1KB9F

Yeast cytochrome bc1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kb9F00
1PPJH 1BE3H 1BCCH 3TGUH 5KLVH 1SQPH 3H1HH 1SQQH 2BCCH 3L70H 3L73H 3CXHF 1PP9H 1BGYH 2A06H 3BCCH 3L75H 1SQXH 1L0LH 4U3FH 1NU1H 3CWBH 4D6TH 3L72H 1NTMH 1SQBH 3CX5F 3H1KH 1NTZH 1L0NH 1KB9F 3L74H 1SQVH 1KYOF 3L71H 3H1LH 1EZVH 1P84F 1NTKH 2IBZH 3H1IH 2FYUH 4PD4F 3H1JH
chains in the Genus database with same CATH superfamily
3LSQA 2LO1A 3P32A 1VQPV 4WBNB 2F95B 4IL6Z 3K5MA 2KG7B 3RYIA 1SESA 3P3NA 2CH7A 3ZN1A 5IT9N 1Y76B 2FMLA 1YHQV 1JJ2U 5KHKA 3OTOO 3C3SA 3L74H 1IXMA 4YIOA 4MVQA 4FLVA 2ETNA 4ZBMA 4MVMA 2KB1A 3O9OA 3ABTA 2DWEC 2WLMA 4I55B 1RM1B 3HR0A 4I9QA 3HKDB 1Q43A 2CK3G 1GN2A 5LOVB 2Q9LA 5CB4A 1NKDA 2Q8VA 1LUWA 4FM2A 4YJ3A 2Q7HA 5EYPB 5K1PA 1O9HA 1OCRC 2EIMC 4Q20A 1QQCA 3ZHSA 2YDEA 5IJ0A 1YZBA 1H2SB 4UB6Z 1YF2A 4CS3A 4EFBA 2VWJA 5B1OA 2BE3A 2Q67A 4X88A 5H6QA 2XT9A 1YEWA 2WLJA 3ZEDA 3CMAV 3DTUB 1XHZA 2OCCB 1ZX3A 4WFBV 4MTGA 2EINB 1JPXA 2Q6AA 3K03A 2F93B 4X1IB 1J5EO 1PKXA 2E5LB 2OTLV 4H37A 1NTMH 1K34A 3JATA 1QBZA 3TJTA 5C93A 4JI4O 3ZRXA 1F4MA 3DC6A 4KFMA 1VF5B 4NXMB 3LNMB 2G38A 4LF8B 4FM0A 3QO5A 4GKJB 2XTAA 1Z2GA 1AR4A 1D5NA 4AILC 4FMTA 4GX5A 2IU3A 3SYCA 1FJGO 1SC5B 1VMGA 4O4IA 3CX5F 2B1IA 5FPRA 3GWOA 5LL6Y 4CH5A 2ATKC 4PELA 1GK9A 2P5OA 1ZLZA 1QR9A 5EBWC 3K59A 2GUZB 5B5EZ 1OV9A 4UCSA 1T5EA 4UVAA 3ZMVA 2Y48A 1G1XB 3CC4V 1RFYA 1AVMA 4DV6B 5BMVA 3F7YC 2QEXV 1SF9A 1P4RA 3AK2A 2WLNA 1MMMA 1I94B 2Q7EA 4DK0A 4FFBB 3CCSV 4PDVA 1SQPH 4L87A 1XUQA 1EN4A 2HVKC 2QE7G 4U3FH 4P2ZA 2Q73A 1KUQA 1AJNA 5LHGA 2JEXA 4NXMO 3T4ZA 5CA0B 1Y67A 4LF8O 3ZMSA 4B7KA 4DRXB 3N2GB 1N0NA 4GKJO 4D7TA 1K9MW 1LR1A 4RAIA 2P7TC 1Y74B 3JAWA 1AILA 2ZDIA 2CUGA 4UB8Z 2YIDA 4GZRB 3JD2A 1WNSA 4U7NA 4DUZB 3GB7C 3WB2A 3E86A 3B40A 1ROPA 5DEDA 1F51A 2X7RB 2X6CA 2ZR3A 5GONB 3AG1C 3K79A 2PGGA 4LFCB 2F43G 2UUCO 1IBLB 4CH4A 3RW0A 4U3JA 2WLLA 4R50A 5EIBC 2AHYA 4JF3A 5CA1A 1R3KC 2M6YA 4YY3B 1HR0B 4LF4B 2KQXA 1BL8A 2QWRB 5FNVA 3ZHTA 1I08A 3EHBB 3IGAC 4EEQA 5B3SB 3HKEB 3OGIB 1US6A 4P9OA 5KMGA 2WWWA 4Z2WA 4MTFA 2ZE5A 5H5NA 3ZMUA 2Q69A 2OYQA 1BT8A 4JV5B 1YSCA 1W0JG 1CXZB 2ILMA 3ETGA 1JFFB 1K97A 2OCHA 1BMFG 2VQEB 1GN3A 2IBZH 4DUZO 2VQFO 3TK1A 3AG2C 1M93A 4TOIA 1NBMG 5KX5B 5KHJA 4LFCO 3ZRWB 1IBLO 1OCCC 1K92A 5LGTA 4JYAB 3LSUA 3UCSC 5CN0A 1VQ4V 4YY3O 1HR0O 2JGDA 2ZE8A 2DE0X 3CB2A 4LF4O 4JI2B 2YEVB 1S0VA 2HP8A 4FZ1A 4X20A 2CGNA 3OEEG 2E75B 3ASOB 1YTFB 2LGQA 2JEUA 1EN5A 3HB3B 1HNWB 1JOYA 1YJWV 2P22C 3H1JH 2A3QA 3CC2V 3G80A 4DUYB 3M7MX 4JV5O 1SA0B 1YI2V 3PN1A 1WA8A 4IGGA 1J95A 1WP8A 3VQXA 3ZHRA 3STLC 1K5QA 4I4TB 2ZINA 2HR3A 1IBMB 1FXVA 1FYJA 5JQGB 4HYOA 1AROP 2CDYA 4PA6A 4DR3B 1PL4A 5H9CA 3H1LH 5JJNB 4UCTA 4JYYA 3JALA 3SPCA 1CP9A 1U96A 5CA3A 4DV5O 4JYAO 1AB3A 3SDLA 3W7XA 4UVBA 3M99B 4Q6GA 4AQYO 1RSOB 1VF7A 1QCEA 5JH7A 2PYLA 1N8RW 2XAHA 2CGOA 3OR7C 4O4JA 1VF6A 1GM8A 3U11A 1YXBA 3KG2A 4DR6B 5FLXN 2DW4A 4TV8A 3FB7C 4WFFA 4X65B 2R70A 4JYBA 1NU1H 2W6IG 4KL1A 1HNWO 2PY5A 1YVWA 2UXDO 2H94A 4J9YB 1JX9A 3I55V 4X1YB 3BA8A 4FJCC 4JI1B 1P7GA 2JK5C 4DR7B 1GO3F 4B3MO 3HKBB 3TXQA 3D36C 2UXCO 2K9PA 4PA7A 3ABUA 4DV3B 3I5DA 1VQ7V 1BQ0A 4DR3O 1OCCB 1W0KG 4LC1A 3SYQA 4HZ3A 4AI8A 4O2AA 1NR1A 4MVZA 1TUEB 1N33O 2QKSA 4C7UA 3OMAB 2UUBB 4PDRA 3CHXA 1A32A 3LNNA 1E1QG 3B4SA 4JI0B 3RYIB 2V7QG 4ZIBA 2CH7B 1OZ0A 4B3SB 4BW9A 2D3OW 2FL4A 3AEIA 2Z3YA 1OHHG 5ITZB 3FX7A 2YIBD 4UV8A 1N4CA 3TETA 1NH2D 1TVKA 3RYHA 4OXSA 1NQTA 1YJ9V 1R6KA 4WFEA 4TV9A 3VQWA 5IYDO 4LP8A 1KKCA 4DR6O 2LFRA 3SGIA 4X65O 3ZX6A 5IY5C 4BR6A 2LP7A 4HNAA 3MAQA 1KC8W 4DR4O 1TA8A 1UFIA 4MVRA 1DLBA 1L0LH 2XASA 4JI1O 1QR8A 1BHAA 4DR7O 2CTRA 4ICGA 2ZD9A 3SYAA 5CB4B 4PHZA 4YJ3B 4E4EA 2R9AA 1V55C 2ZNJA 1EN6A 2ZDIC 4R6ZA 5L3GA 4MVOA 3L70H 3CCJV 1FFXB 1OCZC 1X4TA 2HFEC 4XDLA 2UUBO 1TGOA 3QO7A 4JI0O 3CCVV 1G8MA 1WN7A 3T1HB 3ZBHA 4B3SO 2YS8A 2V4DA 4EB6A 