZR6A 3N5AA 4U1LA 5CFHA 1OTTC 5HP5A 1KUQA 1AP2A 4NB7A 5JLZB 5JIQA 1F3JB 3NIDE 4PJIE 4PU2A 2HX8A 2IWFA 4KK9D 1G1YA 3ZDXF 1BSIA 4A7GA 2NT0A 4NENB 3SPGA 4G6JH 1J5CA 1CQKA 1GAFH 3QJZA 5LWYH 1IFHH 1OGAD 1A7OH 1S7QB 3ABLB 3L7EB 5EEUA 3ORJA 5I19L 4HJTA 4PA3A 4ZO7A 5HJ3A 3PAYA 4GG8A 3N1PC 1EH9A 3MRGA 4HOWA 3ZO9A 4FFWD 4LCWB 3IMTA 1KB5B 4LSQL 3K6SB 1JFHA 3W11C 5CCKH 3WGVB 1J0IA 5B38G 1OCCB 1R5VA 2BHFA 2H0FA 3CFJA 3MRPB 3RL1B 3RNKA 3H9HA 4RQEA 3GSXA 4C4KT 3MLUL 5D7EA 3DSNB 3WG7C 3FSAA 2CTPA 3ZMUA 2LJ2A 1JXDA 2YN5A 4IS6B 4XMVA 1QFWI 4P4RA 3RPKA 1BVNP 1CK0L 1LE9B 2IMNA 1A4JB 1XF3B 2YXLA 3E8VA 5TGBB 3LIZA 2P7TA 3ETEA 2GAZB 2ITCC 2JRIA 1FH2A 1WCBB 3WO3B 1IGML 1LQBC 1KIUB 3DYMA 3O6FD 4FXKC 2NUTB 4R26H 4OD1L 4ZPTB 1HIML 4PJ9B 1LO2H 4BZ1H 4JKWA 4L37A 3ALWA 3E2HB 4HIIB 4N2OA 4JCLA 5BZBA 3EDFA 1NC2D 3D7PA 1KDIA 3WSQH 3OKOB 1F4AA 5DS1A 4TQ8A 4O2CB 4OLUL 2FKXA 5IW1B 2W0XA 1HZKA 4Q8BA 3LNMB 4XPHH 1NWOA 1GYVA 5EPMB 4M48L 3B8SA 4YHIA 2HN7A 1Q1JH 3HHRB 3QNYB 4BR6A 4O02L 1D5NA 5AYTA 1P7KA 3B4NA 2LU5A 1Y7VA 4ZOCA 1WJZA 3MLXH 4HKJA 5F0LB 4N2EA 4X98A 4G7YH 4NUPA 3L73H 1MJUL 4MCZB 1KT2B 5ICUA 1ETA1 2GUZA 1I7RB 5I2IA 1E2WA 4XP9L 1E8YA 3LHAA 1MHHA 3O11B 1MG3C 5H4YA 4BQ6A 4HP5A 1D5XA 3Q6FB 4ANUA 2VN7A 5DD0L 4WO4C 4OM0H 4GYCB 1I08A 1RHHB 2OMYB 4GBXB 2EC9T 2PYED 3QP3A 1XQ8A 4YBHA 3V4VH 4CVUA 3CHSA 2E0PA 4GRWE 3B2VL 1JYVA 1N6QL 3ZK0A 1A14H 1S7UB 4AZ8A 2J6WA 3NABH 4UQ3B 4Z7NF 1W2BU 3R7RA 1OQXA 5JDJA 3CLFL 5IV2A 4EVNA 2VABA 4L8CA 1BXAA 3GMOB 1BFOA 1KC8W 3BPCA 4OIFA 5IVXB 1MQKH 2Z7YA 3BZ5A 3FTSA 1JERA 3QIWC 4K7PH 2YGVA 3MX0B 3CQFA 4N5ED 1RPUA 3GS4A 2AAAA 4EIGB 3QDJD 3OAZK 3FAWA 4F7PB 4TVPD 5DJZB 2VWEC 2HRGA 4GRMA 3V0GA 4YJ2A 3WUZA 3HG3A 3N6YA 3U0WL 3FRUA 3BFRA 3HRZA 4GI8A 1OAUH 5AVUB 3B5GA 5DVOA 4NN7B 