3CS5A

Nbla protein from synechococcus elongatus pcc 7942
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
48
structure length
48
Chain Sequence
VEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Phycobilisome degradation protein nblA
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Synechococcus sp.
total genus 13
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 3cs5A00
3CS5A 2Q8VA 2QDOA 1OJHA
chains in the Genus database with same CATH superfamily
4UVAA 2Q67A 3RYFA 3STZC 4OX9B 1F4MA 1VQ9V 1VQ6V 4TUYB 2UXCO 1ZTEA 1NBMG 3SR2C 3QNEA 4OPAA 1KECA 2VQFB 5A2QN 3RGBA 3CXHF 1DF4A 4DV3O 1VQOV 4RQFA 1XNQO 4DR6B 4FZ1A 1FXHA 2DYSB 4DR7B 5B66Z 2CGOA 4FLWA 5H2FZ 1QCEA 2DN9A 1F7YA 4I9WA 1N32B 1OCZC 5TISZ 4BW9A 4YY3B 5E79Z 4MSWC 1K4DC 4JI4O 1YXBA 3W7WA 5C8YA 4X64O 1I7FA 1GK9A 2UXBB 1H2SB 4FLZA 4MTGA 1IURA 3OUSA 3SPCA 4LF6O 2QGNA 4I50A 1GN6A 4GUNA 3H1JH 3QF7A 1R6TA 4YJ3A 1YJNV 4KP4A 2ADQB 4CS2A 3OT7A 2LGWA 3OR7C 3ZN0A 1SQPH 1VQ5V 1Q81W 1S5HC 1KKDA 3SYQA 4XDKA 1JQ0A 4DK1A 5CBFA 4B3MO 1M4UA 1P84F 1YCIA 5KMGB 3SYPA 3BAAA 1Q86W 4QGPA 2UXNA 1Q6UA 1AR1B 2XUMA 4AILC 3E89A 3T1YO 2VQEB 5J2TB 1WP7A 4DV0B 1BMFG 4EB6A 4J42A 1VQNV 4JV5B 2LW7A 4JI5B 4H0LB 3KG2A 2YUAA 4HBNA 3CPWU 3APOA 4ZI7A 1AI7A 4WFAV 2LJ2A 1ZL8B 2UU9O 5DECA 1ORQC 2B1GA 2AHYA 5GONB 2QA4V 5L3FA 2N74A 4ABMA 2EJRA 3CRAA 4BIUA 1H38A 1G4YB 5CA0B 2CH7A 3C3SA 4DUZB 1KMIZ 5BMVA 3G4SV 4MW8A 4LC1A 1Q7YW 1P4RA 3CCMV 4JTDB 2FL4A 1F23A 1S77D 3K9AA 4HAMA 5IYZA 2WLIA 2Q8VA 3A2FA 3RW0A 4Z2WA 4TWKA 3CCUV 1VARA 1H8HG 5JH7B 5JVDB 2F95B 3F7YC 1QBZA 3ZMSA 1N36O 2Q0OC 3J81N 4GX0A 4NKGB 5KA5A 2WLKA 3IFXA 4FLYA 3BY6A 2ZIMA 3JARA 3OR6C 2QWNB 4UB6Z 5LMNO 1OV9A 3TCUA 1KUQA 1GMGA 2AGAA 4ZIBA 4FMTA 1MSWD 4DUYO 3CCQV 1WPXA 3WB0A 5FL7G 5B1NA 4WFEA 5KHIA 4TSFG 3ZMZA 2UUCB 1PP9H 1MNGA 2CTWA 1VF6C 5HFLA 1QHTA 2C2AA 2YEVA 1D5NA 5IWAO 4WFBV 2JIZG 3NR7A 1VP7A 1AR4A 1NR1A 3F5WC 2P90A 2WLJA 1IBLO 3HKBA 2ZXWC 3JAKB 4W4LA 4EEQA 3RYIA 4BWAA 2UUAB 1AB3A 3ZCCA 1VQ7V 1I08A 2OT5A 3O9OA 4LP8A 2A3QA 2X0LA 1YI2V 1GM7A 2ZDIC 1MA1A 4O2AA 4DXWA 5LMUB 4DV4B 2ZE5A 4PDLA 1ZX3A 4O4JA 4LFAO 2NNUA 2YI8A 2D2CB 3OMAB 1K92A 4F4LA 1COWG 2L6LA 2Y0PA 4MVRA 2CAZC 2LO1A 4H37A 5IJ9A 2EIKB 3UCSC 2IH1C 2UUBB 2ITCC 2XOKG 5B3SC 1NKDA 4LH6A 1IZ3A 4UB8Z 3HKEB 5DN6G 3E8FA 2HEPA 4B7EA 2RNBA 4YHHB 3W7TA 4U7NA 4X1KB 2ZD9A 3VQXA 2D3OW 3P30A 2OCHA 2YI9A 4L8JA 4DRXB 3QO5A 3DTUB 5EZYA 4IHJA 2CDYA 4GKKB 2A0LA 5IJ0A 3K79A 3UO3A 2CTRA 3JYCA 4LF7B 3BFRA 1JR9A 2DYRC 2GTSA 2HKOA 3BCCH 4X1YA 2M6YA 4ZHQB 1K4CC 3TETA 1OCZB 1AILA 2UXXA 2X7RB 5LXTA 1BGYH 4JI7O 2X6CA 1GKFA 1EBOA 4FLUA 2NN4A 3JAWA 2QKCA 5KHKA 3U0ZA 5EBWC 4FLVA 4U7OA 1WJZA 3TK1A 2V4DA 4YJ2B 3ZEDA 3RYHB 3E83A 2JGDB 2DE0X 4TV8A 4X62B 4J80A 1MG1A 4DR2O 3JALA 1XUQA 1NTKH 4BAYA 4GKJO 1THZA 1XBLA 1PPJH 2ZM6O 3W7UA 2PYLA 3UO2A 3QG5A 3HPLC 5KA6A 1QQCA 2QKAA 1PL0A 3OTOO 2XNDG 4Z1MG 4JI6O 4FVMA 2EILC 4O4IA 1PNLA 3AEIA 4DV6B 4LF4B 1Z5WA 3OAAG 4NTXA 4DO2A 2P06A 1TVKB 1ROPA 4LFBB 2O57A 3JSLA 2ODMA 2PY5A 4JI8O 3GWKC 3CXCU 3B2EE 3HKCB 4QPKA 2BTQA 1Y4MA 1YVWA 3CRQA 1L0NH 1ZUQA 3J80N 1SQQH 4LWSA 4FM2A 3JCUZ 3JATA 2Z0AA 2VWJA 4DR5B 3JASA 2B9ZA 3JD0A 4DR3O 2QTSA 5L3CA 1EN5A 1YDXA 2YICA 4FFBA 1Y76A 1K3EA 1KYOF 4PA3A 1HNZO 2NR5A 3CD6V 2BCCH 2WA4A 4DV1B 2MW2B 1YITV 1QNMA 2LW1A 1KP2A 4JI1O 4R7CA 2GUZA 3WFVA 4LF5B 2Y0IA 3QO7A 2WAMA 3B40A 4MTFA 4FLXA 1WA8A 3W7SA 1NVPD 5CA1B 1M57C 1R6KA 4I4TB 4K0KO 1N33B 1CEZA 3N27A 4UCRA 4X8AA 3BA8A 5CN0A 1Q82W 4X66B 2HR3A 3EXAA 2AZ0A 1Q43A 4PV1B 1M1KW 1SA0B 3L70H 3CSXA 4KHPO 2QR4A 4JI0O 1NJIW 3OGIB 3UT5B 1AJPA 3JD1A 1I5YA 3U10A 2LP7A 5H9CA 2ATKC 4E4EA 1WNSA 1E1RG 3CCSV 3O65A 2ZXWB 1AI4A 1HR0O 5FNVA 4F6RB 1V9PA 3RYFB 3ZHSA 5EYPA 4JI3O 3P3PA 2E3CA 