1KB9F

Yeast cytochrome bc1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kb9F00
4U3FH 3L74H 1BGYH 1SQBH 1NU1H 3TGUH 4D6TH 4PD4F 1SQVH 1NTZH 3L71H 1L0NH 3CWBH 3CX5F 3H1IH 3H1KH 1BCCH 1KB9F 5KLVH 1NTKH 1PP9H 2BCCH 2IBZH 1P84F 2A06H 2FYUH 3H1JH 1KYOF 1EZVH 3L73H 3L70H 3CXHF 1SQPH 3BCCH 1L0LH 1PPJH 3H1HH 3L72H 3L75H 3H1LH 1SQXH 1BE3H 1NTMH 1SQQH
chains in the Genus database with same CATH superfamily
1MSDA 1VF6C 4DXWA 3RYHA 3IGAC 3DC6A 5LMNO 2ZINA 2N04A 4UCTA 3VQXA 1VQ4V 2VQEO 4JGSA 3VBBA 2AZ2A 5K1XA 4JI8B 3AG3C 3EFFK 3HR0A 5KX5B 1XNRO 4MTGA 1KYOF 2Y0IA 2Q73A 2QM8A 1PL4A 1OV9A 4B3RB 1HNWO 4RUFA 4LF4O 4JI2B 4DR2O 5B1BB 2V1DA 1BHAA 1UPGA 2Y48A 3HKCB 4YJ2B 1M1KW 2R72A 4Q6GA 1AJQA 1DK1A 4DR3B 3A0RA 4DUYB 4O4IB 1MG1A 1IXBA 1E79G 3SPIA 1P4RA 2HKOA 2VQFB 1GTOA 2CGOA 1K4DC 3UO2A 4FZ1A 1BMFG 3ZN1A 2F95B 1S3JA 3KZIZ 2MK3A 4I55A 2B5UA 1K8AW 4DW0A 3ETEA 3CCJV 5IWAB 5KMGA 3LSQA 4PA4A 2E76B 4WFBV 2QKCA 2K1EA 1N0NA 3T4ZA 1V9PA 4I9QA 5IJ9A 1ZUQA 4F4LA 4GKJB 5IYZA 2JJ1G 2PTMA 1GM7A 3IFXA 2QWNB 2JK5C 1Q6HA 1VQNV 3KKYA 2HJDA 4YY3O 3RVYA 1WPBA 2XUMA 4DR7B 4YJ3A 2Q69A 2EIMC 2X6AA 5B66Z 2PUSA 4N23A 2ZDIA 4FLTA 4O2AB 2KQXA 3CRQA 3KG2A 3ASNB 1SQXH 5HFMA 1S76D 1SERA 3K08A 2DYRC 3L74H 1Z5WA 4X62O 3THOA 5J2UB 1D5NA 4GKKO 4DV2O 1ORQC 1PNKA 1EM1A 2F66C 3I5DA 4DV7O 4DK0A 4U7OA 2EINC 3OR6C 3K58A 3RFRA 1CEZA 1IZ3A 3K5MA 3CRMA 1QQCA 1H2NA 2E74B 2M6YA 4FM1A 2LGQA 3OMAB 4MVMA 4GX1A 1JPXA 2YI8A 4RQEA 2ZCEA 5JJEB 2XAQA 4U7NA 4HBNA 4J7ZA 3UT5A 5IYBO 5JWPA 3P32A 3K9AA 1Y74B 3ABMC 2IU0A 1KC8W 3WB2A 4AI8A 2HLDG 2OTJV 4DR4B 2HHHO 1N32B 2QKSA 1AI6A 4I5SA 2QEXV 3P30A 4JI0B 3CC4V 4UVBA 1FXKB 3LDCA 1V55B 5JJJB 2WLJA 1DLBA 2CTRA 3OTOB 3G6BA 4LF8O 4PA9A 5H6QA 5J9PC 4JI7O 2IW5A 1BHBA 3N2KB 4KP4A 1P49A 1MMMA 2EIKC 4FM0A 3OR7C 2Q7EA 3W7WA 4LF7O 4WFGA 4OX9O 2EULA 4UCSA 4DV0O 4I50A 3A0BZ 2EZPA 5EYPA 3JAWB 2EIJC 1EN5A 2LW7A 1Y76A 2HR3A 1UJWB 4X64B 3I56V 2W6JG 5CB4A 4K35A 1SQPH 3K5OA 3BFRA 2NLJC 2YICA 2YDEA 1SA0A 3AG2B 5EC2C 4H0LB 3RT3C 1F4NA 2UXBB 1Z2GA 5LP6A 2UUBO 1SETA 1P84F 3ABUA 4ZI7A 4H33A 1FPOA 5JVDB 3BCCH 2B9ZA 2R9RB 5KAIZ 4DV6B 4JI5B 2ILMA 1CP9A 1AI4A 1NTMH 5L3GA 2QDOA 3STZC 1WNSA 2XASA 1N34B 2Q5ZA 2YSUB 3E8FA 4FLWA 1WB7A 1F23A 4IGGA 4X65O 4AQYB 3G80A 1AROP 2DYSB 1VQOV 5IY5B 4NTXA 2GBOA 3W7XA 3ZS8C 1QR8A 1I7FA 1GN2A 3L72H 4QNHB 1BL8A 5L3DA 2WWWA 2KKWA 2GV9A 1XDCA 1XBLA 3BA9A 3HKBB 3TJTA 3T1YB 2F23A 4JTAB 2MW2B 2D2CB 5BXZA 3M7MX 1MA1A 4ZOLB 3BVOA 5BR8O 3S3XA 4GZRB 2V4DA 4G2KA 3DXRA 5IDJA 4OXSA 4JTDB 2ZDIC 1GM8A 2LJ2A 3EHBB 4X20B 1L0LH 2EILB 3D36A 1WA8A 3U10A 3N27A 3B2EE 1WB8A 2PI4A 3ZRWA 5BMVB 3CCLV 3T1CA 1I08A 3QVNA 3RWRD 2FL4A 1XQ8A 1Q82W 1OCOC 4DR7O 3JALA 1LUVA 4ZHQA 4ZIBA 4DRXA 2YIBD 4CH4A 2BTQA 5LMUB 4TOIA 3QO5A 1NTZH 4NXMB 1THZA 1IBKO 5LHGA 2GUZB 2EBOA 1FFXB 2ZR2A 4IIJA 3VQVA 1MZEA 3PN1A 3E86A 5KHIA 2HG5C 3CB2A 1K73W 3E89A 5KHGA 1Q81W 4FLZA 4DR1B 3ZX6A 4LWSB 1XMQB 4FLYA 2L6LA 3JASA 1S72V 1U97A 4J7JA 5B3SB 3A2FA 1BCCH 2P90A 4K3AA 3TXQA 4D7SA 5LXTB 2VWKA 4NXNB 4PJ0Z 2CUGA 1G4YB 4XDKA 4TT3G 2VRZA 4WCEV 1S5HC 2DN9A 1K5SA 4ICGA 3CJHB 5IJ0B 4UB8Z 2OCCC 4QGPA 2Y0PA 5FPRA 3RYCA 3KCYA 3CC7V 5FPOA 1N0JA 4P30A 3RYIB 2ZKOA 4CH6A 4GUNA 4UV8A 3D3IA 1HNZO 4PV1B 4EFEA 1AP6A 1SF9A 2JIZG 2KG7B 1N32O 2X6BA 4I9WA 3ZCCA 2UUCB 3M99B 2CE4A 3K0GA 4DR6B 4JI0O 1KKCA 2ITDC 4EB6B 3E8GA 1KUQA 3HKCA 3K03A 4NR1A 2BTOA 4N21A 2A06H 3ZMVA 3NR7A 5JJNB 1YI2V 1F4MA 3OW2U 4JYAO 1QLEB 5CA3A 3CP1A 4DV5O 4G28B 5L3BA 2P22C 5LP6C 2WLNA 3ZMSA 3OFNG 2X6CA 3WFVA 3JAMN 5H5NA 1R6TA 3X2QC 1SS3A 1PP9H 1FJGB 3AG3B 1QLNA 1EFRG 2QWRB 4H37A 2YIDA 1N36B 1KKDA 4GX0A 3K79A 2EX3A 3QNEA 5B1OA 3EVKA 2O57A 1JFFB 2KB1A 5AG2A 5EBMC 3N2GB 1XMOO 2QWPB 2WAMA 3ZJZA 1MSWD 2E75B 3CS5A 4JYCA 1GO3F 1DTOA 4DV1B 4P2ZA 1GK9A 3K3WA 4KHPB 2X7RB 2UXCO 3GB7C 3A8TA 2WLKA 2EJRA 4TQFA 1YDXA 4PDRA 1TA8A 2YXLA 