5B66Z 4PD4F 1PD3A 1PV0A 1FXKA 3DSQA 1SQFA 3G67A 3JATB 2IJKA 5IJ9A 5IYZA 4MW8A 4YJ2B 1XEQA 1S77D 2F1MA 2W0XA 5EBLC 5LA6B 3K5LA 1HNZB 5LYJA 2L35A 4I5SA 2F4VB 2X0LA 3QVNA 2JS3A 2H3OA 3RT3C 2PI5A 4P9PA 2ITCC 1B3QA 5LMNB 2P4VA 4ZKIA 3CCMV 1WJZA 2A9HA 3MD0A 3GWKC 4TQFA 1UPGA 3AG7A 4LFBO 4LR3A 1KB9F 3JCZA 4KUMA 4QGPA 4JASA 4DK1A 1DF5A 3WB0A 3SPJA 3CXHF 2BOCC 3T1HO 4CH6A 4B08A 1VEWA 4TT3G 2CAZC 3KKYA 1GN6A 5JCOC 4W4LA 5E1AC 4YHHB 4O4LA 4JI8B 5LXTA 1KECA 4X1KA 5IY5B 2LJ2A 4IT5A 5LP6A 2QWOB 3A8TA 4JI7B 4UFZA 3ZN0A 1QVGU 1KKDA 2NN4A 1UJWB 1NH2B 3FFQA 4Z1VA 1B06A 4UVCA 2JS5A 3CCUV 4FPPA 4X9QA 3CMEV 2F4VO 3S3WA 3AK1A 4DV4B 1VIBA 2JJ2G 2M7WA 1V55B 5LMNO 5L3CA 3ABLC 1URFA 4O4HB 4YIPA 4PI0A 1JCHA 4I0XA 4IIJB 1OCZB 3S3XA 2DYRC 3JARB 2F23A 5J2TA 4H0LB 1I0HA 4U3JB 4IHJA 2Y4UA 2WLIB 2ZM6B 3HKCA 4Z1MG 3I56V 1KYOF 5CA1B 4U7OA 4DYLA 1BCCH 1H2LA 2ZT9B 3ZS8C 2BSKB 3RWRD 4YHHO 3A0RA 4JI8O 4I50A 5FNVB 2N74A 3IC7A 4LCUC 4JI7O 1SQVH 2AW9A 5KMGB 3UQ8A 3RYCB 1YIJV 5B3SC 3RYFA 4DV4O 4ZOLB 2YC0A 1JVMA 4AHCA 3ETDA 3T4DA 2R72A 1QHTA 2ZE6A 1KQSU 1XNQB 1P7BA 1GMGA 1PNLA 4NTXA 2QM4A 1NVPB 4PJ0Z 3W7WA 5JWPA 1P84F 1XHXA 3E8HA 2ZKOA 4J10A 1K3EA 4DR5B 1AI4A 2LGWA 3R66A 2WLHA 3N27A 2BTQB 5EC2C 1N32B 1S72V 1NI8A 3UO2A 1ZL8B 1THZA 3K08A 4RO2A 1YDXA 3ML0A 2JGDB 1E1RG 3SJCC 2B1GA 1YTFD 4DR1B 4ZI7B 2UXBB 3K0GA 5CBHA 3H1IH 2NLJC 4RQEA 3OW2U 4K8ZA 1LNQA 2E5LO 2HKOA 3OMNB 3TCUA 4FLZA 3ZRVA 2E3CA 4F6RB 3K5NA 1OJHA 2GV9A 2A06H 5CBGA 2YXHA 1AI6A 1H38A 5L3DA 2L6LA 2R9RB 3U0ZA 3F7VC 1I5YA 3B2EE 4J41A 4CZZA 1F23A 3DC5A 4MTXA 3CCLV 4B3TB 1I5XA 3QO8A 3ABLB 3Q4HB 2Q0AA 2DWDC 1Y76A 3ASOC 2ADQB 4PI2A 3CJHA 1ENVA 4FLTA 1NR7A 1FAFA 2DYRB 3K57A 5LHIA 2MK3A 5EIBD 3IC9A 4FLUA 3JASA 2ZQMA 4MVSA 1XNQO 4LF9B 1BGYH 1D5AA 2CE4A 2PUSA 4RUFA 5BZBA 4PA4A 1KP3A 3K04A 3IFXA 2JRIA 3JALB 2IJIA 3FB6C 4DR5O 3EVKA 4I55A 4X66B 4P30A 1FS0G 3KCXA 1XREA 4FLYA 4OX9B 2RCVA 2A79B 2NR5A 1N32O 1NTKH 2RJZA 1BE3H 4DV6O 1M1KW 5FPOA 4LF7B 1I94O 3J80N 2FTKA 1VQ8V 2UXBO 2IJHA 2LQTA 1KD1W 4D6TH 4UCUA 3ASNC 5KHHA 3FYEB 4W4KA 5HFMA 3AG4C 4TV8B 3SPIA 1AI5A 1Q86W 1H8HG 3BFRA 5C8YB 2YI9A 4GT1A 1N0JA 3SJAC 4B3TO 4WF9V 2QWQB 2DYSC 1KP2A 1H8EG 1MA1A 1NS1A 4JTAB 3BHPA 1R6TA 4X1IA 4LWSB 5TISZ 4LF9O 5KUKA 3E22B 3DXRB 1FD9A 2O57A 4N21A 5GTHZ 3OT7A 4CS2A 4BIUA 1MSDA 2UU9B 4UCRA 2DQ0A 1R3JC 4X66O 4OX9O 2OIEA 1Q6UA 1BZKA 3APQA 4H33A 2HG5C 1KMIZ 1GM7A 2AZ2A 1ZUQA 4LF7O 3KZIZ 4LNUB 5EZYB 2RDCA 3N2KA 1EZVH 1VQKV 4LH7A 3B09A 3RYHB 1N36B 2EJRA 1PNKA 1TAEA 1BSMA 1YCIA 2HEPA 4CC5A 4LF5B 4TV9B 4FM1A 2W0FC 3JAMN 4FLWA 2PF4E 5H6RA 1IZ3A 4OPHA 1SS3A 3F5TA 1K7DA 3KCYA 2XAGA 1DK1A 3BRCA 3APOA 3MHHC 3L9DA 4FFBA 4J42A 2Y0PA 4H44B 4NTYA 1VQNV 3WFVA 4BWAA 2VQEO 1I7FA 3UT5A 4JTCB 2YIAA 3VOUA 2VRZA 2UU9O 2GHYA 4G2KA 5CA0A 2XAJA 1Q8IA 1BQZA 2DJVA 3BY6A 4DRXA 2FYUH 1SETA 3A0HZ 3N2GA 4MT8A 4TQDA 1Q6HA 4JAUA 1P49A 1IVSA 3U10A 4TUYA 1VP7A 1S5JA 3ASNB 2YXLA 4BAYA 5GTIZ 1N36O 4JI2O 3AG4B 4LF5O 5GONA 4LFAB 1M4UA 4UXNA 4B3RB 1H2GA 5IYZB 1S5HC 2DYSB 5DECA 1BS3A 4FLXA 3K9AA 5KA5A 4E2LA 3VBBA 1K33A 3NXSA 4NR1A 1G6UA 2QWPB 2HVJC 4DUYO 1Y66A 3G4SV 2GTAA 5E79Z 4RWUA 3CSXA 2KSDA 3RN4A 5J2UA 2N05A 1IXBA 5LGNA 1MNGA 4JI3B 1IBMO 3L75H 3HKEA 3ZJZA 1WB7A 2V1DA 3A2FA 5A9GA 1F4NA 4D7SA 2JJ1G 1MABG 1VQMV 3FYIB 1S5LZ 1R6NA 2QM8A 2WAMA 1JFFA 1VQ6V 1COWG 4UCOA 3A0BZ 2QR4A 1NT2B 2EIJC 1VQ5V 1PP9H 4JTDB 2EX3A 3WB1A 1KU9A 1GAXA 2P67A 4JI5B 4KXRA 2LW1A 4WFGA 3JD0A 4X62B 2PZSA 2JGUA 5KX5A 4LFAO 4B3RO 3ZRWA 4K3AA 3VQYA 2E74B 3FB8C 3ZHQA 2X6AA 3E8BA 4HAMA 2Y69C 3CEIA 1Q7YW 3OTFA 5JVDA 2ZNIA 3WU2Z 1RP3B 3ZMTA 4J7KA 1TUBA 1XL4A 1ZWIC 5B1BC 2QGNA 3P3PA 1M56C 4R8CA 2GBOA 1DF4A 3JSLA 4XDKA 4DV3O 4DW1A 1IURA 1XOUA 2IM9A 4PDMA 2P4KA 5J2TB 2IH3C 5CBFA 3L73H 5IJ0B 4IHJB 1MZEA 2Q5ZA 4BIOA 2ZCEA 2ZE7A 2Y4TA 2HHHB 1SA0A 3K06A 3SJQC 5EBMC 4GLXA 3CRQA 1PL0A 1XILA 4GCZA 1QU7A 