2R70A 4B7KA 3ABLC 4KL1A 1XL6A 4UVCA 4QNHB 1Q3EA 4K8XA 5EIBD 3L73H 1B6QA 1XMQB 1J5EO 4NXNO 1Y74B 1BHBA 1XEQA 1E1QG 1NH2D 2GTAA 1X59A 3NXSA 4YXWG 3K59A 4O4HA 3ZN1A 1SQXH 4NTYA 3ZRWA 1FAFA 1G8MA 3VOUA 1W2BU 5B3SB 1N34O 1UPGA 5JQGA 3SDLA 1WB7A 4CS4A 5C8YB 1Z5VA 1EZVH 2KG7A 3OM3B 2E5LO 2FKXA 2ZE8A 1YEWA 1Q6HA 3ASNC 4AHCA 2NLJC 4I50B 2ZQMA 4TQDA 4YJ3B 4DV5B 1TUEB 2HFEC 1NQTA 4X1IB 1X4TA 4CS3A 1SZTA 3JD4A 1H2GA 1WN7A 4CC5A 3N2GA 2JEUA 1YZBA 3BA9A 2FB5A 3T1HO 1R3IC 1LR1A 2QJ1A 3H1IH 5JJEB 1OCRC 3JD2A 4UCOA 5D5QA 2A06H 3ZHRA 3E2EA 2BSKB 2P6JA 3MDSA 1URFA 1XQ8A 5BZBA 2K9PA 3AK2A 5B5EZ 3RT3C 3DSQA 1NT2B 1KKCA 4RUEA 3AK1A 2ILMA 3K5OA 5H5NA 3SJBC 2GV9A 1K97A 1BQZA 1U96A 1KC8W 4DR4O 5J2UA 3D3IA 1QR9A 5EIBC 1XNRO 2F4VO 2F66C 4RAIA 1XDCA 1F51A 2CH7B 4I0XA 1S76D 4QE9A 3TJTA 5L3EA 4LF9B 4MT8A 1SQBH 4IIJB 5BMVB 4IYIA 4AQYB 1DTOA 3EHBB 3MAQA 5BXZA 3PJSK 5IYZB 2WLIB 4UUJC 4PA7A 4YIPA 1OHHG 3K5LA 1R73A 3ZRVA 3L74H 3K3WA 2EILB 4AI8A 4JYYA 3DC6A 1IDSA 1JFFA 4LR3A 3HKDA 2UXDO 3BHPA 4O2BB 1Q90D 2EBOA 2A79B 3RYCB 4X65O 2HHHB 3F7VC 2PYJA 3K5NA 1H2LA 3T2MA 3B8NA 5GW7A 2JEXA 3UKMA 1HW7A 3M8AA 5B1BC 3LDDA 3WB1A 4R6ZA 4NXMB 3CCEV 1ZSPA 1GN4A 5KUMA 2YEVB 1FYJA 3A0BZ 1R1BA 5H6QA 3DGEA 2JS3A 3KCYA 1EZJA 3BRCA 3ZMVA 2ADPA 3T4DA 3ZHVA 1SERA 1L1FA 3RWRD 3RYIB 4WBNB 1IBKO 2W6IG 2F23A 1VQLV 1JJ2U 3G71V 1XL4A 4MS2A 5KHGA 4I55B 1FFXA 4DR1B 5LP6A 1M57B 2A7WA 3EFFK 3LDEA 4O4JB 4WF9V 4FLTA 4X89A 2V1DA 3L72H 3CJHB 4OX9O 4B3RB 4KFMA 3CEIA 3CCRV 3P32A 2VQFO 5IJ9B 1MZFA 2AXTZ 4DR6O 4DR7O 2WWWA 2Y48A 1V55C 3K06A 1I94B 1N32O 5LA6A 1FPOA 4YY3O 2GBOA 4UV9A 1VIBA 2UXBO 2YS8A 4DV7B 3ETGA 5JJJB 3TXQA 4U3FH 1R3LC 3SPHA 2GSMB 5EZYB 2HVKC 3VQWA 1LNQA 4IHJB 3ABLB 1AP5A 2QSAA 1VF7A 4K3AA 2M7WA 1FJGB 1H2NA 5IJ0B 4PA9A 1NU1H 1ZLZA 1R3JC 3FKSG 2IJJA 1CPYA 4X1YB 4UFZA 1ZL8A 2Q69A 5GONA 1YHQV 4B3TB 2WLNA 2XHBA 2DWDC 4ZOLA 2VQEO 1NTZH 3JAWB 4H44B 3G67A 1M5IA 4DV0O 3E8HA 2PF4E 2QKSA 3ZHUA 2QE7G 1NVPB 3ASNB 1KD1W 1DF5A 4JV5O 4JI5O 2PTMA 4JAUA 1Q5OA 1SQFA 4LFCB 2IBZH 2H94A 3FB8C 4TOIA 4B3SB 4O4LB 3AG3C 4GCZA 1BQ0A 3WB2A 1JCHA 3JALB 4PA4A 4LF8B 1AJQA 2DWEC 4HNAA 4UCSA 1S0VA 1OCCC 2N05A 3D36A 3DXRA 1AR5A 4IT5A 4DUZO 2XASA 1NR7A 1RSOB 2QM4A 1B04A 3AG7A 2BOBC 1VMGA 1DK1A 2EIJC 5KHJA 4GX1A 4UCUA 4GX2A 2DW4A 1GM9A 3AG4C 5CA3A 1SESA 2RCVA 1GH6A 2E75B 3VBBA 2LGQA 3I5DA 1VQMV 1TGOA 4N21A 5KAFZ 1HNWB 5LGUA 2YC0A 1AVMA 1MZEA 3LSSA 3I55V 3R65A 4UCTA 3C3TA 1Z2GA 3IJ4A 3KZIZ 3SYCA 1EM1A 2YXLA 4DV2B 3JATB 1NH2B 5L3DA 4I5SA 3BPZA 3K9SA 5LYJA 2BOCC 3S3WA 4P2ZA 1JJOA 5IYDO 4K35A 1Y6XA 4JYAB 2CE4A 1FXKA 2LFRA 4JI2B 4Q6GA 4R50A 4LCUC 2IJIA 3G6EV 1XHXA 2UUCO 3CB2A 1YSCA 5H6RA 3GVMA 2AHZA 4G28B 1MABG 2GUZB 3AG1C 1IBMB 2QWRB 4MVZA 2ZKOA 3H01A 3F5TA 1L8DA 1PNKA 1WA8B 2YIDA 2JK5C 1GN2A 3CRRA 3DC5A 5LP6C 3SYAA 2KSDA 3HB3B 3L9DA 1M93A 1W0JG 3AG2C 2UUAO 3JCZA 3Q4HA 3K58A 3OMIB 3FAVA 5B1BB 4RWUA 4U3JA 1AROP 4CC6A 4UVBA 5CB4A 1Y67A 2WLMA 3CS5A 2HJDA 5LOVB 5LMUO 4DV4O 4GYCB 1VEWA 2P5OA 4OGQB 4J7ZA 5E1AC 2OTLV 2ZINA 2RN9A 3B09A 2Q0AA 4X1KA 4LNUA 2YXHA 2Q9LA 4C7UA 3M99B 5B1AC 5KX5A 2MK3A 1HNXB 3H9VA 2FYUH 5FNVB 4JYCA 4FK5C 3QO8A 3CRCA 4PI2A 2UUBO 5EYPB 1V54C 3SGIA 1OCOC 5B1OA 1SQVH 2F1MA 5BR8B 4F6EA 2QWOB 2Q7HA 2ZR2A 4YHHO 3KCXA 3ZRSA 2W6JG 4WFHA 3BABA 1WP8A 1FKAO 3ETDA 3CRMA 3FD9A 2P4KA 1GM8A 1XMOB 4GKKO 2GDSA 3MHHC 4MTOA 1S72V 2YXYA 4HYOA 3K0DA 4YJ2A 2R9AA 4LF7O 1V55B 4QE7A 4TV9A 3G80A 3FB7C 1RM1C 4J10A 4IGGA 5ITZA 2YIAA 5LGTA 3ZHQA 2UXCB 1OZ0A 3ZIAG 1SC5B 4A5UB 3A0HZ 1BE3H 3ABTA 3OD4A 4XDJA 1YIJV 2XAGA 4DV3B 5C93A 4NR1A 5HFMA 2ZE7A 3N2GB 5K1PA 2VRZA 1XNQB 2P22C 1KB9F 4FIPC 4X62O 4TT3G 3BEHA 4JTCB 1BL8A 1I5XA 4NB5A 4EKWA 1TA8A 5FLXN 3JSNA 2WLLA 1TUBA 5IT9N 3B77A 5CBGA 4JI4B 1BT8A 3ZX6A 