3ZN0A 1M57C 1L8DA 1AB3A 5E1AC 4I0XB 1HR0O 1FXHA 2DQ0A 1W2BU 4FLXA 1D5AA 3ZHRA 1S77D 1JVMA 1K4CC 1FS0G 1Q8IA 1RM1C 5JCOA 2UXDO 1JCHA 1Y6XA 2Q7HA 5CA1B 4NTYA 1JR9A 1L0NH 2UUAB 3M8AA 4B3TO 5C8YB 4X1IB 1SZXA 5LGUA 2EIMB 2EJ7A 1ZL8B 3F7YC 3G4SV 5KHHA 4LF9B 3CCUV 5E79Z 3BABA 2CAZC 2Z5UA 4O4HB 5BZBA 1I5XA 4B3MB 2DYRB 1H8EG 3VQWA 2F4VO 1K34A 4B7EA 2LP7A 1RSOB 5EIBC 1HNXO 4OPHA 1Y74A 1AVMA 3AG7A 1SQGA 5D5QA 3WB0A 2CH7B 2ZM6B 1AI7A 4JYYA 4LFBB 4CZZA 3CYOA 2PI5A 4WF9V 4MTFA 2EINB 4DV4O 3RW0A 4PDLA 2W0XA 5HFLA 4IHJB 4YIOA 1ZX3A 4F6RB 3IAYA 3SYQA 3I55V 3FYEB 2ZE6A 1R6KA 4JAUA 3JYCA 3ABKC 2WLMA 2E5LB 4JI4B 2VWJA 1IBLB 3UQ8A 1NBMG 3N2KA 3SPJA 3CCVV 1GRJA 2JGUA 1QHTA 1W0JG 3SJAC 4JI3B 1IBMO 5KA6A 4D7TA 1N4CA 3T2MA 1DGSA 4UCUA 5J2TB 2OT5A 4J41A 3WB1A 4J42A 3MDSA 4ASUG 4DR5O 2ZQMA 1COWG 4O4LB 3OTFA 4B3SB 3H1LH 2BSKA 3LDEA 1YEWA 1G1XB 5EC1C 4QIWF 4DV3B 2AHZA 4WBNB 5B1AC 1KB9F 4FLUA 4KL1A 2ARHA 2OIGA 3JD4A 4F6EA 3U11A 1QU7A 1OJHA 4UV9A 2LGWA 4X66O 3WU2Z 4JAAA 4LFCO 2EIKB 4NXNO 1N8RW 4QPJA 1QVFU 1K33A 5KUMA 2JGDB 3FAVB 4FFBB 2YXHA 3E35A 4DW1A 3OUFA 1NVPD 1WP8A 1BT8A 3E22B 4JV5B 1YXBA 2R9AA 2HVKC 3H1KH 3OEHG 2EIJB 1B04A 1JOYA 3F5WC 3FB6C 2Q0OC 3W7SA 1K9MW 1MOFA 5KUKA 3L73H 5L3EA 4O4JB 4JI6B 3C3SA 2ADPA 1N33O 1GN6A 4R6ZA 4CH5A 2WLLA 3OM3B 4LR3A 4RAIA 2N05A 1R6NA 3K57A 3HKDA 1SC5B 1YCIA 1Q86W 1Q3EA 1E1RG 2LFSA 2RDCA 2NNUA 1FD9A 1TAEA 2C2AA 2JJ2G 1ZSPA 4JPRA 3SYOA 3RVZA 2OYQA 4UB6Z 4ZOLA 4G27B 1BS3A 3G71V 1Z5VA 3CEIA 3CX5F 5LL6Y 4OGQB 2WLHA 1VIBA 4Z2WA 1XL6A 3A0HZ 2W6IG 4FJCC 4RQFA 3L70H 3OMNB 5D5PA 4I4TB 5JH7A 4PHZA 4BW9A 4TV8A 2X0LA 4LF6B 3W7TA 5KMGB 1OCRC 3SDLA 2UU9B 3SYAA 4MVSA 5JQGA 2BOBC 4MVQA 1AJPA 2YS8A 1BZKA 1TUBB 5IJ9B 1NR1A 5EBLC 1DF5A 3AG1C 2WA3A 2OCHA 4KXRA 1YJWV 4RUEA 1NI8A 1TUEB 2CTWA 3FFQA 4AILC 1WLEA 4B7KA 2H3OA 5GTIZ 1J5EO 2QR4A 3VOUA 4YJ3B 2XAHA 3CMAV 4K0KO 1QNMA 3RYFB 1KQSU 1M90W 4MVZA 4LFAB 2JRIA 1RFYA 1OCZC 4GCZA 1NJIW 5L3FA 1I5YA 3QO8A 1F51A 1SQBH 3TGUH 2AHYA 3BPZA 1NKDA 2HJFC 4LH7A 3S3WA 3ABLC 3CWBH 1PM9A 3SR2C 3BAAA 1ZLZA 1NVPB 1NH2D 3E2EA 3HKEA 3G67A 1XNQB 1FKAO 2Z3YA 1OCOB 3E83A 2PYLA 5FNVA 4JI8O 2F43G 1GMGA 1QR9A 1XUQA 3T4DA 3TK1A 4LF9O 3T1HB 3DC5A 3ZHQA 4B3RO 1AR5A 4JI2O 4YIPA 3JARA 2XTAA 4YHHB 3RYIA 2XOKG 5LGNA 5ITZB 3OAAG 3LUTB 4MW8A 4DR3O 4DUYO 4HAMA 4NB5A 3UT5B 2NR5A 5GONA 2KG7A 5LMNB 3F7VC 3ICXA 3JCUZ 2VQFO 2VQEB 1PL0A 4W4LA 4CS3A 1XNRB 4EB6A 2H8PC 3AG4C 3TXSA 2ETNA 3ETGA 1HDJA 5IWAO 2PYJA 4NYKA 1HNWB 3FB7C 4LF4B 4QJFB 4TUYB 2RQ6A 5IYDO 3SPCA 3CCRV 5H9CA 3CE2A 2DW4A 4GKJO 1VMGA 2OCCB 1PD3A 4P9PA 1H2MA 1GH6A 1LNQA 4K8XA 3CC2V 3AK2A 4W4KA 5LA6B 2LW1A 3SJBC 4TWKA 4CH3A 5CBFA 5EBWC 4DUZB 4UFZA 5LYJB 2Z0AA 1M93A 3CCQV 3RGBA 4I50B 1AJNA 5EYPB 3W7UA 1IXMA 5EIBD 4B3SO 1MABG 1Y76B 4LCUC 2AW9A 4CC5A 1XOUA 2KSDA 5CB4B 2DE0X 4UVAA 3CMEV 1LUWA 3SPGA 2XAJA 1QCEA 2XAGA 3RN4A 1XHZA 1P7BA 3FB5C 4LF5B 4NTWA 2Q68A 5CBGA 3GWOA 1W0KG 3G6EV 5K1PA 4U3JA 4YY3B 2RCVA 3ABTA 5LP6B 3U0ZA 3X2QB 1VP7A 4ZI7B 5L3CA 3SPHA 5EZYB 4LP8A 1NH2B 4JYBA 1M56C 1VQ8V 1YJ9V 3JAKB 4LBEC 1I94B 1XL4A 4D6TH 5DM6V 4GKKB 4DV2B 1H8HG 4JZGA 4DV7B 4O2BB 2IH3C 3D3QA 4GX5A 4X1KB 5C8YA 4DK1A 1S5LZ 4X1IA 3MHSC 2ZE5A 1AR1B 2ZNJA 5KX5A 1R3LC 1VQKV 1ZL8A 4DR4O 2WSSG 3K5LA 1EN4A 4BR6A 3LSUA 1M57B 1Y67A 4BW5A 3HB3B 4YJ2A 5CA0B 2BCCH 1RSOA 1ZWIC 3OTOO 2OTLV 4FPPA 2HEPA 2ATKC 3TCUA 4J10A 1Q90D 4O4IA 1YVWA 3JD3A 4XDLA 1R73A 2CH7A 2LO1A 4LC1A 1RM1B 4R50A 3JATB 2UXNA 1QBZA 4KFMA 1U96A 3DXRB 4BAYA 1BGYH 4H44B 3LSSA 2ZXWC 3L71H 4IHJA 4J11A 4Z1MG 5LHHA 2HHHB 2HP8A 1KECA 1NZ6A 3CPWU 3B4SA 2GHYA 1T5EA 3QF7A 4FK5C 1DF4A 3Q4HB 1GAXA 4E2LA 1MZFA 4X64O 3ASOC 4J9ZB 3K06A 2P4KA 1SQQH 4WFFA 2Q7GA 4X1YB 3CXCU 1NU1H 4LF8B 3ZRWB 4RWUA 5B3SC 3LNMB 4JI7B 3FYIB 3C90A 4FMTA 2UXBO 3SYCA 1OCCC 2W0FC 3ZIAG 4FM2A 2FYUH 1ENVA 5J2TA 1Q5OA 4DRXB 4UCOA 4EFBA 5C93A 4OX9B 2P5OA 4BIUA 