4G27B 1ORQC 4DW0A 2JIZG 4JZ2A 4DXWA 4XBFA 4I4TA 2WPDG 2DMXA 2P6JA 1NZ6A 3UM7A 5JQGA 2NNUA 1M57C 4X62O 3G6BA 2E76B 4I50B 1B04A 3CCRV 4DV0B 3B77A 3FAVA 1O9GA 3JYCA 4BIZA 2FB5A 1PM9A 4QNHB 2XUMA 3X2QC 3SPGA 2OIGA 1FPOA 3J81N 3OGCC 3T1CA 2RMKB 1NVPD 3EFFK 2IH1C 1ZTEA 1RSOA 3E89A 3WG7C 1SQQH 4DO2A 3K9SA 4O4IB 1Y4MA 3SR2C 3JSNA 4QE7A 2YI8A 2UUAB 1Z5VA 3BEHA 2WA4A 5IE9A 3ETQA 3THOA 1H2NA 2VS0A 1DTOA 5KHIA 2Y0IA 3GVMA 2HHHO 3QNEA 2EIJB 5KLVH 4X1YA 1MOFA 4TWKA 5LHHA 1QVFU 4FFKA 5BMVB 4MTOA 3HKBA 2EJ7A 5KUMA 3DGEA 4KHPB 2VWKA 5LBQA 5CMUA 3D8CA 4G28B 4DV0O 3JAKA 3ABMC 1WB8A 4MW3A 2BTOA 3OD4A 1AR1B 2Y69B 1V54C 1AJPA 2RNBA 2Z5UA 5KAIZ 3CCQV 4CC6A 4J11A 1K73W 3UKMA 1R3LC 1B6QA 3E83A 5B1BB 1M56B 2LFSA 2RN9A 1HNZO 5ITZA 1H2KA 3CJHB 1X59A 3JCUZ 2HLDG 3ABKC 1HNXB 1Q81W 2JVDA 1J5EB 3JASB 3JAWB 3LUTB 3G6EV 2UUAO 1MSWD 2EIKC 4JI4B 1R1BA 2IJJA 1S3JA 2H8PC 1ZSPA 5IYBO 1GH6A 4ZHQA 2WLLB 4PV1B 2XOKG 3FKSG 3SYOA 5DN6G 4IYHA 2PYJA 5KA6A 2AGAA 1XMQB 1FJGB 1M57B 2WLKA 4J7JA 3AG3C 1JJOA 4KHPO 4H13B 5H2FZ 4CH3A 5K1XA 3X2QB 5BY1A 5KHGA 2ODMA 2WA3A 2HJFC 1VQOV 4WCEV 1FFXA 4JPRA 1HW7A 1IBKB 2QDOA 4JAVA 3G71V 1S76D 3VQVA 1BHBA 3MDSA 3E8FA 4NB5A 3WG7B 1VF6C 2DQ3A 1GTOA 2JDIG 3R65A 1Q3EA 4TSFG 2XNDG 1L8DA 1HNXO 4NKGB 2EZOA 3K5OA 1F7YA 1FFTB 1QLEC 4BW5A 4O2BA 1MG1A 4YJ2A 4DV2B 3K3WA 1R3IC 2WSSG 4DR2B 5HFLA 4QIWF 5JJEB 5LA6A 3D36A 3RGBA 2ZM6O 3BAAA 2W6JG 3K58A 1M9NA 1XMQO 1XBLA 4CBCA 3CRCA 3CRMA 3N2KB 4GUNA 4QPJA 1NTZH 4B7EA 2A7WA 1GN4A 3ABMB 3BVOA 1QNMA 2AXTZ 1AJQA 1U97A 4K8XA 1FKAO 1V54B 3B8NA 1K4CC 2CTQA 1ZAUA 4X20B 2R9IA 4X8AA 2UUCB 4J7ZA 1RPRA 2QA4V 1IBKO 3CC7V 2IU0A 1E79G 5EK0A 2F66C 4WBNA 3ABKB 3RBZA 2KG7A 3LDCA 2QWNB 5BR8B 4CS4A 3T2MA 1OCOC 1SERA 1GM9A 1Q90D 2BOBC 2EIKB 3C90A 4F4LA 1WA8B 4LH6A 1IX9A 1XQ8A 2ADPA 2CTPA 3JD1A 3UT5B 3J7AU 1IDSA 4DV2O 3FD9A 3E8GA 4WFHA 5IYCO 2YIBA 4DV1B 5AG2A 5J9PC 4DR2O 4WFAV 2MW2B 1JQ0A 3AG3B 4MSWC 3HKDA 3BPZA 4TUYB 3TGUH 5LOVA 1OCRB 2BCCH 2EIMB 4O4HA 1V9PA 2VQFB 4IIJA 2YSUB 4DR1O 1Q5OA 4N23A 3W7TA 3CWBH 3JARA 4JGSA 5JH7B 5EYPA 1XMOB 2YUAA 4JYCA 2IW5A 2A0LA 4K35A 5KAFZ 4O4JB 2WLIA 4FVMA 3IAYA 2ARHA 3C3TA 5GW7A 2Q4PA 3E35A 4MS2A 1FXKC 3OMIB 3T1YB 4K0KB 3H1HH 1K8AW 3BCCH 1XDCA 1VARA 1QLEB 2Q7GA 5BR8O 1SQGA 2P06A 3ZHUA 4DV7B 1QLNA 3EXAA 1CEZA 2Q0OC 2BSKA 3SYPA 3H9VA 2YICA 5J2UB 1SRYA 2EZPA 2QTOA 3MHSC 4UUJC 4RUEA 3O65A 2OTJV 3STZC 4DV1O 4O2AB 3BA9A 1JR9A 3JD3A 1VQLV 3RYCA 4PA3A 1XNRB 4HBNA 1SQBH 4ZOLA 2GTSA 2Q68A 2K1EA 2B9ZA 2QKCA 2UXNA 2YXYA 4GKKB 2HJDA 5JJJB 1YITV 1GKFA 5L3FA 3OE7G 1TVKB 1AP6A 4FZ0A 4UCVA 2GUZA 1XMOO 5LMUB 3QF7A 4J80A 4A5UB 2EULA 4DV5B 4EFEA 2BTQA 5JCOA 3T1YO 5EC1C 1OCOB 4K0KO 1ZL8A 2DN9A 1W2BU 3E2EA 5LP6C 4NYKA 1WAZA 4HNAB 4DV7O 1EZJA 3M8AA 4AQYB 5JVDB 4PA9A 4ZI7A 1TUBB 3AK3A 4GYCB 3LDEA 3W7UA 4I9WA 3B8MA 4F6RA 3D3QA 3ETEA 4X64B 3H1KH 4PDLA 3OM3B 5DM6V 1L1FA 1D2DA 1HDJA 4J9ZB 4JAAA 3ZRSA 2XAFA 2UXDB 3RVYA 2D2CB 4OGQB 1XNRO 1XI1A 3Q4HA 2RQ6A 3OR6C 4NVPA 5D5PA 5IWAB 4B3MB 3OUFA 4NTWA 4GKKO 2UXCB 1Y74A 3AG1B 3OEHG 1M5IA 4R7CA 4QE9A 4EB6B 5D5QA 2ZXWC 4JZGA 1JA8A 3CPWU 4EKWA 4ASUG 2QM7A 5LMUO 1FXKB 3FAVB 1N33B 3F5WC 5IJ9B 1HP8A 2P90A 3QG5A 4GX2A 5LYJB 3RVZA 2QKAA 3L71H 4XDJA 5F2VO 1DGSA 3JD4A 2QJ1A 2EBOA 3ZIAG 4X64O 2ZR2A 3CD6V 3SPHA 5C8YA 3OAAG 4YXWG 3CE2A 4DR4B 3BABA 3HPLC 5IDJA 1VQ9V 3AG2B 5IWAO 3OUSA 4LWSA 3CCEV 3E22A 2DOSA 2PTMA 3DXRA 1R73A 4L8JA 1AR5A 2AHZA 1SQXH 1CPYA 1LUVA 3JAKB 1HWYA 4O4LB 1WPBA 2B5UA 2FKXA 4KP4A 3SJBC 5LXTB 2GSMB 1Q6IA 4X1KB 5B1AC 1L0NH 3H01A 1N34B 5LP6B 1AI7A 2C2AA 4QPKA 2EILC 4X89A 1YJNV 2X6BA 4IYIA 1SZXA 3ZMZA 3QTCA 4FK5C 3UO3A 2XHBA 2QTSA 4LNUA 3CP1A 4GX1A 5EZYA 1Y6XA 4F6EA 3CXCU 2CTWA 2ITDC 2Z0AA 4QJFB 2YEVA 1WPXA 4ABMA 1SKVA 1Q82W 5L3EA 4I0XB 4NXNB 4I7ZB 4JI3O 1K4DC 1RPOA 3CS5A 3OFNG 3LSSA 1SZTA 4GX0A 4ZHQB 2QSAA 1EBOA 3HKCB 4OPAA 4FIPC 3L72H 1M90W 4LF6B 3ICXA 1PNMA 2ZXWB 3IJ4A 1RM1C 3TXSA 3PJSK 2PI4A 4JI5O 4UV9A 4LFBB 1GRJA 3FB5C 2ZIOA 4MVUA 1N34O 2OT5A 1W59A 1G4YB 4JI6B 2OWOA 1WP7A 1MZFA 2AZ0A 3RYFB 1PPJH 1WLEA 3W7SA 3OTOB 5L3BA 2LW7A 2GDSA 1KBHA 4O2BB 2N04A 4NXNO 3P30A 2OCCC 2EINC 4RQFA 1EFRG 1FXHA 5LGUA 5B1NA 3ZHVA 3LDDA 3CRAA 3NR7A 3K0DA 4LF6O 3RFRA 4LBEC 1NJIW 1EM1A 5A2QN 5BXZA 1H2MA 3D3IA 1K5SA 3CRRA 5B1AB 1XL6A 1Z5WA 2KKWA 2UXXA 5FL7G 2XAQA 1AP5A 2EILB 3CYOA 2ZIMA 1JMKC 4JI6O 3ZCCA