4X64B 2XAFA 2HVJC 3HKCA 2XAJA 4JPRA 2ZNIA 3FYEB 1JA8A 4JAVA 4LF6B 1P49A 1QLEC 2HP8A 2OIGA 5J2UB 3K03A 1D2DA 2ITDC 4DV6O 4LF4O 4B3MB 1M90W 2RMKB 3E35A 4LFBO 3AG3B 4HZ3A 4I0XB 3VQVA 3X2QC 1F4NA 1NI8A 3LDCA 5KAIZ 1K33A 1JVMA 3T1YB 4TQFA 1AJNA 1OCCB 1WPBA 3CYOA 1FXKC 3C90A 1BHAA 2ZCEA 1N0JA 2QTOA 5GTHZ 5FPRA 1RPOA 4DR5O 4CH3A 4JZGA 1PD3A 2EIJB 1BCCH 5J9PC 2ETNA 1JFFB 1K34A 2GHYA 2UU9B 1AI6A 3AG4B 3HKDB 1GTOA 5LHIA 4D6TH 4DV1O 4J9ZB 1BS3A 1M56C 3OW2U 2CUGA 1JOYA 2VWKA 3CC2V 4LF5O 2VS0A 2CTQA 3I56V 2DYRB 4EB6B 5LBQA 1AP6A 2X6AA 4QIWF 2DJVA 3ABUA 3T4ZA 3IAYA 5JCOA 4KXRA 4NYKA 2KKWA 1N33O 2YSUB 4ZI7B 2Q6AA 4JYBA 2QEXV 5KUKA 2PUSA 4F6RA 4X66O 4BIOA 2OYQA 2IM9A 5CMUA 5IE9A 3WG7C 3ASOC 2LQTA 5DEDA 4WFGA 1KQSU 1H8EG 1KBHA 1N36B 3SJQC 5EBMC 2ZDIA 5L3GA 4UCVA 3FX7A 4N23A 1XOUA 3AG1B 1SQGA 1FFXB 2Q7EA 1S3JA 3M7MX 1Y74A 4IL6Z 4GLXA 4YIOA 5LMNB 5LP6B 3N2KA 4BR6A 3UQ8A 1PM9A 2Z5UA 4PDMA 4DUYB 2G38A 2WLHA 4E2LA 3AG2B 1WB8A 4NVPA 2JJ1G 1IXMA 3CCVV 2DOSA 1PV0A 3ETQA 2QWQB 4J7JA 4JAAA 1O9HA 2EX3A 5IWAB 3BVOA 1FS0G 1A32A 1GO3F 3JARB 2YDEA 2BTOA 2EIMC 1KP3A 1XMQO 2QDOA 3OUFA 3K0GA 1IBLB 2QM8A 2W0FC 5KLVH 3GB7C 3RVZA 4X20A 3ABMC 1VQ4V 1O9GA 4X1IA 5B1AB 4X88A 1QVGU 5LA6B 1Q6IA 2W0XA 2EZPA 1V54B 3H1LH 1AI5A 3TGUH 3E22A 1QVFU 1OCOB 4LFAB 5BY1A 3H1HH 2ZR3A 4L87A 4KUMA 1GRJA 1XI1A 1NTMH 1HWYA 3HKBB 3ZMUA 4DV5O 2BSKA 4TUYA 5JWPA 3K57A 1XREA 1YTFD 4J11A 2YIBA 3ZMTA 4JTAB 4Q20A 1Q8IA 3ZRXA 4FZ0A 4O2AB 4ZKIA 1G1XB 4CZZA 4P9PA 1NS1A 4ZOLB 3K5MA 1S5LZ 2ARHA 1RM1B 2DMXA 4IIJA 4RO2A 1IVSA 2OCCC 3K04A 2K1EA 5A9GA 4WCEV 5AG2A 3D3QA 2ZIOA 3ETEA 4NTWA 1Y66A 4HNAB 2V7QG 2OIEA 2A9HA 3TXSA 2IU0A 1WAZA 1XILA 2EINC 3RBZA 4J9YB 2AW9A 3LNMB 5GTIZ 5KMGA 3DXRB 4P30A 4DYLA 4LF9O 3H1KH 4O2BA 4D7TA 4AQYO 3RYCA 4JI7B 4EFBA 1E79G 4K8ZA 1LUVA 2Y69C 5J2TA 2Y4UA 4FPPA 5FPOA 2F43G 4PJ0Z 3MD0A 2RJZA 1SZXA 3K08A 1QLEB 3CE2A 3CP1A 4MVSA 2Q5ZA 3LNNA 4DR2B 3IGAC 2FMLA 1W59A 4GKJB 1XHZA 2N04A 5JCOC 3X2QB 1N4CA 5IY5C 3D8CA 5LXTB 2ZM6B 4FM0A 3FB5C 2HHHO 1SKVA 2HG5C 5LYJB 4WBNA 1SRYA 5CA0A 3LUTB 2YIBD 3ABKC 1SS3A 1FXKB 4I55A 3OTOB 4NXMO 1US6A 4JI6B 1VQ8V 2PGGA 4TV8B 4BW5A 1T5EA 1D5AA 2IH3C 3CWBH 5JH7A 3CJHA 5JVDA 4PDRA 3E8BA 3WU2Z 1PKXA 4JI8B 4J41A 1P7BA 1M56B 2HLDG 1FD9A 1H2MA 3ZJZA 4GX5A 2CGNA 1HDJA 2XT9A 2OTJV 3OEEG 3Q4HB 4XBFA 3E86A 1CXZB 3FAVB 3HR0A 1OCRB 4U3JB 5IYCO 5CB4B 1YJ9V 4I7ZB 3RVYA 4DR1O 4O4IB 1UJWB 2B5UA 4PDVA 1ZWIC 4OPHA 1YF2A 3SJAC 3UM7A 4DR3B 4FFKA 4G2KA 4FJCC 1HNZB 4FM1A 1EFRG 3FFQA 4LNUB 2JGUA 2PZSA 2Q73A 4B3RO 4I9QA 3WG7B 3ASOB 1W0KG 1VQPV 3SYOA 2BTQB 3QTCA 3FYIB 4JI1B 2JS5A 5KX5B 1G6UA 5KHHA 1SETA 4BIZA 4LWSB 2BE3A 1K8AW 4DK0A 4K0KB 3CC4V 3JASB 3JAKA 3CC7V 2HJFC 1MOFA 3G6BA 2R9IA 1UFIA 4GZRB 4FFBB 1Y76B 4DW1A 4X9QA 1GN3A 1I94O 4MW3A 2AZ2A 4MVOA 4DW0A 1VF5B 4KHPB 4JI0B 1I0HA 4DV7O 1K5QA 3CX5F 3E8GA 2WPDG 1B06A 1P7GA 5LHGA 4B08A 2JDIG 2Q4PA 4WFFA 2EIMB 1FJGO 2DYSC 2ZNJA 2XAQA 2P7TC 1FXVA 4RUFA 2R72A 2CTPA 1QU7A 3QVNA 1HR0B 1DLBA 2DQ0A 4TV9B 5K1XA 4O4LA 3ABMB 3CMEV 4H13B 5JJNB 5DM6V 1FFTB 4JI3B 5ITZB 2H3OA 3HKEA 2JRIA 4JZ2A 1GAXA 4B3TO 2KQXA 3P3NA 4QJFB 4CH4A 3CCJV 1RPRA 1J5EB 4NXNB 1QLNA 1RSOA 1MSDA 4LFCO 4DRXA 1WLEA 4B3SO 4XDLA 3R66A 4PI0A 3CCLV 1K9MW 1JPXA 3RFRA 2WLLB 1TUBB 5CBHA 4LF8O 1N34B 1HP8A 3OE7G 5D5PA 4Z1VA 2EZOA 2E5LB 2FTKA 4EFEA 2JVDA 3OTFA 4RQEA 1LUWA 3SPIA 4ZHQA 3W7XA 2WA3A 2IU3A 2L35A 3APQA 2IJKA 1R3KC 2OCCB 3SPGA 5EBLC 3IC9A 3STLC 4P9OA 2XAHA 2IW5A 4O4HB 3J7AU 3L71H 1N8RW 3ZRWB 2DQ3A 4UXNA 5LGNA 2IJHA 3T1HB 5JQGB 1HNWO 3RYHA 4CBCA 3ZS8C 2JGDA 2KG7B 1OJHA 1IX9A 1H2KA 2OWOA 2EINB 4PHZA 4MVMA 1N0NA 3T1CA 4LBEC 1TAEA 4MTXA 4DV2O 1MMMA 4PELA 1VQKV 2Q7GA 1PL4A 5EC2C 4CH5A 2CK3G 1B3QA 2Y69B 4ASUG 4MVQA 1ZAUA 4JYAO 3AK3A 