2RN9A 4DV0B 3CCEV 1A32A 5DEDA 4LFAO 4O2AA 1W59A 4DV6O 4JI5O 1M9NA 2GSMB 1R3KC 3D8CA 4WFAV 4WBNA 1HP8A 1GN4A 4E4EA 1N34O 3ABKB 4R8CA 5J2UA 3B8MA 1KMIZ 4K8ZA 4AQYO 1AR4A 4FIPC 1JX9A 1IX9A 3P3PA 5LGTA 1MNGA 3JASB 4FFKA 4DO2A 3JSNA 3OGCC 2JGDA 2EZOA 4BIZA 2A79B 3FX7A 2UUBB 3E22A 3FD9A 4LNUB 4PI2A 2CK3G 5KLVH 2Q6AA 4PA6A 3CRAA 5IE9A 3T1YO 3OD4A 1VEWA 3TETA 3ZRXA 2DWEC 3CXHF 2DMXA 3D36C 3JCZA 4BWAA 2QTOA 2GDSA 4O4JA 2JVDA 1Q6UA 1TVKB 1I0HA 4JTCB 1VARA 2QJ1A 2Q4PA 1VQ7V 2ZIOA 1G8MA 2YIAA 1WPXA 4X65B 3SJCC 3GWKC 1FYJA 3P3NA 5B1AB 4MVUA 1Q6IA 3H01A 4JAVA 3C3TA 2XHBA 1R3IC 2QA4V 2JS5A 1PPJH 2R70A 1XHXA 3JD1A 2L35A 1IDSA 4UCVA 5LOVB 1YIJV 1FXKA 1S5JA 4CBCA 2YEVB 3DSQA 1SRYA 4MTOA 3RBZA 2QTSA 3J81N 1K3EA 4PDMA 3ZEDA 4AHCA 4DUZO 5BR8B 3CCMV 1V54C 4I4TA 3IC7A 5BY1A 1US6A 2CTPA 2DJVA 2Y69C 5LMUO 2XAFA 2PZSA 3ABMB 3JAWA 4NXMO 1YJNV 1B3QA 1GN3A 4QE7A 3WG7C 1TUBA 4H13B 4NKGB 1EZVH 4GX2A 3ETDA 3OMIB 1HWYA 4IL6Z 4LF5O 2BOCC 2WLIB 4I7ZB 3R66A 4YXWG 1SQFA 3CRRA 1VQ6V 4PD4F 4DR1O 1FAFA 1SZTA 1F7YA 5H6RA 1XMQO 3VQYA 2JEXA 1VQMV 4GLXA 5A2QN 2VS0A 1GKFA 1Q7YW 1CPYA 3RYFA 5TISZ 2ZE7A 3K0DA 2Q67A 5JVDA 1OZ0A 5B1BC 4EEQA 4MVRA 1YF2A 4HNAB 2IJJA 1IBKB 2M7WA 1K7DA 1OCRB 4TV9B 3ZHTA 5CN0A 1I94O 2ZNIA 1KBHA 1NS1A 5LBQA 3E8HA 4JF3A 2P4VA 4Q20A 3AG1B 2A9HA 2OWOA 4JZ2A 2F1MA 4MTXA 3H1HH 3OT7A 3NXSA 1BQ0A 1Q43A 4WFEA 3RYHB 1B06A 2UUCO 1L1FA 4DR6O 3DTUB 1YZBA 2QE7G 1YSCA 1EZJA 3CSXA 5IT9N 4ZKIA 3UKMA 2IJKA 4HYOA 3HKBA 2IJHA 3H1JH 1PV0A 3EXAA 5ITZA 2QSAA 2QWQB 1X4TA 3K5NA 4L8JA 2DOSA 5B1NA 3ZBHA 4QPKA 1OCZB 3B09A 1EN6A 3IC9A 2IM9A 2N74A 1M5IA 3HPLC 4C7UA 2QWOB 5H2FZ 1HW7A 3ABLB 4X9QA 5KHJA 1HNZB 3ML0A 2WPDG 4XBFA 1VF7A 2GTSA 1O9HA 3AK3A 2ZIMA 1IURA 1D2DA 3J80N 3PJSK 1P7GA 1FJGO 1TGOA 4TUYA 3ASNC 1N36O 1BE3H 4X20A 4I55B 4U3FH 3K04A 2IJIA 3ZMUA 2ZD9A 4MT8A 2FMLA 2HVJC 2IBZH 1ZAUA 5LA6A 1RP3B 2RNBA 5BMVA 3APOA 3CCSV 4JYAB 5IYZB 1ZTEA 5JCOC 5GTHZ 5LYJA 4DV5B 1QVGU 4DV1O 1WN7A 4KHPO 1J95A 2E3CA 4R7CA 1ROPA 5A9GA 3AG4B 3APQA 4JI1B 2LFRA 3K9SA 5KA5A 4LH6A 2GUZA 2AGAA 2BSKB 1FFXA 4RO2A 1FFTB 1YTFD 1WAZA 1G6UA 2ADQB 1XMOB 5LHIA 2JDIG 2JEUA 4LWSA 5IYCO 5KHKA 5CBHA 3FKSG 2Q9LA 2UUAO 2UXXA 1XILA 3MHHC 2JS3A 3DGEA 2UXCB 5EZYA 1M4UA 1URFA 1BQZA 3OGIB 5LXTA 2YXYA 2QM7A 4CS4A 3E8BA 1JQ0A 1FXKC 1VQLV 2DWDC 4ABMA 1V55C 3JAKA 3CJHA 5IJ0A 1HR0B 3SJQC 3BEHA 1Y66A 4UCRA 4B3MO 3H1IH 1JJOA 4MS2A 2QKAA 2RMKB 1R1BA 3LDDA 4O2BA 2UXDB 5FLXN 4X1KA 1H38A 2P06A 4IT5A 2WLLB 3ZRSA 3HKDB 2ZM6O 1JA8A 4LFBO 4B3TB 2FKXA 3SYPA 3ZMZA 2HFEC 4UVCA 1PKXA 4UXNA 1JJ2U 3LNNA 1X59A 3F5TA 5CA0A 3AK1A 4HZ3A 2ZE8A 4MW3A 4TQDA 2AZ0A 1H2SB 2E5LO 4DR2B 1YHQV 3ZHSA 3B8NA 4JI4O 1M56B 2F4VB 1RPOA 4PDVA 1IBLO 3AG2C 3JATA 1SESA 5DN6G 1HNXB 1KP2A 1XI1A 1VF6A 4JI3O 2P67A 1YITV 1KD1W 2AXTZ 5JH7B 4DV4B 1E1QG 1LR1A 3STLC 1WP7A 4TV8B 1S0VA 1BSMA 3Q4HA 4X89A 1R3JC 1EBOA 3IJ4A 2H94A 3L9DA 5CMUA 5JQGB 1VQPV 4NVPA 3ZHUA 2CDYA 4QE9A 2B1IA 3K59A 4X1YA 1JFFA 3BRCA 1AP5A 5DECA 3B40A 3N2GA 2YIBA 4DV3O 1XEQA 2DYSC 1JMKC 2ZT9B 5IY5C 2G38A 1KU9A 2FB5A 1SA0B 1K5QA 4UUJC 3L75H 1IBMB 1YTFB 2PY5A 1SQVH 4X88A 1K97A 2ZXWB 3J7AU 4IYHA 3UM7A 4JV5O 4DR5B 1NTKH 5F2VO 4I0XA 4OPAA 1PNLA 2QM4A 1CXZB 2DQ3A 3ASOB 1B6QA 1AILA 2ITCC 4X62B 4JI6O 3ETQA 1OHHG 1XREA 3HKEB 4X66B 5CA1A 3MAQA 1OCCB 4LNUA 2FTKA 5FNVB 2Q8VA 4LFCB 3BHPA 4PA7A 4P9OA 2IH1C 3O65A 2CTQA 2PF4E 5EK0A 2P7TC 4KUMA 2EILC 4PA3A 3JARB 1TVKA 1GM9A 2PGGA 4O4HA 2B1GA 2YI9A 2F93B 2XT9A 1KP3A 4XDJA 4JASA 4GYCB 3R65A 2K9PA 1NT2B 3OUSA 4X8AA 4FVMA 2NN4A 2ODMA 1N33B 5GW7A 5GONB 3AEIA 3B77A 3MD0A 1AI5A 2IU3A 2RJZA 4A5UB 4FZ0A 1NR7A 1O9GA 4EKWA 4LF6O 4F6RA 5LOVA 2YEVA 2A7WA 2UU9O 1H2GA 3UCSC 1VQ5V 3ZMTA 3ZRVA 4FLVA 1WA8B 3QG5A 3JSLA 3BY6A 3FB8C 1WJZA 1PNMA 2Q0AA 4B08A 2LQTA 3CRCA 2YUAA 4L87A 2R9IA 1VQ9V 4BIOA 1H2LA 4CS2A 3JALB 2Y4TA 4ZHQB 4JI1O 3JD2A 4J7KA 3ZHVA 4LF7B 1K92A 2YC0A 3CHXA 2QGNA 2BTQB 2D3OW 2Y4UA 5FL7G 2WLIA 3QO7A 2A3QA 4MVOA 3GVMA 4O4LA 3OEEG 2A0LA 4MSWC 4WFHA 2ZR3A 4CC6A 5B5EZ 1Y4MA 1RPRA 4IIJB 3KCXA 2OIEA 2BE3A 3QTCA 5KAFZ 2XNDG 3BA8A 3UO3A 1XNQO 2CGNA 2V7QG 4U3JB 3CD6V 2GTAA 4IYIA 1V54B 1J5EB 2WA4A 1VF5B 1H2KA 4J9YB 1SKVA 3T1HO 3FAVA 4FFBA 1UFIA 2P6JA 2Y69B 4HNAA 4TSFG 4K0KB 4TV9A 4Z1VA 1IVSA 3WG7B 3JD0A 3SGIA 4YHHO 3OE7G 4DYLA 4PI0A 4ZBMA 4PELA 4J80A 1QLEC 4GT1A 1FXVA 3O9OA 1NQTA 3RYCB 3H9VA