chains in the Genus database with same CATH topology
1PPJH 1BE3H 1BCCH 3TGUH 5KLVH 1SQPH 3H1HH 1SQQH 2BCCH 3L70H 3L73H 3CXHF 1PP9H 1BGYH 2A06H 3BCCH 3L75H 1SQXH 1L0LH 4U3FH 1NU1H 3CWBH 4D6TH 3L72H 1NTMH 1SQBH 3CX5F 3H1KH 1NTZH 1L0NH 1KB9F 3L74H 1SQVH 1KYOF 3L71H 3H1LH 1EZVH 1P84F 1NTKH 2IBZH 3H1IH 2FYUH 4PD4F 3H1JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  1BE3 H;  1BCC H;  3TGU H;  5KLV H;  1SQP H;  3H1H H;  1SQQ H;  2BCC H;  3L70 H;  3L73 H;  3CXH F;  1PP9 H;  1BGY H;  2A06 H;  3BCC H;  3L75 H;  1SQX H;  1L0L H;  4U3F H;  1NU1 H;  3CWB H;  4D6T H;  3L72 H;  1NTM H;  1SQB H;  3CX5 F;  3H1K H;  1NTZ H;  1L0N H;  1KB9 F;  3L74 H;  1SQV H;  1KYO F;  3L71 H;  3H1L H;  1EZV H;  1P84 F;  1NTK H;  2IBZ H;  3H1I H;  2FYU H;  4PD4 F;  3H1J H; 
#chains in the Genus database with same CATH topology
 3LSQ A;  2LO1 A;  3P32 A;  1VQP V;  4WBN B;  2F95 B;  4IL6 Z;  3K5M A;  2KG7 B;  3RYI A;  1SES A;  3P3N A;  2CH7 A;  3ZN1 A;  5IT9 N;  1Y76 B;  2FML A;  1YHQ V;  1JJ2 U;  5KHK A;  3OTO O;  3C3S A;  3L74 H;  1IXM A;  4YIO A;  4MVQ A;  4FLV A;  2ETN A;  4ZBM A;  4MVM A;  2KB1 A;  3O9O A;  3ABT A;  2DWE C;  2WLM A;  4I55 B;  1RM1 B;  3HR0 A;  4I9Q A;  3HKD B;  1Q43 A;  2CK3 G;  1GN2 A;  5LOV B;  2Q9L A;  5CB4 A;  1NKD A;  2Q8V A;  1LUW A;  4FM2 A;  4YJ3 A;  2Q7H A;  5EYP B;  5K1P A;  1O9H A;  1OCR C;  2EIM C;  4Q20 A;  1QQC A;  3ZHS A;  2YDE A;  5IJ0 A;  1YZB A;  1H2S B;  4UB6 Z;  1YF2 A;  4CS3 A;  4EFB A;  2VWJ A;  5B1O A;  2BE3 A;  2Q67 A;  4X88 A;  5H6Q A;  2XT9 A;  1YEW A;  2WLJ A;  3ZED A;  3CMA V;  3DTU B;  1XHZ A;  2OCC B;  1ZX3 A;  4WFB V;  4MTG A;  2EIN B;  1JPX A;  2Q6A A;  3K03 A;  2F93 B;  4X1I B;  1J5E O;  1PKX A;  2E5L B;  2OTL V;  4H37 A;  1NTM H;  1K34 A;  3JAT A;  1QBZ A;  3TJT A;  5C93 A;  4JI4 O;  3ZRX A;  1F4M A;  3DC6 A;  4KFM A;  1VF5 B;  4NXM B;  3LNM B;  2G38 A;  4LF8 B;  4FM0 A;  3QO5 A;  4GKJ B;  2XTA A;  1Z2G A;  1AR4 A;  1D5N A;  4AIL C;  4FMT A;  4GX5 A;  2IU3 A;  3SYC A;  1FJG O;  1SC5 B;  1VMG A;  4O4I A;  3CX5 F;  2B1I A;  5FPR A;  3GWO A;  5LL6 Y;  4CH5 A;  2ATK C;  4PEL A;  1GK9 A;  2P5O A;  1ZLZ A;  1QR9 A;  5EBW C;  3K59 A;  2GUZ B;  5B5E Z;  1OV9 A;  4UCS A;  1T5E A;  4UVA A;  3ZMV A;  2Y48 A;  1G1X B;  3CC4 V;  1RFY A;  1AVM A;  4DV6 B;  5BMV A;  3F7Y C;  2QEX V;  1SF9 A;  1P4R A;  3AK2 A;  2WLN A;  1MMM A;  1I94 B;  2Q7E A;  4DK0 A;  4FFB B;  3CCS V;  4PDV A;  1SQP H;  4L87 A;  1XUQ A;  1EN4 A;  2HVK C;  2QE7 G;  4U3F H;  4P2Z A;  2Q73 A;  1KUQ A;  1AJN A;  5LHG A;  2JEX A;  4NXM O;  3T4Z A;  5CA0 B;  1Y67 A;  4LF8 O;  3ZMS A;  4B7K A;  4DRX B;  3N2G B;  1N0N A;  4GKJ O;  4D7T A;  1K9M W;  1LR1 A;  4RAI A;  2P7T C;  1Y74 B;  3JAW A;  1AIL A;  2ZDI A;  2CUG A;  4UB8 Z;  2YID A;  4GZR B;  3JD2 A;  1WNS A;  4U7N A;  4DUZ B;  3GB7 C;  3WB2 A;  3E86 A;  3B40 A;  1ROP A;  5DED A;  1F51 A;  2X7R B;  2X6C A;  2ZR3 A;  5GON B;  3AG1 C;  3K79 A;  2PGG A;  4LFC B;  2F43 G;  2UUC O;  1IBL B;  4CH4 A;  3RW0 A;  4U3J A;  2WLL A;  4R50 A;  5EIB C;  2AHY A;  4JF3 A;  5CA1 A;  1R3K C;  2M6Y A;  4YY3 B;  1HR0 B;  4LF4 B;  2KQX A;  1BL8 A;  2QWR B;  5FNV A;  3ZHT A;  1I08 A;  3EHB B;  3IGA C;  4EEQ A;  5B3S B;  3HKE B;  3OGI B;  1US6 A;  4P9O A;  5KMG A;  2WWW A;  4Z2W A;  4MTF A;  2ZE5 A;  5H5N A;  3ZMU A;  2Q69 A;  2OYQ A;  1BT8 A;  4JV5 