3CS5A

Nbla protein from synechococcus elongatus pcc 7942
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
48
structure length
48
Chain Sequence
b'VEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phycobilisome degradation protein nblA
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Photosynthesis
total genus 13
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 3cs5A00
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH superfamily
4LF7O 1GM7A 1E79G 1P4RA 3CYOA 1FXKC 1EN6A 5LP6C 2OT5A 1QNMA 5H2FZ 1GTOA 1KKCA 2Q0AA 4I9WA 1I94B 5J9PC 3QNEA 3OR6C 2N04A 3KG2A 4F6RB 2NNUA 3ABKC 3CCRV 4J7ZA 4LF5O 4LF8O 1IBLB 4IIJB 4PDMA 3K9SA 1WA8B 3LNMB 4CS3A 3N2GA 2QKSA 1D5AA 2ZQMA 5B1AB 1R3JC 1AI5A 5DN6G 4B3TB 2WLJA 3L71H 4MVZA 1MOFA 3OAAG 2WWWA 4EB6A 2BCCH 1EN5A 3ZHRA 2EIKB 4UCVA 4GYCB 2UUBO 2JVDA 3CC2V 3QTCA 1Y74A 3CRCA 2DYSB 2OCCC 1PP9H 4O4LB 1K97A 3E8BA 3FB5C 4JI8O 4H13B 1KKDA 1VQ5V 3STLC 4Z2WA 1BGYH 4I55A 1WP8A 5EC2C 5CB4B 5KAIZ 3HKBA 4DV7B 3FKSG 1GM9A 2HJDA 4FK5C 2PGGA 2X0LA 1K7DA 3JATA 3JD3A 3CRRA 3JYCA 1OCZC 3HKEB 2OTLV 2QWNB 1YVWA 3JAWB 3MHSC 1R6TA 1K4CC 2QGNA 1DLBA 1XI1A 5BY1A 2JDIG 4DUZB 1F7YA 5EBLC 3ZHVA 4FLUA 4K35A 4D7SA 1RFYA 2HG5C 3E8FA 4P9PA 3K79A 3H1JH 3ABLB 3HKCA 1KD1W 4FPPA 2NR5A 1PL0A 2LQTA 4EKWA 3N2KA 1BS3A 1B04A 4PA9A 4E4EA 4HBNA 1M93A 2OIGA 4WFEA 3EFFK 2YEVA 2QTOA 1XMOB 4DR5B 3JCZA 2DE0X 1MSDA 3AG2B 1TA8A 2HJFC 1XL6A 4H44B 1YHQV 2X6AA 1EN4A 5GTIZ 4PELA 2D2CB 2GSMB 1IXMA 1AVMA 4W4KA 4I9QA 4TQFA 3ZMVA 1FJGO 2OIEA 2MW2B 4IYIA 3APQA 3F7YC 2ZE7A 4JV5B 1X59A 2E76B 1VQ6V 2W6IG 1HNXO 3C3SA 4KFMA 1AILA 4WCEV 5F2VO 4DO2A 3VQWA 1GAXA 2HKOA 1NTZH 3JALA 4JI6B 4TOIA 4L8JA 4YJ3A 3J81N 3HKDB 3JARB 3HB3B 5JVDB 4UB6Z 3ZRWB 3CMAV 1YF2A 1S72V 1JFFA 5EBMC 3DC6A 3GB7C 5FL7G 2E5LO 1Y67A 3D36A 3FFQA 1RP3B 3CCSV 3ASOB 2UXXA 5L3FA 4O2BB 3SPCA 2UXBB 1N34B 4MSWC 4PHZA 3RBZA 4X1IA 1PNMA 3QVNA 5KX5A 3B40A 1FFTB 2P4VA 1V55B 4FVMA 2DYSC 4BWAA 4GUNA 2A79B 1R1BA 3K0GA 4MTFA 4MVRA 4QNHB 4LF7B 1E1QG 2IW5A 3P3PA 4O4HA 2JIZG 3ETQA 3E8GA 3G6BA 4JZ2A 5BR8B 5B1NA 5LMUO 3R65A 1VQOV 3CC7V 1AR4A 2XAJA 2YXYA 3SYQA 1KC8W 4JYAB 4J42A 4FFBB 5J2TB 2PI5A 1NTMH 1GMGA 5KAFZ 2AXTZ 4J10A 4LF8B 2L35A 1MG1A 1FXKA 1Z5WA 5LP6A 5LMNO 4LF9O 2ADQB 3LSSA 5LOVA 2KSDA 3ABLC 2QEXV 3T1CA 2GHYA 2DWEC 1L0NH 3GWKC 1MSWD 3CCMV 1MABG 2ZM6O 1XREA 3QG5A 3I56V 2JEXA 2JGDA 1K33A 1H8EG 2Q6AA 1SA0B 4J41A 5KMGA 3SJQC 1H38A 5EIBC 4JYBA 1JVMA 4RQFA 3LDEA 2UU9B 2HLDG 4HAMA 3L9DA 1XOUA 3OW2U 4JI5O 4JI8B 2WLLB 2K1EA 2RNBA 3JD0A 5DECA 1AJPA 1QLEB 3FYIB 4IT5A 3SPJA 2W0FC 4LBEC 3K0DA 1EM1A 2VWJA 2EULA 4X1YA 4YJ2B 5L3BA 3OUSA 2Z5UA 1XHZA 1HNZB 1DF4A 2ARHA 3K57A 1B6QA 1SQPH 5B3SB 1XBLA 1CEZA 1HDJA 2EIMB 4KL1A 4X20B 1IZ3A 5B1BB 4R8CA 1GM8A 3J80N 4TUYB 1YI2V 3ASOC 3BA9A 2VQFO 2CDYA 2H3OA 2HP8A 1YXBA 1VQ7V 4QE7A 2XAFA 4DV6O 1V55C 2VQEO 1XNQO 1NS1A 4X89A 1L0LH 2HVKC 2EIJB 1T5EA 1K5QA 1P84F 1GN2A 3CCLV 2RN9A 1K4DC 3DSQA 5EZYA 4LF4O 1BHAA 5HFMA 2GUZA 4P9OA 5C8YB 4UCUA 4X9QA 3QO5A 5JQGB 4TV9A 3UKMA 3ZRVA 5LGNA 4QGPA 2CTPA 3CSXA 3Q4HB 4I0XA 1CP9A 3JAKB 3RYCB 4AILC 3N27A 4B3RB 1IDSA 2Q0OC 4X66B 3CCUV 3VOUA 1RSOB 4FZ0A 1N33B 5LGUA 2Q7HA 2UXCB 4LNUB 3RWRD 4LFAO 4TV8B 4MVUA 4PA7A 2DMXA 1N0NA 3WG7B 1V54B 1GN4A 2EBOA 4PI0A 4PDRA 2XT9A 4L87A 3AG4B 5JJNB 5LBQA 2ITCC 1ZL8B 3BVOA 3EVKA 2R9IA 3AG3B 2Y0PA 4NKGB 4UFZA 1W0KG 2Y4UA 2Q73A 1AI7A 1S5JA 2Q8VA 4IIJA 1NH2D 1WA8A 3K08A 3B77A 1THZA 2R9RB 3IFXA 4E2LA 3A2FA 4U3JB 2QR4A 5JJEB 1LNQA 5C93A 4FM2A 1QLEC 4K0KO 5BXZA 1ZLZA 2XAHA 5K1PA 1HW7A 5IJ9B 1BMFG 1NT2B 4DR2B 2A7WA 1UPGA 4KXRA 2IM9A 1D5NA 1GH6A 4XDLA 1Q90D 4JASA 3RGBA 3ZHSA 4X65B 4DR7B 1Q86W 1ZX3A 1AROP 2ZDIC 3ETGA 1HR0O 3VQYA 4O4LA 2EIMC 2Y69C 1BZKA 