1J95A 3SJCC 4DR4B 4JI2O 3D36C 1QR8A 2EULA 2ZE6A 5LOVA 1CP9A 4ZBMA 3FB6C 5IYBO 1XNRB 1SF9A 3ZBHA 1TVKA 2F4VB 2Q68A 2RDCA 4LH7A 1IBMO 3A0RA 2XTAA 3IC7A 2QWPB 3L75H 1EN4A 3U11A 4GT1A 1BSMA 2WSSG 3OEHG 5IY5B 3A8TA 1YTFB 5LL6Y 1M9NA 3LSUA 2QM7A 3CMAV 1K73W 2X6BA 5EK0A 2PI4A 2PI5A 2E74B 3ABKB 3PN1A 1DGSA 2Z3YA 1K5SA 1JX9A 4MVUA 3OFNG 4CH6A 3CHXA 2R9RB 2UXDB 4PD4F 4X65B 1BZKA 4J7KA 3OMNB 3N2KB 4W4KA 1S5JA 2Y4TA 5L3BA 1HNXO 3GWOA 4D7SA 4R8CA 3SPJA 4JGSA 1RFYA 3B4SA 2P4VA 2E76B 1IXBA 3ML0A 4JF3A 5CA1A 3LSQA 4H33A 4JASA 4I4TA 4QPJA 1KU9A 5F2VO 2P67A 5BR8O 3OGCC 2LFSA 3RN4A 3JAMN 3S3XA 2F93B 2JJ2G 3EVKA 1ENVA 2B1IA 4G27B 3ICXA 3MHSC 3KKYA 1SA0A 5IDJA 2RQ6A 1RP3B 1YJWV 1R6NA 1VF6A 3JD3A 4OXSA 3UT5A 4X20B 3THOA 4PA6A 2EIKC 1PNMA 1U97A 5EC1C 1IBKB 1NZ6A 4IYHA 2EJ7A 2H8PC 1L0LH 1XMOO 3ZHTA 2ZT9B 2KB1A 4ICGA 4UV8A 3VQYA 1K7DA 3B8MA 1JMKC 5LHHA 3E22B 1EN6A
chains in the Genus database with same CATH topology
3CS5A 2Q8VA 2QDOA 1OJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CS5 A;  2Q8V A;  2QDO A;  1OJH A; 
#chains in the Genus database with same CATH topology
 4UVA A;  2Q67 A;  3RYF A;  3STZ C;  4OX9 B;  1F4M A;  1VQ9 V;  1VQ6 V;  4TUY B;  2UXC O;  1ZTE A;  1NBM G;  3SR2 C;  3QNE A;  4OPA A;  1KEC A;  2VQF B;  5A2Q N;  3RGB A;  3CXH F;  1DF4 A;  4DV3 O;  1VQO V;  4RQF A;  1XNQ O;  4DR6 B;  4FZ1 A;  1FXH A;  2DYS B;  4DR7 B;  5B66 Z;  2CGO A;  4FLW A;  5H2F Z;  1QCE A;  2DN9 A;  1F7Y A;  4I9W A;  1N32 B;  1OCZ C;  5TIS Z;  4BW9 A;  4YY3 B;  5E79 Z;  4MSW C;  1K4D C;  4JI4 O;  1YXB A;  3W7W A;  5C8Y A;  4X64 O;  1I7F A;  1GK9 A;  2UXB B;  1H2S B;  4FLZ A;  4MTG A;  1IUR A;  3OUS A;  3SPC A;  4LF6 O;  2QGN A;  4I50 A;  1GN6 A;  4GUN A;  3H1J H;  3QF7 A;  1R6T A;  4YJ3 A;  1YJN V;  4KP4 A;  2ADQ B;  4CS2 A;  3OT7 A;  2LGW A;  3OR7 C;  3ZN0 A;  1SQP H;  1VQ5 V;  1Q81 W;  1S5H C;  1KKD A;  3SYQ A;  4XDK A;  1JQ0 A;  4DK1 A;  5CBF A;  4B3M O;  1M4U A;  1P84 F;  1YCI A;  5KMG B;  3SYP A;  3BAA A;  1Q86 W;  4QGP A;  2UXN A;  1Q6U A;  1AR1 B;  2XUM A;  4AIL C;  3E89 A;  3T1Y O;  2VQE B;  5J2T B;  1WP7 A;  4DV0 B;  1BMF G;  4EB6 A;  4J42 A;  1VQN V;  4JV5 B;  2LW7 A;  4JI5 B;  4H0L B;  3KG2 A;  2YUA A;  4HBN A;  3CPW U;  3APO A;  4ZI7 A;  1AI7 A;  4WFA V;  2LJ2 A;  1ZL8 B;  2UU9 O;  5DEC A;  1ORQ C;  2B1G A;  2AHY A;  5GON B;  2QA4 V;  5L3F A;  2N74 A;  4ABM A;  2EJR A;  3CRA A;  4BIU A;  1H38 A;  1G4Y B;  5CA0 B;  2CH7 A;  3C3S A;  4DUZ B;  1KMI Z;  5BMV A;  3G4S V;  4MW8 A;  4LC1 A;  1Q7Y W;  1P4R A;  3CCM V;  4JTD B;  2FL4 A;  1F23 A;  1S77 D;  3K9A A;  4HAM A;  5IYZ A;  2WLI A;  2Q8V A;  3A2F A;  3RW0 A;  4Z2W A;  4TWK A;  3CCU V;  1VAR A;  1H8H G;  5JH7 B;  5JVD B;  2F95 B;  3F7Y C;  1QBZ A;  3ZMS A;  1N36 O;  2Q0O C;  3J81 N;  4GX0 A;  4NKG B;  5KA5 A;  2WLK A;  3IFX A;  4FLY A;  3BY6 A;  2ZIM A;  3JAR A;  3OR6 C;  2QWN B;  4UB6 Z;  5LMN O;  1OV9 A;  3TCU A;  1KUQ A;  1GMG A;  2AGA A;  4ZIB A;  4FMT A;  1MSW D;  4DUY O;  3CCQ V;  1WPX A;  3WB0 A;  5FL7 G;  5B1N A;  4WFE A;  5KHI A;  4TSF G;  3ZMZ A;  2UUC B;  1PP9 H;  1MNG A;  2CTW A;  1VF6 C;  5HFL A;  1QHT A;  2C2A A;  2YEV A;  1D5N A;  5IWA O;  4WFB V;  2JIZ G;  3NR7 A;  1VP7 A;  1AR4 A;  1NR1 A;  3F5W C;  2P90 A;  2WLJ A;  1IBL O;  3HKB A;  2ZXW C;  3JAK B;  4W4L A;  4EEQ A;  3RYI A;  4BWA A;  2UUA B;  1AB3 A;  3ZCC A;  1VQ7 V;  1I08 A;  2OT5 A;  3O9O A;  4LP8 A;  2A3Q A;  2X0L A;  1YI2 V;  1GM7 A;  2ZDI C;  1MA1 A;  4O2A A;  4DXW A;  5LMU B;  4DV4 B;  2ZE5 A;  4PDL A;  1ZX3 A;  4O4J A;  4LFA O;  2NNU A;  2YI8 A;  2D2C B;  3OMA B;  1K92 A;  4F4L A;  1COW G;  2L6L A;  2Y0P A;  4MVR A;  2CAZ C;  2LO1 A;  4H37 A;  5IJ9 A;  2EIK B;  3UCS C;  2IH1 C;  