B;  1YSC A;  1W0J G;  1CXZ B;  2ILM A;  3ETG A;  1JFF B;  1K97 A;  2OCH A;  1BMF G;  2VQE B;  1GN3 A;  2IBZ H;  4DUZ O;  2VQF O;  3TK1 A;  3AG2 C;  1M93 A;  4TOI A;  1NBM G;  5KX5 B;  5KHJ A;  4LFC O;  3ZRW B;  1IBL O;  1OCC C;  1K92 A;  5LGT A;  4JYA B;  3LSU A;  3UCS C;  5CN0 A;  1VQ4 V;  4YY3 O;  1HR0 O;  2JGD A;  2ZE8 A;  2DE0 X;  3CB2 A;  4LF4 O;  4JI2 B;  2YEV B;  1S0V A;  2HP8 A;  4FZ1 A;  4X20 A;  2CGN A;  3OEE G;  2E75 B;  3ASO B;  1YTF B;  2LGQ A;  2JEU A;  1EN5 A;  3HB3 B;  1HNW B;  1JOY A;  1YJW V;  2P22 C;  3H1J H;  2A3Q A;  3CC2 V;  3G80 A;  4DUY B;  3M7M X;  4JV5 O;  1SA0 B;  1YI2 V;  3PN1 A;  1WA8 A;  4IGG A;  1J95 A;  1WP8 A;  3VQX A;  3ZHR A;  3STL C;  1K5Q A;  4I4T B;  2ZIN A;  2HR3 A;  1IBM B;  1FXV A;  1FYJ A;  5JQG B;  4HYO A;  1ARO P;  2CDY A;  4PA6 A;  4DR3 B;  1PL4 A;  5H9C A;  3H1L H;  5JJN B;  4UCT A;  4JYY A;  3JAL A;  3SPC A;  1CP9 A;  1U96 A;  5CA3 A;  4DV5 O;  4JYA O;  1AB3 A;  3SDL A;  3W7X A;  4UVB A;  3M99 B;  4Q6G A;  4AQY O;  1RSO B;  1VF7 A;  1QCE A;  5JH7 A;  2PYL A;  1N8R W;  2XAH A;  2CGO A;  3OR7 C;  4O4J A;  1VF6 A;  1GM8 A;  3U11 A;  1YXB A;  3KG2 A;  4DR6 B;  5FLX N;  2DW4 A;  4TV8 A;  3FB7 C;  4WFF A;  4X65 B;  2R70 A;  4JYB A;  1NU1 H;  2W6I G;  4KL1 A;  1HNW O;  2PY5 A;  1YVW A;  2UXD O;  2H94 A;  4J9Y B;  1JX9 A;  3I55 V;  4X1Y B;  3BA8 A;  4FJC C;  4JI1 B;  1P7G A;  2JK5 C;  4DR7 B;  1GO3 F;  4B3M O;  3HKB B;  3TXQ A;  3D36 C;  2UXC O;  2K9P A;  4PA7 A;  3ABU A;  4DV3 B;  3I5D A;  1VQ7 V;  1BQ0 A;  4DR3 O;  1OCC B;  1W0K G;  4LC1 A;  3SYQ A;  4HZ3 A;  4AI8 A;  4O2A A;  1NR1 A;  4MVZ A;  1TUE B;  1N33 O;  2QKS A;  4C7U A;  3OMA B;  2UUB B;  4PDR A;  3CHX A;  1A32 A;  3LNN A;  1E1Q G;  3B4S A;  4JI0 B;  3RYI B;  2V7Q G;  4ZIB A;  2CH7 B;  1OZ0 A;  4B3S B;  4BW9 A;  2D3O W;  2FL4 A;  3AEI A;  2Z3Y A;  1OHH G;  5ITZ B;  3FX7 A;  2YIB D;  4UV8 A;  1N4C A;  3TET A;  1NH2 D;  1TVK A;  3RYH A;  4OXS A;  1NQT A;  1YJ9 V;  1R6K A;  4WFE A;  4TV9 A;  3VQW A;  5IYD O;  4LP8 A;  1KKC A;  4DR6 O;  2LFR A;  3SGI A;  4X65 O;  3ZX6 A;  5IY5 C;  4BR6 A;  2LP7 A;  4HNA A;  3MAQ A;  1KC8 W;  4DR4 O;  1TA8 A;  1UFI A;  4MVR A;  1DLB A;  1L0L H;  2XAS A;  4JI1 O;  1QR8 A;  1BHA A;  4DR7 O;  2CTR A;  4ICG A;  2ZD9 A;  3SYA A;  5CB4 B;  4PHZ A;  4YJ3 B;  4E4E A;  2R9A A;  1V55 C;  2ZNJ A;  1EN6 A;  2ZDI C;  4R6Z A;  5L3G A;  4MVO A;  3L70 H;  3CCJ V;  1FFX B;  1OCZ C;  1X4T A;  2HFE C;  4XDL A;  2UUB O;  1TGO A;  3QO7 A;  4JI0 O;  3CCV V;  1G8M A;  1WN7 A;  3T1H B;  3ZBH A;  4B3S O;  2YS8 A;  2V4D A;  4EB6 A;  5B66 Z;  4PD4 F;  1PD3 A;  1PV0 A;  1FXK A;  3DSQ A;  1SQF A;  3G67 A;  3JAT B;  2IJK A;  5IJ9 A;  5IYZ A;  4MW8 A;  4YJ2 B;  1XEQ A;  1S77 D;  2F1M A;  2W0X A;  5EBL C;  5LA6 B;  3K5L A;  1HNZ B;  5LYJ A;  2L35 A;  4I5S A;  2F4V B;  2X0L A;  3QVN A;  2JS3 A;  2H3O A;  3RT3 C;  2PI5 A;  4P9P A;  2ITC C;  1B3Q A;  5LMN B;  2P4V A;  4ZKI A;  3CCM V;  1WJZ A;  2A9H A;  3MD0 A;  3GWK C;  4TQF A;  1UPG A;  3AG7 A;  4LFB O;  4LR3 A;  1KB9 F;  3JCZ A;  4KUM A;  4QGP A;  4JAS A;  4DK1 A;  1DF5 A;  3WB0 A;  3SPJ A;  3CXH F;  2BOC C;  3T1H O;  4CH6 A;  4B08 A;  1VEW A;  4TT3 G;  2CAZ C;  3KKY A;  1GN6 A;  5JCO C;  4W4L A;  5E1A C;  4YHH B;  4O4L A;  4JI8 B;  5LXT A;  1KEC A;  4X1K A;  5IY5 B;  2LJ2 A;  4IT5 A;  5LP6 A;  2QWO B;  3A8T A;  4JI7 B;  4UFZ A;  3ZN0 A;  1QVG U;  1KKD A;  2NN4 A;  1UJW B;  1NH2 B;  3FFQ A;  4Z1V A;  1B06 A;  4UVC A;  2JS5 A;  3CCU V;  4FPP A;  4X9Q A;  3CME V;  2F4V O;  3S3W A;  3AK1 A;  4DV4 B;  1VIB A;  2JJ2 G;  2M7W A;  1V55 B;  5LMN O;  5L3C A;  3ABL C;  1URF A;  4O4H B;  4YIP A;  4PI0 A;  1JCH A;  4I0X A;  4IIJ B;  1OCZ B;  3S3X A;  2DYR C;  3JAR B;  2F23 A;  5J2T A;  4H0L B;  1I0H A;  4U3J B;  4IHJ A;  2Y4U A;  2WLI B;  2ZM6 B;  3HKC A;  4Z1M