chains in the Genus database with same CATH topology
4U3FH 3L74H 1BGYH 1SQBH 1NU1H 3TGUH 4D6TH 4PD4F 1SQVH 1NTZH 3L71H 1L0NH 3CWBH 3CX5F 3H1IH 3H1KH 1BCCH 1KB9F 5KLVH 1NTKH 1PP9H 2BCCH 2IBZH 1P84F 2A06H 2FYUH 3H1JH 1KYOF 1EZVH 3L73H 3L70H 3CXHF 1SQPH 3BCCH 1L0LH 1PPJH 3H1HH 3L72H 3L75H 3H1LH 1SQXH 1BE3H 1NTMH 1SQQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F H;  3L74 H;  1BGY H;  1SQB H;  1NU1 H;  3TGU H;  4D6T H;  4PD4 F;  1SQV H;  1NTZ H;  3L71 H;  1L0N H;  3CWB H;  3CX5 F;  3H1I H;  3H1K H;  1BCC H;  1KB9 F;  5KLV H;  1NTK H;  1PP9 H;  2BCC H;  2IBZ H;  1P84 F;  2A06 H;  2FYU H;  3H1J H;  1KYO F;  1EZV H;  3L73 H;  3L70 H;  3CXH F;  1SQP H;  3BCC H;  1L0L H;  1PPJ H;  3H1H H;  3L72 H;  3L75 H;  3H1L H;  1SQX H;  1BE3 H;  1NTM H;  1SQQ H; 
#chains in the Genus database with same CATH topology
 1MSD A;  1VF6 C;  4DXW A;  3RYH A;  3IGA C;  3DC6 A;  5LMN O;  2ZIN A;  2N04 A;  4UCT A;  3VQX A;  1VQ4 V;  2VQE O;  4JGS A;  3VBB A;  2AZ2 A;  5K1X A;  4JI8 B;  3AG3 C;  3EFF K;  3HR0 A;  5KX5 B;  1XNR O;  4MTG A;  1KYO F;  2Y0I A;  2Q73 A;  2QM8 A;  1PL4 A;  1OV9 A;  4B3R B;  1HNW O;  4RUF A;  4LF4 O;  4JI2 B;  4DR2 O;  5B1B B;  2V1D A;  1BHA A;  1UPG A;  2Y48 A;  3HKC B;  4YJ2 B;  1M1K W;  2R72 A;  4Q6G A;  1AJQ A;  1DK1 A;  4DR3 B;  3A0R A;  4DUY B;  4O4I B;  1MG1 A;  1IXB A;  1E79 G;  3SPI A;  1P4R A;  2HKO A;  2VQF B;  1GTO A;  2CGO A;  1K4D C;  3UO2 A;  4FZ1 A;  1BMF G;  3ZN1 A;  2F95 B;  1S3J A;  3KZI Z;  2MK3 A;  4I55 A;  2B5U A;  1K8A W;  4DW0 A;  3ETE A;  3CCJ V;  5IWA B;  5KMG A;  3LSQ A;  4PA4 A;  2E76 B;  4WFB V;  2QKC A;  2K1E A;  1N0N A;  3T4Z A;  1V9P A;  4I9Q A;  5IJ9 A;  1ZUQ A;  4F4L A;  4GKJ B;  5IYZ A;  2JJ1 G;  2PTM A;  1GM7 A;  3IFX A;  2QWN B;  2JK5 C;  1Q6H A;  1VQN V;  3KKY A;  2HJD A;  4YY3 O;  3RVY A;  1WPB A;  2XUM A;  4DR7 B;  4YJ3 A;  2Q69 A;  2EIM C;  2X6A A;  5B66 Z;  2PUS A;  4N23 A;  2ZDI A;  4FLT A;  4O2A B;  2KQX A;  3CRQ A;  3KG2 A;  3ASN B;  1SQX H;  5HFM A;  1S76 D;  1SER A;  3K08 A;  2DYR C;  3L74 H;  1Z5W A;  4X62 O;  3THO A;  5J2U B;  1D5N A;  4GKK O;  4DV2 O;  1ORQ C;  1PNK A;  1EM1 A;  2F66 C;  3I5D A;  4DV7 O;  4DK0 A;  4U7O A;  2EIN C;  3OR6 C;  3K58 A;  3RFR A;  1CEZ A;  1IZ3 A;  3K5M A;  3CRM A;  1QQC A;  1H2N A;  2E74 B;  2M6Y A;  4FM1 A;  2LGQ A;  3OMA B;  4MVM A;  4GX1 A;  1JPX A;  2YI8 A;  4RQE A;  2ZCE A;  5JJE B;  2XAQ A;  4U7N A;  4HBN A;  4J7Z A;  3UT5 A;  5IYB O;  5JWP A;  3P32 A;  3K9A A;  1Y74 B;  3ABM C;  2IU0 A;  1KC8 W;  3WB2 A;  4AI8 A;  2HLD G;  2OTJ V;  4DR4 B;  2HHH O;  1N32 B;  2QKS A;  1AI6 A;  4I5S A;  2QEX V;  3P30 A;  4JI0 B;  3CC4 V;  4UVB A;  1FXK B;  3LDC A;  1V55 B;  5JJJ B;  2WLJ A;  1DLB A;  2CTR A;  3OTO B;  3G6B A;  4LF8 O;  4PA9 A;  5H6Q A;  5J9P C;  4JI7 O;  2IW5 A;  1BHB A;  3N2K B;  4KP4 A;  1P49 A;  1MMM A;  2EIK C;  4FM0 A;  3OR7 C;  2Q7E A;  3W7W A;  4LF7 O;  4WFG A;  4OX9 O;  2EUL A;  4UCS A;  4DV0 O;  4I50 A;  3A0B Z;  2EZP A;  5EYP A;  3JAW B;  2EIJ C;  1EN5 A;  2LW7 A;  1Y76 A;  2HR3 A;  1UJW B;  4X64 B;  3I56 V;  2W6J G;  5CB4 A;  4K35 A;  1SQP H;  3K5O A;  3BFR A;  2NLJ C;  2YIC A;  2YDE A;  1SA0 A;  3AG2 B;  5EC2 C;  4H0L B;  3RT3 C;  1F4N A;  2UXB B;  1Z2G A;  5LP6 A;  2UUB O;  1SET A;  1P84 F;  3ABU A;  4ZI7 A;  4H33 A;  1FPO A;  5JVD B;  3BCC H;  2B9Z A;  