2IJJA 1VF5B 1LUVA 1GKFA 3L72H 3SPHA 1S5LZ 5ITZB 2QM7A 2YSUB 1XDCA 5LA6A 3FAVB 1E1RG 3KCXA 2FYUH 1TUEB 4KHPO 1TUBB 2DYRB 5LMNB 4PA3A 1NKDA 2RQ6A 1IBMO 1FPOA 2KG7B 4NXMB 5LYJB 3O65A 5CB4A 4NTYA 4LH6A 1RM1C 2Q7EA 1R3LC 3TCUA 4OX9B 4FM1A 1NI8A 1NTKH 3IAYA 1BHBA 3OD4A 1BQZA 4FLTA 3HKEA 3TGUH 3JAWA 4DV1O 4X62O 1VARA 1KYOF 5TISZ 1FS0G 1Q3EA 4GKKB 3JASB 3BEHA 3BPZA 4ZOLB 3W7UA 1EBOA 3CJHA 3OMAB 3CRAA 3FYEB 3VQVA 3M99B 1SQQH 2QA4V 1KBHA 1QQCA 1WNSA 2F95B 4UVCA 1BL8A 4Z1VA 2HHHB 3I5DA 3OUFA 2Q68A 3TK1A 3FB8C 2ZIOA 2EJRA 2R72A 1N36B 1WB7A 5L3GA 1N32O 3SPIA 3EHBB 1VQNV 5FNVB 5IWAB 4HNAA 3FB7C 2YUAA 1AJNA 4FFKA 1Q6UA 3ASNB 4JGSA 3AG3C 4J9YB 3T1YO 4LP8A 1XMQB 2IU0A 2PYLA 3CCQV 4DRXB 4DV6B 4DR3B 1K73W 4GLXA 1PKXA 1S5HC 3B8NA 3HKDA 1AP5A 4DV0O 3ZRXA 3ZRWA 5JVDA 3G6EV 1SQGA 5E79Z 1SZTA 4FMTA 2WLIB 3TXQA 2QWPB 4O2AB 4LF6O 5JCOC 4UXNA 3JSLA 3T1HO 4LFCB 3RFRA 1H2LA 1N0JA 4F4LA 4O2BA 5AG2A 4I50A 4IYHA 2ITDC 3S3WA 2P67A 1AI4A 3E89A 3WU2Z 4ZI7B 4YXWG 3SJCC 4IHJA 5LHIA 1M1KW 4DR6B 3K04A 3OMNB 4ZHQA 1OJHA 4JI4O 3AG7A 1KU9A 2BOBC 3OMIB 3GWOA 2ZR3A 3A0RA 4R6ZA 3RYHB 4P2ZA 3UT5A 2UUCO 2IH1C 2GV9A 1ZWIC 1M57B 3OTOO 2VWKA 1L8DA 2YC0A 2W0XA 3FD9A 3L75H 3W7XA 4JTDB 1Y6XA 5KHHA 5J2TA 1OCRB 4GZRB 5EC1C 2BSKB 5IY5C 4NVPA 1M4UA 2HFEC 4O4JB 5IDJA 1VQKV 2X7RB 1COWG 1VMGA 3RT3C 4Q20A 2QE7G 3ZRSA 1IX9A 1S76D 1QLNA 4DV2O 2ZE6A 2YS8A 1QHTA 3AG1C 1PM9A 2P6JA 1YEWA 5IYDO 3K9AA 3H1LH 2Q67A 2CGOA 3C3TA 2XAQA 4JI0O 3BABA 1KUQA 4PI2A 2P22C 1SA0A 1OCCB 4DR4O 1Q6HA 2JRIA 2B1GA 2JS3A 1KECA 3C90A 4X88A 4R7CA 4X1KB 4CH6A 4JI2O 4LWSB 1AR5A 5D5QA 1ZUQA 1VQ9V 3E8HA 3IJ4A 2C2AA 2WLMA 4WFGA 3RN4A 3STZC 1KP3A 2UXDO 2XUMA 1Y76B 1O9GA 1RPOA 3ZEDA 2P5OA 2QJ1A 2WLLA 3MD0A 2KB1A 4RUEA 3CHXA 3E22A 1DK1A 4LCUC 3CS5A 3BFRA 3T4ZA 3SDLA 4B3SO 3M8AA 5KLVH 4X64O 1Q5OA 1I5XA 5CA0A 3ZN0A 4NR1A 5EYPB 2V4DA 2YIBD 2ZDIA 1R3KC 2QSAA 3DXRB 2PF4E 4DV3B 2PYJA 1VQMV 1BCCH 2R9AA 2NLJC 4NB5A 5IYZB 5B1AC 1GN3A 5GW7A 1PD3A 4B3MO 4WFAV 3S3XA 1D2DA 3TJTA 5JH7B 1JCHA 2YI8A 4IGGA 3H1HH 3P3NA 3UQ8A 1S77D 3G80A 3H1KH 4JTAB 2RDCA 3L73H 2UUAO 4MTGA 2EIKC 4AI8A 4JI7B 4JPRA 2LW1A 3U10A 1I5YA 1PL4A 2W6JG 3GVMA 2V1DA 4DV4O 2EJ7A 5LGTA 4CH4A 2KQXA 3CC4V 1YZBA 1XEQA 2F23A 5C8YA 1M57C 4Q6GA 2GTSA 4AHCA 1XNRO 1OCRC 3Q4HA 5KHGA 3JAKA 3RYCA 4PA4A 1F51A 3CB2A 1VIBA 2H94A 2ATKC 4EB6B 4Z1MG 4K8XA 3ZMSA 2CTWA 2CTQA 1VF6C 4B08A 2EINB 2PY5A 1DGSA 1WPXA 1ZAUA 1DF5A 1XILA 1Y74B 1H2KA 4LF5B 5LXTB 2EZOA 1CXZB 4UCRA 4CC6A 2JJ2G 1HNWO 4N23A 4DW1A 4I55B 1G4YB 4UVAA 1NVPD 2WLKA 1Q43A 2OTJV 3CXCU 1S0VA 4JI4B 2CE4A 2Z0AA 3JATB 4NXNO 1GO3F 2RMKB 1J5EO 2CH7B 3AG2C 4LFBO 3L70H 3HPLC 4RO2A 2UUBB 1PNKA 5JCOA 1NBMG 1SF9A 1URFA 2A06H 3OTOB 1O9HA 5GONB 3DTUB 2BTQB 2ZT9B 1H2SB 4H33A 3HKCB 3SYPA 2FL4A 4J7JA 3ZHTA 3FX7A 4O4IA 2XTAA 1F4MA 2IH3C 3SJBC 4GX5A 3K3WA 3RYIB 1XUQA 2Y48A 5ITZA 3CXHF 1TAEA 1IXBA 4JI3O 2FMLA 2ODMA 4FIPC 4JAAA 3NR7A 5KA5A 2B9ZA 2KG7A 5LYJA 2ZIMA 1G8MA 1EZJA 1Z5VA 4BIOA 4WBNA 1B3QA 2EILB 4JI0B 2JGUA 4CZZA 1JJOA 1GRJA 1TVKA 3WB1A 2VS0A 2K9PA 2DOSA 3E83A 4ZIBA 4I4TB 4ASUG 2DN9A 3ZBHA 3JASA 4JI2B 3K5LA 4FJCC 1IBKO 4MW3A 4DW0A 4KUMA 1R3IC 3W7TA 3RYFA 4OXSA 1VP7A 5BMVB 3CEIA 1I94O 1BSMA 3A0BZ 1WB8A 4X64B 2CGNA 3ABMB 2IJKA 2AHYA 4BAYA 1FJGB 1F4NA 4J9ZB 4X1IB 5KX5B 2EINC 4D7TA 1XQ8A 1QVGU 1HNXB 3TETA 4FLXA 4AQYO 4FLWA 1XHXA 1I0HA 5FNVA 1NH2B 1LR1A 4O4HB 4B3TO 3P32A 1SQBH 1SQXH 2H8PC 1ZSPA 2YXLA 2E5LB 5KA6A 4BIZA 1Z2GA 4F6RA 1IURA 3H01A 3UM7A 1NQTA 1GN6A 5CA1B 2Q9LA 3E2EA 4MVMA 4IL6Z 1R6NA 5J2UB 3U0ZA 3JD1A 2Q7GA 1V9PA 5KHIA 1I7FA 3LSQA 5FPOA 4FLVA 1FXKB 3QO7A 1M9NA 5LP6B 4LC1A 5DEDA 5LOVB 4G28B 3A8TA 2CK3G 4DV7O 4H37A 5LMUB 2F66C 3AK1A 4BW9A 5EK0A 4OPHA 1N8RW 4U7OA 1PNLA 1F23A 4CH3A 5KHKA 