2UUB B;  2ITC C;  2XOK G;  5B3S C;  1NKD A;  4LH6 A;  1IZ3 A;  4UB8 Z;  3HKE B;  5DN6 G;  3E8F A;  2HEP A;  4B7E A;  2RNB A;  4YHH B;  3W7T A;  4U7N A;  4X1K B;  2ZD9 A;  3VQX A;  2D3O W;  3P30 A;  2OCH A;  2YI9 A;  4L8J A;  4DRX B;  3QO5 A;  3DTU B;  5EZY A;  4IHJ A;  2CDY A;  4GKK B;  2A0L A;  5IJ0 A;  3K79 A;  3UO3 A;  2CTR A;  3JYC A;  4LF7 B;  3BFR A;  1JR9 A;  2DYR C;  2GTS A;  2HKO A;  3BCC H;  4X1Y A;  2M6Y A;  4ZHQ B;  1K4C C;  3TET A;  1OCZ B;  1AIL A;  2UXX A;  2X7R B;  5LXT A;  1BGY H;  4JI7 O;  2X6C A;  1GKF A;  1EBO A;  4FLU A;  2NN4 A;  3JAW A;  2QKC A;  5KHK A;  3U0Z A;  5EBW C;  4FLV A;  4U7O A;  1WJZ A;  3TK1 A;  2V4D A;  4YJ2 B;  3ZED A;  3RYH B;  3E83 A;  2JGD B;  2DE0 X;  4TV8 A;  4X62 B;  4J80 A;  1MG1 A;  4DR2 O;  3JAL A;  1XUQ A;  1NTK H;  4BAY A;  4GKJ O;  1THZ A;  1XBL A;  1PPJ H;  2ZM6 O;  3W7U A;  2PYL A;  3UO2 A;  3QG5 A;  3HPL C;  5KA6 A;  1QQC A;  2QKA A;  1PL0 A;  3OTO O;  2XND G;  4Z1M G;  4JI6 O;  4FVM A;  2EIL C;  4O4I A;  1PNL A;  3AEI A;  4DV6 B;  4LF4 B;  1Z5W A;  3OAA G;  4NTX A;  4DO2 A;  2P06 A;  1TVK B;  1ROP A;  4LFB B;  2O57 A;  3JSL A;  2ODM A;  2PY5 A;  4JI8 O;  3GWK C;  3CXC U;  3B2E E;  3HKC B;  4QPK A;  2BTQ A;  1Y4M A;  1YVW A;  3CRQ A;  1L0N H;  1ZUQ A;  3J80 N;  1SQQ H;  4LWS A;  4FM2 A;  3JCU Z;  3JAT A;  2Z0A A;  2VWJ A;  4DR5 B;  3JAS A;  2B9Z A;  3JD0 A;  4DR3 O;  2QTS A;  5L3C A;  1EN5 A;  1YDX A;  2YIC A;  4FFB A;  1Y76 A;  1K3E A;  1KYO F;  4PA3 A;  1HNZ O;  2NR5 A;  3CD6 V;  2BCC H;  2WA4 A;  4DV1 B;  2MW2 B;  1YIT V;  1QNM A;  2LW1 A;  1KP2 A;  4JI1 O;  4R7C A;  2GUZ A;  3WFV A;  4LF5 B;  2Y0I A;  3QO7 A;  2WAM A;  3B40 A;  4MTF A;  4FLX A;  1WA8 A;  3W7S A;  1NVP D;  5CA1 B;  1M57 C;  1R6K A;  4I4T B;  4K0K O;  1N33 B;  1CEZ A;  3N27 A;  4UCR A;  4X8A A;  3BA8 A;  5CN0 A;  1Q82 W;  4X66 B;  2HR3 A;  3EXA A;  2AZ0 A;  1Q43 A;  4PV1 B;  1M1K W;  1SA0 B;  3L70 H;  3CSX A;  4KHP O;  2QR4 A;  4JI0 O;  1NJI W;  3OGI B;  3UT5 B;  1AJP A;  3JD1 A;  1I5Y A;  3U10 A;  2LP7 A;  5H9C A;  2ATK C;  4E4E A;  1WNS A;  1E1R G;  3CCS V;  3O65 A;  2ZXW B;  1AI4 A;  1HR0 O;  5FNV A;  4F6R B;  1V9P A;  3RYF B;  3ZHS A;  5EYP A;  4JI3 O;  3P3P A;  2E3C A;  2R70 A;  4B7K A;  3ABL C;  4KL1 A;  1XL6 A;  4UVC A;  4QNH B;  1Q3E A;  4K8X A;  5EIB D;  3L73 H;  1B6Q A;  1XMQ B;  1J5E O;  4NXN O;  1Y74 B;  1BHB A;  1XEQ A;  1E1Q G;  1NH2 D;  2GTA A;  1X59 A;  3NXS A;  4YXW G;  3K59 A;  4O4H A;  3ZN1 A;  1SQX H;  4NTY A;  3ZRW A;  1FAF A;  1G8M A;  3VOU A;  1W2B U;  5B3S B;  1N34 O;  1UPG A;  5JQG A;  3SDL A;  1WB7 A;  4CS4 A;  5C8Y B;  1Z5V A;  1EZV H;  2KG7 A;  3OM3 B;  2E5L O;  2FKX A;  2ZE8 A;  1YEW A;  1Q6H A;  3ASN C;  4AHC A;  2NLJ C;  4I50 B;  2ZQM A;  4TQD A;  4YJ3 B;  4DV5 B;  1TUE B;  2HFE C;  1NQT A;  4X1I B;  1X4T A;  4CS3 A;  1SZT A;  3JD4 A;  1H2G A;  1WN7 A;  4CC5 A;  3N2G A;  2JEU A;  1YZB A;  3BA9 A;  2FB5 A;  3T1H O;  1R3I C;  1LR1 A;  2QJ1 A;  3H1I H;  5JJE B;  1OCR C;  3JD2 A;  4UCO A;  5D5Q A;  2A06 H;  3ZHR A;  3E2E A;  2BSK B;  2P6J A;  3MDS A;  1URF A;  1XQ8 A;  5BZB A;  2K9P A;  3AK2 A;  5B5E Z;  3RT3 C;  3DSQ A;  1NT2 B;  1KKC A;  4RUE A;  3AK1 A;  2ILM A;  3K5O A;  5H5N A;  3SJB C;  2GV9 A;  1K97 A;  1BQZ A;  1U96 A;  1KC8 W;  4DR4 O;  5J2U A;  3D3I A;  1QR9 A;  5EIB C;  1XNR O;  2F4V O;  2F66 C;  4RAI A;  1XDC A;  1F51 A;  2CH7 B;  4I0X A;  1S76 D;  4QE9 A;  3TJT A;  5L3E A;  4LF9 B;  4MT8 A;  1SQB H;  4IIJ B;  5BMV B;  4IYI A;  4AQY B;  1DTO A;  3EHB B;  3MAQ A;  5BXZ A;  3PJS K;  5IYZ B;  2WLI B;  4UUJ C;  4PA7 A;  4YIP A;  1OHH G;  3K5L A;  1R73 A;  3ZRV A;  3L74 H;  3K3W A;  2EIL B;  4AI8 A;  4JYY A;  3DC6 A;  1IDS A;  1JFF