G;  3I56 V;  1KYO F;  5CA1 B;  4U7O A;  4DYL A;  1BCC H;  1H2L A;  2ZT9 B;  3ZS8 C;  2BSK B;  3RWR D;  4YHH O;  3A0R A;  4JI8 O;  4I50 A;  5FNV B;  2N74 A;  3IC7 A;  4LCU C;  4JI7 O;  1SQV H;  2AW9 A;  5KMG B;  3UQ8 A;  3RYC B;  1YIJ V;  5B3S C;  3RYF A;  4DV4 O;  4ZOL B;  2YC0 A;  1JVM A;  4AHC A;  3ETD A;  3T4D A;  2R72 A;  1QHT A;  2ZE6 A;  1KQS U;  1XNQ B;  1P7B A;  1GMG A;  1PNL A;  4NTX A;  2QM4 A;  1NVP B;  4PJ0 Z;  3W7W A;  5JWP A;  1P84 F;  1XHX A;  3E8H A;  2ZKO A;  4J10 A;  1K3E A;  4DR5 B;  1AI4 A;  2LGW A;  3R66 A;  2WLH A;  3N27 A;  2BTQ B;  5EC2 C;  1N32 B;  1S72 V;  1NI8 A;  3UO2 A;  1ZL8 B;  1THZ A;  3K08 A;  4RO2 A;  1YDX A;  3ML0 A;  2JGD B;  1E1R G;  3SJC C;  2B1G A;  1YTF D;  4DR1 B;  4ZI7 B;  2UXB B;  3K0G A;  5CBH A;  3H1I H;  2NLJ C;  4RQE A;  3OW2 U;  4K8Z A;  1LNQ A;  2E5L O;  2HKO A;  3OMN B;  3TCU A;  4FLZ A;  3ZRV A;  2E3C A;  4F6R B;  3K5N A;  1OJH A;  2GV9 A;  2A06 H;  5CBG A;  2YXH A;  1AI6 A;  1H38 A;  5L3D A;  2L6L A;  2R9R B;  3U0Z A;  3F7V C;  1I5Y A;  3B2E E;  4J41 A;  4CZZ A;  1F23 A;  3DC5 A;  4MTX A;  3CCL V;  4B3T B;  1I5X A;  3QO8 A;  3ABL B;  3Q4H B;  2Q0A A;  2DWD C;  1Y76 A;  3ASO C;  2ADQ B;  4PI2 A;  3CJH A;  1ENV A;  4FLT A;  1NR7 A;  1FAF A;  2DYR B;  3K57 A;  5LHI A;  2MK3 A;  5EIB D;  3IC9 A;  4FLU A;  3JAS A;  2ZQM A;  4MVS A;  1XNQ O;  4LF9 B;  1BGY H;  1D5A A;  2CE4 A;  2PUS A;  4RUF A;  5BZB A;  4PA4 A;  1KP3 A;  3K04 A;  3IFX A;  2JRI A;  3JAL B;  2IJI A;  3FB6 C;  4DR5 O;  3EVK A;  4I55 A;  4X66 B;  4P30 A;  1FS0 G;  3KCX A;  1XRE A;  4FLY A;  4OX9 B;  2RCV A;  2A79 B;  2NR5 A;  1N32 O;  1NTK H;  2RJZ A;  1BE3 H;  4DV6 O;  1M1K W;  5FPO A;  4LF7 B;  1I94 O;  3J80 N;  2FTK A;  1VQ8 V;  2UXB O;  2IJH A;  2LQT A;  1KD1 W;  4D6T H;  4UCU A;  3ASN C;  5KHH A;  3FYE B;  4W4K A;  5HFM A;  3AG4 C;  4TV8 B;  3SPI A;  1AI5 A;  1Q86 W;  1H8H G;  3BFR A;  5C8Y B;  2YI9 A;  4GT1 A;  1N0J A;  3SJA C;  4B3T O;  4WF9 V;  2QWQ B;  2DYS C;  1KP2 A;  1H8E G;  1MA1 A;  1NS1 A;  4JTA B;  3BHP A;  1R6T A;  4X1I A;  4LWS B;  5TIS Z;  4LF9 O;  5KUK A;  3E22 B;  3DXR B;  1FD9 A;  2O57 A;  4N21 A;  5GTH Z;  3OT7 A;  4CS2 A;  4BIU A;  1MSD A;  2UU9 B;  4UCR A;  2DQ0 A;  1R3J C;  4X66 O;  4OX9 O;  2OIE A;  1Q6U A;  1BZK A;  3APQ A;  4H33 A;  2HG5 C;  1KMI Z;  1GM7 A;  2AZ2 A;  1ZUQ A;  4LF7 O;  3KZI Z;  4LNU B;  5EZY B;  2RDC A;  3N2K A;  1EZV H;  1VQK V;  4LH7 A;  3B09 A;  3RYH B;  1N36 B;  2EJR A;  1PNK A;  1TAE A;  1BSM A;  1YCI A;  2HEP A;  4CC5 A;  4LF5 B;  4TV9 B;  4FM1 A;  2W0F C;  3JAM N;  4FLW A;  2PF4 E;  5H6R A;  1IZ3 A;  4OPH A;  1SS3 A;  3F5T A;  1K7D A;  3KCY A;  2XAG A;  1DK1 A;  3BRC A;  3APO A;  3MHH C;  3L9D A;  4FFB A;  4J42 A;  2Y0P A;  4H44 B;  4NTY A;  1VQN V;  3WFV A;  4BWA A;  2VQE O;  1I7F A;  3UT5 A;  4JTC B;  2YIA A;  3VOU A;  2VRZ A;  2UU9 O;  2GHY A;  4G2K A;  5CA0 A;  2XAJ A;  1Q8I A;  1BQZ A;  2DJV A;  3BY6 A;  4DRX A;  2FYU H;  1SET A;  3A0H Z;  3N2G A;  4MT8 A;  4TQD A;  1Q6H A;  4JAU A;  1P49 A;  1IVS A;  3U10 A;  4TUY A;  1VP7 A;  1S5J A;  3ASN B;  2YXL A;  4BAY A;  5GTI Z;  1N36 O;  4JI2 O;  3AG4 B;  4LF5 O;  5GON A;  4LFA B;  1M4U A;  4UXN A;  4B3R B;  1H2G A;  5IYZ B;  1S5H C;  2DYS B;  5DEC A;  1BS3 A;  4FLX A;  3K9A A;  5KA5 A;  4E2L A;  3VBB A;  1K33 A;  3NXS A;  4NR1 A;  1G6U A;  2QWP B;  2HVJ C;  4DUY O;  1Y66 A;  3G4S V;  2GTA A;  5E79 Z;  4RWU A;  3CSX A;  2KSD A;  3RN4 A;  5J2U A;  2N05 A;  1IXB A;  5LGN A;  1MNG A;  4JI3 B;  1IBM O;  3L75 H;  3HKE A;  3ZJZ A;  1WB7 A;  2V1D A;  3A2F A;  5A9G A;  1F4N A;  4D7S A;  2JJ1 G;  1MAB G;  1VQM V;  3FYI B;  1S5L Z;  1R6N A;  2QM8 A;  2WAM A;  1JFF A;  1VQ6 V;  1COW G;  4UCO A;  3A0B Z;  2QR4 A;  1NT2 B;  2EIJ C;  1VQ5 V;  1PP9 H;  4JTD B;  2EX3 A;  3WB1 A;  1KU9 A;  1GAX A;  