4C7UA 3D3QA 1W0JG 4FLZA 2JEUA 1SQFA 5B3SC 2YIDA 4DUZO 3CX5F 3WB0A 3ZHUA 5B1BC 3JCUZ 4QPKA 5D5PA 2M6YA 1R6KA 3F7VC 4LF9B 1NU1H 3CP1A 4EFBA 4WFBV 2DQ3A 2B1IA 1HNWB 4UV9A 3RW0A 4PD4F 4YIOA 2OWOA 1EZVH 2ZM6B 3OE7G 1M56B 3VBBA 2EIJC 4BIUA 4LR3A 1XMOO 4NYKA 4DR5O 2WA3A 1QBZA 3D8CA 3EXAA 5L3CA 1MNGA 1VF6A 1FYJA 4NXNB 3D3IA 4UV8A 2GDSA 4ZBMA 2OCCB 3IGAC 1SQVH 3ABMC 5GTHZ 2Y4TA 4JV5O 4TQDA 3SPGA 4JI5B 3K58A 2WA4A 3OGCC 2ZNJA 4UCOA 2P7TC 1NR1A 4LWSA 1P49A 3AK3A 4DUYO 2ZD9A 4UB8Z 4JI6O 1BT8A 4JF3A 2OYQA 2JK5C 3ZHQA 5IJ0B 3BRCA 1Y76A 3B8MA 2ZXWB 2YIAA 1OCZB 4PV1B 4NTXA 4YY3O 4UVBA 2X6CA 3WG7C 4UCTA 5B1OA 1JPXA 1JR9A 1V54C 2ETNA 2UXBO 1N34O 1AJQA 1HP8A 3AG4C 3IC7A 3K5NA 2VQFB 2BOCC 3SGIA 4JYYA 1SETA 3BHPA 1MA1A 3ABUA 4DV5O 5EBWC 2LFSA 5B5EZ 2QM4A 2Z3YA 1MZEA 2IJHA 5IYZA 5FLXN 1H2GA 2VQEB 4EEQA 1XNQB 3CD6V 3JARA 4MVOA 2XAGA 5BR8O 2FKXA 5JH7A 1VEWA 1VQLV 5B66Z 1IBKB 2ZCEA 2HEPA 5JJJB 1LUWA 4LF4B 3CRQA 2F43G 4YHHO 4JYAO 1JA8A 4OPAA 1VF7A 3M7MX 2DWDC 2DW4A 3ZJZA 4WFFA 4DK1A 4DXWA 4BR6A 1EFRG 1FAFA 3OGIB 4F6EA 2Y0IA 3I55V 2WSSG 4AQYB 1VQ8V 3SR2C 2WLHA 2DJVA 2MK3A 3OTFA 4DR1O 5CN0A 3W7WA 2DYRC 4K8ZA 3G4SV 2QKCA 3APOA 4LFAB 5IYCO 4UUJC 3RVZA 1JX9A 2PUSA 2PZSA 4FFBA 1M56C 2YDEA 2F93B 1WAZA 2E3CA 4CH5A 2UU9O 4G2KA 1ORQC 1ZTEA 5KUMA 5K1XA 2N74A 5LXTA 4GX1A 4JTCB 3UCSC 2CTRA 5LA6B 2ZKOA 1Q7YW 5H5NA 3PN1A 1K9MW 3ZX6A 3ZMTA 3ZN1A 2F1MA 4ICGA 1ENVA 4K0KB 5H6QA 3B4SA 3SYOA 4U7NA 1OV9A 5A9GA 2YI9A 1FKAO 1SS3A 2ZXWC 1HNZO 4G27B 2CH7A 2XNDG 4DYLA 4RAIA 5LL6Y 2P90A 2QM8A 3OEHG 4EFEA 1HR0B 3JSNA 4QE9A 3MHHC 2EZPA 5GONA 3MAQA 2BTQA 3H9VA 3ASNC 3OEEG 3CJHB 4KHPB 2R70A 1U97A 1IBMB 1PPJH 2P06A 3CE2A 4I7ZB 2JS5A 3A0HZ 1FFXB 2ZE5A 3RYIA 4YJ2A 2P4KA 1PV0A 4FZ1A 3DGEA 3K5OA 2O57A 1AB3A 5KHJA 1VQ4V 2FB5A 1Q6IA 4DV1B 4X20A 4X62B 1Y4MA 1FD9A 4TUYA 2YICA 3L74H 3R66A 1AI6A 4HNAB 3WB2A 4MS2A 4I4TA 3ABTA 4KP4A 4B3RO 4X66O 3SJAC 1I08A 1QVFU 1YCIA 1M5IA 4DUYB 1OCOB 2ZNIA 1N33O 1K8AW 1IVSA 2UXCO 5EIBD 2VRZA 2XOKG 1YSCA 2LGWA 4RUFA 4GCZA 5KUKA 5L3DA 5BMVA 3B2EE 2A3QA 1K3EA 4UCSA 1WN7A 3E86A 2AW9A 1N32B 4YY3B 1J95A 3ZMZA 3K59A 1W59A 5JQGA 3N2GB 3KZIZ 3HR0A 3CRMA 4I50B 1H8HG 4DK0A 4PDLA 4JI1O 3LDDA 4FLYA 1FXHA 2Q69A 3ICXA 1S3JA 3T1YB 5HFLA 4IHJB 1P7BA 3F5TA 2GBOA 4CS2A 1BQ0A 4DV5B 1NVPB 4ZHQB 1Q81W 2LP7A 1RSOA 1WPBA 4B7KA 4LNUA 4TV8A 3ETDA 1K92A 4DV0B 1CPYA 4DR2O 3UT5B 3DC5A 2NN4A 4MVSA 4LF6B 3UO3A 5CBFA 4X65O 3RVYA 3KKYA 4YHHB 2XHBA 4DR7O 1WJZA 3T1HB 5LHHA 1OCCC 4TWKA 1ZL8A 4J11A 2GTAA 5CA1A 1Q8IA 4XBFA 3ETEA 2AHZA 5J2UA 4MVQA 3CCEV 3HKBB 4J7KA 3H1IH 4W4LA 4XDJA 1G1XB 4U3JA 3SYCA 3G71V 5L3EA 2BTOA 5A2QN 1YJNV 3G67A 4LH7A 4N21A 4NXMO 4DR1B 1KMIZ 1YDXA 4HZ3A 5IJ9A 1SC5B 1SESA 3F5WC 5FPRA 1KP2A 4OX9O 1QR9A 1UJWB 2HVJC 2QWRB 3B09A 5CBHA 2UUCB 3CCVV 1SKVA 2YXHA 1OZ0A 3BAAA 3O9OA 1P7GA 4XDKA 3OFNG 4A5UB 3N2KB 3WFVA 1HWYA 4GKKO 5CBGA 1NZ6A 4WFHA 2AZ2A 3FAVA 2KKWA 2YEVB 1TUBA 4DV2B 2Q5ZA 4GKJO 3E22B 5CA3A 1SERA 3QF7A 2LO1A 4PJ0Z 2HHHO 4HYOA 3CMEV 5CA0B 1US6A 3ZCCA 2F4VO 1OCOC 4GT1A 1N36O 4WF9V 2AZ0A 1QU7A 4DR4B 4PA6A 2PI4A 3K5MA 2PTMA 4D6TH 2Y69B 3X2QB 5BZBA 5IWAO 3JALB 1TGOA 2B5UA 4ZOLA 2UXDB 4YJ3B 1JQ0A 2D3OW 1X4TA 4J80A 4FM0A 1JFFB 1XMQO 2OCHA 4YIPA 4B3SB 2RJZA 4B7EA 2BE3A 3LUTB 1RM1B 3T4DA 4CS4A 4DR3O 4CBCA 3LDCA 1JJ2U 3IC9A 5IE9A 5IJ0A 2X6BA 3K03A 3CWBH 5IT9N 1MMMA 2WLNA 3BY6A 1YJWV 3U11A 1IBLO 3W7SA 4LFCO 1Y66A 2LFRA 4MW8A 1KQSU 4JAUA 2AGAA 1YITV 1YTFB 1SRYA 2E74B 1GK9A 3K06A 4I5SA 3ZIAG 4MTXA 3J7AU 1L1FA 4B3MB 4DR6O 2IU3A 3JD4A 1SZXA 4DRXA 2ZR2A 2A0LA 4NTWA 1R73A 2A9HA 3AK2A 2IBZH 2UUAB 4JAVA 4H0LB 5IYBO 2WLIA 4O2AA 1W2BU 1N4CA 4QJFB 1UFIA 3JAMN 3UO2A 1YTFD 2JJ1G 4DV4B 2RCVA 1AP6A 3BCCH 3LNNA 1K5SA 3KCYA 1QCEA 1OHHG 3NXSA 