2R9R B;  5KAI Z;  4DV6 B;  4JI5 B;  2ILM A;  1CP9 A;  1AI4 A;  1NTM H;  5L3G A;  2QDO A;  3STZ C;  1WNS A;  2XAS A;  1N34 B;  2Q5Z A;  2YSU B;  3E8F A;  4FLW A;  1WB7 A;  1F23 A;  4IGG A;  4X65 O;  4AQY B;  3G80 A;  1ARO P;  2DYS B;  1VQO V;  5IY5 B;  4NTX A;  2GBO A;  3W7X A;  3ZS8 C;  1QR8 A;  1I7F A;  1GN2 A;  3L72 H;  4QNH B;  1BL8 A;  5L3D A;  2WWW A;  2KKW A;  2GV9 A;  1XDC A;  1XBL A;  3BA9 A;  3HKB B;  3TJT A;  3T1Y B;  2F23 A;  4JTA B;  2MW2 B;  2D2C B;  5BXZ A;  3M7M X;  1MA1 A;  4ZOL B;  3BVO A;  5BR8 O;  3S3X A;  4GZR B;  2V4D A;  4G2K A;  3DXR A;  5IDJ A;  4OXS A;  4JTD B;  2ZDI C;  1GM8 A;  2LJ2 A;  3EHB B;  4X20 B;  1L0L H;  2EIL B;  3D36 A;  1WA8 A;  3U10 A;  3N27 A;  3B2E E;  1WB8 A;  2PI4 A;  3ZRW A;  5BMV B;  3CCL V;  3T1C A;  1I08 A;  3QVN A;  3RWR D;  2FL4 A;  1XQ8 A;  1Q82 W;  1OCO C;  4DR7 O;  3JAL A;  1LUV A;  4ZHQ A;  4ZIB A;  4DRX A;  2YIB D;  4CH4 A;  2BTQ A;  5LMU B;  4TOI A;  3QO5 A;  1NTZ H;  4NXM B;  1THZ A;  1IBK O;  5LHG A;  2GUZ B;  2EBO A;  1FFX B;  2ZR2 A;  4IIJ A;  3VQV A;  1MZE A;  3PN1 A;  3E86 A;  5KHI A;  2HG5 C;  3CB2 A;  1K73 W;  3E89 A;  5KHG A;  1Q81 W;  4FLZ A;  4DR1 B;  3ZX6 A;  4LWS B;  1XMQ B;  4FLY A;  2L6L A;  3JAS A;  1S72 V;  1U97 A;  4J7J A;  5B3S B;  3A2F A;  1BCC H;  2P90 A;  4K3A A;  3TXQ A;  4D7S A;  5LXT B;  2VWK A;  4NXN B;  4PJ0 Z;  2CUG A;  1G4Y B;  4XDK A;  4TT3 G;  2VRZ A;  4WCE V;  1S5H C;  2DN9 A;  1K5S A;  4ICG A;  3CJH B;  5IJ0 B;  4UB8 Z;  2OCC C;  4QGP A;  2Y0P A;  5FPR A;  3RYC A;  3KCY A;  3CC7 V;  5FPO A;  1N0J A;  4P30 A;  3RYI B;  2ZKO A;  4CH6 A;  4GUN A;  4UV8 A;  3D3I A;  1HNZ O;  4PV1 B;  4EFE A;  1AP6 A;  1SF9 A;  2JIZ G;  2KG7 B;  1N32 O;  2X6B A;  4I9W A;  3ZCC A;  2UUC B;  3M99 B;  2CE4 A;  3K0G A;  4DR6 B;  4JI0 O;  1KKC A;  2ITD C;  4EB6 B;  3E8G A;  1KUQ A;  3HKC A;  3K03 A;  4NR1 A;  2BTO A;  4N21 A;  2A06 H;  3ZMV A;  3NR7 A;  5JJN B;  1YI2 V;  1F4M A;  3OW2 U;  4JYA O;  1QLE B;  5CA3 A;  3CP1 A;  4DV5 O;  4G28 B;  5L3B A;  2P22 C;  5LP6 C;  2WLN A;  3ZMS A;  3OFN G;  2X6C A;  3WFV A;  3JAM N;  5H5N A;  1R6T A;  3X2Q C;  1SS3 A;  1PP9 H;  1FJG B;  3AG3 B;  1QLN A;  1EFR G;  2QWR B;  4H37 A;  2YID A;  1N36 B;  1KKD A;  4GX0 A;  3K79 A;  2EX3 A;  3QNE A;  5B1O A;  3EVK A;  2O57 A;  1JFF B;  2KB1 A;  5AG2 A;  5EBM C;  3N2G B;  1XMO O;  2QWP B;  2WAM A;  3ZJZ A;  1MSW D;  2E75 B;  3CS5 A;  4JYC A;  1GO3 F;  1DTO A;  4DV1 B;  4P2Z A;  1GK9 A;  3K3W A;  4KHP B;  2X7R B;  2UXC O;  3GB7 C;  3A8T A;  2WLK A;  2EJR A;  4TQF A;  1YDX A;  4PDR A;  1TA8 A;  2YXL A;  3ZN0 A;  1M57 C;  1L8D A;  1AB3 A;  5E1A C;  4I0X B;  1HR0 O;  1FXH A;  2DQ0 A;  1W2B U;  4FLX A;  1D5A A;  3ZHR A;  1S77 D;  1JVM A;  1K4C C;  1FS0 G;  1Q8I A;  1RM1 C;  5JCO A;  2UXD O;  1JCH A;  1Y6X A;  2Q7H A;  5CA1 B;  4NTY A;  1JR9 A;  1L0N H;  2UUA B;  3M8A A;  4B3T O;  5C8Y B;  4X1I B;  1SZX A;  5LGU A;  2EIM B;  2EJ7 A;  1ZL8 B;  3F7Y C;  3G4S V;  5KHH A;  4LF9 B;  3CCU V;  5E79 Z;  3BAB A;  2CAZ C;  2Z5U A;  4O4H B;  5BZB A;  1I5X A;  4B3M B;  2DYR B;  1H8E G;  3VQW A;  2F4V O;  1K34 A;  4B7E A;  2LP7 A;  1RSO B;  5EIB C;  1HNX O;  4OPH A;  1Y74 A;  1AVM A;  3AG7 A;  1SQG A;  5D5Q A;  3WB0 A;  2CH7 B;  2ZM6 B;  1AI7 A;  4JYY A;  4LFB B;  4CZZ A;  3CYO A;  2PI5 A;  4WF9 V;  4MTF A;  2EIN B;  4DV4 O;  3RW0 A;  4PDL A;  2W0X A;  5HFL A;  4IHJ B;  4YIO A;  1ZX3 A;  4F6R B;  3IAY A;  3SYQ A;  3I55 V;  3FYE B;  2ZE6 A;  1R6K A;  4JAU A;  3JYC A;  3ABK C;  2WLM A;  2E5L B;  4JI4 B;  2VWJ A;  1IBL B;  3UQ8 A;  1NBM G;  3N2K A;  3SPJ A;  3CCV V;  1GRJ A;  2JGU A;  1QHT A;  1W0J G;  3SJA C;  4JI3 B;  1IBM O;  5KA6 A;  4D7T A;  1N4C A;  3T2M A;  1DGS A;  4UCU A;  5J2T B;  2OT5 A;  4J41 A;  3WB1 A;  4J42 A;  3MDS A;  4ASU G;  4DR5 O;  2ZQM A;  1COW G;  4O4L B;  