A;  4LR3 A;  3HKD A;  2UXD O;  3BHP A;  4O2B B;  1Q90 D;  2EBO A;  2A79 B;  3RYC B;  4X65 O;  2HHH B;  3F7V C;  2PYJ A;  3K5N A;  1H2L A;  3T2M A;  3B8N A;  5GW7 A;  2JEX A;  3UKM A;  1HW7 A;  3M8A A;  5B1B C;  3LDD A;  3WB1 A;  4R6Z A;  4NXM B;  3CCE V;  1ZSP A;  1GN4 A;  5KUM A;  2YEV B;  1FYJ A;  3A0B Z;  1R1B A;  5H6Q A;  3DGE A;  2JS3 A;  3KCY A;  1EZJ A;  3BRC A;  3ZMV A;  2ADP A;  3T4D A;  3ZHV A;  1SER A;  1L1F A;  3RWR D;  3RYI B;  4WBN B;  1IBK O;  2W6I G;  2F23 A;  1VQL V;  1JJ2 U;  3G71 V;  1XL4 A;  4MS2 A;  5KHG A;  4I55 B;  1FFX A;  4DR1 B;  5LP6 A;  1M57 B;  2A7W A;  3EFF K;  3LDE A;  4O4J B;  4WF9 V;  4FLT A;  4X89 A;  2V1D A;  3L72 H;  3CJH B;  4OX9 O;  4B3R B;  4KFM A;  3CEI A;  3CCR V;  3P32 A;  2VQF O;  5IJ9 B;  1MZF A;  2AXT Z;  4DR6 O;  4DR7 O;  2WWW A;  2Y48 A;  1V55 C;  3K06 A;  1I94 B;  1N32 O;  5LA6 A;  1FPO A;  4YY3 O;  2GBO A;  4UV9 A;  1VIB A;  2UXB O;  2YS8 A;  4DV7 B;  3ETG A;  5JJJ B;  3TXQ A;  4U3F H;  1R3L C;  3SPH A;  2GSM B;  5EZY B;  2HVK C;  3VQW A;  1LNQ A;  4IHJ B;  3ABL B;  1AP5 A;  2QSA A;  1VF7 A;  4K3A A;  2M7W A;  1FJG B;  1H2N A;  5IJ0 B;  4PA9 A;  1NU1 H;  1ZLZ A;  1R3J C;  3FKS G;  2IJJ A;  1CPY A;  4X1Y B;  4UFZ A;  1ZL8 A;  2Q69 A;  5GON A;  1YHQ V;  4B3T B;  2WLN A;  2XHB A;  2DWD C;  4ZOL A;  2VQE O;  1NTZ H;  3JAW B;  4H44 B;  3G67 A;  1M5I A;  4DV0 O;  3E8H A;  2PF4 E;  2QKS A;  3ZHU A;  2QE7 G;  1NVP B;  3ASN B;  1KD1 W;  1DF5 A;  4JV5 O;  4JI5 O;  2PTM A;  4JAU A;  1Q5O A;  1SQF A;  4LFC B;  2IBZ H;  2H94 A;  3FB8 C;  4TOI A;  4B3S B;  4O4L B;  3AG3 C;  4GCZ A;  1BQ0 A;  3WB2 A;  1JCH A;  3JAL B;  4PA4 A;  4LF8 B;  1AJQ A;  2DWE C;  4HNA A;  4UCS A;  1S0V A;  1OCC C;  2N05 A;  3D36 A;  3DXR A;  1AR5 A;  4IT5 A;  4DUZ O;  2XAS A;  1NR7 A;  1RSO B;  2QM4 A;  1B04 A;  3AG7 A;  2BOB C;  1VMG A;  1DK1 A;  2EIJ C;  5KHJ A;  4GX1 A;  4UCU A;  4GX2 A;  2DW4 A;  1GM9 A;  3AG4 C;  5CA3 A;  1SES A;  2RCV A;  1GH6 A;  2E75 B;  3VBB A;  2LGQ A;  3I5D A;  1VQM V;  1TGO A;  4N21 A;  5KAF Z;  1HNW B;  5LGU A;  2YC0 A;  1AVM A;  1MZE A;  3LSS A;  3I55 V;  3R65 A;  4UCT A;  3C3T A;  1Z2G A;  3IJ4 A;  3KZI Z;  3SYC A;  1EM1 A;  2YXL A;  4DV2 B;  3JAT B;  1NH2 B;  5L3D A;  4I5S A;  3BPZ A;  3K9S A;  5LYJ A;  2BOC C;  3S3W A;  4P2Z A;  1JJO A;  5IYD O;  4K35 A;  1Y6X A;  4JYA B;  2CE4 A;  1FXK A;  2LFR A;  4JI2 B;  4Q6G A;  4R50 A;  4LCU C;  2IJI A;  3G6E V;  1XHX A;  2UUC O;  3CB2 A;  1YSC A;  5H6R A;  3GVM A;  2AHZ A;  4G28 B;  1MAB G;  2GUZ B;  3AG1 C;  1IBM B;  2QWR B;  4MVZ A;  2ZKO A;  3H01 A;  3F5T A;  1L8D A;  1PNK A;  1WA8 B;  2YID A;  2JK5 C;  1GN2 A;  3CRR A;  3DC5 A;  5LP6 C;  3SYA A;  2KSD A;  3HB3 B;  3L9D A;  1M93 A;  1W0J G;  3AG2 C;  2UUA O;  3JCZ A;  3Q4H A;  3K58 A;  3OMI B;  3FAV A;  5B1B B;  4RWU A;  4U3J A;  1ARO P;  4CC6 A;  4UVB A;  5CB4 A;  1Y67 A;  2WLM A;  3CS5 A;  2HJD A;  5LOV B;  5LMU O;  4DV4 O;  4GYC B;  1VEW A;  2P5O A;  4OGQ B;  4J7Z A;  5E1A C;  2OTL V;  2ZIN A;  2RN9 A;  3B09 A;  2Q0A A;  4X1K A;  4LNU A;  2YXH A;  2Q9L A;  4C7U A;  3M99 B;  5B1A C;  5KX5 A;  2MK3 A;  1HNX B;  3H9V A;  2FYU H;  5FNV B;  4JYC A;  4FK5 C;  3QO8 A;  3CRC A;  4PI2 A;  2UUB O;  5EYP B;  1V54 C;  3SGI A;  1OCO C;  5B1O A;  1SQV H;  2F1M A;  5BR8 B;  4F6E A;  2QWO B;  2Q7H A;  2ZR2 A;  4YHH O;  3KCX A;  3ZRS A;  2W6J G;  4WFH A;  3BAB A;  1WP8 A;  1FKA O;  3ETD A;  3CRM A;  3FD9 A;  2P4K A;  1GM8 A;  1XMO B;  4GKK O;  2GDS A;  3MHH C;  4MTO A;  1S72 V;  2YXY A;  4HYO A;  3K0D A;  4YJ2 A;  2R9A A;  4LF7 O;  1V55 B;  4QE7 A;  4TV9 A;  3G80 A;  3FB7 C;  1RM1 C;  4J10 A;  4IGG A;  5ITZ A;  2YIA A;  5LGT A;  3ZHQ A;  2UXC B;  1OZ0 A;  3ZIA