5H9CA 2EX3A 1NR7A 4ZI7A 3ZMUA 1XNRB 4X8AA 4BW5A 2Q4PA 4R50A 3E35A 4PDVA 4JI1B 3OM3B 1XL4A 1DTOA 4JYCA 2LW7A 3OR7C 2JGDB 2UXNA 2LGQA 4ZKIA 2L6LA 3SYAA 5KMGB 3RYHA 1YIJV 3ML0A 2HR3A 3ABKB 4TT3G 2G38A 2WPDG 2EILC 2E75B 4U3FH 1K34A 2XASA 3ZS8C 5JWPA 5CMUA 5E1AC 2BSKA 1JOYA 1U96A 4O4JA 3QO8A 4O4IB 2WAMA 1H2NA 2ZE8A 4RQEA 3MDSA 3X2QC 2FTKA 3PJSK 2ILMA 4CC5A 4X1YB 1G6UA 2QWOB 5H6RA 1ROPA 5LHGA 4OGQB 4TSFG 1WP7A 1J5EB 5DM6V 2ADPA 4LFBB 1NJIW 3THOA 3FB6C 1H2MA 2CUGA 3D36C 4RWUA 1A32A 4WBNB 3P30A 3TXSA 1KB9F 1AR1B 1MZFA 4QPJA 3AEIA 3CPWU 1TVKB 4DV3O 5IY5B 1JMKC 3CCJV 4X1KA 2YIBA 2QWQB 4ABMA 2QKAA 4JZGA 4K3AA 3AG1B 2CAZC 4JI3B 3BA8A 4MT8A 1YJ9V 4GX2A 4P30A 3RYFB 5EZYB 4MTOA 2IJIA 4GKJB 1RPRA 4GX0A 1FFXA 1BE3H 2GUZB 3OT7A 1WLEA 5EYPA 1FXVA 4JI7O 3T2MA 2F4VB 4TV9B 2DQ0A 2QTSA 1VQPV 1QR8A 2N05A 3VQXA 3LSUA 1B06A 2LJ2A 2ZINA 3DXRA 2M7WA 1M90W 2V7QG 4I0XB 1Q82W 4QIWF 3JD2A 2QDOA
chains in the Genus database with same CATH topology
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
#chains in the Genus database with same CATH topology
 4LF7 O;  1GM7 A;  1E79 G;  1P4R A;  3CYO A;  1FXK C;  1EN6 A;  5LP6 C;  2OT5 A;  1QNM A;  5H2F Z;  1GTO A;  1KKC A;  2Q0A A;  4I9W A;  1I94 B;  5J9P C;  3QNE A;  3OR6 C;  2N04 A;  3KG2 A;  4F6R B;  2NNU A;  3ABK C;  3CCR V;  4J7Z A;  4LF5 O;  4LF8 O;  1IBL B;  4IIJ B;  4PDM A;  3K9S A;  1WA8 B;  3LNM B;  4CS3 A;  3N2G A;  2QKS A;  1D5A A;  2ZQM A;  5B1A B;  1R3J C;  1AI5 A;  5DN6 G;  4B3T B;  2WLJ A;  3L71 H;  4MVZ A;  1MOF A;  3OAA G;  2WWW A;  4EB6 A;  2BCC H;  1EN5 A;  3ZHR A;  2EIK B;  4UCV A;  4GYC B;  2UUB O;  2JVD A;  3CC2 V;  3QTC A;  1Y74 A;  3CRC A;  2DYS B;  2OCC C;  1PP9 H;  4O4L B;  1K97 A;  3E8B A;  3FB5 C;  4JI8 O;  4H13 B;  1KKD A;  1VQ5 V;  3STL C;  4Z2W A;  1BGY H;  4I55 A;  1WP8 A;  5EC2 C;  5CB4 B;  5KAI Z;  3HKB A;  4DV7 B;  3FKS G;  1GM9 A;  2HJD A;  4FK5 C;  2PGG A;  2X0L A;  1K7D A;  3JAT A;  3JD3 A;  3CRR A;  3JYC A;  1OCZ C;  3HKE B;  2OTL V;  2QWN B;  1YVW A;  3JAW B;  3MHS C;  1R6T A;  1K4C C;  2QGN A;  1DLB A;  1XI1 A;  5BY1 A;  2JDI G;  4DUZ B;  1F7Y A;  5EBL C;  3ZHV A;  4FLU A;  4K35 A;  4D7S A;  1RFY A;  2HG5 C;  3E8F A;  4P9P A;  3K79 A;  3H1J H;  3ABL B;  3HKC A;  1KD1 W;  4FPP A;  2NR5 A;  1PL0 A;  2LQT A;  4EKW A;  3N2K A;  1BS3 A;  1B04 A;  4PA9 A;  4E4E A;  4HBN A;  1M93 A;  2OIG A;  4WFE A;  3EFF K;  2YEV A;  2QTO A;  1XMO B;  4DR5 B;  3JCZ A;  2DE0 X;  1MSD A;  3AG2 B;  1TA8 A;  2HJF C;  1XL6 A;  4H44 B;  1YHQ V;  2X6A A;  1EN4 A;  5GTI Z;  4PEL A;  2D2C B;  2GSM B;  1IXM A;  1AVM A;  4W4K A;  4I9Q A;  4TQF A;  3ZMV A;  1FJG O;  2OIE A;  2MW2 B;  4IYI A;  3APQ A;  3F7Y C;  2ZE7 A;  4JV5 B;  1X59 A;  2E76 B;  1VQ6 V;  2W6I G;  1HNX O;  3C3S A;  4KFM A;  1AIL A;  4WCE V;  5F2V O;  4DO2 A;  3VQW A;  1GAX A;  2HKO A;  1NTZ H;  3JAL A;  4JI6 B;  4TOI A;  4L8J A;  4YJ3 A;  3J81 N;  3HKD B;  3JAR B;  3HB3 B;  5JVD B;  4UB6 Z;  3ZRW B;  3CMA V;  1YF2 A;  1S72 V;  1JFF A;  5EBM C;  3DC6 A;  3GB7 C;  5FL7 G;  2E5L O;  1Y67 A;  3D36 A;  3FFQ A;  1RP3 B;  3CCS V;  3ASO B;  2UXX A;  5L3F A;  4O2B B;  3SPC A;  2UXB B;  1N34 B;  4MSW C;  4PHZ A;  3RBZ A;  4X1I A;  1PNM A;  3QVN A;  5KX5 A;  3B40 A;  1FFT B;  2P4V A;  1V55 B;  4FVM A;  2DYS C;  4BWA A;  4GUN A;  2A79 B;  1R1B A;  3K0G A;  4MTF A;  4MVR A;  4QNH B;  4LF7 B;  1E1Q G;  2IW5 A;  3P3P A;  4O4H A;  2JIZ G;  3ETQ A;  3E8G A;  3G6B A;  4JZ2 A;  5BR8 B;  5B1N A;  5LMU O;  3R65 A;  1VQO V;  3CC7 V;  1AR4 A;  2XAJ A;  2YXY A;  3SYQ A;  1KC8 W;  4JYA B;  4J42 A;  4FFB B;  5J2T B;  2PI5 A;  1NTM H;  1GMG A;  5KAF Z;  2AXT Z;  4J10 A;  4LF8 B;  2L35 A;  1MG1 A;  1FXK A;  1Z5W A;  