3OTF A;  4B3S B;  3H1L H;  2BSK A;  3LDE A;  1YEW A;  1G1X B;  5EC1 C;  4QIW F;  4DV3 B;  2AHZ A;  4WBN B;  5B1A C;  1KB9 F;  4FLU A;  4KL1 A;  2ARH A;  2OIG A;  3JD4 A;  4F6E A;  3U11 A;  1QU7 A;  1OJH A;  4UV9 A;  2LGW A;  4X66 O;  3WU2 Z;  4JAA A;  4LFC O;  2EIK B;  4NXN O;  1N8R W;  4QPJ A;  1QVF U;  1K33 A;  5KUM A;  2JGD B;  3FAV B;  4FFB B;  2YXH A;  3E35 A;  4DW1 A;  3OUF A;  1NVP D;  1WP8 A;  1BT8 A;  3E22 B;  4JV5 B;  1YXB A;  2R9A A;  2HVK C;  3H1K H;  3OEH G;  2EIJ B;  1B04 A;  1JOY A;  3F5W C;  3FB6 C;  2Q0O C;  3W7S A;  1K9M W;  1MOF A;  5KUK A;  3L73 H;  5L3E A;  4O4J B;  4JI6 B;  3C3S A;  2ADP A;  1N33 O;  1GN6 A;  4R6Z A;  4CH5 A;  2WLL A;  3OM3 B;  4LR3 A;  4RAI A;  2N05 A;  1R6N A;  3K57 A;  3HKD A;  1SC5 B;  1YCI A;  1Q86 W;  1Q3E A;  1E1R G;  2LFS A;  2RDC A;  2NNU A;  1FD9 A;  1TAE A;  2C2A A;  2JJ2 G;  1ZSP A;  4JPR A;  3SYO A;  3RVZ A;  2OYQ A;  4UB6 Z;  4ZOL A;  4G27 B;  1BS3 A;  3G71 V;  1Z5V A;  3CEI A;  3CX5 F;  5LL6 Y;  4OGQ B;  2WLH A;  1VIB A;  4Z2W A;  1XL6 A;  3A0H Z;  2W6I G;  4FJC C;  4RQF A;  3L70 H;  3OMN B;  5D5P A;  4I4T B;  5JH7 A;  4PHZ A;  4BW9 A;  4TV8 A;  2X0L A;  4LF6 B;  3W7T A;  5KMG B;  1OCR C;  3SDL A;  2UU9 B;  3SYA A;  4MVS A;  5JQG A;  2BOB C;  4MVQ A;  1AJP A;  2YS8 A;  1BZK A;  1TUB B;  5IJ9 B;  1NR1 A;  5EBL C;  1DF5 A;  3AG1 C;  2WA3 A;  2OCH A;  4KXR A;  1YJW V;  4RUE A;  1NI8 A;  1TUE B;  2CTW A;  3FFQ A;  4AIL C;  1WLE A;  4B7K A;  2H3O A;  5GTI Z;  1J5E O;  2QR4 A;  3VOU A;  4YJ3 B;  2XAH A;  3CMA V;  4K0K O;  1QNM A;  3RYF B;  1KQS U;  1M90 W;  4MVZ A;  4LFA B;  2JRI A;  1RFY A;  1OCZ C;  4GCZ A;  1NJI W;  5L3F A;  1I5Y A;  3QO8 A;  1F51 A;  1SQB H;  3TGU H;  2AHY A;  3BPZ A;  1NKD A;  2HJF C;  4LH7 A;  3S3W A;  3ABL C;  3CWB H;  1PM9 A;  3SR2 C;  3BAA A;  1ZLZ A;  1NVP B;  1NH2 D;  3E2E A;  3HKE A;  3G67 A;  1XNQ B;  1FKA O;  2Z3Y A;  1OCO B;  3E83 A;  2PYL A;  5FNV A;  4JI8 O;  2F43 G;  1GMG A;  1QR9 A;  1XUQ A;  3T4D A;  3TK1 A;  4LF9 O;  3T1H B;  3DC5 A;  3ZHQ A;  4B3R O;  1AR5 A;  4JI2 O;  4YIP A;  3JAR A;  2XTA A;  4YHH B;  3RYI A;  2XOK G;  5LGN A;  5ITZ B;  3OAA G;  3LUT B;  4MW8 A;  4DR3 O;  4DUY O;  4HAM A;  4NB5 A;  3UT5 B;  2NR5 A;  5GON A;  2KG7 A;  5LMN B;  3F7V C;  3ICX A;  3JCU Z;  2VQF O;  2VQE B;  1PL0 A;  4W4L A;  4CS3 A;  1XNR B;  4EB6 A;  2H8P C;  3AG4 C;  3TXS A;  2ETN A;  3ETG A;  1HDJ A;  5IWA O;  2PYJ A;  4NYK A;  1HNW B;  3FB7 C;  4LF4 B;  4QJF B;  4TUY B;  2RQ6 A;  5IYD O;  3SPC A;  3CCR V;  5H9C A;  3CE2 A;  2DW4 A;  4GKJ O;  1VMG A;  2OCC B;  1PD3 A;  4P9P A;  1H2M A;  1GH6 A;  1LNQ A;  4K8X A;  3CC2 V;  3AK2 A;  4W4K A;  5LA6 B;  2LW1 A;  3SJB C;  4TWK A;  4CH3 A;  5CBF A;  5EBW C;  4DUZ B;  4UFZ A;  5LYJ B;  2Z0A A;  1M93 A;  3CCQ V;  3RGB A;  4I50 B;  1AJN A;  5EYP B;  3W7U A;  1IXM A;  5EIB D;  4B3S O;  1MAB G;  1Y76 B;  4LCU C;  2AW9 A;  4CC5 A;  1XOU A;  2KSD A;  5CB4 B;  2DE0 X;  4UVA A;  3CME V;  1LUW A;  3SPG A;  2XAJ A;  1QCE A;  2XAG A;  3RN4 A;  1XHZ A;  1P7B A;  3FB5 C;  4LF5 B;  4NTW A;  2Q68 A;  5CBG A;  3GWO A;  1W0K G;  3G6E V;  5K1P A;  4U3J A;  4YY3 B;  2RCV A;  3ABT A;  5LP6 B;  3U0Z A;  3X2Q B;  1VP7 A;  4ZI7 B;  5L3C A;  3SPH A;  5EZY B;  4LP8 A;  1NH2 B;  4JYB A;  1M56 C;  1VQ8 V;  1YJ9 V;  3JAK B;  4LBE C;  1I94 B;  1XL4 A;  4D6T H;  5DM6 V;  4GKK B;  4DV2 B;  1H8H G;  4JZG A;  4DV7 B;  4O2B B;  2IH3 C;  3D3Q A;  4GX5 A;  4X1K B;  5C8Y A;  4DK1 A;  1S5L Z;  4X1I A;  3MHS C;  2ZE5 A;  1AR1 B;  2ZNJ A;  5KX5 A;  1R3L C;  1VQK V;  1ZL8 A;  4DR4 O;  2WSS G;  3K5L A;  1EN4 A;  4BR6 A;  3LSU A;  1M57 B;  1Y67 A;  4BW5 A;  3HB3 B;  4YJ2 A;  5CA0 B;  2BCC H;  1RSO A;  1ZWI C;  3OTO O;  2OTL V;  4FPP A;  2HEP A;  2ATK C;  3TCU A;  4J10 A;  1Q90 D;  4O4I A;  1YVW A;  3JD3 A;  4XDL A;  1R73 A;  