2P67 A;  4JI5 B;  4KXR A;  2LW1 A;  4WFG A;  3JD0 A;  4X62 B;  2PZS A;  2JGU A;  5KX5 A;  4LFA O;  4B3R O;  3ZRW A;  4K3A A;  3VQY A;  2E74 B;  3FB8 C;  3ZHQ A;  2X6A A;  3E8B A;  4HAM A;  2Y69 C;  3CEI A;  1Q7Y W;  3OTF A;  5JVD A;  2ZNI A;  3WU2 Z;  1RP3 B;  3ZMT A;  4J7K A;  1TUB A;  1XL4 A;  1ZWI C;  5B1B C;  2QGN A;  3P3P A;  1M56 C;  4R8C A;  2GBO A;  1DF4 A;  3JSL A;  4XDK A;  4DV3 O;  4DW1 A;  1IUR A;  1XOU A;  2IM9 A;  4PDM A;  2P4K A;  5J2T B;  2IH3 C;  5CBF A;  3L73 H;  5IJ0 B;  4IHJ B;  1MZE A;  2Q5Z A;  4BIO A;  2ZCE A;  2ZE7 A;  2Y4T A;  2HHH B;  1SA0 A;  3K06 A;  3SJQ C;  5EBM C;  4GLX A;  3CRQ A;  1PL0 A;  1XIL A;  4GCZ A;  1QU7 A;  4G27 B;  1ORQ C;  4DW0 A;  2JIZ G;  4JZ2 A;  4DXW A;  4XBF A;  4I4T A;  2WPD G;  2DMX A;  2P6J A;  1NZ6 A;  3UM7 A;  5JQG A;  2NNU A;  1M57 C;  4X62 O;  3G6B A;  2E76 B;  4I50 B;  1B04 A;  3CCR V;  4DV0 B;  3B77 A;  3FAV A;  1O9G A;  3JYC A;  4BIZ A;  2FB5 A;  1PM9 A;  4QNH B;  2XUM A;  3X2Q C;  3SPG A;  2OIG A;  1FPO A;  3J81 N;  3OGC C;  3T1C A;  2RMK B;  1NVP D;  3EFF K;  2IH1 C;  1ZTE A;  1RSO A;  3E89 A;  3WG7 C;  1SQQ H;  4DO2 A;  3K9S A;  4O4I B;  1Y4M A;  3SR2 C;  3JSN A;  4QE7 A;  2YI8 A;  2UUA B;  1Z5V A;  3BEH A;  2WA4 A;  5IE9 A;  3ETQ A;  3THO A;  1H2N A;  2VS0 A;  1DTO A;  5KHI A;  2Y0I A;  3GVM A;  2HHH O;  3QNE A;  2EIJ B;  5KLV H;  4X1Y A;  1MOF A;  4TWK A;  5LHH A;  1QVF U;  4FFK A;  5BMV B;  4MTO A;  3HKB A;  2EJ7 A;  5KUM A;  3DGE A;  4KHP B;  2VWK A;  5LBQ A;  5CMU A;  3D8C A;  4G28 B;  4DV0 O;  3JAK A;  3ABM C;  1WB8 A;  4MW3 A;  2BTO A;  3OD4 A;  1AR1 B;  2Y69 B;  1V54 C;  1AJP A;  2RNB A;  2Z5U A;  5KAI Z;  3CCQ V;  4CC6 A;  4J11 A;  1K73 W;  3UKM A;  1R3L C;  1B6Q A;  3E83 A;  5B1B B;  1M56 B;  2LFS A;  2RN9 A;  1HNZ O;  5ITZ A;  1H2K A;  3CJH B;  1X59 A;  3JCU Z;  2HLD G;  3ABK C;  1HNX B;  1Q81 W;  2JVD A;  1J5E B;  3JAS B;  3JAW B;  3LUT B;  3G6E V;  2UUA O;  1MSW D;  2EIK C;  4JI4 B;  1R1B A;  2IJJ A;  1S3J A;  2H8P C;  1ZSP A;  5IYB O;  1GH6 A;  4ZHQ A;  2WLL B;  4PV1 B;  2XOK G;  3FKS G;  3SYO A;  5DN6 G;  4IYH A;  2PYJ A;  5KA6 A;  2AGA A;  1XMQ B;  1FJG B;  1M57 B;  2WLK A;  4J7J A;  3AG3 C;  1JJO A;  4KHP O;  4H13 B;  5H2F Z;  4CH3 A;  5K1X A;  3X2Q B;  5BY1 A;  5KHG A;  2ODM A;  2WA3 A;  2HJF C;  1VQO V;  4WCE V;  1FFX A;  4JPR A;  1HW7 A;  1IBK B;  2QDO A;  4JAV A;  3G71 V;  1S76 D;  3VQV A;  1BHB A;  3MDS A;  3E8F A;  4NB5 A;  3WG7 B;  1VF6 C;  2DQ3 A;  1GTO A;  2JDI G;  3R65 A;  1Q3E A;  4TSF G;  2XND G;  1L8D A;  1HNX O;  4NKG B;  2EZO A;  3K5O A;  1F7Y A;  1FFT B;  1QLE C;  4BW5 A;  4O2B A;  1MG1 A;  4YJ2 A;  4DV2 B;  3K3W A;  1R3I C;  2WSS G;  4DR2 B;  5HFL A;  4QIW F;  5JJE B;  5LA6 A;  3D36 A;  3RGB A;  2ZM6 O;  3BAA A;  2W6J G;  3K58 A;  1M9N A;  1XMQ O;  1XBL A;  4CBC A;  3CRC A;  3CRM A;  3N2K B;  4GUN A;  4QPJ A;  1NTZ H;  4B7E A;  2A7W A;  1GN4 A;  3ABM B;  3BVO A;  1QNM A;  2AXT Z;  1AJQ A;  1U97 A;  4K8X A;  1FKA O;  1V54 B;  3B8N A;  1K4C C;  2CTQ A;  1ZAU A;  4X20 B;  2R9I A;  4X8A A;  2UUC B;  4J7Z A;  1RPR A;  2QA4 V;  1IBK O;  3CC7 V;  2IU0 A;  1E79 G;  5EK0 A;  2F66 C;  4WBN A;  3ABK B;  3RBZ A;  2KG7 A;  3LDC A;  2QWN B;  5BR8 B;  4CS4 A;  3T2M A;  1OCO C;  1SER A;  1GM9 A;  1Q90 D;  2BOB C;  2EIK B;  3C90 A;  4F4L A;  1WA8 B;  4LH6 A;  1IX9 A;  1XQ8 A;  2ADP A;  2CTP A;  3JD1 A;  3UT5 B;  3J7A U;  1IDS A;  4DV2 O;  3FD9 A;  3E8G A;  4WFH A;  5IYC O;  2YIB A;  4DV1 B;  5AG2 A;  5J9P C;  4DR2 O;  4WFA V;  2MW2 B;  1JQ0 A;  3AG3 B;  4MSW C;  3HKD A;  3BPZ A;  4TUY B;  3TGU H;  5LOV A;  1OCR B;  2BCC H;  2EIM B;  4O4H A;  1V9P A;  2VQF B;  4IIJ A;  2YSU B;  4DR1 O;  1Q5O A;  4N23 A;  3W7T A;  3CWB H;  3JAR A;  4JGS A;  5JH7 B;  5EYP A;  1XMO B;  2YUA A;  4JYC A;  2IW5 A;  2A0L A;  4K35 A;  5KAF Z;  