5LP6 A;  5LMN O;  4LF9 O;  2ADQ B;  3LSS A;  5LOV A;  2KSD A;  3ABL C;  2QEX V;  3T1C A;  2GHY A;  2DWE C;  1L0N H;  3GWK C;  1MSW D;  3CCM V;  1MAB G;  2ZM6 O;  1XRE A;  3QG5 A;  3I56 V;  2JEX A;  2JGD A;  1K33 A;  1H8E G;  2Q6A A;  1SA0 B;  4J41 A;  5KMG A;  3SJQ C;  1H38 A;  5EIB C;  4JYB A;  1JVM A;  4RQF A;  3LDE A;  2UU9 B;  2HLD G;  4HAM A;  3L9D A;  1XOU A;  3OW2 U;  4JI5 O;  4JI8 B;  2WLL B;  2K1E A;  2RNB A;  3JD0 A;  5DEC A;  1AJP A;  1QLE B;  3FYI B;  4IT5 A;  3SPJ A;  2W0F C;  4LBE C;  3K0D A;  1EM1 A;  2VWJ A;  2EUL A;  4X1Y A;  4YJ2 B;  5L3B A;  3OUS A;  2Z5U A;  1XHZ A;  1HNZ B;  1DF4 A;  2ARH A;  3K57 A;  1B6Q A;  1SQP H;  5B3S B;  1XBL A;  1CEZ A;  1HDJ A;  2EIM B;  4KL1 A;  4X20 B;  1IZ3 A;  5B1B B;  4R8C A;  1GM8 A;  3J80 N;  4TUY B;  1YI2 V;  3ASO C;  3BA9 A;  2VQF O;  2CDY A;  2H3O A;  2HP8 A;  1YXB A;  1VQ7 V;  4QE7 A;  2XAF A;  4DV6 O;  1V55 C;  2VQE O;  1XNQ O;  1NS1 A;  4X89 A;  1L0L H;  2HVK C;  2EIJ B;  1T5E A;  1K5Q A;  1P84 F;  1GN2 A;  3CCL V;  2RN9 A;  1K4D C;  3DSQ A;  5EZY A;  4LF4 O;  1BHA A;  5HFM A;  2GUZ A;  4P9O A;  5C8Y B;  4UCU A;  4X9Q A;  3QO5 A;  5JQG B;  4TV9 A;  3UKM A;  3ZRV A;  5LGN A;  4QGP A;  2CTP A;  3CSX A;  3Q4H B;  4I0X A;  1CP9 A;  3JAK B;  3RYC B;  4AIL C;  3N27 A;  4B3R B;  1IDS A;  2Q0O C;  4X66 B;  3CCU V;  3VOU A;  1RSO B;  4FZ0 A;  1N33 B;  5LGU A;  2Q7H A;  2UXC B;  4LNU B;  3RWR D;  4LFA O;  4TV8 B;  4MVU A;  4PA7 A;  2DMX A;  1N0N A;  3WG7 B;  1V54 B;  1GN4 A;  2EBO A;  4PI0 A;  4PDR A;  2XT9 A;  4L87 A;  3AG4 B;  5JJN B;  5LBQ A;  2ITC C;  1ZL8 B;  3BVO A;  3EVK A;  2R9I A;  3AG3 B;  2Y0P A;  4NKG B;  4UFZ A;  1W0K G;  2Y4U A;  2Q73 A;  1AI7 A;  1S5J A;  2Q8V A;  4IIJ A;  1NH2 D;  1WA8 A;  3K08 A;  3B77 A;  1THZ A;  2R9R B;  3IFX A;  4E2L A;  3A2F A;  4U3J B;  2QR4 A;  5JJE B;  1LNQ A;  5C93 A;  4FM2 A;  1QLE C;  4K0K O;  5BXZ A;  1ZLZ A;  2XAH A;  5K1P A;  1HW7 A;  5IJ9 B;  1BMF G;  1NT2 B;  4DR2 B;  2A7W A;  1UPG A;  4KXR A;  2IM9 A;  1D5N A;  1GH6 A;  4XDL A;  1Q90 D;  4JAS A;  3RGB A;  3ZHS A;  4X65 B;  4DR7 B;  1Q86 W;  1ZX3 A;  1ARO P;  2ZDI C;  3ETG A;  1HR0 O;  3VQY A;  4O4L A;  2EIM C;  2Y69 C;  1BZK A;  2IJJ A;  1VF5 B;  1LUV A;  1GKF A;  3L72 H;  3SPH A;  1S5L Z;  5ITZ B;  2QM7 A;  2YSU B;  1XDC A;  5LA6 A;  3FAV B;  1E1R G;  3KCX A;  2FYU H;  1TUE B;  4KHP O;  1TUB B;  2DYR B;  5LMN B;  4PA3 A;  1NKD A;  2RQ6 A;  1IBM O;  1FPO A;  2KG7 B;  4NXM B;  5LYJ B;  3O65 A;  5CB4 A;  4NTY A;  4LH6 A;  1RM1 C;  2Q7E A;  1R3L C;  3TCU A;  4OX9 B;  4FM1 A;  1NI8 A;  1NTK H;  3IAY A;  1BHB A;  3OD4 A;  1BQZ A;  4FLT A;  3HKE A;  3TGU H;  3JAW A;  4DV1 O;  4X62 O;  1VAR A;  1KYO F;  5TIS Z;  1FS0 G;  1Q3E A;  4GKK B;  3JAS B;  3BEH A;  3BPZ A;  4ZOL B;  3W7U A;  1EBO A;  3CJH A;  3OMA B;  3CRA A;  3FYE B;  3VQV A;  3M99 B;  1SQQ H;  2QA4 V;  1KBH A;  1QQC A;  1WNS A;  2F95 B;  4UVC A;  1BL8 A;  4Z1V A;  2HHH B;  3I5D A;  3OUF A;  2Q68 A;  3TK1 A;  3FB8 C;  2ZIO A;  2EJR A;  2R72 A;  1N36 B;  1WB7 A;  5L3G A;  1N32 O;  3SPI A;  3EHB B;  1VQN V;  5FNV B;  5IWA B;  4HNA A;  3FB7 C;  2YUA A;  1AJN A;  4FFK A;  1Q6U A;  3ASN B;  4JGS A;  3AG3 C;  4J9Y B;  3T1Y O;  4LP8 A;  1XMQ B;  2IU0 A;  2PYL A;  3CCQ V;  4DRX B;  4DV6 B;  4DR3 B;  1K73 W;  4GLX A;  1PKX A;  1S5H C;  3B8N A;  3HKD A;  1AP5 A;  4DV0 O;  3ZRX A;  3ZRW A;  5JVD A;  3G6E V;  1SQG A;  5E79 Z;  1SZT A;  4FMT A;  2WLI B;  3TXQ A;  2QWP B;  4O2A B;  4LF6 O;  5JCO C;  4UXN A;  3JSL A;  3T1H O;  4LFC B;  3RFR A;  1H2L A;  1N0J A;  4F4L A;  4O2B A;  5AG2 A;  4I50 A;  4IYH A;  2ITD C;  3S3W A;  2P67 A;  1AI4 A;  3E89 A;  3WU2 Z;  4ZI7 B;  4YXW G;  3SJC C;  