2CH7 A;  2LO1 A;  4LC1 A;  1RM1 B;  4R50 A;  3JAT B;  2UXN A;  1QBZ A;  4KFM A;  1U96 A;  3DXR B;  4BAY A;  1BGY H;  4H44 B;  3LSS A;  2ZXW C;  3L71 H;  4IHJ A;  4J11 A;  4Z1M G;  5LHH A;  2HHH B;  2HP8 A;  1KEC A;  1NZ6 A;  3CPW U;  3B4S A;  2GHY A;  1T5E A;  3QF7 A;  4FK5 C;  1DF4 A;  3Q4H B;  1GAX A;  4E2L A;  1MZF A;  4X64 O;  3ASO C;  4J9Z B;  3K06 A;  2P4K A;  1SQQ H;  4WFF A;  2Q7G A;  4X1Y B;  3CXC U;  1NU1 H;  4LF8 B;  3ZRW B;  4RWU A;  5B3S C;  3LNM B;  4JI7 B;  3FYI B;  3C90 A;  4FMT A;  2UXB O;  3SYC A;  1OCC C;  2W0F C;  3ZIA G;  4FM2 A;  2FYU H;  1ENV A;  5J2T A;  1Q5O A;  4DRX B;  4UCO A;  4EFB A;  5C93 A;  4OX9 B;  2P5O A;  4BIU A;  2RN9 A;  4DV0 B;  3CCE V;  1A32 A;  5DED A;  4LFA O;  4O2A A;  1W59 A;  4DV6 O;  4JI5 O;  1M9N A;  2GSM B;  1R3K C;  3D8C A;  4WFA V;  4WBN A;  1HP8 A;  1GN4 A;  4E4E A;  1N34 O;  3ABK B;  4R8C A;  5J2U A;  3B8M A;  1KMI Z;  4K8Z A;  4AQY O;  1AR4 A;  4FIP C;  1JX9 A;  1IX9 A;  3P3P A;  5LGT A;  1MNG A;  3JAS B;  4FFK A;  4DO2 A;  3JSN A;  3OGC C;  2JGD A;  2EZO A;  4BIZ A;  2A79 B;  3FX7 A;  2UUB B;  3E22 A;  3FD9 A;  4LNU B;  4PI2 A;  2CK3 G;  5KLV H;  2Q6A A;  4PA6 A;  3CRA A;  5IE9 A;  3T1Y O;  3OD4 A;  1VEW A;  3TET A;  3ZRX A;  2DWE C;  3CXH F;  2DMX A;  3D36 C;  3JCZ A;  4BWA A;  2QTO A;  2GDS A;  4O4J A;  2JVD A;  1Q6U A;  1TVK B;  1I0H A;  4JTC B;  1VAR A;  2QJ1 A;  2Q4P A;  1VQ7 V;  2ZIO A;  1G8M A;  2YIA A;  1WPX A;  4X65 B;  3SJC C;  3GWK C;  1FYJ A;  3P3N A;  5B1A B;  4MVU A;  1Q6I A;  3H01 A;  4JAV A;  3C3T A;  2XHB A;  1R3I C;  2QA4 V;  2JS5 A;  1PPJ H;  2R70 A;  1XHX A;  3JD1 A;  2L35 A;  1IDS A;  4UCV A;  5LOV B;  1YIJ V;  1FXK A;  1S5J A;  4CBC A;  2YEV B;  3DSQ A;  1SRY A;  4MTO A;  3RBZ A;  2QTS A;  3J81 N;  1K3E A;  4PDM A;  3ZED A;  4AHC A;  4DUZ O;  5BR8 B;  3CCM V;  1V54 C;  4I4T A;  3IC7 A;  5BY1 A;  1US6 A;  2CTP A;  2DJV A;  2Y69 C;  5LMU O;  2XAF A;  2PZS A;  3ABM B;  3JAW A;  4NXM O;  1YJN V;  1B3Q A;  1GN3 A;  4QE7 A;  3WG7 C;  1TUB A;  4H13 B;  4NKG B;  1EZV H;  4GX2 A;  3ETD A;  3OMI B;  1HWY A;  4IL6 Z;  4LF5 O;  2BOC C;  2WLI B;  4I7Z B;  3R66 A;  4YXW G;  1SQF A;  3CRR A;  1VQ6 V;  4PD4 F;  4DR1 O;  1FAF A;  1SZT A;  1F7Y A;  5H6R A;  1XMQ O;  3VQY A;  2JEX A;  1VQM V;  4GLX A;  5A2Q N;  2VS0 A;  1GKF A;  1Q7Y W;  1CPY A;  3RYF A;  5TIS Z;  2ZE7 A;  3K0D A;  2Q67 A;  5JVD A;  1OZ0 A;  5B1B C;  4EEQ A;  4MVR A;  1YF2 A;  4HNA B;  2IJJ A;  1IBK B;  2M7W A;  1K7D A;  1OCR B;  4TV9 B;  3ZHT A;  5CN0 A;  1I94 O;  2ZNI A;  1KBH A;  1NS1 A;  5LBQ A;  3E8H A;  4JF3 A;  2P4V A;  4Q20 A;  3AG1 B;  2A9H A;  2OWO A;  4JZ2 A;  2F1M A;  4MTX A;  3H1H H;  3OT7 A;  3NXS A;  1BQ0 A;  1Q43 A;  4WFE A;  3RYH B;  1B06 A;  2UUC O;  1L1F A;  4DR6 O;  3DTU B;  1YZB A;  2QE7 G;  1YSC A;  1EZJ A;  3CSX A;  5IT9 N;  4ZKI A;  3UKM A;  2IJK A;  4HYO A;  3HKB A;  2IJH A;  3H1J H;  1PV0 A;  3EXA A;  5ITZ A;  2QSA A;  2QWQ B;  1X4T A;  3K5N A;  4L8J A;  2DOS A;  5B1N A;  3ZBH A;  4QPK A;  1OCZ B;  3B09 A;  1EN6 A;  3IC9 A;  2IM9 A;  2N74 A;  1M5I A;  3HPL C;  4C7U A;  2QWO B;  5H2F Z;  1HW7 A;  3ABL B;  4X9Q A;  5KHJ A;  1HNZ B;  3ML0 A;  2WPD G;  4XBF A;  1VF7 A;  2GTS A;  1O9H A;  3AK3 A;  2ZIM A;  1IUR A;  1D2D A;  3J80 N;  3PJS K;  1P7G A;  1FJG O;  1TGO A;  4TUY A;  3ASN C;  1N36 O;  1BE3 H;  4X20 A;  4I55 B;  4U3F H;  3K04 A;  2IJI A;  3ZMU A;  2ZD9 A;  4MT8 A;  2FML A;  2HVJ C;  2IBZ H;  1ZAU A;  5LA6 A;  1RP3 B;  2RNB A;  5BMV A;  3APO A;  3CCS V;  4JYA B;  5IYZ B;  1ZTE A;  5JCO C;  5GTH Z;  5LYJ A;  4DV5 B;  1QVG U;  4DV1 O;  1WN7 A;  4KHP O;  1J95 A;  2E3C A;  4R7C A;  1ROP A;  5A9G A;  3AG4 B;  3APQ A;  4JI1 B;  2LFR A;  3K9S A;  5KA5 A;  4LH6 A;  2GUZ A;  2AGA A;  2BSK B;  1FFX A;  4RO2 A;  1FFT B;  1YTF D;  1WAZ A;  1G6U A;  2ADQ B;  