G;  1SC5 B;  4A5U B;  3A0H Z;  1BE3 H;  3ABT A;  3OD4 A;  4XDJ A;  1YIJ V;  2XAG A;  4DV3 B;  5C93 A;  4NR1 A;  5HFM A;  2ZE7 A;  3N2G B;  5K1P A;  2VRZ A;  1XNQ B;  2P22 C;  1KB9 F;  4FIP C;  4X62 O;  4TT3 G;  3BEH A;  4JTC B;  1BL8 A;  1I5X A;  4NB5 A;  4EKW A;  1TA8 A;  5FLX N;  3JSN A;  2WLL A;  1TUB A;  5IT9 N;  3B77 A;  5CBG A;  4JI4 B;  1BT8 A;  3ZX6 A;  4X64 B;  2XAF A;  2HVJ C;  3HKC A;  2XAJ A;  4JPR A;  2ZNI A;  3FYE B;  1JA8 A;  4JAV A;  4LF6 B;  1P49 A;  1QLE C;  2HP8 A;  2OIG A;  5J2U B;  3K03 A;  1D2D A;  2ITD C;  4DV6 O;  4LF4 O;  4B3M B;  1M90 W;  2RMK B;  3E35 A;  4LFB O;  3AG3 B;  4HZ3 A;  4I0X B;  3VQV A;  3X2Q C;  1F4N A;  1NI8 A;  3LDC A;  5KAI Z;  1K33 A;  1JVM A;  3T1Y B;  4TQF A;  1AJN A;  1OCC B;  1WPB A;  3CYO A;  1FXK C;  3C90 A;  1BHA A;  2ZCE A;  1N0J A;  2QTO A;  5GTH Z;  5FPR A;  1RPO A;  4DR5 O;  4CH3 A;  4JZG A;  1PD3 A;  2EIJ B;  1BCC H;  5J9P C;  2ETN A;  1JFF B;  1K34 A;  2GHY A;  2UU9 B;  1AI6 A;  3AG4 B;  3HKD B;  1GTO A;  5LHI A;  4D6T H;  4DV1 O;  4J9Z B;  1BS3 A;  1M56 C;  3OW2 U;  2CUG A;  1JOY A;  2VWK A;  3CC2 V;  4LF5 O;  2VS0 A;  2CTQ A;  3I56 V;  2DYR B;  4EB6 B;  5LBQ A;  1AP6 A;  2X6A A;  4QIW F;  2DJV A;  3ABU A;  3T4Z A;  3IAY A;  5JCO A;  4KXR A;  4NYK A;  2KKW A;  1N33 O;  2YSU B;  4ZI7 B;  2Q6A A;  4JYB A;  2QEX V;  5KUK A;  2PUS A;  4F6R A;  4X66 O;  4BIO A;  2OYQ A;  2IM9 A;  5CMU A;  5IE9 A;  3WG7 C;  3ASO C;  2LQT A;  5DED A;  4WFG A;  1KQS U;  1H8E G;  1KBH A;  1N36 B;  3SJQ C;  5EBM C;  2ZDI A;  5L3G A;  4UCV A;  3FX7 A;  4N23 A;  1XOU A;  3AG1 B;  1SQG A;  1FFX B;  2Q7E A;  1S3J A;  3M7M X;  1Y74 A;  4IL6 Z;  4GLX A;  4YIO A;  5LMN B;  5LP6 B;  3N2K A;  4BR6 A;  3UQ8 A;  1PM9 A;  2Z5U A;  4PDM A;  4DUY B;  2G38 A;  2WLH A;  4E2L A;  3AG2 B;  1WB8 A;  4NVP A;  2JJ1 G;  1IXM A;  3CCV V;  2DOS A;  1PV0 A;  3ETQ A;  2QWQ B;  4J7J A;  4JAA A;  1O9H A;  2EX3 A;  5IWA B;  3BVO A;  1FS0 G;  1A32 A;  1GO3 F;  3JAR B;  2YDE A;  2BTO A;  2EIM C;  1KP3 A;  1XMQ O;  2QDO A;  3OUF A;  3K0G A;  1IBL B;  2QM8 A;  2W0F C;  5KLV H;  3GB7 C;  3RVZ A;  4X20 A;  3ABM C;  1VQ4 V;  1O9G A;  4X1I A;  5B1A B;  4X88 A;  1QVG U;  5LA6 B;  1Q6I A;  2W0X A;  2EZP A;  1V54 B;  3H1L H;  1AI5 A;  3TGU H;  3E22 A;  1QVF U;  1OCO B;  4LFA B;  5BY1 A;  3H1H H;  2ZR3 A;  4L87 A;  4KUM A;  1GRJ A;  1XI1 A;  1NTM H;  1HWY A;  3HKB B;  3ZMU A;  4DV5 O;  2BSK A;  4TUY A;  5JWP A;  3K57 A;  1XRE A;  1YTF D;  4J11 A;  2YIB A;  3ZMT A;  4JTA B;  4Q20 A;  1Q8I A;  3ZRX A;  4FZ0 A;  4O2A B;  4ZKI A;  1G1X B;  4CZZ A;  4P9P A;  1NS1 A;  4ZOL B;  3K5M A;  1S5L Z;  2ARH A;  1RM1 B;  2DMX A;  4IIJ A;  4RO2 A;  1IVS A;  2OCC C;  3K04 A;  2K1E A;  5A9G A;  4WCE V;  5AG2 A;  3D3Q A;  2ZIO A;  3ETE A;  4NTW A;  1Y66 A;  4HNA B;  2V7Q G;  2OIE A;  2A9H A;  3TXS A;  2IU0 A;  1WAZ A;  1XIL A;  2EIN C;  3RBZ A;  4J9Y B;  2AW9 A;  3LNM B;  5GTI Z;  5KMG A;  3DXR B;  4P30 A;  4DYL A;  4LF9 O;  3H1K H;  4O2B A;  4D7T A;  4AQY O;  3RYC A;  4JI7 B;  4EFB A;  1E79 G;  4K8Z A;  1LUV A;  2Y69 C;  5J2T A;  2Y4U A;  4FPP A;  5FPO A;  2F43 G;  4PJ0 Z;  3MD0 A;  2RJZ A;  1SZX A;  3K08 A;  1QLE B;  3CE2 A;  3CP1 A;  4MVS A;  2Q5Z A;  3LNN A;  4DR2 B;  3IGA C;  2FML A;  1W59 A;  4GKJ B;  1XHZ A;  2N04 A;  5JCO C;  3X2Q B;  1N4C A;  5IY5 C;  3D8C A;  5LXT B;  2ZM6 B;  4FM0 A;  3FB5 C;  2HHH O;  1SKV A;  2HG5 C;  5LYJ B;  4WBN A;  1SRY A;  5CA0 A;  3LUT B;  2YIB D;  3ABK C;  1SS3 A;  1FXK B;  4I55 A;  3OTO B;  4NXM O;  1US6 A;  4JI6 B;  1VQ8 V;  2PGG A;  4TV8 B;  4BW5 A;  1T5E A;  1D5A A;  2IH3 C;  3CWB H;  5JH7 A;  3CJH A;  5JVD A;  4PDR A;  3E8B A;  3WU2 Z;  1PKX A;  4JI8 B;  4J41 A;  1P7B A;  