4IHJ A;  5LHI A;  1M1K W;  4DR6 B;  3K04 A;  3OMN B;  4ZHQ A;  1OJH A;  4JI4 O;  3AG7 A;  1KU9 A;  2BOB C;  3OMI B;  3GWO A;  2ZR3 A;  3A0R A;  4R6Z A;  3RYH B;  4P2Z A;  3UT5 A;  2UUC O;  2IH1 C;  2GV9 A;  1ZWI C;  1M57 B;  3OTO O;  2VWK A;  1L8D A;  2YC0 A;  2W0X A;  3FD9 A;  3L75 H;  3W7X A;  4JTD B;  1Y6X A;  5KHH A;  5J2T A;  1OCR B;  4GZR B;  5EC1 C;  2BSK B;  5IY5 C;  4NVP A;  1M4U A;  2HFE C;  4O4J B;  5IDJ A;  1VQK V;  2X7R B;  1COW G;  1VMG A;  3RT3 C;  4Q20 A;  2QE7 G;  3ZRS A;  1IX9 A;  1S76 D;  1QLN A;  4DV2 O;  2ZE6 A;  2YS8 A;  1QHT A;  3AG1 C;  1PM9 A;  2P6J A;  1YEW A;  5IYD O;  3K9A A;  3H1L H;  2Q67 A;  2CGO A;  3C3T A;  2XAQ A;  4JI0 O;  3BAB A;  1KUQ A;  4PI2 A;  2P22 C;  1SA0 A;  1OCC B;  4DR4 O;  1Q6H A;  2JRI A;  2B1G A;  2JS3 A;  1KEC A;  3C90 A;  4X88 A;  4R7C A;  4X1K B;  4CH6 A;  4JI2 O;  4LWS B;  1AR5 A;  5D5Q A;  1ZUQ A;  1VQ9 V;  3E8H A;  3IJ4 A;  2C2A A;  2WLM A;  4WFG A;  3RN4 A;  3STZ C;  1KP3 A;  2UXD O;  2XUM A;  1Y76 B;  1O9G A;  1RPO A;  3ZED A;  2P5O A;  2QJ1 A;  2WLL A;  3MD0 A;  2KB1 A;  4RUE A;  3CHX A;  3E22 A;  1DK1 A;  4LCU C;  3CS5 A;  3BFR A;  3T4Z A;  3SDL A;  4B3S O;  3M8A A;  5KLV H;  4X64 O;  1Q5O A;  1I5X A;  5CA0 A;  3ZN0 A;  4NR1 A;  5EYP B;  2V4D A;  2YIB D;  2ZDI A;  1R3K C;  2QSA A;  3DXR B;  2PF4 E;  4DV3 B;  2PYJ A;  1VQM V;  1BCC H;  2R9A A;  2NLJ C;  4NB5 A;  5IYZ B;  5B1A C;  1GN3 A;  5GW7 A;  1PD3 A;  4B3M O;  4WFA V;  3S3X A;  1D2D A;  3TJT A;  5JH7 B;  1JCH A;  2YI8 A;  4IGG A;  3H1H H;  3P3N A;  3UQ8 A;  1S77 D;  3G80 A;  3H1K H;  4JTA B;  2RDC A;  3L73 H;  2UUA O;  4MTG A;  2EIK C;  4AI8 A;  4JI7 B;  4JPR A;  2LW1 A;  3U10 A;  1I5Y A;  1PL4 A;  2W6J G;  3GVM A;  2V1D A;  4DV4 O;  2EJ7 A;  5LGT A;  4CH4 A;  2KQX A;  3CC4 V;  1YZB A;  1XEQ A;  2F23 A;  5C8Y A;  1M57 C;  4Q6G A;  2GTS A;  4AHC A;  1XNR O;  1OCR C;  3Q4H A;  5KHG A;  3JAK A;  3RYC A;  4PA4 A;  1F51 A;  3CB2 A;  1VIB A;  2H94 A;  2ATK C;  4EB6 B;  4Z1M G;  4K8X A;  3ZMS A;  2CTW A;  2CTQ A;  1VF6 C;  4B08 A;  2EIN B;  2PY5 A;  1DGS A;  1WPX A;  1ZAU A;  1DF5 A;  1XIL A;  1Y74 B;  1H2K A;  4LF5 B;  5LXT B;  2EZO A;  1CXZ B;  4UCR A;  4CC6 A;  2JJ2 G;  1HNW O;  4N23 A;  4DW1 A;  4I55 B;  1G4Y B;  4UVA A;  1NVP D;  2WLK A;  1Q43 A;  2OTJ V;  3CXC U;  1S0V A;  4JI4 B;  2CE4 A;  2Z0A A;  3JAT B;  4NXN O;  1GO3 F;  2RMK B;  1J5E O;  2CH7 B;  3AG2 C;  4LFB O;  3L70 H;  3HPL C;  4RO2 A;  2UUB B;  1PNK A;  5JCO A;  1NBM G;  1SF9 A;  1URF A;  2A06 H;  3OTO B;  1O9H A;  5GON B;  3DTU B;  2BTQ B;  2ZT9 B;  1H2S B;  4H33 A;  3HKC B;  3SYP A;  2FL4 A;  4J7J A;  3ZHT A;  3FX7 A;  4O4I A;  2XTA A;  1F4M A;  2IH3 C;  3SJB C;  4GX5 A;  3K3W A;  3RYI B;  1XUQ A;  2Y48 A;  5ITZ A;  3CXH F;  1TAE A;  1IXB A;  4JI3 O;  2FML A;  2ODM A;  4FIP C;  4JAA A;  3NR7 A;  5KA5 A;  2B9Z A;  2KG7 A;  5LYJ A;  2ZIM A;  1G8M A;  1EZJ A;  1Z5V A;  4BIO A;  4WBN A;  1B3Q A;  2EIL B;  4JI0 B;  2JGU A;  4CZZ A;  1JJO A;  1GRJ A;  1TVK A;  3WB1 A;  2VS0 A;  2K9P A;  2DOS A;  3E83 A;  4ZIB A;  4I4T B;  4ASU G;  2DN9 A;  3ZBH A;  3JAS A;  4JI2 B;  3K5L A;  4FJC C;  1IBK O;  4MW3 A;  4DW0 A;  4KUM A;  1R3I C;  3W7T A;  3RYF A;  4OXS A;  1VP7 A;  5BMV B;  3CEI A;  1I94 O;  1BSM A;  3A0B Z;  1WB8 A;  4X64 B;  2CGN A;  3ABM B;  2IJK A;  2AHY A;  4BAY A;  1FJG B;  1F4N A;  4J9Z B;  4X1I B;  5KX5 B;  2EIN C;  4D7T A;  1XQ8 A;  1QVG U;  1HNX B;  3TET A;  4FLX A;  4AQY O;  4FLW A;  1XHX A;  1I0H A;  5FNV A;  1NH2 B;  1LR1 A;  4O4H B;  4B3T O;  3P32 A;  1SQB H;  1SQX H;  2H8P C;  1ZSP A;  2YXL A;  2E5L B;  5KA6 A;  4BIZ A;  1Z2G A;  4F6R A;  1IUR A;  3H01 A;  3UM7 A;  1NQT A;  1GN6 A;  5CA1 B;  