2YS4A 3ZTNL 3T2OA 4JFFB 1CD8A 1VF6A 4XZ4A 4AVJA 2ADPA 1U93B 4GUNA 3EFOB 1EO5A 1AKJD 3BAKA 2EXWD 3L4VA 4HFUL 3RBSA 5EH1A 5AVYB 3J8F7 1HEZA 4X7EC 1CE6B 3BP6B 2G2PA 3UTTA 4JPIB 1XXFC 1RERA 4FK5C 5BUGA 5T33H 2OYKA 1OGAB 1N0LA 3MBEA 5EU5A 3H55A 1FVDB 3HFFA 1UOLA 3O6ML 5TE4H 3P4OA 3D48R 1CXZB 2EIMB 3CCVV 1E6OH 1R47A 1Q9LB 1KC5L 3NJFA 1T22B 4QWWD 4DN4H 5FYLE 3NCYP 3U7WH 3EG9B 4OCNC 4RMUA 4WEBH 3JD1A 4NPYA 3CCSV 1YEHH 3QDGE 4UT6A 3ARGC 4MXWL 1FLTX 3CFCH 4MXVF 1FNEA 5L7XH 4KRNA 1I0HA 3ZE1B 4AVIA 3CH1A 1FF5A 1N7ML 1S2EA 4M5ZH 4TQPA 4URTB 1S9YA 5AW1B 2NNAB 3AGVA 1P7GA 1KPVB 1OQOA 2GC4C 1SYSB 2Q5BA 3QUYA 4EBQL 3CFQA 3KWUA 1NR1A 2X4PB 3BWZA 2JGDA 1N8ZA 2R0LH 5C7ZA 2X88A 4HCFA 2VQEB 4GP8B 4CNIB 3PRZA 3ULUH 1IC1A 2PPCA 4U4BA 3K79A 1MIEH 3O4OC 5FYKD 1EK3A 3GWJA 1FLRL 15C8L 2WBJD 1A65A 4DQOL 2GV9A 1QLRA 5ECJE 3P3SA 3GMLA 4PRPB 1W72A 4QHNB 4XXCC 4GKJB 4BSVB 5LHHA 1KP2A 5GONB 2CUIA 3CXHJ 4I9XA 3W9EA 1IAKB 4BKLB 5IFJA 3AG4B 3DOSA 3OKMB 2EYRA 4FG6D 3WNPA 8FABB 2Q10A 3KHOA 4QTHB 2DLGA 1B4TA 1MEXH 2YWZA 3ARDC 2AJXH 2R9HD 4HNAB 1YY9C 4YFDB 1AO7D 4A63A 3ROOA 4LFBO 3O2WH 2QR0A 3D36C 4KQ4H 3MRFB 1I8KA 3IXAB 4FHBD 5ID0B 2EXTA 3NPZB 4ALAH 2WCSA 1UURA 3BHBA 4U6XB 2F9BT 3NPSB 1KCSL 3BRDA 4QXVA 5K39A 1FAKT 3N2KA 3Q0HA 3EW3B 1G1CA 4LIQL 4B3SO 3VB8A 1WPXA 3GSNH 2VERA 3RVXC 5ITZB 1YYML 4OFVA 3ZCCA 4M62H 3FC8A 3QRFM 4L1BA 4Y2NA 1JPGB 1OCZB 2EIKC 3BWUF 2XHNA 4QOKE 3ZE0E 1ZLDA 3MGOB 3O4LD 3L3DB 4ZUSA 2IFGA 3NXSA 1YHQV 2GJ6E 4KJQD 2YBRB 4R3SA 4XRCA 3V4PH 3ZTDC 4C4BA 1L5GB 4J1UB 1AIZA 3HE6D 5A3ID 4OH2A 3TO2A 3X3FL 2KDYA 1FJ1A 4Q0XL 5GRJH 4Q9RL 3SDCD 2EDEA 2PLTA 4JFDB 3TWYA 5HGDA 4ZS6D 4M8QB 2YSSA 1GOFA 1O6SB 1PMYA 3ATDA 3OR6A 4UNVA 1MLCA 3Q6GH 5TDOB 2F54E 4L29A 2IOOA 2XQ0A 3D0AA 1OAKH 3DHPA 2XJLA 3W56A 5A1AA 