1M56 B;  2HLD G;  1FD9 A;  1H2M A;  3ZJZ A;  4GX5 A;  2CGN A;  1HDJ A;  2XT9 A;  2OTJ V;  3OEE G;  3Q4H B;  4XBF A;  3E86 A;  1CXZ B;  3FAV B;  3HR0 A;  1OCR B;  4U3J B;  5IYC O;  5CB4 B;  1YJ9 V;  4I7Z B;  3RVY A;  4DR1 O;  4O4I B;  1UJW B;  2B5U A;  4PDV A;  1ZWI C;  4OPH A;  1YF2 A;  3SJA C;  3UM7 A;  4DR3 B;  4FFK A;  4G2K A;  4FJC C;  1HNZ B;  4FM1 A;  1EFR G;  3FFQ A;  4LNU B;  2JGU A;  2PZS A;  2Q73 A;  4B3R O;  4I9Q A;  3WG7 B;  3ASO B;  1W0K G;  1VQP V;  3SYO A;  2BTQ B;  3QTC A;  3FYI B;  4JI1 B;  2JS5 A;  5KX5 B;  1G6U A;  5KHH A;  1SET A;  4BIZ A;  4LWS B;  2BE3 A;  1K8A W;  4DK0 A;  4K0K B;  3CC4 V;  3JAS B;  3JAK A;  3CC7 V;  2HJF C;  1MOF A;  3G6B A;  2R9I A;  1UFI A;  4GZR B;  4FFB B;  1Y76 B;  4DW1 A;  4X9Q A;  1GN3 A;  1I94 O;  4MW3 A;  2AZ2 A;  4MVO A;  4DW0 A;  1VF5 B;  4KHP B;  4JI0 B;  1I0H A;  4DV7 O;  1K5Q A;  3CX5 F;  3E8G A;  2WPD G;  1B06 A;  1P7G A;  5LHG A;  4B08 A;  2JDI G;  2Q4P A;  4WFF A;  2EIM B;  1FJG O;  2DYS C;  2ZNJ A;  2XAQ A;  2P7T C;  1FXV A;  4RUF A;  2R72 A;  2CTP A;  1QU7 A;  3QVN A;  1HR0 B;  1DLB A;  2DQ0 A;  4TV9 B;  5K1X A;  4O4L A;  3ABM B;  3CME V;  4H13 B;  5JJN B;  5DM6 V;  1FFT B;  4JI3 B;  5ITZ B;  2H3O A;  3HKE A;  2JRI A;  4JZ2 A;  1GAX A;  4B3T O;  2KQX A;  3P3N A;  4QJF B;  4CH4 A;  3CCJ V;  1RPR A;  1J5E B;  4NXN B;  1QLN A;  1RSO A;  1MSD A;  4LFC O;  4DRX A;  1WLE A;  4B3S O;  4XDL A;  3R66 A;  4PI0 A;  3CCL V;  1K9M W;  1JPX A;  3RFR A;  2WLL B;  1TUB B;  5CBH A;  4LF8 O;  1N34 B;  1HP8 A;  3OE7 G;  5D5P A;  4Z1V A;  2EZO A;  2E5L B;  2FTK A;  4EFE A;  2JVD A;  3OTF A;  4RQE A;  1LUW A;  3SPI A;  4ZHQ A;  3W7X A;  2WA3 A;  2IU3 A;  2L35 A;  3APQ A;  2IJK A;  1R3K C;  2OCC B;  3SPG A;  5EBL C;  3IC9 A;  3STL C;  4P9O A;  2XAH A;  2IW5 A;  4O4H B;  3J7A U;  3L71 H;  1N8R W;  3ZRW B;  2DQ3 A;  4UXN A;  5LGN A;  2IJH A;  3T1H B;  5JQG B;  1HNW O;  3RYH A;  4CBC A;  3ZS8 C;  2JGD A;  2KG7 B;  1OJH A;  1IX9 A;  1H2K A;  2OWO A;  2EIN B;  4PHZ A;  4MVM A;  1N0N A;  3T1C A;  4LBE C;  1TAE A;  4MTX A;  4DV2 O;  1MMM A;  4PEL A;  1VQK V;  2Q7G A;  1PL4 A;  5EC2 C;  4CH5 A;  2CK3 G;  1B3Q A;  2Y69 B;  4ASU G;  4MVQ A;  1ZAU A;  4JYA O;  3AK3 A;  1J95 A;  3SJC C;  4DR4 B;  4JI2 O;  3D36 C;  1QR8 A;  2EUL A;  2ZE6 A;  5LOV A;  1CP9 A;  4ZBM A;  3FB6 C;  5IYB O;  1XNR B;  1SF9 A;  3ZBH A;  1TVK A;  2F4V B;  2Q68 A;  2RDC A;  4LH7 A;  1IBM O;  3A0R A;  2XTA A;  3IC7 A;  2QWP B;  3L75 H;  1EN4 A;  3U11 A;  4GT1 A;  1BSM A;  2WSS G;  3OEH G;  5IY5 B;  3A8T A;  1YTF B;  5LL6 Y;  1M9N A;  3LSU A;  2QM7 A;  3CMA V;  1K73 W;  2X6B A;  5EK0 A;  2PI4 A;  2PI5 A;  2E74 B;  3ABK B;  3PN1 A;  1DGS A;  2Z3Y A;  1K5S A;  1JX9 A;  4MVU A;  3OFN G;  4CH6 A;  3CHX A;  2R9R B;  2UXD B;  4PD4 F;  4X65 B;  1BZK A;  4J7K A;  3OMN B;  3N2K B;  4W4K A;  1S5J A;  2Y4T A;  5L3B A;  1HNX O;  3GWO A;  4D7S A;  4R8C A;  3SPJ A;  4JGS A;  1RFY A;  3B4S A;  2P4V A;  2E76 B;  1IXB A;  3ML0 A;  4JF3 A;  5CA1 A;  3LSQ A;  4H33 A;  4JAS A;  4I4T A;  4QPJ A;  1KU9 A;  5F2V O;  2P67 A;  5BR8 O;  3OGC C;  2LFS A;  3RN4 A;  3JAM N;  3S3X A;  2F93 B;  2JJ2 G;  3EVK A;  1ENV A;  2B1I A;  4G27 B;  3ICX A;  3MHS C;  3KKY A;  1SA0 A;  5IDJ A;  2RQ6 A;  1RP3 B;  1YJW V;  1R6N A;  1VF6 A;  3JD3 A;  4OXS A;  3UT5 A;  4X20 B;  3THO A;  4PA6 A;  2EIK C;  1PNM A;  1U97 A;  5EC1 C;  1IBK B;  1NZ6 A;  4IYH A;  2EJ7 A;  2H8P C;  1L0L H;  1XMO O;  3ZHT A;  2ZT9 B;  2KB1 A;  4ICG A;  4UV8 A;  3VQY A;  1K7D A;  3B8M A;  1JMK C;  5LHH A;  3E22 B;  1EN6 A; 
#chains in the Genus database with same CATH homology
 3CS5 A;  2Q8V A;  2QDO A;  1OJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...