2Q9L A;  3E2E A;  4MVM A;  4IL6 Z;  1R6N A;  5J2U B;  3U0Z A;  3JD1 A;  2Q7G A;  1V9P A;  5KHI A;  1I7F A;  3LSQ A;  5FPO A;  4FLV A;  1FXK B;  3QO7 A;  1M9N A;  5LP6 B;  4LC1 A;  5DED A;  5LOV B;  4G28 B;  3A8T A;  2CK3 G;  4DV7 O;  4H37 A;  5LMU B;  2F66 C;  3AK1 A;  4BW9 A;  5EK0 A;  4OPH A;  1N8R W;  4U7O A;  1PNL A;  1F23 A;  4CH3 A;  5KHK A;  4C7U A;  3D3Q A;  1W0J G;  4FLZ A;  2JEU A;  1SQF A;  5B3S C;  2YID A;  4DUZ O;  3CX5 F;  3WB0 A;  3ZHU A;  5B1B C;  3JCU Z;  4QPK A;  5D5P A;  2M6Y A;  1R6K A;  3F7V C;  4LF9 B;  1NU1 H;  3CP1 A;  4EFB A;  4WFB V;  2DQ3 A;  2B1I A;  1HNW B;  4UV9 A;  3RW0 A;  4PD4 F;  4YIO A;  2OWO A;  1EZV H;  2ZM6 B;  3OE7 G;  1M56 B;  3VBB A;  2EIJ C;  4BIU A;  4LR3 A;  1XMO O;  4NYK A;  4DR5 O;  2WA3 A;  1QBZ A;  3D8C A;  3EXA A;  5L3C A;  1MNG A;  1VF6 A;  1FYJ A;  4NXN B;  3D3I A;  4UV8 A;  2GDS A;  4ZBM A;  2OCC B;  3IGA C;  1SQV H;  3ABM C;  5GTH Z;  2Y4T A;  4JV5 O;  4TQD A;  3SPG A;  4JI5 B;  3K58 A;  2WA4 A;  3OGC C;  2ZNJ A;  4UCO A;  2P7T C;  1NR1 A;  4LWS A;  1P49 A;  3AK3 A;  4DUY O;  2ZD9 A;  4UB8 Z;  4JI6 O;  1BT8 A;  4JF3 A;  2OYQ A;  2JK5 C;  3ZHQ A;  5IJ0 B;  3BRC A;  1Y76 A;  3B8M A;  2ZXW B;  2YIA A;  1OCZ B;  4PV1 B;  4NTX A;  4YY3 O;  4UVB A;  2X6C A;  3WG7 C;  4UCT A;  5B1O A;  1JPX A;  1JR9 A;  1V54 C;  2ETN A;  2UXB O;  1N34 O;  1AJQ A;  1HP8 A;  3AG4 C;  3IC7 A;  3K5N A;  2VQF B;  2BOC C;  3SGI A;  4JYY A;  1SET A;  3BHP A;  1MA1 A;  3ABU A;  4DV5 O;  5EBW C;  2LFS A;  5B5E Z;  2QM4 A;  2Z3Y A;  1MZE A;  2IJH A;  5IYZ A;  5FLX N;  1H2G A;  2VQE B;  4EEQ A;  1XNQ B;  3CD6 V;  3JAR A;  4MVO A;  2XAG A;  5BR8 O;  2FKX A;  5JH7 A;  1VEW A;  1VQL V;  5B66 Z;  1IBK B;  2ZCE A;  2HEP A;  5JJJ B;  1LUW A;  4LF4 B;  3CRQ A;  2F43 G;  4YHH O;  4JYA O;  1JA8 A;  4OPA A;  1VF7 A;  3M7M X;  2DWD C;  2DW4 A;  3ZJZ A;  4WFF A;  4DK1 A;  4DXW A;  4BR6 A;  1EFR G;  1FAF A;  3OGI B;  4F6E A;  2Y0I A;  3I55 V;  2WSS G;  4AQY B;  1VQ8 V;  3SR2 C;  2WLH A;  2DJV A;  2MK3 A;  3OTF A;  4DR1 O;  5CN0 A;  3W7W A;  2DYR C;  4K8Z A;  3G4S V;  2QKC A;  3APO A;  4LFA B;  5IYC O;  4UUJ C;  3RVZ A;  1JX9 A;  2PUS A;  2PZS A;  4FFB A;  1M56 C;  2YDE A;  2F93 B;  1WAZ A;  2E3C A;  4CH5 A;  2UU9 O;  4G2K A;  1ORQ C;  1ZTE A;  5KUM A;  5K1X A;  2N74 A;  5LXT A;  4GX1 A;  4JTC B;  3UCS C;  2CTR A;  5LA6 B;  2ZKO A;  1Q7Y W;  5H5N A;  3PN1 A;  1K9M W;  3ZX6 A;  3ZMT A;  3ZN1 A;  2F1M A;  4ICG A;  1ENV A;  4K0K B;  5H6Q A;  3B4S A;  3SYO A;  4U7N A;  1OV9 A;  5A9G A;  2YI9 A;  1FKA O;  1SS3 A;  2ZXW C;  1HNZ O;  4G27 B;  2CH7 A;  2XND G;  4DYL A;  4RAI A;  5LL6 Y;  2P90 A;  2QM8 A;  3OEH G;  4EFE A;  1HR0 B;  3JSN A;  4QE9 A;  3MHH C;  2EZP A;  5GON A;  3MAQ A;  2BTQ A;  3H9V A;  3ASN C;  3OEE G;  3CJH B;  4KHP B;  2R70 A;  1U97 A;  1IBM B;  1PPJ H;  2P06 A;  3CE2 A;  4I7Z B;  2JS5 A;  3A0H Z;  1FFX B;  2ZE5 A;  3RYI A;  4YJ2 A;  2P4K A;  1PV0 A;  4FZ1 A;  3DGE A;  3K5O A;  2O57 A;  1AB3 A;  5KHJ A;  1VQ4 V;  2FB5 A;  1Q6I A;  4DV1 B;  4X20 A;  4X62 B;  1Y4M A;  1FD9 A;  4TUY A;  2YIC A;  3L74 H;  3R66 A;  1AI6 A;  4HNA B;  3WB2 A;  4MS2 A;  4I4T A;  3ABT A;  4KP4 A;  4B3R O;  4X66 O;  3SJA C;  1I08 A;  1QVF U;  1YCI A;  1M5I A;  4DUY B;  1OCO B;  2ZNI A;  1N33 O;  1K8A W;  1IVS A;  2UXC O;  5EIB D;  2VRZ A;  2XOK G;  1YSC A;  2LGW A;  4RUF A;  4GCZ A;  5KUK A;  5L3D A;  5BMV A;  3B2E E;  2A3Q A;  1K3E A;  4UCS A;  1WN7 A;  3E86 A;  2AW9 A;  1N32 B;  4YY3 B;  1J95 A;  3ZMZ A;  3K59 A;  1W59 A;  5JQG A;  3N2G B;  3KZI Z;  3HR0 A;  3CRM A;  4I50 B;  1H8H G;  4DK0 A;  4PDL A;  4JI1 O;  3LDD A;  4FLY A;  1FXH A;  2Q69 A;  3ICX A;  1S3J A;  3T1Y B;  5HFL A;  