1XMO B;  5LHI A;  2JDI G;  2JEU A;  4LWS A;  5IYC O;  5KHK A;  5CBH A;  3FKS G;  2Q9L A;  2UUA O;  2UXX A;  1XIL A;  3MHH C;  2JS3 A;  3DGE A;  2UXC B;  5EZY A;  1M4U A;  1URF A;  1BQZ A;  3OGI B;  5LXT A;  2YXY A;  2QM7 A;  4CS4 A;  3E8B A;  1JQ0 A;  1FXK C;  1VQL V;  2DWD C;  4ABM A;  1V55 C;  3JAK A;  3CJH A;  5IJ0 A;  1HR0 B;  3SJQ C;  3BEH A;  1Y66 A;  4UCR A;  4B3M O;  3H1I H;  1JJO A;  4MS2 A;  2QKA A;  2RMK B;  1R1B A;  3LDD A;  4O2B A;  2UXD B;  5FLX N;  4X1K A;  1H38 A;  2P06 A;  4IT5 A;  2WLL B;  3ZRS A;  3HKD B;  2ZM6 O;  1JA8 A;  4LFB O;  4B3T B;  2FKX A;  3SYP A;  3ZMZ A;  2HFE C;  4UVC A;  1PKX A;  4UXN A;  1JJ2 U;  3LNN A;  1X59 A;  3F5T A;  5CA0 A;  3AK1 A;  4HZ3 A;  2ZE8 A;  4MW3 A;  4TQD A;  2AZ0 A;  1H2S B;  2E5L O;  4DR2 B;  1YHQ V;  3ZHS A;  3B8N A;  4JI4 O;  1M56 B;  2F4V B;  1RPO A;  4PDV A;  1IBL O;  3AG2 C;  3JAT A;  1SES A;  5DN6 G;  1HNX B;  1KP2 A;  1XI1 A;  1VF6 A;  4JI3 O;  2P67 A;  1YIT V;  1KD1 W;  2AXT Z;  5JH7 B;  4DV4 B;  1E1Q G;  1LR1 A;  3STL C;  1WP7 A;  4TV8 B;  1S0V A;  1BSM A;  3Q4H A;  4X89 A;  1R3J C;  1EBO A;  3IJ4 A;  2H94 A;  3L9D A;  5CMU A;  5JQG B;  1VQP V;  4NVP A;  3ZHU A;  2CDY A;  4QE9 A;  2B1I A;  3K59 A;  4X1Y A;  1JFF A;  3BRC A;  1AP5 A;  5DEC A;  3B40 A;  3N2G A;  2YIB A;  4DV3 O;  1XEQ A;  2DYS C;  1JMK C;  2ZT9 B;  5IY5 C;  2G38 A;  1KU9 A;  2FB5 A;  1SA0 B;  1K5Q A;  4UUJ C;  3L75 H;  1IBM B;  1YTF B;  2PY5 A;  1SQV H;  4X88 A;  1K97 A;  2ZXW B;  3J7A U;  4IYH A;  3UM7 A;  4JV5 O;  4DR5 B;  1NTK H;  5F2V O;  4I0X A;  4OPA A;  1PNL A;  2QM4 A;  1CXZ B;  2DQ3 A;  3ASO B;  1B6Q A;  1AIL A;  2ITC C;  4X62 B;  4JI6 O;  3ETQ A;  1OHH G;  1XRE A;  3HKE B;  4X66 B;  5CA1 A;  3MAQ A;  1OCC B;  4LNU A;  2FTK A;  5FNV B;  2Q8V A;  4LFC B;  3BHP A;  4PA7 A;  4P9O A;  2IH1 C;  3O65 A;  2CTQ A;  2PF4 E;  5EK0 A;  2P7T C;  4KUM A;  2EIL C;  4PA3 A;  3JAR B;  1TVK A;  1GM9 A;  2PGG A;  4O4H A;  2B1G A;  2YI9 A;  2F93 B;  2XT9 A;  1KP3 A;  4XDJ A;  4JAS A;  4GYC B;  3R65 A;  2K9P A;  1NT2 B;  3OUS A;  4X8A A;  4FVM A;  2NN4 A;  2ODM A;  1N33 B;  5GW7 A;  5GON B;  3AEI A;  3B77 A;  3MD0 A;  1AI5 A;  2IU3 A;  2RJZ A;  4A5U B;  4FZ0 A;  1NR7 A;  1O9G A;  4EKW A;  4LF6 O;  4F6R A;  5LOV A;  2YEV A;  2A7W A;  2UU9 O;  1H2G A;  3UCS C;  1VQ5 V;  3ZMT A;  3ZRV A;  4FLV A;  1WA8 B;  3QG5 A;  3JSL A;  3BY6 A;  3FB8 C;  1WJZ A;  1PNM A;  2Q0A A;  4B08 A;  2LQT A;  3CRC A;  2YUA A;  4L87 A;  2R9I A;  1VQ9 V;  4BIO A;  1H2L A;  4CS2 A;  3JAL B;  2Y4T A;  4ZHQ B;  4JI1 O;  3JD2 A;  4J7K A;  3ZHV A;  4LF7 B;  1K92 A;  2YC0 A;  3CHX A;  2QGN A;  2BTQ B;  2D3O W;  2Y4U A;  5FL7 G;  2WLI A;  3QO7 A;  2A3Q A;  4MVO A;  3GVM A;  4O4L A;  3OEE G;  2A0L A;  4MSW C;  4WFH A;  2ZR3 A;  4CC6 A;  5B5E Z;  1Y4M A;  1RPR A;  4IIJ B;  3KCX A;  2OIE A;  2BE3 A;  3QTC A;  5KAF Z;  2XND G;  3BA8 A;  3UO3 A;  1XNQ O;  2CGN A;  2V7Q G;  4U3J B;  3CD6 V;  2GTA A;  4IYI A;  1V54 B;  1J5E B;  2WA4 A;  1VF5 B;  1H2K A;  4J9Y B;  1SKV A;  3T1H O;  3FAV A;  4FFB A;  1UFI A;  2P6J A;  2Y69 B;  4HNA A;  4TSF G;  4K0K B;  4TV9 A;  4Z1V A;  1IVS A;  3WG7 B;  3JD0 A;  3SGI A;  4YHH O;  3OE7 G;  4DYL A;  4PI0 A;  4ZBM A;  4PEL A;  4J80 A;  1QLE C;  4GT1 A;  1FXV A;  3O9O A;  1NQT A;  3RYC B;  3H9V A; 
#chains in the Genus database with same CATH homology
 4U3F H;  3L74 H;  1BGY H;  1SQB H;  1NU1 H;  3TGU H;  4D6T H;  4PD4 F;  1SQV H;  1NTZ H;  3L71 H;  1L0N H;  3CWB H;  3CX5 F;  3H1I H;  3H1K H;  1BCC H;  1KB9 F;  5KLV H;  1NTK H;  1PP9 H;  2BCC H;  2IBZ H;  1P84 F;  2A06 H;  2FYU H;  3H1J H;  1KYO F;  1EZV H;  3L73 H;  3L70 H;  3CXH F;  1SQP H;  3BCC H;  1L0L H;  1PPJ H;  3H1H H;  3L72 H;  3L75 H;  3H1L H;  1SQX H;  1BE3 H;  1NTM H;  1SQQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...