4GW4B 1U8LA 1VFBA 3HC4H 5IR1A 5JNYB 4ZMPA 2YC0A 5IJ0B 2FB4H 2WPGA 4MWFB 5F7HA 4GSRA 4R6ZA 2FQDA 5LMUO 1G4MA 2DWEA 5BCAA 4EB6A 2OBGA 1EAPA 1AKJB 3DIVA 2V37A 5GIRA 3RT3C 3RWJA 3CXHF 3GB7C 5B1AB 1T1YB 2VQ1B 3B43A 4OLYL 5DRXB 1C5CH 3PFQA 4PV8B 3B8YA 4YXKH 4R7XA 1IEBA 2PCXA 2UYLA 1NPUA 1LE5B 5ESQA 4G9FE 4FJCC 4HIEB 1HK6A 2VM9A 2JJ2G 2ZIMA 4QRQB 2DBJA 3ABKB 1S76D 2X4OA 2Z31C 2K8QA 1SGKA 1TQSA 5CEXB 4E0RB 3NCEB 4KKPA 1KJ3L 3M45A 5D1QD 2DQFA 4G9DA 4AIZB 4POZC 3IU3B 3UBHA 4C58B 4ZD3H 5JPNC 3VACA 3D85D 3VXRD 4JFOA 1FN4A 4X4KA 2PZSA 3MV9B 5D7IB 3ULSA 1DF5A 1F42A 3UIYA 1I7TB 5H2BB 3RG1C 1E5AA 3WN6A 1MVFA 4G5ZL 4HYTB 4ZX3A 5IROD 2F7PA 2R29H 4PJHB 4DGWC 4OJYA 4L1HA 4DUWA 4H88H 1XHHA 3MLSH 3NGBC 3F6IA 4AQYO 3IS0X 4UT6L 4X5WB 1CBVL 2OI9C 2IU0A 2NY5H 2PCPB 4K3EL 1CDYA 3G5VB 1H8NA 3L5HA 2CKBB 4TV8A 5MENA 1UM5H 3MLTA 3D18B 5FM4A 3ULVE 1AR2A 3THML 5EU7E 4FN0A 4YSSA 1HZLA 1U58A 4F7TB 4J28A 3GKWL 4JN1L 2WBJB 5F70A 3GVMA 3WY3A 2YUXA 2K1MA 4J3OF 4YJ3B 2RFXB 4V1DB 1YEEH 3P69A 4YR6A 4JNXA 3DTXB 3M17A 3VGHA 3NZ8A 2RMKB 2FNWA 1RZQA 1ZV5A 3IDNA 5JORB 4NM4H 5F7EH 3CC2V 3E6HB 2QTSA 2VXQL 3BQUB 4ZTEA 5AVSB 2W9DL 2F53E 2NQDA 3KLQA 3ECBA 3MJWA 3BN9C 5D70H 1LVEA 2ZUSA 2FQGA 1YYLL 1BG1A 4ABQA 1U97A 1VZHA 2NOYA 2X0LA 1BQUA 4KX8A 1W72L 4ZQTA 4F4LA 4UQDA 3ZZSA 2R0WL 4PJAE 5F6IC 4B3VA 1UWGH 1MAJA 1S9WA 3KBHE 2R51A 5IJ9B 1X59A 5KSAD 2WTRB 4NNYB 5HI3C 3MGTA 1QASA 5ISZA 2C7UB 3MCKB 2MNUA 1OF2A 1YNLH 3MSPA 4PB0H 4XNZC 3QZPA 3ZDXE 1HXMA 3QC5X 1GVIA 5GGUA 1K5QA 4DYLA 4R7LA 5JHMA 1FPTL 2B1HL 4FM1A 2YC1A 1TA8A 1JNNL 4XB3A 1AGCB 2OJZH 4JFPB 4NHCL 4Y19D 4Y5VC 1S5HC 5HD8C 1IKFH 1A6TB 1KZQA 2P49B 3O4LB 4Z7WA 3UG3A 1NH2D 3GRWH 1SFHA 3LQAC 4KZEL 3AVEA 2CR0A 4KKAC 3EHBD 4TSCH 3SY0B 4YNYB 1GGCL 3CLEH 3ZRFC 5JW3H 2WYHA