4IHJ B;  1P7B A;  3F5T A;  2GBO A;  4CS2 A;  1BQ0 A;  4DV5 B;  1NVP B;  4ZHQ B;  1Q81 W;  2LP7 A;  1RSO A;  1WPB A;  4B7K A;  4LNU A;  4TV8 A;  3ETD A;  1K92 A;  4DV0 B;  1CPY A;  4DR2 O;  3UT5 B;  3DC5 A;  2NN4 A;  4MVS A;  4LF6 B;  3UO3 A;  5CBF A;  4X65 O;  3RVY A;  3KKY A;  4YHH B;  2XHB A;  4DR7 O;  1WJZ A;  3T1H B;  5LHH A;  1OCC C;  4TWK A;  1ZL8 A;  4J11 A;  2GTA A;  5CA1 A;  1Q8I A;  4XBF A;  3ETE A;  2AHZ A;  5J2U A;  4MVQ A;  3CCE V;  3HKB B;  4J7K A;  3H1I H;  4W4L A;  4XDJ A;  1G1X B;  4U3J A;  3SYC A;  3G71 V;  5L3E A;  2BTO A;  5A2Q N;  1YJN V;  3G67 A;  4LH7 A;  4N21 A;  4NXM O;  4DR1 B;  1KMI Z;  1YDX A;  4HZ3 A;  5IJ9 A;  1SC5 B;  1SES A;  3F5W C;  5FPR A;  1KP2 A;  4OX9 O;  1QR9 A;  1UJW B;  2HVJ C;  2QWR B;  3B09 A;  5CBH A;  2UUC B;  3CCV V;  1SKV A;  2YXH A;  1OZ0 A;  3BAA A;  3O9O A;  1P7G A;  4XDK A;  3OFN G;  4A5U B;  3N2K B;  3WFV A;  1HWY A;  4GKK O;  5CBG A;  1NZ6 A;  4WFH A;  2AZ2 A;  3FAV A;  2KKW A;  2YEV B;  1TUB A;  4DV2 B;  2Q5Z A;  4GKJ O;  3E22 B;  5CA3 A;  1SER A;  3QF7 A;  2LO1 A;  4PJ0 Z;  2HHH O;  4HYO A;  3CME V;  5CA0 B;  1US6 A;  3ZCC A;  2F4V O;  1OCO C;  4GT1 A;  1N36 O;  4WF9 V;  2AZ0 A;  1QU7 A;  4DR4 B;  4PA6 A;  2PI4 A;  3K5M A;  2PTM A;  4D6T H;  2Y69 B;  3X2Q B;  5BZB A;  5IWA O;  3JAL B;  1TGO A;  2B5U A;  4ZOL A;  2UXD B;  4YJ3 B;  1JQ0 A;  2D3O W;  1X4T A;  4J80 A;  4FM0 A;  1JFF B;  1XMQ O;  2OCH A;  4YIP A;  4B3S B;  2RJZ A;  4B7E A;  2BE3 A;  3LUT B;  1RM1 B;  3T4D A;  4CS4 A;  4DR3 O;  4CBC A;  3LDC A;  1JJ2 U;  3IC9 A;  5IE9 A;  5IJ0 A;  2X6B A;  3K03 A;  3CWB H;  5IT9 N;  1MMM A;  2WLN A;  3BY6 A;  1YJW V;  3U11 A;  1IBL O;  3W7S A;  4LFC O;  1Y66 A;  2LFR A;  4MW8 A;  1KQS U;  4JAU A;  2AGA A;  1YIT V;  1YTF B;  1SRY A;  2E74 B;  1GK9 A;  3K06 A;  4I5S A;  3ZIA G;  4MTX A;  3J7A U;  1L1F A;  4B3M B;  4DR6 O;  2IU3 A;  3JD4 A;  1SZX A;  4DRX A;  2ZR2 A;  2A0L A;  4NTW A;  1R73 A;  2A9H A;  3AK2 A;  2IBZ H;  2UUA B;  4JAV A;  4H0L B;  5IYB O;  2WLI A;  4O2A A;  1W2B U;  1N4C A;  4QJF B;  1UFI A;  3JAM N;  3UO2 A;  1YTF D;  2JJ1 G;  4DV4 B;  2RCV A;  1AP6 A;  3BCC H;  3LNN A;  1K5S A;  3KCY A;  1QCE A;  1OHH G;  3NXS A;  5H9C A;  2EX3 A;  1NR7 A;  4ZI7 A;  3ZMU A;  1XNR B;  4X8A A;  4BW5 A;  2Q4P A;  4R50 A;  3E35 A;  4PDV A;  4JI1 B;  3OM3 B;  1XL4 A;  1DTO A;  4JYC A;  2LW7 A;  3OR7 C;  2JGD B;  2UXN A;  2LGQ A;  4ZKI A;  2L6L A;  3SYA A;  5KMG B;  3RYH A;  1YIJ V;  3ML0 A;  2HR3 A;  3ABK B;  4TT3 G;  2G38 A;  2WPD G;  2EIL C;  2E75 B;  4U3F H;  1K34 A;  2XAS A;  3ZS8 C;  5JWP A;  5CMU A;  5E1A C;  2BSK A;  1JOY A;  1U96 A;  4O4J A;  3QO8 A;  4O4I B;  2WAM A;  1H2N A;  2ZE8 A;  4RQE A;  3MDS A;  3X2Q C;  2FTK A;  3PJS K;  2ILM A;  4CC5 A;  4X1Y B;  1G6U A;  2QWO B;  5H6R A;  1ROP A;  5LHG A;  4OGQ B;  4TSF G;  1WP7 A;  1J5E B;  5DM6 V;  2ADP A;  4LFB B;  1NJI W;  3THO A;  3FB6 C;  1H2M A;  2CUG A;  3D36 C;  4RWU A;  1A32 A;  4WBN B;  3P30 A;  3TXS A;  1KB9 F;  1AR1 B;  1MZF A;  4QPJ A;  3AEI A;  3CPW U;  1TVK B;  4DV3 O;  5IY5 B;  1JMK C;  3CCJ V;  4X1K A;  2YIB A;  2QWQ B;  4ABM A;  2QKA A;  4JZG A;  4K3A A;  3AG1 B;  2CAZ C;  4JI3 B;  3BA8 A;  4MT8 A;  1YJ9 V;  4GX2 A;  4P30 A;  3RYF B;  5EZY B;  4MTO A;  2IJI A;  4GKJ B;  1RPR A;  4GX0 A;  1FFX A;  1BE3 H;  2GUZ B;  3OT7 A;  1WLE A;  5EYP A;  1FXV A;  4JI7 O;  3T2M A;  2F4V B;  4TV9 B;  2DQ0 A;  2QTS A;  1VQP V;  1QR8 A;  2N05 A;  3VQX A;  3LSU A;  1B06 A;  2LJ2 A;  2ZIN A;  3DXR A;  2M7W A;  1M90 W;  2V7Q G;  4I0X B;  1Q82 W;  4QIW F;  3JD2 A;  2QDO A; 
#chains in the Genus database with same CATH homology
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...