4O4J B;  2WLI A;  4FVM A;  3IAY A;  2ARH A;  3C3T A;  5GW7 A;  2Q4P A;  3E35 A;  4MS2 A;  1FXK C;  3OMI B;  3T1Y B;  4K0K B;  3H1H H;  1K8A W;  3BCC H;  1XDC A;  1VAR A;  1QLE B;  2Q7G A;  5BR8 O;  1SQG A;  2P06 A;  3ZHU A;  4DV7 B;  1QLN A;  3EXA A;  1CEZ A;  2Q0O C;  2BSK A;  3SYP A;  3H9V A;  2YIC A;  5J2U B;  1SRY A;  2EZP A;  2QTO A;  3MHS C;  4UUJ C;  4RUE A;  3O65 A;  2OTJ V;  3STZ C;  4DV1 O;  4O2A B;  3BA9 A;  1JR9 A;  3JD3 A;  1VQL V;  3RYC A;  4PA3 A;  1XNR B;  4HBN A;  1SQB H;  4ZOL A;  2GTS A;  2Q68 A;  2K1E A;  2B9Z A;  2QKC A;  2UXN A;  2YXY A;  4GKK B;  2HJD A;  5JJJ B;  1YIT V;  1GKF A;  5L3F A;  3OE7 G;  1TVK B;  1AP6 A;  4FZ0 A;  4UCV A;  2GUZ A;  1XMO O;  5LMU B;  3QF7 A;  4J80 A;  4A5U B;  2EUL A;  4DV5 B;  4EFE A;  2BTQ A;  5JCO A;  3T1Y O;  5EC1 C;  1OCO B;  4K0K O;  1ZL8 A;  2DN9 A;  1W2B U;  3E2E A;  5LP6 C;  4NYK A;  1WAZ A;  4HNA B;  4DV7 O;  1EZJ A;  3M8A A;  4AQY B;  5JVD B;  4PA9 A;  4ZI7 A;  1TUB B;  3AK3 A;  4GYC B;  3LDE A;  3W7U A;  4I9W A;  3B8M A;  4F6R A;  3D3Q A;  3ETE A;  4X64 B;  3H1K H;  4PDL A;  3OM3 B;  5DM6 V;  1L1F A;  1D2D A;  1HDJ A;  4J9Z B;  4JAA A;  3ZRS A;  2XAF A;  2UXD B;  3RVY A;  2D2C B;  4OGQ B;  1XNR O;  1XI1 A;  3Q4H A;  2RQ6 A;  3OR6 C;  4NVP A;  5D5P A;  5IWA B;  4B3M B;  3OUF A;  4NTW A;  4GKK O;  2UXC B;  1Y74 A;  3AG1 B;  3OEH G;  1M5I A;  4R7C A;  4QE9 A;  4EB6 B;  5D5Q A;  2ZXW C;  4JZG A;  1JA8 A;  3CPW U;  4EKW A;  4ASU G;  2QM7 A;  5LMU O;  1FXK B;  3FAV B;  1N33 B;  3F5W C;  5IJ9 B;  1HP8 A;  2P90 A;  3QG5 A;  4GX2 A;  5LYJ B;  3RVZ A;  2QKA A;  3L71 H;  4XDJ A;  5F2V O;  1DGS A;  3JD4 A;  2QJ1 A;  2EBO A;  3ZIA G;  4X64 O;  2ZR2 A;  3CD6 V;  3SPH A;  5C8Y A;  3OAA G;  4YXW G;  3CE2 A;  4DR4 B;  3BAB A;  3HPL C;  5IDJ A;  1VQ9 V;  3AG2 B;  5IWA O;  3OUS A;  4LWS A;  3CCE V;  3E22 A;  2DOS A;  2PTM A;  3DXR A;  1R73 A;  4L8J A;  1AR5 A;  2AHZ A;  1SQX H;  1CPY A;  1LUV A;  3JAK B;  1HWY A;  4O4L B;  1WPB A;  2B5U A;  2FKX A;  4KP4 A;  3SJB C;  5LXT B;  2GSM B;  1Q6I A;  4X1K B;  5B1A C;  1L0N H;  3H01 A;  1N34 B;  5LP6 B;  1AI7 A;  2C2A A;  4QPK A;  2EIL C;  4X89 A;  1YJN V;  2X6B A;  4IYI A;  1SZX A;  3ZMZ A;  3QTC A;  4FK5 C;  3UO3 A;  2XHB A;  2QTS A;  4LNU A;  3CP1 A;  4GX1 A;  5EZY A;  1Y6X A;  4F6E A;  3CXC U;  2CTW A;  2ITD C;  2Z0A A;  4QJF B;  2YEV A;  1WPX A;  4ABM A;  1SKV A;  1Q82 W;  5L3E A;  4I0X B;  4NXN B;  4I7Z B;  4JI3 O;  1K4D C;  1RPO A;  3CS5 A;  3OFN G;  3LSS A;  1SZT A;  4GX0 A;  4ZHQ B;  2QSA A;  1EBO A;  3HKC B;  4OPA A;  4FIP C;  3L72 H;  1M90 W;  4LF6 B;  3ICX A;  1PNM A;  2ZXW B;  3IJ4 A;  1RM1 C;  3TXS A;  3PJS K;  2PI4 A;  4JI5 O;  4UV9 A;  4LFB B;  1GRJ A;  3FB5 C;  2ZIO A;  4MVU A;  1N34 O;  2OT5 A;  1W59 A;  1G4Y B;  4JI6 B;  2OWO A;  1WP7 A;  1MZF A;  2AZ0 A;  3RYF B;  1PPJ H;  1WLE A;  3W7S A;  3OTO B;  5L3B A;  2LW7 A;  2GDS A;  1KBH A;  4O2B B;  2N04 A;  4NXN O;  3P30 A;  2OCC C;  2EIN C;  4RQF A;  1EFR G;  1FXH A;  5LGU A;  5B1N A;  3ZHV A;  3LDD A;  3CRA A;  3NR7 A;  3K0D A;  4LF6 O;  3RFR A;  4LBE C;  1NJI W;  1EM1 A;  5A2Q N;  5BXZ A;  1H2M A;  3D3I A;  1K5S A;  3CRR A;  5B1A B;  1XL6 A;  1Z5W A;  2KKW A;  2UXX A;  5FL7 G;  2XAQ A;  1AP5 A;  2EIL B;  3CYO A;  2ZIM A;  1JMK C;  4JI6 O;  3ZCC A; 
#chains in the Genus database with same CATH homology
 1PPJ H;  1BE3 H;  1BCC H;  3TGU H;  5KLV H;  1SQP H;  3H1H H;  1SQQ H;  2BCC H;  3L70 H;  3L73 H;  3CXH F;  1PP9 H;  1BGY H;  2A06 H;  3BCC H;  3L75 H;  1SQX H;  1L0L H;  4U3F H;  1NU1 H;  3CWB H;  4D6T H;  3L72 H;  1NTM H;  1SQB H;  3CX5 F;  3H1K H;  1NTZ H;  1L0N H;  1KB9 F;  3L74 H;  1SQV H;  1KYO F;  3L71 H;  3H1L H;  1EZV H;  1P84 F;  1NTK H;  2IBZ H;  3H1I H;  2FYU H;  4PD4 F;  3H1J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...